>gi|26553508|ref|NP_757442.1| F0F1 ATP synthase subunit A [Mycoplasma penetrans HF-2] >gi|26453514|dbj|BAC43846.1| ATP synthase subunit A [Mycoplasma penetrans HF-2] (302 aa)
Score = 1315, Expect = 3.5e-143, Identities = 302/302 (100%), Positives = 302/302 (100%)
  Q:     1 MISDGTNSVITTLQASSAFSDWKPFEYRSEITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEEESQVKKIKKKSPLSELKMSAEKRNQSNVDLINVSTIE 302
           MISDGTNSVITTLQASSAFSDWKPFEYRSEITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEEESQVKKIKKKSPLSELKMSAEKRNQSNVDLINVSTIE
  S:     1 MISDGTNSVITTLQASSAFSDWKPFEYRSEITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEEESQVKKIKKKSPLSELKMSAEKRNQSNVDLINVSTIE 302
>gi|44296|emb|CAA45545.1| adenosinetriphosphatase [Mycoplasma gallisepticum] (297 aa)
Score = 325, Expect = 1.9e-28, Identities = 89/268 (33%), Positives = 142/268 (52%)
  Q:     4 DGTNSVITTLQASSAFSDWKPFEYRSEITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVV-GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRR-DPTVLEPGP--EVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEEESQVKK 271
           +G    +TT   +S   +W P    + + SI ++  ++ ++   Y   +KKL P +PP G    +  L+  F+ L  +++G++  + +     +F YI + N++S+V G   PT+ +TVTF+LGL +  GT I+G+KYQK ++F  F     IK        IP   NP  +     P +SISLRLW N++AG++ + L Y+L    F    P+    G     ++  L    FH + D LV +IQAFVFV L L YWS   +  E +  +K
  S:    18 NGWIDFLTTKPLASQGIEWTPLIPTAHVLSIFMVLFMIAILTAVYYTKLKKLKPTEPPTGYVLVVQLLILQFENLTVDLLGEKNRRLSLLFIIIFVYILISNLMSMVGGIAAPTSSSTVTFSLGLMSFFGTFIMGVKYQKLAYFRDFFVIIKIKK-----KTIPLMINPLNVIGYFAPLLSISLRLWGNVLAGSIFIALLYSLFRTFFTLGSPSSFSVGLVFGTLVGGLVIPAFHVYFDILVSAIQAFVFVSLMLTYWSQPIKAAENAAEEK 284
>gi|33860130|sp|P33251|ATP6_MYCGA ATP synthase a chain (ATPase protein 6) (297 aa)
Score = 324, Expect = 2.8e-28, Identities = 91/268 (33%), Positives = 145/268 (54%)
  Q:     4 DGTNSVITTLQASSAFSDWKPFEYRSEITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVV-GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRR-DPTVLEPGPEVILFSLFA----VP-FHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEEESQVKK 271
           +G    +TT   +S   +W P    + + SI ++  ++ ++   Y   +KKL P +PP G    +  L+  F+ L  +++G++  + +     +F YI + N++S+V G   PT+ +TVTF+LGL +  GT I+G+KYQK ++F  F     IK        IP   NP  +     P +SISLRLW N++AG++ + L Y+L    F    P+    G   ++F   A    +P FH + D LV +IQAFVFV L L YWS   +  E +  +K
  S:    18 NGWIDFLTTKPLASQGIEWTPLIPTAHVLSIFMVLFMIAILTAVYYTKLKKLKPTEPPTGYVLVVQLLILQFENLTVDLLGEKNRRLSLLFIIIFVYILISNLMSMVGGIAAPTSSSTVTFSLGLMSFFGTFIMGVKYQKLAYFRDFFVIIKIKK-----KTIPLMINPLNVIGYFAPLLSISLRLWGNVLAGSIFIALLYSLFRTFFTLWSPSSFSVG---LVFGTLAGGLVIPAFHVYFDILVSAIQAFVFVSLMLTYWSQPIKAAENAAEEK 284
>gi|31544504|ref|NP_853082.1| F0F1 ATP synthase subunit A [Mycoplasma gallisepticum R] >gi|31541349|gb|AAP56650.1| AtpB [Mycoplasma gallisepticum R] (299 aa)
Score = 324, Expect = 3.0e-28, Identities = 91/268 (33%), Positives = 145/268 (54%)
  Q:     4 DGTNSVITTLQASSAFSDWKPFEYRSEITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVV-GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRR-DPTVLEPGPEVILFSLFA----VP-FHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEEESQVKK 271
           +G    +TT   +S   +W P    + + SI ++  ++ ++   Y   +KKL P +PP G    +  L+  F+ L  +++G++  + +     +F YI + N++S+V G   PT+ +TVTF+LGL +  GT I+G+KYQK ++F  F     IK        IP   NP  +     P +SISLRLW N++AG++ + L Y+L    F    P+    G   ++F   A    +P FH + D LV +IQAFVFV L L YWS   +  E +  +K
  S:    20 NGWIDFLTTKPLASQGIEWTPLIPTAHVLSIFMVLFMIAILTAVYYTKLKKLKPTEPPTGYVLVVQLLILQFENLTVDLLGEKNRRLSLLFIIIFVYILISNLMSMVGGIAAPTSSSTVTFSLGLMSFFGTFIMGVKYQKLAYFRDFFVIIKIKK-----KTIPLMINPLNVIGYFAPLLSISLRLWGNVLAGSIFIALLYSLFRTFFTLWSPSSFSVG---LVFGTLAGGLVIPAFHVYFDILVSAIQAFVFVSLMLTYWSQPIKAAENAAEEK 286
>gi|13508343|ref|NP_110293.1| F0F1 ATP synthase subunit A [Mycoplasma pneumoniae M129] >gi|2493055|sp|Q50326|ATP6_MYCPN ATP synthase a chain (ATPase protein 6) >gi|1209760|gb|AAC43653.1| ATP synthase a chain >gi|1673906|gb|AAB95886.1| ATP synthase A chain [Mycoplasma pneumoniae M129] (293 aa)
Score = 314, Expect = 4.2e-27, Identities = 89/252 (35%), Positives = 129/252 (51%)
  Q:    17 SAFSDWKPFEYRSEITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVG-FENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMF---RRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWS-----GSTEPEEESQ 268
           S  + WKP     ++  I V+ I++  + + Y   ++K DP +        +  L    +    +++G+E  KFTPY   +  Y+   N+I ++G    PT+  T TF+LGL T LG +I+GI+YQ+ SFF  F F   IK K     +IP   NP        P  SISLRLW NI+ G LIL LFY      F      P  L  G   I   +     H + D +VG++Q +VFV+LT  YW+     G  E +E +Q
  S:    26 SPVAGWKPLLPTDQVFGIFVVFIVLLTLFLVYWIKLRKADPLRNHSSFVLLMQMLFVWAQDTTADLIGEENKKFTPYFLMLLLYLVSSNLIGLLGGISPPTSSLTFTFSLGLATFLGIVIMGIRYQRWSFFKSFTFNITIKGKK-YSTLIP---NPLSFLGEFAPLFSISLRLWGNILGGTLILALFYNFWFFAFSTLSNKPLALSLG--AIFAGILTPALHVYFDVVVGTLQGYVFVMLTYNYWAKMRNIGLEESQEAAQ 280
>gi|12045267|ref|NP_073078.1| F0F1 ATP synthase subunit A [Mycoplasma genitalium G37] >gi|1352013|sp|P47645|ATP6_MYCGE ATP synthase a chain (ATPase protein 6) >gi|3844997|gb|AAC71633.1| ATP synthase F0, A subunit [Mycoplasma genitalium G37] >gi|166078675|gb|ABY79293.1| ATP synthase F0, A subunit [synthetic Mycoplasma genitalium JCVI-1.0] (292 aa)
Score = 312, Expect = 7.7e-27, Identities = 84/242 (34%), Positives = 125/242 (51%)
  Q:    17 SAFSDWKPFEYRSEITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVG-FENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMF---RRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWS 258
           S  S WKPF    +I  I ++ +++    ++Y   +KK D  K           L    +    +++G+E  KF PY   +  YI   N++S++G    PT+  T TF+LGL T +G +++GI+YQ+ +FF +F F   +K K      IP   NPF I     P  SISLRLW NI+AG +IL LFY   + +F      P  L  G   +   L     H + D + G +Q +VFV+LT  YW+
  S:    26 SPISGWKPFAPTDQILGIFIVFVLLLTFFIFYKLKLKKADSLKNNSYFLLLFQMLFVWVQDTTADLLGEENKKFAPYFLMLLLYIVSSNLVSLLGGISPPTSSLTFTFSLGLATFIGIVVMGIRYQRWNFFKEFAFGITVKGKK-YSTFIP---NPFSILSGFAPLFSISLRLWGNILAGTVILALFYNFWIFIFSSINNQPLALSLG--TVFAGLITPVLHIYFDVIAGVLQGYVFVMLTYNYWA 265
>gi|13357694|ref|NP_077968.1| F0F1 ATP synthase subunit A [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|170761918|ref|YP_001752220.1| ATP synthase F0, A subunit [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171920399|ref|ZP_02691080.2| ATP synthase F0, A subunit [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|183508756|ref|ZP_02689922.2| ATP synthase F0, A subunit [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186701996|ref|ZP_02554405.2| ATP synthase F0, A subunit [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|11356742|pir||H82929 ATP synthase A chain UU137 [imported] - Ureaplasma urealyticum >gi|6899096|gb|AAF30543.1|AE002114_10 ATP synthase A chain [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168827495|gb|ACA32757.1| ATP synthase F0, A subunit [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171902837|gb|EDT49126.1| ATP synthase F0, A subunit [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|182675689|gb|EDT87594.1| ATP synthase F0, A subunit [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186700772|gb|EDU19054.1| ATP synthase F0, A subunit [Ureaplasma parvum serovar 6 str. ATCC 27818] (275 aa)
Score = 292, Expect = 1.4e-24, Identities = 82/236 (34%), Positives = 120/236 (50%)
  Q:    31 ITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEEE 266
           I +II++T+I+  V + Y   +KKL  +  P      I  ++  F+ LV + MG + +K  PY+   FCYIF  N++S+ GF+  T  + V  A+ L T +G  I+ +KYQK+SFF KF FK       G  +MI    NP  I   + P IS++ RLW NI A A++L + Y          P V   G  +I   +      G+     G+IQAFVF +LT   W    +  EE
  S:    16 IAAIIMVTLIIGTVSLIYFSMVKKLTVHDVPNRFVIIIGMIVDYFRGLVVDTMGAKHVKLAPYVLFTFCYIFTANLVSLFGFKEATTASAVPLAMALGTVIGGQIVALKYQKASFFLKFAFKI-----KGFPIMI----NPLEIVSKLTPIISLTFRLWGNISAAAILLNITYWAFAGFTNVVPWV---GVSLIAAVVILPILIGYFTCFAGTIQAFVFTLLTSINWGLEIKEGEE 239
>gi|171920702|ref|ZP_02695331.2| ATP synthase F0, A subunit [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|185178707|ref|ZP_02964525.1| ATP synthase F0, A subunit [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188024245|ref|ZP_02996942.1| ATP synthase F0, A subunit [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188039636|ref|ZP_02528966.2| ATP synthase F0, A subunit [Ureaplasma urealyticum serovar 8] >gi|188518547|ref|ZP_02556800.2| ATP synthase F0, A subunit [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|188524097|ref|ZP_02557349.2| ATP synthase F0, A subunit [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|188530854|ref|ZP_02546616.2| ATP synthase F0, A subunit [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gi|188568716|ref|ZP_02828757.2| ATP synthase F0, A subunit [Ureaplasma urealyticum serovar 2] >gi|188592529|ref|ZP_02694090.2| ATP synthase F0, A subunit [Ureaplasma urealyticum serovar 10] >gi|195867691|ref|ZP_03079692.1| ATP synthase F0, A subunit [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|171903441|gb|EDT49730.1| ATP synthase F0, A subunit [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|184209302|gb|EDU06345.1| ATP synthase F0, A subunit [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188018905|gb|EDU56945.1| ATP synthase F0, A subunit [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188997889|gb|EDU66986.1| ATP synthase F0, A subunit [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|195660134|gb|EDX53514.1| ATP synthase F0, A subunit [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|195660546|gb|EDX53802.1| ATP synthase F0, A subunit [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (275 aa)
Score = 292, Expect = 1.5e-24, Identities = 80/236 (33%), Positives = 120/236 (50%)
  Q:    31 ITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEEE 266
           I +II++T+I+  + + Y   ++KL  +  P      I  ++  F+ LV + MG + +K  PY+   FCYIF  N++S+ GF+  T  ++V  A+ L T +G  I+ +KYQK+SFF KF FK  IK         P   NP  I   + P IS++ RLW NI A A++L + Y          P V   G  +I   +      G+     G+IQAFVF +LT   W    +  EE
  S:    16 IAAIIIVTLIIATISLIYFSMIRKLTVHDVPNRFVIIIGMIVDYFRGLVVDTMGAKHVKLAPYVLFTFCYIFTANLVSLFGFKEATTASSVPLAMALATVVGGQIVALKYQKASFFLKFTFK--IKG-------FPIMVNPLEIVSKLTPIISLTFRLWGNISAAAILLNITYWAFAGFTNVVPWV---GVSLIAAVIILPILIGYFTCFAGTIQAFVFTLLTSINWGLEIKEGEE 239
>gi|110004060|emb|CAK98399.1| hypothetical atp synthase a chain transmembrane protein [Spiroplasma citri] (272 aa)
Score = 247, Expect = 2.5e-19, Identities = 74/218 (33%), Positives = 109/218 (50%)
  Q:    41 MTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWS 258
           M L + YY   +KKL P   P G+  F    +   +  V ++MG ++   T Y+  +  YI + N++SVVGFE+     TV  ++GL T LG    GIKYQK  +F KF                  F NP  +    +P ISIS RL+ NI+ G +I+ LF AL   ++   P +   GP  +L  +F      + D   G IQA++F +LT+ YW+
  S:    47 MLLSIGYYK-RLKKLGPTDVPTGLVLFAEITIKWVEKQVVDLMGPKYKFLTVYVMYLLLYIGIGNLMSVVGFESLATAYTVPLSMGLVTFLGIYYFGIKYQKLVYFKKF------------------FINPLELLTQFVPLISISFRLFGNILGGTVIITLFTALMNFIWGHIPYI---GPVDLLAGVFLPFLSIYFDVFDGLIQAYIFSILTIAYWA 242
>gi|50364924|ref|YP_053349.1| F0F1 ATP synthase subunit A [Mesoplasma florum L1] >gi|50363480|gb|AAT75465.1| ATP synthase subunit A [Mesoplasma florum L1] (284 aa)
Score = 229, Expect = 2.8e-17, Identities = 68/238 (28%), Positives = 124/238 (52%)
  Q:    29 SEITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYAL----------------------PMVMFRRDPTVLEPGPE---------VILFSLFAVPF-HGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEEE 266
           ++ ++II+ TI++  + + YN  ++  D +K   G+   I   + + + LV  IMG+++ K TPY   +  YI + +++S++GFE+P++  TVT ++   T +       +YQK ++  +++                   NP  I     P +S+S RL+ N++ G++ILGL YA+                      P   F     + +   +         V +F+    PF H + D     IQA VF +L+L YW+     E+E
  S:    10 TQFSAIIITTILICAICITYNIKVRGQDEDKELSGLIVIIDMFVSSVENLVISIMGRKYRKLTPYFLYICLYIIVGSMVSLLGFESPSSSYTVTLSMAFVTFVMIYYFAFRYQKWAYLKRYI-------------------NPIEIFTQFTPLLSMSFRLFGNLLGGSIILGLVYAMFIGFQSSWAHGTISFGDEGMHWPSFGFWNAGVLGDDAWKMQYTYWWSGVNIFTSVITPFLHMYFDMFDAVIQAVVFTMLSLSYWAEGMGEEQE 260
>gi|160881860|ref|YP_001560828.1| ATP synthase F0, A subunit [Clostridium phytofermentans ISDg] >gi|160430526|gb|ABX44089.1| ATP synthase F0, A subunit [Clostridium phytofermentans ISDg] (247 aa)
Score = 206, Expect = 1.2e-14, Identities = 75/230 (32%), Positives = 109/230 (47%)
  Q:    33 SIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMG-KEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTE 262
           S++++ I++    V  N  +KK DP K P     FI  L+ +  ++    MG K   KF  YI T+F  I L N   + G   PTA   VT AL L T +     G KYQK++     LFK             P    P  I   +   +S+SLRL+ NI++G +++GL Y L               P+VIL  + A P H + D   G+IQ +VF +LT+ + S + E
  S:    44 SLLIVMIVIIAFAVIANRCIKKADPYKVPGKFLNFIEFLVESIDSMTKANMGEKHGFKFANYIGTLFISILLMNFSGLFGMRPPTADYGVTLALALITFVLIHYNGFKYQKAAHVTN-LFK-------------PLPLTPINIIGELATPLSLSLRLFGNILSGTVMMGLIYGLL--------------PKVILLFVPA-PLHIYFDVFSGAIQTYVFCMLTMVFISNTFE 245
>gi|188159054|ref|ZP_02998493.1| F0F1 ATP synthase subunit A [Mycoplasma mycoides subsp. mycoides LC str. GM12] (287 aa)
Score = 205, Expect = 1.6e-14, Identities = 76/236 (32%), Positives = 126/236 (53%)
  Q:    31 ITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMV--------------MFR------RDPTVLEPG---------PEVILFSLFAVPF-HGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEEE 266
           + +I+++ II+  + + YN  ++  + +    G    +   + + + +V  I+GK++ K TPYI  +F YIF+  ++S++G E      TVT ++G+ T +     GIKYQK +FF +F                    NP  +     P ISIS RL+ N++ G++ILGL Y L +               M R       +P ++E G           + LF+   +PF H + D   G IQ+ VF +LTL YWS   +  E+
  S:    23 LITILLVVIIVCTISIIYNKKVRNYNIDDKMPGFLVLVNVFVASVENIVVSILGKKYQKLTPYIMYLFAYIFIGCLLSILGLEAQGTSFTVTLSMGMVTFIMIYYFGIKYQKLAFFKRFR-------------------NPVELFTQFTPLISISFRLFGNLIGGSIILGLLYGLLIGFQLSWGVNNIEVDGMTRWASYAIWNPELVENGYLKQYEYWWAGLNLFTTPIMPFLHMYFDLFSGVIQSTVFAMLTLSYWSAQIDDNEK 269
>gi|167755044|ref|ZP_02427171.1| hypothetical protein CLORAM_00548 [Clostridium ramosum DSM 1402] >gi|167705094|gb|EDS19673.1| hypothetical protein CLORAM_00548 [Clostridium ramosum DSM 1402] (222 aa)
Score = 203, Expect = 2.8e-14, Identities = 69/224 (30%), Positives = 107/224 (47%)
  Q:    30 EITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIK-FTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLT 253
           E+   +VI + + +  VY    +   DP   PKGI   +   + A    +  IM K+F K + PY   VFCYI + N+ S++GFE+PT+  ++TFA+       T I  I  Q ++   K  FK+   T           + P  I  ++ P ISIS+RL+ NI++G++++ L Y     +          GP      + A  FH + D   G IQ  VFV L+
  S:     9 ELIYSLVIMVCLGVFFVYAGKKVALADPTVKPKGIVLVVETGVKAIDDYMKSIMPKKFAKNYYPYFAMVFCYILVSNLSSLIGFESPTSNYSITFAM-------TFITFILIQYNALKKKGFFKYVWDT----------VWPPTNILSVLSPLISISMRLFGNILSGSILMTLIYQFTAWISFHVINFNFLGP------IIAPVFHCYFDIFAGCIQTLVFVTLS 210
>gi|83319402|ref|YP_424073.1| F0F1 ATP synthase subunit A [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|83283288|gb|ABC01220.1| ATP synthase F0, subunit A [Mycoplasma capricolum subsp. capricolum ATCC 27343] (286 aa)
Score = 202, Expect = 4.3e-14, Identities = 76/232 (32%), Positives = 124/232 (53%)
  Q:    31 ITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMV--------------MFR------RDPTVLEPG---------PEVILFSLFAVPF-HGFLDWLVGSIQAFVFVVLTLCYWSGSTE 262
           + SI+++ II+  + + YN  ++  + +    G    +   + + + +V  I+GK++ K TPYI  +F YIF+  ++S++G E      TVT ++G+ T +     GIKYQK +FF +F                    NP  +     P ISIS RL+ N++ G++ILGL Y L +               M R       +P ++E G           + LF+   +PF H + D   G IQ+ VF +LTL YWS   +
  S:    23 LISILLVVIIVCTISIIYNKKVRNYNIDDKMPGFLVLVNVFVASVENIVVSILGKKYQKLTPYIMYLFAYIFIGCLLSILGLEAQGTSFTVTLSMGMVTFIMIYYFGIKYQKLAFFKRFR-------------------NPVELFTQFTPLISISFRLFGNLIGGSIILGLLYGLLIGFQLSWGVNNIQVDGMTRWASYAIWNPELVENGYLKQYEFWWAGLNLFTTPIMPFLHMYFDLFSGVIQSTVFAMLTLSYWSAQID 265
>gi|47459050|ref|YP_015912.1| F0F1 ATP synthase subunit A [Mycoplasma mobile 163K] >gi|47458379|gb|AAT27701.1| ATP synthase a chain [Mycoplasma mobile 163K] (268 aa)
Score = 200, Expect = 6.3e-14, Identities = 76/263 (28%), Positives = 131/263 (49%)
  Q:    28 RSEITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEEESQVKKIKKKSPLSELKMSAEKRNQ 290
           + ++ S+I +T+++ L+ V   F +KK+ PN+ P G+A      +         I G +  K  PYIFT+  ++ + NI+ + G E  T   +V   L L T LGT ++ I +QK     K+L           KV +P+      +     P IS+S R++ NI+ G+ IL L Y +   ++   P +   G   +L ++ A   + + D   G IQA++F +LT+ +W+  T+   E + KKI +K   S+  +  EK+ Q
  S:    24 QPQLISLIFVTLVLILISVVVYFKVKKVKPNESPYGVALLSEQYVTFVDDNFQAITGGKIDKVGPYIFTLITFLVVGNILGIFGLEPITTSYSVPLTLALITWLGTYVIAIIFQKWRKLRKYL-----------KVTLPFI-----LIGEFSPIISLSFRIFGNIIGGSTILFLIYFVTGYIWGFIPII---GQVNLLGAVLAPALNLYFDLFGGLIQAYLFTILTMVFWTLETDI-PEKKKKKILRKDIASKTTLENEKKLQ 266
>gi|148377616|ref|YP_001256492.1| F0F1 ATP synthase subunit A [Mycoplasma agalactiae PG2] >gi|148291662|emb|CAL59048.1| ATP synthase A chain [Mycoplasma agalactiae PG2] (271 aa)
Score = 196, Expect = 1.7e-13, Identities = 68/272 (25%), Positives = 123/272 (45%)
  Q:    16 SSAFSDWKPFEYRSEITSIIVITIIMTLVLVYYNFSMKKL-DPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEEESQVKKIKKKSPLSELKMSAEK 287
           +  ++DW     + ++ S+I + +I  +  +Y    +KK    +K P GI   +   +        +   K   K   Y+F +  ++ + N++ ++G E  T   ++    GL + LG  + G+ YQK  FF K+                    NP  +     P ISIS R++ NI+ G++I+ + Y+L   ++ +      P P  +L  +F    H + D     IQA VF  LT  +W+   E EE+S   KI +KS +S  ++  ++
  S:    18 NGGYADWN----QKQLLSLITVVLICLVFSLYVFIKIKKYAKEDKAPSGIILVMEGYVNYIDNAFDDNTDKRIPKARFYVFGLATFLIIGNLLGLIGLEPVTTSYSIALTFGLMSWLGIYVTGLIYQKWRFFAKYK-------------------NPIEVIGQFSPLISISFRIFGNIIGGSIIMVMIYSLFGYIWTKMIPSSPPLP--LLAVIFTPVLHLYFDVFSAFIQALVFCSLTTIWWAQEAEVEEKSV--KIDEKSNVSSNQIKVKQ 263
>gi|54020000|ref|YP_115564.1| F0F1 ATP synthase subunit A [Mycoplasma hyopneumoniae 232] >gi|53987173|gb|AAV27374.1| ATP synthase A chain [Mycoplasma hyopneumoniae 232] (242 aa)
Score = 194, Expect = 3.6e-13, Identities = 69/263 (26%), Positives = 134/263 (50%)
  Q:    19 FSDWKPFEYRSEITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFI-KFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEEESQVKKIKKKSPLSEL 281
           F DW     + ++ ++ ++  ++ ++ +   F +KK   +K P  +  F  + L     LV E  G+ +I K  PYIF++F +  L N++S+VG E  +   +VT +L   +  G  ++G  Y +    +K+L +F                NP  I  I  P IS+S R++ N+++G+++L + Y+    ++++ P        + +  +F  PF  + D +   IQ+F+FV+LT  YW G    ++E+++K  KK+  L ++
  S:     4 FRDWN----QPQLFTLFILVFLVIILSIIIFFHIKKAKIDKSPSAVVLFAESYLIFIDDLV-ETAGEGYINKVKPYIFSLFTFFLLGNLLSLVGLEPISTSISVTLSLAFVSWFGIFVVGAIYSR----WKYLSEFAK--------------NPLKIIGIPAPLISLSFRMYGNLISGSVLLLIIYSGVQWIYQKIPLGTFGNFNLPIVLIFP-PFLIYFDIVGSLIQSFIFVILTTSYW-GMEVNQDEARLKINKKRLNLQKI 242
>gi|71894426|ref|YP_278534.1| F0F1 ATP synthase subunit A [Mycoplasma synoviae 53] >gi|71851214|gb|AAZ43823.1| ATP synthase A chain [Mycoplasma synoviae 53] (267 aa)
Score = 191, Expect = 7.1e-13, Identities = 64/253 (25%), Positives = 112/253 (44%)
  Q:    28 RSEITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVP-FHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEEESQVKKIKKKSPLSE 280
           +S+I S+I+  II+ +V +     + K+ PN+ P G+A      +       Y      F K  PY+FT+  ++ + N++S  G +      +V   L + T +G   +GI Y+K S+  +F+                   NP      I P IS+  R++ NI  G  ++ L Y    ++F    T++    E   F     P FH + D     +Q +VF+ LT+ YW   +  ++ S  ++ K+K    E
  S:    18 QSQIISLILTVIIILVVSLIVFAKVTKVKPNQAPTGVALVAEMYVTMVDDNSYNGTSGNFAKARPYLFTLITFLTVGNMMSFFGLDPIATSYSVPLTLAIATWIGIFTVGIMYKKWSYLKEFV-------------------NPLDFVGKIPPVISLGFRMYGNITGGGTVVVLMY----LIFGYLWTLVFKNSEWFFFGSLITPLFHFYFDVFDSLLQGYVFLTLTMVYWLNESGLDDVSTSQEEKQKLTFKE 248
>gi|144227441|gb|AAZ44137.2| ATP synthase A chain [Mycoplasma hyopneumoniae J] (242 aa)
Score = 190, Expect = 9.9e-13, Identities = 68/263 (25%), Positives = 134/263 (50%)
  Q:    19 FSDWKPFEYRSEITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFI-KFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEEESQVKKIKKKSPLSEL 281
           F DW     + ++ ++ ++  ++ ++ +   F +KK   ++ P  +  F  + L     LV E  G+ +I K  PYIF++F +  L N++S+VG E  +   +VT +L   +  G  ++G  Y +    +K+L +F                NP  I  I  P IS+S R++ N+++G+++L + Y+    ++++ P        + +  +F  PF  + D +   IQ+F+FV+LT  YW G    ++E+++K  KK+  L ++
  S:     4 FRDWN----QPQLFTLFILVFLVIILSIIIFFHIKKAKIDESPSAVVLFAESYLIFIDDLV-ETAGEGYINKVKPYIFSLFTFFLLGNLLSLVGLEPISTSISVTLSLAFISWFGIFVVGAIYSR----WKYLSEFAK--------------NPLKIIGIPAPLISLSFRMYGNLISGSVLLLIIYSGVQWIYQKIPLGTFGNFNLPIVLIFP-PFLIYFDIVGSLIQSFIFVILTTSYW-GMEVNQDEARLKINKKQLNLQKI 242
>gi|144575257|gb|AAZ53424.2| ATP synthase A chain [Mycoplasma hyopneumoniae 7448] (242 aa)
Score = 189, Expect = 1.1e-12, Identities = 68/263 (25%), Positives = 134/263 (50%)
  Q:    19 FSDWKPFEYRSEITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFI-KFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEEESQVKKIKKKSPLSEL 281
           F DW     + ++ ++ ++  ++ ++ +   F +KK   ++ P  +  F  + L     LV E  G+ +I K  PYIF++F +  L N++S+VG E  +   +VT +L   +  G  ++G  Y +    +K+L +F                NP  I  I  P IS+S R++ N+++G+++L + Y+    ++++ P        + +  +F  PF  + D +   IQ+F+FV+LT  YW G    ++E+++K  KK+  L ++
  S:     4 FRDWN----QPQLFTLFILVFLVIILSIIIFFHIKKAKIDESPSAVVLFAESYLIFIDDLV-ETAGEGYINKVKPYIFSLFTFFLLGNLLSLVGLEPISTSISVTLSLAFVSWFGIFVVGAIYSR----WKYLSEFAK--------------NPLKIIGIPAPLISLSFRMYGNLISGSVLLLIIYSGVQWIYQKIPLGTFGNFNLPIVLIFP-PFLIYFDIVGSLIQSFIFVILTTSYW-GMEVNQDEARLKINKKQLNLQKI 242
>gi|71893402|ref|YP_278848.1| F0F1 ATP synthase subunit A [Mycoplasma hyopneumoniae J] (243 aa)
Score = 189, Expect = 1.1e-12, Identities = 68/263 (25%), Positives = 134/263 (50%)
  Q:    19 FSDWKPFEYRSEITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFI-KFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEEESQVKKIKKKSPLSEL 281
           F DW     + ++ ++ ++  ++ ++ +   F +KK   ++ P  +  F  + L     LV E  G+ +I K  PYIF++F +  L N++S+VG E  +   +VT +L   +  G  ++G  Y +    +K+L +F                NP  I  I  P IS+S R++ N+++G+++L + Y+    ++++ P        + +  +F  PF  + D +   IQ+F+FV+LT  YW G    ++E+++K  KK+  L ++
  S:     5 FRDWN----QPQLFTLFILVFLVIILSIIIFFHIKKAKIDESPSAVVLFAESYLIFIDDLV-ETAGEGYINKVKPYIFSLFTFFLLGNLLSLVGLEPISTSISVTLSLAFISWFGIFVVGAIYSR----WKYLSEFAK--------------NPLKIIGIPAPLISLSFRMYGNLISGSVLLLIIYSGVQWIYQKIPLGTFGNFNLPIVLIFP-PFLIYFDIVGSLIQSFIFVILTTSYW-GMEVNQDEARLKINKKQLNLQKI 243
>gi|72080389|ref|YP_287447.1| F0F1 ATP synthase subunit A [Mycoplasma hyopneumoniae 7448] (243 aa)
Score = 189, Expect = 1.2e-12, Identities = 68/263 (25%), Positives = 134/263 (50%)
  Q:    19 FSDWKPFEYRSEITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFI-KFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEEESQVKKIKKKSPLSEL 281
           F DW     + ++ ++ ++  ++ ++ +   F +KK   ++ P  +  F  + L     LV E  G+ +I K  PYIF++F +  L N++S+VG E  +   +VT +L   +  G  ++G  Y +    +K+L +F                NP  I  I  P IS+S R++ N+++G+++L + Y+    ++++ P        + +  +F  PF  + D +   IQ+F+FV+LT  YW G    ++E+++K  KK+  L ++
  S:     5 FRDWN----QPQLFTLFILVFLVIILSIIIFFHIKKAKIDESPSAVVLFAESYLIFIDDLV-ETAGEGYINKVKPYIFSLFTFFLLGNLLSLVGLEPISTSISVTLSLAFVSWFGIFVVGAIYSR----WKYLSEFAK--------------NPLKIIGIPAPLISLSFRMYGNLISGSVLLLIIYSGVQWIYQKIPLGTFGNFNLPIVLIFP-PFLIYFDIVGSLIQSFIFVILTTSYW-GMEVNQDEARLKINKKQLNLQKI 243
>gi|42561409|ref|NP_975860.1| F0F1 ATP synthase subunit A [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|42492907|emb|CAE77502.1| ATP SYNTHASE A CHAIN [Mycoplasma mycoides subsp. mycoides SC str. PG1] (287 aa)
Score = 189, Expect = 1.2e-12, Identities = 73/219 (33%), Positives = 115/219 (52%)
  Q:    48 YNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMV--------------MFR------RDPTVLEPG---------PEVILFSLFAVPF-HGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEEE 266
           YN  ++  + +    G    +   + + + +V  I+GK++ K TPYI  +F YIF+  ++S++G E      TVT ++G+ T +     GIKYQK +FF +F                    NP  +     P ISIS RL+ N++ G++ILGL Y L +               M R       +P ++E G           + LF+   +PF H + D   G IQ+ VF +LTL YWS   +  E+
  S:    40 YNKKIRNYNIDDKMPGFLVLVNVFVASVENIVVSILGKKYQKLTPYIMYLFAYIFIGCLLSILGLEAQGTSFTVTLSMGMVTFIMIYYFGIKYQKLAFFKRFR-------------------NPVELFTQFTPLISISFRLFGNLIGGSIILGLLYGLLIGFQLSWGVNNIQVDGMTRWASYAIWNPELVENGYLKQYEYWWAGLNLFTTPIMPFLHMYFDLFSGVIQSTVFAMLTLSYWSAQIDDNEK 269
>gi|153956285|ref|YP_001397050.1| F0F1 ATP synthase subunit A [Clostridium kluyveri DSM 555] >gi|146349143|gb|EDK35679.1| AtpB [Clostridium kluyveri DSM 555] (227 aa)
Score = 179, Expect = 2.0e-11, Identities = 74/224 (33%), Positives = 111/224 (49%)
  Q:    31 ITSIIV----ITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISV-VGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLF--AVPFHGFLDWLVGSIQAFVFVVLTL 254
           ITS +V    I +I+ ++  ++  +M++L     P G    +  ++ A + LV   MGKE+I F PYI T+  YI + NI  V +G + PT   +VT  L L T +      IK        K   K Y    +   VM+     P  I + ++  +S+SLRL+ N+ AGA+I+G+ Y              E    +  FS F   +P H F D   GSIQ  VFV+LT+
  S:    19 ITSSVVVQWGIILILAVLAKFFTRNMQRL-----PDGRQNVVEMIVEAVQNLVKNNMGKEYISFVPYIGTLAIYILVMNIAPVIIGLKAPTEDLSVTLGLALITFVLVQFNAIK--------KTGLKNYFIGYTKPVVMLL----PLNIVERLVLPVSLSLRLFGNLTAGAVIIGIVY--------------EGLGNIAWFSQFLIPIPLHAFFDLFDGSIQMIVFVMLTV 218
>gi|167747410|ref|ZP_02419537.1| hypothetical protein ANACAC_02130 [Anaerostipes caccae DSM 14662] >gi|167652772|gb|EDR96901.1| hypothetical protein ANACAC_02130 [Anaerostipes caccae DSM 14662] (242 aa)
Score = 170, Expect = 2.1e-10, Identities = 67/228 (29%), Positives = 104/228 (45%)
  Q:    29 SEITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVP--FHGFLDWLVGSIQAFVFVVLTLCY 256
           + +T++IV+  IM L L+     MK  +    P G+A  +  ++     LV   MGK +  F  YI ++  +IF+ N   + G   PTA    T +L L T +       K +K   F   LF+            IP  F    I +   P +S+SLRL+ NIMAG ++L L+Y L                 + +F+   +P   H + D   G+IQ FVF +LT+ +
  S:    39 THVTTLIVMLFIMVLALIARRSIMKDYEK---PSGLANAVELVVEMLDKLVKSTMGKHWKPFANYIGSIMFFIFIANTSGLFGLRAPTADYGTTLSLALITFVMIQYSAFKTRKFRMFTD-LFQ-----------PIPVLFPVNVIGEFATP-VSLSLRLFGNIMAGTIMLSLWYGL-----------------LPIFAKLGLPAFLHVYFDLFSGAIQTFVFAMLTMTF 235
>gi|169351557|ref|ZP_02868495.1| hypothetical protein CLOSPI_02337 [Clostridium spiroforme DSM 1552] >gi|169291779|gb|EDS73912.1| hypothetical protein CLOSPI_02337 [Clostridium spiroforme DSM 1552] (223 aa)
Score = 169, Expect = 2.6e-10, Identities = 65/226 (28%), Positives = 106/226 (46%)
  Q:    28 RSEITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIK-FTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLT 253
           + E+   ++I  I+++  V     +K  DP K P+G+       +   +  +  +M  +F K + PY   +F YIF+ NI  + GFE PT+  ++T A+       TII     Q ++   K +F  YIK            + P  I   + P IS+S+RL+ NI+AG+++L L Y+    + +        GP      + A  FH + D   G IQ  VFV L+
  S:     9 QPELVFSLIIMTILSIFFVLVGRKVKVADPTKRPRGVVLVCETGVKMIQDYMETLMPSKFSKNYYPYFAMMFIYIFISNISGLFGFEAPTSNYSITLAI-------TIITFTLIQYNALKTKGIFT-YIKD---------IIWPPTNILGTLAPLISLSMRLFGNIVAGSILLSLIYSFTGYLSQYVINFNFLGP------VIAPIFHAYFDVFAGFIQTLVFVTLS 212
>gi|126701097|ref|YP_001089994.1| ATP synthase A chain [Clostridium difficile 630] >gi|145952628|ref|ZP_01801637.1| hypothetical protein CdifQ_04004004 [Clostridium difficile QCD-32g58] >gi|168697763|ref|ZP_02730040.1| ATP synthase A chain [Clostridium difficile QCD-37x79] >gi|168714966|ref|ZP_02747243.1| ATP synthase A chain [Clostridium difficile QCD-63q42] >gi|168726398|ref|ZP_02758675.1| ATP synthase A chain [Clostridium difficile QCD-76w55] >gi|168730156|ref|ZP_02762433.1| ATP synthase A chain [Clostridium difficile QCD-97b34] >gi|196124981|ref|ZP_03116730.1| ATP synthase A chain [Clostridium difficile ATCC 43255] >gi|196162319|ref|ZP_03122880.1| ATP synthase A chain [Clostridium difficile CIP 107932] >gi|115252534|emb|CAJ70377.1| ATP synthase A chain [Clostridium difficile 630] (234 aa)
Score = 169, Expect = 2.8e-10, Identities = 61/230 (26%), Positives = 104/230 (45%)
  Q:    33 SIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIK----FTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTE 262
           +I+V   IM  + +   F  + L    P   +  F+   +G    +V ++MGK  +K      PYI ++F +    N+  ++G  +PT     T A  + T       G+K++  S+F +      I               P  I   +   IS+S R + NI+ G +I+GLFY L   +    P +  P  E+    L  VP H + D   G +QA++F++LT+ + S + E
  S:    17 TILVSWGIMAFLAIASYFLTRNLK-KVPTSKVQIFLEFAVGGLAKMVTDVMGKNTVKRMPYMIPYIGSLFLFFACSNLSPLLGLRSPTTDLDTTAAWAMITFFMIYFAGVKFKGLSYFKELAQPLAIML-------------PINIIGELARPISLSFRPFGNILGGTIIMGLFYQLLGFISSLIPGLSIPIGEI----LIPVPLHLYFDLFAGLLQAYIFIMLTMVFISSAGE 232
>gi|196164025|ref|ZP_03124556.1| ATP synthase A chain [Clostridium difficile QCD-23m63] (234 aa)
Score = 166, Expect = 5.7e-10, Identities = 60/230 (26%), Positives = 104/230 (45%)
  Q:    33 SIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIK----FTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTE 262
           +I+V   IM  + +   F  + L    P   +  F+   +G    +V ++MGK  +K      PYI ++F +    N+  ++G  +PT     T A  + T       G+K++  S+F +      I               P  I   +   IS+S R + NI+ G +I+GLFY L   +    P +  P  ++    L  VP H + D   G +QA++F++LT+ + S + E
  S:    17 TILVSWGIMAFLAIASYFLTRNLK-KVPTSKVQIFLEFAVGGLAKMVTDVMGKNTVKRMPYMIPYIGSLFLFFACSNLSPLLGLRSPTTDLDTTAAWAMITFFMIYFAGVKFKGLSYFKELAQPLAIML-------------PINIIGELARPISLSFRPFGNILGGTIIMGLFYQLLGFISSLIPGLSIPIGQI----LIPVPLHLYFDLFAGLLQAYIFIMLTMVFISSAGE 232
>gi|15828743|ref|NP_326103.1| F0F1 ATP synthase subunit A [Mycoplasma pulmonis UAB CTIP] >gi|14089685|emb|CAC13445.1| ATP SYNTHASE A CHAIN [Mycoplasma pulmonis] (270 aa)
Score = 166, Expect = 5.8e-10, Identities = 57/243 (23%), Positives = 113/243 (46%)
  Q:    45 LVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVP-FHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEE----ESQVKKIKKKSPLSELKMSAEK 287
           LV Y F ++K +  + PKG+       +GAF++   +    +  +   Y F++  ++ + N+IS++G E      +V   L L + +G  +     +K    +  +                   NP  +    +P +S+S+R++ NI+ G+ ++ LFY     ++ +   +     ++++ + F  P FH + D     IQA+VF +L++ YWS   + +E    +S+    KK    S+LK    K
  S:    45 LVVY-FKVRKQNYKEVPKGVVLIAEEYVGAFQSTFDDASENKLKRSGAYFFSLITFLLIGNLISLIGLEPIVTSYSVPLTLALISWIGITVFKFANRKVKIIFDII-------------------NPLDLIGHFIPLLSLSVRIFGNIIGGSTVVFLFYTFLGYLWGQ---ISGSQNQLLVLAPFFTPLFHLYFDLFGAIIQAYVFTLLSIVYWSSEIDEKELRKKQSKFNFSKKIFSFSQLKRKQNK 269
>gi|167768332|ref|ZP_02440385.1| hypothetical protein CLOSS21_02888 [Clostridium sp. SS2/1] >gi|167709856|gb|EDS20435.1| hypothetical protein CLOSS21_02888 [Clostridium sp. SS2/1] (243 aa)
Score = 166, Expect = 6.1e-10, Identities = 68/234 (29%), Positives = 104/234 (44%)
  Q:    29 SEITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTE 262
           + +T++IV+  I+ L L+  +     L  ++ P G+  F+  ++     LV   MG+ +  F  YI T+  +IF  N   + G   PTA    T AL L T +       K  K   F   LFK            IP  F    I +   P +S+SLRL+ NIMAG +++ L+Y L        P + + G    L        H + D   G+IQ FVF +LT+ + +   E
  S:    40 THVTTLIVMVFIIVLALIARH---AVLHGDEKPSGLQNFVEMIVEMLDNLVKGSMGRHWRPFVNYIGTIMVFIFFANTSGLFGLRPPTADYGTTLALALITFVLIQYSAFKTSKLHVFTD-LFK-----------PIPILFPINLIGEFATP-LSMSLRLFGNIMAGTIMMALWYGLL-------PWLAQLGIPAFL--------HMYFDLFSGAIQTFVFAMLTMTFITDKRE 242
>gi|158321586|ref|YP_001514093.1| ATP synthase F0, A subunit [Alkaliphilus oremlandii OhILAs] >gi|158141785|gb|ABW20097.1| ATP synthase F0, A subunit [Alkaliphilus oremlandii OhILAs] (231 aa)
Score = 166, Expect = 6.1e-10, Identities = 61/232 (26%), Positives = 113/232 (48%)
  Q:    31 ITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFY----ALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTE 262
           +T II+    +T +L+  NF        K PKG+   +  L+        + MG++   F PY+ T+F ++ + N+I +VG   PTA    TFAL + T    II+     K+S     +  ++          +P+ F    + D+  P IS++ RL+ N++ G +I+ L Y    +L  ++  +   + + G  ++        FH + D   G +Q+F+FV+L++ Y S + +
  S:    23 VTWIIMAIFAITSILITRNFE-------KIPKGMQNVVEMLVDTMNKFTMQTMGEKRRSFAPYMGTIFLFLLVGNLIGLVGLRPPTADLNTTFALSILT---FIIIHYNSVKTSGIGGKIKGYFEP--------LPFLFPINVLGDVATP-ISLAFRLFGNVVGGLVIMSLLYSALGSLSGMIGLQSIPIFQAGIPLV--------FHAYFDVFSGVLQSFIFVMLSMVYISNAMD 231
>gi|164688902|ref|ZP_02212930.1| hypothetical protein CLOBAR_02550 [Clostridium bartlettii DSM 16795] >gi|164602106|gb|EDQ95571.1| hypothetical protein CLOBAR_02550 [Clostridium bartlettii DSM 16795] (234 aa)
Score = 166, Expect = 6.4e-10, Identities = 62/232 (26%), Positives = 106/232 (45%)
  Q:    31 ITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTP----YIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTE 262
           I+  +V + I+  VL+  ++ + +     P   +   +   +   K LV   MGK+  K  P    YI ++F +    N+I ++GF +PTA    T A  L T       G+K +  +++             G    +P    P  I       IS++ R + NI+ G +I+GL Y L   +    P V  P  ++++     VP H + D   G +QAF+FV+LT+ + S + E
  S:    16 ISETVVTSWIIMAVLIIASYFLTRNLKLVPTSKVQIMLEYAVVTLKNLVEGNMGKDVFKKMPNMFYYIGSLFLFFAFSNLIGLLGFRSPTADVDTTLAWALLTVFLIYFEGMKAKGLAYW------------KGLMEPVPLLL-PLNIVSEFATPISLTFRPFGNILGGTVIMGLLYKLLAFISTLIPNVSIPFLQLVI----PVPLHLYFDLFAGCLQAFIFVMLTMVFVSSAAE 234
>gi|15896125|ref|NP_349474.1| F0F1 ATP synthase subunit A [Clostridium acetobutylicum ATCC 824] >gi|5915709|sp|O05097|ATP6_CLOAB ATP synthase a chain (ATPase protein 6) >gi|15025917|gb|AAK80814.1|AE007784_11 FoF1-type ATP synthase A subunit [Clostridium acetobutylicum ATCC 824] >gi|1905949|gb|AAB50191.1| F-type ATP synthase subunit a >gi|4323562|gb|AAD16420.1| ATP synthase subunit a [Clostridium acetobutylicum] (221 aa)
Score = 164, Expect = 8.9e-10, Identities = 71/244 (29%), Positives = 113/244 (46%)
  Q:    13 LQASSAFSDWKPFEYRSEITSIIVIT-IIMTLVLVYYNFSMKKLD--PNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           L A + FS  K   Y   IT  +V+  IIM ++++   F  K L   PN+  + +   I NL+     LV E MG++F+ F P I T+  +I   N+  +VG E  T   +VT    L +        IK      + K +F       S   +M+P       +  + +P +S+ LRL+ N++ GA+++ L Y+ P  +                  L  VP HGF D   G +Q +VFV+LT+ +
  S:     3 LGAKTVFS-MKLGSYNFAITETVVLQWIIMAVIILLAIFLTKNLKKVPNRK-QSVIEMIVNLING---LVKENMGEKFMNFVPIIGTMAVFILFLNLTGLVGIEPATKDISVTAGFALVSAFLINATAIKRIGVGGYIKSIF-------SQGPIMVPMNL----LEKVTIP-VSLCLRLFINMLVGAIVMSLIYSTPAKI------------------LLPVPLHGFFDMFDGVLQVYVFVLLTMIF 214
>gi|121282039|gb|ABM53593.1| putative ATP synthase a chain [uncultured bacterium CBNPD1 BAC clone 2089] (252 aa)
Score = 163, Expect = 1.4e-09, Identities = 60/231 (25%), Positives = 115/231 (49%)
  Q:    34 IIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKT-LVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFEN--PTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPE 264
           I +I ++ T++         + D  K P+G        +   +  ++ + MG++ + +TP++ T+F +I+LCN+  ++ F     TA   +  AL L   +     GIK+Q    ++K +       K+   ++ P  F    I+ II+   S+++RL+AN++AG ++L  F  L   +F+    +L P     +  +F + F    + LV  +QA++F +LT  Y  G+  PE
  S:    25 IAIIAVLATIIGCTIFTLAARADAKKAPRGARNLAETSVEFIENGVIMQTMGRDGLGWTPFLLTLFLFIYLCNVPGIIPFFQMPATARMAIPAALALMVWVVYNGAGIKHQGFGGYFKSVLFPPGVPKALYVLVTPIEF----ISAIIVRPFSLAVRLFANMLAGHILLVTFALLSESLFQAKDKILIP---FGVLPMFMLIFLTGFEVLVAFLQAYIFTILTAVYIGGAVHPE 251
>gi|77964175|gb|ABB13420.1| ATP synthase subunit a [Clostridium paradoxum] (232 aa)
Score = 161, Expect = 2.4e-09, Identities = 61/228 (26%), Positives = 102/228 (44%)
  Q:    31 ITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWS 258
           +T  I  T ++ L+L  + +   + +  K PKG+  F+  ++ A   LV + MG++ + F PYI ++F ++   N++ ++G   PTA    T  + L T +     GI+ +    + K            N  +I    NP          IS+S RL+ NI  G +I  L Y     +  R   +  P    IL        H + D   G +QAF+FV+LT+ + S
  S:    18 VTETITTTWLIILLLSCFAYFGTR-NFEKLPKGLQNFVELIVDAVNKLVKQTMGEDKVGFAPYIGSIFLFLICANLVGLLGIRPPTADLNTTVGMALITFILVQFNGIRVKGLKGYLKGFLDPLPFLLPLN--VIGELANP----------ISLSFRLFGNIAGGMVITTLLYGFLSFLTTRFIGISIP----ILQVGIPAVLHIYFDLFTGVLQAFIFVMLTMVFIS 228
>gi|6014713|gb|AAF01473.1| F1FO ATPase a subunit [Acetobacterium woodii] (220 aa)
Score = 156, Expect = 8.0e-09, Identities = 62/232 (26%), Positives = 104/232 (44%)
  Q:    31 ITSIIVIT-IIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFY-ALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTE 262
           IT  +V T IIM L+LV      K +   +P K        ++ A   LV + MGK+ +KF PY+  +  ++   N   + G  +PTA    T A          +L  K +++    +  F+            +P+ F P  +       +S+S RL+ N++ G +I+ L Y AL  ++F                 L  VPFH + D   G +Q+F+F +LT+ + SG+ +
  S:    15 ITQTLVNTWIIMALILVVCYILTKNMQIKRPGKA-QVIAETIVTALDDLVGQTMGKDKMKFAPYMLALIMFLAFSNTAGIYGLRSPTADLNCTVAC-FDDVFFDAVLWFKIKRTGRLSQGFFE-----------PMPFLF-PINVIGEFANPVSLSFRLFGNMLGGGIIMALLYSALAGLIF--------------FPVLIPVPFHFYFDIFSGLLQSFIFTMLTMVFISGAMD 220
>gi|168333937|ref|ZP_02692169.1| ATP synthase F0, A subunit [Epulopiscium sp. 'N.t. morphotype B'] (232 aa)
Score = 155, Expect = 1.0e-08, Identities = 60/224 (26%), Positives = 104/224 (46%)
  Q:    39 IIMTLVLVYYNFSMKKLDPNK--PPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVP--FHGFLDWLVGSIQAFVFVVLTLCYWSGSTE 262
           IIM ++ ++  +  KK++     P       I +++  F++     MG++   F+ +   +F +I   N+  ++    PTA    TFAL L T     + GIK  K   +YK LF+            IP  F P  +   +   IS+S RL+ NI+ G +I+GL+YA+                 +  F L  +P   H + D   G++Q  +FV+L++ + S + E
  S:    35 IIMAILTIFGFYVKKKVEAFTIVPETKFQVAIESIVSMFESFTMSTMGEKNKGFSHFYGPMFLFILFANLSGLILLRPPTADIATTFALSLTTFFMVQLYGIK-SKGIGYYKELFQ-----------PIPLLF-PLNVVGELANPISLSFRLFGNILGGTIIMGLYYAM-----------------IPWFGLIGIPSILHMYFDVFAGTLQTLIFVMLSMTFVSSAME 232
>gi|167750151|ref|ZP_02422278.1| hypothetical protein EUBSIR_01120 [Eubacterium siraeum DSM 15702] >gi|167656894|gb|EDS01024.1| hypothetical protein EUBSIR_01120 [Eubacterium siraeum DSM 15702] (242 aa)
Score = 152, Expect = 2.2e-08, Identities = 54/188 (28%), Positives = 93/188 (49%)
  Q:    71 LLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWS 258
           L+  F  +V + MG+++ K+TPYI  +FC+  L +++ + GF  PT+  +V  A G    + T +L ++ +  +   K   K +I+        +P+   PF I   I   +S +LR +ANI+AG++I GL Y     +     ++  P    + F LF+             IQA++F  LT+ Y S
  S:    71 LVNFFNNMVRDTMGEKYRKYTPYIGGLFCFSILSSLMGLFGFRCPTSDLSVIAAWG----ITTFVLTLRNKLKTGGIKGYLKGFIEP-------MPFML-PFNIIGDIANPVSQTLRHFANILAGSVIGGLIYFALGQVANGLASIGVPAVCSLYFDLFS-----------AFIQAYIFCTLTMAYVS 235
>gi|169628538|ref|YP_001702187.1| ATP synthase A chain AtpB [Mycobacterium abscessus] >gi|169240505|emb|CAM61533.1| ATP synthase A chain AtpB [Mycobacterium abscessus] (257 aa)
Score = 152, Expect = 2.5e-08, Identities = 75/258 (29%), Positives = 118/258 (45%)
  Q:     9 VITTLQASSAFS-----------DWKPFEYRSEITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFT-PYIFTVFCYIFLCNIISVVGFE-------------NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEEE 266
           +ITT QA +A             D+ P+E    + +I+   +   +V+    F   K+     P G+  F   +   F+  V   +G +   F  P   T+F +I + N ISV+  +              P +      AL LF         + Y  + F  + L    IK   G+   +  F NP  I ++  P IS+SLRL+ N+ AG +++ L     + MF   P  +   P  I  S          D  VG IQAF+F +LT+ Y+S S E +E+
  S:     1 MITTFQAEAAIEVGHHKHWTWHGDFWPYELTFNVDTIVATALAGVVVIALALFLRAKVTSTGVPNGVQLFFEAVTVQFRNQVESAIGMKIAPFVLPLAVTIFVFILVSNWISVLPVQYTDDTGKTAELLAPPASDINYVLALALFVF-------VCYHIAGFARRGLIGHPIKLLKGH-TWVTAFINP--IEELAKP-ISLSLRLFGNMFAGGIMVAL-----IAMF---PAWIMWAPNAIWKSF---------DLFVGLIQAFIFALLTVLYFSQSMELDED 255
>gi|156452237|ref|ZP_02058609.1| ATP synthase F0, A subunit [Methylobacterium chloromethanicum CM4] >gi|163852590|ref|YP_001640633.1| F0F1 ATP synthase subunit A [Methylobacterium extorquens PA1] >gi|156188854|gb|EDO21051.1| ATP synthase F0, A subunit [Methylobacterium chloromethanicum CM4] >gi|163664195|gb|ABY31562.1| ATP synthase F0, A subunit [Methylobacterium extorquens PA1] (251 aa)
Score = 151, Expect = 3.3e-08, Identities = 51/185 (27%), Positives = 93/185 (50%)
  Q:    79 VYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENP-TALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLF-YALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEP 263
           V++  G++  +F P +F++F ++ + N++ ++ +    T+   VTF L L   L  +I G+    + F   F+        SG    +     P  I   +   IS+S+RL+ANI+AG + L +F + +  ++      VL P P  +  +L A      L++LV ++QA+VF  LT  Y + +  P
  S:    76 VHQATGEDGKRFLPLVFSLFMFVLILNLLGMIPYAFAVTSHLIVTFGLALVVILTVVIYGVAKHGTHFLGVFV-------PSGVPKPLLLIMVPIEIVSFLSRPISLSVRLFANILAGHIALKIFAFFVVQLLVAGAWGVLSPLPLALTIALTA------LEFLVAALQAYVFATLTAVYLADALHP 249
>gi|166033110|ref|ZP_02235939.1| hypothetical protein DORFOR_02832 [Dorea formicigenerans ATCC 27755] >gi|166027467|gb|EDR46224.1| hypothetical protein DORFOR_02832 [Dorea formicigenerans ATCC 27755] (220 aa)
Score = 151, Expect = 3.4e-08, Identities = 57/230 (24%), Positives = 101/230 (43%)
  Q:    33 SIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTE 262
           S+ V  IIM +V++     ++ L    P K     + + +G       ++MGKE  ++ PY+ TV  YI + NII + GF+ PT    VT AL + +       GI       + K   K            +P F  P  + +I++  +S+ +RL+ N++   +I+ L                    +++  ++  +PF  + D   G +QA+VFV LT  + +   E
  S:    23 SVAVTWIIMAVVVLLCVIFVRNLSVENPGKA-QLLLESAIGKGVDFFEDVMGKENRRYIPYLITVLIYIGIANIIGLFGFKPPTKDLNVTIALAVMSMCLIEYSGIHKNGLKHWVKHFAK-----------PVP-FVAPIMVLEIVIRPLSLCMRLFGNVLGAFVIMELL-------------------KIVAPAIIPIPFSFYFDIFDGFLQAYVFVFLTALFMNEEQE 220
>gi|163782857|ref|ZP_02177853.1| ATP synthase F0 subunit a [Hydrogenivirga sp. 128-5-R1-1] >gi|159881978|gb|EDP75486.1| ATP synthase F0 subunit a [Hydrogenivirga sp. 128-5-R1-1] (219 aa)
Score = 150, Expect = 4.5e-08, Identities = 64/239 (26%), Positives = 114/239 (47%)
  Q:    27 YRSEITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVV-GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEE 265
           Y   I  ++ + I   LVL+    S+K       P      +   L   + ++ + +G+E +++TP I ++  +IF  N++ +V GF+ PTA      A+ L   L     GI+    ++   F+             + P+FF    I+ I  P I++SLRL+AN+ AGAL+L     L +    ++P  +   P V+LF + A+ F          IQ ++F++L++ Y +G+   EE
  S:     6 YNHVILGLVAMGIATLLVLIGGKPSIK-------PSKYQALLEGYLRFVRGMLRDNIGEEGVRYTPLIASMGLFIFFSNLLGMVPGFDAPTANINTNLAMALIVFLFYNFEGIRTNGINYIKHFMGPI--------PALAPFFFIVEIISHIARP-ITLSLRLFANMKAGALLLVSIVGLVI----QNPFTMAVSPVVLLF-IIAIKFLAIF------IQTYIFMILSVVYLAGAVVHEE 218
>gi|84701718|ref|ZP_01016293.1| Fo ATP synthase subunit A [Parvularcula bermudensis HTCC2503] >gi|84690964|gb|EAQ16804.1| Fo ATP synthase subunit A [Parvularcula bermudensis HTCC2503] (282 aa)
Score = 149, Expect = 5.1e-08, Identities = 59/186 (31%), Positives = 96/186 (51%)
  Q:    78 LVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVV--------GFE--NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHG-----FLDWLVGSIQAFVFVVLTLCYWSGSTEP 263
           ++ + +G E     PYIFT+F +IFL NI+ ++        G     PT+   VTFAL   +    I++ I + K+   +  LF       SG  +++     P  +   +   IS+ +RL+AN++AG ++L +F    + +F         G    L  +  +PF G     FL+ LV  +QAFVF VL+  Y S +  P
  S:    95 MLRDAVGDEGRALFPYIFTLFVFIFLANILGLLPTIPGTPEGLHVFTPTSHIIVTFALASLSV--GIVVVIGFMKNGLGFLKLF-----APSGIPLLLMPLIVPIEVVSFLSRPISLGVRLFANMLAGHIVLKVFAGFVVTLF---------GAGGALAVISIIPFFGIVIVFFLELLVAFLQAFVFAVLSCIYLSDALHP 279
>gi|188582611|ref|YP_001926056.1| ATP synthase F0, A subunit [Methylobacterium populi BJ001] >gi|179346109|gb|ACB81521.1| ATP synthase F0, A subunit [Methylobacterium populi BJ001] (251 aa)
Score = 149, Expect = 5.5e-08, Identities = 51/185 (27%), Positives = 92/185 (49%)
  Q:    79 VYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENP-TALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLF-YALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEP 263
           V++  G +  +F P +F++F ++ + N++ ++ +    T+   VTF L L   L  +I G+    + F   F+        SG    +     P  I   +   IS+S+RL+ANI+AG + L +F + +  ++      VL P P  +  +L A      L++LV ++QA+VF  LT  Y + +  P
  S:    76 VHQATGADGKRFLPLVFSLFMFVLILNLLGMIPYAFAVTSHLIVTFGLALVVILTVVIYGVAKHGTHFLGVFV-------PSGVPKPLLLIMVPIEIVSFLSRPISLSVRLFANILAGHIALKIFAFFVVQLLVAGAWGVLSPLPLALTIALTA------LEFLVAALQAYVFATLTAVYLADALHP 249
>gi|193216466|ref|YP_001999708.1| ATP synthase A chain [Mycoplasma arthritidis 158L3-1] >gi|193001789|gb|ACF07004.1| ATP synthase A chain [Mycoplasma arthritidis 158L3-1] (267 aa)
Score = 148, Expect = 6.6e-08, Identities = 59/251 (23%), Positives = 112/251 (44%)
  Q:    24 PFEYRSEITSIIVITIIMTLVLVYYNF-SMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVIL--FSLFAVP-FHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPE-EESQVKKIKK 274
           P E    +   ++  +++T +L    F ++K+    K P      +  L+        ++      K  PY  ++F ++   N++S+ GF    +  +   A    T + T  L + Y K  F  K L        +GN                + P IS++ R++ NI+ G +++ LF+A    ++ +   V       ++  F +   P F+ + D   G+IQAFVF+ LT+ YWS ++E + +E   +KI +
  S:    13 PSEVNENVIFTMIALVVITFILAILIFVAIKRQKVEKAPGAAVLLVEQLITKGDDYASDLHEHRLDKANPYFISIFVFLLFGNLLSLFGFAPIGSALSAVLAASAVTWIVTFGLNVIYHKIIFLLKLLN---PLELAGN----------------VTPLISLTFRMFGNIIGGVVLITLFHAFLNSIWIKIINVSAESAAAVINPFGILLTPIFNLYFDLFAGAIQAFVFMTLTISYWSEASEVDVKEKHREKISE 249
>gi|168185926|ref|ZP_02620561.1| ATP synthase F0, A subunit [Clostridium botulinum C str. Eklund] >gi|169296170|gb|EDS78303.1| ATP synthase F0, A subunit [Clostridium botulinum C str. Eklund] (228 aa)
Score = 147, Expect = 9.2e-08, Identities = 61/228 (26%), Positives = 105/228 (46%)
  Q:    27 YRSEITSIIVIT----IIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTL 254
           Y+  I++++VI     +I  L+ V     +KK+ P+K    +  F+       K ++  IMG+E + FTPYI T+  ++ + N+  +VG E PT   +VT  +   + +      IK Q    + K            N + + +   P  I + IM  +S+SLRL+ N+ A  +I+ L Y     +         P P  I      +P H + D   G +Q  +F +LT+
  S:    14 YKIAISNVVVIQWAIILITLLICVMVTRKLKKV-PDKKQTVVEMFV----SGIKDIIKNIMGEEAVVFTPYIGTLVIFLLIMNLAGLVGIEPPTKDFSVTCGVAAISFVVIQAYAIKKQGLGGYLK---------GYTNPIWVLF---PINIMERIMLPVSLSLRLFGNMTAAVVIMDLVYKGLSSL---------PLPFGIGQFAIPIPLHFYFDVFDGGLQMIIFTMLTM 219
>gi|150388186|ref|YP_001318235.1| ATP synthase F0, A subunit [Alkaliphilus metalliredigens QYMF] >gi|149948048|gb|ABR46576.1| ATP synthase F0, A subunit [Alkaliphilus metalliredigens QYMF] (232 aa)
Score = 144, Expect = 2.0e-07, Identities = 58/226 (25%), Positives = 97/226 (42%)
  Q:    31 ITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           I+  +V+T  +  VL  + F   +    + P G+      ++     L  + MG +   F PY+ T+F ++ + NI+ + G   PTA   VTFAL L T       G K +    + K   + +             F  P  I   +   IS++ RL+ NI+ G +I+ L Y    +        LE  P  I  +   V  H + D   G +Q F+FV+L++ +
  S:    18 ISETVVMTWFVMAVLFAFAFVATR-RFERVPSGLQNVTEAIVDEMNGLTAQTMGADKKGFAPYMGTLFLFLLVSNILGIFGLRPPTADVNVTFALALTTFAMIHFFGAKTKGLGTYLKGFLEPFA------------FMLPLNILSELSLPISLAFRLFGNIVGGFIIMALLYG--GLASVSGMIGLESFP--IFAAGIPVALHLYFDLFAGVLQTFIFVMLSMVF 226
>gi|162447842|ref|YP_001620974.1| F-type H+-transporting ATPase a chain [Acholeplasma laidlawii PG-8A] >gi|161985949|gb|ABX81598.1| F-type H+-transporting ATPase a chain [Acholeplasma laidlawii PG-8A] (233 aa)
Score = 143, Expect = 2.6e-07, Identities = 58/232 (25%), Positives = 96/232 (41%)
  Q:    34 IIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEE 265
           IIV+ +++  +++ +  S  K+  N  P  +   I   +          +GK +    P I ++  +IFL NI  +   + PT   TVT A  + + +    +G++ +    F         KT  G          P  I   + P IS+++RL+ NI +GA +L L YA+              GP  ++    A   H   D   G IQ  VFV+LT  + S   E  +
  S:    22 IIVLVVLICSLIIRHKVSKLKIGDN--PGKVMTGIITFVQFMNNYAKNNIGKHWKMLAPIILSLAIFIFLSNISGLFLLDTPTKYATVTLAFAIVSVITIQSVGLRSKGLKHF---------KTLMGPMWWFSPVMIPLNILSDLTPLISMTMRLFGNIASGAAVLTLIYAV-------------SGPATVIAGPVA---HAIFDIGFGVIQTIVFVLLTTVFSSNKIEESD 226
>gi|154484975|ref|ZP_02027423.1| hypothetical protein EUBVEN_02693 [Eubacterium ventriosum ATCC 27560] >gi|149733928|gb|EDM50047.1| hypothetical protein EUBVEN_02693 [Eubacterium ventriosum ATCC 27560] (238 aa)
Score = 143, Expect = 2.9e-07, Identities = 58/230 (25%), Positives = 102/230 (44%)
  Q:    33 SIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTE 262
           S++V  IIM +++V   F  + L      K     +  ++G      Y+++G++  ++ PY+ TV  YI + N+I + G ++PT    VT AL L + +     GI  +    F K   +  I       +M+     P  I ++ +  +S+ +RL+ NI+   +I+ L                    +++   L  VP   + D   G IQA+VFV LT  +   S E
  S:    41 SVVVTWIIMAVLIVAAFFLGRNLKVENVGKR-QLVVETVIGGLHNFFYDMLGEKGKRYIPYMMTVGIYIAISNMIGLFGLKSPTKDVGVTGALALMSIILVEYAGIHQKGVKGFLKSFAEPII-------IML-----PMNILEVFIRPLSLCMRLFGNILGAFVIMELI-------------------KIVAPVLVPVPLSLYFDLFDGFIQAYVFVFLTSLFIKESIE 238
>gi|14715600|gb|AAK72437.1|AF283808_2 ATP synthase subunit a [Clostridium pasteurianum] (227 aa)
Score = 143, Expect = 2.9e-07, Identities = 61/232 (26%), Positives = 106/232 (45%)
  Q:    33 SIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVT--FALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPY-FFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPE 264
           SI++  ++M +++V      + L   K P      +  ++G F  LV + MG ++ KF P+I T+  ++   N+  +VG E  T    VT  FAL  F  +           ++ F K   K Y K     +++ P+    P  + +     IS+ LRL+ N++ G ++LGL Y L + +              +   +  +P H F D   G IQ ++F++LT+ Y     E E
  S:    22 SIVIQWVVMAIIIVLTLILTRNL--KKIPGKRQSILEMIVGFFNNLVNDNMGAKYKKFVPFIGTMGIFMLFLNLSGLVGVEPSTRDINVTAGFALISFVVI----------NANAFIKVGVKGYCK-----ELVKPFPLMLPMNLLEKFTLPISLCLRLFCNMLVGTIVLGLLYQLLVYLGH------------VFAFVIPIPLHFFFDVFDGVIQVYIFMMLTMLYTKMGAEEE 227
>gi|187933625|ref|YP_001884705.1| ATP synthase F0, A subunit [Clostridium botulinum B str. Eklund 17B] >gi|187721778|gb|ACD22999.1| ATP synthase F0, A subunit [Clostridium botulinum B str. Eklund 17B] (226 aa)
Score = 143, Expect = 3.0e-07, Identities = 57/221 (25%), Positives = 95/221 (42%)
  Q:    34 IIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTL 254
           II++ + +T  L+  N   K   PNK    +  F      A  +LV   MG+ ++ F PY+ T+  Y+ L N   +VG + PT   +VT  L + T +      IK      + K     +I               P  I + +M  +S++LRL+ N++A  +++ L Y              + G  +I+        HG+ D   G+IQ  VF +LT+
  S:    28 IIILAVAITAYLLTRNLKQK---PNKKQAALEKF----YEAVTSLVSNTMGESYVGFVPYVGTLIIYLLLLNFTGLVGIKPPTQNLSVTVGLAITTFVVINFTAIKRNGLGGYLKGFGHPFIGML------------PINIMERVMLPVSLALRLFGNMLAATILVDLVYT----ALGHIGMAAQIGLPIIV--------HGYFDLFDGTIQMLVFTMLTI 217
>gi|83816026|ref|YP_445045.1| ATP synthase F0, A subunit [Salinibacter ruber DSM 13855] >gi|83757420|gb|ABC45533.1| ATP synthase F0, A subunit [Salinibacter ruber DSM 13855] (412 aa)
Score = 142, Expect = 3.3e-07, Identities = 63/235 (26%), Positives = 114/235 (48%)
  Q:    28 RSEITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFI------KFTPYIFTVFCYIFLCNIISVVGFENP-TALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALI----LGLFYALPMVMFRR---DPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTE 262
           R  I  ++ + I++ + +       K+ D  + PKG+     N++      V + + K  I       F PY+ T F +I + NI+ +V F    T+   VT  + + T    ++ G     SS +YK L    +       V+I     P  I  ++M  +++++RL+AN+M G+LI    +GL + + ++M        TV+  G     F++F +     L  LV  IQA+VF +L+  +   + E
  S:   145 RHLIFGLLAMLIVLGVFIALAQRYKKEHDRPEAPKGV---FQNMMEVLVVFVRDEIAKPNIPDGKWRTFLPYLLTAFFFILVANILGLVPFAGAATSNIAVTGVMAIMTFSIVLLYG-----SSDYYKEL----LTGPPDAPVLIRIILVPIEIIGLVMRHLALAIRLFANMMGGSLIIFSLIGLVFMMNVIMGEAAAWSTTVISIG-----FTVFIL----LLKLLVAFIQAYVFTILSALFIGMAVE 372
>gi|189465907|ref|ZP_03014692.1| hypothetical protein BACINT_02270 [Bacteroides intestinalis DSM 17393] >gi|189434171|gb|EDV03156.1| hypothetical protein BACINT_02270 [Bacteroides intestinalis DSM 17393] (383 aa)
Score = 142, Expect = 3.6e-07, Identities = 66/241 (27%), Positives = 116/241 (48%)
  Q:    31 ITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKG-IAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVV----GFENPTALTTVTFALGLFTTLGTIILGIK-YQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEEESQVKK 271
           I S++++ II+ +   Y     K    +  P G I F    ++     ++   +G ++ KF PY+ T F +IF+ NI+ ++    G  N T    +T  L LFT +   + G K Y K  F+    +   +        M+P F   FGI     P+ ++ +RL+AN++AG + + +   L  +     P +   G   +   LF + F   L+ LV  IQA+VF +L+  +   + E  +E +VK+
  S:   150 INSVLLLIIILAVAQWY----RKHPQGSAAPGGFIGFMEMFIMMVNDDIIKSCVGPKYRKFAPYLLTAFFFIFINNIMGLIPIFPGGANVTGNIAITMVLALFTFVAVNLFGTKTYWKDIFWPDVPWWLKVPVP-----MMP-FIEFFGI--FTKPF-ALMIRLFANMLAGHMAMLVLTCLIFISASMGPAL--NGTLTVASVLFNI-FMNALELLVAFIQAYVFTMLSAVFIGLAQEEHKEVKVKE 380
>gi|85860964|ref|YP_463166.1| F0F1 ATP synthase subunit A [Syntrophus aciditrophicus SB] >gi|85724055|gb|ABC78998.1| F0F1-type ATP synthase, subunit a [Syntrophus aciditrophicus SB] (251 aa)
Score = 142, Expect = 3.6e-07, Identities = 53/219 (24%), Positives = 102/219 (46%)
  Q:    71 LLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVV-GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEEESQVKKIKKKSPLSELKMSAEKRN 289
           L+ A ++ + E+  ++  ++ P+I T+F +I L N++ +V G+  PTA  T T  L +   +   + GI  Q       +L +++  T         + F PF +       +++++RL+ NIM+G  ++ +  A+  + F   P ++                   L  L+G +QA++F VL + Y + +T+  E    KK +K  P +E      K N
  S:    65 LVSAMRSQIAEVSQEDPDRYLPFIGTLFLFIGLSNVLVIVPGYVAPTASLTTTAVLSISVFIAVPLFGISRQG---LLNYLKEYFQPT---------FIFFPFHVMGEFSRTLALAVRLFGNIMSGDKVVAILLAVTPLFF---PMIMHA-----------------LGLLIGLVQAYIFSVLAMVYIASATQSHE----KKERKDQPEAEDVAQDTKHN 248
>gi|15605749|ref|NP_213126.1| ATP synthase F0 subunit a [Aquifex aeolicus VF5] >gi|3913126|sp|O66566|ATP6_AQUAE ATP synthase a chain (ATPase protein 6) >gi|2982905|gb|AAC06523.1| ATP synthase F0 subunit a [Aquifex aeolicus VF5] (216 aa)
Score = 142, Expect = 3.9e-07, Identities = 60/216 (27%), Positives = 103/216 (47%)
  Q:    50 FSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVV-GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEE 265
           F +K   P+  P      +   L   + ++ E +G+  +K+ P I  +  ++F  NI+ +V GFE PTA      AL L         G +    ++   F+            +M P+FF    I+ I  P I++SLRL+AN+ AGAL+L    +L +    ++P  L   P V++F + A+ F          IQ ++F++L++ Y +G+   EE
  S:    19 FVLKGGKPSLKPTKYQALLEGYLRFVRNMLLENVGERGLKYVPLIAAIGLFVFFGNILGMVPGFEAPTANINTNLALALLVFFYYHFEGFRENGLAYLKHFMGPI--------PLMAPFFFVVEVISHIARP-ITLSLRLFANMKAGALLLLTLVSLVI----KNPFTLVVSPVVLIF-VIAIKFLAIF------IQTYIFMILSVVYIAGAVAHEE 215
>gi|110801683|ref|YP_699468.1| F0F1 ATP synthase subunit A [Clostridium perfringens SM101] >gi|110682184|gb|ABG85554.1| ATP synthase F0, A subunit [Clostridium perfringens SM101] (218 aa)
Score = 141, Expect = 4.1e-07, Identities = 62/224 (27%), Positives = 101/224 (45%)
  Q:    31 ITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPF--HGFLDWLVGSIQAFVFVVLTL 254
           I+S IV      LV+  +     K   NKP K +   + +L      LV   MG+ +I F PYI T+  ++ + N+  ++G   PT   +V  AL + + +   +  I+      + K  FK Y+       VM+P       +  II P +S++LRL+ N++A  L++ L Y+                  +   +   VP   HGF D   G+IQ  VF +LT+
  S:    11 ISSTIVFQWAAMLVITIFAILSTKNLKNKPGK-LQVVLESLYQTVYNLVKSNMGESYIGFVPYIGTLAVFLLVLNLYGLIGLAPPTQDLSVAVALTITSFVVVHVNAIRKCHVGGYIKGYFKPYL-------VMLPLNL----MERIIFP-VSLALRLFGNMLAATLLIDLMYS--------------GLAHIGWIAQLGVPIVAHGFFDVFDGTIQMIVFTMLTM 209
>gi|164421006|ref|YP_001648501.1| ATP synthase F0 subunit 6 [Topsentia ophiraphidites] >gi|158938936|gb|ABW83863.1| ATP synthase F0 subunit 6 [Topsentia ophiraphidites] (244 aa)
Score = 141, Expect = 4.2e-07, Identities = 65/249 (26%), Positives = 108/249 (43%)
  Q:     8 SVITTLQASSAFSDWKPFEYRSEITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           +V+  +   + + DW      S +  ++ +TI   L+        +KL PN+    +     N+    + +V++ +GK   K+ P I ++F +I L NI+ +  +   PTA   VTF L L   +   +LG    K +F         I    G  +M+  F          +  IS+ +RL ANI AG L+  +       M      VL       LF +  + F   L+ +V  IQA+VF++LT  Y
  S:    10 NVVRLITIQAFWGDWLVTFTNSSLMMVLAVTIFRLLL------KGEKLVPNRWQSIMELIYVNI----RAVVHDNLGKSGQKYLPLILSIFIFIALLNILGLFPYVFTPTAHIVVTFGLSLSIIIAVTLLGFITFKGNF-------LSILMPGGVPLMLAPFLVIIETISFTIRAISLGVRLAANITAGHLLFAILSGFAFNMLSNGLIVLS------LFPIIIMIFITLLEIMVALIQAYVFMLLTTIY 236
>gi|186920121|ref|YP_001874775.1| ATP synthase F0 subunit 6 [Hemiselmis andersenii] >gi|186461067|gb|ACC78229.1| ATP synthase F0 subunit 6 [Hemiselmis andersenii] (247 aa)
Score = 141, Expect = 4.5e-07, Identities = 58/227 (25%), Positives = 107/227 (47%)
  Q:    32 TSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWS 258
           T  + +T+++T++   +  S   L PN+  + I    +  +   + ++YE + +    F P IFT+F ++F CN++ +V F    T+    TF+LG+   +G  I+G+K     FF  FL         G+ +M+     P  +   +   +++S+RL+AN+MAG  +L +       M       L     + LF L  +     L+  +  +QA+V+  L   Y S
  S:    29 TFFLCLTLVITILFFTFILSNSTLIPNRW-QSITEMTYEFV---QNMLYEALKERGNYFFPIIFTMFTFVFACNLLGMVPFTFTVTSHIIFTFSLGMIIFVGLNIIGLKQHGLHFFSLFL-------PPGSPLMLALLLVPIELISYVFRVVALSVRLFANMMAGHTLLKILATFAWKMLTIGGIFL----IIQLFPLMIIIAITGLELAIAFLQAYVWTTLICLYLS 241
>gi|75340079|sp|O05330|ATP6_RHOCA ATP synthase a chain (ATPase protein 6) >gi|1934975|emb|CAA72981.1| FoF1 ATP synthase, subunit A [Rhodobacter capsulatus] (237 aa)
Score = 141, Expect = 4.9e-07, Identities = 51/191 (26%), Positives = 90/191 (47%)
  Q:    73 GAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFK---FYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYAL-PMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEP 263
           G    +V ++ GK+ + + PYIFT+F +I   N + ++     PT+   VT  + +   +G   LG     S F   F        ++       +I YF  P          +S S+RL  N+MAG  ++ +F A  P+++F     ++ P   + + +++A      L+ LV  +QA+VF +LT  Y   +  P
  S:    56 GFIHKMVEDVAGKDGLVYFPYIFTLFLFILFSNFLGLIPMAFTPTSHIAVTGVMAMGVFIGVTALGFMKHGSHFLNLFWVSAAPLPLRPILAVIEVISYFVRP----------VSHSIRLAGNMMAGHAVMEVFAAFAPLILFSFVGVIVTPLSVLAIVAMYA------LEILVAFVQAYVFTILTCVYLKDALHP 235
>gi|164420797|ref|YP_001648465.1| ATP synthase F0 subunit 6 [Ephydatia muelleri] >gi|158938913|gb|ABW83841.1| ATP synthase F0 subunit 6 [Ephydatia muelleri] (244 aa)
Score = 141, Expect = 5.0e-07, Identities = 62/249 (24%), Positives = 107/249 (42%)
  Q:     8 SVITTLQASSAFSDWKPFEYRSEITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           +V+  +   +   DW      S +  ++ +TI   L+         KL PN+    +     N+    +++V++ +GK   K+ P++  +F +I + NI+ +  +  +PTA   +TF L L   +   +LG    + +F   F       T  G  +M+            I   IS+ LRL ANI AG L+  +       M      +L       LF +  + F   L+ +V  IQA+VF +LT  Y
  S:    10 NVVRLITIQAFLGDWLVTFTNSSMMMVLAVTIFWLLL------KGDKLIPNRWQSIMELIHLNI----RSVVHDNLGKPGQKYFPFVLCIFLFIAMLNILGLFPYVFSPTAHIVMTFGLSLSIMIAVTLLGFITFRLNFLSIF-------TPGGAPLMLAPLLVLIETVSYITRVISLGLRLAANISAGHLLFAILSGFAFNMLSNGLVILS------LFPMLIMVFITLLEMMVAVIQAYVFCLLTTIY 236
>gi|153815539|ref|ZP_01968207.1| hypothetical protein RUMTOR_01775 [Ruminococcus torques ATCC 27756] >gi|145847181|gb|EDK24099.1| hypothetical protein RUMTOR_01775 [Ruminococcus torques ATCC 27756] (218 aa)
Score = 141, Expect = 5.1e-07, Identities = 57/232 (24%), Positives = 103/232 (44%)
  Q:    31 ITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLF-YALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTE 262
           I+  +V+T I+  VLV  +  + +    + P  +   + +++G  +     I+GKE   + PY+ TV  Y+ + N I ++GF+ PT    VT AL + +       GI       + K   K            +P    P  I +I++  +S+ +RL+ N++AG ++L L  Y +P++                      +P   + D   G +QA+VFV LT  + +   E
  S:    18 ISESVVVTWIIMAVLVLLSIILVRNLKVENPGKVQLALESMIGWAQDFFEGIIGKENKAYVPYLITVLLYLAVSNTIGLLGFKPPTKDLNVTAALAIMSMCVIEFSGIHKNGVVHWMKHFAK-----------PVP-VVAPITILEIVIRPLSLCMRLFGNMLAGFVVLELLKYFVPLIC--------------------PIPVSFYFDIFDGLLQAYVFVFLTALFMTEEME 218
>gi|51244667|ref|YP_064551.1| ATP synthase, A chain [Desulfotalea psychrophila LSv54] >gi|50875704|emb|CAG35544.1| probable ATP synthase, A chain [Desulfotalea psychrophila LSv54] (240 aa)
Score = 140, Expect = 5.8e-07, Identities = 60/224 (26%), Positives = 102/224 (45%)
  Q:    39 IIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFI-KFTPYIFTVFCYIFLCNIISVV-GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTE 262
           ++M  + +   F++  L+   P KG  F+   ++G       + MG+E   KF P I T   YI + N+I ++ GF +PTA    T AL L       ++G K     ++  F+           K ++P    P  +       +S+S+RL+ NIMA  ++LG+ + L  + F   P ++                   L  LV  +QA VFV+LT+ Y++ + E
  S:    42 LVMAFLFLVSKFTLGNLEI-IPGKGQNFWEM-IIGGMDDFFADNMGREMADKFFPMIATFALYIAVANLIGLIPGFMSPTASINTTLALTLIVWATHHVIGFKEHGLGYYKHFIGPM--------KWLVPLML-PIELISNFARLLSLSIRLFGNIMAKEVLLGILFGLAGMFFAPLPIMV-------------------LGVLVSLVQAMVFVLLTVVYFAQAQE 237
>gi|188589169|ref|YP_001919892.1| ATP synthase F0, A subunit [Clostridium botulinum E3 str. Alaska E43] >gi|188499450|gb|ACD52586.1| ATP synthase F0, A subunit [Clostridium botulinum E3 str. Alaska E43] (226 aa)
Score = 140, Expect = 5.9e-07, Identities = 57/221 (25%), Positives = 96/221 (43%)
  Q:    34 IIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTL 254
           II++ + +T  L+  N   K   PNK    +  F   +     +LV   MG+ ++ F PY+ T+  Y+ L N   +VG + PT   +VT  L + T +      IK      + K     +I               P  I + +M  +S++LRL+ N++A  +++ L Y            V + G  +I+        HG+ D   G+IQ  VF +LT+
  S:    28 IIILAVAITAYLLTRNLKQK---PNKKQAALEKFYETV----TSLVSNTMGESYVGFVPYVGTLIIYLLLLNFTGLVGIKPPTQNLSVTVGLAITTFVVINFTAIKRNGLGGYLKGFGHPFIGML------------PINIMERVMLPVSLALRLFGNMLAATILVDLVYK----ALGNIGMVAQIGLPIIV--------HGYFDLFDGTIQMLVFTMLTI 217
>gi|189426191|ref|YP_001953368.1| ATP synthase F0, A subunit [Geobacter lovleyi SZ] >gi|189422450|gb|ACD96848.1| ATP synthase F0, A subunit [Geobacter lovleyi SZ] (230 aa)
Score = 140, Expect = 6.1e-07, Identities = 55/202 (27%), Positives = 93/202 (46%)
  Q:    61 PKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVV-GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTE 262
           P G+  F+  ++   + ++ E MG+    F P I T+  +I + N++ ++ GF  PTA    T A  +   L T ++GIK+    +   F+   +         + P  F    I  +  P +S++LRL+ N+    L+L +F+AL           L P P ++            +  LV  IQAFVF++L + Y  GS E
  S:    54 PSGVQNFMEVVVDGIENMIVETMGEHGRSFFPLIATLAIFILVSNLVGLIPGFYPPTANVNTTAACAIVVFLATHVVGIKHHGFHYLKHFMGPIWW--------LAPLMFFIEVIGHLSRP-VSLTLRLFGNMNGHELVLMIFFAL--------APFLVPLPMML------------MGVLVSFIQAFVFMLLAMIYIQGSLE 227
>gi|110636604|ref|YP_676811.1| ATP synthase, subunit A (H(+)-transporting two-sector ATPase) [Cytophaga hutchinsonii ATCC 33406] >gi|110279285|gb|ABG57471.1| ATP synthase, subunit A (H(+)-transporting two-sector ATPase) [Cytophaga hutchinsonii ATCC 33406] (376 aa)
Score = 140, Expect = 6.2e-07, Identities = 61/232 (26%), Positives = 104/232 (44%)
  Q:    31 ITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFK-TLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVV-GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTE 262
           I++I++I +   +   Y        +  K P G+  F   ++G  +  +  +++G ++ +F PY+ TVF +I+  N++ ++ G  N T   TVT  L   T + T I G  Y      +       ++       +I     PF          S+ +RL+ANI AG +I+  F  L  +      ++    P  + F LF      FL+  V  IQAFVF +LT  Y+  + E
  S:   156 ISAILLIAVFTAVAKGYVK------NKGKAPSGVQSFFEPIVGYVRDEIAVKMIGPKYERFMPYLLTVFFFIWFNNLLGLMPGGANLTGNITVTLVLAGITFIITTINGNGYYWKHVLWTPGVPLPLRIIILPIEIIGLITKPF----------SLMIRLFANITAGHIIILSFIGLIFIF----KSLFLVAPLSVAFGLFMT----FLELFVALIQAFVFTLLTAMYFGSAVE 365
>gi|187777259|ref|ZP_02993732.1| hypothetical protein CLOSPO_00811 [Clostridium sporogenes ATCC 15579] >gi|187774187|gb|EDU37989.1| hypothetical protein CLOSPO_00811 [Clostridium sporogenes ATCC 15579] (226 aa)
Score = 140, Expect = 6.2e-07, Identities = 65/230 (28%), Positives = 114/230 (49%)
  Q:    25 FEYRSEITSII----VITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTL 254
           F Y+  ITS +    VI +I++L+ +    ++KK+ P+K    +      +L + + LV E MG EF KF PY+ T+  Y+ L N++ ++G + PT   ++   + + + +      IK   ++ +     K Y+            F  P  I + IM  +S+SLRL+ N+ A  LI+ L Y+       R  +  +         +  +PFH + D   G+IQ F+FV+LT+
  S:    13 FGYKFGITSTLITQWVIIVIISLMSIILTRNLKKV-PDKKQTIMEI----MLNSVRGLVNENMGPEFKKFVPYVGTLMIYLLLMNLMGLLGLKPPTLDLSLVAGIAVISFIVIQGYAIKKSGATHYLAGYGKPYL------------FLLPLNILERIMLPVSLSLRLFGNMTAAVLIMDLVYS----ALSRVSSFAQ--------LVIPIPFHIYFDLFDGTIQMFIFVMLTM 217
>gi|85860198|ref|YP_462400.1| ATP synthase A chain [Syntrophus aciditrophicus SB] >gi|85723289|gb|ABC78232.1| ATP synthase A chain [Syntrophus aciditrophicus SB] (217 aa)
Score = 140, Expect = 6.4e-07, Identities = 53/202 (26%), Positives = 95/202 (47%)
  Q:    61 PKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVV-GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTE 262
           P     F+  ++G F +LV + MG E  KF P I T+  +I + N++ +V GFE+PTA      A+ +   + T  +GIK     +  +F+   +         ++P       I+ ++ P +S+S+RL+ NI  G +++ + + L           L P P +            FL   +  IQ  VF++L++ Y +G+ E
  S:    41 PGSFQSFMEVVIGGFDSLVTDTMGHEGKKFFPLIATIGLFILVSNLLGLVPGFESPTANLNTNAAMAVVVFILTHYVGIKVHGGKYIKQFMGPVWW--------LVPLMIPIELISHLVRP-LSLSIRLFGNIEGGHIVVAVLFLL--------APFLVPVPIL------------FLKVFISLIQTLVFMLLSMMYIAGAME 214
>gi|126734938|ref|ZP_01750684.1| ATP synthase subunit A [Roseobacter sp. CCS2] >gi|126715493|gb|EBA12358.1| ATP synthase subunit A [Roseobacter sp. CCS2] (248 aa)
Score = 140, Expect = 6.5e-07, Identities = 56/193 (29%), Positives = 91/193 (47%)
  Q:    71 LLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFK---FYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEP 263
           + G    +V ++ GK+ +K+ PYI T+F +I   N ++++    +PT++  VT  LG        ILG      +F   F        ++       +I YF  P          +S S+RL  NIMAG  +L +F     +      T++ P   V +F + A+  +G L+ LV  IQA+VF +LT  Y   +  P
  S:    72 IYGFIYKMVEDVCGKDGVKYFPYIMTLFLFILFSNYLALIPMSYSPTSMIAVTAVLGFGVFFAVTILGFVKNGPAFLGLFWMSDAPAVLRPIIAVIEVISYFVRP----------VSHSIRLAGNIMAGHAVLKVFAGFAAL------TLVSP---VAVFGIVAI--YG-LEVLVCGIQAYVFTILTCVYLKDALHP 246
>gi|53713463|ref|YP_099455.1| ATP synthase A subunit [Bacteroides fragilis YCH46] >gi|60681709|ref|YP_211853.1| putative ATP synthase A chain [Bacteroides fragilis NCTC 9343] >gi|52216328|dbj|BAD48921.1| ATP synthase A subunit [Bacteroides fragilis YCH46] >gi|60493143|emb|CAH07924.1| putative ATP synthase A chain [Bacteroides fragilis NCTC 9343] (383 aa)
Score = 139, Expect = 7.1e-07, Identities = 63/241 (26%), Positives = 115/241 (47%)
  Q:    31 ITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVV----GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPY--FFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEEESQVKK 271
           I S I++ II++   V + +  ++     P   I F    ++     ++   +G  + KF PY+ T F +IF+ NI+ ++    G  N T    +T  L LFT +   I G K+     F+  +  +        KV IP   F   FG+     P+ ++ +RL+AN+++G + + +   L  +     P +   G   +   LF + F   L+ LV  IQA+VF +L+  +   + E  ++ +VK+
  S:   153 INSAILLAIILS---VAHWYRKREQGAYAPGGFIGFMEMFIMMVHDDVIKSCVGPNYKKFAPYLLTAFFFIFINNIMGLIPIFPGGANVTGNIAITLVLALFTFVIVNIFGTKHYWKDIFWPDVPWWL-------KVPIPMMPFIEFFGV--FTKPF-ALMIRLFANMLSGHMAMLVLTCLIFISASMGPAI--NGSLTVASVLFNI-FMNLLEVLVAFIQAYVFTMLSAVFIGLAQEGGKKEEVKE 383
>gi|182420279|ref|ZP_02951508.1| ATP synthase F0, A subunit [Clostridium butyricum 5521] >gi|182375874|gb|EDT73466.1| ATP synthase F0, A subunit [Clostridium butyricum 5521] (226 aa)
Score = 139, Expect = 7.5e-07, Identities = 60/224 (26%), Positives = 101/224 (45%)
  Q:    31 ITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPY-FFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPF--HGFLDWLVGSIQAFVFVVLTL 254
           IT+ ++   ++ LVL   +F + +    KP K +   +  L      LV   MG  ++ F PYI T+  Y+ + N + ++GF+ PT   +VT A  + T L   I  IK    + +             G   M P  F  P  I + ++  +S+SLRL+ N++A  ++L L Y                   + +F+   +P   H + D   G+IQ  VF +LT+
  S:    19 ITTSVITQWVIILVLGIGSFLLTRNLKLKPGK-LQAALEKLYQMIYNLVENTMGSVYLSFLPYIGTLMVYLLVLNFLGLIGFKPPTQDLSVTIAFAIITFLVVNINAIKKNGIADY-------------GKSYMHPVAFMLPINIMEKLVLPVSLSLRLFGNMVAATIVLDLLYT--------------KLGGINMFAQLGLPVVAHVYFDLFDGTIQMLVFSMLTM 217
>gi|91215459|ref|ZP_01252430.1| ATP synthase A subunit [Psychroflexus torquis ATCC 700755] >gi|91186411|gb|EAS72783.1| ATP synthase A subunit [Psychroflexus torquis ATCC 700755] (362 aa)
Score = 139, Expect = 7.7e-07, Identities = 64/235 (27%), Positives = 111/235 (47%)
  Q:    31 ITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVY--EIMGKEFIKFTPYIFTVFCYIFLCNIISVV-GFENPTALTTVTFALGLFTTLGTIILGIK-YQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGF---LDWLVGSIQAFVFVVLTLCYWSGSTEPEE 265
           + S+++  I+M ++ +      KK      PKG    +  L+   +  +   +I  K+F+KF P++ TVF +I++ N++ ++ G  N T   +VT ALGLFT   TI+ G K Y K  F+             G    +        I  + +  I++ +RL+ANI AG +I      L  ++            E    +  +VPF  F   L+ LV  +QAF+F +L+  +   + +  E
  S:   144 VASMLLTVIVMLILFIGLAGHYKK--SKSAPKGFKNILETLVIFVRDEIARPQIGDKKFMKFMPFLLTVFFFIWITNLLGLLPGAANVTGNISVTVALGLFTLALTIVNGNKDYWKHVFWM-----------PGIPTAVKPILAIVEILGVFIKPIALMIRLFANITAGHIITLSLIGLIFIL------------ENAGVAAISVPFAVFITVLELLVAFLQAFIFTLLSALFIGMAVQEHE 360
>gi|193215089|ref|YP_001996288.1| ATP synthase F0, A subunit [Chloroherpeton thalassium ATCC 35110] >gi|193088566|gb|ACF13841.1| ATP synthase F0, A subunit [Chloroherpeton thalassium ATCC 35110] (333 aa)
Score = 139, Expect = 8.7e-07, Identities = 54/217 (24%), Positives = 100/217 (46%)
  Q:    40 IMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFK-TLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALI----LGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           I+ L++       KK+  N+ PKG+A  +  L+   +  +  + +G  + +F P++ T+F +I +CN+I +V +    T    VT  L +FT L T       Q S+     +  F      G   ++     P     +     ++++RL+AN+ AG ++    LGL +     M           P  + F+LF       L+ LV  +QA++F +L+  +
  S:   110 ILLLIMFGVGNQYKKMTKNQAPKGMANLMEVLVDFIRLDVAKQNIGHGYERFMPFLLTIFFFILVCNLIGLVPYSATATGNINVTATLAIFTFLVT-------QASAIRAHGIGGFLAHLTGGTHPLMWIIMVPVEFIGLFTKPFALTVRLFANMTAGHIVIISLLGLIFVFKTYMI---------APVSVAFALFIY----LLEILVAFLQAYIFTLLSALF 312
>gi|154251153|ref|YP_001411977.1| F0F1 ATP synthase subunit A [Parvibaculum lavamentivorans DS-1] >gi|154155103|gb|ABS62320.1| ATP synthase F0, A subunit [Parvibaculum lavamentivorans DS-1] (260 aa)
Score = 138, Expect = 9.0e-07, Identities = 51/186 (27%), Positives = 88/186 (47%)
  Q:    78 LVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEP 263
           +V +  G + ++F P+IF++F +IF  N+I +  +    T+   VTFAL +   LG  + G       F   F+        SG  + +        I       IS S+RL+AN++AG ++L +F    +       T+   G   ++  LF +     L++LV ++QA+VF +LT  Y   +  P
  S:    83 MVRDNAGHDAMRFFPFIFSLFMFIFFANMIGMFPYAFTVTSHIVVTFALAIVVFLGVTLTGFVLHGPRFLKVFV-------PSGVPMALLPLVVAIEIISYFSRPISHSVRLFANMLAGHIMLKVFAGFVLTFM----TMGVVGWAGMILPLFMIVALTALEFLVAALQAYVFTILTCMYLHDALHP 258
>gi|89210209|ref|ZP_01188601.1| H+-transporting two-sector ATPase, A subunit [Halothermothrix orenii H 168] >gi|89160282|gb|EAR79938.1| H+-transporting two-sector ATPase, A subunit [Halothermothrix orenii H 168] (216 aa)
Score = 138, Expect = 9.3e-07, Identities = 60/226 (26%), Positives = 104/226 (46%)
  Q:    33 SIIVITIIMTLVLVYYNFSMKKLD--PNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVV-GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWS 258
           ++IV  +++ L++++     ++L+  P +    +   I ++    +T+    +     KF P+I T+F YI + NII V+ G  NPT     T  L L   L +   G++ +     + +L  F      G  V+   F  P  I   +   IS S RL+ NI+AG ++LG       ++F+  P             L  VP H + D  +G +QA +F +L + Y S
  S:    19 TLIVSWVVVILLIIFSKIVTRRLEMVPGRLQSAVELLITSIEDQIETM----LPGRGSKFLPFIATIFIYIGVSNIIGVIPGVANPTGDLNTTLGLALVVFLVSQYYGVRKKG---LWGYLKGF------GEPVV---FMLPINIIGELAKPISHSFRLFGNIVAGGILLG-------IVFQFAPW------------LIPVPLHAWFDLFIGLVQALIFGMLAIAYIS 212
>gi|62161297|ref|YP_214863.1| ATP synthase F0 subunit 6 [Axinella corrugata] >gi|55275028|gb|AAV49306.1| ATP synthase F0 subunit 6 [Axinella corrugata] (244 aa)
Score = 138, Expect = 9.5e-07, Identities = 63/249 (25%), Positives = 109/249 (43%)
  Q:     8 SVITTLQASSAFSDWKPFEYRSEITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           +VI  +   +   DW      S +   +V+T++  L+         KL PN+    +     N+    +++V++ +GK   K+ P++ ++F +I + NI+ +  +   PTA   +TF L L   +   +LG    K +F         I    G  +M+  F         ++  IS+ +RL ANI AG L+  +       M      VL       LF +  + F   L+ +V  IQA+VF +LT  Y
  S:    10 NVIRLITIQAFLGDWLVTFTNSAMMMGLVVTMVWLLL------KGDKLIPNRWQSVVELIHLNI----RSVVHDNLGKXGQKYFPFVLSLFIFIAILNILGLFPYVFTPTAHIVMTFGLSLSILIAVTLLGFTTFKLNF-------LSILMPGGVPLMLAPFLVGIETLSYMIRAISLGVRLAANISAGHLLFAILSGFTFNMLSNGLVVLS------LFPMLILVFITLLEMMVAVIQAYVFCLLTTIY 236
>gi|16124623|ref|NP_419187.1| F0F1 ATP synthase subunit A [Caulobacter crescentus CB15] >gi|13421523|gb|AAK22355.1| ATP synthase F0, A subunit [Caulobacter crescentus CB15] (253 aa)
Score = 137, Expect = 1.2e-06, Identities = 51/186 (27%), Positives = 83/186 (44%)
  Q:    71 LLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           L G    L   I+G +  KF P+IFT+F ++   N+  +      T+   VT  LGL   L  + +G       FF  F         SG    + +   P  I   ++  I++ LRL+ N++ G ++L +F    +V       +   G  + L S+ A+     L+++V  +QAFVF VL   Y
  S:    69 LYGLVDGLAESIIGHDGKKFLPFIFTLFAFVLFMNVQGMFLVFTATSQLAVTLTLGLMVILTVVAVGFAKNGLKFFKLF-------APSGVPWPLYFLLVPIEILSFLIRPITLGLRLFGNMLGGHVVLKIFAGF-VVALGGLGVLGWAGAALALTSVVALT---ALEFMVAFLQAFVFAVLACVY 243
>gi|163744750|ref|ZP_02152110.1| F0F1 ATP synthase subunit A [Oceanibulbus indolifex HEL-45] >gi|161381568|gb|EDQ05977.1| F0F1 ATP synthase subunit A [Oceanibulbus indolifex HEL-45] (253 aa)
Score = 137, Expect = 1.3e-06, Identities = 54/191 (28%), Positives = 86/191 (45%)
  Q:    73 GAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFK---FYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEP 263
           G    +V +I GKE +KF PYI T+F +I + N + ++     PTA  +VT  L L   +   ++G     ++F   F        ++       +I YF  P          +S S+RL  N+MAG  ++ +F     +       V+ P       S+ A+     L+ LV  IQA+VF +LT  Y   +  P
  S:    79 GFIYKMVEDICGKEGLKFFPYIMTLFMFIVMANFLGLIPTAFTPTAHFSVTVVLALAVFITVTVVGFVKNGAAFLSLFWVSSAPLALRPVLAIIELISYFVRP----------VSHSIRLAGNVMAGHAVIKVFAGFAAI------AVISP------VSVLAITAMYGLEVLVAFIQAYVFTILTCVYLKDALHP 251
>gi|117927855|ref|YP_872406.1| F0F1 ATP synthase subunit A [Acidothermus cellulolyticus 11B] >gi|117648318|gb|ABK52420.1| ATP synthase F0, A subunit [Acidothermus cellulolyticus 11B] (271 aa)
Score = 137, Expect = 1.3e-06, Identities = 57/227 (25%), Positives = 98/227 (43%)
  Q:    35 IVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKF-TPYIFTVFCYIFLCNIISVV------GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGST 261
           I+ ++I  +++V     M+    +  P  +      L+      V E MG     F  P   T+F YI LCN I V+          PTA   +T  L L   +   I+ +K +    + +  F+ Y              F P  + + +   I+++LRL+ NI +GA+++ L   +P              P V+    +       +D  VG IQAF+F +LT+ Y++ +T
  S:    34 ILTSVIAGVIVVGLGLYMRWTARSGVPSKMQLLFEMLVSWVNRQVEESMGLRVAPFVAPMAVTLFVYILLCNWIGVLPSGHPEHLPAPTADINLTLTLALVVIVPMHIVSLKRRGLGRYIRHYFEPY------------KIFFPINVVEELAKPITLALRLFGNIFSGAIMVSLLALMP--------------PYVLWLPQW---LWKLIDLGVGVIQAFIFALLTILYYAFAT 238
>gi|84515975|ref|ZP_01003336.1| ATP synthase subunit A [Loktanella vestfoldensis SKA53] >gi|84510417|gb|EAQ06873.1| ATP synthase subunit A [Loktanella vestfoldensis SKA53] (250 aa)
Score = 137, Expect = 1.3e-06, Identities = 51/193 (26%), Positives = 87/193 (45%)
  Q:    71 LLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFK---FYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEP 263
           + G    ++ +I GK+ +K+ PYI T+F +I   N I+++    +PT++  VT  LG  + +   ILG     +SF   F       +++       +I Y   P          +S+S+RL  NI AG ++L +F     +       +L             +  +G L+ LV  IQA+VF +L   Y   +  P
  S:    74 MYGFIYKMIEDITGKDGVKYFPYIMTLFVFILFANFIALIPMSYSPTSMIAVTATLGFGSFVAITILGFVKHGASFLKLFWMSDAPLFLRPIIAVIEVISYLVRP----------VSLSIRLGGNIAAGHVVLKVFAGFAALAVASPAAILG-----------IIAIYG-LEVLVAGIQAYVFTILICVYLKDALHP 248
>gi|153853578|ref|ZP_01994958.1| hypothetical protein DORLON_00948 [Dorea longicatena DSM 13814] >gi|149753733|gb|EDM63664.1| hypothetical protein DORLON_00948 [Dorea longicatena DSM 13814] (234 aa)
Score = 137, Expect = 1.4e-06, Identities = 55/229 (24%), Positives = 103/229 (44%)
  Q:    34 IIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFY-ALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTE 262
           ++V  IIM ++ +     ++ L   KP K +   + +++G  +     I+GKE   + PY+ TV  Y+ + N+I ++GF+ PT    VT AL + +       GI       + K   K            +P    P  I +I++  +S+ +RL+ N++ G +++ L    +P+++                     +PF  + D   G +QA+VFV LT  + +   E
  S:    38 VVVTWIIMAVLTILSIVFVRNLSIEKPGK-VQLMLESVIGWAQDFFEGIIGKENKGYIPYLMTVALYLAISNVIGLLGFKPPTKDMNVTIALAVMSMFVIEWSGIHRNGLVHWCKHFAK-----------PVP-IVAPIMILEIVIRPLSLCMRLFGNMLGGFVVMELIKEVVPLIV--------------------PIPFSFYFDIFDGLLQAYVFVFLTALFMTEEME 234
>gi|39995443|ref|NP_951394.1| ATP synthase F0, A subunit [Geobacter sulfurreducens PCA] >gi|39982206|gb|AAR33667.1| ATP synthase F0, A subunit [Geobacter sulfurreducens PCA] (229 aa)
Score = 137, Expect = 1.5e-06, Identities = 58/202 (28%), Positives = 94/202 (46%)
  Q:    61 PKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVV-GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTE 262
           P G+  F+  ++G  + +V E MG++   + P I T+  ++ + N+I ++ GF  PTA    T A  +   L T I+GIK     +   F+   +         + P  F    I  +  P +S+SLRL+ N+    L+L +F+AL           L P P ++            +  LV  IQAFVF++L + Y  GS E
  S:    53 PTGMQNFMEVVIGGIENMVEETMGEKGKPYFPLIATLALFVLVSNLIGLIPGFFPPTANLNTTAACAVIVFLSTHIVGIKKHGFHYLQHFMGPIWW--------LAPLMFFIEIIGHLSRP-LSLSLRLFGNMNGHELVLMIFFAL--------APFLVPLPMML------------MGVLVSFIQAFVFMLLAMIYIQGSLE 226
>gi|167762918|ref|ZP_02435045.1| hypothetical protein BACSTE_01282 [Bacteroides stercoris ATCC 43183] >gi|167699258|gb|EDS15837.1| hypothetical protein BACSTE_01282 [Bacteroides stercoris ATCC 43183] (391 aa)
Score = 136, Expect = 1.6e-06, Identities = 62/241 (25%), Positives = 112/241 (46%)
  Q:    31 ITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVV----GFENPTALTTVTFALGLFTTLGTIILGIK-YQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEEESQVKK 271
           I S+++I I++++   Y        D   P   + F    ++     ++   +G ++ KF PY+ T F +IF+ N++ ++    G  N T    +T  L + T L   I G K Y K  F+    +   +        M+P F   FGI     P+ ++ +RL+AN++AG + + +   L  +     P +   G   +   LF +  +G L+ LV  IQA+VF +L+  +   + E   E   +K
  S:   157 INSVLLIVIVLSVARWYRRHPQ---DSAAPGGFVGFMEMFIMMVNDDVIKSCVGPKYRKFAPYLLTAFFFIFINNLMGLIPVFPGGANVTGNIAITMVLAVCTFLAVNIFGTKAYWKDIFWPDVPWWLKVPVP-----MMP-FIEFFGI--FTKPF-ALMIRLFANMLAGHMAMLVLTCLIFISASMGPAL--NGSLTVASVLFNIFMNG-LELLVAFIQAYVFTMLSAVFIGLAQEEHTEKAGEK 387
>gi|118445006|ref|YP_879002.1| F0F1 ATP synthase subunit A [Clostridium novyi NT] >gi|118135462|gb|ABK62506.1| ATP synthase F0, A subunit [Clostridium novyi NT] (228 aa)
Score = 136, Expect = 1.7e-06, Identities = 60/228 (26%), Positives = 104/228 (45%)
  Q:    27 YRSEITSIIVI----TIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTL 254
           Y+  I++I+VI     +I  L+ +     +KK+ P K    +  F+       K ++  IMG+E + FTPYI T+  ++ + N+  +VG E PT   +VT  +   + +      IK Q    + K            N + + +   P  I + +M  +S+SLRL+ N+ A  +I+ L Y     +         P P  I      +P H + D   G +Q  +F +LT+
  S:    14 YKIAISNIVVIQWAIILITLLICIMVTRKLKKI-PGKRQTAVEMFV----SGIKDIIKNIMGEEAVVFTPYIGTLVIFLLVMNLAGLVGIEPPTKDFSVTCGVAAISFIVIQAYAIKKQGLGGYLK---------GYTNPIWVLF---PINIMERVMLPVSLSLRLFGNMTAAVVIMDLVYKGLSSL---------PLPFGIAQLGIPIPLHFYFDVFDGGLQMIIFTMLTM 219
>gi|23464599|ref|NP_696967.1| ATP synthase F0 subunit 6 [Monosiga brevicollis ATCC 50154] >gi|23344062|gb|AAN28338.1| ATP synthase F0 subunit 6 [Monosiga brevicollis] (252 aa)
Score = 136, Expect = 1.7e-06, Identities = 54/176 (30%), Positives = 86/176 (48%)
  Q:    85 KEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFA---VPFHGFLDWLVGSIQAFVFVVLTLCYWSGS 260
           KE   + P+I TVF +I L N+  ++ +  +PTA   VTF L L   +G  +LG+    S++F  F+        +G+ +++  F     +       +S+ +RL ANI AG ++  +       M       L  G  +I+ SLF    V F   ++  V  IQA+VF +LT  Y S S
  S:    83 KESQAYFPWILTVFMFIVLMNLFGIIPYTFSPTAHIAVTFGLSLSIFIGVTLLGMVNHGSNYFSMFM-------PAGSPLILAPFMIVIELISHTAKAVSLGVRLAANITAGHILFAILSGFTWTM-------LTSGGFMIIASLFPMAIVLFITIIEMAVAVIQAYVFSLLTAIYISES 248
>gi|18311175|ref|NP_563109.1| F0F1 ATP synthase subunit A [Clostridium perfringens str. 13] >gi|110798805|ref|YP_696872.1| F0F1 ATP synthase subunit A [Clostridium perfringens ATCC 13124] >gi|168205570|ref|ZP_02631575.1| ATP synthase F0, A subunit [Clostridium perfringens E str. JGS1987] >gi|168210123|ref|ZP_02635748.1| ATP synthase F0, A subunit [Clostridium perfringens B str. ATCC 3626] >gi|168213703|ref|ZP_02639328.1| ATP synthase F0, A subunit [Clostridium perfringens CPE str. F4969] >gi|168215822|ref|ZP_02641447.1| ATP synthase F0, A subunit [Clostridium perfringens NCTC 8239] >gi|169344221|ref|ZP_02865203.1| ATP synthase F0, A subunit [Clostridium perfringens C str. JGS1495] >gi|182624002|ref|ZP_02951790.1| ATP synthase F0, A subunit [Clostridium perfringens D str. JGS1721] >gi|18145858|dbj|BAB81899.1| ATP synthase A chain [Clostridium perfringens str. 13] >gi|110673452|gb|ABG82439.1| ATP synthase F0, A subunit [Clostridium perfringens ATCC 13124] >gi|169297680|gb|EDS79780.1| ATP synthase F0, A subunit [Clostridium perfringens C str. JGS1495] >gi|170662935|gb|EDT15618.1| ATP synthase F0, A subunit [Clostridium perfringens E str. JGS1987] >gi|170711741|gb|EDT23923.1| ATP synthase F0, A subunit [Clostridium perfringens B str. ATCC 3626] >gi|170714799|gb|EDT26981.1| ATP synthase F0, A subunit [Clostridium perfringens CPE str. F4969] >gi|177910895|gb|EDT73249.1| ATP synthase F0, A subunit [Clostridium perfringens D str. JGS1721] >gi|182382385|gb|EDT79864.1| ATP synthase F0, A subunit [Clostridium perfringens NCTC 8239] (224 aa)
Score = 136, Expect = 1.7e-06, Identities = 60/223 (26%), Positives = 103/223 (46%)
  Q:    32 TSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPF--HGFLDWLVGSIQAFVFVVLTL 254
           ++II     M L++V+   S + L  NKP K +   + ++      LV   MG+ +I F PYI T+  ++ + N   ++G   PT   +V  AL + + +   +  I+      + K  FK Y        +M+P       +  II P +S++LRL+ N++A  L++ L Y+                  +  F+   +P   HGF D   G+IQ  VF +LT+
  S:    19 STIIFQWAAMLLIIVFALLSTRNLK-NKPGK-LQVVLESIYQTVYNLVKSNMGESYIGFVPYIGTLAIFLLVLNFYGLIGLAPPTQDLSVAVALAITSFVVVHVNAIRRCHIGGYIKGYFKPY-------PLMLPLNL----MERIIFP-VSLALRLFGNMLAATLLIDLMYS--------------GLGHISWFAQLGMPILAHGFFDVFDGTIQMIVFTMLTM 215
>gi|149277106|ref|ZP_01883248.1| ATP synthase, subunit A (H(+)-transporting two-sector ATPase) [Pedobacter sp. BAL39] >gi|149231983|gb|EDM37360.1| ATP synthase, subunit A (H(+)-transporting two-sector ATPase) [Pedobacter sp. BAL39] (377 aa)
Score = 136, Expect = 1.8e-06, Identities = 68/248 (27%), Positives = 117/248 (47%)
  Q:    15 ASSAFSDWKPFEYRSEITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKT-LVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVV----GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGIT----DIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTE 262
           AS+A  D   F     + ++ V   ++ +V V    + +K    K PKG+  F+  ++   +  +    +G ++ KF PY+ TVF +I++ NI+ ++    G  N T    +TF L LFT +   I G K+     ++K +F             +P++  P  +      II    ++ +RL+ANI AG +I+    +L  +        L   P  I F LF       L+ LV  +QAF+F +LT  +   + E
  S:   146 ASAAVLD---FSITKNVAAMFVAIAVILIVFVSVAAAYRK-RVGKAPKGLQSFVEPIIIFVRDDIARPNIGHKYAKFMPYLLTVFFFIWINNILGLIPIFPGGANVTGNIALTFVLSLFTMIVVNINGNKH-----YWKHIF----------LPNVPFWLWPLMVVVEVIGIISKPFALMIRLFANITAGHIIVLSLISLIFIF-----KTLAIAPVSIAFVLFM----DVLELLVAFLQAFIFTLLTALFIGMAVE 374
>gi|163814615|ref|ZP_02206004.1| hypothetical protein COPEUT_00766 [Coprococcus eutactus ATCC 27759] >gi|158450250|gb|EDP27245.1| hypothetical protein COPEUT_00766 [Coprococcus eutactus ATCC 27759] (190 aa)
Score = 136, Expect = 1.9e-06, Identities = 44/192 (22%), Positives = 90/192 (46%)
  Q:    71 LLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTE 262
           ++  F  L   ++G+  +K+ PY+ TV  YI + NI+ V GF+ PT    VT +L + + +   + GI+ + +        K ++K+ +    ++     P  + ++++  +S+ +RL+ N++   +I+ L                    E ++  +  +P   + D+  G +QAFVF  LT  Y   + E
  S:    30 IITTFNNLFKGVIGEAGMKYVPYLITVILYIGMANIMGVFGFKPPTKDLNVTASLAIMSIVLVQVAGIRGKGT--------KGWVKSFAEPVAIVA----PLNVLELVIKPLSLCMRLFGNVLGAFVIMKLI-------------------EAVVPLIVPIPLSLYFDFFDGFLQAFVFTFLTTLYMQEAME 190
>gi|83941577|ref|ZP_00954039.1| ATP synthase subunit A [Sulfitobacter sp. EE-36] >gi|83847397|gb|EAP85272.1| ATP synthase subunit A [Sulfitobacter sp. EE-36] (262 aa)
Score = 135, Expect = 2.1e-06, Identities = 53/191 (27%), Positives = 83/191 (43%)
  Q:    73 GAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFK---FYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEP 263
           G    +V +I GKE +K+ PYI T+F +I   N + ++     PT+  +VT  +      G  ILG     +SF   F        ++       +I YF  P          +S S+RL  N+MAG  ++ +F     +              +  FS+ A+     L+ LV  IQA+VF +LT  Y   +  P
  S:    88 GFIYKMVEDICGKEGVKYFPYIMTLFMFIVFSNFLGLLPMAFTPTSHISVTAVMAFAVFFGVTILGFVKNGASFLSLFWVSSAPLALRPVLAVIELISYFVRP----------VSHSIRLAGNMMAGHAVIKVFAGFAALAA------------IAPFSVLAITAMYGLEVLVSFIQAYVFAILTCVYLKDALHP 260
>gi|83855054|ref|ZP_00948584.1| ATP synthase subunit A [Sulfitobacter sp. NAS-14.1] >gi|83842897|gb|EAP82064.1| ATP synthase subunit A [Sulfitobacter sp. NAS-14.1] (259 aa)
Score = 135, Expect = 2.1e-06, Identities = 53/191 (27%), Positives = 83/191 (43%)
  Q:    73 GAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFK---FYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEP 263
           G    +V +I GKE +K+ PYI T+F +I   N + ++     PT+  +VT  +      G  ILG     +SF   F        ++       +I YF  P          +S S+RL  N+MAG  ++ +F     +              +  FS+ A+     L+ LV  IQA+VF +LT  Y   +  P
  S:    85 GFIYKMVEDICGKEGVKYFPYIMTLFMFIVFSNFLGLLPMAFTPTSHISVTAVMAFAVFFGVTILGFVKNGASFLSLFWVSSAPLALRPVLAVIELISYFVRP----------VSHSIRLAGNMMAGHAVIKVFAGFAALAA------------IAPFSVLAITAMYGLEVLVSFIQAYVFAILTCVYLKDALHP 257
>gi|83951209|ref|ZP_00959942.1| ATP synthase subunit A [Roseovarius nubinhibens ISM] >gi|83839108|gb|EAP78404.1| ATP synthase subunit A [Roseovarius nubinhibens ISM] (258 aa)
Score = 135, Expect = 2.3e-06, Identities = 60/229 (26%), Positives = 106/229 (46%)
  Q:    35 IVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVV-GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFK---FYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYAL-PMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEP 263
           +V+T++    L+    S + + P++  + IA   +   G  + +V ++ GK+ + + PYI T+F +I   N + ++ G   PT+   VT  L +   L   ++G     + F   F        ++       +I YF  P          +S S+RL  N+MAG  ++ +F A  PM++      +L     V   S+ A+     L+ LV  IQA+VF +LT  Y   +  P
  S:    42 MVMTVLAATALLVLGTSGRSVIPSRI-QSIAELCY---GFIRKMVEDVAGKDALPYFPYIMTLFVFIIFANFLGLLPGAFTPTSHIAVTAILAMAVFLTVTVMGFVKNGAGFLGLFWVSSAPLPLRPVLALIEVISYFVRP----------VSHSIRLAGNMMAGHAVIKVFAAFAPMILLSTGLGLL-----VTPLSILAITAVYALEVLVAFIQAYVFTILTCVYLKDALHP 256
>gi|11467584|ref|NP_043730.1| H(+)-transporting ATPase, F0 subunit 6 [Allomyces macrogynus] >gi|1703473|sp|P50364|ATP6_ALLMA ATP synthase subunit a (ATPase protein 6) >gi|459017|gb|AAA64932.1| subunit 6 of the ATPase complex >gi|1236414|gb|AAC49231.1| H(+)-transporting ATPase, F0 subunit 6 [Allomyces macrogynus] (262 aa)
Score = 135, Expect = 2.3e-06, Identities = 59/228 (25%), Positives = 105/228 (46%)
  Q:    29 SEITSIIVITIIMTLVLVYYNFSMKK--LDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           + +T+I ++ II  LVL  +  S     + P +    +  ++ ++LG  K  +        I F P IFT F ++F+ NI+ ++ +   PT+  +VT  L +   +G  ++G    +  FF  F+ K       G  + +                 S++LRL AN+ AG  + G+  AL +       ++L  G  + L     V  +G L+ LV  +Q++VF +LT  Y
  S:    31 TSLTNIAILFIIGLLVLTIFQISASSHLIKPTRWNIVLETWVASILGIVKDQIGNDAKNSLIYF-PLIFTFFSFVFISNILGMIPYSFTPTSHISVTLGLSIAIMIGVTLIGFSKHQLDFFSLFVPK-------GTPLALVPLLVLIEFISYSARAFSLALRLTANVSAGHCLFGVISALSVSACIAVSSLLLKGITITLPLAVLVVLYG-LELLVALLQSYVFTLLTCSY 252
>gi|161485733|ref|NP_660927.2| F0F1 ATP synthase subunit A [Chlorobium tepidum TLS] (352 aa)
Score = 135, Expect = 2.5e-06, Identities = 54/226 (23%), Positives = 104/226 (46%)
  Q:    31 ITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEI-MGKEFIKFTPYIFTVFCYIFLCNIISVVGF-ENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGF---LDWLVGSIQAFVFVVLTLCY 256
           +  I +  I++ ++      S+KK+  N+ PKG+A    +L+      V +  +G  + KF PY+ TVF +I +CN++ ++ +    T    VT  L +FT + T     K Q    + + L        +G    +     P  I        ++++RL+AN+ AG +I+   + +  ++              I+    ++PF  F   L+  V  +QA+VF +L+  +
  S:   112 VVMIWLAAILLVVIASAAGASVKKMSANQAPKGVANVFESLVDFISNDVAKPNIGHGYEKFLPYLLTVFFFILVCNLLGLIPYGATATGNINVTLTLSVFTFVITQFSAFKAQGVKGYLQHL-------TAGTHWALWIIMVPIEILGQFTKPFALTIRLFANMTAGHIIILSLFFISFIL-----------KSYIVAVAVSIPFAIFIYLLELFVAFLQAYVFTMLSALF 324
>gi|159042994|ref|YP_001531788.1| F0F1 ATP synthase subunit A [Dinoroseobacter shibae DFL 12] >gi|157910754|gb|ABV92187.1| ATP synthase F0, A subunit [Dinoroseobacter shibae DFL 12] (229 aa)
Score = 135, Expect = 2.6e-06, Identities = 58/229 (25%), Positives = 100/229 (43%)
  Q:    33 SIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVV-GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGST 261
           +I+   IIM ++        + L P+ PP      +  ++G     + EI  +   +   +  T+F +I   N+++VV GF+ PTA  + T AL L   +   + GI  +            Y++T     V++     PF I   +   IS+++RL+ NIM+GA+I  +   +    F   P V++                  L  L G IQA++F +L   Y S +T
  S:    21 TIVNTWIIMAVLTGTAALVTRNLRPDVPPNRWRTTLEVIVGGIVGQIAEITERRDPRILYFSGTLFLFIVTANLLTVVPGFDTPTASLSTTVALALSVLIAVPLFGIGSRG--------LGGYLRTYLEPSVIML----PFNIISEVSRGISLAIRLYGNIMSGAVIAAILLGVAPFFF---PVVMD-----------------MLGLLTGVIQAYIFAILATVYISSAT 218
>gi|145932341|ref|YP_001165389.1| ATP synthase F0 subunit 6 [Phytophthora sojae] >gi|110169584|gb|ABG54050.1| ATP synthase F0 subunit 6 [Phytophthora sojae] (239 aa)
Score = 134, Expect = 2.6e-06, Identities = 57/179 (31%), Positives = 82/179 (45%)
  Q:    78 LVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPG--PEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           L Y  +GK    F   IF VF +I LCN+I +V +    T+   +TF L L   LG  I+GIK  K +F    L        SG  + +     P  +   I   IS+ +RL+AN+MAG  +L +       M   +  +      P +I+  L        L+  V  IQA+VF +LT  Y
  S:    63 LTYSSIGKAGKHFVSLIFVVFFFILLCNLIGMVPYSFTVTSHLIITFTLALTIYLGFNIIGIKKHKLNFLNLLL-------PSGASIALVPILIPIELVSYIFRVISLPVRLFANMMAGHTLLKVIAGFAWTMLNVNSFIFMAHFIPLIIIVLLVG------LEIAVALIQAYVFTILTCMY 231
>gi|78224549|ref|YP_386296.1| H+-transporting two-sector ATPase, A subunit [Geobacter metallireducens GS-15] >gi|78195804|gb|ABB33571.1| H+-transporting two-sector ATPase, A subunit [Geobacter metallireducens GS-15] (229 aa)
Score = 134, Expect = 2.8e-06, Identities = 57/202 (28%), Positives = 94/202 (46%)
  Q:    61 PKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVV-GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTE 262
           P G+  F+  ++G  + +V E MG++   + P I T+  ++ + N+I ++ GF  PTA    T A  +   L T ++GIK     +   F+   +         + P  F    I  +  P +S+SLRL+ N+    L+L +F+AL           L P P ++            +  LV  IQAFVF++L + Y  GS E
  S:    53 PTGMQNFMEVVVGGIENMVEETMGEKGRPYFPLIATLALFVLVSNLIGLIPGFFPPTANLNTTAACAIIVFLSTHVVGIKKHGFHYLQHFMGPIWW--------LAPLMFFIEIIGHLSRP-LSLSLRLFGNMNGHELVLMIFFAL--------APFLVPLPMML------------MGVLVSFIQAFVFMLLAMIYIQGSLE 226
>gi|164420943|ref|YP_001648456.1| ATP synthase F0 subunit 6 [Amphimedon compressa] >gi|158668067|gb|ABW76531.1| ATP synthase F0 subunit 6 [Amphimedon compressa] (241 aa)
Score = 134, Expect = 3.3e-06, Identities = 56/220 (25%), Positives = 99/220 (45%)
  Q:    37 ITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           + +++ + + +      KL PN+    +     N+    +T+V + +GK   K+ P++ ++F +I L N++ +  +   PTA   VTF L L   +G  ILG+   KS+F         I   +G  +++  F         I   +S+ +RL AN+ AG L+  +       M     +V         F +  + F   L+  V  IQA+VF +LT  Y
  S:    33 MMMVLAVTIFWLLLKGDKLIPNRWQSIMELIHLNI----RTVVDDNLGKPGQKYFPFVLSLFLFIALLNVLGLFPYVFTPTAQIVVTFGLSLSIIIGVTILGLTAFKSNF-------LSILVPNGAPLVLAPFLVLIETIGYISRAVSLGMRLAANLTAGHLLFAIVSGFAFNMLSGALSV---------FPMLIMMFITILEMAVAIIQAYVFCLLTAIY 233
>gi|170747148|ref|YP_001753408.1| ATP synthase F0, A subunit [Methylobacterium radiotolerans JCM 2831] >gi|170653670|gb|ACB22725.1| ATP synthase F0, A subunit [Methylobacterium radiotolerans JCM 2831] (251 aa)
Score = 133, Expect = 3.6e-06, Identities = 47/185 (25%), Positives = 90/185 (48%)
  Q:    79 VYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENP-TALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLF-YALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEP 263
           V++  G    +F P +F++F ++ + N+  ++ +    T+   +TF L        +I G+    + FF  F+        SG    +     P  +   I   IS+S+RL+AN++AG + + +F + +  ++     +VL P P  +  +L A      L++LV ++QA+VF  LT  Y + +  P
  S:    76 VHQATGDGGKRFMPLVFSLFMFVLVLNLFGMIPYAFAVTSHLIITFGLAALVISTVVIFGVMKHGTHFFGLFV-------PSGVPKPLLAILVPIEVISFISRPISLSVRLFANMLAGHIAMKIFAFFVVQLLLAGAWSVLSPLPLFLTIALTA------LEFLVAALQAYVFATLTAIYLNDALHP 249
>gi|14010339|gb|AAK51957.1|AF362012_1 ATP synthase F0 subunit 6 [Cliona sp. RFW-2001] (216 aa)
Score = 133, Expect = 3.9e-06, Identities = 53/181 (29%), Positives = 84/181 (46%)
  Q:    76 KTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGIT----DIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           +++V + +G+   K+ P++  +F +I + NI+ +  +   PTA   +TF L L   +  I+LG        F  F   F      G    +P    PF +       ++  IS+ +RL ANI AG L+ G+       M      VL   P +IL       F   L+ +V  IQA+VF +LT  Y
  S:    40 RSVVQDNLGRSGQKYFPFVLCLFLFIVMLNILGLFPYIFTPTAHIVITFGLSLSIIIAVILLG--------FINFKLNFLSMLMPGG---VPLGLAPFLVIIETLSFMVRAISLGVRLAANISAGHLLFGIISGFAFTMLSSGLMVLSVFPVIILV------FITLLEIMVAVIQAYVFCLLTTIY 208
>gi|160893779|ref|ZP_02074563.1| hypothetical protein CLOL250_01333 [Clostridium sp. L2-50] >gi|156864764|gb|EDO58195.1| hypothetical protein CLOL250_01333 [Clostridium sp. L2-50] (192 aa)
Score = 133, Expect = 4.3e-06, Identities = 43/187 (22%), Positives = 86/187 (45%)
  Q:    70 NLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           +++  F  L  ++MG++   + PY+ TV  YI + NI  + GF+ PT    VT AL + + +   ++ I+ +          K ++K+ +    ++     P  + +I++  +S+ +RL+ N++   +++ L  A+  V                   +  +P   + D   G +QAFVF  LT  Y
  S:    29 SIITTFNNLFSDVMGEKGKAYIPYLITVILYIGMANIAGIFGFKPPTKDLNVTAALAIMSIVMVQVVCIRSRGP--------KGWLKSFAEPVAIVA----PINVMEIVIKPLSLCMRLFGNVLGAFVVMKLIEAVAPV-------------------IVPIPLSLYFDIFDGLLQAFVFTFLTALY 184
>gi|124004913|ref|ZP_01689756.1| ATP synthase A subunit [Microscilla marina ATCC 23134] >gi|123989591|gb|EAY29137.1| ATP synthase A subunit [Microscilla marina ATCC 23134] (358 aa)
Score = 133, Expect = 4.4e-06, Identities = 66/234 (28%), Positives = 110/234 (47%)
  Q:    25 FEYRSEITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGI-AFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVV-GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFY----KFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWS 258
           F     + S+ V   ++  V    +   KK    K P+GI +FF   ++     +  E +G ++ +FTPY+ TVF +I+  N++ ++ G  N T    VT  L + T + T +   K   +  F     K L+   +  +     +I  F  PF          S+ +RL+ANI AG +I+   + L  +        L  G   ++ + FA  F  FL+ LV  IQA+VF +L+  Y+S
  S:   128 FSITKNVASLFVSVALLFFVFFSVSKGYKK-RAGKAPRGIQSFFEPIIIFVRDDIAKENIGPKYERFTPYLLTVFFFIWFNNMLGLLPGAANLTGNIAVTLVLSVITFVITTLSANKNYWAHIFTPPVPKLLYIILVPIE-----IIGMFTKPF----------SLMIRLFANITAGHIIMLSLFGLIFIF-----QSLAVG---VVSTAFAT-FMNFLELLVAFIQAYVFTLLSASYFS 342
>gi|145932434|ref|YP_001165346.1| ATP synthase F0 subunit 6 [Phytophthora ramorum] >gi|110169632|gb|ABG54097.1| ATP synthase F0 subunit 6 [Phytophthora ramorum] >gi|188037996|gb|ACD46614.1| ATP synthase F0 subunit 6 [Phytophthora ramorum] (239 aa)
Score = 132, Expect = 4.4e-06, Identities = 56/179 (31%), Positives = 82/179 (45%)
  Q:    78 LVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPG--PEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           L Y  +GK    F   IF VF +I LCN+I +V +    T+   +TF L L   LG  ++GIK  K +F    L        SG  + +     P  +   I   IS+ +RL+AN+MAG  +L +       M   +  +      P +I+  L        L+  V  IQA+VF +LT  Y
  S:    63 LTYSSIGKAGKHFVSLIFVVFFFILLCNLIGMVPYSFTVTSHLIITFTLALTIYLGFNLIGIKKHKLNFLNLLL-------PSGASIALVPILVPIELVSYIFRVISLPVRLFANMMAGHTLLKVIAGFAWTMLNVNSFIFMAHFIPLIIIVLLVG------LEIAVALIQAYVFTILTCMY 231
>gi|164421036|ref|YP_001648487.1| ATP synthase F0 subunit 6 [Aplysina fulva] >gi|158668085|gb|ABW76548.1| ATP synthase F0 subunit 6 [Aplysina fulva] (244 aa)
Score = 132, Expect = 4.6e-06, Identities = 64/253 (25%), Positives = 114/253 (45%)
  Q:     8 SVITTLQASSAFSDWKPFEYRSEITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGS 260
           ++I  +   + F DW P  + +  + ++VI I+  L+L+  ++    L P +    +     N+    +++V + +G    K+ P + ++F YI + NI+ +  +   PT    +TF L L   +G I+LGI   K +F   F+         G  + + +   P      +   +S+ LRL AN+ AG L+  +       M      VL       LF +  + F   L+  V  IQA+VF +LT  Y S +
  S:    10 NIIRLITIQALFEDW-PITFTNS-SMMMVIAIMAILLLLKGDW----LIPRRWQILMEIIYLNI----RSVVRDNLGAPGEKYFPLVLSLFLYIGMLNILGLFPYIFTPTVHIVITFGLSLSILIGVILLGIIKFKWNFLSIFM-------PGGAPLALAFILVPIETLSYLSRALSLGLRLAANLTAGHLLFAIISGFTFTMLANGLFVLS------LFPMLVMLFITILEMAVAIIQAYVFSLLTTIYLSDT 240
>gi|9695391|ref|NP_037613.1| ATP synthase F0 subunit 6 [Phytophthora infestans] >gi|6692644|gb|AAF24787.1|U17009_19 ATP synthase F0 subunit 6 [Phytophthora infestans] >gi|58012149|gb|AAW62557.1| ATP synthase F0 subunit 6 [Phytophthora infestans] >gi|58201988|gb|AAW67043.1| ATP synthase F0 subunit 6 [Phytophthora infestans] >gi|58202035|gb|AAW67089.1| ATP synthase F0 subunit 6 [Phytophthora infestans] (239 aa)
Score = 132, Expect = 4.7e-06, Identities = 57/179 (31%), Positives = 82/179 (45%)
  Q:    78 LVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPG--PEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           L Y  +GK    F   IF VF +I LCN+I +V +    T+   +TF L L   LG  I+GIK  K +F    L        SG  + +     P  +   I   IS+ +RL+AN+MAG  +L +       M   +  +      P +I+  L        L+  V  IQA+VF +LT  Y
  S:    63 LTYSSIGKAGKYFVSLIFVVFFFILLCNLIGMVPYSFTVTSHLIITFTLALTIYLGFNIIGIKKHKLNFLNLLL-------PSGASIALVPILVPIELVSYIFRVISLPVRLFANMMAGHTLLKVIAGFAWTMLNVNSFIFIAHFIPLIIIVLLVG------LEIAVALIQAYVFTILTCMY 231
>gi|15611834|ref|NP_223485.1| F0F1 ATP synthase subunit A [Helicobacter pylori J99] >gi|9910640|sp|Q9ZL15|ATP6_HELPJ ATP synthase a chain (ATPase protein 6) >gi|4155332|gb|AAD06346.1| ATP synthase F0, subunit a [Helicobacter pylori J99] (226 aa)
Score = 132, Expect = 5.0e-06, Identities = 58/227 (25%), Positives = 102/227 (44%)
  Q:    39 IIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFI-KFTPYIFTVFCYIFLCNIISVV-GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEE 265
           +++T VL+++            P G+     +++ A  ++  +I+G+E   K+ P   T+  Y+F  N+I ++ GFE+PTA  + T  L L         GI+ Q         FK++       K + P+ F P  I       +S+S RL+ NI    + L       ++M    P  +   P ++LF              +G +QAFVF++LT  Y +G+   +E
  S:    24 VVLTAVLMFFISLGASRKMQMVPMGLQNVYESIISAILSVAKDIIGEELARKYFPLAGTIALYVFFSNMIGIIPGFESPTASWSFTLVLALIVFFYYHFEGIRVQG-------FFKYFAHFAGPVKWLAPFMF-PIEIISHFSRIVSLSFRLFGNIKGDDMFL-------LIMLLLVPWAVPVAPFMVLF-------------FMGILQAFVFMILTYVYLAGAVLTDE 224
>gi|188587441|ref|YP_001918986.1| ATP synthase F0, A subunit [Natranaerobius thermophilus JW/NM-WN-LF] >gi|179352128|gb|ACB86398.1| ATP synthase F0, A subunit [Natranaerobius thermophilus JW/NM-WN-LF] (217 aa)
Score = 132, Expect = 5.2e-06, Identities = 54/234 (23%), Positives = 103/234 (44%)
  Q:    25 FEYRSEITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWS 258
           FE+ +   +IIV  +IM  +++    + + L+  K P G+  F+  +    + LV   MG++   F PY+ T+  Y+ + N+  ++    PT+    TF L   T +     G++ + ++ + K   +        N V           ++I  P+ S++ RL+ N++   +I+ L Y+   ++    P                   H + D   G IQ F+FV+LT+ Y S
  S:    13 FEFGALTETIIVSWVIMAFLVIISIITTRNLE--KIPSGLQNFMELVYEGIEWLVDSTMGEKNRAFLPYMGTLTLYLIIANLTGLLNIRPPTSDVNTTFGLAAITFVLVHYSGVRSKGAAGYMKSFAEPLPFLLPLNLV-----------SEIAQPF-SLAFRLFGNMVGAFIIMALIYSFAPILIPVLP-------------------HMYFDIFAGIIQTFIFVMLTMTYIS 213
>gi|160938931|ref|ZP_02086282.1| hypothetical protein CLOBOL_03825 [Clostridium bolteae ATCC BAA-613] >gi|158437894|gb|EDP15654.1| hypothetical protein CLOBOL_03825 [Clostridium bolteae ATCC BAA-613] (229 aa)
Score = 132, Expect = 5.5e-06, Identities = 45/181 (24%), Positives = 88/181 (48%)
  Q:    82 IMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLF-YALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTE 262
           ++GKE   + PY+ TV  YI + N+I ++GF++PT    VT +L + + +   + GI+ +          + +IK+ +    +I     P  + ++ +  +S+ +RL+ N++   +++ L  + LP+++                     +PF  + D   G IQA+VFV LT  Y   + E
  S:    79 LLGKEGKAYIPYLITVVIYIGIANMIGLLGFKSPTKDLNVTVSLAVMSIVLVEVAGIRKKG--------VRGWIKSFAEPIAIIA----PINVLELFIRPLSLCMRLFGNVLGAIVVMALIKHLLPLIV--------------------PLPFSFYFDIFDGVIQAYVFVFLTSLYIKEAIE 228
>gi|160942711|ref|ZP_02089953.1| hypothetical protein FAEPRAM212_00187 [Faecalibacterium prausnitzii M21/2] >gi|158445985|gb|EDP22988.1| hypothetical protein FAEPRAM212_00187 [Faecalibacterium prausnitzii M21/2] (247 aa)
Score = 132, Expect = 5.5e-06, Identities = 65/227 (28%), Positives = 101/227 (44%)
  Q:    30 EITSIIVITIIMTLVLVYYNFSMK---KLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYF-FNPFGITDIIMPWISISLRLWANIMAGALILGLFY----ALPMVMFRRDPTVLEPGPEVILFSLFAVPFHG-FLDWLVGSIQAFVFVVLTLCY 256
           +IT  +V T I+  +L  +   +    KL+     +  A FI   L  F   V++ MG  F ++ P I  +F     CN+ISVVG  +PTA      A  +   +  +   IK      + K L               P F   P  +   +   +S++ R + NI++G +I  L Y    +L  V+F   P  L    ++ LF +    F G + DW  G IQAF+F  LT  +
  S:    23 KITQTLVTTWIVMALLSGFAIWLGHDLKLENVSKRQAAAEFIVTRLEQF---VHDNMGFHFDQYIPLIGAIFALSVGCNLISVVGLWSPTADLNTEAAWAIVVFVLIMYYKIKTNGILAYIKGLLD-------------PIFIMAPINVLSEVSTPVSMAFRHFGNILSGTVISTLLYWALASLSHVIFGWLPGFLS---QIQLFQIGIPAFTGLYFDWFGGCIQAFIFCTLTAIF 239
>gi|21645911|gb|AAM71269.1| ATP synthase F0, A subunit [Chlorobium tepidum TLS] (276 aa)
Score = 132, Expect = 5.6e-06, Identities = 54/226 (23%), Positives = 104/226 (46%)
  Q:    31 ITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEI-MGKEFIKFTPYIFTVFCYIFLCNIISVVGF-ENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGF---LDWLVGSIQAFVFVVLTLCY 256
           +  I +  I++ ++      S+KK+  N+ PKG+A    +L+      V +  +G  + KF PY+ TVF +I +CN++ ++ +    T    VT  L +FT + T     K Q    + + L        +G    +     P  I        ++++RL+AN+ AG +I+   + +  ++              I+    ++PF  F   L+  V  +QA+VF +L+  +
  S:    36 VVMIWLAAILLVVIASAAGASVKKMSANQAPKGVANVFESLVDFISNDVAKPNIGHGYEKFLPYLLTVFFFILVCNLLGLIPYGATATGNINVTLTLSVFTFVITQFSAFKAQGVKGYLQHL-------TAGTHWALWIIMVPIEILGQFTKPFALTIRLFANMTAGHIIILSLFFISFIL-----------KSYIVAVAVSIPFAIFIYLLELFVAFLQAYVFTMLSALF 248
>gi|81428741|ref|YP_395741.1| F0F1 ATP synthase subunit A [Lactobacillus sakei subsp. sakei 23K] >gi|78610383|emb|CAI55433.1| H(+)-transporting two-sector ATPase (ATP synthase), A subunit [Lactobacillus sakei subsp. sakei 23K] (237 aa)
Score = 132, Expect = 5.7e-06, Identities = 62/231 (26%), Positives = 106/231 (45%)
  Q:    35 IVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCN---------IISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEE 265
           ++++  +   LV++      L P K    + + I    G  K+ +    GK+F  F    F +F ++F+ N         +  VV  ++PTA   +T +L +      ++L   +      +    K YIK           FF P  I +    ++++SLRL+ NI AG ++L L   + M       T+L   P  +++  F+V         +GSIQAFVFV L++ Y S   E E+
  S:    23 VLLSAAIVFALVFFLSRKIALKPTKRQNVLEWMIDFTNGIVKSAMPGEEGKQFYLFA---FVMFLFVFISNQFGLIFQMKVDEVVWLKSPTADPIITMSLAMIV----LVLSHYFSIERLGFGNYLKSYIKPVG--------FFLPINIIEQFTNFLTLSLRLYGNIFAGEVLLNLL--VKMAFSHGPATMLVTAPIQMVWQGFSV--------FIGSIQAFVFVTLSMVYISEKVEMED 237
>gi|148378156|ref|YP_001252697.1| ATP synthase F0, A subunit [Clostridium botulinum A str. ATCC 3502] >gi|153930796|ref|YP_001382557.1| F0F1 ATP synthase subunit A [Clostridium botulinum A str. ATCC 19397] >gi|153936027|ref|YP_001386109.1| F0F1 ATP synthase subunit A [Clostridium botulinum A str. Hall] >gi|153938837|ref|YP_001389513.1| F0F1 ATP synthase subunit A [Clostridium botulinum F str. Langeland] >gi|168177483|ref|ZP_02612147.1| ATP synthase F0, A subunit [Clostridium botulinum NCTC 2916] >gi|168182240|ref|ZP_02616904.1| ATP synthase F0, A subunit [Clostridium botulinum Bf] >gi|170757339|ref|YP_001779778.1| ATP synthase F0, A subunit [Clostridium botulinum B1 str. Okra] >gi|170758440|ref|YP_001785479.1| ATP synthase F0, A subunit [Clostridium botulinum A3 str. Loch Maree] >gi|148287640|emb|CAL81705.1| ATP synthase A chain [Clostridium botulinum A str. ATCC 3502] >gi|152926840|gb|ABS32340.1| ATP synthase F0, A subunit [Clostridium botulinum A str. ATCC 19397] >gi|152931941|gb|ABS37440.1| ATP synthase F0, A subunit [Clostridium botulinum A str. Hall] >gi|152934733|gb|ABS40231.1| ATP synthase F0, A subunit [Clostridium botulinum F str. Langeland] >gi|169122551|gb|ACA46387.1| ATP synthase F0, A subunit [Clostridium botulinum B1 str. Okra] >gi|169405429|gb|ACA53840.1| ATP synthase F0, A subunit [Clostridium botulinum A3 str. Loch Maree] >gi|182671312|gb|EDT83286.1| ATP synthase F0, A subunit [Clostridium botulinum NCTC 2916] >gi|182674517|gb|EDT86478.1| ATP synthase F0, A subunit [Clostridium botulinum Bf] (226 aa)
Score = 131, Expect = 6.9e-06, Identities = 66/230 (28%), Positives = 110/230 (47%)
  Q:    25 FEYRSEITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPY-FFNPFGITDIIMPWISISLRLWANIMAGALILGLFY-ALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTL 254
           F Y+  ITS +VI  ++  ++   +  + + +  K P      +  +L   + LV E MG+EF  F P+I T+  Y+ L N++ ++G + PT   +V   + L + +  +I G   +K+    K  F  Y K         PY F  P  + + +M  +S+SLRL+ NI A  LI+ L Y AL  + +     V              +P H + D   G+IQ  +FV+LT+
  S:    13 FGYKFGITSSLVIQWVIIAIVALLSIILTR-NLKKVPDKRQTVMEMMLDLVRNLVNENMGEEFKSFIPFIGTLMIYLLLMNLVGLLGLKPPTLDYSVVLGMALISFV--VIQGYAIRKTGL--KSYFLGYGK---------PYLFLLPLNVIERVMLPVSLSLRLFGNITAAVLIMDLVYSALASISWFAQLVV-------------PIPLHIYFDLFDGTIQMVIFVMLTM 217
>gi|1703472|sp|P50363|ATP6_ALLAR ATP synthase subunit a (ATPase protein 6) >gi|9800497|gb|AAF99320.1|AF281324_2 ATP synthase F0 subunit 6 [Allomyces arbuscula] >gi|459015|gb|AAA64931.1| ATPase complex subunit 6 (262 aa)
Score = 131, Expect = 6.9e-06, Identities = 58/228 (25%), Positives = 104/228 (45%)
  Q:    29 SEITSIIVITIIMTLVLVYYNFSMKK--LDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           + +T+I ++ II  LVL  +  S     + P +    +  ++ ++LG  K  +        I F P IFT F ++F+ NI+ ++ +   PT+  +VT  L +   +G  ++G    +  FF  F+ K       G  + +                 S++LRL AN+ AG  + G+   L +       ++L  G  + L     V  +G L+ LV  +Q++VF +LT  Y
  S:    31 TSLTNIAILFIIGLLVLTIFQISASSHLIKPTRWNIVLETWVASILGIVKDQIGNDAKNSLIYF-PLIFTFFSFVFISNILGMIPYSFTPTSHISVTLGLSIAIMIGVTLIGFSKHQLDFFSLFVPK-------GTPLALVPLLVLIEFISYSARAFSLALRLTANVSAGHCLFGVISMLSVSACMAVSSILLKGITIGLPLAVLVVLYG-LELLVALLQSYVFTLLTCSY 252
>gi|117926948|ref|YP_867565.1| F0F1 ATP synthase subunit A [Magnetococcus sp. MC-1] >gi|117610704|gb|ABK46159.1| ATP synthase F0, A subunit [Magnetococcus sp. MC-1] (268 aa)
Score = 131, Expect = 6.9e-06, Identities = 50/175 (28%), Positives = 80/175 (45%)
  Q:    82 IMGKEFIKFTPYIFTVFCYIFLCNIISVV-GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           I G E  K+ P IFT+F  +  CN++ ++ G   PT+   VT  L L        L I    + F   F+        SG   M+     P  I   +   +S+S+RL+AN+ AG  +L + +     +         P   +++ + FA  F GF +  +G IQA++F +LT  Y
  S:   102 IGGAEGRKYFPAIFTLFLLVLFCNLLGLIPGSFTPTSQLVVTATLALSVFFFATGLAIVKHGTGFIGFFV-------PSGVPPMLLILMVPIEIVSYLSRPVSLSVRLFANMTAGHTVLAIMFFFAATL---------PLGGLLMPAAFATVFTGF-ELFIGFIQAYIFTILTCVY 260
>gi|69247781|ref|ZP_00604486.1| H+-transporting two-sector ATPase, A subunit [Enterococcus faecium DO] >gi|68194710|gb|EAN09192.1| H+-transporting two-sector ATPase, A subunit [Enterococcus faecium DO] (239 aa)
Score = 131, Expect = 7.2e-06, Identities = 70/242 (28%), Positives = 109/242 (45%)
  Q:    24 PFEYRSEITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVG----------FENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPY-FFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEV-ILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEE 265
           P  +   +  ++++T ++   L Y+     KL P      I + I    G    +   +  KE   F    FT+F ++F+ N I +V           +++PTA   VT  L     L T + G+K        K  FK Y      N  + PY F  P  + +     ++++LRL+ NI AG ++L L   + + +      +  P   V I FSLF           +GSIQAFVFV L++ Y S   E EE
  S:    12 PIWFDGTVCIMVLLTCLIVFFLAYFFTRNLKLKPTGKQNAIEWVIDFSRG---IVTDNLPRKELSNFHLLAFTLFLFVFVANNIGLVTKIVLPNETTLWKSPTADPFVTLTLAFIMILLTHLFGVK--------KLGFKGYFV----NSFLKPYSFMFPMKLIEEFTNLLTLALRLYGNIYAGEVLLTLIAKMVISLGWFSLPLAIPLEMVWIAFSLF-----------IGSIQAFVFVTLSMVYMSHKIEVEE 239
>gi|189462116|ref|ZP_03010901.1| hypothetical protein BACCOP_02796 [Bacteroides coprocola DSM 17136] >gi|189431197|gb|EDV00182.1| hypothetical protein BACCOP_02796 [Bacteroides coprocola DSM 17136] (342 aa)
Score = 131, Expect = 7.5e-06, Identities = 56/226 (24%), Positives = 108/226 (47%)
  Q:    31 ITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVV----GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           I S +++ I+M+ V  Y    +++     P  G+      +L  +  ++   +G+++ ++ PY+ T F ++ + N++ ++    G  N T    +T  L + T L T I G K      ++K +F   + T     V +      FGI     P+ ++ +RL+ANIMAG   +    A+  +  +  P +   G   ++   F + F   L+ LV  IQA+VF +L+  +
  S:   116 INSAVLLVIMMSCVRWYKKHPVEQ---GAPKGGVGMIEALVLMIYDDVIKGCIGEDYKRYAPYLLTAFFFVLVNNLMGLIPVFPGGANVTGNIAITLVLAVITFLFTNIFGTKE-----YWKEIFWPDVPTWLKAPVPMMPLIEFFGI--FTKPF-ALMIRLFANIMAGHAAILSLIAIIFITVKVGPVI--NGSMTVVAVAFGI-FMDALEILVAFIQAYVFTMLSAVF 331
>gi|108800846|ref|YP_641043.1| F0F1 ATP synthase subunit A [Mycobacterium sp. MCS] >gi|119869986|ref|YP_939938.1| F0F1 ATP synthase subunit A [Mycobacterium sp. KMS] >gi|126436444|ref|YP_001072135.1| F0F1 ATP synthase subunit A [Mycobacterium sp. JLS] >gi|108771265|gb|ABG09987.1| ATP synthase F0, A subunit [Mycobacterium sp. MCS] >gi|119696075|gb|ABL93148.1| ATP synthase F0, A subunit [Mycobacterium sp. KMS] >gi|126236244|gb|ABN99644.1| ATP synthase F0, A subunit [Mycobacterium sp. JLS] (251 aa)
Score = 130, Expect = 7.6e-06, Identities = 62/233 (26%), Positives = 103/233 (44%)
  Q:    33 SIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFT-PYIFTVFCYIFLCNIISV--VGFENPT--------ALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEE 265
           +I+   I   +VL    F   K+     P G+  F   L    +  +   +G     F  P   T+F +I + N +SV  V + + T        A + + F L L      + + I Y  + F+ + L     K   G+  ++     P  + + +   IS+SLRL+ NI AG +++ L    P       P ++   P  I  S          D  VG+IQAF+F +LT+ Y+S S E ++
  S:    31 TILSTAIAAAIVLGLAFFLRAKVTSTGVPNGVQLFWEALTVQMRNQIESAIGMRVAGFVLPLAVTLFAFILIANWLSVLPVQYSDETGIHELLKPAASDINFVLAL-----ALFVFIAYHAAGFWRRGLLGHPKKLLKGHVAILA----PINLVEELAKPISLSLRLFGNIFAGGILVALIALFP-------PWIMW-APNAIWKSF---------DLFVGAIQAFIFALLTILYFSQSMELDD 248
>gi|119358473|ref|YP_913117.1| F0F1 ATP synthase subunit A [Chlorobium phaeobacteroides DSM 266] >gi|119355822|gb|ABL66693.1| ATP synthase F0, A subunit [Chlorobium phaeobacteroides DSM 266] (342 aa)
Score = 130, Expect = 7.8e-06, Identities = 56/237 (23%), Positives = 109/237 (45%)
  Q:    31 ITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEI-MGKEFIKFTPYIFTVFCYIFLCNIISVVGF-ENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNK------VMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGF---LDWLVGSIQAFVFVVLTLCYWSGSTEPEEES 267
           + ++ V++ I+ +V        K + P   PKG    +  L+   +  V +  +G  + K+ PY+ TVF ++ LCN++ +V +    T    VT  L  FT + T I  +K            K Y+   +G        +MIP  F       +    +++++RL+AN+ AG +++     +  ++              I+    +VPF  F   L+  V  +QA++F +L+  +   ++  EE +
  S:   110 VVTLWVVSAIVLIVFTIIGSKYKTMSPKTAPKGFVNAMEALVEFIRLDVAKANIGPGYEKYLPYLLTVFMFVLLCNVLGLVPYGATATGNINVTLTLATFTFVLTQIAALKAHG--------IKGYLAHLTGGTHPALWIIMIPIEF-----IGLFTKPVALTIRLFANMTAGHIVILSLIFISFIL-----------KSYIVAVAMSVPFSIFIYLLEIFVAFLQAYIFTMLSALFIGLASAHEEHA 333
>gi|29377099|ref|NP_816253.1| F0F1 ATP synthase subunit A [Enterococcus faecalis V583] >gi|29344565|gb|AAO82323.1| ATP synthase F0, A subunit [Enterococcus faecalis V583] (239 aa)
Score = 130, Expect = 8.3e-06, Identities = 68/242 (28%), Positives = 107/242 (44%)
  Q:    24 PFEYRSEITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVG----------FENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPY-FFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPG----PEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEE 265
           P  +   I  ++++T I+    VY      KL P      I + +  + G    +   +  KE   F    FT+F ++ + NI+ +V           +++PTA   VT  L +   + T   G+K        +F FK Y+     N  + P  F  P  + +     +++ LRL+ NI AG ++LGL             TV   G    P  I   +  V F  F    +G IQAF+FV L++ Y S   E EE
  S:    12 PIWFDGTIVLMVLLTCIIVFAFVYACTRNMKLRPKGKQTVIEWLVDFIRG---IITDNLPRKEVSNFHLMAFTLFMFVLVSNILGLVTKIVVGDDLSVWKSPTADPIVTLTLAMMMIVLTHFFGMK--------RFGFKGYLV----NSYLRPVGFLLPVKLMEEFTNLLTLGLRLYGNIFAGEVLLGLIAG----------TVASVGLWVIPLAIPLEMIWVAFSIF----IGCIQAFIFVTLSMVYMSHKIETEE 239
>gi|160890320|ref|ZP_02071323.1| hypothetical protein BACUNI_02761 [Bacteroides uniformis ATCC 8492] >gi|156860052|gb|EDO53483.1| hypothetical protein BACUNI_02761 [Bacteroides uniformis ATCC 8492] (356 aa)
Score = 130, Expect = 8.7e-06, Identities = 61/211 (28%), Positives = 99/211 (46%)
  Q:    60 PPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGF----ENPTALTTVTFALGLFTTLGTIILGIK-YQKSSFFYKFLFKFYIKTKSGNKVMIPY--FFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEEESQVK 270
           P   I F    ++     ++   +G ++ KF PY+ T F +IF+ NI+ ++ F     N T    +T  L + T L   I G K Y K  F+    +          KV IP   F   FGI     P+ ++ +RL+AN++AG + + +   L  +     P +   G   +   LF + F   L+ LV  IQA+VF +L+  +   + E  +E  VK
  S:   153 PGGFIGFMEMFIMMVNDDIIKSCVGPKYRKFAPYLLTAFFFIFINNIMGLIPFFPGGANVTGNIAITMVLAICTFLAVNIFGTKTYWKDIFWPDVPWWL--------KVPIPMMPFIEFFGI--FTKPF-ALMIRLFANMLAGHMAMLVLTCLIFISASMGPAL--NGTLTVASVLFNI-FMNALELLVAFIQAYVFTMLSAVFIGLAQEEHKEKAVK 356
>gi|114570751|ref|YP_757431.1| F0F1 ATP synthase subunit A [Maricaulis maris MCS10] >gi|114341213|gb|ABI66493.1| ATP synthase F0, A subunit [Maricaulis maris MCS10] (258 aa)
Score = 130, Expect = 8.8e-06, Identities = 65/229 (28%), Positives = 115/229 (50%)
  Q:    35 IVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVG-FENP-------TALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVM---FRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEP 263
           +V+T ++T+VL     S + L PN+  + +A  I+   G    +V    G+E ++F P++FT+F +I + N++ +   F  P       T+   VT AL +   L  II G+   K+ F +  LF       SG  + +        I   +   +S S+RL+AN++AG ++L +F    + +   +     +    P  +  SL A      L++LV  +QA+VF +LT  Y + +  P
  S:    34 MVLTTVLTIVLFMVAMSSRALVPNRA-QSVAEIIY---GFVADMVRSTAGQEGLRFFPFVFTLFIFILVANMLGMFPYFPAPGAHSFTITSHLIVTVALAMLVWLTVIIYGVF--KNGFGFLKLF-----VPSGVPIFVLPLVVVIEIISFVSRPLSHSVRLFANMLAGHILLKVFAGFVVTLAAAWGGFGYLAGIAPLAMAVSLTA------LEFLVAFLQAYVFAMLTCIYLNDALHP 256
>gi|118579923|ref|YP_901173.1| ATP synthase F0, A subunit [Pelobacter propionicus DSM 2379] >gi|118502633|gb|ABK99115.1| ATP synthase F0, A subunit [Pelobacter propionicus DSM 2379] (229 aa)
Score = 130, Expect = 9.2e-06, Identities = 56/202 (27%), Positives = 91/202 (45%)
  Q:    61 PKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVV-GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTE 262
           P G+  F+  ++G  + +V E MG+    + P + T+  ++ + N+I ++ GF  PTA    T A  +   L T ++GIK     +   F       T        P  F    I  +  P +S++LRL+ N+    L+L +F+ L           L P P ++            +  LV  IQAFVF++LT+ Y  GS E
  S:    53 PGGLQNFMEIIVGGIENMVTETMGEHGRPYFPLVATIGIFVLVSNLIGLIPGFFPPTANINTTAACAIVVFLSTHVVGIKRHGIGYIKHFCGPILWLT--------PIMFFIEVIGHLSRP-VSLTLRLFGNMNGHELVLIIFFGL--------APFLVPLPMML------------MGVLVSFIQAFVFMLLTMIYIQGSLE 226
>gi|50261319|ref|YP_052913.1| ATP synthase F0 subunit 6 [Saprolegnia ferax] >gi|48237632|gb|AAT40681.1| ATP synthase F0 subunit 6 [Saprolegnia ferax] (238 aa)
Score = 130, Expect = 9.4e-06, Identities = 53/179 (29%), Positives = 83/179 (46%)
  Q:    78 LVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPG--PEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           L Y  +GK    F   IF +F ++ LCN+I ++ +    T+   +TFAL L   +G  I+GI+  K  FF   L        SG  + +     P  +   I   IS+ +RL+AN+MAG  +L +       M   +  +      P ++L  L ++         V  IQA+VF +LT  Y
  S:    62 LAYSNIGKNGRYFFSLIFVLFFFVLLCNLIGMIPYSFTVTSHLIITFALSLTIYIGFNIIGIQKHKLKFFGLLL-------PSGASINLVPLLVPIELISYIFRAISLPVRLFANMMAGHTLLKVIAGFAWTMLNVNTVIFIAHFIPLILLVILVSIELG------VAVIQAYVFTILTCIY 230
>gi|160914784|ref|ZP_02076998.1| hypothetical protein EUBDOL_00791 [Eubacterium dolichum DSM 3991] >gi|158433324|gb|EDP11613.1| hypothetical protein EUBDOL_00791 [Eubacterium dolichum DSM 3991] (231 aa)
Score = 129, Expect = 1.0e-05, Identities = 51/236 (21%), Positives = 100/236 (42%)
  Q:    31 ITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGIT-DIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEEE 266
           I + + + +I+ +   +    +KK DP + PKG       +      ++ + + +    + P+  ++   +   N++ ++G + PT+  +V   L +   +     G+K +             IK +          F P  +  D+ +P +S+SLRL+ N++AG +I+G+ Y L   +           P  I+       FH + D   G IQ ++F  L   + S S   EEE
  S:    18 IVNWLALCVILMIFFYFAGKKIKKADPREAPKGFLLLCEVIAKLGTGIISDNLKERTKAYLPFFGSLIFMMAPSNLLGLIGLQPPTSNLSVNVTLAVMMFVLVQYTGLKEKG------------IKGRIAELCDPFLLFMPLNVLGDLALP-VSLSLRLFGNMLAGTIIVGMVYGLMESLL----------PFSIIGYSLTPFFHAYFDIFSGLIQTYIFFTLASFFLSDSMASEEE 231
>gi|170788033|gb|EDT29077.1| ATP synthase F0, A subunit [Oligotropha carboxidovorans OM5] (249 aa)
Score = 129, Expect = 1.1e-05, Identities = 49/186 (26%), Positives = 87/186 (46%)
  Q:    78 LVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEP 263
           +V E +G+E +KF P +F++F ++ + N+I V+ +  + T+   VT AL L   L  ++ G+      FF  F+        SG  + I        +   +   +S S+RL+AN++AG + L +F +    +      +   G       L        L+ LV  +QA+VF +LT  Y + +  P
  S:    72 MVRESLGEEGMKFFPLVFSIFMFVLMANLIGVIPYTFSVTSHLIVTVALALIVFLTVLLYGLYKNGLKFFRVFV-------PSGVPIYILPLIAMIEVISFLSRPVSHSVRLFANMLAGHITLKVFASFVTSL----GALGVAGIAGAALPLAMTTAISILEVLVALLQAYVFAILTCIYLNDALHP 247
>gi|189501525|ref|YP_001957242.1| ATP synthase F0, A subunit [Candidatus Amoebophilus asiaticus 5a2] >gi|189496966|gb|ACE05513.1| ATP synthase F0, A subunit [Candidatus Amoebophilus asiaticus 5a2] (339 aa)
Score = 129, Expect = 1.1e-05, Identities = 52/179 (29%), Positives = 86/179 (48%)
  Q:    87 FIKFTPYIFTVFCYIFLCNIISVV-GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWI-------------SISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGF---LDWLVGSIQAFVFVVLTLCYWSGSTEPEE 265
           +++F PY+ ++F +I+L N++ ++ G  N T   +VT AL LFT                       F I    GNK    + FNP G+   + P +             S+ +RL+ANI AG +IL     L                + +L  + +VPF GF   L  +V  +QA++F +L+  Y+  + E  +
  S:   179 YMRFMPYLLSIFFFIWLNNLMGLLPGAANVTGNISVTLALALFT-----------------------FVITNVHGNKYYWGHVFNPPGVPKWLAPIMVPVEILGLFTKPFSLMIRLFANITAGHIILLSIIGLIFTF------------QTVLVGMVSVPFGGFMFLLKLVVAFLQAYIFTLLSAIYFGMAVETHD 339
>gi|145621112|ref|ZP_01777109.1| ATP synthase F0, A subunit [Geobacter bemidjiensis Bem] >gi|144942577|gb|EDJ77705.1| ATP synthase F0, A subunit [Geobacter bemidjiensis Bem] >gi|197089652|gb|ACH40923.1| ATP synthase F0, A subunit [Geobacter bemidjiensis Bem] (229 aa)
Score = 129, Expect = 1.1e-05, Identities = 56/202 (27%), Positives = 91/202 (45%)
  Q:    61 PKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVV-GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFL-DWLVGSIQAFVFVVLTLCYWSGSTE 262
           P G+  F+  ++G  + ++ E MG+    F P + T+  +I + N+I +V GF  PTA    T A  +   + T I+G+K+  + +   FL              + +F    G    +   IS++LRL+ N+    L+L +F+ L                     + F VP    L   LV  IQAFVF++L + Y  GS E
  S:    53 PSGLQNFMEVIVGGIENMLVETMGEHGKPFFPLVATLALFILVSNLIGLVPGFFPPTANINTTAACAVVVFVTTHIVGVKHHGAGYIKHFLGPIAWLAP------MMFFIEVIGHLSRV---ISLTLRLFGNMNGHELVLIIFFGL---------------------APFIVPLPMMLMGVLVSFIQAFVFMLLAMIYIQGSLE 226
>gi|191163760|ref|ZP_03025632.1| ATP synthase F0, A subunit [Geobacter sp. M21] >gi|190995205|gb|EDV70661.1| ATP synthase F0, A subunit [Geobacter sp. M21] (191 aa)
Score = 129, Expect = 1.1e-05, Identities = 55/202 (27%), Positives = 91/202 (45%)
  Q:    61 PKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVV-GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFL-DWLVGSIQAFVFVVLTLCYWSGSTE 262
           P G+  F+  ++G  + ++ E MG+    F P + T+  +I + N+I ++ GF  PTA    T A  +   + T I+G+K+  + +   FL              + +F    G    +   IS++LRL+ N+    L+L +F+ L                     + F VP    L   LV  IQAFVF++L + Y  GS E
  S:    15 PSGLQNFMEVIVGGIENMLVETMGEHGKPFFPLVATLALFILVSNLIGLIPGFFPPTANINTTAACAVVVFVTTHIVGVKHHGAGYIKHFLGPIAWLAP------MMFFIEVIGHLSRV---ISLTLRLFGNMNGHELVLIIFFGL---------------------APFVVPLPMMLMGVLVSFIQAFVFMLLAMIYIQGSLE 188
>gi|114322022|ref|YP_743705.1| F0F1 ATP synthase subunit A [Alkalilimnicola ehrlichei MLHE-1] >gi|114228416|gb|ABI58215.1| ATP synthase F0, A subunit [Alkalilimnicola ehrlichei MLHE-1] (255 aa)
Score = 129, Expect = 1.2e-05, Identities = 51/174 (29%), Positives = 84/174 (48%)
  Q:    92 PYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGL--FTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFG-----------ITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEE 265
           P   T+FC+IFL N++ +V  +    + ++ +A G+  F  L T+ L + +  S   +  +  +  K K          F+PFG           I ++I   IS+SLRL+ N+ A  LI  L   LP  +          G    +F +  +P           +QAF+F++LT+ Y S + E EE
  S:    88 PLALTIFCWIFLMNLMDLVPID---MVPSLMYAAGVDYFKILPTVDLNVTFALSISVFFLIIAYSFKGKGAGGFAKELLFHPFGPWLLPFNLILNIIELIAKPISLSLRLFGNMYAAELIFILISLLPWWI------QWALGTPWAIFHILVIP-----------LQAFIFMMLTVVYLSMANEHEE 254
>gi|163733904|ref|ZP_02141346.1| F0F1 ATP synthase subunit A [Roseobacter litoralis Och 149] >gi|161393015|gb|EDQ17342.1| F0F1 ATP synthase subunit A [Roseobacter litoralis Och 149] (248 aa)
Score = 129, Expect = 1.2e-05, Identities = 59/226 (26%), Positives = 103/226 (45%)
  Q:    38 TIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFK---FYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEP 263
           +II  ++L+    S + + P++  + +A   +   G    +V +I GKE +KF PYI T+F +I   N + ++     PT+   VT  L +   +   ILG     S+F   F        ++       +I YF  P          +S S+RL  N+MAG  ++ +F     +      T++ P   + + +++       L+ LV  IQA+VF +LT  Y   +  P
  S:    43 SIIAVILLLVVGSSKRAIVPSRA-QSVAELAY---GFIYKMVEDICGKEGLKFFPYIMTLFMFIVCANFLGLIPSSFTPTSHFAVTVVLAMAVFVTVTILGFVKNGSAFLSLFWVASAPLALRPVLAIIEIISYFVRP----------VSHSIRLAGNVMAGHAVIKVFAGFAAL------TLVSPVAILGITAMYG------LEVLVSFIQAYVFTILTCVYLKDALHP 246
>gi|15645447|ref|NP_207621.1| F0F1 ATP synthase subunit A [Helicobacter pylori 26695] >gi|108563239|ref|YP_627555.1| F0F1 ATP synthase subunit A [Helicobacter pylori HPAG1] >gi|188527325|ref|YP_001910012.1| F0F1 ATP synthase subunit A [Helicobacter pylori Shi470] >gi|2493054|sp|P56085|ATP6_HELPY ATP synthase a chain (ATPase protein 6) >gi|2313962|gb|AAD07878.1| ATP synthase F0, subunit a (atpB) [Helicobacter pylori 26695] >gi|107837012|gb|ABF84881.1| ATP synthase F0, subunit a [Helicobacter pylori HPAG1] >gi|188143565|gb|ACD47982.1| F0F1 ATP synthase subunit A [Helicobacter pylori Shi470] (226 aa)
Score = 129, Expect = 1.2e-05, Identities = 55/205 (26%), Positives = 93/205 (45%)
  Q:    61 PKGIAFFIFNLLGAFKTLVYEIMGKEFI-KFTPYIFTVFCYIFLCNIISVV-GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEE 265
           P G+     +++ A  ++  +I+G+E   K+ P   T+  Y+F  N+I ++ GFE+PTA  + T  L L         GI+ Q         FK++       K + P+ F P  I       +S+S RL+ NI    + L       ++M    P  +   P ++LF              +G +QAFVF++LT  Y +G+   +E
  S:    46 PMGLQNVYESIISAILSVAKDIIGEELARKYFPLAGTIALYVFFSNMIGIIPGFESPTASWSFTLVLALIVFFYYHFEGIRVQG-------FFKYFAHFAGPVKWLAPFMF-PIEIISHFSRIVSLSFRLFGNIKGDDMFL-------LIMLLLVPWAVPVAPFMVLF-------------FMGILQAFVFMILTYVYLAGAVLTDE 224
>gi|182677736|ref|YP_001831882.1| ATP synthase F0, A subunit [Beijerinckia indica subsp. indica ATCC 9039] >gi|182633619|gb|ACB94393.1| ATP synthase F0, A subunit [Beijerinckia indica subsp. indica ATCC 9039] (253 aa)
Score = 129, Expect = 1.2e-05, Identities = 48/180 (26%), Positives = 90/180 (50%)
  Q:    84 GKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLF--YALPMVMFRRDPTVLEPGP--EVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEP 263
           G++ ++F P++F++F ++FL N+I +V +    T+   VTF L +      +I G+    + F   F         SG   ++  F     +   I   IS+S+RL+AN++AG + L +   +   ++       ++ P P   V++F+ F +        LV  +QA+VF +LT  Y + +  P
  S:    82 GRDGMRFFPFVFSIFMFVFLANLIGLVPYTFTVTSQIAVTFGLAMIVIGTVVIYGLIKHGTHFLGIF-------APSGVSPLLLPFMIMIEVISFISRPISLSIRLFANMLAGHITLKVMGGFVAGLLGAGSVYALVAPLPLAMVVIFTAFEL--------LVAFLQAYVFTILTCVYLNDAVHP 251
>gi|45644|emb|CAA37911.1| unnamed protein product [Propionigenium modestum] >gi|45649|emb|CAA41368.1| F0 subunit [Propionigenium modestum] (289 aa)
Score = 129, Expect = 1.2e-05, Identities = 57/228 (25%), Positives = 100/228 (43%)
  Q:    33 SIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIIS---VVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPY-FFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGS 260
           ++I    +M  +++ + +S K L+   P +  AFF   + G    L+ +++G    K+  YI T+F ++ + NI+S   + GF +   + ++  AL   T      +G+    +  F    F+          +  P     P  +        +IS+RL+ N+ AG +ILGL Y    V                   L   P H + D   G +Q+FVF++LT+ Y  GS
  S:    70 TVISTWFVMLFLIMVFRWSSKNLEV-VPERKQAFFE-TIYGFLDDLIGQLLGNWKKKYFTYIGTLFLFLLISNIVSFFPIPGFSSENGVFSIAPALRTPTADLNTTVGLALLTTYSFIAASFRTSGFFGFFKGLFEPMPLMFPINLAGEFAKPTNISIRLFGNMFAGMVILGLLYKAAPV-------------------LIPAPLHLYFDLFSGVVQSFVFIMLTMVYIQGS 280
>gi|15608444|ref|NP_215820.1| F0F1 ATP synthase subunit A [Mycobacterium tuberculosis H37Rv] >gi|15840755|ref|NP_335792.1| F0F1 ATP synthase subunit A [Mycobacterium tuberculosis CDC1551] >gi|31792497|ref|NP_854990.1| F0F1 ATP synthase subunit A [Mycobacterium bovis AF2122/97] >gi|121637233|ref|YP_977456.1| F0F1 ATP synthase subunit A [Mycobacterium bovis BCG str. Pasteur 1173P2] >gi|148661092|ref|YP_001282615.1| F0F1 ATP synthase subunit A [Mycobacterium tuberculosis H37Ra] >gi|148822522|ref|YP_001287276.1| F0F1 ATP synthase subunit A [Mycobacterium tuberculosis F11] >gi|167969632|ref|ZP_02551909.1| F0F1 ATP synthase subunit A [Mycobacterium tuberculosis H37Ra] >gi|194543614|ref|YP_002078643.1| ATP synthase A chain atpB [Mycobacterium tuberculosis C] >gi|54036774|sp|P63655|ATP6_MYCBO ATP synthase a chain (ATPase protein 6) >gi|54040843|sp|P63654|ATP6_MYCTU ATP synthase a chain (ATPase protein 6) >gi|1322428|emb|CAA97737.1| PROBABLE ATP SYNTHASE A CHAIN ATPB (PROTEIN 6) [Mycobacterium tuberculosis H37Rv] >gi|13880947|gb|AAK45606.1| ATP synthase F0, A subunit [Mycobacterium tuberculosis CDC1551] >gi|31618086|emb|CAD94197.1| PROBABLE ATP SYNTHASE A CHAIN ATPB (PROTEIN 6) [Mycobacterium bovis AF2122/97] >gi|121492880|emb|CAL71351.1| Probable ATP synthase a chain atpB (protein 6) [Mycobacterium bovis BCG str. Pasteur 1173P2] >gi|124600621|gb|EAY59631.1| ATP synthase A chain atpB [Mycobacterium tuberculosis C] >gi|134149715|gb|EBA41760.1| ATP synthase A chain atpB [Mycobacterium tuberculosis str. Haarlem] >gi|148505244|gb|ABQ73053.1| ATP synthase A chain AtpB [Mycobacterium tuberculosis H37Ra] >gi|148721049|gb|ABR05674.1| ATP synthase A subunit atpB [Mycobacterium tuberculosis F11] (250 aa)
Score = 129, Expect = 1.3e-05, Identities = 57/235 (24%), Positives = 106/235 (45%)
  Q:    32 TSIIVITIIMTLVLVYYNFSMK-KLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFT-PYIFTVFCYIFLCNIISVVGFEN-----------PTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEEE 266
           T  ++ T I  L+++   F ++ K+     P G+  F   +    +  V   +G     F  P   T+F +I + N ++V+  +             +A   + + L L      + + + Y  +  + + +    IK   G+  ++     P  + + +   IS+SLRL+ NI AG +++ L    P       P ++   P  I  +          D  VG+IQAF+F +LT+ Y+S + E EEE
  S:    27 TDTVLSTAIAGLIVIALAFYLRAKVTSTDVPGGVQLFFEAITIQMRNQVESAIGMRIAPFVLPLAVTIFVFILISNWLAVLPVQYTDKHGHTTELLKSAAADINYVLAL-----ALFVFVCYHTAGIWRRGIVGHPIKLLKGHVTLLA----PINLVEEVAKPISLSLRLFGNIFAGGILVALIALFP-------PYIMW-APNAIWKAF---------DLFVGAIQAFIFALLTILYFSQAMELEEE 248
>gi|164421054|ref|YP_001648684.1| ATP synthase F0 subunit 6 [Plakortis angulospiculatus] >gi|158939044|gb|ABW83964.1| ATP synthase F0 subunit 6 [Plakortis angulospiculatus] (247 aa)
Score = 128, Expect = 1.3e-05, Identities = 52/181 (28%), Positives = 80/181 (44%)
  Q:    76 KTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           ++++ E +G +   +  ++F +F +I L NI+ +  +   PT    +TF L     LG  ILGI   K  F   F+         G  +M+  F         +   IS+ LRL ANI AG L+  +F      M      +L       LF +  + F   L+  V  IQA+VF +LT  Y
  S:    71 QSMIKENLGAQGKHYFSFVFCLFIFIGLLNILGLFPYVFTPTTHIIITFGLSFSIVLGVTILGILRFKIDFMSMFM-------PGGVLLMLAPFLVIIETISYVTRAISLGLRLAANISAGHLLFAIFSGFVFDMLTNGLIILS------LFPVLVMIFITILEMAVAVIQAYVFCLLTTIY 239
>gi|121602220|ref|YP_988695.1| F0F1 ATP synthase subunit A [Bartonella bacilliformis KC583] >gi|120614397|gb|ABM44998.1| ATP synthase F0, A subunit [Bartonella bacilliformis KC583] (252 aa)
Score = 128, Expect = 1.3e-05, Identities = 60/235 (25%), Positives = 112/235 (47%)
  Q:    29 SEITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVG-FENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLF--YALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEP 263
           + ++  I+ T++++ V ++ + S ++L P +  + I+   +  +    + + E  G + +KF P +F++F +I + N I +   F   T+   +TF+L +   L  I  G       F   F+        SG  VMI        +       IS+SLRL+AN++AG + L +F  + + MV            P ++  ++ A      L++LV  +QA+VF VLT  Y + +  P
  S:    30 TNVSFFIIATVVLSSVFLFISSSSRRLVPTRM-QSISEMAYEFVA---STLRESAGVQGMKFFPLVFSLFVFILVANFIGLFPYFYTITSQIMITFSLAMLVILTVIGCGFYKHGIGFLKLFV-------PSGVPVMILPLVTVIEVISFFSRPISLSLRLFANMLAGHITLKVFSGFIVSMVGLGFIGVGGSILPLIMTVAITA------LEFLVAFLQAYVFTVLTCMYLNDAVHP 250
>gi|195953252|ref|YP_002121542.1| ATP synthase F0, A subunit [Hydrogenobaculum sp. Y04AAS1] >gi|195932864|gb|ACG57564.1| ATP synthase F0, A subunit [Hydrogenobaculum sp. Y04AAS1] (217 aa)
Score = 128, Expect = 1.3e-05, Identities = 65/239 (27%), Positives = 114/239 (47%)
  Q:    27 YRSEITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGF-ENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGN-KVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEE 265
           Y   ITSI+ + + + +VL           P   P  + F I + +   K++V E MG++ +++ P I ++  ++F  N++ ++ F + PT     T AL       T+I+   Y    F    L   YIK   G  K + P+FF    I   +   +S+SLRL+AN+  GA++L     + +     +P  L   P V++F +        +  L   +QAF+F++L+  Y +G+   EE
  S:     4 YEHVITSIVAMVVALGVVLAAGK-------PKIMPSKLQFVIESYINFCKSMVTENMGEQGLRYLPLIASIGLFVFFGNVMELLPFVDAPTGNINTTLAL-------TLIVFFLYHFEGFRVNGL--GYIKHFMGPIKALAPFFF-IIEIMSHLGRVVSLSLRLFANMKGGAILLISIIGVLI----GNPFTLAVSPIVLVFLI-------TIKVLAIVLQAFIFMILSTIYIAGAVVHEE 216
>gi|160884432|ref|ZP_02065435.1| hypothetical protein BACOVA_02416 [Bacteroides ovatus ATCC 8483] >gi|156110171|gb|EDO11916.1| hypothetical protein BACOVA_02416 [Bacteroides ovatus ATCC 8483] (364 aa)
Score = 128, Expect = 1.3e-05, Identities = 58/218 (26%), Positives = 106/218 (48%)
  Q:    39 IIMTLVLVYYNFSMKKLDPNKPPKG-IAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGF----ENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           +++ +VL   ++  K+    K P G I F    ++     ++   +G  + KF PY+ T F +IF+ N++ ++ F     N T    +T  L + T L   I G K+     F+  +  +++K       M+P F   FGI     P+ ++ +RL+AN++AG + + +   L  +     P +   G   +   LF + F   L+ LV  IQA+VF +L+  +
  S:   138 LLLIIVLSVSHWYRKRPQGAKAPGGFIGFMEMFIMMVNDDIIKSCVGPNYRKFAPYLLTAFFFIFINNMMGLIPFFPGGANVTGNIAITMVLAVCTFLAVNIFGSKHYWKDIFWPDV-PWWLKVPVP---MMP-FIEFFGI--FTKPF-ALMIRLFANMLAGHMAMLVLTCLIFISASMGPAL--NGTLTVASVLFNI-FMNALELLVAFIQAYVFTMLSAVF 349
>gi|249182|gb|AAB22155.1| sodium dependent ATPase F1 subunit a [Propionigenium modestum, Peptide, 287 aa] >gi|384171|prf||1905281A Na ATPase (287 aa)
Score = 128, Expect = 1.4e-05, Identities = 57/228 (25%), Positives = 100/228 (43%)
  Q:    33 SIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIIS---VVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPY-FFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGS 260
           ++I    +M  +++ + +S K L+   P +  AFF   + G    L+ +++G    K+  YI T+F ++ + NI+S   + GF +   + ++  AL   T      +G+    +  F    F+          +  P     P  +        +IS+RL+ N+ AG +ILGL Y    V                   L   P H + D   G +Q+FVF++LT+ Y  GS
  S:    70 TVISTWFVMLFLIMVFRWSSKNLEV-VPERKQAFFE-TIYGFLDDLIGQLLGNWKKKYFTYIGTLFLFLLISNIVSFFPIPGFSSENGVFSIAPALRTPTADLNTTVGLALLTTYSFIAASFRTSGFFGFFKGLFEPMPLMFPINLAGEFAKPTNISIRLFGNMFAGMVILGLLYKAAPV-------------------LIPAPLHLYFDLFSGVVQSFVFIMLTMVYIQGS 280
>gi|118619164|ref|YP_907496.1| F0F1 ATP synthase subunit A [Mycobacterium ulcerans Agy99] >gi|118571274|gb|ABL06025.1| ATP synthase a chain AtpB [Mycobacterium ulcerans Agy99] (250 aa)
Score = 128, Expect = 1.5e-05, Identities = 61/235 (25%), Positives = 108/235 (45%)
  Q:    32 TSIIVITIIMTLVLVYYNFSMK-KLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFT-PYIFTVFCYIFLCNIISV--VGFENPTALTT---------VTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEEE 266
           T  ++ T I  L+++   F ++ K+     P G+  F   +    +  V   +G     F  P   T+F +I + N +SV  V + +    TT         + + L L      + + + Y  +  + + +    IK   G+  ++     P  + + I   IS+SLRL+ NI AG++++ L    P       P ++   P  I  S          D  VG+IQAF+F +LT+ Y+S + E EE+
  S:    27 TDTVLSTAIAALIVLALAFYLRSKVTSTAVPGGVQLFFEAITIQMRGQVESAIGMRIAPFVLPLAVTIFVFILISNWLSVLPVQYTDEHGQTTELLKPAAADINYVLAL-----ALFVFVCYHAAGIWRRGIVGHPIKLLKGHVAILA----PINLVEEIAKPISLSLRLFGNIFAGSILVALIALFP-------PYIMW-APNAIWKSF---------DLFVGAIQAFIFALLTILYFSQAMELEED 248
>gi|58040599|ref|YP_192563.1| F0F1 ATP synthase subunit A [Gluconobacter oxydans 621H] >gi|58003013|gb|AAW61907.1| ATP synthase subunit a [Gluconobacter oxydans 621H] (233 aa)
Score = 128, Expect = 1.5e-05, Identities = 51/203 (25%), Positives = 90/203 (44%)
  Q:    74 AFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVV-GFENPTALTTVTFALGLFTTLGTIILGIKYQK-SSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGS-TEPEEESQVKKIKKKS 276
           A    + E M  E   +  ++ T+F +I + N  S+V G E PTA+     AL +   L  II G++    + +   FL+         + VM+P       +   +    S+ +RL+ N+MAG  I+G+  +L  +                   L  +P    LD L G++QA++F +L + + +G+ T P     +K    +S
  S:    61 ALDQQIRETMRTEPAPYRSFVGTLFLFILVANWSSLVPGVEPPTAILATDAALAIIVFLAIIIFGVRSGGVTGYLRSFLWP--------SVVMVP-----LNLIGTLTRTFSLMVRLFGNVMAGVFIIGIVLSLAGL-------------------LVPIPLMA-LDLLTGAVQAYIFAILAMVFIAGALTRPAAPQSIKNTGSRS 233
>gi|110678644|ref|YP_681651.1| F0F1 ATP synthase subunit A [Roseobacter denitrificans OCh 114] >gi|109454760|gb|ABG30965.1| ATP synthase F0, A subunit [Roseobacter denitrificans OCh 114] (248 aa)
Score = 128, Expect = 1.5e-05, Identities = 53/191 (27%), Positives = 86/191 (45%)
  Q:    73 GAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFK---FYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEP 263
           G    +V +I GKE +KF PYI T+F +I   N + ++     PT+   VT  L L   +   ILG     ++F   F        ++       +I YF  P          +S S+RL  N+MAG  ++ +F     +      T++ P   + + +++       L+ LV  IQA+VF +LT  Y   +  P
  S:    74 GFIYKMVEDICGKEGLKFFPYIMTLFMFIVCANFLGLIPSSFTPTSHFAVTVVLALAVFVTVTILGFVKNGTAFLSLFWVSSAPLALRPVLAIIEIISYFVRP----------VSHSIRLAGNVMAGHAVIKVFAGFAAL------TLVSPVAILGITAMYG------LEVLVSFIQAYVFTILTCVYLKDALHP 246
>gi|89069741|ref|ZP_01157077.1| ATP synthase subunit A [Oceanicola granulosus HTCC2516] >gi|89044687|gb|EAR50798.1| ATP synthase subunit A [Oceanicola granulosus HTCC2516] (251 aa)
Score = 128, Expect = 1.5e-05, Identities = 55/191 (28%), Positives = 83/191 (43%)
  Q:    73 GAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTT-----VTFALGLFTTLGTIILGIKYQKSSFFYKFLFK---FYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEP 263
           G    +V ++ G+E +K+ PYIFT+F +I   N + ++    PT+  T     VT  L L   L   ILG     + F   F        ++       +I YF  P          +S S+RL  NIMAG  ++ +F     +              V   S+ A+     L+ LV  IQA+VF +LT  Y   +  P
  S:    77 GFVYKMVEDVSGREGLKYFPYIFTLFLFIVFANFLGLI----PTSFATTSHIAVTAVLALSVFLTVTILGFVLNGTKFLGLFWVSSAPLALRPVLAIIELISYFVRP----------VSHSIRLGGNIMAGHAVIKVFAGFAAI------------ATVAPLSVIAIAAIYGLEVLVAFIQAYVFTILTCVYLKDALHP 249
>gi|183984064|ref|YP_001852355.1| ATP synthase a chain AtpB [Mycobacterium marinum M] >gi|183177390|gb|ACC42500.1| ATP synthase a chain AtpB [Mycobacterium marinum M] (250 aa)
Score = 128, Expect = 1.6e-05, Identities = 61/235 (25%), Positives = 107/235 (45%)
  Q:    32 TSIIVITIIMTLVLVYYNFSMK-KLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFT-PYIFTVFCYIFLCNIISV--VGFENPTALTT---------VTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEEE 266
           T  ++ T I  L+++   F ++ K+     P G+  F   +    +  V   +G     F  P   T+F +I + N +SV  V + +    TT         + + L L      + + + Y  +  + + +    IK   G+  ++     P  + + I   IS+SLRL+ NI AG +++ L    P       P ++   P  I  S          D  VG+IQAF+F +LT+ Y+S + E EE+
  S:    27 TDTVLSTAIAALIVLALAFYLRSKVTSTAVPGGVQLFFEAITIQMRGQVESAIGMRIAPFVLPLAVTIFVFILISNWLSVLPVQYTDEHGQTTELLKPAAADINYVLAL-----ALFVFVCYHAAGIWRRGIVGHPIKLLKGHVAILA----PINLVEEIAKPISLSLRLFGNIFAGGILVALIALFP-------PYIMW-APNAIWKSF---------DLFVGAIQAFIFALLTILYFSQAMELEED 248
>gi|90420161|ref|ZP_01228069.1| ATP synthase F0, subunit A [Aurantimonas sp. SI85-9A1] >gi|90335495|gb|EAS49245.1| ATP synthase F0, subunit A [Aurantimonas sp. SI85-9A1] (254 aa)
Score = 128, Expect = 1.6e-05, Identities = 53/229 (23%), Positives = 110/229 (48%)
  Q:    35 IVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVG-FENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLF--YALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEP 263
           +V+T+ +    +YY+   + L PN+  + ++   +  +     ++ +  G   ++F P++F++F +I + N++ ++  F   T+   VTFAL L      ++ G+      FF  F+         G    +        +   +   +S+S+RL+AN++AG + L +F  + + +  F          P ++  +L A      L++LV ++QA+VF VLT  Y + +  P
  S:    38 MVVTVAVATAFLYYSTRGRGLVPNRM-QSVSELSYEFVA---NMLRDAAGSGGMRFFPFVFSLFMFILVANLLGMIPYFFTVTSHLIVTFALALLVMGVVVVYGLMKHGLHFFKLFV-------PEGVPAAVLPLVVVIEVVSFLSRPVSLSVRLFANMLAGHITLKVFAGFVVSLSAFGALGIAGAILPLLMTVALTA------LEFLVAALQAYVFAVLTCMYLNDAIHP 252
>gi|196188433|gb|EDX83398.1| ATP synthase F0, A subunit [Synechococcus sp. PCC 7335] (246 aa)
Score = 127, Expect = 1.8e-05, Identities = 47/175 (26%), Positives = 81/175 (46%)
  Q:    90 FTPYIFTVFCYIFLCNIISVV-GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPE 264
           F P+I T+F +I + N+++++ G+  PT   + T AL +       I GIK Q      K     Y++    N +M+P     F I   +   IS+S+RL+ N+M+G +I+G+  ++                      LFA         L G IQA++F +L +   + +TE +
  S:    81 FLPFIGTLFIFIAVSNVLAILPGYHPPTGSLSTTAALAICVFFAVPIFGIKRQG----LKGYLSSYVQP---NPIMLP-----FNIIGELSRTISLSVRLFGNVMSGTMIVGILLSVA--------------------PLFAPVVMRAFGLLTGLIQAYIFAILAMVAIAAATEAQ 224
>gi|114763712|ref|ZP_01443106.1| F0F1 ATP synthase subunit A [Roseovarius sp. HTCC2601] >gi|114543713|gb|EAU46726.1| F0F1 ATP synthase subunit A [Roseovarius sp. HTCC2601] (254 aa)
Score = 127, Expect = 1.8e-05, Identities = 62/235 (26%), Positives = 109/235 (46%)
  Q:    29 SEITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTT-----VTFALGLFTTLGTIILGIKYQKSSFFYKFLFK---FYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEP 263
           + +T  ++I I++ + L+ +  S + + P++  + +A   +   G    +V ++ GK+ + + PYI T+F +I + N + ++    P + TT     VT  L L   LG  ILG     +SF   F        ++       +I YF  P          +S S+RL  N+MAG  +L +F     V        + P   V + +++       L+ LV  IQA+VF +LT  Y   +  P
  S:    40 TNVTLWMLIAILVIVALMVFGTSRRAVVPSRS-QSVAELAY---GFIHKMVEDVAGKDGLVYFPYIMTLFMFIVIANFLGLI----PMSFTTTSHFAVTVVLALCVFLGVTILGFVKNGASFLSLFWVSSAPMALRPVLAIIEIISYFVRP----------VSHSIRLAGNVMAGHAVLKVFAGFAAVA------AISPLTIVAITAIYG------LEVLVAFIQAYVFTILTCVYLKDALHP 252
>gi|116749040|ref|YP_845727.1| ATP synthase F0, A subunit [Syntrophobacter fumaroxidans MPOB] >gi|116698104|gb|ABK17292.1| ATP synthase F0, A subunit [Syntrophobacter fumaroxidans MPOB] (239 aa)
Score = 127, Expect = 1.8e-05, Identities = 52/202 (25%), Positives = 88/202 (43%)
  Q:    61 PKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVV-GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTE 262
           PKG   F   ++   +  +  I G+E     P I ++  +I   N + ++ GF +PTA    T A  L + + T ++GIK+    +   F+   +  T             P  I   I   +S+S+RL+ N+    L+LG+ + L                    F L  +P   FL    G IQAF+F +L++ Y++G+ E
  S:    62 PKGAQNFFEVVITGIEDFMISITGEEGRFVFPLIASLGMFILFSNYLGMIPGFFSPTANINTTAACALISVVFTHVIGIKFHGVKYIKHFMGPVWWLTP---------LIMPIEIIGHIARVLSLSIRLFGNVFGEELVLGILFFLAG------------------FYLAPLPMM-FLGLFTGFIQAFIFCLLSMMYFAGAIE 236
>gi|109947723|ref|YP_664951.1| F0F1 ATP synthase subunit A [Helicobacter acinonychis str. Sheeba] >gi|109714944|emb|CAJ99952.1| F0 ATP synthase, A chain [Helicobacter acinonychis str. Sheeba] (226 aa)
Score = 127, Expect = 2.0e-05, Identities = 55/205 (26%), Positives = 93/205 (45%)
  Q:    61 PKGIAFFIFNLLGAFKTLVYEIMGKEFI-KFTPYIFTVFCYIFLCNIISVV-GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEE 265
           P G+     +++ A  ++  +I+G+E   K+ P   T+  Y+F  N+I ++  FE+PTA  + T  L L         GI+ Q         FK++       K + P+ F P  I       +S+S RL+ NI    + L       ++M    P V+   P ++LF              +G +QAFVF++LT  Y +G+   +E
  S:    46 PMGLQNVYESIISAILSVAKDIIGEELARKYFPLAGTIALYVFFSNMIGIIPSFESPTASWSFTLVLALIVFFYYHFEGIRVQG-------FFKYFAHFAGPVKWLAPFMF-PIEIISHFSRIVSLSFRLFGNIKGDDMFL-------LIMLLLVPWVIPVAPFMVLF-------------FMGILQAFVFMILTYVYLAGAVLTDE 224
>gi|56417143|ref|YP_154217.1| F0F1 ATP synthase subunit A [Anaplasma marginale str. St. Maries] >gi|56388375|gb|AAV86962.1| ATP synthase A chain [Anaplasma marginale str. St. Maries] (267 aa)
Score = 127, Expect = 2.0e-05, Identities = 44/175 (25%), Positives = 78/175 (44%)
  Q:    84 GKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWS 258
           G E +++ P + T F ++  CN++ ++ F    T+  +VT AL L       ++G ++Q   F   FL         G  + +        +   +   +S+++RL AN++AG  I+ +     + M      VL P P   +  L A       +  V  +QA++F VLT  Y S
  S:   103 GAEGLRYIPLVMTTFLFVLACNLVGILPFGFTATSHLSVTLALSLVVCTAITVIGFRHQGLHFLRIFL-------PEGTPLWLAPMMVFIKLFAYVARPVSLAIRLAANMIAGHTIIAVIADFVLKMH----LVLAPLPFAFIMGLIA------FEIFVAILQAYIFTVLTTVYLS 261
>gi|91202298|emb|CAJ75358.1| similar to ATPB gene encoding subunit a of ATP synthase [Candidatus Kuenenia stuttgartiensis] (236 aa)
Score = 126, Expect = 2.2e-05, Identities = 55/236 (23%), Positives = 106/236 (44%)
  Q:    33 SIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVV-GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEEESQ 268
           +I+   I M +++    F  KKL            +  L+      +  I  +E  +F P + T+F +I +  I+S++ G+++PT   + T AL +   +     GI  +    F  +L K Y+K           F  PF I       I++++RL+ N+M+G++I+ +  ++  + F   P +++                  L  L G IQA++F +L++ Y + +T   EE +
  S:    21 TIVYTWITMAVIVALSWFGTKKLTTECKISRWQNLLETLVLGMNKQIRAISNQEPDRFLPIVGTLFLFISVSVIMSIIPGYQSPTGSLSTTAALAICVFVAVQFYGISKRG---FIGYL-KHYLKPTP--------FMLPFNILGEASRTIALAVRLFGNVMSGSVIIAILLSIAPIFF---PILMQA-----------------LGLLTGLIQAYIFAILSIVYIASATRVYEEKE 225
>gi|163699021|ref|ZP_02117882.1| H(+)-transporting two-sector ATPase [Methylobacterium nodulans ORS 2060] >gi|162434872|gb|EDQ45455.1| H(+)-transporting two-sector ATPase [Methylobacterium nodulans ORS 2060] (251 aa)
Score = 126, Expect = 2.3e-05, Identities = 48/187 (25%), Positives = 90/187 (48%)
  Q:    77 TLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPF----GITDIIMPWISISLRLWANIMAGALILGLFYA-LPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEP 263
           + V++  G    +F P++F++F ++ + N+  ++ +    T+   +TF L L   L  +I G     + F   F+              +P +  P      +   I   IS+S+RL+AN++AG + L +F   +P ++      +L P P  +  ++ A      L+ LV ++QA+VF  LT  Y S +  P
  S:    74 STVHQSAGHGSERFVPFVFSLFMFVLILNLFGMIPYAFTVTSHIIITFMLALMVILTVVIYGFMAHGTHFLNLFV-----------PPGVPGWLMPLIVVIEVVSFISRPISLSVRLFANMLAGHIALKIFAGFVPALLAAGAWGILSPLPLALSVAVTA------LEVLVAALQAYVFATLTSIYLSDALHP 249
>gi|164420973|ref|YP_001648595.1| ATP synthase F0 subunit 6 [Xestospongia muta] >gi|158938978|gb|ABW83902.1| ATP synthase F0 subunit 6 [Xestospongia muta] (244 aa)
Score = 126, Expect = 2.4e-05, Identities = 59/219 (26%), Positives = 98/219 (44%)
  Q:    38 TIIMTLVLVYYNFSMK--KLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           +++M L +  +   +K  KL PN+    +     N+    + +V++ +GK   K+ P++  +F +I L NI+ +  +   PTA   VTF L L   +G  +LG    K  F         I    G  +++  F         +   IS+ +RL ANI+AG L+  +       +      VL   P +I+       F   L+  V  IQA+VF +LT  Y
  S:    32 SMMMGLAVTIFWLLLKGDKLIPNRWQSVMELIHLNI----RFVVHDNLGKTGQKYFPFVLCLFLFIVLLNILGLFPYVFTPTAHIIVTFGLSLSIIIGVTLLGFLTWKIDF-------LSILMPGGAPLVLAPFLVIIETISYVARAISLGVRLAANIIAGHLLFAIISGFTFNIMSNGLVVLSFFPMLIMI------FITLLEMAVAVIQAYVFCLLTAIY 236
>gi|88711570|ref|ZP_01105658.1| ATP synthase A subunit [Flavobacteriales bacterium HTCC2170] >gi|88710511|gb|EAR02743.1| ATP synthase A subunit [Flavobacteriales bacterium HTCC2170] (360 aa)
Score = 126, Expect = 2.4e-05, Identities = 47/183 (25%), Positives = 86/183 (46%)
  Q:    86 EFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEEESQ 268
           ++ +F PY+ TVF +++  N+  +     N T    VTFAL + T L T     ++  +  ++K +F        G  V + +   P  +  + +   ++ +RL+ANIMAG ++L    AL   +       L  G      SL    F   ++ LV ++QA++F +L+  Y+  + E  E  +
  S:   194 KYKRFMPYLLTVFFFVWFLNLFGLTPLGVNVTGNIAVTFALAIITFLIT-----QFSGNGNYWKHIFWM-----PGVPVPMKFILAPIELLGVFIKPFALMIRLYANIMAGHVVLMSIIALVFTV----QNWLGGG-----LSLVLAFFLSIIELLVAALQAYIFTLLSALYFGFAVEEHEHDE 358
>gi|78044762|ref|YP_361344.1| ATP synthase F0, A subunit [Carboxydothermus hydrogenoformans Z-2901] >gi|77996877|gb|ABB15776.1| ATP synthase F0, A subunit [Carboxydothermus hydrogenoformans Z-2901] (223 aa)
Score = 126, Expect = 2.5e-05, Identities = 59/218 (27%), Positives = 102/218 (46%)
  Q:    39 IIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMG-KEFIKFTPYIFTVFCYIFLCNIISVVGFEN-------PTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYAL-PMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           II+ L ++ Y    +K++  + P+G+   +  ++      +  I+G K+  K+ P+I T F +I + N I ++ F         PT+  +VT AL +     T   GI  +   +F  F+  F              F  P  I + ++  +S+S+RL+ NI    L++G F  L PM++              ++F+L  V        L G+IQA VF +LT  Y
  S:    24 IILFLAILSY-LGTRKME--RVPRGLQNVLEMVVEGLYNFIGGIVGEKKAPKYFPFIATFFLFILISNYIGLLPFAGHEGPYVPPTSTISVTAALAIIVFFATQFFGIAEKGLGYFKHFISPFI-------------FMLPLNILEQLVRPLSLSMRLYGNIYGHELVVGTFMGLVPMLI-------------PVVFNLLGV--------LTGAIQAVVFTLLTSSY 213
>gi|126695332|ref|YP_001090219.1| ATP synthase F0 subunit 6 [Oscarella carmela] >gi|116876188|gb|ABK30952.1| ATP synthase F0 subunit 6 [Oscarella carmela] (245 aa)
Score = 126, Expect = 2.6e-05, Identities = 50/181 (27%), Positives = 81/181 (44%)
  Q:    76 KTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           +T+V + +GKE  K+ P++  +F +I L NI  +  +   PT    VTF L L   +G  I+G+   +++F   F+         G  + +  F         +   IS+ +RL AN+ AG L+  +       M       L   P +I+       F   L+  V  IQA+VF +LT  Y
  S:    69 RTMVKDNLGKEGAKYFPFVLCLFIFIVLLNIFGLFPYVFTPTVHIIVTFGLSLSILIGVTIVGLFNFRTNFMSLFM-------PGGAPLALAPFLVLIETISYMSRAISLGVRLAANLSAGHLLFAILSGFTFDMLTNGLAFLSIFPMLIMI------FITLLEMAVAVIQAYVFCLLTTIY 237
>gi|159045570|ref|YP_001534364.1| F0F1 ATP synthase subunit A [Dinoroseobacter shibae DFL 12] >gi|157913330|gb|ABV94763.1| ATP synthase F0, A subunit [Dinoroseobacter shibae DFL 12] (248 aa)
Score = 126, Expect = 2.6e-05, Identities = 50/191 (26%), Positives = 85/191 (44%)
  Q:    73 GAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFK---FYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEP 263
           G    +V ++ GK+ IK+ PYIFT+F +I + N + ++      T+   VT  L L   +   ++G     + F   F        ++       +I YF  P          +S S+RL  N+MAG  +L +F     V        + P   + + +++       L+ LV +IQA+VF +LT  Y   +  P
  S:    74 GFVYKMVEDVTGKDGIKYFPYIFTLFMFILVANFLGLIPMSFTTTSHIAVTAVLALAVFITVTVIGFVKNGAGFLSLFWVASAPLALRPILAVIEIISYFVRP----------VSHSIRLAGNMMAGHAVLKVFAGFAQV------AAVAPIAIIGVMAIYG------LEVLVSAIQAYVFTILTCVYLKDALHP 246
>gi|114705290|ref|ZP_01438198.1| ATP synthase subunit A [Fulvimarina pelagi HTCC2506] >gi|114540075|gb|EAU43195.1| ATP synthase subunit A [Fulvimarina pelagi HTCC2506] (253 aa)
Score = 126, Expect = 2.7e-05, Identities = 51/186 (27%), Positives = 95/186 (51%)
  Q:    78 LVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVG-FENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLF--YALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEP 263
           ++ +  G   ++F P++F++F +I + N+I +   F   T+   VTFAL +      +  GIK     FF  F+       +    V++P       I+ +  P +S+S+RL+AN++AG + L +F  + + +  F     +    P ++  +L A      L++LV ++QA+VF VLT  Y + +  P
  S:    75 MLRDAAGTAGMRFFPFVFSIFTFILVANLIGMFPYFFTVTSHLIVTFALAMMVMSVVVGYGIKKHGVKFFNVFV------PEGVPAVLMPLVVLIEIISFLSRP-VSLSVRLFANMLAGHITLKVFAGFVVSLSAFGALGVIGSILPFLMAVALTA------LEFLVAALQAYVFAVLTCLYLNDAVHP 250
>gi|163854289|ref|YP_001633635.1| ATP synthase F0 subunit 6 [Negombata magnifica] >gi|163639444|emb|CAM06600.1| ATP synthase F0 subunit 6 [Negombata magnifica] (244 aa)
Score = 126, Expect = 2.7e-05, Identities = 61/225 (27%), Positives = 104/225 (46%)
  Q:    32 TSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGF-ENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFY-IKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           +SI+V+ ++  + L+   F   KL PN+    +     N+    +++V+E +GK   K+ P++  +F +I L N++ +  +   PTA   VTF L L       +LG        F  F  +F  I    G  +++  F         ++  IS+ +RL ANI AG L+  +       +      +L   P +I+       F   L+ +VG IQA+VF +LT  Y
  S:    31 SSIMVVGVVFIVGLL---FKGDKLIPNRWQLIMEIIHSNM----RSVVHENLGKTGQKYFPFVLCLFLFIVLLNVLGLFPYIFTPTAHIVVTFGLSLSIMTAVTLLG--------FLTFKIEFLSILVPGGVPLIMAPFLVIIETLSYMLRAISLGVRLAANISAGHLLFAILSGFAFNLLFNGFLILGGIPVLIM------GFITLLEMMVGVIQAYVFSLLTTIY 236
>gi|163794975|ref|ZP_02188944.1| F0F1-type ATP synthase, subunit a [alpha proteobacterium BAL199] >gi|159179794|gb|EDP64321.1| F0F1-type ATP synthase, subunit a [alpha proteobacterium BAL199] (241 aa)
Score = 126, Expect = 2.7e-05, Identities = 49/179 (27%), Positives = 86/179 (48%)
  Q:    78 LVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENP-TALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           +V E +G +   + P+IF +F +I L N++ +V +    T+   VTFAL +   +G  ++ I  +    F  F F       +G  + +     P  I   +   +S+S+RL+AN+MAG  ++ +F    + +      V    P V+L +L         + LV  +QA+VF +LT  Y
  S:    71 MVRENVGSDGRPYFPFIFALFMFILLGNLLGMVPYSYTFTSQIIVTFALAITVFIGVTLVAI-VRHGVHFLTFFFP------AGAPIYMAPLLIPIEILSYLSRPVSLSVRLFANMMAGHTMMKVFGGFVVAL-----GVFGVAPMVVLVALTG------FEILVAVLQAYVFTILTCIY 232
>gi|145596148|ref|YP_001160445.1| ATP synthase F0, A subunit [Salinispora tropica CNB-440] >gi|145305485|gb|ABP56067.1| ATP synthase F0, A subunit [Salinispora tropica CNB-440] (259 aa)
Score = 126, Expect = 2.8e-05, Identities = 61/230 (26%), Positives = 112/230 (48%)
  Q:    35 IVITIIMTLVLVYY--NFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVV-GFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPE 264
           +++ + + LV+V+Y   +   KL P+K  + +A  ++ L+     +V E MG   I+F PY   +F +I + NI S+V G + +P A       L + + +  + +GI+      + K            + ++IP  F    + + ++  ++++LRL+AN+ AG L+L +F     VM   D   ++      +FS        F + LV  +QA+VFV L+  Y   S   E
  S:    35 LMVWLAVGLVIVFYMATYRNPKLVPSKG-QWLAESVYGLVR--DNIVREQMGNAGIRFAPYFTVLFSFILVTNIFSIVPGLQISPNAHIAFPIVLSVISYVLYLAVGIRKHGLLKYLKMSLILPGVPWPMHFLLIPIEF----LQNFVVRPVTLALRLFANMFAGHLLLLVFTVGGFVMLSADNLFVQV---TSVFSFAMAIVMAFFEALVAVLQAYVFVTLSANYVGTSLAEE 258
>gi|49473959|ref|YP_032001.1| F0F1 ATP synthase subunit A [Bartonella quintana str. Toulouse] >gi|49239462|emb|CAF25813.1| ATP synthase A chain transmembrane protein [Bartonella quintana str. Toulouse] (252 aa)
Score = 125, Expect = 2.9e-05, Identities = 57/235 (24%), Positives = 110/235 (46%)
  Q:    29 SEITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVG-FENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEP 263
           + ++  I+ T++ T V ++ + S + L P +  + I+   +  +    + + E  G + ++F P +F++F +I + N I +   F   T+   +TF+L +   L  +  G +     F   F+        SG  V+I        +       IS+SLRL+AN++AG + L +F    + M   +  ++  G  ++   L        L++LV  +QA+VF VLT  Y + +  P
  S:    30 TNVSFFIIATVVATSVFLFISSSSRGLVPTRM-QSISEIAYEFVA---STLRESCGVQGMQFFPLVFSLFTFILVANFIGLFPYFYTITSQIMITFSLAMLVILTVVGYGFRKHGIGFLKLFV-------PSGVPVVILPLVTMIEVISFFSRPISLSLRLFANMLAGHITLKVFSGFIVSMI--ELGIMGVGGSIL--PLIMTVAITALEFLVAFLQAYVFTVLTCMYLNDAVHP 250
>gi|118579038|ref|YP_900288.1| ATP synthase F0, A subunit [Pelobacter propionicus DSM 2379] >gi|118501748|gb|ABK98230.1| ATP synthase F0, A subunit [Pelobacter propionicus DSM 2379] (229 aa)
Score = 125, Expect = 2.9e-05, Identities = 57/202 (28%), Positives = 94/202 (46%)
  Q:    61 PKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVV-GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKV-MIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTE 262
           P G+  F+  ++G  + ++ E MG+    + P + TV  ++ + N+I ++ GF  PTA    T A  +   + T ++GIK              YIK   G  + + P  F    I  +  P +S++LRL+ N+    L+L +F+ L           L P P ++            +  LV  IQAFVF++LT+ Y  GS E
  S:    53 PCGLQNFMEVVVGGVENMIVETMGEHGRPYFPLVATVGLFVLVSNLIGLIPGFFPPTANINTTAACAIVVFIATHVVGIKRHGIG---------YIKHFCGPILWLAPVMFFIEVIGHLSRP-LSLTLRLFGNMNGHELVLIIFFGL--------APFLVPLPMML------------MGVLVSFIQAFVFMLLTMIYIQGSLE 226
>gi|57239563|ref|YP_180699.1| F0F1 ATP synthase subunit A [Ehrlichia ruminantium str. Welgevonden] >gi|58579551|ref|YP_197763.1| F0F1 ATP synthase subunit A [Ehrlichia ruminantium str. Welgevonden] >gi|58617605|ref|YP_196804.1| F0F1 ATP synthase subunit A [Ehrlichia ruminantium str. Gardel] >gi|15811139|gb|AAL08819.1|AF308665_2 hypothetical ATP synthase A chain [Cowdria ruminantium] >gi|57161642|emb|CAH58571.1| ATP synthase A subunit [Ehrlichia ruminantium str. Welgevonden] >gi|58417217|emb|CAI28330.1| ATP synthase A chain [Ehrlichia ruminantium str. Gardel] >gi|58418177|emb|CAI27381.1| ATP synthase A chain [Ehrlichia ruminantium str. Welgevonden] (243 aa)
Score = 125, Expect = 3.1e-05, Identities = 60/233 (25%), Positives = 113/233 (48%)
  Q:    26 EYRSEITSIIVITIIMTLVL---VYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISV--VGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPW----ISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWS 258
           EY  + T+  +  ++ T ++    Y     + + PN P + I   I++ +    + +   +GKE +++ P +FT+F +I +CN++ +  +GF   T+   VTFA+ +   +    +G K+Q + F +  L +             P +  P  +   +  +    +S+S+RL AN++AG  I+ +     + M       L P P  I F +  + F  F    V  +QA++F VLT  Y S
  S:    22 EYNIDFTNASLFMVLSTFLISLSCYVGLRKESVIPN-PLQSIIEIIYDFI---VSTIESNVGKEGLQYVPLVFTIFTFILVCNLLGILPLGF-TVTSHIAVTFAISMIVFISVTFIGFKHQGTHFLHILLPQ-----------GTPMWLAPMMVLIELFAYCARPVSLSIRLAANMIAGHTIIKVIAGFVINM----NIFLTPLP--IAFIIILIGFEIF----VAILQAYIFTVLTCVYLS 237
>gi|114454|sp|P21903|ATP6_PROMO ATP synthase a chain, sodium ion specific (ATPase protein 6) >gi|45601|emb|CAA46894.1| ATPase a subunit [Propionigenium modestum] >gi|45608|emb|CAA38579.1| ATPase a subunit [Propionigenium modestum] (289 aa)
Score = 125, Expect = 3.1e-05, Identities = 57/228 (25%), Positives = 99/228 (43%)
  Q:    33 SIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIIS---VVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPY-FFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGS 260
           ++I    +M  +++ + +S K L+   P +  AFF   + G    L  +++G    K+  YI T+F ++ + NI+S   + GF +   + ++  AL   T      +G+    +  F    F+          +  P     P  +        +IS+RL+ N+ AG +ILGL Y    V                   L   P H + D   G +Q+FVF++LT+ Y  GS
  S:    70 TVISTWFVMLFLIMVFRWSSKNLEV-VPERKQAFFE-TIYGFLDDLYGQLLGNWKKKYFTYIGTLFLFLLISNIVSFFPIPGFSSENGVFSIAPALRTPTADLNTTVGLALLTTYSFIAASFRTSGFFGFFKGLFEPMPLMFPINLAGEFAKPTNISIRLFGNMFAGMVILGLLYKAAPV-------------------LIPAPLHLYFDLFSGVVQSFVFIMLTMVYIQGS 280
>gi|84500354|ref|ZP_00998603.1| ATP synthase subunit A [Oceanicola batsensis HTCC2597] >gi|84391307|gb|EAQ03639.1| ATP synthase subunit A [Oceanicola batsensis HTCC2597] (264 aa)
Score = 125, Expect = 3.2e-05, Identities = 63/235 (26%), Positives = 108/235 (45%)
  Q:    29 SEITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTT-----VTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNP-FGITDIIMPW---ISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEP 263
           + +T  + + I+  +VL+    S +   P++  + IA   +   G    +V ++ GK+ + F PYI T+F +I   N + ++    P + TT     VT  L L   L   I G     S    KFL  F++ +        P    P   I ++I  +   +S S+RL  N+MAG  ++ +F     +       V+ P   V + +++       L+ LV  IQA+VF +LT  Y   +  P
  S:    50 TNVTLWMALAIVAVIVLMVLATSRRATIPSRG-QSIAELAY---GFVYKMVEDVAGKDAVGFFPYIMTLFLFIVSANFLGLI----PMSFTTTSHFAVTVVLALAVFLTVTIYGFMKNGS----KFLGLFWVASA-------PLALRPILAIIEVISYFVRPVSHSIRLAGNVMAGHAVIKVFAGFAAI------AVISPVSVVAITAMYG------LEVLVAFIQAYVFTILTCVYLKDALHP 262
>gi|163726320|ref|ZP_02133834.1| ATP synthase F0, A subunit [Desulfatibacillum alkenivorans AK-01] >gi|161400375|gb|EDQ24629.1| ATP synthase F0, A subunit [Desulfatibacillum alkenivorans AK-01] (229 aa)
Score = 125, Expect = 3.3e-05, Identities = 51/192 (26%), Positives = 86/192 (44%)
  Q:    71 LLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVV-GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTE 262
           L+G  +  +  ++G+E   F P   T+F YI LCN++ ++ GF  PTA      +  +     T  LGIK+  + +   F+         G  + +   F            +S++ RL+ N+M   L+L       M++F      L P P + +  L AV            +QAFVF +L++ Y++GS E
  S:    62 LVGGLEEFMVGVVGEEGRWFLPLAATLFLYILLCNLMGLLPGFFPPTANVNTPLSCAIVVFCFTHFLGIKHHGAKYVKHFM---------GPILALTPLFLILETISHFARVLSLTFRLFGNMMGHELVL-------MILFFLAGAFLAPLPIMAMGILVAV------------VQAFVFFMLSIMYFAGSIE 226
>gi|152993168|ref|YP_001358889.1| F0F1 ATP synthase subunit A [Sulfurovum sp. NBC37-1] >gi|151425029|dbj|BAF72532.1| F0F1-type ATP synthase, A subunit [Sulfurovum sp. NBC37-1] (241 aa)
Score = 125, Expect = 3.5e-05, Identities = 58/237 (24%), Positives = 104/237 (43%)
  Q:    32 TSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFI-KFTPYIFTVFCYIFLCNIISVV-GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEEESQ 268
           +++++  +++  V+V     M        P G    +   LG    +  +++G+E   K+ P +  V  +IF+ N+I ++ GFE+PT+   VT  L L   +     GIK          +  ++       K++ P  F P  I   +   IS+S RL+ NI    L L +   L +V F      + P P  +L +  A+            +Q FVF++L   Y +G+   +EE +
  S:    18 SAVLIAHLLLVAVIVIMIAKMATKSFRAVPNGTQNVMEAYLGGVVAMGKDVIGEELARKYLPLVAAVGLFIFVSNVIGIIPGFESPTSNINVTLPLALMVFVYYNYEGIKKHG-------VVHYFAHFAGPVKLLAPLMF-PIEIVSHLSRIISLSFRLFGNIKGDDLFLWVL--LMLVPF------VAPLPAYLLLTFSAL------------LQTFVFMILIYVYLAGAVAIDEEHE 228
>gi|30024053|ref|NP_267925.2| F0F1 ATP synthase subunit A [Lactococcus lactis subsp. lactis Il1403] >gi|116512628|ref|YP_811535.1| F0F1 ATP synthase subunit A [Lactococcus lactis subsp. cremoris SK11] >gi|15082068|gb|AAK84014.1|AF393838_3 H+-ATPase F0-part a-subunit [Lactococcus lactis subsp. lactis] >gi|15963432|dbj|BAB69466.1| H+-ATPase a subunit [Lactococcus lactis subsp. lactis] >gi|116108282|gb|ABJ73422.1| F0F1-type ATP synthase, subunit a [Lactococcus lactis subsp. cremoris SK11] (237 aa)
Score = 125, Expect = 3.5e-05, Identities = 62/235 (26%), Positives = 102/235 (43%)
  Q:    24 PFEYRSEITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVG----------FENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWS 258
           P  +   IT +  +T+++   LV++     +L P      + + +  + G  K     +   E  +F    FT+F ++ + N I +V           +++PTA  TV   L L   + +  LG++        KF FK Y+K         P    P  I +     +S+ LRL+ NI AG ++LGL   +        P         I FSLF           + ++QA+VFV+LT  Y S
  S:    11 PIPFDGTITVMTFVTVLIVFGLVFWASRNMQLKPKGKQNVLEWVVDFVNGVSKD---NVGPHEAPRFALMNFTLFSFLLIANCIGLVTKISTPGDVSLWKSPTANPTVDLTLALLVVVMSNTLGVQ--------KFGFKGYLKVAFWKD---PKGLLPMNILEEFTNALSLGLRLYGNIFAGEIMLGLIAGMIQSTMWMLPVAWILEVAWIGFSLF-----------ISALQAYVFVLLTNLYIS 230
>gi|86742394|ref|YP_482794.1| F0F1 ATP synthase subunit A [Frankia sp. CcI3] >gi|86569256|gb|ABD13065.1| ATP synthase F0, A subunit [Frankia sp. CcI3] (284 aa)
Score = 125, Expect = 3.7e-05, Identities = 48/179 (26%), Positives = 91/179 (50%)
  Q:    82 IMGKEFIKFTPYIFTVFCYIFLCNIISVV-GFENP-TALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGI--TDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGS 260
           ++G++  ++TPY+  +F ++ +CN+++VV G + P T+   V   L L T +     GIK   +  +    FK  I       + I     P  I  T I+ P+ ++++RL+AN+ AG ++L +F      +  + P V   G   +L ++    F   +D    ++QA++  +LT  Y  G+
  S:    85 VIGEKGTRYTPYLLVLFSFVLICNVLAVVPGAQFPATSRIAVPMVLALVTYVLFNYAGIKANGAGPY----FKEMIDPAPTAPLWIRVLLAPIEILSTLIVRPF-TLAVRLFANMFAGHILLLVFSLGADYLLPKPPYVF--GAASLLVAIILTAFELVID----ALQAYIITILTAAYIGGA 256
>gi|95929954|ref|ZP_01312694.1| ATP synthase F0, A subunit [Desulfuromonas acetoxidans DSM 684] >gi|95133923|gb|EAT15582.1| ATP synthase F0, A subunit [Desulfuromonas acetoxidans DSM 684] (224 aa)
Score = 124, Expect = 3.9e-05, Identities = 62/244 (25%), Positives = 105/244 (43%)
  Q:    19 FSDWKPFEYRSEITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVV-GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTE 262
           F  W   +  + +   +  T  + L+L+   F + +      P G    + +++G  + L+ E MG +   + P I T   +I + N++++V GF  PTA      AL L     T I+G+K    ++   F+             + P  F    I  +  P +S+SLRL+ N+    ++L +F+AL                 V LF    +   G L   V  IQAFVF +L + Y +G+ E
  S:     7 FLQWVEQQLHTHLGEHVTYTWFVMLLLIALAFVISR-GIKMVPSGWQNLMESVVGGIENLITETMGPKGKTYFPLIATFALFILVSNLVALVPGFYPPTANLNTNAALALTVFAMTHIIGVKEHGIAYLKHFMGPIL--------ALAPLIFIIEIIGHLARP-LSLSLRLFGNMYGHEIVLMIFFAL-----------------VPLFLPIPMMMMGIL---VAFIQAFVFTLLAMIYIAGALE 221
>gi|83856029|ref|ZP_00949558.1| putative ATP synthase A chain [Croceibacter atlanticus HTCC2559] >gi|83849829|gb|EAP87697.1| putative ATP synthase A chain [Croceibacter atlanticus HTCC2559] (361 aa)
Score = 124, Expect = 4.1e-05, Identities = 61/229 (26%), Positives = 107/229 (46%)
  Q:    34 IIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKE--FIKFTPYIFTVFCYIFLCNIISVVGFENPTALT---TVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTE 262
           + +  I++ L+ +      +K D N P  GIA F+  L+   +  +   M  E  + K+ P++ TVF +I++ NI  ++   N   L+     T  L  FT + T   G K      F+            G  V I  F  P  +  +I+  +S+++RL+ANI AG +I+    +L  +        L   P  + F+LF       ++ +V +IQA++F VL+  Y+  + E
  S:   143 MFISVIVLLLIFITAARKYRKSDTNVP-SGIASFVEPLIIFVRDEIGIPMIGEHKYKKYMPFLLTVFFFIWINNIFGLIPIANGANLSGNIAFTAVLAGFTFIITTFSGNKNYWQHIFWM----------PGVPVPIKIFLIPIELIGMIVKPVSLAIRLFANITAGHIIILSLISLIFIF-----NSLAVAPVSVAFALFI----SIIEIIVTAIQAYIFTVLSALYFGMAVE 356
>gi|158340803|ref|YP_001521971.1| F0F1 ATP synthase subunit A [Acaryochloris marina MBIC11017] >gi|158311044|gb|ABW32657.1| ATP synthase F0, A subunit [Acaryochloris marina MBIC11017] (234 aa)
Score = 124, Expect = 4.2e-05, Identities = 44/189 (23%), Positives = 95/189 (50%)
  Q:    79 VYEIMGKEFIKFTPYIFTVFCYIFLCNIISVV-GFENPTALTTVTFALGLFTTLGTIILGIKYQK-SSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEEES 267
           + EI+ +    + P+I T+F +I L N++SV+ G++ PT   + T AL L       + G++ +    +  ++L          N +M+P  FN  G    I   +++++RL+ N+M+G +I+G+  ++  + F   P +++                  L  L G IQA++F +L + + + +++ ++ +
  S:    67 IQEIIDQPADPYLPFIGTLFIFIALSNLLSVIPGYQPPTGSLSTTTALALCVFFAVPLYGVQKKGVRGYLQQYL--------QPNPIMLP--FNIIGDFSRI---VALAVRLFGNVMSGTMIVGILLSVAPLFF---PVMMQ-----------------VLGLLTGVIQAYIFAILAMVFIAAASQVDQHN 224
>gi|153806529|ref|ZP_01959197.1| hypothetical protein BACCAC_00793 [Bacteroides caccae ATCC 43185] >gi|149131206|gb|EDM22412.1| hypothetical protein BACCAC_00793 [Bacteroides caccae ATCC 43185] (377 aa)
Score = 124, Expect = 4.3e-05, Identities = 54/197 (27%), Positives = 94/197 (47%)
  Q:    60 PPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGF----ENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           P   I F    ++     ++   +G  + KF PY+ T F +IF+ NI+ ++ F     N T    +T  L + T L   I G K+     F+  +  +++K       M+P F   FGI     P+ ++ +RL+AN++AG + + +   L  +     P +   G   +   LF + F   L+ LV  IQA+VF +L+  +
  S:   173 PGGFIGFMEMFIMMVNDDIIKSCVGPNYRKFAPYLLTAFFFIFVNNIMGLIPFFPGGANVTGNIAITMVLAICTFLAVNIFGTKHYWKDIFWPDV-PWWLKVPVP---MMP-FIEFFGI--FTKPF-ALMIRLFANMLAGHMAMLVLTCLIFISASMGPAL--NGTLTVASVLFNI-FMNALELLVAFIQAYVFTMLSAVF 362
>gi|78187940|ref|YP_375983.1| F0F1 ATP synthase subunit A [Pelodictyon luteolum DSM 273] >gi|78167842|gb|ABB24940.1| H+-transporting two-sector ATPase, A subunit [Pelodictyon luteolum DSM 273] (341 aa)
Score = 124, Expect = 4.5e-05, Identities = 53/231 (22%), Positives = 108/231 (46%)
  Q:    34 IIVITIIMTLVLVYYNF---SMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEI-MGKEFIKFTPYIFTVFCYIFLCNIISVVGF-ENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGF---LDWLVGSIQAFVFVVLTLCYWSGSTEPE 264
           ++++ I+  ++LV ++F   + +K+ P   P G+A  +  L+   +  V +  +G  +    PY+ TVF +I LCNI+ ++ +    T    VT  L +FT   T       Q +S     L  +     +G    +     P  +  +     ++++RL+AN+ AG +++     +  ++              ++ +  +VPF  F   L+  V  +QAF+F +L+  +   +T  E
  S:   112 VVMLWIVSAILLVLFSFVGAAYRKITPKTAPSGVANTMEALVEFIRLDVAKSNIGHGYEAHLPYLLTVFMFILLCNILGLIPYGATATGNINVTLTLAVFTFFIT-------QAASLKAHGLKGYLTHLTAGTHWSLWIIMIPIEVIGLFTKPFALTVRLFANMTAGHIVILSLIFISFIL-----------KSYVVAAAVSVPFSIFIYLLEIFVAFLQAFIFTMLSALFIGLATAHE 332
>gi|148266258|ref|YP_001232964.1| ATP synthase F0, A subunit [Geobacter uraniireducens Rf4] >gi|146399758|gb|ABQ28391.1| ATP synthase F0, A subunit [Geobacter uraniireducens Rf4] (229 aa)
Score = 124, Expect = 4.6e-05, Identities = 57/202 (28%), Positives = 89/202 (44%)
  Q:    61 PKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVV-GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTE 262
           P G+  F+  ++G  + +V E MG     F P I T+  +I + N+I +V GF  PTA    T A  +   + T ++GIK     +   FL              + +F    G    +   IS++LRL+ N+    L+L +F+ L           L P P ++            +  LV  IQAFVF++L + Y  GS E
  S:    53 PGGLQNFMEVIIGGVENMVVETMGHHGKPFFPLIATLAIFILVSNLIGLVPGFFPPTANINTTAACAVIVFVTTHVVGIKEHGFKYIKHFLGPILWLAP------MMFFIEVIGHFSRV---ISLTLRLFGNMNGHELVLMIFFGL--------APFLVPLPMML------------MGVLVSFIQAFVFMLLAMIYIQGSLE 226
>gi|86131152|ref|ZP_01049751.1| ATP synthase A subunit [Cellulophaga sp. MED134] >gi|85818563|gb|EAQ39723.1| ATP synthase A subunit [Dokdonia donghaensis MED134] (392 aa)
Score = 124, Expect = 4.6e-05, Identities = 51/174 (29%), Positives = 90/174 (51%)
  Q:    83 MGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNP-FGITDIIMPWI----SISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           +G+ + KFT Y+ TVF +I++ N++ ++ F  N T    VT AL + T +  +  G K+    F+   L+             IPY F P  GI ++I   +    S+ +RL+ANI AG  ++    A+ ++M     ++   G  ++  SLF   F   ++ LV  +QA++F  L+  +
  S:   199 IGESYRKFTGYLLTVFFFIWILNLVGLMPFGFNVTGQIAVTAALAVITLVIYVFSGNKH----FWGHMLW----------MPGIPYVFRPLLGIIELIGTLVIKPFSLLVRLFANITAGHTVVMSLVAVGILM---QESLSATGSTIV--SLFLSLFIMLIEVLVAFLQAYIFTTLSALF 359
>gi|125624730|ref|YP_001033213.1| F0F1 ATP synthase subunit A [Lactococcus lactis subsp. cremoris MG1363] >gi|6048348|gb|AAF02203.1|AF059739_3 H+-ATPase F0-part a-subunit [Lactococcus lactis subsp. cremoris] >gi|124493538|emb|CAL98519.1| ATP synthase F0, A subunit [Lactococcus lactis subsp. cremoris MG1363] (237 aa)
Score = 124, Expect = 4.7e-05, Identities = 62/235 (26%), Positives = 102/235 (43%)
  Q:    24 PFEYRSEITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVG----------FENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWS 258
           P  +   IT +  +T+++   LV++     +L P      + + +  + G  K     +   E  +F    FT+F ++ + N I +V           +++PTA  TV   L L   + +  LG++        KF FK Y+K         P    P  I +     +S+ LRL+ NI AG ++LGL   +        P         I FSLF           + ++QA+VFV+LT  Y S
  S:    11 PIPFDGTITVMTFVTVLIVFGLVFWASRNMQLKPKGKQNVLEWVVDFVNGVSKD---NVGPHEAPRFGLMNFTLFSFLLIANCIGLVTKISTPGDVSLWKSPTANPTVDLTLALLVVVMSNTLGVQ--------KFGFKGYLKVAFWKD---PKGLLPMNILEEFTNALSLGLRLYGNIFAGEIMLGLIAGMIQSTMWMLPVAWILEVAWIGFSLF-----------ISALQAYVFVLLTNLYIS 230
>gi|163867851|ref|YP_001609055.1| F0F1 ATP synthase subunit A [Bartonella tribocorum CIP 105476] >gi|161017502|emb|CAK01060.1| ATP synthase, A chain [Bartonella tribocorum CIP 105476] (261 aa)
Score = 123, Expect = 5.0e-05, Identities = 57/235 (24%), Positives = 112/235 (47%)
  Q:    29 SEITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVG-FENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLF--YALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEP 263
           + ++   V+T+++T   ++ + S + L P +  + ++   +  +    + + E  G + ++F P +F++F +I + N I +   F   T+   +TF+L +   L  I  G      SF   F+        SG  V++        I   +   IS+SLRL+AN++AG + L +F  + + M+            P ++  ++ A      L++LV  +QA+VF VLT  Y + +  P
  S:    39 TNVSLFTVVTVVITAAFLFISSSSRGLVPTRM-QSLSEMAYEFVA---STLRESSGVQGMQFFPLVFSLFTFILVANFIGLFPYFYTVTSQIMITFSLAMVVILTVIGYGFYKHGISFLKLFV-------PSGVPVVVLPLVTMIEIISFLSRPISLSLRLFANMLAGHITLKVFAGFIVSMIGVGIVGVGGAVLPLIMTVAITA------LEFLVAFLQAYVFTVLTCMYLNDAIHP 259
>gi|153811242|ref|ZP_01963910.1| hypothetical protein RUMOBE_01634 [Ruminococcus obeum ATCC 29174] >gi|149832740|gb|EDM87824.1| hypothetical protein RUMOBE_01634 [Ruminococcus obeum ATCC 29174] (190 aa)
Score = 123, Expect = 5.0e-05, Identities = 48/172 (27%), Positives = 78/172 (45%)
  Q:    82 IMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLT 253
           I+G+E  ++ PY+ +   YI + NI  V GF  PT    VT AL L +     I+ I+Y  S F  + L  F         +M+     P  I ++ +   S+ +RL+ N++   +++ L                    E I  ++  +PF  + D+  G IQA+VFV LT
  S:    41 ILGEEGKRYIPYLMSTVIYIGIANIAGVFGFTPPTKDMNVTIALSLMS-----IILIEY--SGFHKRGLKGFLHSFAEPVPIML-----PINILELAIRPTSLCMRLFGNVLGSFVVMKLL-------------------EFICPAILPIPFSLYFDFFDGFIQAYVFVFLT 181
>gi|164420958|ref|YP_001648525.1| ATP synthase F0 subunit 6 [Callyspongia plicifera] >gi|158668097|gb|ABW76559.1| ATP synthase F0 subunit 6 [Callyspongia plicifera] (244 aa)
Score = 123, Expect = 5.4e-05, Identities = 50/181 (27%), Positives = 82/181 (45%)
  Q:    76 KTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFY-IKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           +++V++ +GK   K+ P++  +F +I + N++ +  +   PT    VTF L     +G  +LG        F  F F F  I T  G  +++  F         +   IS+ +RL AN+ AG L+  +       M      VL   P +I+       F   L+  V  IQA+VF +LT  Y
  S:    68 RSVVHDNLGKTGEKYFPFVLCLFIFIVMLNVMGLFPYVFTPTVHIVVTFVLSFSILMGVTLLG--------FITFKFNFLSILTPGGAPLVLAPFLILIETLSYMSRAISLGVRLAANLTAGHLLFAIISGFAFNMLSNGLIVLSXFPLLIMI------FITLLEMAVAVIQAYVFCLLTAIY 236
>gi|126464838|ref|YP_001041814.1| F0F1 ATP synthase subunit A [Rhodobacter sphaeroides ATCC 17029] >gi|126106653|gb|ABN79178.1| ATP synthase F0, A subunit [Rhodobacter sphaeroides ATCC 17029] (227 aa)
Score = 123, Expect = 6.2e-05, Identities = 48/169 (28%), Positives = 77/169 (45%)
  Q:    94 IFTVFCYIFLCNIISVV-GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTE 262
           I T+  ++  CN  S++ G E PTA      AL L   L TI  GI+ Q     + +L  F   T +    MIP       + + I   +S+ LRL+ N+M+G  +LG+  +L  +                   L  +P    LD L G++QA++F +L L + + + E
  S:    81 IGTLLLFVLTCNWSSLIPGVEPPTAHLETDAALALIVFLTTIGFGIRAQG---LWGWLRAFARPTWA----MIP-----LNLVEQITRSVSLMLRLFGNVMSGVFVLGIVLSLAGL-------------------LVPIPLMA-LDLLTGAVQAYIFAILALVFIASAVE 218
>gi|145220544|ref|YP_001131253.1| F0F1 ATP synthase subunit A [Prosthecochloris vibrioformis DSM 265] >gi|145206708|gb|ABP37751.1| ATP synthase F0, A subunit [Prosthecochloris vibrioformis DSM 265] (348 aa)
Score = 123, Expect = 6.3e-05, Identities = 49/221 (22%), Positives = 101/221 (45%)
  Q:    36 VITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEI-MGKEFIKFTPYIFTVFCYIFLCNIISVVGF-ENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGF---LDWLVGSIQAFVFVVLTLCY 256
           ++++I+ +V      + KK+   + P G+A  +  L+   +  V +  +G  + K  PY+ TVF +I LCN++ ++ +    T    VT  L +FT   T    +K      + + L        +G    +     P  +  +     ++++RL+AN+ AG +++     +  ++              I+ +  +VPF  F   L+  V  +QAF+F +L+  +
  S:   124 IVSVILLVVFAAVGGTYKKMTARQAPGGLANAMEALVEFIRLDVAKSNIGHGYEKHLPYLLTVFMFILLCNLLGLIPYGATATGNINVTLTLAVFTFFITQTASLKAHGLKGYLQHL-------TAGTHWSLWIIMIPIEVIGLFTKPFALTVRLFANMTAGHIVILSLIFISFIL-----------KSYIVAAAVSVPFSIFIYLLEIFVAFLQAFIFTMLSALF 331
>gi|108804480|ref|YP_644417.1| ATP synthase F0, A subunit [Rubrobacter xylanophilus DSM 9941] >gi|108765723|gb|ABG04605.1| ATP synthase F0, A subunit [Rubrobacter xylanophilus DSM 9941] (258 aa)
Score = 122, Expect = 6.4e-05, Identities = 56/184 (30%), Positives = 94/184 (51%)
  Q:    73 GAFKTLVYEI-----------MGKEFIKFTPYIFTVFCYIFLCNIISVVGFENP-TALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           GA++ LV E+           + +E  K+ PY  T+F ++ + NII +     P T+  + T  L LFT + T   G++         +L  +         +M P  +    I +   P ++++LRL+ANI+AG LI+ +F  L ++++   PT     P       FAV F+ F +  V  IQA++F +LT  Y
  S:    66 GAYQVLVEELFRFGRDMFGGQINEEGRKWFPYSLTLFIFLLVLNIIGLFPNSYPVTSNISFTATLALFTFVLTQYEGVRRNG---LVTYLKSWAPADLPAKPLMYPIMWFLHLIQEFTKP-LTLALRLYANILAGHLIIFVF--LSLILYFGLPTAFVSVP-------FAVVFYAF-EIFVAVIQAYIFAILTQVY 247
>gi|126738040|ref|ZP_01753761.1| F0F1 ATP synthase subunit A [Roseobacter sp. SK209-2-6] >gi|126720537|gb|EBA17242.1| F0F1 ATP synthase subunit A [Roseobacter sp. SK209-2-6] (266 aa)
Score = 122, Expect = 6.5e-05, Identities = 53/191 (27%), Positives = 84/191 (43%)
  Q:    73 GAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVV-GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFK---FYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLF--YALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEP 263
           G    +V ++ GK+ +KF PYI T+F +I + N + ++ G    T+   VT  L         I+G     + F   F        ++       +I YF  P          +S S+RL  N+MAG  +L +F  +A  + +F   P             +FA+     L+ LV  IQA+VF +LT  Y   +  P
  S:    91 GFIYKMVEDVAGKDGVKFFPYIMTLFMFILMANFLGLIPGSFTTTSHIAVTAVLAALVFFTVTIVGFVKNGAGFLGLFWVSSAPLALRPILAVIELISYFVRP----------VSHSIRLAGNVMAGHAVLKVFAGFAAALGLFSFLP-------------IFAITAVYALEVLVAFIQAYVFTILTCVYLKDALHP 264
>gi|89053258|ref|YP_508709.1| F0F1 ATP synthase subunit A [Jannaschia sp. CCS1] >gi|88862807|gb|ABD53684.1| ATP synthase F0 A subunit [Jannaschia sp. CCS1] (282 aa)
Score = 122, Expect = 6.6e-05, Identities = 54/191 (28%), Positives = 85/191 (44%)
  Q:    73 GAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTT-----VTFALGLFTTLGTIILGIKYQKSSFFYKFLFK---FYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEP 263
           G  + +V ++ GK+ + + PYIFT+F YI   N + ++    P++ TT     VT  L L   +   I+G     + F   F        ++       +I YF  P          +S S+RL   ++AG  +L +F      M          G   I   L  V  +G L+ LV +IQA+VF +LT  Y   +  P
  S:   107 GFVRQMVEDVAGKDALPYFPYIFTLFLYILCANFLGLI----PSSFTTTSHIAVTAVLALAVFITVTIVGFVKNGAGFLSLFWVSSAPLVLRPILAVIEIISYFVRP----------VSHSVRLAGVMLAGHAVLKVFAGFAGAM----------GLASIAPILGVVAIYG-LEVLVSAIQAYVFTILTCVYLKDALHP 280
>gi|182702579|ref|ZP_02955578.1| ATP synthase F0, A subunit [Methylocella silvestris BL2] >gi|172067661|gb|EDT53777.1| ATP synthase F0, A subunit [Methylocella silvestris BL2] (250 aa)
Score = 122, Expect = 7.3e-05, Identities = 47/180 (26%), Positives = 86/180 (47%)
  Q:    84 GKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYA-LPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEP 263
           G+E ++F P++F++F ++   N+I ++ +    T+   VTFAL        I+ G+    + F   F+        SG    +  F     +   I   IS+S+RL+AN++AG + L +    +  ++      V+ P P   + +L A       + LV  +QA+VF +LT  Y + +  P
  S:    80 GREGMRFFPFVFSLFLFVLFSNLIGLIPYTFTVTSQIIVTFALAALVIGTVIVYGVIRHGAHFLNLFV-------PSGVAPALLPFIVLIEVISFISRPISLSVRLFANMLAGHITLKVLGGFVAALLGAGAYAVIAPLPLAGVVALTA------FELLVAVLQAYVFAILTCVYLNDAIHP 248
>gi|29346124|ref|NP_809627.1| ATP synthase A subunit [Bacteroides thetaiotaomicron VPI-5482] >gi|29338018|gb|AAO75821.1| ATP synthase A subunit [Bacteroides thetaiotaomicron VPI-5482] (368 aa)
Score = 122, Expect = 7.6e-05, Identities = 54/197 (27%), Positives = 94/197 (47%)
  Q:    60 PPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGF----ENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           P   I F    ++     ++   +G  + KF PY+ T F +IF+ NI+ ++ F     N T    +T  L + T L   I G K+     F+  +  +++K       M+P F   FGI     P+ ++ +RL+AN++AG + + +   L  +     P +   G   +   LF + F   L+ LV  IQA+VF +L+  +
  S:   166 PGGFIGFMEMFIMMVNDDIIKSCVGPNYRKFAPYLLTAFFFIFINNIMGLIPFFPGGANVTGNIAITMVLAICTFLAVNIFGTKHYWKDIFWPDV-PWWLKVPVP---MMP-FIEFFGI--FTKPF-ALMIRLFANMLAGHMAMLVLTCLIFISASMGPAL--NGTLTVASVLFNI-FMNALELLVAFIQAYVFTMLSAVF 355
>gi|125654678|ref|YP_001033872.1| F0F1 ATP synthase subunit A [Rhodobacter sphaeroides 2.4.1] >gi|77386338|gb|ABA81767.1| H+-transporting two-sector ATPase, A subunit [Rhodobacter sphaeroides 2.4.1] (227 aa)
Score = 122, Expect = 8.2e-05, Identities = 47/169 (27%), Positives = 77/169 (45%)
  Q:    94 IFTVFCYIFLCNIISVV-GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTE 262
           I T+  ++  CN  S++ G E PTA      AL L   L TI  GI+ Q     + +L  F   T +    MIP       + + +   +S+ LRL+ N+M+G  +LG+  +L  +                   L  +P    LD L G++QA++F +L L + + + E
  S:    81 IGTLLLFVLTCNWSSLIPGVEPPTAHLETDAALALIVFLTTIGFGIRAQG---LWGWLRAFARPTWA----MIP-----LNLVEQVTRSVSLMLRLFGNVMSGVFVLGIVLSLAGL-------------------LVPIPLMA-LDLLTGAVQAYIFAILALVFIASAVE 218
>gi|150395672|ref|YP_001326139.1| F0F1 ATP synthase subunit A [Sinorhizobium medicae WSM419] >gi|150027187|gb|ABR59304.1| ATP synthase F0, A subunit [Sinorhizobium medicae WSM419] (250 aa)
Score = 121, Expect = 9.0e-05, Identities = 55/187 (29%), Positives = 93/187 (49%)
  Q:    77 TLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVG-FENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEP 263
           +++ E  G + +KF P +F++F +I   N++ +V  F   T+   VTFAL +F  +GT+IL   Y+    F K      +        ++P       I+ +  P IS+S+RL+AN++AG + L +F      +       +      IL  +  V   G L++LV  +QA+VF VLT  Y + +  P
  S:    71 SMLREGAGSQGMKFFPMVFSLFMFILTANLLGMVPYFFTVTSQIIVTFALAVFV-IGTVILYGFYKHGFGFLKLFVPHGVP-----GALLPLVVAIEIISFLSRP-ISLSVRLFANMLAGHITLKVFAGFVASLSAFGALGIGGA---ILPLIMTVALTG-LEFLVAFLQAYVFAVLTCMYLNDAVHP 247
>gi|154503958|ref|ZP_02041018.1| hypothetical protein RUMGNA_01784 [Ruminococcus gnavus ATCC 29149] >gi|153795385|gb|EDN77805.1| hypothetical protein RUMGNA_01784 [Ruminococcus gnavus ATCC 29149] (218 aa)
Score = 121, Expect = 9.3e-05, Identities = 56/232 (24%), Positives = 107/232 (46%)
  Q:    31 ITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYA-LPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTE 262
           I+  +V+T I+  VLV  +  + +    + P  +   +   +         I+GK   ++ PY+ TV  Y+   N+I ++GF+ PT    VT AL + +     +  I+Y   S  +K   K ++K  +    ++     P  I +I +  +S+ +RL+ N++AG +++ L  A +P+++                     +P + + D   G IQA+VFV LT  + +   E
  S:    18 ISESVVVTWIIMAVLVGLSLILVRNLKVENPGKVQLALEAAIDWATDFFEGILGKGNKRYIPYLITVLLYLACANMIGLLGFKPPTKDLNVTAALAVMS-----MCLIEY---SGIHKNGMKHWVKHFAKPVPVVA----PIMILEIFIRPLSLCMRLFGNMLAGFVVMELLKAFVPLII--------------------PLPMNFYFDIFDGLIQAYVFVFLTALFMTEEQE 218
>gi|116490717|ref|YP_810261.1| F0F1-type ATP synthase, subunit a [Oenococcus oeni PSU-1] >gi|116091442|gb|ABJ56596.1| F0F1-type ATP synthase, subunit a [Oenococcus oeni PSU-1] (241 aa)
Score = 121, Expect = 1.0e-04, Identities = 64/227 (28%), Positives = 106/227 (46%)
  Q:    32 TSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISV--------VGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPY-FFNPFGITDIIMPWISISLRLWANIMAGALILGLF--YALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWS 258
           T+II  ++   LVL    F  +KL   +P K   F  + +    + +  +I   E   +  YIFT+F +IF+ N + +           ++PTA+  VT  + L T +     G+         KF +K Y +    N  + P     P  I +    ++++ LR++ NI AG ++L L   +ALP        + +   P  + +  F++        L+GSIQAFVF  LT  Y S
  S:    19 TTIISTSMAFVLVLAIVIFLSRKLSI-RPGKRQNFLEWTIDFTNRIVKDQIPTAEGSTYRLYIFTLFLFIFVSNQMGLFLQFGSDSAQIKSPTAVPLVTMTMALITLMVARFAGVG--------KFGYKGYFR----NTYLAPIPVLLPINILEQFTNFLTLGLRIYGNIFAGEILLTLISGFALPSDKLSSPLSFILAIPLELAWQAFSI--------LIGSIQAFVFATLTSVYIS 235
>gi|154245922|ref|YP_001416880.1| F0F1 ATP synthase subunit A [Xanthobacter autotrophicus Py2] >gi|154160007|gb|ABS67223.1| ATP synthase F0, A subunit [Xanthobacter autotrophicus Py2] (250 aa)
Score = 121, Expect = 1.0e-04, Identities = 54/186 (29%), Positives = 93/186 (50%)
  Q:    78 LVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPW----ISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEP 263
           +V +  G E + F P +F++F ++ + N++ ++ +    TA   VT A+ L      I+ G     + F + F+        SG    +P F  PF +   ++ +    IS+SLRL+AN++AG + L +F A  +V       V   G  +  F + A+     L+ LV  +QA+VF VLT  Y + +  P
  S:    73 MVRDSAGSEGMVFFPLVFSLFTFVLVSNVVGLIPYTFTVTAHLIVTAAMALLVIGTVIVYGFVRHGTHFLHLFV-------PSG----VPAFLLPFLVVIEVVSFLSRPISLSLRLFANMLAGHIALKVF-AFFVVGLASAGVVGWFGATLPFFMIVALY---ALELLVAMLQAYVFAVLTSIYLNDAIHP 248
>gi|1168557|sp|P43454|ATP6_ENTHR ATP synthase a chain (ATPase protein 6) >gi|153567|gb|AAA26853.1| H+ ATPase (239 aa)
Score = 121, Expect = 1.0e-04, Identities = 67/242 (27%), Positives = 108/242 (44%)
  Q:    24 PFEYRSEITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVG----------FENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPY-FFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEV-ILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEE 265
           P  +   +  ++++T ++   LVY+     K+ P      + + I    G    +   +  KE   F    FT+F ++F+ N I ++           +++PTA   VT  L       T + G+K        K  FK Y      N  + PY F  P  + +     ++++LRL+ NI AG ++L L   +   +      +  P   V I FSLF           +GSIQAFVFV L++ Y S   E EE
  S:    12 PVWFDGTVCMMVLLTCLIVFFLVYFFTRNLKMKPTGKQNALEWVIDFTRG---IVTDNLPRKELNNFHLLAFTLFLFVFVANNIGLITKIVLPSETTLWKSPTANPFVTLTLAFIMITLTHLFGVK--------KLGFKGYFV----NSFLKPYSFMFPMKLIEEFTNLLTLALRLYGNIYAGEVLLTLIANMMNNLGWFSLPLAIPLEMVWIAFSLF-----------IGSIQAFVFVTLSMVYMSHKIEVEE 239
>gi|83945333|ref|ZP_00957681.1| ATP synthase subunit A [Oceanicaulis alexandrii HTCC2633] >gi|83851167|gb|EAP89024.1| ATP synthase subunit A [Oceanicaulis alexandrii HTCC2633] (258 aa)
Score = 121, Expect = 1.1e-04, Identities = 59/233 (25%), Positives = 110/233 (47%)
  Q:    31 ITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVG-FENP-------TALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEP 263
           +TS++++  +++L +     S + L P +  + +A  ++  +     ++    G   +KF P++FT+F +I + N++ +   F  P       T+   VTFAL L      I  G+      FF  F         SG    +     P  I   +   +++ +RL+AN++AG ++L +F    +++     +V   G    +  L  V     L++LV  +QA+VF VLT  Y S +  P
  S:    36 VTSVVLVAGLLSLAM-----SKRALVPGRS-QSVAELLYEFVAG---MIRSTAGDAGLKFFPFVFTLFAFILMGNMLGMFPYFPAPGFHGFTFTSHIIVTFALALVVMAIVIGYGVFKHGLKFFSLFF-------PSGVPWPLYILLTPIEIISFLSRPVTLGVRLFANMLAGHILLKVFAGFIIML----GSVGALGVLGAVAPLIMVVALTALEFLVAFLQAYVFAVLTCIYLSDALHP 256
>gi|17987829|ref|NP_540463.1| F0F1 ATP synthase subunit A [Brucella melitensis 16M] >gi|17983557|gb|AAL52727.1| ATP SYNTHASE A CHAIN [Brucella melitensis 16M] (277 aa)
Score = 121, Expect = 1.1e-04, Identities = 60/235 (25%), Positives = 110/235 (46%)
  Q:    29 SEITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVG-FENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPW-------------ISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEP 263
           + +++ +V T+++    +Y   S + L P +  + ++   +  +    T + +  G + +KF P++F++F ++ + N I +   F   T+   VTFAL L      I  G        F+K  F F               F P G+  II+P              IS+S+RL+AN++AG + L +F    + +     ++   G    +  L        L++LV  +QA+VF VLT  Y + +  P
  S:    55 TNVSAFMVATVVLASGFLYLTSSGRGLIPTRL-QSVSEMAYEFVA---TSLRDSAGSKGMKFFPFVFSLFMFVLVANFIGLFPYFYTVTSQIIVTFALSLLVIGTVIFYG--------FFKHGFGFL------------KLFVPSGVPGIIVPLVVLIEIISFLSRPISLSVRLFANMLAGHITLKVFAGFVVSL----SSLGALGIGGAVLPLLMTVAITALEFLVAFLQAYVFTVLTCMYINDAVHP 275
>gi|69938376|ref|ZP_00632854.1| H+-transporting two-sector ATPase, A subunit [Paracoccus denitrificans PD1222] >gi|119385604|ref|YP_916659.1| F0F1 ATP synthase subunit A [Paracoccus denitrificans PD1222] >gi|119376199|gb|ABL70963.1| ATP synthase F0, A subunit [Paracoccus denitrificans PD1222] (248 aa)
Score = 121, Expect = 1.1e-04, Identities = 52/193 (26%), Positives = 84/193 (43%)
  Q:    71 LLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFK---FYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEP 263
           L G    +V ++ GK+ +K+ PY+ T+FC+I   N + ++    +PT+   VT  L +    G  +LG     + F   F        ++       +I YF  P          +S S+RL  NIMAG  ++ +F A   V                +  +     +G L+ LV  IQA+VF +LT  Y   +  P
  S:    72 LYGMVHKMVEDVTGKDGLKYFPYVMTLFCFILFANFLGLLPKSFSPTSHIAVTAVLAVLVFAGVTVLGFVKNGAHFLGLFWVSSAPLALRPVLAVIELISYFVRP----------VSHSIRLAGNIMAGHAVIKVFAAFAAVAA-----------IAPVSVVAITAMYG-LEVLVCLIQAYVFTILTCVYLKDALHP 246
>gi|14010343|gb|AAK51959.1|AF362014_1 ATP synthase F0 subunit 6 [demosponge RFW-2001] (215 aa)
Score = 120, Expect = 1.1e-04, Identities = 54/220 (24%), Positives = 97/220 (44%)
  Q:    37 ITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFY-IKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           + +++ ++L +     ++L PN+    +     N+    + +V++ +GK   K+ P++  +F +I + N++ +  +   PT    VTF L     +G  +LG        F  F F F  I    G  +++  F         +   IS+ +RL AN+ AG L+  +       M      VL   P +I+       F   L+  V  IQA+VF +LT  Y
  S:     4 MMMVLAVILFWLLLKGERLIPNRWQSIMEIIHLNI----RLVVHDNLGKIGEKYFPFVLCLFIFIVMLNVMGLFPYVFTPTVHIVVTFGLSFSILMGVTLLG--------FITFKFNFLSILMPGGAPLVLAPFLILIETLSYMSRAISLGVRLAANLTAGHLLFAIISGFAFNMLSNGLIVLSTFPLLIMI------FITLLEMAVAVIQAYVFCLLTAIY 207
>gi|162146975|ref|YP_001601436.1| F0F1 ATP synthase subunit A [Gluconacetobacter diazotrophicus PAl 5] >gi|187596991|ref|ZP_02983251.1| ATP synthase F0, A subunit [Gluconacetobacter diazotrophicus PAl 5] >gi|161785552|emb|CAP55123.1| putative ATP synthase [Gluconacetobacter diazotrophicus PAl 5] >gi|187490816|gb|EDU28757.1| ATP synthase F0, A subunit [Gluconacetobacter diazotrophicus PAl 5] (249 aa)
Score = 120, Expect = 1.1e-04, Identities = 46/141 (32%), Positives = 73/141 (51%)
  Q:   116 TALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVM--FRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           T+   VT AL L   +  +I+ +K Q   FF  F+        +G  V +     P  I   +   +S+S+RL+AN++AG ++L +F A  +++        VL  GP VI  +L A      L+ LVG++QA+VF +LT  Y
  S:   113 TSHIAVTLALALLVFVLAVIVSLKAQGPKFFAHFM-------PAGAPVALAPLLVPIEILSFLSRPVSLSIRLFANMVAGHVMLEMFAAFTIMLAGLGLFGDVLAVGPVVINVALMA------LELLVGALQAYVFAILTCIY 242
>gi|118475487|ref|YP_891946.1| F0F1 ATP synthase subunit A [Campylobacter fetus subsp. fetus 82-40] >gi|118414713|gb|ABK83133.1| ATP synthase F0, A subunit [Campylobacter fetus subsp. fetus 82-40] (226 aa)
Score = 120, Expect = 1.2e-04, Identities = 59/233 (25%), Positives = 103/233 (44%)
  Q:    34 IIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFI--KFTPYIFTVFCYIFLCNIISVV-GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEEE 266
           +I++ II+ +V      SM+ +     P+G    +   L    ++  ++MG + +  K+ P + T+   +   N+I ++ GFE P++   +T  L L   L     GI+ Q        + K++      NK++ P  F P  I   +   +S+S RL+ NI    L L       MV+    P V  P P   L +  A+            +Q F+F++LT  Y +G+    EE
  S:    23 LILVAIIVLIVAKLATRSMQLV-----PRGSQNLLEAYLEGIVSMGRDVMGSDELARKYLPLVATIGLIVLTSNVIGIIPGFEAPSSSLNLTLCLALSVFLYYNFEGIRTQG-------IIKYFAHFMGPNKILAPLMF-PIEIVSHLSRIVSLSFRLFGNIKGDDLFL-------MVVLSLAPWV-APLPAFALLTFMAL------------LQTFIFMILTYVYLAGAVVVSEE 225
>gi|1929507|gb|AAB51460.1| ATP synthase subunit a (227 aa)
Score = 120, Expect = 1.2e-04, Identities = 58/225 (25%), Positives = 106/225 (47%)
  Q:    32 TSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVV-GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILG-LFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           ++++   IIM L+L     + +KL  +  P+G    +   L  F  L+ EI+GKE  ++ P + T+F +I   N+   + G + PT   + T A  + T +   I GI+      + +  F+             P+ F P  + + ++  +S+SLRL+ N+    +++  LF  +P ++         P P ++            L  L+G+IQAFVF +LT+ Y
  S:    28 STVVNTWIIMILLLAGIFLATRKL--SFIPRGAQHVLEMFLEFFYGLLEEIIGKEGRRYLPLVATLFIFILSLNLSWFIPGMKPPTMDLSTTAAFAVTTIILVQIFGIRKLGLRGYIRHFFQ-----------PAPFLF-PLNVIEELVKPVSLSLRLFGNLFGEEMVVTILFLMIPFLL---------PTPIML------------LGVLMGTIQAFVFTLLTITY 219
>gi|182679691|ref|YP_001833837.1| ATP synthase F0, A subunit [Beijerinckia indica subsp. indica ATCC 9039] >gi|182635574|gb|ACB96348.1| ATP synthase F0, A subunit [Beijerinckia indica subsp. indica ATCC 9039] (230 aa)
Score = 120, Expect = 1.3e-04, Identities = 57/218 (26%), Positives = 94/218 (43%)
  Q:    60 PPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVV-GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNK-VMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEEESQVKKIKKKSP 277
           PP      +  + GA  + + + M  +   +   I T+  Y+   N  S+V G E PTA      AL L     TI+ G++ Q            Y+KT +    VMIP       + + I    S+ +RL+ NIM+G  I+G+  +L  +                   L  +P    LD L G+IQA++F +L  C + G+   E  +  ++ + K+P
  S:    46 PPSRSQAALETVTGAIDSQIKDTMQVDPAPYRALIGTIVLYVLTANWSSLVPGVEPPTAHLETDAALALIVFCATIVYGVRAQG--------LAGYLKTFADPSWVMIP-----LNVVEQITRTFSLIIRLFGNIMSGVFIIGIILSLAGL-------------------LVPIPLMA-LDLLTGAIQAYIFAILA-CVFIGAAVSERPAPSQQ-EPKTP 230
>gi|196477470|gb|ACG76998.1| ATP synthase protein, subunit A [Phenylobacterium zucineum HLK1] (261 aa)
Score = 120, Expect = 1.3e-04, Identities = 47/185 (25%), Positives = 82/185 (44%)
  Q:    72 LGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLF--YALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
            G    L   I+G E  +F P++FT+F +I   N++ +      T+   VT  L   T L  +I+G      + +  F+        SG    +     P  +   ++  ++++LRL+ N++ G + L +F  + + +        +   G    L SL  V     L++LV  +QAFVF VL   Y
  S:    71 FGYIDDLTTSIIGHEGKRFFPFVFTLFLFILAMNLLGMFLVFTATSQLAVTATLAALTILLVLIVGFARNGHNMYKLFV-------PSGVPWYMLILVTPIELISFLLRPVTLALRLFGNMLGGHVALKVFAGFVVSLGALAAGGGLGLLGIPGALLSLGGVVALTALEFLVAFLQAFVFAVLACVY 250
>gi|78186929|ref|YP_374972.1| F0F1 ATP synthase subunit A [Pelodictyon luteolum DSM 273] >gi|78166831|gb|ABB23929.1| H+-transporting two-sector ATPase, A subunit [Pelodictyon luteolum DSM 273] (223 aa)
Score = 120, Expect = 1.3e-04, Identities = 44/196 (22%), Positives = 91/196 (46%)
  Q:    71 LLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVV-GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEEE 266
           ++G  +  + E+  +  +++ PY+ T+F +I   N+ +++ G+E PT   + T AL +   +   + GI       +       Y+K      +M+P     F I   +   +++++RL+ NIM+G++IL +   +   +F             +L S+  +        L G +QA++F +L   Y S +T   +E
  S:    59 IVGMARRQIEEVGLRRSMQYLPYLGTLFIFIAFSNLCTIIPGYEPPTGSLSTTAALAMSVFVAVPLFGIAESGLGGY----LSTYVKP---TPIMLP-----FNIISELSRTLALAVRLFGNIMSGSMILAILLTVTPFVFP------------VLMSVLGL--------LTGMVQAYIFSILATVYISAATRARKE 223
>gi|89897664|ref|YP_521151.1| ATP synthase F0 A subunit [Desulfitobacterium hafniense Y51] >gi|89337112|dbj|BAE86707.1| ATP synthase F0 A subunit [Desulfitobacterium hafniense Y51] (245 aa)
Score = 120, Expect = 1.3e-04, Identities = 58/224 (25%), Positives = 106/224 (47%)
  Q:    33 SIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIK-FTPYIFTVFCYIFLCNIISVV-----------------------GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           ++++  I+M +++ +     + L   KP K +   +  ++   + LV + M  E  K    Y+ T+  ++F+ N+  ++                          +PTA    T AL L T    I +GIK++ S +F+ FL  + I             F    + D++   ++++ RL+ NI AG +++G+   LP          + P    + FS+F           +G+IQAFVF VLT  Y
  S:    18 TLVMTWIVMAIIIAFVLSGARHLTSGKPGK-MQNVLEWMVDFVRKLVSDNMDYEKGKPLLGYLVTLILFVFVSNVFGLIPNFTFGLLHNVEFAKLNEIFHGAALMSPTADINTTMALALMTMGLVISMGIKHKGSHYFHHFLEPYKI-------------FAVIHVIDLLSKPMTLAFRLFGNIYAGEVLIGVILMLPGWWVFGG---ILPDAIWLAFSVF-----------IGAIQAFVFTVLTTAY 237
>gi|82702781|ref|YP_412347.1| F0F1 ATP synthase subunit A [Nitrosospira multiformis ATCC 25196] >gi|82410846|gb|ABB74955.1| ATP synthase F0, A subunit [Nitrosospira multiformis ATCC 25196] (251 aa)
Score = 120, Expect = 1.3e-04, Identities = 42/178 (23%), Positives = 81/178 (45%)
  Q:    90 FTPYIFTVFCYIFLCNIISVV-GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEEES 267
           + P++ T+F ++ + N+ +V  G+E PT   + T AL +   +     GI+ Q      +   + Y+K        +P    PF I       +++++RL+ N+M+G +IL +   +   +F   P V+                 G L  L+G +QA++F +L   Y + +T    E+
  S:    78 YLPFLGTLFVFVAVANLFAVFPGYEPPTGSLSTTVALAICVFVAVPFYGIREQG----LRRYLQSYLKP-------VPLLL-PFNILGEFTRTLALAVRLFGNMMSGTMILAIMLIITPFIF---PVVM-----------------GVLHLLIGGVQAYIFSILATVYIAAATSDNGEN 224
>gi|78188048|ref|YP_378386.1| F0F1 ATP synthase subunit A [Chlorobium chlorochromatii CaD3] >gi|78170247|gb|ABB27343.1| H+-transporting two-sector ATPase, A subunit [Chlorobium chlorochromatii CaD3] (345 aa)
Score = 120, Expect = 1.4e-04, Identities = 56/221 (25%), Positives = 102/221 (46%)
  Q:    36 VITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEI-MGKEFIKFTPYIFTVFCYIFLCNIISVVGF-ENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNK------VMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGF---LDWLVGSIQAFVFVVLTLCY 256
           V++ I+  +    N   K     + PKGIA  +  L+   +  V +  +GK + K+ PY+ TVF +I +CN++ +V +    T    VT  L  FT   T    +K            K Y+   +G        +MIP  F       +    +++++RL+AN+ AG +++     +  ++              I+  + +VPF  F   L+  V  +QAF+F +L+  +
  S:   117 VVSAIVIALFAAANGQYKTGSAMRAPKGIANALEALVDFIRLDVAKANIGKGYEKYLPYLLTVFFFILVCNLLGLVPYGATATGNINVTLTLATFTFFLTQAAALKAHG--------IKGYLAHLTGGTHPALWIIMIPIEF-----IGLFTKPVALTIRLFANMTAGHIVILSLIFISFIL-----------KSYIVAVVMSVPFSIFIYLLELFVAFLQAFIFTMLSALF 324
>gi|167648332|ref|YP_001685995.1| F0F1 ATP synthase subunit A [Caulobacter sp. K31] >gi|167350762|gb|ABZ73497.1| ATP synthase F0, A subunit [Caulobacter sp. K31] (257 aa)
Score = 119, Expect = 1.4e-04, Identities = 52/186 (27%), Positives = 83/186 (44%)
  Q:    71 LLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGI----TDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           + G    L   I+G E  K  P++FT+F  I   N + ++     T+   VT   G+ T    +I+G       FF  F+        SG    +P+   P  I       ++  ++++LRL+ N+M G + L +F             +L  G  V + S+  V     L++LV  +QAFVF VLT  Y
  S:    70 VFGLIDNLTDSIIGHEGRKLFPFVFTIFTLILGMNFLGLMLAFTATSQIAVTATFGVLTIGLVLIIGFAKHGLGFFKLFV-------PSG----VPWVLLPVIILIEFASFLLRPVTLTLRLFGNMMGGHVALKVFAGFVAAAVVGQIGLL--GIPVGILSIGMVTALTALEFLVAFLQAFVFAVLTCIY 246
>gi|149201375|ref|ZP_01878350.1| F0F1 ATP synthase subunit A [Roseovarius sp. TM1035] >gi|149145708|gb|EDM33734.1| F0F1 ATP synthase subunit A [Roseovarius sp. TM1035] (243 aa)
Score = 119, Expect = 1.5e-04, Identities = 58/235 (24%), Positives = 104/235 (44%)
  Q:    29 SEITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTT-----VTFALGLFTTLGTIILGIKYQKSSFFYKFLFK---FYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYAL-PMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEP 263
           + +T  + +T++  + L+    S +   P++    +      L    + +V ++ GK+ + F PYI T+F +I   N + ++    P A TT     VT  + +   L   ++G       F   F        ++       +I YF  P          +S S+RL  N+MAG  ++ +F A  PM++      ++     V   S+ A+     L+ LV  IQA+VF +LT  Y   +  P
  S:    21 TNVTLWMALTVLAIIALMVMGTSRRATIPSRTQSVVEL----LYDFIRKMVEDVAGKDALVFFPYIMTLFLFILFANFLGLL----PMAFTTTSHIAVTAVMAMMVFLTVTVVGFVKHGVGFLGLFWVSSAPLALRPVLALIEVISYFVRP----------VSHSIRLAGNMMAGHAVVKVFAAFAPMILISTGIGIV-----VTPLSILAISTIYALEVLVAFIQAYVFTILTCVYLKDALHP 241
>gi|170744957|ref|YP_001773612.1| ATP synthase F0, A subunit [Methylobacterium sp. 4-46] >gi|168199231|gb|ACA21178.1| ATP synthase F0, A subunit [Methylobacterium sp. 4-46] (251 aa)
Score = 119, Expect = 1.5e-04, Identities = 49/187 (26%), Positives = 87/187 (46%)
  Q:    77 TLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPF----GITDIIMPWISISLRLWANIMAGALILGLFYA-LPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEP 263
           + V++  G    +F P +F++F ++ + N+  ++ +    T+   VTF L L   L  +I G       F   F+              +P +  P      +   I   IS+S+RL+AN++AG + L +F   +P ++      +L P P  +  ++ A      L+ LV  +QA+VF  LT  Y S +  P
  S:    74 STVHQSAGHGSERFVPLVFSLFMFVLVLNLFGMIPYAFTVTSHIIVTFMLALVVILTVVIYGFMAHGVHFLDLFV-----------PPGVPGWLKPLIVAIEVVSFISRPISLSVRLFANMLAGHIALKIFAGFVPALLAAGIWGILSPLPLALSVAITA------LEMLVAVLQAYVFATLTSIYLSDALHP 249
>gi|114797617|ref|YP_760620.1| F0F1 ATP synthase subunit A [Hyphomonas neptunium ATCC 15444] >gi|114737791|gb|ABI75916.1| ATP synthase F0, A subunit [Hyphomonas neptunium ATCC 15444] (253 aa)
Score = 119, Expect = 1.5e-04, Identities = 63/218 (28%), Positives = 101/218 (46%)
  Q:    39 IIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFH-----GFLDWLVGSIQAFVFVVLTLCY 256
           +++ +VLV   FSM        P  +        G    +V    G+E +KF P++FT+F +I   N+I +V +    T+   VT AL +   L  I++G+      FF  F         SG  + I     P  I   +   +++ LRL+AN++AG ++L LF            TV+  G   I   + A+ F        L++LV  +QA+VF +LT  Y
  S:    36 MLLGVVLVIGFFSMATRKGELVPSRLQSVAEMGYGFIADMVRSAAGEEGLKFFPFVFTLFFFILFANLIGMVPYAFTTTSHIIVTGALAMTVILMVIVVGLIKNGLGFFKLF-------APSGAPLPIYIILTPIEIISFLARPLTLGLRLFANMLAGHIMLKLFAGF---------TVMLIGAGAIYIPVAALAFAMGVALNALEFLVAGLQAYVFAILTCVY 243
>gi|115373472|ref|ZP_01460769.1| H+-transporting two-sector ATPase, A subunit [Stigmatella aurantiaca DW4/3-1] >gi|115369478|gb|EAU68416.1| H+-transporting two-sector ATPase, A subunit [Stigmatella aurantiaca DW4/3-1] (344 aa)
Score = 119, Expect = 1.6e-04, Identities = 58/226 (25%), Positives = 105/226 (46%)
  Q:    31 ITSIIVITIIMTLVLVYYNFSMKKLDPNK-PPKGIAFFIFNLLGAF---KTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGF-ENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGN------KVMIP-----YFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHG---FLDWLVGSIQAFVFVVLTLCY 256
           IT   V+  +   +L+ +       D +K  P+G+   +F +L  F   +  +  I  +E  ++ PY+ T F +I   N++ +V +    T    +T  L + T + T + GI+              Y+   +G        +MIP      F  PF +T          +RL+AN++AG ++  LF+ L ++     P V          +L +VPF      L+  V  +QA+VF +L+  +
  S:    95 ITKHTVMMWLAAALLILFILGFSNRDKSKLVPRGVGANMFEMLIVFVRDELAIKNIGKEEGPRYVPYLLTAFFFILFMNMLGLVPWMATATGNLAITAGLAICTFVLTQVAGIRAAG--------LGGYLGHLTGGVAPWLWPIMIPVEILGLFTKPFALT----------MRLFANMLAGHIV--LFFLLGLIFMLGHPAV----------ALVSVPFAMGIYLLELFVAFVQAYVFTMLSALF 309
>gi|153007845|ref|YP_001369060.1| F0F1 ATP synthase subunit A [Ochrobactrum anthropi ATCC 49188] >gi|151559733|gb|ABS13231.1| ATP synthase F0, A subunit [Ochrobactrum anthropi ATCC 49188] (249 aa)
Score = 119, Expect = 1.7e-04, Identities = 57/235 (24%), Positives = 114/235 (48%)
  Q:    29 SEITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVG-FENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPG--PEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEP 263
           + +++ +V T+++    +Y   S + L P +  + ++   +  +    T + +  G + +KF P++F++F ++ + N + +   F   T+   VTFAL +   +GT+I+        FF   L    +   SG   +I        I   +   IS+S+RL+AN++AG + L +F    + +    P  +     P ++  ++ A      L++LV  +QA+VF VLT  Y + +  P
  S:    27 TNVSAFMVATVVVASGFLYLTSSGRGLIPTRL-QSVSEMAYEFVA---TSLRDSAGSKGMKFFPFVFSLFMFVLVANFLGLFPYFYTVTSQIIVTFALAVLV-IGTVIV------YGFFKHGLGFLKLFVPSGVPGIIVPLVVAIEIISFLSRPISLSVRLFANMLAGHITLKVFAGFVVSLAALGPIGIGGAVLPLIMTVAITA------LEFLVAFLQAYVFTVLTCMYINDAVHP 247
>gi|164421012|ref|YP_001648533.1| ATP synthase F0 subunit 6 [Iotrochota birotulata] >gi|158938942|gb|ABW83868.1| ATP synthase F0 subunit 6 [Iotrochota birotulata] (244 aa)
Score = 119, Expect = 1.7e-04, Identities = 54/216 (25%), Positives = 97/216 (44%)
  Q:    41 MTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           + +++++  F  +KL PN+    +     N+    + +V+E +GK   K+ P++ ++F +I + NI+ +  +   PTA   VTF   L   +   +LG+   K  F         I    G  +++            ++  IS+ LRL ANI AG L+  +       +      ++   P VI+       F   L+ +V  IQA+VF +LT  Y
  S:    37 LAVIIIWLLFKGEKLIPNRWQLVMELIHNNM----RAVVHENLGKAGEKYFPFVLSLFLFIAVLNILGLFPYVFTPTAHIVVTFGFSLSIMIAVTLLGLLTFKVEF-------VSILVPGGVPLVLAPILVVIESLSYMIRVISLGLRLAANISAGHLLFAILSGFAFNLLVNGFWIIGSFPVVIM------GFITLLEMMVAVIQAYVFSLLTTIY 236
>gi|77918559|ref|YP_356374.1| ATP synthase F0, A subunit [Pelobacter carbinolicus DSM 2380] >gi|77544642|gb|ABA88204.1| ATP synthase F0, A subunit [Pelobacter carbinolicus DSM 2380] (234 aa)
Score = 119, Expect = 1.7e-04, Identities = 50/202 (24%), Positives = 96/202 (47%)
  Q:    61 PKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVV-GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYAL-PMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTE 262
           P G+  F+  +L   + +V + MG + + + P I T+  ++ + N+I ++ GF  PTA      AL +   L T I+G++     +F  F+   +  T             P  +   +   +S+SLRL+ N+    ++L +F++L P+++         P P +++              LV  IQ FVF++L++ Y +G+ E
  S:    58 PGGMQNFMELVLVEIRGMVRDTMGPKGMVYFPLIATLALFLLVSNLIGLIPGFAPPTASLNTNAALAVGVFLVTHIVGVREHGIRYFKHFMGPVWWLTP---------LILPIELIGHLARPLSLSLRLFGNMYGHEIVLMIFFSLVPLLL---------PIPMMLM------------GILVAFIQTFVFMLLSMIYIAGALE 231
>gi|3746270|gb|AAD02891.1| ATP synthase subunit 6 [Suillus luteus] (257 aa)
Score = 119, Expect = 1.7e-04, Identities = 61/232 (26%), Positives = 114/232 (49%)
  Q:    31 ITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGL-FTTL-GTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGF-----LDWLVGSIQAFVFVVLTLCYWSGSTE 262
           +T++ + ++I+  ++V  ++ M   D    P   +  + +L  +  ++V E +G+E   + P+I+++F +I + N++  + +   T  T+V  ++GL FT L G  ILG+   K  FF  F+        SG  + +        +   +    S+ +RL+AN++AG  +L +       MF            +I+F +  VPF  F     L+  V  IQA+VFV+L   Y   + E
  S:    37 LTNLALYSLIIFTLIVGLHY-MGNNDIKLLPSKWSILLESLFASINSMVREQIGREI--YLPFIYSLFFFILIANLLGNIPYSY-TITTSVIVSIGLSFTILIGVTILGLSIHKIHFFSFFI-------PSGTPLALVPLLVLIELISYLARAFSLGIRLFANVVAGHTLLKILSTFLYQMFSGG---------LIIFIVTLVPFALFLAITGLELAVSFIQAYVFVLLVCSYIKDAIE 255
>gi|63025100|ref|YP_232794.1| ATP synthase F0 subunit 6 [Geodia neptuni] >gi|37961462|gb|AAP59159.1| ATP synthase F0 subunit g [Geodia neptuni] (244 aa)
Score = 119, Expect = 1.8e-04, Identities = 54/220 (24%), Positives = 99/220 (45%)
  Q:    37 ITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           + +++ +++ +      KL PN+    I F   N+     ++V + +GK   KF P++  +F +I + NI+ +  +   PTA   +T  + +   +   +LG+      F +K  F F I    G  +++  F         ++  IS+ +RL ANI AG L+  +       M      +    P +I+       F   L+ +V  IQA+VF +LT  Y
  S:    33 MMMMLAIIISWSLLEGNKLIPNRWQFVIEFIYINI----HSVVQDNLGKAGQKFFPFVLCLFIFIAMLNILGLFPYVFVPTAQIVITLGMSVSIIIAVTLLGL------FTFKLNF-FSILMPGGVPLVLAPFLVVIETASYLIKAISLGVRLAANISAGHLLFAILSGFAXNMLSNGMIISSLVPMLIMV------FITLLEIMVAIIQAYVFCLLTTIY 236
>gi|83591200|ref|YP_431209.1| ATP synthase F0, A subunit [Moorella thermoacetica ATCC 39073] >gi|83574114|gb|ABC20666.1| ATP synthase F0, A subunit [Moorella thermoacetica ATCC 39073] (218 aa)
Score = 119, Expect = 1.8e-04, Identities = 58/225 (25%), Positives = 106/225 (47%)
  Q:    32 TSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVV-GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILG-LFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           ++++   IIM L+L     + +KL  +  P+G    +   L  F  L+ EI+GKE  ++ P + T+F +I   N+   + G + PT   + T A  + T +   I GI+      + +  F+             P+ F P  + + ++  +S+SLRL+ N+    +++  LF  +P ++         P P ++            L  L+G+IQAFVF +LT+ Y
  S:    19 STVVNTWIIMILLLAGIFLATRKL--SFIPRGAQHVLEMFLEFFYGLLEEIIGKEGRRYLPLVATLFIFILSLNLSWFIPGMKPPTMDLSTTAAFAVTTIILVQIFGIRKLGLRGYIRHFFQ-----------PAPFLF-PLNVIEELVKPVSLSLRLFGNLFGEEMVVTILFLMIPFLL---------PTPIML------------LGVLMGTIQAFVFTLLTITY 210
>gi|160943205|ref|ZP_02090441.1| hypothetical protein FAEPRAM212_00691 [Faecalibacterium prausnitzii M21/2] >gi|158445444|gb|EDP22447.1| hypothetical protein FAEPRAM212_00691 [Faecalibacterium prausnitzii M21/2] (263 aa)
Score = 118, Expect = 2.0e-04, Identities = 47/184 (25%), Positives = 77/184 (41%)
  Q:    82 IMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEE 265
           ++GKE  ++ PY+ TV  YI   N+I V G + PT    VT AL L + +     G++ +  + F K L        +   +M      P  I +I +   S+ +RL+ N++   +I+ L   +  V      ++                   + D   G IQ +VFV LT  +   S   EE
  S:   111 LLGKEGSRYVPYLMTVALYIACSNVIGVFGVKPPTKDLDVTAALALMSIVLIEYAGVRARGGAGFLKSL-------AAPTPIM-----TPMNILEIAIRPTSLCMRLFGNVLGAFVIMELLKLVVPVFVPAVFSL-------------------YFDLFDGLIQTYVFVFLTALFMKESIGGEE 263
>gi|159039546|ref|YP_001538799.1| ATP synthase F0, A subunit [Salinispora arenicola CNS-205] >gi|157918381|gb|ABV99808.1| ATP synthase F0, A subunit [Salinispora arenicola CNS-205] (265 aa)
Score = 118, Expect = 2.1e-04, Identities = 57/236 (24%), Positives = 121/236 (51%)
  Q:    29 SEITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFA--LGLFTTLGTIILGIKYQKSSFFYKFLF----KFYIKTKSGNKVMIPY-FFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPE 264
           ++IT+++ + + + ++    ++   +L P K  + +A  ++  +     +  +++G   ++F PY  T+FC+I L N  ++V F   +  + + F   L + + +  I  G+++  +  F+K        +YI       +++P  FF+ F    ++ P+ S+++RL+AN+ AG ++L +F      M   +  +    P  +L     +    FL++LV  +QA+VF VLT  Y  G+   E
  S:    39 TKITAMVWLAVGILIIFFLASYRNPQLVPTKK-QWLAESVYGFVR--NNIAVDMIGHAGVRFAPYFTTLFCFILLTNFFAIVPFLQISPNSHIAFPAFLAVISYVLFIYAGVRHHGAGKFFKNSLVPPAPWYIL-----PLLVPIEFFSTF----LVRPF-SLAIRLFANMFAGHMLLLVFTLGGFAMLNANVWL---APVSVLSWAMTIAL-TFLEFLVIVLQAYVFTVLTASYVQGALADE 264
>gi|168699162|ref|ZP_02731439.1| ATP synthase F0, A subunit [Gemmata obscuriglobus UQM 2246] (292 aa)
Score = 118, Expect = 2.3e-04, Identities = 49/176 (27%), Positives = 89/176 (50%)
  Q:    89 KFTPYIFTVFCYIFLCNIISVVGF-ENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWIS-------------ISLRLWANIMAGALILG--LFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPE 264
           ++ P+++T+F +I  CN++ +V F  +PTA  ++T  L L   L T +  ++        K++  +  + K+ N  M  +      +T  I+P I+             +++RL+ANI AG + LG  L +A+       DP      P   + ++        L+  V  +QAFVFV+L+  +      PE
  S:   115 RYVPFLWTLFLFILACNLLGMVPFLGSPTAELSITLVLALSVFLVTHVSAVRKLGVG---KYVMSYIPRLKADNLPMTIF------LTVAIVPLIAAIEVMGAFIRAAVLAIRLFANIFAGHVALGAILLFAVA------DPIQGGLSPGGTVAAVVMATALSVLELFVAFLQAFVFVLLSSIFLGMQLNPE 291
>gi|85706762|ref|ZP_01037854.1| ATP synthase subunit A [Roseovarius sp. 217] >gi|85668820|gb|EAQ23689.1| ATP synthase subunit A [Roseovarius sp. 217] (235 aa)
Score = 118, Expect = 2.3e-04, Identities = 58/235 (24%), Positives = 102/235 (43%)
  Q:    29 SEITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTT-----VTFALGLFTTLGTIILGIKYQKSSFFYKFLFK---FYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEP 263
           + +T  + +T++  + L+    S +   P +  + +A  ++  +   + +V ++ GK+ + F PYI T+F +I   N + ++    P A TT     VT  + +   L   ILG      +F   F        ++       +I YF  P          +S S+RL  N+MAG  ++ +F     V              +   S+ AV     L+ LV  IQA+VF +LT  Y   +  P
  S:    21 TNVTLWMALTVLAIIALLVMGTSGRATIPTRM-QSVAELLYEFV---RKMVEDVAGKDALVFFPYIMTLFLFILFANFLGLL----PMAFTTTSHIAVTAVMAVMVFLTVTILGFVKNGPAFLSLFWVSSAPLALRPILAVIELISYFVRP----------VSHSIRLAGNMMAGHAVIKVFAGFSQVAM------------IAPLSILAVSAMYGLEVLVSFIQAYVFTILTCVYLKDALHP 233
>gi|153809943|ref|ZP_01962611.1| hypothetical protein RUMOBE_00324 [Ruminococcus obeum ATCC 29174] >gi|149834121|gb|EDM89201.1| hypothetical protein RUMOBE_00324 [Ruminococcus obeum ATCC 29174] (252 aa)
Score = 118, Expect = 2.4e-04, Identities = 50/180 (27%), Positives = 88/180 (48%)
  Q:    83 MGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTA--LTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVP---------FHGFLDWLVGSIQAFVFVVLTLCYWSGSTE 262
           MG++F    P++  +F    + N+IS+VG  +PT+   T   +A+ +F     I++  +  K+S F  +L         G    IP    PF +   +   +S++ R + NI++G +I GL Y    V       +L   P ++   L  +P            + DW  G +QAF+F +LT+ Y + + E
  S:    78 MGEKFRYMIPFVAALFATSVVSNLISLVGLRSPTSDLSTEAAWAVVVF-----IMITAQKIKTSGFGGYL--------KGFTQPIP-VMTPFNVLSELATPVSMACRHFGNILSGVVINGLIYGALAVA---SSALLGLIPGLVGDVLSQIPVLDVGIPAILSVYFDWFSGIMQAFIFCMLTVMYIANAAE 251
>gi|22266793|gb|AAM94907.1|AF522463_2 subunit a [Ilyobacter tartaricus] (287 aa)
Score = 118, Expect = 2.4e-04, Identities = 65/228 (28%), Positives = 100/228 (43%)
  Q:    33 SIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIIS---VVGF------------ENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGS 260
           ++I    +M  ++  + +S + L+   P K  AFF   L   F  L+ +++G    K+  YI T+F +I + NI+S   + GF              PTA    T  L L TT         +  +SF     F F+        +M P       +        +IS+RL+ N+ AG +ILGL Y    V                   L   P H + D   G +Q+FVF++LT+ Y  GS
  S:    70 TVISTWCVMLFLIFIFRWSSQNLEIT-PGKKQAFFE-TLYAFFDALIGQMLGSWKKKYFTYISTLFLFILISNILSFFPIPGFSYENGILIAPALRTPTADLNTTVGLALVTTY-------SFMAASFRVSGFFGFFKGLFEPMPLMFP-----INLAGEFAKPTNISIRLFGNMFAGMVILGLLYKAAPV-------------------LIPAPMHLYFDLFSGIVQSFVFIMLTMVYIQGS 279
>gi|126732374|ref|ZP_01748174.1| F0F1 ATP synthase subunit A [Sagittula stellata E-37] >gi|126707243|gb|EBA06309.1| F0F1 ATP synthase subunit A [Sagittula stellata E-37] (235 aa)
Score = 117, Expect = 2.7e-04, Identities = 58/235 (24%), Positives = 106/235 (45%)
  Q:    29 SEITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTA---LTTVTFALGLF---TTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEP 263
           + +T  + ++I+  ++L+    S + + P++  + +A   +   G    +V ++ GK+ +K+ PYI T+F +I   N + ++     T      TV  AL +F   T LG +  G+ +   S F+       ++       +I YF  P          +S S+RL  N+MAG  ++ +F     +              V   S+ A+     L+ LV  IQA+VF +LT  Y   +  P
  S:    21 TNVTLWLFLSIVAIVLLMVVGTSRRAIVPSRS-QSVAELAY---GFVYKMVEDVTGKDGLKYFPYIMTLFLFIVFANFLGLIPMSFTTTSHFAVTVVLALAVFLTVTILGFLKNGVGFL--SLFWVSAAPLALRPVLALIELISYFVRP----------VSHSIRLAGNLMAGHAVIKVFAGFAAI------------AAVSPISVLAITAMYGLEILVAFIQAYVFTILTCVYLKDALHP 233
>gi|49147195|ref|YP_025788.1| ATP synthase F0 subunit 6 [Pseudendoclonium akinetum] >gi|33439210|gb|AAQ18747.1| ATP synthase F0 subunit 6 [Pseudendoclonium akinetum] (269 aa)
Score = 117, Expect = 2.7e-04, Identities = 51/186 (27%), Positives = 85/186 (45%)
  Q:    77 TLVYEIMG-KEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDP---TVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTE 262
           +LV+E +G     K+   +FTVF Y+ + N++ ++ F    TA   V F+L     +G  ++G+   K  F   FL        SG  + +        +   I   IS+ +RL+AN+ AG  +L +       M   +    T L   P V++ ++F       L+  V  +QA+VF VL   Y   + E
  S:    90 SLVHEQLGPTNAPKYVSIVFTVFLYVLVANLLGLIPFSFATTAQLVVAFSLSFSLFIGVTLIGVVKHKLHFLSFFL-------PSGAPIALAPLLVVIELISYIFRPISLGVRLFANLTAGHSLLAIIAGFSWTMLGVNTFFMTALATLPAVVIIAIFG------LELAVSFLQAYVFAVLLCIYLKDAIE 267
>gi|113170503|ref|YP_717294.1| Atp6 [Ostreococcus tauri] >gi|112806910|emb|CAL36416.1| unnamed protein product [Ostreococcus tauri] (249 aa)
Score = 117, Expect = 2.8e-04, Identities = 46/180 (25%), Positives = 84/180 (46%)
  Q:    77 TLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           +LV E +GK+ +K+ P++FT+F ++ L N+I ++ +    T+   +TF L     +   ++G +     FF   L         G  + +        +       IS+ +RL+AN+MAG  ++ +       M      VL+    +    +FA+    FL+  V  +QA+VF +LT  Y
  S:    72 SLVSEQIGKKGVKYFPFVFTLFTFLLLSNLIGMIPYSFTTTSHFVITFTLSFCVFIAMTLIGFQTHGLHFFSFLL-------PPGAPLALAPGLVVIELVSYCFRGISLGVRLFANMMAGHTLVKILSGFAWSMLSLS-GVLKAAAAIPFLVVFALM---FLEVGVACLQAYVFTILTCIY 241
>gi|15827570|ref|NP_301833.1| F0F1 ATP synthase subunit A [Mycobacterium leprae TN] >gi|1168559|sp|P45829|ATP6_MYCLE ATP synthase a chain (ATPase protein 6) >gi|699349|gb|AAA63110.1| atpB [Mycobacterium leprae] >gi|13093120|emb|CAC31520.1| probable ATP synthase A chain protein [Mycobacterium leprae] (251 aa)
Score = 117, Expect = 2.9e-04, Identities = 58/216 (26%), Positives = 94/216 (43%)
  Q:    50 FSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFT-PYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKF----LFKFYIKTKSGNKVMI----PYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEE 265
           F   K++    P G+  F   +    +T +   +G     F  P   T+F +I + N +SV+  +   A    T        L +    I Y  +  F+ F    L   + +   G+ V +      F  P  + + I   IS+SLRL+ NI AG +++ L    P       P ++   P  I  S          D  VG+IQAF+F +LT+ Y+S + E E+
  S:    47 FLRTKVNSTGVPCGMQLFWEAITVQMRTQIESAIGMRIAPFVLPLAVTIFVFILISNWLSVLPLQYTNADGHTT------EVLSSAAADINYVLALAFFVFVCYHLAGIWRRGIVGHPVAVLKGHVAFLAPINLVEEITKPISLSLRLFGNIFAGGILVTLIALFP-------PYIMW-APNAIWKSF---------DLFVGAIQAFIFSILTILYFSQAMEVED 248
>gi|15964588|ref|NP_384941.1| F0F1 ATP synthase subunit A [Sinorhizobium meliloti 1021] >gi|15073766|emb|CAC45407.1| Probable ATP synthase A chain transmembrane protein [Sinorhizobium meliloti 1021] (250 aa)
Score = 117, Expect = 3.0e-04, Identities = 56/187 (29%), Positives = 95/187 (50%)
  Q:    77 TLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVG-FENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEP 263
           +++ E  G   +KF P +F++F +I   N++ +V  F   T+   VTFAL +F  +GT++L   Y+     + FL  F  +   G   ++P       I+ +  P IS+S+RL+AN++AG + L +F      +       +      IL  +  V   G L++LV  +QA+VF VLT  Y + +  P
  S:    71 SMLREGAGSHGMKFFPMVFSLFMFILTANLLGMVPYFFTVTSQIIVTFALAVFV-IGTVLLYGFYKHG---FGFLKLFVPQGVPG--ALLPLVVAIEIISFLSRP-ISLSVRLFANMLAGHITLKVFAGFVASLSAFGALGIGGA---ILPLIMTVALTG-LEFLVAFLQAYVFAVLTCMYLNDAVHP 247
>gi|167358559|ref|ZP_02293213.1| ATP synthase F0, A subunit [Rhizobium leguminosarum bv. trifolii WSM1325] >gi|167074626|gb|EDR78448.1| ATP synthase F0, A subunit [Rhizobium leguminosarum bv. trifolii WSM1325] (250 aa)
Score = 117, Expect = 3.0e-04, Identities = 57/186 (30%), Positives = 93/186 (50%)
  Q:    78 LVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVG-FENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFY-IKTKSGNKVMIPYFFNPFGITDIIMPW----ISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEP 263
           ++ E  GK+ +KF P +F++F ++   N++ +   F   T+   VTFAL +      ++ G        FYK  F F  +   SG    +P    P  +T  I+ +    IS+S+RL+AN++AG + L +F     V        L  G  V+   +  V   G L++LV  +QA+VF VLT  Y + +  P
  S:    72 MLKEGAGKQGMKFFPLVFSLFMFVLTANLLGMFPYFFTVTSQIIVTFALAILVIGTVLVYG--------FYKHGFHFLNVFVPSG----VPGLLLPLVVTIEIISFLSRPISLSVRLFANMLAGHITLKVFAGF--VASLGTMGALGIGGAVLPL-IMTVALTG-LEFLVAFLQAYVFAVLTCMYLNDAIHP 247
>gi|120405288|ref|YP_955117.1| F0F1 ATP synthase subunit A [Mycobacterium vanbaalenii PYR-1] >gi|119958106|gb|ABM15111.1| ATP synthase F0, A subunit [Mycobacterium vanbaalenii PYR-1] (256 aa)
Score = 117, Expect = 3.1e-04, Identities = 60/234 (25%), Positives = 104/234 (44%)
  Q:    35 IVITIIMTLVLVYYNFSMK-KLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFT-PYIFTVFCYIFLCNIISVVG-------------FENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEEESQ 268
           I+ T I  ++++   F +K K+     P G+  F   L    +  + + +G +   F  P    +F +I + N ++V+              ++ P +      AL LF         I Y  +  + + +    IK   G+      F  P  I + +   IS++LRL+ NI AG +++ L     + MF   P  ++  P  I  +          D  VG IQAF+F +LT+ Y+S S E + E  
  S:    36 ILATAITAVIVIGLAFYLKSKVTSTGVPGGVQLFWEALTIQMRGQIEQAIGMKVAPFVLPLAVAIFVFILISNWLAVLPLQYGGSDGAAGELYKPPASDINFVLALALFVF-------ICYHAAGIWRRGIVGHPIKVVKGHVA----FLAPINIVEELAKPISLALRLFGNIFAGGILVAL-----IAMF---PWYVQWLPNAIWKTF---------DLFVGLIQAFIFSLLTILYFSQSMELDHEDH 256
>gi|13432050|gb|AAD02026.2|AAD02026 ATP synthase F0 subunit 6 [Tetilla sp.] (244 aa)
Score = 116, Expect = 3.3e-04, Identities = 57/223 (25%), Positives = 99/223 (44%)
  Q:    34 IIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           ++VI +I++ +L       K+L PN+      F I +      ++V E +GK   KF P++  +F +I + N++ +  +   PTA   +T  L +   +   +LG+   K  F       F I    G  +++  F         ++  IS+ +RL ANI AG L+  +       M      +    P +I+       F   L+ +V  IQA+VF +LT  Y
  S:    34 MMVIAVIISWLLS----EGKRLIPNR----WQFLIESAYINIHSVVQENLGKAGQKFFPFVLCLFIFIAMLNVLGLFPYVFVPTAQIVITLGLSVSIIIAVTLLGVLTFKLKF-------FSILMPGGVPLVLAPFLVVIETASYLIKAISLGVRLAANISAGHLLFAILSGFAFNMLSSGMIISSLVPMLIMV------FITLLEIMVAVIQAYVFCLLTTIY 236
>gi|88606873|ref|YP_505726.1| F0F1 ATP synthase subunit A [Anaplasma phagocytophilum HZ] >gi|88597936|gb|ABD43406.1| ATP synthase F0, A subunit [Anaplasma phagocytophilum HZ] (242 aa)
Score = 116, Expect = 3.3e-04, Identities = 44/171 (25%), Positives = 78/171 (45%)
  Q:    88 IKFTPYIFTVFCYIFLCNIISV--VGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWS 258
           +++ P++ ++F ++  CNII +  +GF   T+  +VT AL +       +LG  +Q   F   FL         G  + +        +   +   +S+++RL AN++AG  I+ +     + M      VL P P   +  L A       +  V  +QA++F VLT  Y S
  S:    82 LRYIPFVLSIFLFVLACNIIGILPLGF-TATSHVSVTLALSVVVCASVTVLGFNHQGLHFLRIFL-------PEGTPLWLAPMMVFIKLFAYLARPVSLAIRLAANMIAGHTIIAVIAEFVLKMH----PVLAPLPFAFIMVLIA------FEIFVAILQAYIFTVLTTVYLS 236
>gi|46447308|ref|YP_008673.1| putative H+-transporting two-sector ATPase (chain a, atpB) [Candidatus Protochlamydia amoebophila UWE25] >gi|46400949|emb|CAF24398.1| putative H+-transporting two-sector ATPase (chain a, atpB) [Candidatus Protochlamydia amoebophila UWE25] (271 aa)
Score = 116, Expect = 3.3e-04, Identities = 61/257 (23%), Positives = 114/257 (44%)
  Q:    10 ITTLQASSAFSDWKPFEYRSEITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGF-ENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNK-VMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEEE 266
           I+ L      + W  F +R E     ++   +  ++ Y     K++ P+K    +   +      F  L+ E++G E   + P++ T+F YIF  NI  +V   + P++   +T AL +        L I   ++   + FL+      KS  + ++ P  F+   I+ +  P ++++LRL+ N++   +++G F  + +VM            E  +     +PF  FL  L   +QA VF +L+  Y   S   E E
  S:    28 ISVLYHRFQHTTWAQFLHRWENIIFAILVASLISLVAYLGARKKEIIPSKFQNLLEIAV----EKFSHLILEVLGPEGKAYIPFLGTLFIYIFTMNIFGMVPLMKAPSSSLNITAALAICVFCLVQFLNI---RNMGIFGFLYHLAGSPKSMLEWLLAPLMFSLEIISQLSRP-LTLALRLFGNVLGEDILIGTFALMGVVMIS--------SVETFVGIPLQLPFM-FLGLLTSFMQALVFTLLSTVYILLSMHKEGE 269
>gi|183013863|gb|ACC38451.1| ATP synthase F0 subunit 6 [Phytophthora ramorum] >gi|183013865|gb|ACC38452.1| ATP synthase F0 subunit 6 [Phytophthora ramorum] >gi|183013867|gb|ACC38453.1| ATP synthase F0 subunit 6 [Phytophthora ramorum] >gi|183013869|gb|ACC38454.1| ATP synthase F0 subunit 6 [Phytophthora ramorum] (178 aa)
Score = 116, Expect = 3.4e-04, Identities = 42/122 (34%), Positives = 60/122 (49%)
  Q:    78 LVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALIL 199
           L Y  +GK    F   IF VF +I LCN+I +V +    T+   +TF L L   LG  ++GIK  K +F    L        SG  + +     P  +   I   IS+ +RL+AN+MAG  +L
  S:    54 LTYSSIGKAGKHFVSLIFVVFFFILLCNLIGMVPYSFTVTSHLIITFTLALTIYLGFNLIGIKKHKLNFLNLLL-------PSGASIALVPILVPIELVSYIFRVISLPVRLFANMMAGHTLL 169
>gi|169261436|gb|ACA52298.1| ATPase subunit 6 [Candelabrochaete africana] (237 aa)
Score = 116, Expect = 3.4e-04, Identities = 60/224 (26%), Positives = 111/224 (49%)
  Q:    33 SIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTL--GTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGF-----LDWLVGSIQAFVFVVLTLCY 256
           S++V+++I+TL   Y   +  KL P+K     +  + ++  +  ++V E +GKE   + P+I++VF +I + N+   V + + T  T++  ++GL  T+     ILG+   K  FF  F+        +G  + +        +   +    S+ +RL+AN++AG  ++ +       MF            VI+F +  +PF  F     L+  V  IQA+VF +LT  Y
  S:    28 SVLVVSLIVTLH--YMGNNENKLVPSK----WSIALESIFASIHSMVREQLGKEI--YLPFIYSVFFFILIANLFGNVPY-SFTITTSIMVSIGLSFTILVAVTILGLSIHKLHFFSYFV-------PAGTPLALVPLLVLIEMVSYLARAFSLGIRLFANVVAGHTLMKILATFLYQMF---------SAGVIMFVVTLLPFVLFLAIMGLELAVSFIQAYVFTILTWSY 233
>gi|86152867|ref|ZP_01071072.1| ATP synthase F0, A subunit [Campylobacter jejuni subsp. jejuni HB93-13] >gi|85843752|gb|EAQ60962.1| ATP synthase F0, A subunit [Campylobacter jejuni subsp. jejuni HB93-13] (226 aa)
Score = 116, Expect = 3.8e-04, Identities = 48/177 (27%), Positives = 78/177 (44%)
  Q:    89 KFTPYIFTVFCYIFLCNIISVV-GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEE 265
           K+ P + T+   +F  NII ++ GF +PTA   +T +L        II+ + Y       +   K++       K++ P  F P  I   +   +S+S RL+ NI    L L +  AL           + P P  +L +  A             +QAF+F++LT  Y +G+T  EE
  S:    75 KYLPLVATLGIIVFFSNIIGIIPGFHSPTASLNLTLSLA-------IIVFVYYHFEGIRAQGFVKYFAHFMGPIKLLAPLMF-PIEIVSHLSRVVSLSFRLFGNIKGDDLFLMVILALV--------PYIAPLPAYVLLAFMAF------------LQAFIFMILTYVYLAGATVVEE 224
>gi|57238076|ref|YP_179325.1| F0F1 ATP synthase subunit A [Campylobacter jejuni RM1221] >gi|86150332|ref|ZP_01068558.1| ATP synthase F0, A subunit [Campylobacter jejuni subsp. jejuni CF93-6] >gi|121612748|ref|YP_001000879.1| F0F1 ATP synthase subunit A [Campylobacter jejuni subsp. jejuni 81-176] >gi|148926207|ref|ZP_01809892.1| ATP synthase F0 sector A subunit [Campylobacter jejuni subsp. jejuni CG8486] >gi|167005789|ref|ZP_02271547.1| F0F1 ATP synthase subunit A [Campylobacter jejuni subsp. jejuni 81-176] >gi|57166880|gb|AAW35659.1| ATP synthase F0, A subunit [Campylobacter jejuni RM1221] >gi|85839157|gb|EAQ56420.1| ATP synthase F0, A subunit [Campylobacter jejuni subsp. jejuni CF93-6] >gi|87249284|gb|EAQ72245.1| ATP synthase F0, A subunit [Campylobacter jejuni subsp. jejuni 81-176] >gi|145845378|gb|EDK22471.1| ATP synthase F0 sector A subunit [Campylobacter jejuni subsp. jejuni CG8486] (226 aa)
Score = 116, Expect = 3.8e-04, Identities = 48/177 (27%), Positives = 78/177 (44%)
  Q:    89 KFTPYIFTVFCYIFLCNIISVV-GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEE 265
           K+ P + T+   +F  NII ++ GF +PTA   +T +L        II+ + Y       +   K++       K++ P  F P  I   +   +S+S RL+ NI    L L +  AL           + P P  +L +  A             +QAF+F++LT  Y +G+T  EE
  S:    75 KYLPLVATLGIIVFFSNIIGIIPGFHSPTASLNLTLSLA-------IIVFVYYHFEGIRAQGFVKYFAHFMGPIKLLAPLMF-PIEIVSHLSRVVSLSFRLFGNIKGDDLFLMVILALV--------PYIAPLPAYVLLTFMAF------------LQAFIFMILTYVYLAGATVVEE 224
>gi|21450010|ref|NP_659272.1| ATP synthase F0 subunit a [Laminaria digitata] >gi|21425335|emb|CAC87968.1| ATPase subunit 6 [Laminaria digitata] (249 aa)
Score = 116, Expect = 3.9e-04, Identities = 49/226 (21%), Positives = 101/226 (44%)
  Q:    31 ITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPG--PEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           IT+ ++ T +     +Y  + +     +  P      + +L  +   LV++ +G++  K+ P++F +F +I + N+  +V    P + T  +  +       T+ +G+    SS     +   ++    G  +++ +   P  I   +   +S+++RL+AN+MAG  +L +       M      +L     P  +L  LF       L+  V  IQA+VF +L+  Y
  S:    26 ITNAMITTCVGLAFFIYIYYCLSVYGLSCFPTRWQLVLESLYLSTAGLVWDSVGQQGQKYFPFLFVIFSFILISNVSGLV----PYSFTITSHLIQTMVLALTVFVGVMIICSSKHGFHMLSLFLP--GGTSMILAFLLVPIEIVSYVFKPLSLAVRLFANMMAGHTLLKVIAGFAWAMMGSGGLLLVAHIVPLAVLVILFG------LELAVALIQAYVFTILSCIY 241
>gi|73667485|ref|YP_303501.1| F0F1 ATP synthase subunit A [Ehrlichia canis str. Jake] >gi|72394626|gb|AAZ68903.1| H+-transporting two-sector ATPase, A subunit [Ehrlichia canis str. Jake] (243 aa)
Score = 116, Expect = 4.1e-04, Identities = 59/228 (25%), Positives = 106/228 (46%)
  Q:    35 IVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISV--VGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTE 262
           +V++ I   +  Y     + + PN   + I  FI+  +    + +   +GKE +++ P +FT+F +I  CN++ +  +GF   T+   VTFA+ +   +   I+G K+Q   F    L +      +   V I  F             +S+S+RL AN++AG  I+ +     + M       L P P  ++F +  + F  F    V  +QA++F VLT  Y S + +
  S:    34 MVLSTISVALFCYIGLKKESIIPNGI-QSIVEFIYEFI---VSTIESNVGKEGLQYIPLVFTIFMFIATCNLLGILPLGF-TATSHIAVTFAISMVVFVSVTIIGFKHQGIHFLRILLPQGTPGWLAPMMVFIELF-------AYCARPVSLSIRLAANMIAGHTIIKVIAGFVVKM----NIFLTPLP--MIFIIILIGFEIF----VAILQAYIFTVLTCVYLSDAVK 241
>gi|108744832|gb|ABG02567.1| ATPase subunit 6 [Gomphidius roseus] (240 aa)
Score = 116, Expect = 4.1e-04, Identities = 55/196 (28%), Positives = 96/196 (48%)
  Q:    61 PKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGL-FTTL-GTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGF-----LDWLVGSIQAFVFVVLTLCY 256
           P   +  + +L  +  ++V E +G+E   + P+I+++F +I + N++  + +   T  T+V  ++GL FT L G  ILG+   K  FF  F+        SG  + +        +   +    S+ +RL+AN++AG  +L +       MF            +I+F +  VPF  F     L+  V  IQA+VFV+L   Y
  S:    53 PSKWSILLESLFSSINSMVREQIGREI--YLPFIYSLFFFILIANLLGNIPYSY-TITTSVIVSIGLSFTILIGVTILGLSIHKIHFFSFFI-------PSGTPLALVPLLVLIELISYLARAFSLGIRLFANVVAGHTLLKILSTFLYQMFSGG---------LIIFIVTLVPFALFLAITGLELAVSFIQAYVFVLLVCSY 236
>gi|87199337|ref|YP_496594.1| F0F1 ATP synthase subunit A [Novosphingobium aromaticivorans DSM 12444] >gi|87135018|gb|ABD25760.1| ATP synthase F0, A subunit [Novosphingobium aromaticivorans DSM 12444] (260 aa)
Score = 116, Expect = 4.1e-04, Identities = 59/195 (30%), Positives = 90/195 (46%)
  Q:    62 KGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNI-----ISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKV-MIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGF------LDWLVGSIQAFVFVVLTLCY 256
           +G+  F+ NLL A        +GK   K+ PY+F++F +I   N+     +++VG    TA +  T    L      I+LG+ + K    +  LF        G  V MIP  F P  +   ++   S+ LRL+  +MAG ++L +              +      V  F L AVP          L+ LV  IQA+VF +LT  Y
  S:    68 EGLTGFVDNLLQAN-------IGKAGRKYLPYVFSLFAFILFANMLGLLPLALVGVHPFTATSHFTVTGVLAIMSFAIVLGVGFAKHGLHFFSLF-----VPHGTPVPMIPIIF-PIELISFMVRPFSLGLRLFVAMMAGHVLLEVLSGF---------VISGTNAGVGTFFLAAVPSFLLMIGICALELLVAGIQAYVFALLTCVY 252
>gi|77920583|ref|YP_358398.1| F0F1 ATP synthase subunit A [Pelobacter carbinolicus DSM 2380] >gi|77546666|gb|ABA90228.1| ATP synthase F0, A subunit [Pelobacter carbinolicus DSM 2380] (239 aa)
Score = 115, Expect = 4.4e-04, Identities = 43/182 (23%), Positives = 88/182 (48%)
  Q:    89 KFTPYIFTVFCYIFLCNIISVV-GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEEESQVK 270
           +F P++ ++F ++   NI+SV+ G+  PT   + T AL +   L   + GI+ +  S +     + YIK           F  PF +   +   +++++RL+ N+M+G++I G+  ++  + F   P +++                  L  + G IQA++F VL   Y + + + E++ + K
  S:    77 EFLPFLGSLFLFVLFSNILSVIPGYVAPTGSLSTTTALAVCVFLSVPLWGIQRRGLSGY----LRMYIKPS--------VFMLPFNVMGEVSRTLALAVRLFGNVMSGSMIAGILLSIAPLFF---PVLMQ-----------------LLGLITGVIQAYIFAVLAAVYIAAAAQMEQQREAK 227
>gi|158520818|ref|YP_001528688.1| ATP synthase F0, A subunit [Desulfococcus oleovorans Hxd3] >gi|158509644|gb|ABW66611.1| ATP synthase F0, A subunit [Desulfococcus oleovorans Hxd3] (224 aa)
Score = 115, Expect = 4.5e-04, Identities = 64/233 (27%), Positives = 104/233 (44%)
  Q:    26 EYRSEITSIIVITIIMTLVLVYYNFSMKK--LDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGF-ENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYF-FNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWL-VGSIQAFVFVVLTLCYWS 258
           E    I  I ++ I+M +++V+  F+ +   L P +        +  L    +  + E +G+   K  P I  +F ++ + N + V+ F E PT    V  +LG+   +     GIK +          + Y+K       M P+F   P  +   +   ISIS RL+ NIM G++I+ +   L                   ++SL   PF  F   L VG+IQAFVF +LT+ Y S
  S:    18 ELTFNIKVIAMVWIVMAILIVFALFTTRNRGLVPGRMQIVGELLVTQLYALTEDALDEKLGR---KLAPMICALFMFLVMSNYMGVIPFMEEPTKDLNVPLSLGIMGFVIAHFFGIKQKG--------LRAYVK-----GYMEPFFILLPLNLIGELAKVISISFRLFGNIMGGSIIILVVSHL-------------------VYSLILPPFLCFFFGLFVGTIQAFVFTMLTIVYVS 220
>gi|172058687|ref|YP_001815147.1| ATP synthase F0, A subunit [Exiguobacterium sibiricum 255-15] >gi|171991208|gb|ACB62130.1| ATP synthase F0, A subunit [Exiguobacterium sibiricum 255-15] (247 aa)
Score = 115, Expect = 4.5e-04, Identities = 61/235 (25%), Positives = 108/235 (45%)
  Q:    22 WKPFEYRSEITSIIVITIIMTLVLVYYNFSMKKL--DPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISV---------VGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPW---ISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           W  F      T++I + I   LV +      ++L   P      +  F+  + G   + +    G  F+ F     T+F +I + N++ +         + F +PTA   VT AL     + +   G+K +         F  Y KT          F  P  I  II  +   +++ LRL+ NI AG +++G+  ++ +V    D   L P    IL ++  + + GF    +G+IQA++F++LT+ Y
  S:    13 WGDFVLYGSWTNLITVLIAAALVFLIAVAGTRRLVMKPTGAQNVMEMFLEFVRGIISSTMDWKTGGRFLTFG---MTLFLFIIVSNLMGLPFNVVTGHYIWFNSPTADPYVTLALSSMVVVMSHYYGVKMRG--------FGSYAKT----------FMTPMFIITIIEEFANTLTLGLRLYGNIFAGEIMIGIILSIGIVSGTNDFQFLGP-VGAILSAIPMLIWQGF-SLFIGAIQAYIFLILTMVY 238
>gi|148559292|ref|YP_001258409.1| F0F1 ATP synthase subunit A [Brucella ovis ATCC 25840] >gi|148370549|gb|ABQ60528.1| ATP synthase F0, A subunit [Brucella ovis ATCC 25840] (249 aa)
Score = 115, Expect = 4.6e-04, Identities = 60/235 (25%), Positives = 110/235 (46%)
  Q:    29 SEITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVG-FENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPW-------------ISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEP 263
           + +++ +V T+++    +Y   S + L P +  + ++   +  +    T + +  G + +KF P++F++F ++ + N I +   F   T+   VTFAL L      I  G        F+K  F F               F P G+  II+P              IS+S+RL+AN++AG + L +F    + +     ++   G    +  L        L++LV  +QA+VF VLT  Y + +  P
  S:    27 TNVSAFMVATVVLASGFLYLTSSGRGLIPTRL-QSVSEMAYEFVA---TSLRDSAGSKGMKFFPFVFSLFMFVLVANFIGLFPYFYTVTSQIIVTFALSLLVIGTVIFYG--------FFKHGFGFL------------KLFVPSGVPGIIVPLVVLIEIISFLSRPISLSVRLFANMLAGHITLKVFAGFVVSL----SSLGALGIGGTVLPLLMTVAITALEFLVAFLQAYVFTVLTCMYINDAVHP 247
>gi|20807124|ref|NP_622295.1| F0F1 ATP synthase subunit A [Thermoanaerobacter tengcongensis MB4] >gi|20515619|gb|AAM23899.1| F0F1-type ATP synthase a subunit [Thermoanaerobacter tengcongensis MB4] (217 aa)
Score = 115, Expect = 4.6e-04, Identities = 51/202 (25%), Positives = 86/202 (42%)
  Q:    61 PKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTE 262
           P G+   +  ++  F   V   +G  +  + PY+ TV  ++ + N IS+ G   PT   + T AL + + +  II  ++ +    F+ FL  F+       +  I  F N   + D+ +  +S++ RL+ NI    +I        M +  R   V+ P    I F LF            G +Q  VFV LT+ Y   + E
  S:    48 PSGVQNVVELIVDGFNKFVESALGDHWKDYAPYLGTVAAFLTIANTISIFGLTPPTKDFSTTSALAIMSIVTVIIASLRARG---FFGFLKHFF-------RSPIDLFIN---LLDLFVRPLSLAARLFGNIFGAVVI--------MELIERAVPVVLPAFLSIYFDLFD-----------GLLQMLVFVFLTMLYIEEAIE 217
>gi|149174227|ref|ZP_01852854.1| ATP synthase subunit A [Planctomyces maris DSM 8797] >gi|148846772|gb|EDL61108.1| ATP synthase subunit A [Planctomyces maris DSM 8797] (238 aa)
Score = 115, Expect = 4.7e-04, Identities = 53/201 (26%), Positives = 95/201 (47%)
  Q:    71 LLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVV-GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYA-LPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTE-----------PEEESQVKK 271
           L+   +  + E+  ++   + P+I T+F +I + NI+S+V G+  PT+  + T AL     +   + GI  Q    +     K YI+              PF I   +   +++++RL+ NIM+G++I  +    +P+ +              IL   F +        L G IQA++F VL + Y + +T+           PEE S+ KK
  S:    58 LVSGLRNQIQEVSQQDPGPYLPFIGTLFLFIVVSNILSIVPGYHAPTSSISTTAALATCVFVAVPLYGIASQGLVDY----LKQYIRPS--------VLMLPFNIIGELSRTLALAVRLYGNIMSGSVIGAILLGFVPLFV-------------PILMQAFGL--------LTGIIQAYIFSVLAMVYIASATQVSQAISEQPQSPEEYSKQKK 238
>gi|23501286|ref|NP_697413.1| F0F1 ATP synthase subunit A [Brucella suis 1330] >gi|62289372|ref|YP_221165.1| F0F1 ATP synthase subunit A [Brucella abortus bv. 1 str. 9-941] >gi|82699297|ref|YP_413871.1| F0F1 ATP synthase subunit A [Brucella melitensis biovar Abortus 2308] >gi|161618358|ref|YP_001592245.1| F0F1 ATP synthase subunit A [Brucella canis ATCC 23365] >gi|163842666|ref|YP_001627070.1| F0F1 ATP synthase subunit A [Brucella suis ATCC 23445] >gi|189023625|ref|YP_001934393.1| ATP synthase subunit A [Brucella abortus S19] >gi|23347174|gb|AAN29328.1| ATP synthase F0, A subunit [Brucella suis 1330] >gi|62195504|gb|AAX73804.1| AtpB, ATP synthase F0, A subunit [Brucella abortus biovar 1 str. 9-941] >gi|82615398|emb|CAJ10367.1| H+-transporting two-sector ATPase, A subunit [Brucella melitensis biovar Abortus 2308] >gi|161335169|gb|ABX61474.1| ATP synthase F0, A subunit [Brucella canis ATCC 23365] >gi|163673389|gb|ABY37500.1| ATP synthase F0, A subunit [Brucella suis ATCC 23445] >gi|189019197|gb|ACD71919.1| ATP synthase subunit A [Brucella abortus S19] (249 aa)
Score = 115, Expect = 4.7e-04, Identities = 60/235 (25%), Positives = 110/235 (46%)
  Q:    29 SEITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVG-FENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPW-------------ISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEP 263
           + +++ +V T+++    +Y   S + L P +  + ++   +  +    T + +  G + +KF P++F++F ++ + N I +   F   T+   VTFAL L      I  G        F+K  F F               F P G+  II+P              IS+S+RL+AN++AG + L +F    + +     ++   G    +  L        L++LV  +QA+VF VLT  Y + +  P
  S:    27 TNVSAFMVATVVLASGFLYLTSSGRGLIPTRL-QSVSEMAYEFVA---TSLRDSAGSKGMKFFPFVFSLFMFVLVANFIGLFPYFYTVTSQIIVTFALSLLVIGTVIFYG--------FFKHGFGFL------------KLFVPSGVPGIIVPLVVLIEIISFLSRPISLSVRLFANMLAGHITLKVFAGFVVSL----SSLGALGIGGAVLPLLMTVAITALEFLVAFLQAYVFTVLTCMYINDAVHP 247
>gi|41408555|ref|NP_961391.1| F0F1 ATP synthase subunit A [Mycobacterium avium subsp. paratuberculosis K-10] >gi|41396913|gb|AAS04774.1| AtpB [Mycobacterium avium subsp. paratuberculosis K-10] (252 aa)
Score = 115, Expect = 4.9e-04, Identities = 56/234 (23%), Positives = 101/234 (43%)
  Q:    32 TSIIVITIIMTLVLVYYNFSMK-KLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFT-PYIFTVFCYIFLCNIISVVGFE-------NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEE 265
           T  I+ T I  L+++   F ++ K+     P G+  F   +    +  +   +G     F  P   T+F +I + N +SV+  +           L +V   +     L   +  + Y  +  + + +    +    G+      F  P  + + +   IS+SLRL+ NI AG +++ L    P       P ++   P  I  +          D  VG+IQAF+F +LT+ Y+S + E EE
  S:    29 TDTILSTGIAALIVLALAFFLRAKITSTGVPSGVQLFWEAITVQMRDQIESAVGMRIAPFVLPLAVTIFVFILISNWLSVLPLQYTDKSGHTTELLKSVAADINYVLALALFVF-VCYHVAGIWRRGVVGHPLAVLKGHVA----FLAPINVVEELAKPISLSLRLFGNIFAGGILVALIALFP-------PYIMW-APNAIWKAF---------DLFVGAIQAFIFSILTILYFSQAMEIEE 249
>gi|57505563|ref|ZP_00371490.1| ATP synthase F0, A subunit [Campylobacter upsaliensis RM3195] >gi|57016110|gb|EAL52897.1| ATP synthase F0, A subunit [Campylobacter upsaliensis RM3195] (226 aa)
Score = 115, Expect = 4.9e-04, Identities = 49/177 (27%), Positives = 77/177 (43%)
  Q:    89 KFTPYIFTVFCYIFLCNIISVV-GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEE 265
           K+ P + T+   +F  NII ++ GF  P+A   +T +L L   +     GIK Q        + K++       K++ P  F P  +       IS+S RL+ NI    L L +  AL           + P P  +L +  A             +QAF+F++LT  Y +G+T  EE
  S:    75 KYLPLVATLGVIVFFSNIIGIIPGFHAPSASLNLTLSLALIVFVYYHFEGIKTQG-------VVKYFAHFMGPVKILAPLMF-PIELVSHFSRVISLSFRLFGNIKGDDLFLAVILALV--------PYIAPLPAYVLLTFMAF------------LQAFIFMILTYVYLAGATIVEE 224
>gi|90961570|ref|YP_535486.1| F0F1 ATP synthase subunit A [Lactobacillus salivarius UCC118] >gi|90820764|gb|ABD99403.1| ATP synthase A chain [Lactobacillus salivarius UCC118] (237 aa)
Score = 115, Expect = 5.0e-04, Identities = 57/176 (32%), Positives = 86/176 (48%)
  Q:    89 KFTPYIFTVFCYIFLCNIISVV------GFE---NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPY-FFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPE 264
           +F    FT+F +IF+ N + ++      G E   +PT+    T  L     + +  LG+K        KF FK Y K    N  + P     P  I +    +I+++LRL+ NI AG ++L L Y   M   +   T +   P  I++  F+V         +GSIQA+VFV LT+ Y S   E E
  S:    74 QFGLLAFTLFVFIFISNQLGLIIELTFNGVEYVKSPTSSPLTTLTLAFMILVLSHYLGVK--------KFGFKGYFK----NTFLSPMPALLPISIFEQFTNFITLALRLYGNIYAGEVLLKLIYN--MANSKGVLTYIPAIPLEIIWQGFSV--------FIGSIQAYVFVTLTMVYISQKVEKE 237
>gi|148259414|ref|YP_001233541.1| F0F1 ATP synthase subunit A [Acidiphilium cryptum JF-5] >gi|146401095|gb|ABQ29622.1| ATP synthase F0, A subunit [Acidiphilium cryptum JF-5] (251 aa)
Score = 115, Expect = 5.1e-04, Identities = 50/179 (27%), Positives = 86/179 (48%)
  Q:    78 LVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVG-FENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           +V + +G+E  +F P++FT+F +I + NI+ +   F   T+   +T AL LF    + ++G  Y    F      KF+  +  G    +     P  I   +   IS+S+RL+ANI AG ++  +F    +++      V   G    +  L        L++LV  +QA+VF +LT  Y
  S:    74 MVLDTIGEEGKRFFPFVFTLFAFILIGNILGLFPYFFAFTSHIAITGALALFVFALSTLVGFWYHGIGF-----LKFF--SPPGVPGWLLPLLIPIEIVSFLSRPISLSVRLFANITAGHVMWEVFAGFMLMLVSGLGAV---GVVAAIIPLGLNIALTALEFLVAFLQAYVFAILTCLY 243
>gi|111225286|ref|YP_716080.1| F0F1 ATP synthase subunit A [Frankia alni ACN14a] >gi|111152818|emb|CAJ64562.1| ATP synthase a chain (ATPase protein 6) [Frankia alni ACN14a] (289 aa)
Score = 115, Expect = 5.3e-04, Identities = 44/179 (24%), Positives = 88/179 (49%)
  Q:    82 IMGKEFIKFTPYIFTVFCYIFLCNIISVVGFEN--PTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGI--TDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGS 260
           ++G++  ++TPY+  +F ++ + N+++++       T+   V   L + T +  I  GIK   +  +    FK  I       + I     P  I  T I+ P+ ++++RL+AN+ AG L+L +F      +  + P V   G   +L ++    F   +D    ++QA++  +LT  Y  G+
  S:    90 VIGEKGARYTPYLLVLFSFVLVSNVLAIIPAAQFPATSRIAVPMVLAVVTWVMFIYAGIKSNGAGAY----FKEMIDPAPTAPLAIRLLLGPIEILSTLIVRPF-TLAIRLFANMFAGHLLLLVFSLGADYLLPKPPFVF--GVASLLVAIVLTAFELVID----ALQAYIITILTAAYIGGA 261
>gi|49475209|ref|YP_033250.1| F0F1 ATP synthase subunit A [Bartonella henselae str. Houston-1] >gi|49238014|emb|CAF27220.1| ATP synthase A chain transmembrane protein [Bartonella henselae str. Houston-1] (252 aa)
Score = 115, Expect = 5.4e-04, Identities = 56/235 (23%), Positives = 110/235 (46%)
  Q:    29 SEITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVG-FENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLF--YALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEP 263
           + ++  IV T++++ V ++ + S + L P +  + ++   +  +    + + E  G + ++F P +F++F +I + N I +   F   T+   +TF+L +      I  G       F   F+        SG  V+I        +       IS+SLRL+AN++AG + L +F  + + M+            P ++  ++ A      L++LV  +QA+VF VLT  Y + +  P
  S:    30 TNVSFFIVATVVVSSVFLFISSSSRGLVPTRM-QSVSEMAYEFVA---STLRESSGVQGMQFFPLVFSLFTFILVANFIGLFPYFYTITSQIMITFSLAMLVIFTVISYGFYKHGVGFLKLFV-------PSGVPVLILPLVTMIEVISFFSRPISLSLRLFANMLAGHITLKVFSGFIVSMIGIGIMGVGGSILPLIMTVAITA------LEFLVAFLQAYVFTVLTCMYLNDAVHP 250
>gi|116618951|ref|YP_819322.1| F0F1-type ATP synthase, subunit a [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|116097798|gb|ABJ62949.1| F0F1-type ATP synthase, subunit a [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (241 aa)
Score = 114, Expect = 5.4e-04, Identities = 63/222 (28%), Positives = 109/222 (49%)
  Q:    32 TSIIVITIIMTLVLVYYNFSMKKLD--PNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIIS----------VVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPY-FFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVP----FHGFLDWLVGSIQAFVFVVLT 253
           T+II   + M +V++      +KL   PNK    I + +    G       ++  K+  +F  + FT+F ++ + N +           V   ++PTA   VT  L + + +    +G++        +  FK YIK    N    PY +  P  I + +  ++++SLRL+ NI AG ++L L             ++  PG    L+S+ A+P    + GF    +G IQA+VFV+LT
  S:    18 TTIISTLLAMAIVIIVSIVLTRKLSVKPNKRQNAIEYLLDFTNGIVNG---QLTKKQARQFGLFAFTLFFFVIVSNEMGLLIQFKLGDGVTYIKSPTADPIVTMTLAIMSLMVAHGMGVQ--------ELGFKGYIK----NMFFTPYSWMLPLNIIEQLANFLTLSLRLFGNIFAGEMLLTLVAN----------SLAWPGHFNGLWSVLALPIEMVWQGF-SLFIGGIQAYVFVILT 230
>gi|86137234|ref|ZP_01055812.1| ATP synthase subunit A [Roseobacter sp. MED193] >gi|85826558|gb|EAQ46755.1| ATP synthase subunit A [Roseobacter sp. MED193] (266 aa)
Score = 114, Expect = 5.5e-04, Identities = 59/235 (25%), Positives = 108/235 (45%)
  Q:    29 SEITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPT----ALTTVTFALGLFTT--LGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLF--YALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEP 263
           + +T  + + ++   +L+    S + + P++  + IA   +   G    +V ++ GK+ +KF PYI T+F +I + N + ++     T    A+T +   L  FT   +G +  G+ +     F+       ++       +I YF  P          +S S+RL  N+MAG  +L +F  +A  + +F   P             +FA+     L+ LV  IQA+VF +LT  Y   +  P
  S:    51 TNVTLWLALAVVCVFLLMVVGSSRRAIVPSRA-QSIAELTY---GFIYKMVEDVAGKDGVKFFPYIMTLFMFILMANFLGLIPMSFTTTSHIAVTAILAGLVFFTVTIVGFVKNGVGFL--GLFWVSSAPLALRPILAIIELISYFVRP----------VSHSIRLAGNVMAGHAVLKVFAGFAGALGLFSFLP-------------IFAITAVYALEVLVAFIQAYVFTILTCVYLKDALHP 264
>gi|194476681|ref|YP_002048860.1| ATP synthase subunit A [Paulinella chromatophora] >gi|171191688|gb|ACB42650.1| ATP synthase subunit A [Paulinella chromatophora] (242 aa)
Score = 114, Expect = 5.5e-04, Identities = 61/226 (26%), Positives = 107/226 (47%)
  Q:    31 ITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMG-KEFIKFTPYIFTVFCYIFLCN---------IISVVGFE--NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILG-LFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           I+S +VI+ ++ LV+       +K++  + P+G+   +  L    + L  E +G K +  + P+I T+F +IF CN         +I +   E   PTA    T A+ L  +L     G+  +   +F     ++Y++      +M+P+      I D   P +S+S RL+ NI+A  L++G L + +P         +L P P +            FL     +IQA +F  L   Y
  S:    34 ISSWVVISALLVLVIT----GTRKME--RDPQGVQNLLEFLWDYLRDLAREQIGEKAYRDWLPFIGTLFLFIFGCNWGGALVPWKLIELPNGELGAPTADINTTVAMALLVSLSYFYAGLSRKGLRYF-----EYYVEP---TPIMLPFKI----IEDFTKP-LSLSFRLFGNILADELVVGVLAFLVP---------ILVPLPAM------------FLGLFTSAIQALIFATLAANY 232
>gi|8708909|gb|AAF78800.1| Fo ATP synthase subunit A [Bradyrhizobium japonicum] (279 aa)
Score = 114, Expect = 5.6e-04, Identities = 52/180 (28%), Positives = 87/180 (48%)
  Q:    84 GKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFL---FKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYA-LPMVMFRRDPTVLEPG--PEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEP 263
           G E +KF P IF++F +I + N+I ++ +    ++   VT AL L      +I G+      FF  F+      YI        ++ +F  P          +S S+RL+AN++AG + L +F   + M+ F         G  P  +  +L+A      L+ LV  +QA+VF +LT  Y + +  P
  S:   107 GSEGMKFFPLIFSLFMFICVSNLIGIIPYTFTISSHLIVTAALALLVFFTVLIYGVAKNGLKFFSIFVPHGVPGYILPLVMFIEILSFFLRP----------VSHSVRLFANMLAGHIALKVFAGFVAMLGFSLGALGWVGGVLPLALTVALYA------LEILVAFLQAYVFAILTCIYLNDAIHP 277
>gi|146276246|ref|YP_001166405.1| F0F1 ATP synthase subunit A [Rhodobacter sphaeroides ATCC 17025] >gi|145554487|gb|ABP69100.1| ATP synthase F0, A subunit [Rhodobacter sphaeroides ATCC 17025] (261 aa)
Score = 114, Expect = 5.7e-04, Identities = 48/186 (25%), Positives = 80/186 (43%)
  Q:    71 LLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFK---FYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           L G    +V E+ G E +K+ PY+ T+F ++   N++ ++      T+   VT  L L   +G   LG       F   F        I+       +I YF  P          +S S+RL  N+MAG  ++ +      +       V+ P     + +++A      L+ LV  +QA+VF +LT  Y
  S:    84 LYGFIHNMVEEVTGHEGVKYFPYVMTLFLFVLCGNVLGLLPLSFTTTSHMAVTVPLALMVFVGVTALGFMRNGPGFLKMFWVTSAPLAIRPVLAVIEVISYFVRP----------VSHSIRLAGNMMAGHAVIKVIAGFASI------AVVSPVVVGAVTAIYA------LELLVAVVQAYVFTILTCVY 251
>gi|118462240|ref|YP_880760.1| F0F1 ATP synthase subunit A [Mycobacterium avium 104] >gi|118163527|gb|ABK64424.1| ATP synthase F0, A subunit [Mycobacterium avium 104] (252 aa)
Score = 114, Expect = 5.8e-04, Identities = 59/234 (25%), Positives = 101/234 (43%)
  Q:    32 TSIIVITIIMTLVLVYYNFSMK-KLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFT-PYIFTVFCYIFLCNIISVVGFE-------------NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEE 265
           T  I+ T I  L+++   F ++ K+     P G+  F   +    +  +   +G     F  P   T+F +I + N +SV+  +             +  A      AL LF  +   + GI  +        + K ++            F  P  + + +   IS+SLRL+ NI AG +++ L    P       P ++   P  I  +          D  VG+IQAF+F +LT+ Y+S + E EE
  S:    29 TDTILSTGIAALIVLALAFFLRAKITSTGVPSGVQLFWEAITVQMRDQIESAVGMRIAPFVLPLAVTIFVFILISNWLSVLPLQYTDKSGHTTELLKSAAADINYVLALALFVFVCYHVAGIWRRGVVGHPLAVLKGHVA-----------FLAPINVVEELAKPISLSLRLFGNIFAGGILVALIALFP-------PYIMW-APNAIWKAF---------DLFVGAIQAFIFSILTILYFSQAMEIEE 249
>gi|15888058|ref|NP_353739.1| F0F1 ATP synthase subunit A [Agrobacterium tumefaciens str. C58] >gi|15155682|gb|AAK86524.1| ATP synthase A chain [Agrobacterium tumefaciens str. C58] (249 aa)
Score = 114, Expect = 5.8e-04, Identities = 53/180 (29%), Positives = 91/180 (50%)
  Q:    77 TLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVG-FENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFY-IKTKSG-NKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLF--YALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           +++ E  GK+ + F P++F++F ++   N++ +   F   T+   VTFAL        I+ G        FYK    F+ I   SG  K ++P   +   I+ +  P IS+S+RL+AN++AG + L +F  +   M             P ++  ++ A      L++LV  +QA+VF VLT  Y
  S:    71 SMLREGAGKKGMVFFPFVFSLFMFVLTANLLGMFPYFFTVTSQIIVTFALACLVIGTVIVYG--------FYKHGLHFFGIFAPSGVPKALLPLVASIEMISFLSRP-ISLSVRLFANMLAGHITLKVFAGFVASMGALGALGVGGAVLPLIMTVAMTA------LEFLVAFLQAYVFAVLTCMY 240
>gi|126665450|ref|ZP_01736432.1| ATP synthase subunit A [Marinobacter sp. ELB17] >gi|126630078|gb|EBA00694.1| ATP synthase subunit A [Marinobacter sp. ELB17] (253 aa)
Score = 114, Expect = 5.8e-04, Identities = 54/233 (23%), Positives = 99/233 (42%)
  Q:    33 SIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVV-GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEE 265
           +I+   I+M L++    F  + L  + PP  +   +  ++   +  + E+          +  T+F +I L N++ V+ GF  PT+  + T AL L   +   +  I             K Y++T     V++     PF I       IS+++RL+ N+M+GA+I  +   +    F   P +++                  L  L G IQA++F +L   Y S +T  +E
  S:    21 TIVNTWIVMVLLVGISWFVTRNLRADVPPDRLRTALEVIVKLIQGQIEEVTQNSARHVMYFAGTLFLFIALSNLMLVIPGFSPPTSSLSTTMALALSVLVAVPVFSIASGG--------VKSYLRTFIEPSVIML----PFNIISEFSHGISLAIRLYGNVMSGAVIAAILLTVAPFFF---PVLMD-----------------MLGLLTGMIQAYIFAILATVYISSATAGKE 222
>gi|118469891|ref|YP_889194.1| F0F1 ATP synthase subunit A [Mycobacterium smegmatis str. MC2 155] >gi|118171178|gb|ABK72074.1| ATP synthase F0, A subunit [Mycobacterium smegmatis str. MC2 155] (252 aa)
Score = 114, Expect = 5.9e-04, Identities = 57/234 (24%), Positives = 104/234 (44%)
  Q:    35 IVITIIMTLVLVYYNFSMK-KLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFT-PYIFTVFCYIFLCNIISVVG-------------FENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEEESQ 268
           I+ T +  ++++   F ++ K+     P G+  F   L    +  +   +G +   F  P   T+F +I + N ++V+              ++ P +      AL LF         + Y  +  + + +    IK   G+      F  P  I + +   IS++LRL+ NI AG +++ L     + MF   P  ++  P  +  +          D  VG IQAF+F +LT+ Y+S S E + E  
  S:    32 ILATAVTAVIVIALAFYLRAKVTSTGVPSGVQLFWEALTIQMRQQIEGSIGMKIAPFVLPLSVTIFVFILISNWLAVLPLQYGGADGAAAELYKAPASDINFVLALALFVF-------VCYHAAGIWRRGIVGHPIKVVKGHVA----FLAPINIVEELAKPISLALRLFGNIFAGGILVAL-----IAMF---PWYIQWFPNAVWKTF---------DLFVGLIQAFIFSLLTILYFSQSMELDHEDH 252
>gi|91201492|emb|CAJ74552.1| similar to ATP synthase subunit A [Candidatus Kuenenia stuttgartiensis] (257 aa)
Score = 114, Expect = 5.9e-04, Identities = 59/241 (24%), Positives = 103/241 (42%)
  Q:    28 RSEITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVG-FENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKV-MIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFH---GFLDWLVGSIQAFVFVVLTLCYWSGSTEPEEESQ 268
           + E   I++  +I+  + ++   + +KL     P  I   +  ++   +      MG+   +F P+I T F YIF  N++  +  F +PT+    T AL L     T   GIK  K  F        Y+K   G  V + P  F    + +++   +S+S+RL+ NI+    ++ +F                 G    L     +P H    FL  L  +IQA +F +L   Y +G+    +E +
  S:    36 KHEWVPIVMSALIIIFLGLFSLLATRKL--RMVPGRIQSLLELIVEGLENFTKSQMGRVAERFIPFIGTFFIYIFCMNMLGQIPLFHSPTSNLNTTVALALIVFFATQYQGIK-SKGVF-------GYLKHMVGKPVWLAPLTFPLHIMQEVLSRPLSLSMRLFGNILGEDTVIAIFI----------------GFAPFLLGFIPLPIHLPMVFLALLGSTIQAMIFALLASFYIAGAIGIHDEEE 255
>gi|149173281|ref|ZP_01851912.1| ATP synthase F0, A subunit [Planctomyces maris DSM 8797] >gi|148848087|gb|EDL62419.1| ATP synthase F0, A subunit [Planctomyces maris DSM 8797] (286 aa)
Score = 114, Expect = 5.9e-04, Identities = 45/175 (25%), Positives = 81/175 (46%)
  Q:    89 KFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEP 263
           K+ P++ + F Y+ +CN++ V  +  + T    VT AL   T    +I G + Q    F+  L    ++   G KV++        +   ++    +++RL+ANIMAG  ++ +F  L  +    D  +      V+  S+ A    G L+  V  +QA+VF  L   + S +  P
  S:   116 KYLPFVLSCFFYVLICNLLGVFPWMGSATGELNVTIALAFTTFCAVVIYGSREQGPIQFWLSLAP-SMELPIGLKVILLPMIWVIELAGFLIKHAVLAIRLFANIMAGHTVIAVF--LGFIAMTADTGMWAI---VMPSSIIAQILVGLLELFVAFLQAYVFAFLATLFISAAVNP 285
>gi|84508613|ref|YP_448660.1| ATP synthase F0 subunit a [Desmarestia viridis] >gi|45925645|gb|AAS79046.1| ATPase subunit 6 [Desmarestia viridis] (249 aa)
Score = 114, Expect = 6.1e-04, Identities = 46/179 (25%), Positives = 81/179 (45%)
  Q:    78 LVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPG--PEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           L+++ +G +  K+ P++F +F +I + N+  +V +    T+    T  L L   +G II+            FL         G  +++ +   P  I   I   +S+++RL+AN+MAG  +L +       M      +L     P  +L  LF       L+  V  IQA+VF +L+  Y
  S:    73 LIWDSVGPQGQKYFPFLFAIFSFILISNVSGLVPYSFTVTSHLIQTMVLALTVFIGVIIICASTHGFHMLSLFL-------PGGTSMVLAFLLVPIEIVSYIFKPLSLAVRLFANMMAGHTLLKVIAGFAWAMMGSGGLLLVAHIVPLAVLVILFG------LELAVALIQAYVFTILSCIY 241
>gi|167748914|ref|ZP_02421041.1| hypothetical protein ANACAC_03688 [Anaerostipes caccae DSM 14662] >gi|167651536|gb|EDR95665.1| hypothetical protein ANACAC_03688 [Anaerostipes caccae DSM 14662] (226 aa)
Score = 114, Expect = 6.2e-04, Identities = 47/185 (25%), Positives = 82/185 (44%)
  Q:    72 LGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           +G      + I+G E   + PY+ TV  Y+ L N+  +VG   PT    VT  L + + +     GI+ +         FK +IK+ +     +P F  P  + ++ +  +S+ +RL+ NI+ G +I+ L                    +++   L  +PF  + D   G IQ +VFV LT  +
  S:    67 VGGVYRFFHGILGDEGKGYIPYLATVGIYLGLSNLSGLVGLTPPTKDINVTAGLAVMSIVLIEYSGIRKKG--------FKGFIKSFAEP---VP-FIAPLNVLEVFIRPLSLCMRLFGNILGGFVIMELL-------------------KIVAPILVPIPFSFYFDVFDGLIQMYVFVFLTAIF 220
>gi|15150737|ref|NP_150403.1| ATP synthase F0 subunit a [Pylaiella littoralis] >gi|3121794|sp|Q37601|ATP6_PYLLI ATP synthase subunit a (ATPase protein 6) >gi|871416|emb|CAA86023.1| ATP synthetase, subunit 6 [Pylaiella littoralis] >gi|15147743|emb|CAC50844.1| ATPase subunit 6 [Pylaiella littoralis] (248 aa)
Score = 114, Expect = 6.2e-04, Identities = 46/179 (25%), Positives = 83/179 (46%)
  Q:    78 LVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE---NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVL--EPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           LV++ +G    K  P++F +F +I + N+  +V +        + T+  AL +F  +  I+L   +   S F             G  +++ +   P  I   +   +S+++RL+AN+MAG  +L +  A+   M      +L     P  +L  LF       L+  V  IQA+VF +L+  Y
  S:    73 LVWDSVGPRRPKVFPFLFVIFSFILISNVQGLVPYSFTITSHLIQTMVLALTVFIGVIIIVLAHGFHMLSLFLP----------GGTSIVLAFLLVPIEIVSYVFKPLSLAVRLFANMMAGHTLLKVIAAVAWAMMGSGGLLLIAHIVPLGVLVILFG------LELAVALIQAYVFTILSCIY 240
>gi|126647164|ref|ZP_01719674.1| ATP synthase A subunit [Algoriphagus sp. PR1] >gi|126577212|gb|EAZ81460.1| ATP synthase A subunit [Algoriphagus sp. PR1] (326 aa)
Score = 114, Expect = 6.4e-04, Identities = 54/226 (23%), Positives = 100/226 (44%)
  Q:    31 ITSIIVITIIMTLVLVYYNFSM----KKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVV-GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           IT  +V+  I+ +V+ +   S     KK  P  P    A     ++     +  + +G ++ KF PY+ T+F +I+  N++ ++ G  N T    VT  L + T + T + G K      ++K +F        G  + +     P  I  +     ++ +RL+  I AG +++  F AL  +              + + S   V F   ++ LV +IQA+VF + +  Y
  S:   102 ITKNVVMMFIVLIVVAFLALSAASHYKKNGPVAPKGAAAIIEPIVIFVRDEIAKDSIGPKYKKFVPYLITLFLFIWFGNLLGLLPGAANMTGNIAVTMVLAVLTFIITNVNGNKD-----YWKHVF-----ATPGVPIPMLLIIVPVEIIGLFTKPFALMVRLFVAITAGHIVILGFIALAFIF---------ESYAIGVASTLMVTFINIIELLVATIQAYVFTLFSAMY 313
>gi|120437594|ref|YP_863280.1| ATP synthase subunit A [Gramella forsetii KT0803] >gi|117579744|emb|CAL68213.1| ATP synthase subunit A [Gramella forsetii KT0803] (366 aa)
Score = 114, Expect = 6.5e-04, Identities = 57/185 (30%), Positives = 92/185 (49%)
  Q:    81 EIMGKEFIKFTPYIFTVFCYIFLCNIISVV-GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPF-----GITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGF---LDWLVGSIQAFVFVVLTLCYWSGSTEPEE 265
           +I  K+++KF P++ +VF +I++ N++ ++ G  N T    VT +LGLFT L  I  G K      FYK  F             IP +  P      G+  +I P  ++ +RL+ANI AG +I+     L  ++            E    +  +VPF  F   L+ LV  +QAF+F +L+  +   + E  E
  S:   198 QIGEKKYMKFMPFLLSVFFFIWITNLMGLLPGAANVTGNIAVTVSLGLFTMLIMIFNGNKD-----FYKHTFWM---------PGIPTWVKPILAVVEGLGLLIKP-AALMIRLFANITAGHIIILSLIGLIFIL------------ENAGIAGVSVPFALFITVLELLVAFLQAFIFTILSALFIGMAVEEHE 364
>gi|15792528|ref|NP_282351.1| F0F1 ATP synthase subunit A [Campylobacter jejuni subsp. jejuni NCTC 11168] >gi|88596640|ref|ZP_01099877.1| ATP synthase F0, A subunit [Campylobacter jejuni subsp. jejuni 84-25] >gi|157415467|ref|YP_001482723.1| F0F1 ATP synthase subunit A [Campylobacter jejuni subsp. jejuni 81116] >gi|88191481|gb|EAQ95453.1| ATP synthase F0, A subunit [Campylobacter jejuni subsp. jejuni 84-25] >gi|112360522|emb|CAL35319.1| ATP synthase F0 sector A subunit [Campylobacter jejuni subsp. jejuni NCTC 11168] >gi|157386431|gb|ABV52746.1| ATP synthase F0 sector A subunit [Campylobacter jejuni subsp. jejuni 81116] (226 aa)
Score = 114, Expect = 6.5e-04, Identities = 48/177 (27%), Positives = 77/177 (43%)
  Q:    89 KFTPYIFTVFCYIFLCNIISVV-GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEE 265
           K+ P + T+   +F  NII ++ GF  PTA   +T +L        II+ + Y       +   K++       K++ P  F P  I   +   +S+S RL+ NI    L L +  AL           + P P  +L +  A             +QAF+F++LT  Y +G+T  EE
  S:    75 KYLPLVATLGIIVFFSNIIGIIPGFHAPTASLNLTLSLA-------IIVFVYYHFEGIRAQGFVKYFAHFMGPIKLLAPLMF-PIEIVSHLSRVVSLSFRLFGNIKGDDLFLMVILALV--------PYIAPLPAYVLLTFMAF------------LQAFIFMILTYVYLAGATVVEE 224
>gi|99866596|gb|ABF67642.1| ATP synthase F0 subunit 6 [Palythoa sp. JVK-2006] (232 aa)
Score = 114, Expect = 6.7e-04, Identities = 57/227 (25%), Positives = 102/227 (44%)
  Q:    30 EITSIIVIT-----IIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFY-IKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           +I S++ +T     +I+ +V+    F   KL PN+        + ++   F  +V + +G E +K+ P++ ++F +I   N++ +  +   PT    VT  L     +G  + G+        +KF + F  I    G  + +            +   IS+ +RL AN+ AG L+  +       M       L  G  + LF L  + F   L+  V  IQA+VF +LT+ Y
  S:    10 KIVSLVALTNSSMMMILAVVVSLLLFRGTKLIPNRWQS----IMESIYSHFHGVVKDNLGAEGLKYFPFVLSLFTFIVFLNVLGLFPYVFTPTVHIVVTLGLSFSIVIGVTLGGL--------WKFKWNFLSILMPDGAPLGLAPLLVMIETVSYVSRAISLGVRLAANLSAGHLLFAILAGFGFNM-------LIAGTFLSLFPLLIMVFITLLEMAVAVIQAYVFCLLTVIY 224
>gi|12724792|gb|AAK05867.1|AE006407_3 ATP synthase subunit a (EC 3.6.1.34) [Lactococcus lactis subsp. lactis Il1403] (217 aa)
Score = 114, Expect = 6.8e-04, Identities = 59/222 (26%), Positives = 97/222 (43%)
  Q:    37 ITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVG----------FENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWS 258
           +T+++   LV++     +L P      + + +  + G  K     +   E  +F    FT+F ++ + N I +V           +++PTA  TV   L L   + +  LG++        KF FK Y+K         P    P  I +     +S+ LRL+ NI AG ++LGL   +        P         I FSLF           + ++QA+VFV+LT  Y S
  S:     4 VTVLIVFGLVFWASRNMQLKPKGKQNVLEWVVDFVNGVSKD---NVGPHEAPRFALMNFTLFSFLLIANCIGLVTKISTPGDVSLWKSPTANPTVDLTLALLVVVMSNTLGVQ--------KFGFKGYLKVAFWKD---PKGLLPMNILEEFTNALSLGLRLYGNIFAGEIMLGLIAGMIQSTMWMLPVAWILEVAWIGFSLF-----------ISALQAYVFVLLTNLYIS 210
>gi|126463459|ref|YP_001044573.1| F0F1 ATP synthase subunit A [Rhodobacter sphaeroides ATCC 17029] >gi|126105123|gb|ABN77801.1| ATP synthase F0, A subunit [Rhodobacter sphaeroides ATCC 17029] (261 aa)
Score = 114, Expect = 6.9e-04, Identities = 47/186 (25%), Positives = 79/186 (42%)
  Q:    71 LLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFK---FYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           L G    +V E+ G E +K+ PY+ T+F ++   N++ ++      T+   VT  L L   +G   LG       F   F        I+       +I YF  P          +S S+RL  N+MAG  ++ +      ++      V        + +++A      L+ LV  +QA+VF +LT  Y
  S:    84 LYGFIHNMVEEVTGHEGVKYFPYVMTLFLFVLCGNVLGLLPLSFTTTSHMAVTVPLALMVFVGVTALGFMKNGPGFLKMFWVTSAPLAIRPVLAVIEVISYFVRP----------VSHSIRLAGNMMAGHAVIKVIAGFASIVVVSPVVV------GAVTAIYA------LELLVAVVQAYVFTILTCVY 251
>gi|190890575|ref|YP_001977117.1| ATP synthase protein, subunit A [Rhizobium etli CIAT 652] >gi|190695854|gb|ACE89939.1| ATP synthase protein, subunit A [Rhizobium etli CIAT 652] (250 aa)
Score = 114, Expect = 7.0e-04, Identities = 50/186 (26%), Positives = 88/186 (47%)
  Q:    78 LVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVG-FENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFY-IKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLF--YALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEP 263
           ++ E  GK+ +KF P +F++F ++   N++ +   F   T+   VTFAL +      ++ G        FYK  F F  +   SG   ++        I   +   IS+S+RL+AN++AG + L +F  +   +             P ++  +L        L++LV  +QA+VF VLT  Y + +  P
  S:    72 MLKEGAGKQGMKFFPLVFSLFMFVLTANLLGMFPYFFTVTSQIIVTFALAILVIGTVLVYG--------FYKHGFHFLNVFVPSGVPGILLPLVVAIEIISFLSRPISLSVRLFANMLAGHITLKVFAGFVASLGALGAVGVGGAVLPLIMTVALTG------LEFLVAFLQAYVFAVLTCMYLNDAIHP 247
>gi|86150991|ref|ZP_01069207.1| ATP synthase F0, A subunit [Campylobacter jejuni subsp. jejuni 260.94] >gi|85842161|gb|EAQ59407.1| ATP synthase F0, A subunit [Campylobacter jejuni subsp. jejuni 260.94] (226 aa)
Score = 113, Expect = 7.2e-04, Identities = 48/177 (27%), Positives = 77/177 (43%)
  Q:    89 KFTPYIFTVFCYIFLCNIISVV-GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEE 265
           K+ P + T+   +F  NII ++ GF  PTA   +T +L        II+ + Y       +   K++       K++ P  F P  I   +   +S+S RL+ NI    L L +  AL           + P P  +L +  A             +QAF+F++LT  Y +G+T  EE
  S:    75 KYLPLVATLGIIVFFSNIIGIIPGFHAPTASLNLTLSLA-------IIVFVYYHFEGIRVQGFVKYFAHFMGPIKLLAPLMF-PIEIVSHLSRVVSLSFRLFGNIKGDDLFLMVILALV--------PYIAPLPAYVLLTFMAF------------LQAFIFMILTYVYLAGATVVEE 224
>gi|86356510|ref|YP_468402.1| F0F1 ATP synthase subunit A [Rhizobium etli CFN 42] >gi|86280612|gb|ABC89675.1| ATP synthase protein, subunit A [Rhizobium etli CFN 42] (250 aa)
Score = 113, Expect = 7.3e-04, Identities = 51/186 (27%), Positives = 88/186 (47%)
  Q:    78 LVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVG-FENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFY-IKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLF--YALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEP 263
           ++ E  GK+ +KF P +F++F ++   N++ +   F   T+   VTFAL +      +I G        FYK  F F  +   SG   ++        I   +   IS+S+RL+AN++AG + L +F  +   +             P ++  +L        L++LV  +QA+VF VLT  Y + +  P
  S:    72 MLKEGAGKQGLKFFPLVFSLFMFVLTANLLGMFPYFFTITSQIIVTFALAILVISTVLIYG--------FYKHGFHFLNVFVPSGVPGILLPLVVAIEIISFLSRPISLSVRLFANMLAGHITLKVFAGFVASLGALGAVGVGGAVLPLIMTVALTG------LEFLVAFLQAYVFAVLTCMYLNDAIHP 247
>gi|108744822|gb|ABG02562.1| ATPase subunit 6 [Hygrophoropsis aurantiaca] (239 aa)
Score = 113, Expect = 7.5e-04, Identities = 53/196 (27%), Positives = 96/196 (48%)
  Q:    61 PKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTL--GTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGF-----LDWLVGSIQAFVFVVLTLCY 256
           P   +  + +L  +  ++V E +GKE   + P+I+++F +I + N++  + + + T  T+V  ++GL  T+  G  ILG+   K  FF  F+        SG  + +        +   +    S+ +RL+AN++AG  +L +       MF            +I+F +  +PF  F     L+  V  IQA+VFV+L   Y
  S:    51 PSKWSILLESLFASINSMVREQIGKEI--YLPFIYSLFFFILIANLLGNIPY-SFTITTSVIVSIGLSFTILIGVTILGLYIHKIHFFSFFI-------PSGTPLALVPLLVLIELISYLARAFSLGIRLFANVVAGHTLLKILSTFLYQMFSGG---------IIIFIVTLLPFALFLAITGLELAVSFIQAYVFVLLVCSY 234
>gi|87125412|ref|ZP_01081258.1| ATP synthase A subunit [Synechococcus sp. RS9917] >gi|86167181|gb|EAQ68442.1| ATP synthase A subunit [Synechococcus sp. RS9917] (242 aa)
Score = 113, Expect = 7.6e-04, Identities = 59/226 (26%), Positives = 107/226 (47%)
  Q:    31 ITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMG-KEFIKFTPYIFTVFCYIFLCN---------IISVVGFE--NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILG-LFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           ++S +VI +++ LV+V      +K++  + P+G+   +  L    + L  E +G K +  + P++ T+F +IF+CN         ++ +   E   PTA    T A+ L  +L     G+  +   +     F++Y+       +M+P+      I D   P +S+S RL+ NI+A  L++  L + +P         VL P P +            FL     +IQA +F  L   Y
  S:    34 LSSWVVIGVLLALVVV----GTRKME--RDPRGVQNLLEFLWDYLRDLAREQIGEKAYRDWLPFVGTLFLFIFVCNWGGALIPWKLVELPNGELGAPTADINTTVAMALLVSLSYFYAGLSRKGLRY-----FEYYVDP---TPIMLPFKI----IEDFTKP-LSLSFRLFGNILADELVVAVLAFLVP---------VLVPLPAM------------FLGLFTSAIQALIFATLAANY 232
>gi|150015302|ref|YP_001307556.1| F0F1 ATP synthase subunit A [Clostridium beijerinckii NCIMB 8052] >gi|149901767|gb|ABR32600.1| ATP synthase F0, A subunit [Clostridium beijerinckii NCIMB 8052] (229 aa)
Score = 113, Expect = 7.6e-04, Identities = 49/172 (28%), Positives = 84/172 (48%)
  Q:    83 MGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVP--FHGFLDWLVGSIQAFVFVVLTL 254
           MG+E+  F PYI T+  Y+ + N++ ++GF+ PT+  ++T +  + T L   +  I+      F K L   +I        M+P       I  II+P +S++LRL+ N++A  ++L L Y                   + +F+ F +P   H + D   G IQ  VF +LT+
  S:    73 MGEEYESFLPYIGTLMIYLLILNLVGLLGFKPPTSDLSITASFAITTFLVVNLNAIRKNGILGFGKGLLHPFIP-------MLPLNI----IERIILP-MSLALRLFGNMIAAVILLELVY--------------RGLSSISIFAQFGIPVILHAYFDLFDGLIQMIVFTMLTM 220
>gi|71385888|gb|AAZ31251.1| ATPase subunit 6 [Cyathus striatus] (244 aa)
Score = 113, Expect = 7.7e-04, Identities = 60/231 (25%), Positives = 106/231 (45%)
  Q:    26 EYRSEITSIIVITIIMTLVLV---YYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENP-TALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGF-----LDWLVGSIQAFVFVVLTLCY 256
           E    +T++ + +I + LV++   YY  +  KL PNK     +  + +   +  ++V E +G     + P+I+++F +I + N+IS V +    TA   V   L L   +G  IL +      FF  F+        +G  + +        +   +   +S+ +RL+ANI+AG  +L +       +F            VI+  +  +PF  F     L+  V  IQAFVF +L   Y
  S:    21 EMHLSLTNLGLYSIFILLVVIGLHYYGNNESKLIPNK----WSISLESSFASLSSMVREQVGTHSEIYLPFIYSLFFFILIGNLISNVPYSFAVTASGVVALGLSLTIFIGVTILALSIHGVKFFAFFI-------PAGTPLGLVPLLVLIELVSYLARAVSLGVRLFANIVAGHTLLKILSTYLYKLF---------SGSVIIALITLIPFTIFLALIGLELAVSLIQAFVFTLLVCSY 240
>gi|187764087|ref|YP_001876536.1| ATPase subunit 6 [Dictyostelium fasciculatum] >gi|160688795|gb|ABX45210.1| ATPase subunit 6 [Dictyostelium fasciculatum] (244 aa)
Score = 113, Expect = 7.8e-04, Identities = 50/184 (27%), Positives = 88/184 (47%)
  Q:    75 FKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWS 258
           F  L+   +GK  I F P IF +F +I + N++ +V      T    +TF+L +   +G  I G +     F   F+          N  ++P       ++ ++ P IS+++RL+AN++AG ++L +     +V+F+     L P   V  FSL        L+  +  +QA+VF +L + Y S
  S:    69 FIDLLLVQIGKAGILFFPLIFAIFVFILILNLMGLVPLSFTITGQIMITFSLAIIILIGLTIFGFRIHGIKFVNLFI------PSGLNPGLVPLLVCIEIMSYLLRP-ISLAVRLFANMLAGHILLHIIGGAAIVLFQYFYVGLLPWVCVCAFSL--------LELGIAFLQAYVFSILVVIYIS 238
>gi|163789454|ref|ZP_02183893.1| F0F1 ATP synthase subunit A [Carnobacterium sp. AT7] >gi|159875308|gb|EDP69373.1| F0F1 ATP synthase subunit A [Carnobacterium sp. AT7] (247 aa)
Score = 113, Expect = 8.0e-04, Identities = 53/187 (28%), Positives = 89/187 (47%)
  Q:    85 KEFIKFTPYIFTVFCYIFLCNIISV---------VGFENPTALTTVTFALGLFTTLGTIILGIKYQ--KSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVP----FHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEEESQVKK 271
           K+  KF    FT+  ++F+ N++ +           +++PTA   +T  L     + T   G++ Q  K+ F   F+              +P+ F P  I +     ++++LRL+ NI AG ++LGL  +L                + I   +  +P    + GF    +GSIQAFVF  LT+ Y S   E EE ++  K
  S:    70 KQSEKFRLLGFTILTFVFVSNMMGLPLMLIIDDYQMWKSPTADPVITLTLAAMVIVMTHYFGVQEQGVKNYFMNSFVRP------------VPFLF-PIKIFEEFTNTLTLALRLYGNIYAGEILLGLIASLAQ-------------SKGIFTWIVGIPLEMAWQGF-SIFIGSIQAFVFTTLTMVYLSHKVEHEESTEHTK 244
>gi|148252429|ref|YP_001237014.1| F0F1 ATP synthase subunit A [Bradyrhizobium sp. BTAi1] >gi|146404602|gb|ABQ33108.1| ATP synthase subunit A, membrane-bound, F0 sector [Bradyrhizobium sp. BTAi1] (247 aa)
Score = 113, Expect = 8.2e-04, Identities = 56/180 (31%), Positives = 89/180 (49%)
  Q:    84 GKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPW-------------ISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEP 263
           G   + F P +F++F +IF+ NI+ ++ +    ++   VTF+L L   L  II G        FYK   KF+              F P GI  +I+P              IS S+RL+AN++AG + L +F +  + M      V + G   +L     V   G L+ +V  +QA+VF +LT  Y + +  P
  S:    76 GSHGMTFFPLVFSLFMFIFVSNIVGIIPYTFTVSSHIIVTFSLALLVFLTVIIYG--------FYKNGLKFF------------KLFVPSGIPAVILPLVVVIEIISFFSRPISHSVRLFANMLAGHVTLKVFASF-VTMLGALGFVGKVG--ALLPLGLTVALTG-LELMVAFLQAYVFTILTCIYLNDAIHP 245
>gi|169261430|gb|ACA52295.1| ATPase subunit 6 [Coniophora arida] (240 aa)
Score = 113, Expect = 8.4e-04, Identities = 54/196 (27%), Positives = 95/196 (48%)
  Q:    61 PKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTL--GTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGF-----LDWLVGSIQAFVFVVLTLCY 256
           P   +  + +L  +  ++V + +G+E   + P+I+ +F +I + N++  V + + T  T+V  ++GL  T+  G  ILG+   K  FF  F+        SG  + +        +   +    S+ +RL+AN++AG  +L +       MF            +I+F L  VPF  F     L+  V  IQA+VFV+L   Y
  S:    53 PSRWSIVLESLFASINSMVRDQIGREI--YLPFIYGLFFFILIANLVGNVPY-SFTITTSVIVSIGLSFTILIGVTILGLSIHKVHFFSFFI-------PSGTPLALVPLLVLIELISYLARAFSLGIRLFANVVAGHTLLKILSTFLFKMFSGG---------IIIFILTLVPFTLFLAITGLELAVSFIQAYVFVLLGWSY 236
>gi|108744814|gb|ABG02558.1| ATPase subunit 6 [Boletinellus merulioides] (238 aa)
Score = 113, Expect = 8.5e-04, Identities = 58/219 (26%), Positives = 106/219 (48%)
  Q:    38 TIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTL--GTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGF-----LDWLVGSIQAFVFVVLTLCY 256
           +II++L++  + F     D    P   +  + +   +  T+V + +GKE   + P+I+++F +I + N++  + + + T  T+V  ++GL  T+  G  ILG+   K  FF  F+        SG  + +        +   +    S+ +RL+AN++AG  +L +       MF            +I+F L  +PF  F     L+  V  IQA+VFV+L   Y
  S:    32 SIILSLIVGLHIFGNN--DTKLLPSKWSILLESFFASINTMVRDQIGKEI--YLPFIYSLFFFILVANLVGNIPY-SFTITTSVIVSIGLSFTILIGVTILGLSIHKIHFFSFFI-------PSGTPLALVPLLVLIELISYLARAFSLGIRLFANVVAGHTLLKILSTFLFKMFSGG---------LIIFILTLLPFALFLAITGLELAVSFIQAYVFVLLVCSY 236
>gi|163738203|ref|ZP_02145619.1| F0F1 ATP synthase subunit A [Phaeobacter gallaeciensis BS107] >gi|163743797|ref|ZP_02151170.1| F0F1 ATP synthase subunit A [Phaeobacter gallaeciensis 2.10] >gi|161382946|gb|EDQ07342.1| F0F1 ATP synthase subunit A [Phaeobacter gallaeciensis 2.10] >gi|161388819|gb|EDQ13172.1| F0F1 ATP synthase subunit A [Phaeobacter gallaeciensis BS107] (267 aa)
Score = 113, Expect = 8.7e-04, Identities = 51/191 (26%), Positives = 84/191 (43%)
  Q:    73 GAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVV-GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLF---KFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLF--YALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEP 263
           G    +V ++ GK+ +KF PYI T+F +I   N++ ++ G    T+   VT  L +   +   + G     + F   F        ++       +I YF  P          +S  +RL  N+MAG  +L +F  +A  + +F   P             +FA+     L+ LV  IQA+VF +LT  Y   +  P
  S:    92 GFIYKMVEDVTGKDGLKFFPYIMTLFMFILTANMLGLIPGSFTTTSHFAVTAVLAMLVFVTVTVTGFVLHGTKFLGLFWVGSAPLALRPVLAIIELISYFVRP----------VSHCIRLAGNVMAGHAVLKVFAGFAGALGLFSFLP-------------IFAITAVYALEVLVAFIQAYVFTILTCVYLKDALHP 265
>gi|84796302|gb|ABC66225.1| ATP synthase subunit 6 [Thanatephorus cucumeris] (241 aa)
Score = 113, Expect = 9.2e-04, Identities = 57/221 (25%), Positives = 106/221 (47%)
  Q:    36 VITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTL--GTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           ++ + +TL L + + + +KL P+K     +  + +   +  T+V + +G     + P+I+++F +I + N+   V + N T  T++  +LGL  T+  G  IL +   K  FF  F+        SG  + +        +   +   +S+ +RL+ANIMAG  ++ +       MF    ++L     V+ F+LF       L+  V  IQA+VF +L   Y
  S:    34 IVLLFLTLGLHFVSSNNRKLVPSK----WSIALESSFASINTMVRDQIGTANEVYLPFIYSLFFFIIIANLTGNVPY-NYTITTSIVVSLGLSFTIFIGVTILALSIHKVRFFSFFI-------PSGTPLALVPLLVLIELISYLARAVSLGVRLFANIMAGHTLMKILSTFLFQMF--SSSILVAILTVVPFALFTAIIG--LEIGVSFIQAYVFSILVCSY 240
>gi|116073693|ref|ZP_01470955.1| ATP synthase subunit AF0F1 ATP synthase subunit A [Synechococcus sp. RS9916] >gi|116068998|gb|EAU74750.1| ATP synthase subunit AF0F1 ATP synthase subunit A [Synechococcus sp. RS9916] (241 aa)
Score = 112, Expect = 9.3e-04, Identities = 62/226 (27%), Positives = 110/226 (48%)
  Q:    31 ITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIK-FTPYIFTVFCYIFLCN---------IISVVGFE--NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILG-LFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           ++S I+I +++ LVLV      +KL  N+ P+G+   +  +    + L  + +G+++ + + P+I T+F +IF+ N         +I +   E   PTA    T A+ L  +L     G+  +   FF     + Y++      +M+P     F I +     +S+S RL+ NI+A  L +G L Y +P+++         P P V+L  LF             +IQA +F  L   Y
  S:    34 LSSWILIGVLLALVLV----GTRKL--NRDPQGVQNLLEFMWDYLRDLARDQIGEKYYREWLPFIGTLFLFIFVSNWGGALIPWKVIELPEGELGAPTADINTTVAMALLVSLAYFYAGLSKKGLRFF-----ELYVEP---TPIMLP-----FKIIEEFTKPLSLSFRLFGNILADELAVGVLVYLVPLIV---------PLP-VMLLGLFT-----------SAIQALIFATLAAFY 232
>gi|146343457|ref|YP_001208505.1| F0F1 ATP synthase subunit A [Bradyrhizobium sp. ORS278] >gi|146196263|emb|CAL80290.1| ATP synthase subunit A, membrane-bound, F0 sector [Bradyrhizobium sp. ORS278] (247 aa)
Score = 112, Expect = 9.3e-04, Identities = 55/180 (30%), Positives = 89/180 (49%)
  Q:    84 GKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISI-------------SLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEP 263
           G   + F P +F++F +IF+ NI+ ++ +    ++   VTF+L L   L  II G        FYK   KF+              F P GI  +I+P + I             S+RL+AN++AG + L +F +  + M      V + G   +L     V   G L+ +V  +QA+VF +LT  Y + +  P
  S:    76 GSHGMTFFPLVFSLFMFIFVSNIVGIIPYTFTVSSHIIVTFSLALLVFLTVIIYG--------FYKNGLKFF------------KLFVPSGIPAVILPLVVIIEIISFFSRPISHSVRLFANMLAGHVTLKVFASF-VTMLGALGFVGKVG--ALLPLGLTVALTG-LELMVAFLQAYVFTILTCIYLNDAIHP 245
>gi|108744830|gb|ABG02566.1| ATPase subunit 6 [Porphyrellus porphyrosporus] (247 aa)
Score = 112, Expect = 9.3e-04, Identities = 59/208 (28%), Positives = 102/208 (49%)
  Q:    49 NFSMK-KLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTL--GTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGF-----LDWLVGSIQAFVFVVLTLCY 256
           NF+ K KL PNK     +  + +L  +  T+V + +G+E   + P+I+++F +I   N++  + +   T  T++  ++GL  T+  G  ILG+   K  FF  F+        SG  + +        +   +    S+ +RL+AN++AG  +L +       MF            +I+F L  +PF  F     L+  V  IQA+VFV+L   Y
  S:    53 NFNTKMKLIPNKE----SILLESLFSSINTIVRDQIGREV--YLPFIYSLFLFILCSNLVGNIPY-TFTITTSIIVSIGLSFTILIGVTILGLSIHKIHFFSFFI-------PSGTPLALVPLLVLIELISYLARAFSLGIRLFANMVAGHTLLKILSTFLFKMFSGG---------LIIFVLTLLPFALFLAITGLELAVSFIQAYVFVLLVCSY 245
>gi|39933923|ref|NP_946199.1| F0F1 ATP synthase subunit A [Rhodopseudomonas palustris CGA009] >gi|167367922|ref|ZP_02302063.1| ATP synthase F0, A subunit [Rhodopseudomonas palustris TIE-1] >gi|192289342|ref|YP_001989947.1| ATP synthase F0, A subunit [Rhodopseudomonas palustris TIE-1] >gi|39647770|emb|CAE26290.1| Fo ATP synthase subunit A [Rhodopseudomonas palustris CGA009] >gi|192283091|gb|ACE99471.1| ATP synthase F0, A subunit [Rhodopseudomonas palustris TIE-1] (248 aa)
Score = 112, Expect = 9.7e-04, Identities = 51/186 (27%), Positives = 86/186 (46%)
  Q:    78 LVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEP 263
           ++    GKE +KF P +F++F +I + N+I +V +    ++   VT AL L      +I G       FF  F+        SG  + I        +    +  +S S+RL+AN++AG + L +F +  + M      V   G  + L    A+     L+ LV  +QA+VF +LT  Y + +  P
  S:    71 MIRSTAGKEGLKFFPLVFSLFMFIAVSNLIGIVPYTFTVSSHLIVTVALALLVFFTVLIYGFSKNGLKFFKLFV-------PSGVPIYILPLVVFIEVISFFLKPVSHSVRLFANMLAGHIALKVFASF-VAMLGALGVVGWFGAVLPLGLTIALT---ALELLVAFLQAYVFAILTCIYLNDAIHP 246
>gi|117414266|gb|ABK34541.1| ATP synthase subunit 6 [Tilletia hyalospora] (236 aa)
Score = 112, Expect = 9.7e-04, Identities = 47/179 (26%), Positives = 82/179 (45%)
  Q:    78 LVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVV--GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGF-----LDWLVGSIQAFVFVVLTLCY 256
           LV   +G     + P+I+++F +I   N+   +  GF  PT+   V+  L +   +G  ILG++  K  FF  F+        SG  + +     P  +   +    S+ +RL+AN+  G +++ +       +F            +I+  +  +PF  F     L+  V  IQA+VF VLT  Y
  S:    67 LVKSQIGNSNEIYLPFIYSLFFFILFANLSGNIPYGFTVPTSAAIVSLGLSVTIFIGVTILGLRLHKVHFFSFFV-------PSGTPLRLIPLLVPIELISYVARAFSLGIRLFANVTRGHILMKILSGFLASLF---------ANSIIVAIVTIIPFTVFLGITGLEIAVSFIQAYVFCVLTSSY 236
>gi|169188274|ref|ZP_02848420.1| ATP synthase F0, A subunit [Paenibacillus sp. JDR-2] >gi|169004923|gb|EDS51778.1| ATP synthase F0, A subunit [Paenibacillus sp. JDR-2] (254 aa)
Score = 112, Expect = 1.0e-03, Identities = 66/243 (27%), Positives = 115/243 (47%)
  Q:    26 EYRSEITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGK--EFIKFTPYI---FTVFCYIFLCNII--------------SVVG---------------FENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEEESQ 268
           E+   + ++I+IT I+  VL     S++ +    P K     + N L      V  I+G   +  K  PY+    T+  YIF+ +++              S+ G               +++PTA   VT AL L   L T I G++        K   K Y++          + F P  +   +   +S++LRL+ NI AG +++ +   + +             P ++++  F+V         VG+IQAFVF +LT+ Y S +   EE  +
  S:    14 EFDLAVIAMILITSIIVFVLA--RLSVRNISVTNPTK-----LQNFLEWVIEFVQNIIGTSMDLKKGRPYLILGLTLIMYIFVGDMLGLPLGIVTEVHHGASIFGMNLDLGGEEEAHIAWWKSPTADVAVTGALTLIVVLLTHIEGLRLNT-----KHYLKHYVEPH--------WLFLPLSLIKEVSKPLSLALRLYGNIFAGEVMIAVILGMGVWGI----------PALVVWQGFSV--------FVGAIQAFVFCMLTMVYMSQAIVHEEHGE 252
>gi|77464619|ref|YP_354123.1| F0F1 ATP synthase subunit A [Rhodobacter sphaeroides 2.4.1] >gi|77389037|gb|ABA80222.1| FoF1 ATP synthase, subunit A [Rhodobacter sphaeroides 2.4.1] (247 aa)
Score = 112, Expect = 1.0e-03, Identities = 47/186 (25%), Positives = 79/186 (42%)
  Q:    71 LLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFK---FYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           L G    +V E+ G E +K+ PY+ T+F ++   N++ ++      T+   VT  L L   +G   LG       F   F        I+       +I YF  P          +S S+RL  N+MAG  ++ +      ++      V        + +++A      L+ LV  +QA+VF +LT  Y
  S:    70 LYGFIHNMVEEVTGHEGVKYFPYVMTLFLFVLCGNVLGLLPLSFTTTSHMAVTVPLALMVFVGVTALGFMKNGPGFLKMFWVTSAPLAIRPVLAVIEVISYFVRP----------VSHSIRLAGNMMAGHAVIKVIAGFASIVVVSPVVV------GAVTAIYA------LELLVAVVQAYVFTILTCVY 237
>gi|169261424|gb|ACA52292.1| ATPase subunit 6 [Diplomitoporus lindbladii] (240 aa)
Score = 112, Expect = 1.1e-03, Identities = 53/196 (27%), Positives = 92/196 (46%)
  Q:    61 PKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTL--GTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFL-----DWLVGSIQAFVFVVLTLCY 256
           P  I+  + +L     T+V E +GKE   + P+I+++F +I + N +  V + + T  T+   +LGL  T+     ILG+   K  FF  F+        SG  + +        +   +    S+ LRL+AN++AG  ++ +       +F            +I+  L  +PF  FL     +  +  IQA+VF +LT  Y
  S:    53 PSKISIALESLFTTINTMVREQLGKEI--YLPFIYSLFMFILIANYLGAVPY-SFTITTSAIVSLGLSVTIWIAVTILGLSIHKLHFFSFFV-------PSGTPLPLLPLLVLIELVSYVARAASLGLRLFANLVAGHTLMKILATFLYKLF---------SASLIVAVLTLIPFVLFLAIMTLELAINFIQAYVFTILTWSY 236
>gi|169201546|ref|ZP_02860689.1| ATP synthase F0, A subunit [Rhizobium leguminosarum bv. trifolii WSM2304] >gi|169084111|gb|EDS64838.1| ATP synthase F0, A subunit [Rhizobium leguminosarum bv. trifolii WSM2304] (250 aa)
Score = 112, Expect = 1.1e-03, Identities = 50/186 (26%), Positives = 88/186 (47%)
  Q:    78 LVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVG-FENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFY-IKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLF--YALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEP 263
           ++ E  GK+ +KF P +F++F ++   N++ +   F   T+   VTFAL +      ++ G        FYK  F F  +   SG   ++        I   +   IS+S+RL+AN++AG + L +F  +   +             P ++  +L        L++LV  +QA+VF VLT  Y + +  P
  S:    72 MLKEGAGKQGMKFFPLVFSLFMFVLTANLLGMFPYFFTITSQIIVTFALAILVIGTVLVYG--------FYKHGFHFLNVFVPSGVPGILLPLVVSIEIISFLSRPISLSVRLFANMLAGHITLKVFAGFVASLGALGAVGVGGAVLPLIMTVALTG------LEFLVAFLQAYVFAVLTCMYLNDAIHP 247
>gi|84684302|ref|ZP_01012204.1| ATP synthase subunit A [Rhodobacterales bacterium HTCC2654] >gi|84668055|gb|EAQ14523.1| ATP synthase subunit A [Rhodobacterales bacterium HTCC2654] (253 aa)
Score = 112, Expect = 1.1e-03, Identities = 52/193 (26%), Positives = 83/193 (43%)
  Q:    71 LLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFK---FYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEP 263
           L G    +V ++ GK+ +KF PYI T+F +I   N + ++      T+   VT  L L   L   I+G     + F   F        ++       +I YF  P          +S S+RL  NIMAG  ++ +F     V        + P   V + +++       L+ LV  +QA+VF +LT  Y   +  P
  S:    77 LYGFTYKMVEDVAGKDAVKFFPYIMTLFMFILFANYLGLLPMSFATTSHIAVTAVLALAVFLTVTIVGFVKNGAKFLGLFWVSSAPLALRPILAIIELISYFVRP----------VSHSIRLGGNIMAGHAVMKVFAGFAAVA------AISPFAVVSITAIYG------LEVLVAGVQAYVFTILTCVYLHDALHP 251
>gi|134300987|ref|YP_001114483.1| ATP synthase F0, A subunit [Desulfotomaculum reducens MI-1] >gi|134053687|gb|ABO51658.1| ATP synthase F0, A subunit [Desulfotomaculum reducens MI-1] (262 aa)
Score = 112, Expect = 1.1e-03, Identities = 66/226 (29%), Positives = 102/226 (45%)
  Q:    33 SIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFF--IFNLLGAFKTLVYEIMGKEF-IKFTPYIFTVFCYIFLCNIISVV-GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFG-------ITDIIMPWISISLRLWANIMAG----ALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWS 258
           ++I+  I M LVL++     K  +   P K  A F  ++  LG     V+  +G +      P I T F YI   N++ ++    +PTA    TF L L   L                  L  ++    +G    I ++F PF        I +I  P ++++ RL+ NI AG    A++LGL      V     P+V+      + FS+F           VG +QAFVF +LT+ Y S
  S:    50 TMIMTWITMALVLLFAWACTKNQNVRSPGKAQATFEVLWEFLGG---QVFSNLGNKLGAAMMPIIVTFFIYIVFANLLGLIPTLSSPTADKNTTFGLALIVVL------------------LIHYHGLKANGVGGHIGHYFQPFKPFVVIHLIEEIARP-VTLAFRLYGNIFAGEVLIAVLLGLININAYVFGGFIPSVIW-----LAFSVF-----------VGFVQAFVFSMLTIAYVS 252
>gi|109648038|ref|ZP_01371941.1| ATP synthase F0, A subunit [Desulfitobacterium hafniense DCB-2] >gi|109641128|gb|EAT50683.1| ATP synthase F0, A subunit [Desulfitobacterium hafniense DCB-2] (245 aa)
Score = 112, Expect = 1.1e-03, Identities = 56/224 (25%), Positives = 106/224 (47%)
  Q:    33 SIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIK-FTPYIFTVFCYIFLCNIISVV-----------------------GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           ++I+  I+M +++V+    ++ L   KP K +   +  ++   + L+ + M  E  K    Y+ T+  ++F  N+  +V                          +PTA    T AL L T      +GIK++ S +F+ FL    +             F+   + D++   ++++ RL+ NI AG +++ +   LP +        + P    + FS+F           +G+IQ+FVF VLT  Y
  S:    18 TLIMTWIVMAIIIVFVLSGVRHLTSGKPGK-MQNVLEWMVDFVRKLISDNMDYEKGKPLLGYLVTLILFVFTSNVFGLVPNFTFGLLHNVEFAKLNEIFHGAALMSPTADINTTMALALMTMGLVFYMGIKHKGSHYFHHFLEPHPV-------------FSLIHVIDLLSKPMTLAFRLFGNIYAGEVLISVILMLPGIWVLGG---ILPDTIWLAFSVF-----------IGAIQSFVFTVLTTAY 237
>gi|192809062|ref|ZP_03037737.1| ATP synthase F0, A subunit [Geobacillus sp. Y412MC10] >gi|192801733|gb|EDV78238.1| ATP synthase F0, A subunit [Geobacillus sp. Y412MC10] (266 aa)
Score = 112, Expect = 1.1e-03, Identities = 55/204 (26%), Positives = 91/204 (44%)
  Q:    62 KGIAFFIFNLLGAFKTLVYEIMGKEFIKFT--PYIFTVFCYIFLCNI-------ISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGL-----FYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEE 265
           KG A+    L       V  ++G  F   T  P  FTVF    L  +         V+ +++PTA  +VT  L +   +    LG+K  +  +   ++  F I             F P  I + +   I++++RL+ANI AG +++ +     FY +P                      F   + GF    +G++QAF+F +LT+ Y S +T  EE
  S:    84 KGKAYISLGLTLILFIFVANLLGLPFSIITDLPENFTVFGQPILATLGLEHGHYAHVLWWKSPTADISVTAGLAIVVFVLMNYLGLKLNRKHYLKHYIEPFPI-------------FLPLNIIENLAKPIALAIRLYANIFAGEVLITVILKTGFYGIP----------------------FMAAWQGF-SIFIGALQAFIFTILTMVYISQTTIHEE 265
>gi|57168084|ref|ZP_00367223.1| ATP synthase F0, A subunit [Campylobacter coli RM2228] >gi|57020458|gb|EAL57127.1| ATP synthase F0, A subunit [Campylobacter coli RM2228] (226 aa)
Score = 112, Expect = 1.1e-03, Identities = 47/177 (26%), Positives = 76/177 (42%)
  Q:    89 KFTPYIFTVFCYIFLCNIISVV-GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEE 265
           K+ P + T+   +F  NII ++ GF  PTA   +T +L        II+ + Y       +   K++       K + P  F P  +   +   +S+S RL+ NI    L L +  AL           + P P  +L +  A             +QAF+F++LT  Y +G+T  EE
  S:    75 KYLPLVATLGIIVFFSNIIGIIPGFHAPTASLNLTLSLA-------IIVFVYYHFEGIRTQGFIKYFAHFMGPIKFLAPLMF-PIEVVSHLSRVVSLSFRLFGNIKGDDLFLMVILALV--------PYIAPLPAYVLLTFMAF------------LQAFIFMILTYVYLAGATIVEE 224
>gi|56698068|ref|YP_168439.1| F0F1 ATP synthase subunit A [Silicibacter pomeroyi DSS-3] >gi|56679805|gb|AAV96471.1| ATP synthase F0, A subunit [Silicibacter pomeroyi DSS-3] (256 aa)
Score = 112, Expect = 1.2e-03, Identities = 53/191 (27%), Positives = 82/191 (42%)
  Q:    73 GAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTT-----VTFALGLFTTLGTIILGIKYQKSSFFYKFLFK---FYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEP 263
           G    +V +I GK+ +K+ PY+ T+F +I   N + ++    P + TT     VT  L L   L   ILG     + F   F        ++       +I YF  P          +S S+RL  N+MAG  ++ +F     +      +VL            A+     L+ LV  IQA+VF +LT  Y   +  P
  S:    82 GFIYKMVEDICGKDGVKYFPYVMTLFMFIVTANFLGLL----PKSFTTTSHFAVTMVLALAVFLTVTILGFVKNGAGFLSLFWVASAPLALRPILAIIELISYFVRP----------VSHSIRLAGNVMAGHAVIKVFAGFAAIAAISPVSVL------------AITAMYGLEVLVAFIQAYVFTILTCVYLKDALHP 254
>gi|57240622|ref|ZP_00368571.1| ATP synthase F0, A subunit [Campylobacter lari RM2100] >gi|57018963|gb|EAL55736.1| ATP synthase F0, A subunit [Campylobacter lari RM2100] (226 aa)
Score = 112, Expect = 1.2e-03, Identities = 50/178 (28%), Positives = 78/178 (43%)
  Q:    89 KFTPYIFTVFCYIFLCNIISVV-GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYAL-PMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEEE 266
           K+ P + T+   +F  NII ++ GFE P+A    +  L +   +     GIK Q         FK++       K++ P  F P  +       IS+S RL+ NI    L L +  AL P V          P P  IL +  A             +Q+F+F++LT  Y +G+T  +E+
  S:    75 KYLPLVATIGFIVFFSNIIGIIPGFEAPSASLNFSATLAIIVFVYYHFEGIKTQG-------FFKYFAHFMGPVKILAPLMF-PIEVVSHFSRVISLSFRLFGNIKGDDLFLAVILALVPWV---------APLPAYILLTFMAF------------LQSFIFMILTYVYLAGATVVDEQ 225
>gi|124286759|ref|YP_001023653.1| ATP synthase F0 subunit 6 [Savalia savaglia] >gi|110083978|gb|ABG49155.1| ATP synthase F0 subunit 6 [Savalia savaglia] (232 aa)
Score = 111, Expect = 1.2e-03, Identities = 49/182 (26%), Positives = 79/182 (43%)
  Q:    75 FKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFY-IKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           F  +V + +G E +K+ P+I ++F +I   N++ +  +   PT    VT  L     +G  + G+        +KF F F  I    G  + +            +   IS+ +RL AN+ AG L+  +       M       L  G  + LF L  + F   L+  V  IQA+VF +LT  Y
  S:    56 FHGVVKDNLGAEGLKYFPFILSLFTFIVFLNVLGLFPYVFAPTVHIVVTLGLSFSIVIGVTLGGL--------WKFKFNFLSILMPDGAPLGLAPLLVIIETVSYVSRAISLGVRLAANLSAGHLLFAILAGFGFNM-------LIAGTFLSLFPLLIMVFITLLEMAVAVIQAYVFCLLTTIY 224
>gi|38233640|ref|NP_939407.1| F0F1 ATP synthase subunit A [Corynebacterium diphtheriae NCTC 13129] >gi|38199900|emb|CAE49566.1| ATP synthase A chain [Corynebacterium diphtheriae] (261 aa)
Score = 111, Expect = 1.3e-03, Identities = 65/226 (28%), Positives = 110/226 (48%)
  Q:    31 ITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYE-IMGK-EFIKFTPYIFTVFCYIFLCNIISVVGFEN--PTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIP-------------YFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           I  ++ + ++M LVLV + F++    P   P G+      LL   +  + E I+GK E  +F P + T+F  +  CN+ SV+ F N  P A   +   L LF  +  I  G K        ++ F  Y+K+     V+IP              FF+ F     ++   +++LRL AN++AG +IL L ++     F +    L     +   +L A       + LV  +QA++F +L+  Y
  S:    31 IDRLMFVRLLMALVLVIF-FAVAMRSPKLVPSGLQNVAEYLLDFVRIHIAEDILGKKEGNRFLPILSTIFFVVLFCNLPSVIPFLNISPNARIGMPLVLALFGYIAFIYAGAK--------RYGFFKYVKS----SVVIPNLPPVLHLLVVPLEFFSTF-----VLRPATLTLRLMANMLAGHIILVLLFSATNFFFWQ----LNGWTALSAVTLVAGIAFTLFEMLVIFLQAYIFALLSAVY 251
>gi|86751669|ref|YP_488165.1| F0F1 ATP synthase subunit A [Rhodopseudomonas palustris HaA2] >gi|86574697|gb|ABD09254.1| ATP synthase F0, A subunit [Rhodopseudomonas palustris HaA2] (248 aa)
Score = 111, Expect = 1.3e-03, Identities = 49/186 (26%), Positives = 91/186 (48%)
  Q:    78 LVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTA---LTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEP 263
           ++    GKE +KF P +F++F +I + N++ ++ +    +   + TVT A+ +F T+  ++ G+      FF  F+        SG  + I        +    +  +S S+RL+AN++AG + L +F +  + M      V   G  + L    A+     L+ LV  +QA+VF +LT  Y + +  P
  S:    71 MIRSTAGKEGLKFFPLVFSLFMFIAVSNLVGIIPYTFTVSSHLIVTVTLAMLVFVTV--LVYGLAKNGLKFFKLFV-------PSGVPIYILPLVVFIEVISFFLKPVSHSVRLFANMLAGHIALKVFASF-IAMLGALGVVGWVGAVLPLGLTIALT---ALELLVAFLQAYVFAILTCIYLNDAIHP 246
>gi|11466555|ref|NP_044804.1| ATP synthase F0 subunit 6 [Reclinomonas americana] >gi|2258385|gb|AAD11919.1| ATP synthase F0 subunit 6 [Reclinomonas americana] (249 aa)
Score = 111, Expect = 1.3e-03, Identities = 45/179 (25%), Positives = 80/179 (44%)
  Q:    78 LVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPG--PEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           +VY  +G +  K+ P IFT F +I  CN++ +V +    T+   +T  L +   +G  I+        FF  FL         G  + +  F     I   +   +S+++RL+AN+M+G  +L +       M  +   +      P  I+F+L        L+  +  +QA+VF +L   Y
  S:    73 MVYGQIGSKGYKYLPLIFTTFTFILACNMLGMVPYSFTVTSHLVITLGLAMSIFIGVNIIAANQHGLHFFSFFL-------PQGISLALAPFLVLIEIISYLFRVVSLAVRLFANMMSGHALLKILAGFSWTMSSKGGLIAVASIIPLAIVFALTG------LELAIAFLQAYVFAILVCIY 241
>gi|152995982|ref|YP_001340817.1| F0F1 ATP synthase subunit A [Marinomonas sp. MWYL1] >gi|150836906|gb|ABR70882.1| ATP synthase F0, A subunit [Marinomonas sp. MWYL1] (243 aa)
Score = 111, Expect = 1.3e-03, Identities = 42/187 (22%), Positives = 87/187 (46%)
  Q:    89 KFTPYIFTVFCYIFLCNIISVV-GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEEESQVKKIKKK 275
           K+  ++ ++F +I L  + +++ GFE PT   + T AL L   +   + GI+ Q         F  Y+ + +   +++     PF I   +   +++++RL+ N+M+GA+I+ +   +   +F   P V+                   L  L G +QA++F +L   Y + +T   ++   KK  ++
  S:    77 KYIGFLGSLFLFIALSALGTIIPGFEPPTGSLSTTVALALCVLVAVPLFGIQEQG--------FGSYLSSYTKPTIIML----PFNIISEVSRTLALAVRLFGNMMSGAMIIAILLTITPFLF---PIVMT-----------------LLGLLTGIVQAYIFFILATVYIAAATRSSKKQTQKKTAQQ 232
>gi|126724947|ref|ZP_01740790.1| ATP synthase subunit A [Rhodobacterales bacterium HTCC2150] >gi|126706111|gb|EBA05201.1| ATP synthase subunit A [Rhodobacterales bacterium HTCC2150] (210 aa)
Score = 111, Expect = 1.3e-03, Identities = 50/191 (26%), Positives = 86/191 (45%)
  Q:    73 GAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEP 263
           G    +V ++ GK+ + + PYI T+F +I + N + ++      T+   VT  + +   L   +LGI      F + F F       S   ++ P       I+  + P +S S+RL  N+MAG  ++ +F     V+      V    P   + +++A      L+ LV  IQA+VF +LT  Y   +  P
  S:    35 GFIYKMVEDVAGKDAVGYFPYIMTLFMFIVMANFLGLIPMSFATTSHIAVTAIMAMAVFLFVTLLGI------FKHGFGFLHLFWIGSAPLILRPILALIEVISYFVRP-VSHSIRLAGNMMAGHAVIKVFAGFAGVL-----GVGAVAPIAAITAVYA------LETLVAFIQAYVFAILTCVYLKDALHP 208
>gi|153952326|ref|YP_001397704.1| F0F1 ATP synthase subunit A [Campylobacter jejuni subsp. doylei 269.97] >gi|152939772|gb|ABS44513.1| ATP synthase F0, A subunit [Campylobacter jejuni subsp. doylei 269.97] (226 aa)
Score = 111, Expect = 1.4e-03, Identities = 53/205 (25%), Positives = 88/205 (42%)
  Q:    61 PKGIAFFIFNLLGAFKTLVYEIMGKE--FIKFTPYIFTVFCYIFLCNIISVV-GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEE 265
           P+G+       L    ++  + MG E    K+ P + T+   +F  NII ++ GF  PTA   +T +L        II+ + Y       +   K++       K++ P  F P  I   +   +S+S RL+ NI    L L +  AL           + P P  +L +  A             +QAF+F++LT  Y +G+T  E+
  S:    45 PRGMQNLAEAFLEGVLSMGRDTMGSEKGVRKYLPLVATLGIIVFFSNIIGILPGFHAPTASLNLTLSLA-------IIVFVYYHFEGIRAQGFIKYFAHFMGPIKLLAPLMF-PIEIVSHLSRVVSLSFRLFGNIKGDDLFLMVILALV--------PYIAPLPAYVLLTFMAF------------LQAFIFMILTYVYLAGATVVEK 224
>gi|84508573|ref|YP_448621.1| ATP synthase F0 subunit a [Fucus vesiculosus] >gi|39653296|gb|AAR29315.1| ATPase subunit 6 [Fucus vesiculosus] (249 aa)
Score = 111, Expect = 1.5e-03, Identities = 47/179 (26%), Positives = 80/179 (44%)
  Q:    78 LVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPG--PEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           L+++ +G    K+ P+IF +F +I + N+  +V +    T+    T  L L   +G +I+            FL         G  + + +   P  I   I   +S+++RL+AN+MAG  +L +       M      +L     P V+L  LF       L+  V  IQA+VF +L+  Y
  S:    73 LIWDSIGPAGQKYFPFIFMIFSFILISNVSGLVPYSFTITSHLIQTMVLALSVFIGVVIICASTHGFHMLSLFL-------PGGTSLALAFLLVPIEIVSYIFKPLSLAVRLFANMMAGHTLLKVIAGFAWAMMGSGGLLLLAHIVPLVVLVILFG------LELAVALIQAYVFTILSCIY 241
>gi|193212723|ref|YP_001998676.1| alternate F1F0 ATPase, F0 subunit A [Chlorobaculum parvum NCIB 8327] >gi|193086200|gb|ACF11476.1| alternate F1F0 ATPase, F0 subunit A [Chlorobaculum parvum NCIB 8327] (226 aa)
Score = 111, Expect = 1.5e-03, Identities = 45/179 (25%), Positives = 83/179 (46%)
  Q:    89 KFTPYIFTVFCYIFLCNIISVV-GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSG-NKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEEES 267
           K+ P+I T+F +I   N+ +V+ G+E PT   + T AL L   +   + GI               Y+KT +    +M+P     F I   +   +++++RL+ N+M+G +IL +   +  ++F   P ++                   L  L G +QA++F +L   Y + +T   E+S
  S:    77 KYLPFIATLFLFIATANLCTVIPGYEPPTGSLSTTAALALSVFIAVPLFGIAESG--------LVGYLKTYAEPTPIMLP-----FNIVGELTRTMALAVRLFGNMMSGDMILVILLTISPLVF---PVLMN-----------------ILGLLTGMVQAYIFSILATVYIAAATRTREKS 224
>gi|108744824|gb|ABG02563.1| ATPase subunit 6 [Paxillus vernalis] (240 aa)
Score = 111, Expect = 1.5e-03, Identities = 59/221 (26%), Positives = 107/221 (48%)
  Q:    36 VITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTL--GTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGF-----LDWLVGSIQAFVFVVLTLCY 256
           +I + +T+ L  Y  +  KL P+K     +    +   +  ++V + +GKE   + P+I+++F +I + N++  + + + T  T+V  ++GL  T+  G  ILG+   K  FF  F+        SG  + +        +   +    S+ +RL+AN++AG  +L +       MF            +I+F L  +PF  F     L+  V  IQA+VFV+L   Y
  S:    32 IIILSLTVGLHIYGNNDNKLLPSK----WSILFESFFASINSIVRDQIGKEI--YLPFIYSLFFFILVANLVGNIPY-SFTISTSVIVSIGLSFTILIGVTILGLSIHKIHFFSFFI-------PSGTPLALVPLLVLIELISYLARAFSLGIRLFANMVAGHTLLKILSTFLFKMFSGG---------IIIFVLTLLPFALFLAITGLELAVSFIQAYVFVLLVCSY 236
>gi|145222900|ref|YP_001133578.1| F0F1 ATP synthase subunit A [Mycobacterium gilvum PYR-GCK] >gi|145215386|gb|ABP44790.1| ATP synthase F0, A subunit [Mycobacterium gilvum PYR-GCK] (259 aa)
Score = 110, Expect = 1.6e-03, Identities = 57/234 (24%), Positives = 104/234 (44%)
  Q:    35 IVITIIMTLVLVYYNFSMK-KLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFT-PYIFTVFCYIFLCNIISVVG-------------FENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEEESQ 268
           I+ T I  ++++   F +K K+     P G+  F   L    +  + + +G +   F  P    +F +I + N ++V+              ++ P +      AL LF         I Y  +  + + +    IK   G+      F  P  + + +   IS++LRL+ NI AG +++ L     + MF   P  ++  P  +  +          D  VG IQAF+F +LT+ Y+S S E + +  
  S:    39 ILATAITAVIVIGLAFYLKSKVTATGVPGGVQLFWEALTIQMRGQIEQAIGMKVAPFVLPLAVAIFVFILVSNWLAVLPLQYGGSDGAAGELYKPPASDINFVLALALFVF-------ICYHAAGIWRRGIVGHPIKVVKGHVA----FLAPINVVEELAKPISLALRLFGNIFAGGILVAL-----IAMF---PWYIQWLPNAVWKTF---------DLFVGLIQAFIFSLLTILYFSQSMELDHDEH 259
>gi|160688746|gb|ABX45162.1| ATPase subunit 6 [Polysphondylium pallidum] (243 aa)
Score = 110, Expect = 1.7e-03, Identities = 47/184 (25%), Positives = 83/184 (45%)
  Q:    75 FKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWS 258
           F  L+ E  GK  I F P IF +F +I + N++ +V      T    +TF+L +   +G  I G +     F   F+        SG +  +        +    +  +S+++RL+AN++AG ++L +     + +F+     L P   V  FSL  +         +  +QA+VF +L + Y S
  S:    68 FIDLIIEQTGKPGILFFPLIFVIFLFILILNVLGLVPLSFTVTGQVMITFSLAIILMIGITIFGFRVHGIKFVNLFI-------PSGIEAWLLPLLVFIELMSYCLRPLSLAVRLFANMLAGHILLHIVGGAAIYLFQYCYIGLLPWAFVCAFSLLEIG--------IAFLQAYVFSILVVIYIS 237
>gi|114564216|ref|YP_751730.1| F0F1 ATP synthase subunit A [Shewanella frigidimarina NCIMB 400] >gi|114335509|gb|ABI72891.1| ATP synthase F0, A subunit [Shewanella frigidimarina NCIMB 400] (246 aa)
Score = 110, Expect = 1.8e-03, Identities = 44/178 (24%), Positives = 85/178 (47%)
  Q:    89 KFTPYIFTVFCYIFLCNIISVV-GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGST---EPEEE 266
           K+  ++ ++F +I    I +V+ GFE PT   + T AL L   +   + GI+ Q          + Y+ + +   V++     PF +   +   +++++RL+ N+M+G +ILG+  ++   +F   P V+                   L  L G +QA++F +L   Y + +T   +PE E
  S:    77 KYLGFLGSLFLFIATSAICTVIPGFEPPTGSLSSTVALALCVFVAVPMFGIEKQG--------LRGYLASYTKPTVIML----PFNLISEVSRTLALAVRLFGNMMSGVMILGILLSITPFLF---PIVMT-----------------LLGLLTGMVQAYIFFILATVYIAAATRIQQPERE 226
>gi|15603902|ref|NP_220417.1| F0F1 ATP synthase subunit A [Rickettsia prowazekii str. Madrid E] >gi|6225071|sp|Q9ZEC1|ATP6_RICPR ATP synthase a chain (ATPase protein 6) >gi|3860593|emb|CAA14494.1| ATP SYNTHASE A CHAIN (atpB) [Rickettsia prowazekii] (242 aa)
Score = 110, Expect = 1.8e-03, Identities = 53/222 (23%), Positives = 103/222 (46%)
  Q:    35 IVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLF--YALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           +++   ++L  +Y  F  +KL P++     A  ++NL+         I G++FI   P +F++F +I  CN++ +  +    T+   VTF L L   L   I+G      SF   FL         G  V +        +   +   +S+SLRL AN+MAG ++L +   + + ++++ +      P P +++   F +         +  +QA++F +L+  Y
  S:    33 MLLATTLSLTYLYLAFYNRKLIPSRLQVS-AEIVYNLVADMLNQNIGIKGRKFI---PLVFSLFIFILFCNLLGMTPYSFTATSHIIVTFTLALLIFLTVTIVGFIKHGVSFLTLFL-------PHGTPVWLAPLMIVIELFTYLARPVSLSLRLAANMMAGHVLLKVIASFTVSLMIYLK----FLPIPLMVILIGFEI--------FIAILQAYIFTILSCMY 234
>gi|71385895|gb|AAZ31252.1| ATPase subunit 6 [Clavulina sp. MB03-034] (240 aa)
Score = 110, Expect = 1.8e-03, Identities = 50/179 (27%), Positives = 86/179 (48%)
  Q:    78 LVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTT--LGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGF-----LDWLVGSIQAFVFVVLTLCY 256
           +V   +G    K+ P+I+++F +I + N++  V ++     T+V  +LGL  T  +G  ILG+   K  FF  F+        +G  + +            +    S+ +RL+AN++AG  +L +   L   +F            +I+F +  VPF  F     L+  V  IQA+VF +LT  Y
  S:    68 IVRSQIGSSNEKYLPFIYSLFFFILISNLLGNVPYQYAVG-TSVIVSLGLSITIFMGVTILGLAKHKLHFFSFFV-------PAGTPIFLVPMLVLIEFISYVARAFSLGVRLFANLVAGHSLLKILSGLLAKLFTSG---------IIVFIVTLVPFAIFVLLCGLEIAVSVIQAYVFCLLTCSY 236
>gi|58578635|ref|YP_203355.1| ATP synthase F0 subunit 6 [Mortierella verticillata] >gi|57545568|gb|AAW51692.1| ATP synthase F0 subunit 6 [Mortierella verticillata] (256 aa)
Score = 110, Expect = 1.8e-03, Identities = 51/222 (22%), Positives = 100/222 (45%)
  Q:    35 IVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSL----FAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           ++I   + L + Y + +  K+ P++     A    +L G+   ++   +G +   + P+++T+F Y+ L N+I +V +   P++         +   +G  ILG +     FF  F+        +G  + +            +   +S+ LRL AN++ G ++L +F              +  GP + L S+    F + F G L+  +  IQA+VF +LT  Y
  S:    41 LIIVTFLILAMSYLSLNNNKVVPSR----WALVQESLFGSILNMINSTIGTKGQAYLPFLYTIFLYVLLSNLIGLVPYSFTPSSHFVFGIGFSVAILIGVTILGFQTHALKFFGLFV-------PAGTPLGLVPVLVMIETISYLARALSLGLRLTANMIGGHVLLKIFSTFTW-------KAVIGGPVLALISIIPFTFIIAFTG-LELAIAFIQAYVFTMLTASY 248
>gi|170017981|ref|YP_001728900.1| ATP synthase F0, A subunit [Leuconostoc citreum KM20] >gi|169804838|gb|ACA83456.1| ATP synthase F0, A subunit [Leuconostoc citreum KM20] (241 aa)
Score = 110, Expect = 2.0e-03, Identities = 50/169 (29%), Positives = 88/169 (52%)
  Q:    85 KEFIKFTPYIFTVFCYIFLCNIIS----------VVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPY-FFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVP----FHGFLDWLVGSIQAFVFVVLT 253
           K+  +F  Y FT+F +I + N +           V   ++PTA   VT  L + + +    +G++        +  FK Y+K    N ++ PY +  P  I + +  ++++SLRL+ NI AG ++L L             ++  PG     +++ A+P    + GF    +G IQA+VFV+LT
  S:    70 KQARQFGLYAFTLFFFIVVSNEMGLLLQLQGTDGVTYIKSPTANPIVTMTLAIMSLMVAHGMGVQ--------QLGFKGYLK----NMLLTPYSWMLPLNIIEQLANFLTLSLRLFGNIFAGEMLLTLVAN----------SLAWPGHLNGFWTVLALPIEMVWQGF-SLFIGGIQAYVFVILT 230
>gi|10802915|gb|AAG23663.1|AF288091_8 ATP synthase F0 subunit 6 [Thraustochytrium aureum] (251 aa)
Score = 109, Expect = 2.1e-03, Identities = 51/188 (27%), Positives = 91/188 (48%)
  Q:    65 AFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLF--YALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVL 252
           +FF+F      + +V E +G +  K+  +IF +F ++ +CN I +V +    T+   VTF+L +   +G + +G K+     F   L        SG    I  FF         +P +++ +RL+ANI+AG ++L +   +   +++      +    P  +LF L       FL+  V  IQA+VF +L
  S:    66 SFFLF-----IENIVQENIGVKGQKYFSFIFCLFIFLLICNTIGLVPYSFTVTSHFIVTFSLSILVWVGKLFIGFKHHGLKLFGVLL-------PSGIPFAIVPFFIIVEFLSFFIPLVALGVRLFANIIAGHILLKVIVGFCWSIIIIGGLFFLAHFIPMGVLFLLL------FLETAVAFIQAYVFTML 238
>gi|121605231|ref|YP_982560.1| F0F1 ATP synthase subunit A [Polaromonas naphthalenivorans CJ2] >gi|120594200|gb|ABM37639.1| ATP synthase F0, A subunit [Polaromonas naphthalenivorans CJ2] (236 aa)
Score = 109, Expect = 2.1e-03, Identities = 44/177 (24%), Positives = 78/177 (44%)
  Q:    85 KEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGST 261
           K++I F   +F       LC +I   G+E PT   + T AL L   +   + GI+ Q            Y+KT     V++     PF +       +++++RL+ N+M+GA+I+G+  ++   +F   P V+                   L  L G +QA++F +L   Y + +T
  S:    76 KQYIGFLGTLFLFVAMASLCTVIP--GYEPPTGSLSTTAALALCVMVSVPLFGIQDQG--------LAGYLKTYLEPTVIML----PFNLISEASRTLALAVRLFGNMMSGAMIIGILLSITPFIF---PVVMT-----------------VLGLLTGMVQAYIFSILAAVYIAAAT 218
>gi|124484823|ref|YP_001031205.1| ATP synthase F0 subunit 6 [Amphimedon queenslandica] >gi|113952595|gb|ABI48994.1| ATP synthase F0 subunit 6 [Amphimedon queenslandica] (234 aa)
Score = 109, Expect = 2.2e-03, Identities = 49/181 (27%), Positives = 83/181 (45%)
  Q:    76 KTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFY-IKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           + +VY+ +GK   K+ P+I ++F +I + N + V  +   PT    +TF + L   +G  +LG        F+ F   F  I   +G  +++  F         +   IS+ +RL AN++AG L+  +       M      +L   P +I+       F   L+  V  IQA+VF +LT  Y
  S:    58 RGMVYDNLGKPGQKYFPFILSLFMFIVVLNGLGVFPYVFTPTVHIIITFGMSLSIIIGVTLLG--------FWGFGGNFLSILMPAGAPMVLAPFLIVVEAISYVSRAISLGVRLAANLIAGHLLFSIISGFAFSMLVGGLALLGLFPMLIMV------FITLLEMAVAGIQAYVFCLLTTIY 226
>gi|114432|sp|P20600|ATP6_BACME ATP synthase a chain (ATPase protein 6) >gi|142555|gb|AAA82520.1| ATP synthase a subunit (236 aa)
Score = 109, Expect = 2.2e-03, Identities = 60/228 (26%), Positives = 100/228 (43%)
  Q:    31 ITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMG-KEFIKFTPYIFTVFCYIFLCNIISV---------VGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWS 258
           + ++  + + +  VL     +MK       P G   FI  +L   K LV   M  K   +F     T+  YIF+ N++ +         + +++PTA   +T  L +   + +   GIK +  S + K  FK               F  P  I +     +++ LRL+ NI AG ++L L   L    F        P   ++L+  F++         VG+IQAF+F +LT+ Y S
  S:    22 MVTVASVIVFLIAVLCTRTLAMK-------PSGAQNFIEWVLDFVKGLVNSNMDWKTGGRFLTLGVTLLMYIFVSNMLGLPFAIVIDHNLWWKSPTADPAITLTLAVMVVVLSHYYGIKMRGFSAYTKDYFKPMA------------FLFPLKIIEEFANTLTLGLRLYGNIYAGEILLSLLAGLATTGFLGTIGAAIP---MLLWQGFSI--------FVGAIQAFIFTMLTMVYLS 229
>gi|60117115|ref|YP_209578.1| ATP synthase F0 subunit a [Polysphondylium pallidum] >gi|51339679|gb|AAU00593.1| ATP synthase F0 subunit a [Polysphondylium pallidum] (243 aa)
Score = 109, Expect = 2.3e-03, Identities = 47/184 (25%), Positives = 83/184 (45%)
  Q:    75 FKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWS 258
           F  L+ E  GK  I F P IFT+F ++ + N++ +V      T    +TF+L +   +G  I G +     F   F+        SG +  +             +  +S+++RL+AN++AG ++L +     + +F+     L P   V  FSL  +         +  +QA+VF +L + Y S
  S:    68 FIDLIIEQTGKPGILFFPLIFTIFLFVLILNVLGLVPLSFTVTGQIIITFSLAIILMIGITIFGFRVHGIKFINLFI-------PSGIEAWLLPLLIFIEFMSYCLRPLSLAVRLFANMLAGHILLHIVGGAAIFLFKYCYIGLLPWVFVCAFSLLEIG--------ISFLQAYVFSILVVIYIS 237
>gi|172036423|ref|YP_001802924.1| putative ATP synthase F0, subunit A [Cyanothece sp. ATCC 51142] >gi|171697877|gb|ACB50858.1| putative ATP synthase F0, subunit A [Cyanothece sp. ATCC 51142] (230 aa)
Score = 109, Expect = 2.4e-03, Identities = 46/168 (27%), Positives = 83/168 (49%)
  Q:    89 KFTPYIFTVFCYIFLCNIISVVG-FENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           +F P+I T+F +I + N++++   +++P    + T AL L   +   I GIK    + +     + YI+      VM+P     F +   I   +S+++RL+ NIM+ +L++ +  ++  + F   P V+       LF L           LVG IQA+VF +L + Y
  S:    77 QFLPFIGTLFLFITMANLLTIFPVYQSPAGSLSTTAALALCVFVAVPIYGIKNVGITNY----LRHYIQP---TPVMLP-----FNLISEISRTVSLAIRLFGNIMSTSLLVAILISIVPLFF---PAVM------TLFGL-----------LVGVIQAYVFTILAMVY 213
>gi|89889663|ref|ZP_01201174.1| ATP synthase, a chain [Flavobacteria bacterium BBFL7] >gi|89517936|gb|EAS20592.1| ATP synthase, a chain [Flavobacteria bacterium BBFL7] (384 aa)
Score = 109, Expect = 2.4e-03, Identities = 45/171 (26%), Positives = 79/171 (46%)
  Q:    86 EFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           ++ K+  Y+ TVF  I++ N++ +  F  N T    VT  L LFT    II+     K  + + F          G  V++     P  +  ++    S+ +RL+ANI AG +++    AL + +  +   V   G      S+F   F   ++ LV  +QAF+F +L+  +
  S:   199 KYRKYMGYLLTVFFLIWISNLLGLTPFGFNITGQIAVTVCLALFTF---IIVQFSGNKDYWMHIFWM-------PGVPVLMKIALIPIELIGLLTKPFSLLVRLFANITAGHVVVMGLIALMITLKAQFGIVGSTG-----LSIFLTLFLSVIELLVAFLQAFIFTMLSALF 355
>gi|58584717|ref|YP_198290.1| F0F1 ATP synthase subunit A [Wolbachia endosymbiont strain TRS of Brugia malayi] >gi|58419033|gb|AAW71048.1| F0F1-type ATP synthase, subunit a [Wolbachia endosymbiont strain TRS of Brugia malayi] (241 aa)
Score = 109, Expect = 2.4e-03, Identities = 51/179 (28%), Positives = 85/179 (47%)
  Q:    84 GKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPW----ISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTE 262
           G + +K  P +FTVF +   CN++ ++ +    T+   VTFAL +     T I+G K +  +F    L +            IP +  P  +   +  +    IS+S+RL AN++AG  I+ +     M M      +L P P      LF +   GF +  V  +QA++F +LT  Y S + +
  S:    79 GSKGLKHIPLVFTVFTFTLSCNLVGMLPYSFTVTSHVIVTFALSMIVFTYTTIVGFKEKGINFLRILLPE-----------GIPSWLAPMMVFIKLFAYLARPISLSIRLAANMIAGHTIIKVVAGFIMNMH----LILTPIP-----FLFIIALIGF-EVFVAILQAYIFTILTCIYLSDAVK 241
>gi|11465898|ref|NP_066447.1| ATP synthase F0 subunit 6 [Ochromonas danica] >gi|10505231|gb|AAG18413.1|AF287134_38 ATP synthase F0 subunit 6 [Ochromonas danica] (279 aa)
Score = 109, Expect = 2.4e-03, Identities = 49/167 (29%), Positives = 75/167 (44%)
  Q:    90 FTPYIFTVFCYIFLCNIISVVGFENPTALT--TVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGF-----LDWLVGSIQAFVFVVLTLCY 256
           F P IF VF +I   N+  ++ + NPT  +    T  +G      T+ LG+      +F  FL        +G ++ + +   P      I   +S+SLRL+ NI+AG  +L    A   + F         G    L+ +F +P   F     L+  V  IQAFVF +L   Y
  S:   111 FVPLIFCVFTFICSINLFGLIPY-NPTLTSHLIATLTIGTSVFFMTVWLGVAKHGIQYFKTFL-------PTGTRLGLAFLLVPIEFISFIFKPVSLSLRLFVNIVAGHTLLHTIAAFVFIEF-----FFVLGKPFFLYLVFYIPVFAFLCLFILETAVCLIQAFVFSILICIY 271
>gi|78357742|ref|YP_389191.1| ATP synthase F0, A subunit [Desulfovibrio desulfuricans subsp. desulfuricans str. G20] >gi|78220147|gb|ABB39496.1| ATP synthase F0, A subunit [Desulfovibrio desulfuricans G20] (233 aa)
Score = 109, Expect = 2.4e-03, Identities = 51/192 (26%), Positives = 84/192 (43%)
  Q:    71 LLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVV-GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTE 262
           ++G  +  V  I G++  K  P +   F +I   N+  +V GF+ PTA    T +L LF  +    +GI+   + +   F+   +  +     +M+P       I+    P +S+SLRL+ NI     +L LF+ L          ++   P   LF+L  V            +QAF+F +L   Y  GS E
  S:    67 IIGGLEEFVVSITGEDGRKVYPVLIVFFLFILCMNLTGLVPGFDAPTANINTTASLALFCFIYYNYIGIQRWGAGYIKHFMGPMWWLSP----LMLPLEL----ISHTARP-LSLSLRLFGNIRGEEFVLILFFMLA--------PIIGTIPIYFLFTLAKV------------LQAFIFFMLATIYLKGSLE 230
>gi|83594576|ref|YP_428328.1| F0F1 ATP synthase subunit A [Rhodospirillum rubrum ATCC 11170] >gi|114457|sp|P15012|ATP6_RHORU ATP synthase a chain (ATPase protein 6) >gi|152599|gb|AAA26455.1| ATP synthase F-0 sector, a subunit >gi|581525|emb|CAA31246.1| ATPase F-0-subunit a (AA 1 - 241) [Rhodospirillum rubrum] >gi|83577490|gb|ABC24041.1| H+-transporting two-sector ATPase, A subunit [Rhodospirillum rubrum ATCC 11170] (241 aa)
Score = 109, Expect = 2.4e-03, Identities = 41/179 (22%), Positives = 84/179 (46%)
  Q:    78 LVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           ++ + +GKE +K+ PYI T+F ++FL N++ ++ +    T+   VT AL +   +   I+G       +F  F          G  ++      P  +   +    S+S+RL+AN+  G ++L +     +++      V    P  ++  +        L++ + ++QA+VF +LT  Y
  S:    71 MIRDNVGKEGMKYFPYILTLFVFVFLGNMLGMLPYSFTFTSHIAVTAALAVGIFIAVTIIGFARHGFHYFRMFF-------PHGAPLLTAPLLIPIELISYLSRPFSLSVRLFANMTVGHIMLKVLAGFVIMLGVVGGVV----PFAVVLGVTV------LEFFIAALQAYVFTILTCIY 233
>gi|27376299|ref|NP_767828.1| F0F1 ATP synthase subunit A [Bradyrhizobium japonicum USDA 110] >gi|27349439|dbj|BAC46453.1| FoF1 ATP synthase A chain [Bradyrhizobium japonicum USDA 110] (249 aa)
Score = 109, Expect = 2.5e-03, Identities = 52/180 (28%), Positives = 87/180 (48%)
  Q:    84 GKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFL---FKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYA-LPMVMFRRDPTVLEPG--PEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEP 263
           G E +KF P IF++F +I + N+I ++ +    ++   VT AL L      +I G+      FF  F+      YI        ++ +F  P          +S S+RL+AN++AG + L +F   + M+ F         G  P  +  +L+A      L+ LV  +QA+VF +LT  Y + +  P
  S:    77 GSEGMKFFPLIFSLFMFICVSNLIGIIPYTFTISSHLIVTAALALLVFFTVLIYGVAKNGLKFFSIFVPHGVPGYILPLVMFIEILSFFLRP----------VSHSVRLFANMLAGHIALKVFAGFVAMLGFSLGALGWVGGVLPLALTVALYA------LEILVAFLQAYVFAILTCIYLNDAIHP 247
>gi|34496121|ref|NP_900336.1| F0F1 ATP synthase subunit A [Chromobacterium violaceum ATCC 12472] >gi|34101975|gb|AAQ58342.1| ATP synthase F0, A subunit [Chromobacterium violaceum ATCC 12472] (270 aa)
Score = 109, Expect = 2.5e-03, Identities = 59/202 (29%), Positives = 98/202 (48%)
  Q:    61 PKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNII-----------------SVVGFEN--------PTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFK--FYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTE 262
           P  +  F+  ++   +T V E+   +     P   T+FC++FL N +                 +  G E         P+A    TFA+ L   +  +   IK +    + K L    F+     G  ++ P  F  F + ++    IS+SLRL+ N+ AG LI  L   LP             G + +L + +A+ FH     L+ ++QAFVF++LT+ Y S + E
  S:    58 PGRLQLFVEMIVELVQTQVREVFHGKSKMIAPLALTIFCWVFLMNFMDLFPVDLFPMAAQWIGYTFFGLEPHHVYFRVVPSADVNATFAMSLSVLILIVGFSIKAKGLGGWGKELLTAPFHSSNPVGAIILAPLNF-AFQLVELAAKPISLSLRLFGNLYAGELIFILIALLPW------------GLQWVLGAPWAI-FH----ILIITLQAFVFMMLTIVYLSLAVE 268
>gi|149915442|ref|ZP_01903969.1| F0F1 ATP synthase subunit A [Roseobacter sp. AzwK-3b] >gi|149810731|gb|EDM70572.1| F0F1 ATP synthase subunit A [Roseobacter sp. AzwK-3b] (251 aa)
Score = 109, Expect = 2.6e-03, Identities = 56/235 (23%), Positives = 98/235 (41%)
  Q:    29 SEITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVV-GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFK---FYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEP 263
           + +T  + +TII  + L+    S +   P +  + I    +   G    +V ++ GK+ + F PYI T+F +I   N + ++ G    T+   VT  L L   +   ++G     ++F   F        ++       +I YF  P          +S S+RL  N+MAG  ++ +F     +              V   ++  V     L+ LV  IQA+VF +LT  Y   +  P
  S:    37 TNVTLWMALTIIAVIALMVLGTSGRSTIPGRM-QSIGELAY---GFVYKMVEDVAGKDAVGFFPYIMTLFMFIVFANFLGLIPGSFTTTSHFAVTVVLALLVFITVTVVGFVKNGAAFLGLFWVSSAPLPLRPILAIIEVISYFVRP----------VSHSIRLAGNLMAGHAVIKVFAGFAAI------------AAVSPLAILGVTAMYGLEILVSFIQAYVFTILTCVYLKDALHP 249
>gi|91783929|ref|YP_559135.1| F0F1 ATP synthase subunit A [Burkholderia xenovorans LB400] >gi|91687883|gb|ABE31083.1| H+-transporting two-sector ATPase, A subunit [Burkholderia xenovorans LB400] (231 aa)
Score = 108, Expect = 2.8e-03, Identities = 46/193 (23%), Positives = 83/193 (43%)
  Q:    79 VYEIMGKEFIKFTPYIFTVFCYIFLCNIISVV-GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEEESQVKK 271
           + + M  E   +   I T+F ++ + N  ++V G   PTA      AL L     TI  G++ + ++    +L  F       + VMIP       + + I    S+ +RL+ N+M+G  ++G+  +L  +                   L  +P    LD L G++QA++F VL++ +   +        VKK
  S:    66 IRDTMQTEAATYRALIGTLFVFVLVANWCALVPGVTPPTAHLETDAALALIVLGATIFYGVRSRGAT---GYLASF----AEPSWVMIP-----LNVVEQITRTFSLVVRLFGNVMSGVFVIGILLSLAGL-------------------LVPIPLMA-LDLLTGAVQAYIFAVLSMVFIGAAIGDPHHVSVKK 227
>gi|104773789|ref|YP_618769.1| F0F1 ATP synthase subunit A [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|116513795|ref|YP_812701.1| F0F1 ATP synthase subunit A [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|103422870|emb|CAI97532.1| H+ transporting ATPase / ATP synthase, A subunit [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|116093110|gb|ABJ58263.1| F0F1-type ATP synthase, subunit a [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (239 aa)
Score = 108, Expect = 2.8e-03, Identities = 65/227 (28%), Positives = 108/227 (47%)
  Q:    30 EITSIIVITIIMTLVL-VYYNFSMK-KLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISV-----VG----FENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEV-----ILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           ++  II  T++  +V  + Y  S K ++ PNK    + + I    G  K  V +   ++ +    Y F +F +IF  N + +     VG     ++PTA    T +  + T L +   GI+        KF  K Y++    N      F  P  I +    ++++SLRL+ NI AG ++L L                + GP +     IL +  A+ + GF    +GSIQA+VFV L++ Y
  S:    17 DLVGIIGSTLMAIVVFAICYALSRKVEMKPNKKQNVLEYLIDFTDGIVKDNVEDPAAQKHLSL--YAFVLFLFIFCMNQLGLFLEVKVGDYMVIKSPTADPVTTMSFAMMTLLLSFTFGIQ--------KFGTKGYLQ----NYARPVGFLLPINIIEEFTNFLTLSLRLYGNIFAGEVLLTLIGN-------------QLGPSMGIVTRILAAPLAMIWQGF-SVFIGSIQAYVFVTLSMVY 231
>gi|60499213|gb|AAX21836.1| ATP synthase F0 subunit 6 [Fusarium oxysporum] (266 aa)
Score = 108, Expect = 2.8e-03, Identities = 47/167 (28%), Positives = 77/167 (46%)
  Q:    90 FTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           + P+I+T+F +I + N+I +V +    T+   +TFAL     LG  ILG +     F       F +   +G  + +        +   +   +S+ LRL ANI AG ++L +       +      +   G   ++  LF + F G L+  +  IQA VFVVLT  Y
  S:   102 YFPFIYTLFIFILINNLIGMVPYSFASTSHFALTFALSFTIVLGATILGFQKHGLKF-------FSLLVPAGCPLALLLLLVTIELISYLARNVSLGLRLAANITAGHMLLSILSGFVYNIMNSGFILFILG---LIPLLFIIAFSG-LELAIAFIQAQVFVVLTSSY 258
>gi|88807376|ref|ZP_01122888.1| ATP synthase subunit A [Synechococcus sp. WH 7805] >gi|88788590|gb|EAR19745.1| ATP synthase subunit A [Synechococcus sp. WH 7805] (242 aa)
Score = 108, Expect = 2.9e-03, Identities = 54/198 (27%), Positives = 91/198 (45%)
  Q:    59 KPPKGIAFFIFNLLGAFKTLVYEIMG-KEFIKFTPYIFTVFCYIFLCN---------IISVVGFE--NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILG-LFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           + PKG+   +  L    + L  E +G K +  + P++ T+F +IF+CN         +I +   E   PTA    T A+ L  +L     G+  +   +     F++Y++      +M+P+      I D   P +S+S RL+ NI+A  L++  L + +P         VL P P +            FL     +IQA +F  L   Y
  S:    56 RDPKGVQNLLEYLWDYLRELAREQIGEKAYRDWLPFVGTLFLFIFVCNWGGALIPWRLIELPNGELGAPTADINTTVAMALLVSLSYFYAGLSRKGLRY-----FEYYVEP---TPIMLPFKI----IEDFTKP-LSLSFRLFGNILADELVVAVLAFLVP---------VLVPLPAM------------FLGLFTSAIQALIFATLAANY 232
>gi|11497473|ref|NP_042263.1| H(+)-transporting ATPase [Prototheca wickerhamii] >gi|467864|gb|AAD12651.1| H(+)-transporting ATPase [Prototheca wickerhamii] (249 aa)
Score = 108, Expect = 2.9e-03, Identities = 46/181 (25%), Positives = 85/181 (46%)
  Q:    76 KTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLF--YALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           ++L+ E +G +  K+ P +FT+F ++   N+I ++ +    T+   VTF L L   +   I+G +     FF   L K       G  +++        +       IS+ +RL+AN+MAG  ++ +   +A  M+      +V    P  ++F+L        L+  V  +QA+VF +L   Y
  S:    71 RSLIQEQIGAKGRKYFPLVFTLFVFLLFTNLIGMIPYSFTATSHLAVTFGLSLSLFIAITIIGFQVHGLHFFSFLLPK-------GAPLILAPLLVVLELVSYSFRAISLGVRLFANMMAGHTLVKILSGFAWTMLSVGGILSVASILPFAVVFALIG------LEIGVACLQAYVFTILVCIY 241
>gi|20091268|ref|NP_617343.1| F0F1 ATP synthase subunit A [Methanosarcina acetivorans C2A] >gi|19916390|gb|AAM05823.1| H(+)-transporting ATP synthase, subunit A [Methanosarcina acetivorans C2A] (229 aa)
Score = 108, Expect = 2.9e-03, Identities = 41/173 (23%), Positives = 82/173 (47%)
  Q:    89 KFTPYIFTVFCYIFLCNI-ISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGST 261
           K+  ++ T+F +I + N+ I + G+E PT   + T AL L   +   I GI+ Q            Y+++ +   +++     PF I   +   +++++RL+ NIM+G++I+ +   +   +F   P ++                   L  L+G +QA++F VL   Y + +T
  S:    77 KYLGFLGTLFLFIAVANLCIIIPGYEPPTGSLSTTAALALCVFVAVPIFGIEEQG--------LGSYLRSYTEPTILML----PFNIISELSRTLALAIRLFGNIMSGSMIIAILLTIAPFIF---PIIMTA-----------------LGLLIGMVQAYIFSVLATVYITAAT 218
>gi|163723702|ref|ZP_02131236.1| ATP synthase F0, A subunit [Desulfatibacillum alkenivorans AK-01] >gi|161403189|gb|EDQ27423.1| ATP synthase F0, A subunit [Desulfatibacillum alkenivorans AK-01] (231 aa)
Score = 108, Expect = 3.0e-03, Identities = 63/225 (28%), Positives = 103/225 (45%)
  Q:    34 IIVITIIMTLVLVYYNFSMKK--LDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVG-------FENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWS 258
           I++  I++ ++L++   ++KK  + PN        F+ NL       + E +GK   K+ P I  +F ++++ N++ V+        F  PT        LGL         GIK +      K   K YI+  +        F  P  +   +   +SIS RL+ NIM G++I+       +V+     ++L P       +LF     GF    VG+IQAFVF +LT  Y S
  S:    27 ILMTWIVIGILLLFGFLAVKKRGVIPNPMQVVGELFVKNLYDLADDALEEELGK---KYGPMICALFLFLWMSNMLGVLPPLGFIPEFSEPTKDLNTPLGLGLMGFFIAHAAGIKEKG----IKDYLKVYIEPFA--------FMLPLNLIGELAKVVSISFRLFGNIMGGSIII-------LVVSHLTYSILLPP------ALF-----GFFGIFVGTIQAFVFTMLTTVYIS 227
>gi|112361346|gb|ABI15717.1| putative ATP synthase F0 a subunit [Pseudomonas veronii] (233 aa)
Score = 108, Expect = 3.0e-03, Identities = 49/180 (27%), Positives = 85/180 (47%)
  Q:    89 KFTPYIFTVFCYIFLCNIISVV-GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKT-KSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY-------WSGSTEPEEESQ 268
           ++  ++ T+F ++    + +VV GFE PTA  + T AL L   +   I GI  Q         F  Y+K+      +M+P     F +       +++++RL+ N+M+GA+IL +  ++   +F   P V+                   L  L G +QA++F +L   Y        S ST+PE  S+
  S:    77 RYLSFLGTLFLFVAASALGTVVPGFEPPTASLSTTVALALCVLVAVPIFGIYSQG--------FASYMKSYMEPTPIMLP-----FNLISEASRTLALAVRLFGNMMSGAMILAILLSITPFVF---PIVMT-----------------VLGLLTGMVQAYIFTILAAVYIAAATRSGSASTQPEPASR 232
>gi|85713866|ref|ZP_01044855.1| ATP synthase subunit A [Nitrobacter sp. Nb-311A] >gi|85698992|gb|EAQ36860.1| ATP synthase subunit A [Nitrobacter sp. Nb-311A] (247 aa)
Score = 108, Expect = 3.1e-03, Identities = 49/180 (27%), Positives = 88/180 (48%)
  Q:    84 GKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFY-IKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEP 263
           GK+ +KF P++F++F  + + N++ ++ +    ++   VT AL        +I G        FYK   KF+ +   SG  V+I        +   +   +S S+RL+AN++AG + L +F +  + M      V   G  + L  + A+     L+ LV  +QA+VF +LT  Y + +  P
  S:    76 GKDGMKFFPFVFSIFMLVTVSNLVGIIPYTFTISSHIIVTAALAFLVFFTVLIYG--------FYKNGLKFFKLFVPSGIPVVILPLVVAIEVISFLSRPVSHSVRLFANMLAGHITLKVFASF-VTMLGAMGIVGVFGAALPLALVVALT---ALELLVAFLQAYVFTILTCIYINDAIHP 245
>gi|92115900|ref|YP_575629.1| F0F1 ATP synthase subunit A [Nitrobacter hamburgensis X14] >gi|91798794|gb|ABE61169.1| ATP synthase F0, A subunit [Nitrobacter hamburgensis X14] (247 aa)
Score = 108, Expect = 3.1e-03, Identities = 49/185 (26%), Positives = 90/185 (48%)
  Q:    79 VYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFY-IKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEP 263
           ++   GK+ +KF P++FT+F  + + N++ +V +    ++   VT AL        +I G        FYK   +F+ +   SG  ++I        +   +   +S S+RL+AN++AG + L +F +  + M      V   G  + L  + A+     L+ LV  +QA+VF +LT  Y + +  P
  S:    71 IHTTAGKDGMKFFPFVFTIFMLVTVSNLVGIVPYTFTISSHIIVTAALAFLVFFTVLIYG--------FYKNGLRFFKLFVPSGIPIVILPLVVAIEVISFLSRPVSHSVRLFANMLAGHITLKVFASF-VTMLGAMGIVGVFGAVLPLALVVALT---ALELLVAFLQAYVFTILTCIYINDAIHP 245
>gi|170694204|ref|ZP_02885359.1| ATP synthase F0, A subunit [Burkholderia graminis C4D1M] >gi|170140944|gb|EDT09117.1| ATP synthase F0, A subunit [Burkholderia graminis C4D1M] (232 aa)
Score = 108, Expect = 3.1e-03, Identities = 44/182 (24%), Positives = 81/182 (44%)
  Q:    92 PY---IFTVFCYIFLCNIISVV-GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEEESQVKKIK 273
           PY   I T+F ++ + N  ++V G   PTA      AL L     T+  G++ +  + + +            + VMIP       + + I    S+ +RL+ N+M+G  ++G+  +L  +                   L  +P    LD L G++QA++F VL++ +   +    + + VKK K
  S:    76 PYRALIGTLFVFVLIANWCALVPGVTPPTARLETDAALALVVLGATVFHGLRSRGVAGYLRSF-------AEPSWVMIP-----LNVVEQITRTFSLVVRLFGNVMSGVFVIGILLSLAGL-------------------LVPIPLMA-LDLLTGAVQAYIFAVLSMVFIGAAIGEPQHAPVKKAK 229
>gi|77917633|ref|YP_355448.1| ATP synthase F0, A subunit [Pelobacter carbinolicus DSM 2380] >gi|77543716|gb|ABA87278.1| ATP synthase F0, A subunit [Pelobacter carbinolicus DSM 2380] (234 aa)
Score = 108, Expect = 3.3e-03, Identities = 50/202 (24%), Positives = 89/202 (44%)
  Q:    61 PKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVV-GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYAL-PMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTE 262
           P G+   +  +L     L  E MG +  ++ P I T+  +I   N+I+++ GF  PTA      AL L     T ++G++     +F  F+         G    +     P  I   +   +S++LRL+ N+    ++L +F+ L P+++         P P ++            +  LV  IQ FVF +L + Y +G+ E
  S:    58 PGGLQNLVEIVLVELGRLADETMGPKGRRYFPLIATLALFILFSNLIALIPGFAPPTANLNTNAALALAVFGMTHVVGVREHGLKYFKHFV---------GPVWWLAPLILPIEIIGHLARPLSLALRLFGNMYGHEIVLVIFFTLVPLLL---------PIPMML------------MGILVAFIQTFVFTLLAMIYIAGALE 231
>gi|189183295|ref|YP_001937080.1| ATP synthase A chain [Orientia tsutsugamushi str. Ikeda] >gi|189180066|dbj|BAG39846.1| ATP synthase A chain [Orientia tsutsugamushi str. Ikeda] (242 aa)
Score = 108, Expect = 3.4e-03, Identities = 54/179 (30%), Positives = 86/179 (48%)
  Q:    78 LVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGIT----DIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           LV+ I+G +  KF P I T+F +I L NI+ +V      T+   VTF+L +     T++ GI   K  FF  FL K            IP +  P  +       I   IS+SLRL AN++AG ++L +  A  +V       + +P P  ++  L         +  +  +QA++F +L+  Y
  S:    72 LVHSIIGPQGKKFFPLILTLFLFISLGNILGMVPHAFTFTSHIIVTFSLAMIVFTTTLVYGIYRHKLGFFSLFLPK-----------NIPLWLAPIMVIIELCVFISKPISLSLRLTANMVAGHILLKII-AWSIVSL---TWLFKPLPIALVIVLIG------FELFISILQAYIFTILSCVY 234
>gi|116250699|ref|YP_766537.1| F0F1 ATP synthase subunit A [Rhizobium leguminosarum bv. viciae 3841] >gi|115255347|emb|CAK06422.1| putative ATP synthase A chain [Rhizobium leguminosarum bv. viciae 3841] (250 aa)
Score = 108, Expect = 3.4e-03, Identities = 52/186 (27%), Positives = 92/186 (49%)
  Q:    78 LVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVG-FENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFY-IKTKSGNKVMIPYFFNPFGITDIIMPW----ISISLRLWANIMAGALILGLF--YALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEP 263
           ++ E  GK+ ++F P +F++F ++   N++ +   F   T+   VT AL +      ++ G        FYK  FKF  +   SG    +P    P  +T  I+ +    IS+S+RL+AN++AG + L +F  +   +             P ++  +L        L++LV  +QA+VF VLT  Y + +  P
  S:    72 MLTEGAGKQGMQFFPLVFSLFMFVLTANLLGMFPYFFTVTSQIIVTAALAILVIGTVVVYG--------FYKHGFKFLNVFVPSG----VPGILLPLVVTIEIISFLSRPISLSVRLFANMLAGHITLKVFAGFVASLGALGAVGVGGAVLPLIMTVALTG------LEFLVAFLQAYVFAVLTCMYLNDAIHP 247
>gi|118726896|ref|ZP_01575511.1| ATP synthase F0, A subunit [Clostridium cellulolyticum H10] >gi|118663711|gb|EAV70357.1| ATP synthase F0, A subunit [Clostridium cellulolyticum H10] (235 aa)
Score = 108, Expect = 3.5e-03, Identities = 64/229 (27%), Positives = 103/229 (44%)
  Q:    34 IIVITIIMTLVLVYYNFSMKKLD--PNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVV--------GFE--NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFY-ALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTE 262
           ++ + IIM +++V      +KL   PNK  + +A  I   +     LV + +   +  F PY+ TV  ++ L N +S+         GF+   PT    VT  L + +    I  GI+Y     + K   K          VM+P     F I D ++   S++LRL+ NI+   +++ L Y A P+      P VL                  + D   G +QA+VF+ LT  Y S + E
  S:    30 VVTMWIIMAIMIVLAIVLTRKLSLIPNKR-QNVAEIIVEFI---NNLVKDAIPHHWKAFAPYLGTVMLFLILANTVSIFNIIPGGEEGFKLRPPTRNINVTVCLAVMSICVVIYAGIRYNGVGGWIKSFAK-------PTPVMLP-----FNILDYLIKPTSLALRLFGNILGAFIVMELIYMAFPIFA----PAVLS----------------CYFDLFDGILQAYVFMFLTSIYISEALE 235
>gi|157738233|ref|YP_001490917.1| F0F1 ATP synthase subunit A [Arcobacter butzleri RM4018] >gi|157700087|gb|ABV68247.1| ATP synthase F0 sector, A subunit [Arcobacter butzleri RM4018] (228 aa)
Score = 108, Expect = 3.5e-03, Identities = 57/208 (27%), Positives = 89/208 (42%)
  Q:    61 PKGIAFFIFNLLGAFKTLVYEIMGKEFIK-FTPYIFTVFCYIFLCNIISVV-GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEEESQ 268
           P G    +   +G   ++  + MG++  + + P I ++   IF+ N+I V+ GFE PT+    T +L L   +    LGIK        K  F  Y K   G   ++     P  I   +   +S+S RL+ +I    + L       MV+    P +L P P   L + F V            +QAF+F +LT  Y +GS   E E  
  S:    47 PTGSQNVLEAFVGGIISMGADTMGEKNARTYMPLIGSLALVIFVSNMIGVIPGFEAPTSNINFTLSLALIVFVYYNYLGIK--------KNGFVAYFKHFMGPMPVLAPLMFPIEIISHLSRIVSLSFRLFGSIRGDDMFL-------MVLLMLVPWIL-PLPGFFLLTAFGV------------LQAFIFSILTYVYIAGSIMMEHEEH 228
>gi|20065789|ref|NP_612821.1|ATP6_16049 ATP synthase F0 subunit 6 [Acropora tenuis] >gi|5817780|gb|AAD52917.1|AF152244_4 ATPase subunit 6 [Acropora tenuis] >gi|19908469|gb|AAM02912.1|AF338425_6 ATP synthase subunit 6 [Acropora tenuis] (232 aa)
Score = 107, Expect = 3.6e-03, Identities = 48/182 (26%), Positives = 78/182 (42%)
  Q:    75 FKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           F  +V + +G E +++ P I ++F +I   N++ +  +   PT    VT  L     +G  + G    K  FF  F+        SG  + +            I   IS+ +RL AN+ AG L+  +       M      ++  GP V +F L  + F   L+  V  IQA+VF +L   Y
  S:    56 FHGVVKDNLGSEGLRYFPLIVSLFFFIVFLNVLGLFPYVFTPTVHIVVTLGLSFSIIIGVTLAGFWRFKGDFFSVFM-------PSGAPLGLAPLLVLIETVSFISRAISLGVRLAANLSAGHLLFAILAGFGFNM------LVASGP-VGVFPLLIMVFITLLEVAVAVIQAYVFCLLATIY 224
>gi|193213686|ref|YP_001999639.1| ATP synthase F0, A subunit [Chlorobaculum parvum NCIB 8327] >gi|193087163|gb|ACF12439.1| ATP synthase F0, A subunit [Chlorobaculum parvum NCIB 8327] (350 aa)
Score = 107, Expect = 3.8e-03, Identities = 58/229 (25%), Positives = 103/229 (44%)
  Q:    36 VITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEI-MGKEFIKFTPYIFTVFCYIFLCNIISVVGF-ENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGF---LDWLVGSIQAFVFVVLTLCYWSGSTEPE 264
           V  +I+ LV       +KK+   + P GIA  +  L+   +  V +  +G  + K  PY+ +VF +I +CN++ ++ +    T    VT AL +FT   T I   K      + K L        +G    +     P  I       +++++RL+AN+ AG +I+     +  ++              I+ +  +VPF  F   L+  V  +QAFVF +L+  +   +T  E
  S:   122 VAAVILILVGAAAGAGVKKISVKQAPSGIANVMEALVDFIRLDVAKSNIGHGYEKHLPYLISVFFFILVCNLLGLIPYGATATGNINVTLALSIFTFFITQIAAFKELGVGGYVKHL-------TAGTHWSLWIIMIPIEIIGQFTKPVALTIRLFANMTAGHIIILSLIFISFIL-----------ESYIVAAAVSVPFAIFIYLLEIFVAFLQAFVFTMLSALFIGLATAHE 337
>gi|110816069|ref|YP_684401.1| ATP synthase F0 subunit 6 [Oltmannsiellopsis viridis] >gi|86450280|gb|ABC96359.1| ATP synthase F0 subunit 6 [Oltmannsiellopsis viridis] (258 aa)
Score = 107, Expect = 3.9e-03, Identities = 47/180 (26%), Positives = 80/180 (44%)
  Q:    77 TLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           +LV E +G++   +  +IFT F  I  CN++ ++ +    T+   VTF L L   +G  I+G +     FF  FL K       G  + +        +       IS+ +RL+ N+++G  +L +       M       L  G  +    + A+     L+  V S+QA+VF +LT  Y
  S:    81 SLVGEQIGEKGKPYFTWIFTTFILILACNLVGMIPYSFTTTSHVAVTFGLALSLFVGITIIGFQNHGLHFFSFFLPK-------GTPLALVPLLVLIEVMSYCTRPISLGVRLFVNLISGHALLKILSGFAWTMLTSG-GALAVGSLIPFVVIVAIT---GLELAVSSLQAYVFCILTCIY 250
>gi|6088084|dbj|BAA85619.1| ATPase 6 [Acropora digitifera] (215 aa)
Score = 107, Expect = 4.0e-03, Identities = 48/182 (26%), Positives = 78/182 (42%)
  Q:    75 FKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           F  +V + +G E +++ P I ++F +I   N++ +  +   PT    VT  L     +G  + G    K  FF  F+        SG  + +            I   IS+ +RL AN+ AG L+  +       M      ++  GP V +F L  + F   L+  V  IQA+VF +L   Y
  S:    47 FHGVVKDNLGSEGLRYFPLIVSLFFFIVFLNVLGLFPYVFTPTVHIVVTLGLSFSIIIGVTLAGFWRFKGDFFSVFM-------PSGAPLGLAPLLVLIETVSFISRAISLGVRLAANLSAGHLLFAILAGFGFNM------LVASGP-VGVFPLLIMVFITLLEVAVAVIQAYVFCLLATIY 215
>gi|103486565|ref|YP_616126.1| F0F1 ATP synthase subunit A [Sphingopyxis alaskensis RB2256] >gi|98976642|gb|ABF52793.1| ATP synthase F0, A subunit [Sphingopyxis alaskensis RB2256] (261 aa)
Score = 107, Expect = 4.0e-03, Identities = 53/225 (23%), Positives = 100/225 (44%)
  Q:    32 TSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNI-----ISVVGFE--NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           +++ ++   +TL L  +    ++L P +    +  F     G   +++   +G E  K+TPY+F++F +I  CN+     + V+G      T+   +T  L L +    +++G       FF  F+         G  + +     P      ++   S+ LRL+  + AG ++L +     +  F  +   L     V+ F+L        L+ LV  IQA+VF +LT  Y
  S:    35 SALWMVVAAITLGLFMWGGMRRQLVPGRWQVAVEGFT----GFISSMMMANIGTEGRKYTPYVFSLFMFILFCNLLGMLPLGVLGLHPFTVTSHIAITGVLALISFAIVLVVGFWRHGLHFFSLFV-------PHGTPLPMIPIIAPIEFVSFMVRPFSLGLRLFVAMTAGHVLLKVLSGFVINGFNAETLWLGSIVSVLSFTLMIGI--SALELLVAGIQAYVFALLTSLY 253
>gi|62390094|ref|YP_225496.1| F0F1 ATP synthase subunit A [Corynebacterium glutamicum ATCC 13032] >gi|9757615|dbj|BAB08151.1| H+-ATPase a subunit [Corynebacterium glutamicum] >gi|10039446|dbj|BAB13354.1| H+-ATPase a subunit [Brevibacterium flavum] >gi|41325430|emb|CAF19910.1| ATP SYNTHASE F0 SUBUNIT 6 [Corynebacterium glutamicum ATCC 13032] (322 aa)
Score = 107, Expect = 4.1e-03, Identities = 58/223 (26%), Positives = 110/223 (49%)
  Q:    34 IIVITIIMT-LVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYE-IMGK-EFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILG-LFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           I++I ++MT +V+V++ ++M+K  P   P G+  F    L   +  + E I+GK E  +F P + T+F    L N+ +++   N ++ + + F + +    G I       K   F+K++    +       + +      F  T I+ P ++++LRL AN +AG +IL  LF A     F+ +      G  +++  LF V      + +V  +QA++F +L   Y
  S:    95 IVLIRLLMTAVVVVFFLWAMRK--PKLVPHGVQNFAEYALDFVRIHIAEDILGKKEGRRFLPILATIFFAALLMNLATIIPGLNISSNSRIAFPI-VMAVAGYIAFIYAGSKRYGFFKYVKSSVVIPNIPPALHVLVVPIEFFSTFILRP-VTLALRLMANFLAGHIILVLLFSATNFFFFQFNGWTAMSGVTILMAVLFTV-----YEIIVIFLQAYIFALLVAVY 312
>gi|148240358|ref|YP_001225745.1| F0F1 ATP synthase subunit A [Synechococcus sp. WH 7803] >gi|147848897|emb|CAK24448.1| ATP synthase A chain [Synechococcus sp. WH 7803] (242 aa)
Score = 107, Expect = 4.1e-03, Identities = 53/198 (26%), Positives = 91/198 (45%)
  Q:    59 KPPKGIAFFIFNLLGAFKTLVYEIMG-KEFIKFTPYIFTVFCYIFLCN---------IISVVGFE--NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILG-LFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           + PKG+   +  L    + L  E +G K +  + P++ T+F +IF+CN         ++ +   E   PTA    T A+ L  +L     G+  +   +     F++Y++      +M+P+      I D   P +S+S RL+ NI+A  L++  L + +P         VL P P +            FL     +IQA +F  L   Y
  S:    56 RDPKGVQNLLEYLWDYLRELAREQIGEKAYRDWLPFVGTLFLFIFVCNWGGALIPWRLVELPNGELGAPTADINTTVAMALLVSLSYFYAGLSRKGLRY-----FEYYVEP---TPIMLPFKI----IEDFTKP-LSLSFRLFGNILADELVVAVLAFLVP---------VLVPLPAM------------FLGLFTSAIQALIFATLAANY 232
>gi|87043012|ref|YP_492626.1| ATP synthase F0 subunit a [Dictyostelium citrinum] >gi|122121922|sp|Q2LCR6|ATP6_DICCI ATP synthase subunit a (ATPase protein 6) >gi|84682112|gb|ABC60377.1| ATPase subunit 6 [Dictyostelium citrinum] (244 aa)
Score = 107, Expect = 4.1e-03, Identities = 60/226 (26%), Positives = 107/226 (47%)
  Q:    31 ITSIIV-ITIIMTLVLVYYNFSMKK--LDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           IT+I V + ++M +V+  Y  S+ K  L  N   + I   I+  +     L+ E +GK  I F P+I ++F ++   N++ ++      T    VTF L +   +G  I G +     F   F+        SG +  +        I   ++  IS+++RL+AN++AG L++ +     + + +     + P   VI F         FL+  +  +QA+VFV+LTL Y
  S:    25 ITTITVYLGLLMVIVIGMYKVSLYKATLIGNNNWQHIGEMIYEFV---VDLILEQVGKPGILFFPFIMSLFLFVLTLNVMGLIPLSFTVTGQLLVTFTLAITIMIGITIWGFRIHGIKFLNIFV-------PSGIEPWLLPLLVFIEIMSYVLRPISLAVRLFANMLAGHLLIHIIGVAAIYLMQFYFIGILPWICVIAFM--------FLELGIAFLQAYVFVLLTLIY 236
>gi|146221448|gb|ABQ11847.1| ATP synthase F0 subunit 6 [Sympagella nux] (242 aa)
Score = 107, Expect = 4.2e-03, Identities = 49/187 (26%), Positives = 83/187 (44%)
  Q:    76 KTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTE 262
           K L  E + ++ + + P I ++       N+I ++ +    T+   +TF+L L   + T I  I   KS FF        I T   + +++  F         I   IS+ +RL ANI AG L+L +  +  +     +  +L   P   LF +        L+ +V  IQA+VF +LT  Y S + +
  S:    66 KNLTQEHIKEKQLTYNPLILSILTIFITINLIGLLPYVFTTTSHIIITFSLSLTIIIKTTISAIMTHKSKFFS-------ILTPQNSPLILAPFLILIETISFITRTISLGVRLAANISAGHLLLSILSSFALNTLLTNHYLLSLLPISALFLI------SILEIMVAIIQAYVFTLLTTIYLSDTIK 240
>gi|6088072|dbj|BAA85613.1| ATPase 6 [Acropora brueggemanni] >gi|6088074|dbj|BAA85614.1| ATPase 6 [Isopora palifera] >gi|6088076|dbj|BAA85615.1| ATPase 6 [Acropora donei] >gi|6088078|dbj|BAA85616.1| ATPase 6 [Acropora tenuis] >gi|6088080|dbj|BAA85617.1| ATPase 6 [Acropora florida] >gi|6088082|dbj|BAA85618.1| ATPase 6 [Acropora gemmifera] >gi|6088086|dbj|BAA85620.1| ATPase 6 [Acropora nasuta] (215 aa)
Score = 107, Expect = 4.4e-03, Identities = 48/182 (26%), Positives = 78/182 (42%)
  Q:    75 FKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           F  +V + +G E +++ P I ++F +I   N++ +  +   PT    VT  L     +G  + G    K  FF  F+        SG  + +            I   IS+ +RL AN+ AG L+  +       M      ++  GP V +F L  + F   L+  V  IQA+VF +L   Y
  S:    47 FHGVVKDNLGSEGLRYFPLIVSLFFFIVFLNVLGLFPYVFTPTVHIVVTLGLSFSIIIGVTLAGFWRFKGDFFSVFM-------PSGAPLGLAPLLVLIETVSFISRAISLGVRLAANLSAGHLLFAILAGFGFNM------LVASGP-VGVFPLLIMVFITLLEVAVAVIQAYVFCLLATIY 215
>gi|169665168|gb|ACA63373.1| ATP synthase subunit 6 [Stereum hirsutum] (212 aa)
Score = 107, Expect = 4.4e-03, Identities = 49/202 (24%), Positives = 89/202 (44%)
  Q:    36 VITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALT-TVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFL 237
           ++  I+++ + Y   +  K+ P+K   G+     +L     T+V E +GKE   + P+I+++F YI + N++  + +   T  +  VT         G  ILG+   K+ FF  F+        SG  + +            +    S+ +RL+ANI+AG  +L +       MF            +I+F L  +PF  F+
  S:    19 LLLFIISIGIHYLGNNEAKILPSKWSIGLE----SLYTTINTMVKEQLGKEI--YLPFIYSLFFYILIANLLGNIPYSYATTTSIIVTIGFSFTILTGVTILGLSIHKTEFFSYFV-------PSGTPLALVPLLVLIETVSYLARAFSLGIRLFANIVAGHTLLKILATFLYQMF---------NSSIIMFVLTLIPFTIFI 199
>gi|68171933|ref|ZP_00545249.1| H+-transporting two-sector ATPase, A subunit [Ehrlichia chaffeensis str. Sapulpa] >gi|88658166|ref|YP_507871.1| F0F1 ATP synthase subunit A [Ehrlichia chaffeensis str. Arkansas] >gi|67998643|gb|EAM85380.1| H+-transporting two-sector ATPase, A subunit [Ehrlichia chaffeensis str. Sapulpa] >gi|88599623|gb|ABD45092.1| ATP synthase F0, A subunit [Ehrlichia chaffeensis str. Arkansas] (243 aa)
Score = 107, Expect = 4.5e-03, Identities = 55/232 (23%), Positives = 102/232 (43%)
  Q:    27 YRSEITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISV--VGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWS 258
           Y  + T+  +  ++ TL++  + +   + + N  P  +   I  +     + +   +G++ +++ P +FT+F +I  CN++ V  +GF   T+   VTFA+ +   +    +G K+Q   F    L K      +   V I  F             +S+S+RL AN++AG  I+ +     + M       L P P   +  L         +  V  +QA++F VLT  Y S
  S:    23 YNIDFTNASLFMVLSTLIISLFCYIGLRKE-NILPNSMQLIIEAIYNFIVSTIESNVGRKGLQYIPLVFTIFTFIATCNLLGVLPLGF-TVTSHIAVTFAISMVVFISVTAIGFKHQGIHFLRILLPKGTPGWLAPMMVFIELF-------AYCARPVSLSIRLAANMIAGHTIIKVIAGFVIKM----NIFLTPLPMAFIIILIG------FEIFVAILQAYIFTVLTCVYLS 237
>gi|22653469|gb|AAN04079.1| ATP synthase F0 subunit 6 [Amoebidium parasiticum] (249 aa)
Score = 107, Expect = 4.6e-03, Identities = 52/220 (23%), Positives = 95/220 (43%)
  Q:    37 ITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDP--TVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           +T+I+ +VL+   + +        P  I   +  L      L+ + +G++   + P+IFT+F YI + N++ +V +  + TA  +V  AL      G  + G      +F   F+         G  + +        +       IS+ +RL ANI AG L+L +       M       ++    P +++F++        L+  V  IQA+VF +LT  Y
  S:    32 LTMIIAIVLIITAYKLSIERGYIVPTRIQSVVEILYETVYGLIKDNIGEKGNAYFPFIFTLFTYIVVLNLMGMVPYVFSATAHISVALALSFGIWFGVTLRGFSLHGINFLSMFM-------PQGAPMALAPLLVMIELVSYSARAISLGVRLAANISAGHLLLAILSGFTWTMLAAGGILSLASVLPALVIFAMSG------LELAVAVIQAYVFTLLTCIY 241
>gi|118590785|ref|ZP_01548186.1| F0F1 ATP synthase subunit A [Stappia aggregata IAM 12614] >gi|118436761|gb|EAV43401.1| F0F1 ATP synthase subunit A [Stappia aggregata IAM 12614] (249 aa)
Score = 106, Expect = 4.6e-03, Identities = 49/180 (27%), Positives = 83/180 (46%)
  Q:    84 GKEFIKFTPYIFTVFCYIFLCNIISVVG-FENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDP-----TVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEP 263
           G E ++F P +F++F ++ + N+  +   F   T+   VTFAL +   L  II G       F   F+        SG    +        +   +   IS+S+RL+AN++AG + L +F    + +          ++L  G  V L +L         ++LV  +QA+VF VLT  Y + +  P
  S:    78 GTEGMRFFPLVFSLFMFVLVANLFGMFPYFFTITSHIIVTFALAMLVILTVIIYGFMKNGMKFLKLFV-------PSGVPGALIPLVTLIEVISFLSRPISLSVRLFANMLAGHITLKVFSGFVVSLSAMGAVGIFGSILPLGMTVALTAL---------EFLVAFLQAYVFTVLTCMYLNDAIHP 247
>gi|87301257|ref|ZP_01084098.1| ATP synthase subunit A [Synechococcus sp. WH 5701] >gi|87284225|gb|EAQ76178.1| ATP synthase subunit A [Synechococcus sp. WH 5701] (242 aa)
Score = 106, Expect = 4.8e-03, Identities = 63/235 (26%), Positives = 110/235 (46%)
  Q:    31 ITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMG-KEFIKFTPYIFTVFCYIFLCN---------IISVVGFE--NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILG-LFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEE 265
           ++S +VI  ++ LV+       + L+  + P+G+   +  + G  + L  E +G K +  + P+I T+F +IF+ N         +I +   E   PTA    T AL L  +L     G+   +  F Y   F++Y++      +M+P     F I +     +S+S RL+ NI+A  L++  L + +P+V+         P P +            FL     +IQA +F  L   Y+ G    EE
  S:    34 LSSWLVIGALLALVVA----GTRNLE--RDPRGVQNLLEFIWGYLRDLAREQIGEKAYRDWLPFIGTLFLFIFVSNWGGALVPWKLIHLPSGELGAPTADINTTIALALLVSLAYFYAGL--SRKGFRY---FEYYVEP---TPIMLP-----FKIVEDFTKPLSLSFRLFGNILADELVVAVLAFLVPLVV---------PLPAM------------FLGLFTSAIQALIFATLA-AYYIGEAVHEE 240
>gi|75674437|ref|YP_316858.1| F0F1 ATP synthase subunit A [Nitrobacter winogradskyi Nb-255] >gi|74419307|gb|ABA03506.1| H+-transporting two-sector ATPase, A subunit [Nitrobacter winogradskyi Nb-255] (247 aa)
Score = 106, Expect = 4.8e-03, Identities = 49/180 (27%), Positives = 88/180 (48%)
  Q:    84 GKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFY-IKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEP 263
           GKE +KF P++F++F  + + N++ ++ +    ++   VT AL        +I G        FYK   +F+ +   SG  V+I        +   +   +S S+RL+AN++AG + L +F +  + M      V   G  + L  + A+     L+ LV  +QA+VF +LT  Y + +  P
  S:    76 GKEGMKFFPFVFSIFMLVTVSNLVGIIPYTFTISSHIIVTAALAFLVFFTVLIYG--------FYKNGLRFFKLFVPSGIPVVILPLVVTIEVISFLSRPVSHSVRLFANMLAGHITLKVFASF-VTMLGAMGIVGVFGAVLPLALVVALT---ALELLVAFLQAYVFTILTCIYINDAIHP 245
>gi|11467086|ref|NP_042562.1| H(+)-transporting ATPase, subunit 6 [Acanthamoeba castellanii] >gi|3913132|sp|Q37385|ATP6_ACACA ATP synthase subunit a (ATPase protein 6) >gi|562067|gb|AAD11855.1| H(+)-transporting ATPase, subunit 6 [Acanthamoeba castellanii] (247 aa)
Score = 106, Expect = 4.8e-03, Identities = 53/225 (23%), Positives = 100/225 (44%)
  Q:    32 TSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           T I+ + +I    L Y N+S     P+K    +      +L  FK  +  I+    +K+ P +  VF +I   N+I ++ +    T     TF +      G  ++     K+ FF  F+           K +IP+      ++ +I P+ S+S+RL+AN++AG  +L +  A    +F++          +    L  + F   L++ +  +QA++F +LT  Y
  S:    30 TIILFVILIGFTFLFYVNYSTNTYIPSKWQYAVENIYLFVLQLFKQQINNIVA---LKYFPLVLFVFSFILFANLIGLLPYGFTITGHIIFTFQIAFSLFFGITLINFFNNKTEFFNLFV------PSGVPKPLIPFLVVIEVVSYLIRPF-SLSVRLFANMLAGHTLLNILSAFIFNVFKKYAL-------ISFLPLLFIVFIIVLEFCIAIVQAYIFSILTCIY 238
>gi|126661083|ref|ZP_01732165.1| F0F1 ATP synthase subunit A [Cyanothece sp. CCY0110] >gi|126617627|gb|EAZ88414.1| F0F1 ATP synthase subunit A [Cyanothece sp. CCY0110] (230 aa)
Score = 106, Expect = 4.9e-03, Identities = 46/168 (27%), Positives = 83/168 (49%)
  Q:    89 KFTPYIFTVFCYIFLCNIISVVG-FENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           +F P+I T+F +I + N++++   +++P    + T AL L   +   I GIK    + +     + YI+      VM+P     F +   I   +S+++RL+ NIM+ +L++ +  ++  + F   P V+       LF L           LVG IQA+VF +L + Y
  S:    77 QFLPFIGTLFLFITMANLLTIFPVYQSPAGSLSTTAALALCVFVAVPIYGIKNVGVTNY----LRHYIQP---TPVMLP-----FNLISEISRTVSLAIRLFGNIMSTSLLVAILISIVPLFF---PAVM------TLFGL-----------LVGVIQAYVFTILAMVY 213
>gi|4091918|gb|AAC99652.1| ATP synthetase subunit 6 [Sarcophyton glaucum] (237 aa)
Score = 106, Expect = 5.2e-03, Identities = 48/190 (25%), Positives = 82/190 (43%)
  Q:    71 LLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGS 260
           L   F  LV +    +  ++   I T+F +I   N++ +  +   PTA   +TF L L   +   ILGI   + +F    +        SG  +++        +   +   IS+ +RL AN+ AG L+  +  +    M  +   VL   P +++       F   L+  V  IQA+VF +LT  Y + S
  S:    56 LYNHFLGLVKDSTANKGTQYFALIITIFTFIAGLNLLGLFPYVFTPTAHIIITFGLSLSILIAVTILGITQYRWNFASMMM-------PSGAPLLLAPLLVSIEVISYLSRAISLGIRLAANVSAGHLLFAILASFGFAMISKGMLVLSLAPILVMI------FITLLEIAVALIQAYVFCLLTTIYINDS 233
>gi|33151286|ref|NP_872639.1| F0F1 ATP synthase subunit A [Haemophilus ducreyi 35000HP] >gi|33147506|gb|AAP95028.1| ATP synthase A chain [Haemophilus ducreyi 35000HP] (262 aa)
Score = 106, Expect = 5.3e-03, Identities = 46/167 (27%), Positives = 79/167 (47%)
  Q:    92 PYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFG-------------ITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFH---GFLDWLVGSIQAFVFVVLTLCYWS 258
           P   T+FC++F+ N I +V  +    L  + F +     + T  +      S   +  +  + +K+K  N +   Y  +PF              +T +  P IS++ RL+ N+ AG LI    + L  VM+  D   L+            +P H        LV ++QAF+F++LT+ Y S
  S:    87 PLALTIFCWVFIMNAIDLVPVDFLPQLANM-FGIHYLRAVPTADISATLGMSICVFGLILFYTVKSKGFNGLAKEYTLHPFNHWAFIPVNFILETVTLLAKP-ISLAFRLFGNMYAGELI----FILIAVMYMADNFALQA---------LGIPLHLVWAIFHILVITLQAFIFMMLTIVYLS 254
>gi|18640457|ref|NP_570145.1| ATP synthase protein 6 [Hypocrea jecorina] >gi|18496638|gb|AAL74171.1|AF447590_8 ATP synthase protein 6 [Hypocrea jecorina] (259 aa)
Score = 106, Expect = 5.4e-03, Identities = 45/167 (26%), Positives = 76/167 (45%)
  Q:    90 FTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           + P+I+T+F +I + N+I ++ +    T    +TFAL     LG  ILG +     F       F +   +G  + +        +   +   +S+ LRL ANI AG ++L +       +          G   +L  +F + F G L++ +  IQA VFVVL+  Y
  S:    95 YFPFIYTLFVFILINNLIGMIPYSFASTGHFALTFALSFTIVLGATILGFQKHGLKF-------FSLLVPAGCPLALLPLLVTIELISYLARNVSLGLRLAANITAGHMLLSILSGFVYNIMNSGIIFFVLG---LLPLVFIIAFSG-LEFAIAFIQAQVFVVLSSSY 251
>gi|23100436|ref|NP_693903.1| F0F1 ATP synthase subunit A [Oceanobacillus iheyensis HTE831] >gi|22778669|dbj|BAC14937.1| H(+)-transporting ATP synthase A chain [Oceanobacillus iheyensis HTE831] (240 aa)
Score = 106, Expect = 5.7e-03, Identities = 61/228 (26%), Positives = 104/228 (45%)
  Q:    31 ITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMG-KEFIKFTPYIFTVFCYIFLCNIISV---------VGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWS 258
           ++++++  I+  +V V+  +  +KL     PKGI  F+   +   + ++ + M  K    F P   T+  YI + N+I V         + +++PTA   +T  L       T   GIK + +        K Y+KT       +P    PF I +     +++ LRL+ NI AG ++L L   L             P      FS+F           +G+IQ++VFV+LT+ Y S
  S:    21 LSNLMMTFIVCLIVFVFCVWGSRKL--QMKPKGIQNFMEWAVEFVRGIIQDNMDWKTGRIFLPLGLTLIFYILVSNLIGVATVGVVEHDLWWKSPTADAVMTLTLSTMIIALTHYYGIKLRGT--------KAYLKTYVSP---VPLML-PFKIVEEFTNTLTLGLRLFGNIYAGEILLSLLVGLATTSIFGFFGAALPMLAWQTFSVF-----------IGAIQSYVFVMLTMVYMS 233
>gi|167463129|ref|ZP_02328218.1| ATP synthase F0, A subunit [Paenibacillus larvae subsp. larvae BRL-230010] (259 aa)
Score = 106, Expect = 5.8e-03, Identities = 40/159 (25%), Positives = 71/159 (44%)
  Q:   107 ISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEE 265
           + +  +++PTA  +VT  L          LG+      +   +   F+             FF P  + + +   ++++LRL+ANI AG +++               T+L  G   I  +   + + GF    VG+IQAF+F +LT+ Y + ST+ EE
  S:   130 VEIAWWKSPTADLSVTSGLAAIVFFLVHFLGLTRNTKHYLKHYFQPFW-------------FFFPLNLIETLAKPVTLALRLFANIFAGEVLIA--------------TILMAG---IFGTPLLIAWQGF-SIFVGAIQAFLFTILTMVYIADSTKHEE 257
>gi|115494867|ref|YP_778637.1| ATP synthase F0 subunit 6 [Chrysopathes formosa] >gi|82792228|gb|ABB90977.1| ATP synthase subunit 6 [Chrysopathes formosa] (237 aa)
Score = 106, Expect = 5.8e-03, Identities = 47/176 (26%), Positives = 77/176 (43%)
  Q:    75 FKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFY-IKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFV 250
           F ++V + +G E +K+ P+I ++F +I   N++ +  +   PT    VT  L     +G  + GI        +KF + F  I    G  + +            I   IS+ +RL AN+ AG L+  +       M       L  G  + LF L  + F   L+  V  IQA+VF+
  S:    56 FHSVVKDNLGPEGLKYFPFIISLFLFIVFLNVLGLFPYVFTPTVHIVVTLGLSFSIVIGVTLAGI--------WKFKWNFLSILMPDGAPLGLAPLLVLIETVSYISRAISLGVRLAANLSAGHLLFAILAGFSFSM-------LTAGGLLSLFPLLIMVFITLLEMAVAVIQAYVFL 218
>gi|62736238|ref|YP_227566.1| ATP synthase subunit 6 [Candida metapsilosis] >gi|62177750|gb|AAX73041.1| ATP synthase subunit 6 [Candida metapsilosis] >gi|170779369|gb|AAR26265.2| ATP synthase subunit 6 [Candida metapsilosis] (246 aa)
Score = 106, Expect = 5.8e-03, Identities = 55/232 (23%), Positives = 109/232 (46%)
  Q:    31 ITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE---NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTE 262
           IT+  +  II++L++++Y+  ++         G++  +  +      LV   +G++   F P IFT+F +I + N+IS++ +    +   +  V+F+L L+  +G ++LG+      FF  F+        SG  + +                IS+ LRL ANI++G L++ +  +L + +          G    +  + AV     L++ +  IQA+VF +L   Y   S +
  S:    25 ITNYTLYLIIVSLIIMFYSSIIRNNFLGSSRWGVS--VIAIYDTILNLVNGQIGRKGGYFFPLIFTIFNFILIANLISMIPYSFAISAQLVAVVSFSLALW--IGNVVLGLYLHGWGFFALFV-------PSGTPLPLVPVLVLIEALSYASRAISLGLRLGANILSGHLLMLILGSLIIGLMSSSLFGFISG----IIPILAVVAITILEFAIAIIQAYVFSILLSGYIKDSVD 244
>gi|58039573|ref|YP_191537.1| F0F1 ATP synthase subunit A [Gluconobacter oxydans 621H] >gi|58001987|gb|AAW60881.1| ATP synthase A chain [Gluconobacter oxydans 621H] (249 aa)
Score = 106, Expect = 5.8e-03, Identities = 37/141 (26%), Positives = 67/141 (47%)
  Q:   116 TALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           T+   VTF L +   + +I+  I++Q   F   FL        +G  V +     P  I   +   +S+S+RL+AN++AG ++L +F    +++      +   G  + +  +        L+ LVG +QA+VF +LT  Y
  S:   113 TSHIAVTFGLAIMVFIISILASIRFQGVGFLKHFL-------PAGTPVWLAPLLVPIEIISFLSRPVSLSIRLFANMVAGHVLLEVFAGFTIML----AGLGAFGHVLAIAPIAINIALTALELLVGVLQAYVFAILTCIY 242
>gi|633582|emb|CAA87756.1| ATP synthase subunit 6 [Platymonas subcordiformis] (249 aa)
Score = 106, Expect = 5.8e-03, Identities = 56/219 (25%), Positives = 102/219 (46%)
  Q:    39 IIMTLVLVYYNFSMKKLDPN-KPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLF--YALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYW 257
           +++T  +V+  FS+  +D     P     F+  +      LV E +G E  K+  ++FTVF +I   N+I ++ +    T+   VTF++ L   LG  I+G       FF   L K       G  + +        +       +S+ ++L+AN+MAG  ++ +   +A  M+      T+    P +++F+L        L+  V  +QA+VF +LT  Y+
  S:    33 LMLTTFVVFLLFSLVTIDGGFLIPTRWQTFVEMIYEFVMNLVDEQIGGEGQKYFAFVFTVFHFILFINLIGMIPYSFTATSHLIVTFSMSLSLFLGITIIGFNTHGLHFFSFLLPK-------GAPLALAPLLVVLELVSYCFRGVSLGVQLFANMMAGHTLVKILSGFAWTMLCAGGLLTIASTIPFLVVFALTG------LELAVAFLQAYVFTILTCIYF 242
>gi|108744806|gb|ABG02554.1| ATPase subunit 6 [Botryobasidium isabellinum] (238 aa)
Score = 105, Expect = 6.3e-03, Identities = 55/221 (24%), Positives = 103/221 (46%)
  Q:    36 VITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTL--GTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGF-----LDWLVGSIQAFVFVVLTLCY 256
           ++ + +   L Y   + KKL P+K     +  + +   +  ++V   +G     + P+I+++F +I + N+   V + N T  T++  ++GL  T+  G  ILG+K     FF  F+        SG  + +            +    S+ +RL+AN++AG  +L +   L   +F            +++F +  +PF  F     L+  V  IQA+VF +LT  Y
  S:    32 LVVLFLVTGLHYVGNNNKKLVPSK----WSIALESSFASINSMVRSQIGSANEVYLPFIYSLFFFIIISNLSGNVPY-NYTVTTSLIVSIGLSFTIFIGVTILGLKNHHLHFFSYFI-------PSGTPLGLVPLLVLIEFISYLARAFSLGIRLFANMVAGHTLLKILSTLLYTLF---------SSSLVMFFVTLLPFGIFTALIGLELAVSVIQAYVFCILTCSY 238
>gi|84796251|gb|ABC66210.1| ATP synthase subunit 6 [Ceratobasidium sp. CBS 133.82] (223 aa)
Score = 105, Expect = 6.4e-03, Identities = 48/194 (24%), Positives = 94/194 (48%)
  Q:    36 VITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTL--GTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLF 229
           ++ + +TL L + + + +KL P+K     +  + +   +  T+V + +G     + P+I+++F +I + N+   V + N T  T++  +LGL  T+  G  IL +   K  FF  F+        SG  + +        +   +   +S+ +RL+ANIMAG  ++ +       MF    ++L     V+ F+LF
  S:    24 IVLLFLTLGLHFVSSNNRKLVPSK----WSIALESSFASINTMVRDQIGTANEVYLPFIYSLFFFIIIANLTGNVPY-NYTITTSIVVSLGLSVTIFIGVTILALSIHKVRFFSFFI-------PSGTPLALVPLLVLIELISYLARAVSLGVRLFANIMAGHTLMKILSTFLFQMF--SSSILVAVITVVPFALF 205
>gi|167628988|ref|YP_001679487.1| ATP synthase f0, a subunit [Heliobacterium modesticaldum Ice1] >gi|167591728|gb|ABZ83476.1| ATP synthase f0, a subunit [Heliobacterium modesticaldum Ice1] (240 aa)
Score = 105, Expect = 7.0e-03, Identities = 52/226 (23%), Positives = 104/226 (46%)
  Q:    33 SIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVV--------------GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLF-----YALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWS 258
           +++   ++M +++++   + ++     P + +A + F +    K +      K+      Y+ T+  +IF+ N+I +                  +PTA   +T AL   T +     GIKY  + +F  F    ++             F P    +++   ++++ RL+ NI AG +++ +      + L  ++    P V+  G     FS+F           VG+IQ+FVF VLT+ Y S
  S:    16 TLLFTWLVMAILIIFGYIAGRRATSGTPDRIVAVWEFVIDFVAKIVADNTDYKKMAGLLAYLVTLIMFIFVSNMIGLFPNFTFGLGHLHTAGNLMSPTADLNLTLALATMTIILAQYYGIKYNGTHYFGHFFSPHWL-------------FFPIHAIELLTKPVTLAFRLYGNIFAGEVLIKVLLTFIPFGLVYLLGGFIPHVIWLG-----FSVF-----------VGAIQSFVFTVLTIVYIS 231
>gi|163761007|ref|ZP_02168085.1| F0F1 ATP synthase subunit A [Hoeflea phototrophica DFL-43] >gi|162281788|gb|EDQ32081.1| F0F1 ATP synthase subunit A [Hoeflea phototrophica DFL-43] (249 aa)
Score = 105, Expect = 7.2e-03, Identities = 50/180 (27%), Positives = 87/180 (48%)
  Q:    84 GKEFIKFTPYIFTVFCYIFLCNIISVVG-FENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPW-------------ISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPG--PEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEP 263
           G + ++F P +F++F +I + N++ +   F   T+   VTFAL +      I+ G        F+K    F               F P G+  ++MP              IS+S+RL+AN++AG + L +F    + +       +     P ++  +L A      L++LV  +QA+VF VLT  Y + +  P
  S:    78 GSQGMRFFPMVFSLFMFILVANLLGMFPYFFTVTSHLIVTFALAMLVIGTVIVYG--------FWKHGLHFL------------NLFVPSGVPGVLMPLVVMIEVISFLSRPISLSVRLFANMLAGHITLKVFAGFVVSLGSMGALGIGGAILPLIMTVALTA------LEFLVAFLQAYVFAVLTCMYLNDALHP 247
>gi|7524988|ref|NP_050086.1| ATPase subunit 6 [Dictyostelium discoideum] >gi|74895287|sp|Q27559|ATP6_DICDI ATP synthase subunit a (ATPase protein 6) >gi|1088422|dbj|BAA04732.1| ATP synthase A chain (protein 6) [Dictyostelium discoideum] >gi|4958891|dbj|BAA78068.1| ATPase subunit 6 [Dictyostelium discoideum] (244 aa)
Score = 105, Expect = 7.3e-03, Identities = 47/179 (26%), Positives = 84/179 (46%)
  Q:    78 LVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           L+ E +GK  I F P+I ++F ++   N++ ++      T    VTF L +   +G  I G +     F   F+        SG +  +        I   ++  IS+++RL+AN++AG L++ +     + + +     + P   VI F         FL+  +  +QA+VFV+LTL Y
  S:    72 LIIEQVGKPGILFFPFIMSLFLFVLTLNVMGLIPLSFTVTGQLLVTFTLAITIMIGITIWGFRIHGIKFLNIFV-------PSGIEPWLLPLLVFIEIMSYVLRPISLAVRLFANMLAGHLLIHIIGVAAIYLMQFYFIGILPWICVIAFM--------FLELGIAFLQAYVFVLLTLIY 236
>gi|169335787|ref|ZP_02862980.1| hypothetical protein ANASTE_02212 [Anaerofustis stercorihominis DSM 17244] >gi|169258525|gb|EDS72491.1| hypothetical protein ANASTE_02212 [Anaerofustis stercorihominis DSM 17244] (267 aa)
Score = 105, Expect = 7.5e-03, Identities = 57/225 (25%), Positives = 101/225 (44%)
  Q:    38 TIIMTLVLVYYNFS----MKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGF---ENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPM-------------------------VMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTE 262
           TII T+ ++   F+    +KK    +P          L+ + +  V   MGK+ + F+PY F++  ++ + N+   V       PTA    T  LG  T + T    IK +    + K  F+              +   P  I   I   +S+  RL+ NI  G +IL L Y++ +                           F ++  V      +++ S F    HG+ D   G +Q F+F +L++ + S + +
  S:    22 TIIWTVFVLALTFAILMFLKKDLQIRPTTKRQVIAETLVTSTRDFVSNTMGKKNVGFSPYFFSLAAFLLISNLSGFVFLNIVRPPTADAATTLTLGFLTFILTQFFAIKSKGVKKYIKSFFEPI------------FILLPINIIGEIANPVSLGFRLFGNITGGMIILTLAYSIFLGSTTAAMFTFITTLLLCIYMKFGKPNKFTQNKFVKTIAILLLIPSFFLAFCHGYFDLFAGILQTFIFCMLSMVFISSAMD 266
>gi|157814417|ref|YP_052713.2| ATP synthase F0 subunit 6 [Candida zemplinina] >gi|157824556|gb|AAR10340.2| ATP synthase F0 subunit 6 [Candida zemplinina] (248 aa)
Score = 105, Expect = 7.5e-03, Identities = 59/216 (27%), Positives = 99/216 (45%)
  Q:    41 MTLVLVYYNFSMKKLDPNK-PPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENP-TALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGF-----------LDWLVGSIQAFVFVVLTLCY 256
           M ++ VYY F+M      K        FI  L      +V   MG +  K+ P ++++F ++   N+IS++ +     A    T +L +   +G  +LG+   K  +F  F+        SG  + +  F     +   I   IS+ LRL AN+++G L+L +   L   MF           + I+ S F +   GF           L++ + + QA+VF VLT  Y
  S:    33 MLVLGVYYMFNMYVFKSGKLISTNYNMFIEALYSTMLNMVKSQMGNKGNKYFPLMYSLFMFMLFSNLISMIPYNFAINAQLMFTISLSMTIWMGLTMLGLIKHKFEYFGLFM-------PSGTSLPLVPFLVMIEMISNIARSISLGLRLGANMLSGHLLLTILCGL---MF-----------DFIMSSSFIIAILGFIPLIMILGIVSLEFAMAAKQAYVFCVLTCSY 240
>gi|157826462|ref|YP_001495526.1| F0F1 ATP synthase subunit A [Rickettsia bellii OSU 85-389] >gi|157801766|gb|ABV78489.1| F0F1 ATP synthase subunit A [Rickettsia bellii OSU 85-389] (242 aa)
Score = 105, Expect = 7.5e-03, Identities = 54/222 (24%), Positives = 104/222 (46%)
  Q:    35 IVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWI----SISLRLWANIMAGALILGLF--YALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           +++  ++ L   Y  FS  +L P++        I+NL+     ++ + +G +  KF P IFT+F +I  CN+  ++ +    T+   +TFAL +   L   I+G       F   FL               P +  P  I   +  ++    S+SLRL AN+MAG ++L +   + + ++++ +      P P +++   F +         V  +QA++F +L+  Y
  S:    33 MLLASVLALTYFYLAFSNPRLVPSRLQIS-GEIIYNLV---TDMLNQNVGSKGRKFVPVIFTLFVFILFCNLFGMIPYGFTVTSHIIITFALAILVFLMVTIVGFVKHGMHFLSLFL-----------PHGTPLWLAPLMIIIELFTYLARPASLSLRLAANMMAGHILLKVIASFVITLMIYLK----FLPIPLMVILIGFEI--------FVAILQAYIFTILSCVY 234
>gi|89899961|ref|YP_522432.1| F0F1 ATP synthase subunit A [Rhodoferax ferrireducens T118] >gi|89344698|gb|ABD68901.1| ATP synthase F0, A subunit [Rhodoferax ferrireducens T118] (231 aa)
Score = 105, Expect = 7.8e-03, Identities = 44/191 (23%), Positives = 88/191 (46%)
  Q:    71 LLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVV-GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGST 261
           ++ A +  + E+  ++  K+  ++ T+F ++   ++ +V+ G+E PT   + T AL     +     GIK Q            Y+K+     V++     PF I   I   +++++RL+ N+M+GA+I+G+   +   +F   P V+                   L  L G +QA++F +L   Y + +T
  S:    59 VVTAIEKQIEEVGLRDPKKYLGFLGTLFLFVATASLCTVIPGYEPPTGSLSTTAALAFCVFVAVPFFGIKDQG--------LGGYLKSYVEPTVIML----PFNIISEISRTLALAVRLFGNMMSGAMIIGILLTITPFIF---PIVMTA-----------------LGLLTGMVQAYIFSILAAVYIAAAT 218
>gi|108744816|gb|ABG02559.1| ATPase subunit 6 [Fibulorhizoctonia sp. LA082103L] (238 aa)
Score = 104, Expect = 7.8e-03, Identities = 49/196 (25%), Positives = 86/196 (43%)
  Q:    61 PKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENP-TALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           P   +  + ++  +   +V E +GKE   + P+I++ F +I + N+I  + +    T+   V+  L     +G  ILG+   K  FF  F+        +G  + +        +   I    S+ +RL++NI AG  +L +       +F     +L     +I F LF       L+  V  IQA+VF +L L Y
  S:    52 PSNWSLLLESIFASINAMVREQLGKEM--YLPFIYSTFIFILVSNLIGNIPYSFAITSSIVVSIGLSFTLVIGVTILGLSIHKVHFFSFFI-------PAGTPLALVPLLVLIELISYIARAFSLGIRLFSNITAGHTLLKILSTFLYQLF--SGGLLVAVVTLIPFGLFLAIIG--LELAVSFIQAYVFTLLLLSY 235
>gi|158312872|ref|YP_001505380.1| F0F1 ATP synthase subunit A [Frankia sp. EAN1pec] >gi|158108277|gb|ABW10474.1| ATP synthase F0, A subunit [Frankia sp. EAN1pec] (295 aa)
Score = 104, Expect = 7.9e-03, Identities = 47/179 (26%), Positives = 91/179 (50%)
  Q:    82 IMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTI------ILGIKYQKSSFFYKFLF------KFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLF-----YALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGS 260
           ++G+    F+PY+  +FC+I + N+++V+    P A    T  + L   L  +      I+GI+   +  ++K +         ++K      ++ P  F    ++ +I    ++++RL+AN+ AG ++L +F     Y LP   F      L  G   I  +LF +        ++  +QA++F VLT  Y  G+
  S:    90 VIGERGRTFSPYLTILFCFILVSNVMAVI----PVAQFPTTSRIALPMILAAVSWFIFNIVGIREHGAGTYFKDMLVPAPTAPLFVKV-----ILAPIEF----VSTMIARPATLAIRLFANMFAGHMLLLVFALGADYLLPKPQFVFG---LVSGLMAIALTLFEL--------MIDVLQAYIFTVLTAAYIGGA 261
>gi|91206105|ref|YP_538460.1| F0F1 ATP synthase subunit A [Rickettsia bellii RML369-C] >gi|123388082|sp|Q1RGZ3|ATP6_RICBR ATP synthase a chain (ATPase protein 6) >gi|91069649|gb|ABE05371.1| ATP synthase A chain [Rickettsia bellii RML369-C] (242 aa)
Score = 104, Expect = 8.0e-03, Identities = 54/222 (24%), Positives = 99/222 (44%)
  Q:    35 IVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWI----SISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFL---DWLVGSIQAFVFVVLTLCY 256
           +++  ++ L   Y  FS  +L P++        I+NL+     ++ + +G +  KF P IFT+F +I  CN+  ++ +    T+   +TFAL +   L   I+G       F   FL               P +  P  I   +  ++    S+SLRL AN+MAG ++L +  +  + +             +I      +P    L   +  V  +QA++F +L+  Y
  S:    33 MLLASVLALTYFYLAFSNPRLVPSRLQIS-GEIIYNLV---TDMLNQNVGSKGRKFVPVIFTLFVFILFCNLFGMIPYGFTVTSHIIITFALAILVFLMVTIVGFVKHGMHFLSLFL-----------PHGTPLWLAPLMIIIELFTYLARPASLSLRLAANMMAGHILLKVIASFVVTL-------------MIYLKFLPIPLMVILIGFEIFVAILQAYIFTILSCVY 234
>gi|115304389|ref|YP_762686.1| ATP synthase subunit 6 [Ustilago maydis] >gi|121929064|sp|Q0H8Y6|ATP6_USTMA ATP synthase subunit a precursor (ATPase protein 6) >gi|72256219|gb|AAZ67009.1| ATP synthase subunit 6 [Ustilago maydis] (254 aa)
Score = 104, Expect = 8.1e-03, Identities = 54/221 (24%), Positives = 103/221 (46%)
  Q:    36 VITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTL--GTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLF--YALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           ++T+ + L L     + K+L P++     +  + +   +   LV   +G     + P+I+++F +I + N+   V +   T  T++  ++GL  T+  G  ILG++  K  FF  F+        SG  + +     P  +   +    S+ +RL+AN+ AG +++ +   +  P+       +VL   P +I   +        L+  V  IQA+VF VLT  Y
  S:    40 ILTVYLVLALHIMGSNNKQLIPSR----WSIALESSFASVHGLVKSQIGAANEMYLPFIYSLFFFILIANLSGNVPY-GFTVATSIMVSIGLSMTIFIGVTILGLRLHKVHFFSFFV-------PSGTPLGLVPLLVPIELISYLARAFSLGVRLFANVTAGHVLMKILAGFLAPLFTSTFIISVLTVLPFIIFTGIIG------LEIAVSFIQAYVFCVLTCSY 246
>gi|117414258|gb|ABK34537.1| ATP synthase subunit 6 [Entyloma gaillardianum] (235 aa)
Score = 104, Expect = 8.5e-03, Identities = 55/221 (24%), Positives = 104/221 (47%)
  Q:    36 VITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGL--FTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGF-----LDWLVGSIQAFVFVVLTLCY 256
           +IT+ ++L   +   + K+L P++     +  + +   +   LV   +G     + P+I+++F ++   N+   + + + T +T++  +LGL     LG  ILG++  K  FF  F+        +G    +     P  I   +   +S+ +RL+AN++AG  +L +       MF            VI+  +  +PF  F     L+  V  IQA+VF +LT  Y
  S:    29 IITVYISLAFHFIANNNKQLVPSR----WSISLESSFASVHGLVKAQIGSSNEVYLPFIYSLFFFVLFANLSGNIPY-SFTVMTSMIASLGLSVMIFLGVTILGLQLHKLHFFSFFV-------PNGCPAALIPLLVPIEIISYLARAVSLGVRLFANMVAGHTLLKILSGFLAPMFTGG---------VIMAVITLIPFTVFVALIGLEIAVSFIQAYVFCILTASY 235
>gi|63025144|ref|YP_232809.1| ATP synthase F0 subunit 6 [Tethya actinia] >gi|37961478|gb|AAP59068.1| ATP synthase F0 subunit g [Tethya actinia] (244 aa)
Score = 104, Expect = 8.7e-03, Identities = 49/181 (27%), Positives = 81/181 (44%)
  Q:    76 KTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           ++ V+E +GK   K+ P+I  +F +I + NI+ +  +   PTA   +TF L L   +   ILG+   K  F         I    G  + +  F         ++  IS+ +RL+ANI AG L+  +       M  +   +L       +  +  + F   L+  V  IQA+VF +LT  Y
  S:    68 RSAVHENLGKLGQKYFPFILCLFLFIAILNILGLFPYVFTPTAHIIITFGLSLSIMIVVTILGLITFKLDF-------LSILMPGGIPLALAPFLVIIETLSYMIRAISLGVRLFANITAGHLLFVIISGFAFSMISKGFLILS------IIPIMILIFITLLEMAVAIIQAYVFSLLTTIY 236
>gi|73670554|ref|YP_306569.1| F0F1 ATP synthase subunit A [Methanosarcina barkeri str. Fusaro] >gi|72397716|gb|AAZ71989.1| H(+)-transporting ATP synthase, subunit A [Methanosarcina barkeri str. Fusaro] (229 aa)
Score = 104, Expect = 8.7e-03, Identities = 43/159 (27%), Positives = 75/159 (47%)
  Q:   103 LCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGST 261
           LC II   G+E PT   + T AL L   +   + GI+ Q  S         Y+KT +   +++     PF I   I   +++++RL+ NIM+G++I+ +   +   +F          P++++           L  LVG +QA++F VL   Y + +T
  S:    94 LCIIIP--GYEPPTGSLSTTAALALCVFVAVPLFGIEEQGVSN--------YLKTYTEPTIIML----PFNIISEISRTLALAIRLFGNIMSGSMIVAILLTITPFIF----------PDLMI----------VLGLLVGMVQAYIFSVLATVYIAAAT 218
>gi|71385908|gb|AAZ31253.1| ATPase subunit 6 [Cyphellostereum laeve] (238 aa)
Score = 104, Expect = 8.8e-03, Identities = 48/185 (25%), Positives = 88/185 (47%)
  Q:    72 LGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTT--LGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGF-----LDWLVGSIQAFVFVVLTLCY 256
             +  ++V E +G     + P+I+++F +I + N++  V + + T  T++  A+GL  T  +G  +LG+   K SFF  F+        SG  + +        +        S+ +RL+AN++AG  +L +       MF            +++F L  +PF  F     L+  V  IQ++VF +L   Y
  S:    60 FASVNSMVREQIGSLNEIYLPFIYSLFFFILIANLVGNVPY-SFTVTTSIIVAIGLSFTIFIGVTLLGLSIHKVSFFKYFI-------PSGTPLALVPLLVLIELVSYTARAFSLGIRLFANMVAGHTLLKILSTFLFKMF---------SAGLVIFVLTLIPFAIFMALIGLELAVSFIQSYVFCILVSSY 234
>gi|164421151|ref|YP_001648553.1| ATP synthase F0 subunit 6 [Chondrilla aff. nucula CHOND] >gi|158668112|gb|ABW76573.1| ATP synthase F0 subunit 6 [Chondrilla aff. nucula CHOND] (244 aa)
Score = 104, Expect = 9.0e-03, Identities = 44/181 (24%), Positives = 78/181 (43%)
  Q:    76 KTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           +++V + +G    K+ P++ ++F +I + N + +  +   PT    +TF L     +G  +LG+   K +F   F+        SG  +++            I   +S+ LRL AN+ AG L+  +       M               LF +  + F   L+  V  IQA+VF +LT  Y
  S:    68 RSVVRDNLGASGDKYFPFVISLFIFIAMLNTLGLFPYVFTPTVHIVITFGLSFSILIGVTLLGVLTFKWNFLSMFM-------PSGAPLVLAPLLVYIETLSYISRALSLGLRLAANLTAGHLLFAIMSGFTFNMLANGLIFTS------LFPVLIMLFVTILEMAVAVIQAYVFSLLTTIY 236
>gi|164420988|ref|YP_001648609.1| ATP synthase F0 subunit 6 [Halisarca dujardini] >gi|158668142|gb|ABW76601.1| ATP synthase F0 subunit 6 [Halisarca dujardini] (244 aa)
Score = 104, Expect = 9.1e-03, Identities = 45/182 (24%), Positives = 78/182 (42%)
  Q:    75 FKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
            +++V + +G    KF P++ ++F +I + N + +  +   PT    +TF L     +G  I+G+   K +F   F+        SG  +++            +   IS+ LRL AN+ AG L+  +       M               LF +  + F   L+  V  IQA+VF +LT  Y
  S:    67 LRSVVRDNLGASGDKFFPFVISLFIFIAMLNTLGLFPYVFTPTVHIVITFGLSFSILIGVTIMGVFTFKWNFLSMFM-------PSGAPLLLAPLLVYIETISYLSRAISLGLRLAANLTAGHLLFAIMSGFTFNMLANGLIFTS------LFPMLIMVFVTILEMAVAVIQAYVFSLLTTIY 236
>gi|117414250|gb|ABK34533.1| ATP synthase subunit 6 [Conidiosporomyces ayresii] (238 aa)
Score = 104, Expect = 9.2e-03, Identities = 47/167 (28%), Positives = 81/167 (48%)
  Q:    90 FTPYIFTVFCYIFLCNIISVV--GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           + P+I+++F +I   N+   V  GF  PT+   V+  L +   +G  ILG++  K  FF  F+        SG  + +     P  +   I    S+ +RL+AN+  G +++ +       +F    ++L     +I F++F +   G L+  V  IQA+VF VLT  Y
  S:    81 YLPFIYSLFFFILFANLSGNVPYGFTVPTS-AIVSLGLSVTIFIGVTILGLRLHKIHFFSFFV-------PSGTPLRLVPLLVPIELISYIARAFSLGIRLFANLTRGHILMKILSGFLATLFSN--SILVAIITIIPFAVF-LGITG-LEVAVSFIQAYVFCVLTSSY 237
>gi|171742077|ref|ZP_02917884.1| hypothetical protein BIFDEN_01182 [Bifidobacterium dentium ATCC 27678] >gi|171277691|gb|EDT45352.1| hypothetical protein BIFDEN_01182 [Bifidobacterium dentium ATCC 27678] (269 aa)
Score = 104, Expect = 9.3e-03, Identities = 64/233 (27%), Positives = 109/233 (46%)
  Q:    24 PFEYRSEITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGK-EFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFAL--GLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITD--IIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           PF     I   I+ T+IM LVL     S  KL P +    + + I  +      +VY++MG+    ++ P I TVFC + + N+  ++   N  A  ++T  L   ++      I GI+ +    F +   + + K   G    I    +P  + +  II P+ S+++RL+AN+++G LIL L   L    F     V +      + +  A  F    + LV  +QA++F +LT  Y
  S:    35 PFAINRIILVRILATVIMMLVL-GITASRAKLIPGRWQGAVEWLIEFVR---DNIVYQVMGELRGKRYVPMITTVFCTLLIFNLCGIIPGFNIAASASITLPLVFAMWCFCQYWIAGIREKGLGHFLRD--EIFPK---GVPAPIYILLSPIQLLELLIIRPF-SLTIRLFANMVSGHLILAL--CLSATQFFLIDVVNKLMMPFGIITFAAGMFMFLFEALVACLQAYIFAILTTAY 260
>gi|158520647|ref|YP_001528517.1| ATP synthase F0, A subunit [Desulfococcus oleovorans Hxd3] >gi|158509473|gb|ABW66440.1| ATP synthase F0, A subunit [Desulfococcus oleovorans Hxd3] (229 aa)
Score = 104, Expect = 9.4e-03, Identities = 49/202 (24%), Positives = 84/202 (41%)
  Q:    61 PKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVV-GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTE 262
           P  +  F+  L+   +  +  + G+E   F P   T+  +I + N+I +V GF  PTA      A  +   + T  +GIKY    +   FL   +         + P  F P  I   +   +S++ RL+ N+M    +L + + L    F   P +                    L   V  +QAFVF +L++ Y++G+ E
  S:    52 PTKMQNFLEVLISGIEEFMVSVTGEEGRWFFPLAGTIAIFIAVSNLIGLVPGFFPPTASINTPLACAIVVFVFTHFIGIKYHGPKYIKHFLGPVWW--------LAPLIF-PIEIIGHLARVLSLTFRLFGNMMGHESVLVILFMLGGAFFAPLPIMA-------------------LGIFVAFVQAFVFFLLSVMYFAGAME 226
>gi|51473316|ref|YP_067073.1| F0F1 ATP synthase subunit A [Rickettsia typhi str. Wilmington] >gi|81390263|sp|Q68XQ1|APT6_RICTY ATP synthase a chain (ATPase protein 6) >gi|51459628|gb|AAU03591.1| H(+)-transporting two-sector ATPase F(0) A subunit; ATP synthase.; Chloroplast ATPase.; F(0)F(1)-ATPase.; F(1)-ATPase.; H(+)-transporting ATP synthase.; H(+)-transporting ATPase.; Mitochondrial ATPase. [Rickettsia typhi str. Wilmington] (242 aa)
Score = 104, Expect = 9.7e-03, Identities = 57/224 (25%), Positives = 103/224 (45%)
  Q:    33 SIIVITIIMTLVLVYY--NFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLF--YALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           S I + +  TL L Y+   F  +KL P++     A  ++N +         I G++FI   P +F++F +I  CN++ +  +    T+   VTF L L   L   I+G      SF   FL         G  V +        +   +   +S+SLRL AN+MAG ++L +   + + ++++ +      P P +++   F +         V  +QA++F +L+  Y
  S:    29 SSIYMLLASTLALTYFYLAFYNRKLIPSRLQVS-AEIVYNFVVDMLNQNIGIKGRKFI---PLVFSLFIFILFCNLLGMTPYSFTATSHIIVTFTLALLIFLTVTIVGFIKHGMSFLTLFL-------PQGTPVWLAPLMIVIELFTYLAKPVSLSLRLAANMMAGHVLLKVIAGFTVSLMIYLK----FLPIPLIVILIGFEI--------FVAILQAYIFTILSCMY 234
>gi|67458422|ref|YP_246046.1| F0F1 ATP synthase subunit A [Rickettsia felis URRWXCal2] >gi|75537105|sp|Q4UNH7|ATP6_RICFE ATP synthase a chain (ATPase protein 6) >gi|67003955|gb|AAY60881.1| ATP synthase A chain [Rickettsia felis URRWXCal2] (242 aa)
Score = 104, Expect = 9.8e-03, Identities = 51/222 (22%), Positives = 103/222 (46%)
  Q:    35 IVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLF--YALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           +++  I+ L   Y  F  +KL P++     A  ++NL+     ++ + +G +  KF P +F++F +I  CN++ +  +    T+   VTF L +   L   I+G       F   FL         G  + +        +   +   +S+SLRL AN+MAG ++L +   + + ++++ +      P P +++   F +         V  +QA++F +L+  Y
  S:    33 MLLASILALTYFYLAFYNRKLVPSRLQVS-AEIVYNLVA---DMLNQNIGVKGRKFIPLVFSLFIFILFCNLLGMTPYSFTATSHIIVTFTLAILVFLTVTIVGFVKHGLRFLTLFL-------PHGTPLWLAPLMIVIELFTYLARPVSLSLRLAANMMAGHVLLKVIAGFTVSLMIYLK----FLPIPLMVILIGFEI--------FVAILQAYIFTILSCMY 234
>gi|115531589|ref|YP_783951.1| ATP synthase F0 subunit 6 [Aurelia aurita] >gi|110226016|gb|ABG56248.1| ATP synthase F0 subunit 6 [Aurelia aurita] (234 aa)
Score = 104, Expect = 1.0e-02, Identities = 54/220 (24%), Positives = 95/220 (43%)
  Q:    37 ITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTAL-TTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           + +I++++ +   F++ KL P +    I      +   +  LV + +G +  K+ P++F++F  I   N++ +  +         VTF L L   +   ILGIK  K+ FF   +         G  + +            +   IS+ +RL AN+ AG L+  +  +    M   D  +L   P  I+       F   L+  V  IQA+VF +LT  Y
  S:    23 LMLILSIIFIIGFFNVNKLIPGRWQSIIEI----VYDHWIVLVKDSLGVKGSKYFPFVFSLFLLIAWLNVLGLFPYVFTVGTHIIVTFGLSLSILIIVTILGIKNFKADFFSMLM-------PQGAPMGLAPLLVLIETASYLSRAISLGVRLAANLSAGHLLFAILASFAYQMLVGDLVLLSIFPIAIMV------FITILEIAVAMIQAYVFCLLTTIY 226
>gi|84796246|gb|ABC66209.1| ATP synthase subunit 6 [Ceratobasidium sp. AG-P] (230 aa)
Score = 103, Expect = 1.0e-02, Identities = 43/175 (24%), Positives = 85/175 (48%)
  Q:    36 VITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTL--GTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMF 210
           ++ + +TL L + + + +KL P+K     +  + +   +  T+V + +G     + P+I+++F +I + N+   V + N T  T++  +LGL  T+  G  IL +   K  FF  F+        SG  + +        +   +   +S+ +RL+ANIMAG  ++ +       MF
  S:    30 IVLLFLTLGLHFVSSNNRKLVPSK----WSIALESSFASINTMVRDQIGTANEVYLPFIYSLFFFIIIANLTGNVPY-NYTITTSIVVSLGLSVTIFIGVTILALSIHKVRFFSFFI-------PSGTPLALVPLLVLIELISYLARAVSLGVRLFANIMAGHTLMKILSTFLFQMF 194
>gi|114769964|ref|ZP_01447574.1| F0F1 ATP synthase subunit A [alpha proteobacterium HTCC2255] >gi|114549669|gb|EAU52551.1| F0F1 ATP synthase subunit A [alpha proteobacterium HTCC2255] (249 aa)
Score = 103, Expect = 1.0e-02, Identities = 61/227 (26%), Positives = 102/227 (44%)
  Q:    37 ITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTT-----VTFALGLFTTLGTIILGIKYQKSSFFYKFLFK---FYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEP 263
           +T++    L+    S + + PN+  + I    +   G    ++ ++ GK+ +K+ P+I T+F +I   N + ++    P A TT     VT  L +   L   ILG      SFF  F        ++       +I YF  P          +S S+RL  N+MAG  ++ +F A   V+       + P      F++ A+     L+ LV  IQA+VF +LT  Y   +  P
  S:    43 LTVLAVFALLVLGTSRRAMVPNRV-QSIGELAY---GFIYRMIEDVAGKDGVKYFPHIMTLFMFIVFSNFLGLL----PMAFTTTSHIAVTGVLAMGVFLSVTILGFVKHGFSFFGLFWISSAPLILRPILALIEIISYFVRP----------LSHSIRLAGNMMAGHAVIKVFAAFAAVL------AISP------FAIIAITAIYALEVLVAFIQAYVFAILTCVYLKDALHP 247
>gi|194333722|ref|YP_002015582.1| alternate F1F0 ATPase, F0 subunit A [Prosthecochloris aestuarii DSM 271] >gi|194311540|gb|ACF45935.1| alternate F1F0 ATPase, F0 subunit A [Prosthecochloris aestuarii DSM 271] (223 aa)
Score = 103, Expect = 1.0e-02, Identities = 44/188 (23%), Positives = 88/188 (46%)
  Q:    79 VYEIMGKEFIKFTPYIFTVFCYIFLCNIISVV-GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFN-PFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEEE 266
           + EI  ++  K+  Y+ T+F ++    + +++ G+E PT   + T AL L   +   + GI+        +  F  Y+K+      M P F   PF I       +++++RL+ N+M+G +I+G+   +  + F             +L S+  +        L G +QA++F +L   Y + +T+  +E
  S:    67 IREIGLRQPEKYLSYLATLFLFVATAVLFTIIPGYEPPTGSLSTTAALALSVFVAVPLYGIE--------RVGFGAYLKS-----YMKPTFIMLPFNIISEFSRTLALAVRLFGNMMSGVMIIGILLGIAPLFFP------------VLMSVLGL--------LTGMVQAYIFSMLATVYIAAATKSRDE 223
>gi|71385922|gb|AAZ31255.1| ATPase subunit 6 [Clavulinopsis laeticolor] (244 aa)
Score = 103, Expect = 1.1e-02, Identities = 48/196 (24%), Positives = 87/196 (44%)
  Q:    61 PKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENP-TALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGF-----LDWLVGSIQAFVFVVLTLCY 256
           P   + F+ +L  +  ++V E +G     + P+I+++F ++   N+I  + +    T    V  +L     +G  ILG+   K +FF  F+        SG  +++    +       +   +S+ +RL+AN+ AG  +L +       MF            +I+F    +PF  F     L+  V  IQ FVF +L   Y
  S:    55 PSKWSIFLESLFSSINSMVREQIGSSNEIYLPFIYSLFFFVLFANLIGNIPYSFVITTSAIVCLSLSFTIFIGVTILGLSIHKINFFSFFV-------PSGCPLVLVPMLSIIEFISYLARSVSLGVRLFANMFAGHSLLKILSTFLYQMF---------SSSIIMFIFTLLPFSIFVALCGLEIAVSFIQTFVFCLLVSSY 240
>gi|42520301|ref|NP_966216.1| F0F1 ATP synthase subunit A [Wolbachia endosymbiont of Drosophila melanogaster] >gi|42410039|gb|AAS14150.1| ATP synthase F0, A subunit [Wolbachia endosymbiont of Drosophila melanogaster] (241 aa)
Score = 103, Expect = 1.1e-02, Identities = 50/179 (27%), Positives = 85/179 (47%)
  Q:    84 GKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTE 262
           G + ++  P IFTVF +I  CN++ V+ +    T+   VTFAL +   +   I+G K ++  F    L K      +   ++I  F        ++ P +S+S+RL AN++AG  I+ +     + M         P P      LF +   GF +  V  +QA++F +LT  Y S + +
  S:    79 GSKGLQHIPLIFTVFIFILSCNLVGVLPYSFTVTSHVIVTFALSMVVFIYITIVGFKEREVEFLRILLPKGTPSWLAPIIIIIKLF------AYLVRP-VSLSIRLAANMIAGHTIIKVIAGFIVNM----NIFFTPAP-----FLFIIALIGF-EVFVAILQAYIFTILTCVYLSDAVK 241
>gi|88608811|ref|YP_506283.1| F0F1 ATP synthase subunit A [Neorickettsia sennetsu str. Miyayama] >gi|88600980|gb|ABD46448.1| ATP synthase F0, A subunit [Neorickettsia sennetsu str. Miyayama] (243 aa)
Score = 103, Expect = 1.1e-02, Identities = 48/177 (27%), Positives = 78/177 (44%)
  Q:    84 GKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTT---VTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGS 260
           GK    + P I +VF Y+   N++ ++       +T+   VT AL +   +   ++G+K Q   FF  FL         G    I        +   +   IS+++RL AN++AG  IL +            PT L   P   LF +  + F  F    +  +QA++FV+LT  Y + S
  S:    77 GKAGSDYFPLILSVFLYVLFANLVGMLPLPMSFTVTSHIVVTLALAMVVFIFVTLIGLKKQGMGFFAMFL-------PDGTPNWIAPLMIFLEVCTYLFRPISLAIRLTANMIAGHTILKVIAGFVY------PTSLLISPLSFLFVVVLIVFEVF----IAMLQAYIFVMLTCVYLNDS 239
>gi|67157243|ref|ZP_00418545.1| H+-transporting two-sector ATPase, A subunit [Azotobacter vinelandii AvOP] >gi|67085510|gb|EAM04983.1| H+-transporting two-sector ATPase, A subunit [Azotobacter vinelandii AvOP] (231 aa)
Score = 103, Expect = 1.1e-02, Identities = 43/163 (26%), Positives = 72/163 (44%)
  Q:    94 IFTVFCYIFLCNIISVV-GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           I ++F +I   N   ++ G E PTA      AL L   + +I  G+  +  + + +            + VMIP       I + +    S+S+RL+ NIM+G  +LG+  +L  +                   L  +PF   LD L G+IQA++F VL + +
  S:    83 IGSLFLFILAANWAELIPGIEPPTASLETDAALALIVFVASIACGVASRGPAGYLRTF-------AEPSWVMIP-----LNIVEQLTRTFSLSVRLFGNIMSGVFVLGIALSLAGL-------------------LVPIPFMA-LDLLTGAIQAYIFSVLAMVF 214
>gi|71385880|gb|AAZ31249.1| ATPase subunit 6 [Cantharellus cinnabarinus] (244 aa)
Score = 103, Expect = 1.1e-02, Identities = 47/168 (27%), Positives = 82/168 (48%)
  Q:    89 KFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTT--LGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGF-----LDWLVGSIQAFVFVVLTLCY 256
           ++ P+I+++F +I + N++S V + N    T++  +LGL  T  +G  ILG+   +  FF  F+        SG   ++            +    S+ +RL+AN++AG  +L +   L   +F            VI F L  +PF  F     L+  V  IQ++V+ +LT  Y
  S:    83 QYLPFIYSLFFFILISNLVSNVPY-NYALTTSLIVSLGLSITIWIGVTILGLYKHRVHFFSFFI-------PSGTPGILVPLLVLIEFISYVARAFSLGVRLFANLVAGHTLLKILSGLLTKLFTSG---------VIFFILTLIPFSIFVALCGLEIAVSIIQSYVWCILTCSY 240
>gi|154687802|ref|YP_001422963.1| F0F1 ATP synthase subunit A [Bacillus amyloliquefaciens FZB42] >gi|154353653|gb|ABS75732.1| AtpB [Bacillus amyloliquefaciens FZB42] (244 aa)
Score = 103, Expect = 1.1e-02, Identities = 63/228 (27%), Positives = 107/228 (46%)
  Q:    31 ITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAF------FIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISV-----VGFE----NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWS 258
           +T+I++IT+   +VL+    + + L   +P K   F      F+ N++G+   L      K    F     T+  YIF+ N++ +     VG E    +PTA   +T  L +     T   G+K +      K   K Y++        +P  F P  I +     +++ LRL+ NI AG ++LGL   L    +     +   G    +  + A  +  F    +G+IQAF+F +LT+ Y S
  S:    17 LTNILMITVASVIVLLIAILTTRTLSI-RPGKAQNFMEWIVDFVRNIIGSTMDL------KTGANFLALGVTLLMYIFVSNMLGLPFSVTVGHELWWKSPTADPAITLTLAVMVVSLTHYYGVKMKG----LKEYSKDYLRP-------VPLMF-PMKIIEEFANTLTLGLRLYGNIFAGEILLGLLANLATNFYSNSFFLGLVGTVGAIIPMLA--WQAF-SLFIGTIQAFIFTMLTMVYMS 237
>gi|154488038|ref|ZP_02029155.1| hypothetical protein BIFADO_01607 [Bifidobacterium adolescentis L2-32] >gi|154083511|gb|EDN82556.1| hypothetical protein BIFADO_01607 [Bifidobacterium adolescentis L2-32] (269 aa)
Score = 103, Expect = 1.1e-02, Identities = 64/233 (27%), Positives = 109/233 (46%)
  Q:    24 PFEYRSEITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGK-EFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFAL--GLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITD--IIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           PF     I   I+ T+IM LVL     S  KL P +    + + I  +      +VY++MG+    ++ P I TVFC + + N+  ++   N  A  ++T  L   ++      I GI+ +    F +   + + K   G    I    +P  + +  II P+ S+++RL+AN+++G LIL L   L    F     V +      + +  A  F    + LV  +QA++F +LT  Y
  S:    35 PFAINRIILVRILATVIMLLVL-GITASRAKLIPGRWQGAVEWLIEFVR---DNIVYQVMGELRGKRYVPMITTVFCTLLVFNLCGIIPGFNIAASASITLPLVFAMWCFCQYWIAGIREKGLGHFLRD--EIFPK---GVPAPIYILLSPIQLLELLIIRPF-SLTIRLFANMVSGHLILAL--CLSATQFFLVDVVNKVMMPFGIITFAAGMFMFLFEALVACLQAYIFAILTTAY 260
>gi|194337851|ref|YP_002019645.1| ATP synthase F0, A subunit [Pelodictyon phaeoclathratiforme BU-1] >gi|194310328|gb|ACF45028.1| ATP synthase F0, A subunit [Pelodictyon phaeoclathratiforme BU-1] (340 aa)
Score = 103, Expect = 1.1e-02, Identities = 47/218 (21%), Positives = 95/218 (43%)
  Q:    36 VITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEI-MGKEFIKFTPYIFTVFCYIFLCNIISVVGF-ENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGF---LDWLVGSIQAFVFVVLT 253
           V++ I+ ++        KK+   + P G+   +  L+   +  V +  +G  + K+  Y+ TVF ++ LCN++ +V +    T    VT  L  FT   T +  +K      +   L         G    +     P     +    +++++RL+AN+ AG +++     +  ++              I+  + +VPF  F   L+  V  +QAF+F +L+
  S:   113 VVSAILLILFSLVGSKYKKMTARQAPTGLVNAMEALVEFIRIDVAKANIGVGYEKYLNYLLTVFFFVLLCNLLGLVPYGATATGNINVTLTLATFTFFITQVAALKAHGIKGYLAHL-------TGGTHPALWIIMIPIEFIGLFTKPVALTIRLFANMTAGHIVILSLIFISFIL-----------QSYIVAVVMSVPFSIFIYLLELFVAFLQAFIFTMLS 317
>gi|126022815|ref|NP_050832.2| ATP synthase CF0 A subunit [Nephroselmis olivacea] (236 aa)
Score = 103, Expect = 1.1e-02, Identities = 54/196 (27%), Positives = 91/196 (46%)
  Q:    61 PKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCN---------IISVVGFE--NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYAL-PMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           P+G   F+  +L   + L    +G E  K+ PY+ T+F +IF+ N         +I +   E   PTA    T AL L T+      G+  +   +F K+L            +++P       + D   P +S+S RL+ N++A  L++ +  +L P+V+         P P ++L  LFA           G+IQ+ +F  L   Y
  S:    55 PEGGQNFLEYVLEFIRDLAKTQIGHESRKWVPYLGTLFLFIFVSNWSGALVPWRLIELPNGELGAPTADINTTVALALMTSTAYFYAGLTKKGFGYFSKYL--------KPTPILLPINI----LEDFTKP-LSLSFRLFGNVLADELVVAVLISLVPLVV---------PIP-MMLLGLFA-----------GAIQSLIFATLAGAY 228
>gi|119026451|ref|YP_910296.1| F0F1 ATP synthase subunit A [Bifidobacterium adolescentis ATCC 15703] >gi|118766035|dbj|BAF40214.1| ATP synthase A chain [Bifidobacterium adolescentis ATCC 15703] (269 aa)
Score = 103, Expect = 1.2e-02, Identities = 64/233 (27%), Positives = 109/233 (46%)
  Q:    24 PFEYRSEITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGK-EFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFAL--GLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITD--IIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           PF     I   I+ T+IM LVL     S  KL P +    + + I  +      +VY++MG+    ++ P I TVFC + + N+  ++   N  A  ++T  L   ++      I GI+ +    F +   + + K   G    I    +P  + +  II P+ S+++RL+AN+++G LIL L  +            L     +I F+  A  F    + LV  +QA++F +LT  Y
  S:    35 PFAINRIILVRILATVIMLLVL-GITASRAKLIPGRWQGAVEWLIEFVR---DNIVYQVMGELRGKRYVPMITTVFCTLLVFNLCGIIPGFNIAASASITLPLVFAMWCFCQYWIAGIREKGLGHFLRD--EIFPK---GVPAPIYILLSPIQLLELLIIRPF-SLTIRLFANMVSGHLILALCLSATQFFLVDVVNKLMMPFGIITFA--AGMFMFLFEALVACLQAYIFAILTTAY 260
>gi|59797898|sp|Q9TL13|ATPI_NEPOL Chloroplast ATP synthase a chain precursor (ATPase subunit IV) >gi|5880710|gb|AAD54803.1|AF137379_26 CF0 subunit IV of ATP synthase [Nephroselmis olivacea] (239 aa)
Score = 103, Expect = 1.2e-02, Identities = 54/196 (27%), Positives = 91/196 (46%)
  Q:    61 PKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCN---------IISVVGFE--NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYAL-PMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           P+G   F+  +L   + L    +G E  K+ PY+ T+F +IF+ N         +I +   E   PTA    T AL L T+      G+  +   +F K+L            +++P       + D   P +S+S RL+ N++A  L++ +  +L P+V+         P P ++L  LFA           G+IQ+ +F  L   Y
  S:    58 PEGGQNFLEYVLEFIRDLAKTQIGHESRKWVPYLGTLFLFIFVSNWSGALVPWRLIELPNGELGAPTADINTTVALALMTSTAYFYAGLTKKGFGYFSKYL--------KPTPILLPINI----LEDFTKP-LSLSFRLFGNVLADELVVAVLISLVPLVV---------PIP-MMLLGLFA-----------GAIQSLIFATLAGAY 231
>gi|34581012|ref|ZP_00142492.1| ATP synthase A chain [Rickettsia sibirica 246] >gi|28262397|gb|EAA25901.1| ATP synthase A chain [Rickettsia sibirica 246] (242 aa)
Score = 103, Expect = 1.2e-02, Identities = 51/222 (22%), Positives = 104/222 (46%)
  Q:    35 IVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLF--YALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           +++  I+ L   Y  F  +KL P++     A  ++NL+     ++ + +G +  KF P +F++F +I  CN++ ++ +    T+   VTF L +   L   I+G       F   FL         G  + +        +   +   +S+SLRL AN+MAG ++L +   + + ++++ +      P P +++   F +         V  +QA++F +L+  Y
  S:    33 MLLASILALTYFYLAFYNRKLVPSRLQVS-AEIVYNLVA---DMLNQNIGVKGRKFIPLVFSLFIFILFCNLLGMIPYSFTTTSHIIVTFTLAILVFLMVTIVGFVKHGLRFLTLFL-------PHGTPLWLAPLMIVIELFTYLARPVSLSLRLAANMMAGHVLLKVIAGFTVSLMIYLK----FLPIPIMVILIGFEI--------FVAILQAYIFTILSCMY 234
>gi|32034342|ref|ZP_00134542.1| COG0356: F0F1-type ATP synthase, subunit a [Actinobacillus pleuropneumoniae serovar 1 str. 4074] >gi|190150983|ref|YP_001969508.1| ATP synthase A chain [Actinobacillus pleuropneumoniae serovar 7 str. AP76] >gi|189916114|gb|ACE62366.1| ATP synthase A chain [Actinobacillus pleuropneumoniae serovar 7 str. AP76] (262 aa)
Score = 103, Expect = 1.2e-02, Identities = 50/167 (29%), Positives = 78/167 (46%)
  Q:    92 PYIFTVFCYIFLCNIISVV------------GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFH---GFLDWLVGSIQAFVFVVLTLCYWS 258
           P   T+FC++F+ N I +V            G     A+ T   +  L  ++    L + Y   S  +  L K Y      + V IP  F    +T +  P IS++ RL+ N+ AG LI    + L  VM+  D   L+            +P H        LV ++QAF+F++LT+ Y S
  S:    87 PLALTIFCWVFIMNAIDLVPVDFLPQLANMFGIHYLRAVPTADISATLGMSICVFFLILFYTVKSKGFGGLVKEYTLHPFNHWVFIPVNFILETVTLLAKP-ISLAFRLFGNMYAGELI----FILIAVMYMADNFALQA---------LGIPLHLVWAIFHILVITLQAFIFMMLTIVYLS 254
>gi|40806420|gb|AAR92136.1| ATP synthase subunit 6 [Candida orthopsilosis] (246 aa)
Score = 103, Expect = 1.2e-02, Identities = 56/232 (24%), Positives = 109/232 (46%)
  Q:    31 ITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE---NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTE 262
           IT+  +  II++L++V+Y+  ++         G++  +  +      LV   +G++   + P IFT+F +I + N+IS++ +    +   +  V+F+L L+  +G ++LG+      FF  F+        SG  + +                IS+ LRL ANI++G L++ +  +L + +          G    +  + AV     L++ +  IQA+VF +L   Y   S E
  S:    25 ITNYTLYLIIVSLIIVFYSSIIRHNFLGSSRWGVS--VIAIYDTILNLVNGQIGRKGGYYFPLIFTIFNFILIANLISMIPYSFAISAQLVAVVSFSLALW--IGNVVLGLYLHGWGFFALFV-------PSGTPLALVPVLVLLEALSYASRAISLGLRLGANILSGHLLMLILGSLIISLMSSSLLGFVSG----IIPILAVVAITILEFGIAIIQAYVFSILLSGYIKDSVE 244
>gi|85708927|ref|ZP_01039993.1| ATP synthase A chain [Erythrobacter sp. NAP1] >gi|85690461|gb|EAQ30464.1| ATP synthase A chain [Erythrobacter sp. NAP1] (261 aa)
Score = 103, Expect = 1.2e-02, Identities = 53/174 (30%), Positives = 84/174 (48%)
  Q:    83 MGKEFIKFTPYIFTVFCYIFLCNIISV----VGFENPTALT---TVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKV-MIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           +GKE  K+ PYIF++F +I   N++ +    + F +P   T   TVT  L + +    +I+G       FF  F+         G  + MIP  F P  +   ++   S++LRL+  +MAG ++L +  +  M            G  V L S   +     L+ LV  IQA+VF +LT  Y
  S:    83 IGKEGRKYLPYIFSLFMFILFGNLLGLLPIGLAFLHPFTFTSHFTVTGVLAVISFSIVLIVGFWKHGIKFFTLFV-------PHGTPLPMIPIIF-PIELISFLVRPFSLALRLFVAMMAGHVLLKVLSSFVMDGINAGVGF---GLLVSLPSFLLMIGISALEILVAGIQAYVFALLTSLY 253
>gi|117414280|gb|ABK34548.1| ATP synthase subunit 6 [Sporisorium sorghi] (235 aa)
Score = 103, Expect = 1.3e-02, Identities = 54/221 (24%), Positives = 103/221 (46%)
  Q:    36 VITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTL--GTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLF--YALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           ++T+ + L L     + K+L P++     +  + +   +   LV   +G     + P+I+++F +I + N+   V +   T  T++  ++GL  T+  G  ILG++  K  FF  F+        SG  + +     P  +   +    S+ +RL+AN+ AG +++ +   +  P+       +VL   P +I   +        L+  V  IQA+VF VLT  Y
  S:    29 ILTVYLVLALHIMGSNNKQLIPSR----WSIALESSFASVHGLVKSQIGAANEMYLPFIYSLFFFILIANLSGNVPY-GFTVATSIMVSIGLSMTIFIGVTILGLRLHKVHFFSFFV-------PSGTPLGLVPLLVPIELISYLARAFSLGVRLFANVTAGHVLMKILAGFLAPLFTSTFIVSVLTVLPFIIFTGIIG------LEIAVSFIQAYVFCVLTCSY 235
>gi|68536426|ref|YP_251131.1| F0F1 ATP synthase subunit A [Corynebacterium jeikeium K411] >gi|68264025|emb|CAI37513.1| ATP synthase A chain [Corynebacterium jeikeium K411] (287 aa)
Score = 103, Expect = 1.3e-02, Identities = 58/232 (25%), Positives = 111/232 (47%)
  Q:    34 IIVITIIMTLVL-VYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYE-IMGK-EFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTV--TFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTK---SGNKVMIPYFFNPF-GITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEE 265
           ++VI I+M L++  ++ F+M+K  P   P G+       L   +  + E I+GK E  +F P I  +F  +   N+ +++ F N +A   V     L +   +  I  G+K        ++ F  YIK+     G    + +   P    +  ++  +++++RL AN++AG +IL + ++     F +           ILF++    F    + +V  +QA++F +LT  Y   S   +E
  S:    60 LMVIRIVMILLVSAFFFFAMRK--PKLIPSGVQNVAEYFLDFVRIHIAEDILGKKEGRRFLPIIAAIFFTVLAVNMSTIIPFMNISASARVGLPLVLAVVAYIAFIYAGVK--------RYGFGKYIKSSLIIPGLPSWLHFIVAPIEAFSTFVLRPVTLTIRLMANMLAGHIILVMLFSATNFFFWQMSGWTAAAGGTILFAIAFTLF----ELMVIFLQAYIFSLLTAVYIELSLHADE 286
>gi|109898983|ref|YP_662238.1| F0F1 ATP synthase subunit A [Pseudoalteromonas atlantica T6c] >gi|109701264|gb|ABG41184.1| ATP synthase F0, A subunit [Pseudoalteromonas atlantica T6c] (239 aa)
Score = 103, Expect = 1.3e-02, Identities = 46/191 (24%), Positives = 85/191 (44%)
  Q:    90 FTPYIFTVFCYIFLCNIISVV-GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY-WSGSTEPEEESQVKKIKKKSPLSE 280
           +  ++ T+F +I + N++++V GFE PT   + T AL     +     GIK +      ++L  +   T          F  PF I   +   +++++RL+ N+M+GA+IL +   +   +F   P ++                   L  L G +QA++F VL   Y  + S    ++S   +  K +P  E
  S:    78 YMGFLGTLFLFIAMSNLLTMVPGFEPPTGSLSTTIALAACVFVSVPYYGIKNRG---IKRYLLSYTQPTP---------FMLPFNIIGELSRTLALAVRLFGNMMSGAMILAILLVISPFIF---PVIMS-----------------VLGLLTGMVQAYIFFVLASVYIGAASVVNNQQSLTLRSPKSNPTKE 238
>gi|157964088|ref|YP_001498912.1| F0F1 ATP synthase subunit A [Rickettsia massiliae MTU5] >gi|157843864|gb|ABV84365.1| ATP synthase A chain [Rickettsia massiliae MTU5] (248 aa)
Score = 102, Expect = 1.3e-02, Identities = 51/222 (22%), Positives = 97/222 (43%)
  Q:    35 IVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFL---DWLVGSIQAFVFVVLTLCY 256
           +++  I+ L   Y  F  +KL P++     A  ++NL+     ++ + +G +  KF P +F++F +I  CN++ +  +    T+   VTF L +   L   I+G       F   FL         G  + +        +   +   +S+SLRL AN+MAG ++L +     + +             +I      +P    L   +  V  +QA++F +L+  Y
  S:    39 MLLASILALTYFYLAFYNRKLVPSRLQVS-AEIVYNLVA---DMLNQNIGVKGRKFIPLVFSLFIFILFCNLLGMTPYSFTTTSHIIVTFTLAILVFLTVTIVGFVKHGLRFLTLFL-------PHGTPLWLAPLMIVIELFTYLARPVSLSLRLAANMMAGHVLLKVIAGFTVSL-------------MIYLKFLPIPLMMILIGFEIFVAILQAYIFTILSCMY 240
>gi|150406458|ref|YP_001315114.1| ATP synthase F0 subunit 6 [Chlorokybus atmophyticus] >gi|126507695|gb|ABO15092.1| ATP synthase F0 subunit 6 [Chlorokybus atmophyticus] (251 aa)
Score = 102, Expect = 1.3e-02, Identities = 47/180 (26%), Positives = 84/180 (46%)
  Q:    81 EIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPW----ISISLRLWANIMAGALILGLF--YALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGS 260
           +I G   +KF P IF  F ++  CN+I ++ +    T+   +T  L L   +G  I+G +     FF   L K            +P    P  +   ++ +    +S+ +RL+AN+MAG  ++ +   +A  M+       +    P +I+F+L        L+  V  +QA+VF +L   Y + S
  S:    78 QISGNRGLKFFPLIFVTFTFLLFCNLIGMIPYSFTVTSHFVITSGLALSLFIGVTIVGFQTHGLHFFSFLLPK-----------GVPLALAPLVVVLELISYCFRALSLGIRLFANMMAGHTLVKILSGFAWTMLSMGGIMYIAHLAPLLIVFALTG------LEIGVAMLQAYVFTILICIYLNDS 247
>gi|87311756|ref|ZP_01093871.1| ATP synthase F0, A subunit [Blastopirellula marina DSM 3645] >gi|87285540|gb|EAQ77459.1| ATP synthase F0, A subunit [Blastopirellula marina DSM 3645] (397 aa)
Score = 102, Expect = 1.3e-02, Identities = 60/226 (26%), Positives = 108/226 (47%)
  Q:    36 VITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFI-----KFTPYIFTVFCYIFLCNIISVVGFEN-PTALTTVTFALGLFT-TLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGST 261
           ++ I+M LV  +Y   +KK   +  PKG    + +LL AF   + E + +  I     KF P + T+F ++  CN++ ++ +   PTA  +VT +L   T  +G     +K+     +   +    +    G  + I  F     +  + +    + +RL AN++AG L+L    AL + M   +  +  P   +I+ S  AV F   L+  V  +QA++F  L+  +   ST
  S:   176 LVAIVMVLVFTWYASRLKK---SIVPKG---RVTHLLDAFVCYLREQVIRPGIGHGADKFVPVLLTMFFFVLGCNLLGMIPWLGAPTASFSVTLSLAFATLVIGMGAGALKFGPVGVWLNLIPHMDLPLIIGIPIKIMLFV--IELAGLFIKHAVLGVRLLANMVAGHLVLLGIVALGVEMSGWNLILTLP---IIVGS--AVLF-SCLELFVAFLQAYIFTFLSSLFIGAST 394
>gi|117414290|gb|ABK34553.1| ATP synthase subunit 6 [Ustilago striiformis] (237 aa)
Score = 102, Expect = 1.4e-02, Identities = 55/221 (24%), Positives = 101/221 (45%)
  Q:    36 VITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTL--GTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           ++T+ + L L     + K+L P++     +  + +   +   LV   +G     + P+I+++F +I + N+   V +   T  T++  ++GL  T+  G  ILG++  K  FF  F+        SG  + +     P  +   +    S+ +RL+AN +AG  +L +       MF      +     +I FS+F       L+  V  IQA+VF +LT  Y
  S:    30 ILTVYLVLALHIMGSNNKQLIPSR----WSISLESSFASVHGLVKSQIGAANEMYLPFIYSLFFFILIANLSGNVPY-GFTVATSIMVSIGLSMTIFIGVTILGLRLHKVHFFSFFV-------PSGTPLGLVPLLVPIELISYLARAFSLGVRLFANTVAGHTLLKILSGFLAPMFTSG--AITAVITLIPFSIFIALIG--LEIAVSFIQAYVFCILTASY 236
>gi|148284440|ref|YP_001248530.1| F0F1 ATP synthase subunit A [Orientia tsutsugamushi str. Boryong] >gi|146739879|emb|CAM79837.1| ATP synthase subunit A [Orientia tsutsugamushi Boryong] (242 aa)
Score = 102, Expect = 1.4e-02, Identities = 54/179 (30%), Positives = 86/179 (48%)
  Q:    78 LVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITD----IIMPWISISLRLWANIMAGALILGLF-YALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           LV+ I+G +   F P I T+F +I L NII +V      T+   VTF+L +     T++ GI   K  FF  FL K            IP +  P  +       I   IS+SLRL AN++AG ++L +  +++  + +   P  +     +I F LF           +  +QA++F +L+  Y
  S:    72 LVHSIIGPQGKVFFPLILTLFLFISLGNIIGMVPHAFTFTSHIIVTFSLAMIVFTTTLVYGIYRHKLGFFSLFLPK-----------NIPLWLAPIMVIIELCVFISKPISLSLRLTANMVAGHILLKIIAWSIVSLTWFFKPLPIALVIVLIGFELF-----------ISILQAYIFTILSCVY 234
>gi|117414268|gb|ABK34542.1| ATP synthase subunit 6 [Melanopsichium pennsylvanicum] (235 aa)
Score = 102, Expect = 1.4e-02, Identities = 49/179 (27%), Positives = 83/179 (46%)
  Q:    78 LVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTL--GTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           LV   +G     + P+I+++F +I + N+   V +   T  T++  ++GL  T+  G  ILG++  K  FF  F+        SG  + +     P  +   +    S+ +RL+AN +AG  +L +       MF      +     +I FS+F       L+  V  IQA+VF +LT  Y
  S:    67 LVKSQIGAANEMYLPFIYSLFFFILIANLSGNVPY-GFTVATSIMVSIGLSMTIFIGVTILGLRLHKVHFFSFFV-------PSGTPLGLVPLLVPIELISYLARAFSLGVRLFANTVAGHTLLKILSGFLAPMFTSG--AITAVITLIPFSIFIALIG--LEIAVSFIQAYVFCILTASY 235
>gi|58696898|ref|ZP_00372406.1| ATP synthase F0, A subunit [Wolbachia endosymbiont of Drosophila simulans] >gi|58698346|ref|ZP_00373261.1| ATP synthase F0, A subunit [Wolbachia endosymbiont of Drosophila ananassae] >gi|58535136|gb|EAL59220.1| ATP synthase F0, A subunit [Wolbachia endosymbiont of Drosophila ananassae] >gi|58536882|gb|EAL60076.1| ATP synthase F0, A subunit [Wolbachia endosymbiont of Drosophila simulans] (241 aa)
Score = 102, Expect = 1.4e-02, Identities = 50/179 (27%), Positives = 84/179 (46%)
  Q:    84 GKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTE 262
           G + ++  P IFTVF +I  CN++ V+ +    T+   VTFAL +   +   I+G K +   F    L K      +   ++I  F        ++ P +S+S+RL AN++AG  I+ +     + M         P P      LF +   GF +  V  +QA++F +LT  Y S + +
  S:    79 GSKGLQHIPLIFTVFIFILSCNLVGVLPYSFTVTSHVIVTFALSMVVFIYITIVGFKERGVEFLRILLPKGTPSWLAPIIIIIKLF------AYLVRP-VSLSIRLAANMIAGHTIIKVIAGFIVNM----NIFFTPAP-----FLFIIALIGF-EVFVAILQAYIFTILTCVYLSDAVK 241
>gi|126209116|ref|YP_001054341.1| F0F1 ATP synthase subunit A [Actinobacillus pleuropneumoniae L20] >gi|126097908|gb|ABN74736.1| ATP synthase A chain [Actinobacillus pleuropneumoniae L20] (262 aa)
Score = 102, Expect = 1.5e-02, Identities = 50/167 (29%), Positives = 78/167 (46%)
  Q:    92 PYIFTVFCYIFLCNIISVV------------GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFH---GFLDWLVGSIQAFVFVVLTLCYWS 258
           P   T+FC++F+ N I +V            G     A+ T   +  L  ++    L + Y   S  +  L K Y      + V IP  F    +T +  P IS++ RL+ N+ AG LI    + L  VM+  D   L+            +P H        LV ++QAF+F++LT+ Y S
  S:    87 PLALTIFCWVFIMNAIDLVPVDFLPQLANMFGIHYLRAVPTADISAPLGMSICVFFLILFYTVKSKGFGGLVKEYTLHPFNHWVFIPVNFILETVTLLAKP-ISLAFRLFGNMYAGELI----FILIAVMYMADNFALQA---------LGIPLHLVWAIFHILVITLQAFIFMMLTIVYLS 254
>gi|84796255|gb|ABC66211.1| ATP synthase subunit 6 [Ceratobasidium sp. CBS 137.82] (233 aa)
Score = 102, Expect = 1.5e-02, Identities = 50/197 (25%), Positives = 95/197 (48%)
  Q:    33 SIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTL--GTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLF 229
           SI  + + +TL L + + + +KL P+K     +  + +   +  T+V + +G     + P+I+++F +I + N+   V + N T  T++  +LGL  T+  G  IL +   K  FF  F+        SG  + +        +   +   +S+ +RL+ANIMAG  ++ +       MF    ++L     +I F+LF
  S:    28 SISTVLLFLTLGLHFVSSNNRKLVPSK----WSIALESSFASINTMVRDQIGTANEVYLPFIYSLFFFIIIANLSGNVPY-NYTITTSIVVSLGLSLTIFIGVTILALSIHKVRFFSFFI-------PSGTPLALVPLLVLIELISYLARAVSLGVRLFANIMAGHTLMKILSTFLFQMF--SSSILVSVITLIPFALF 212
>gi|117414284|gb|ABK34550.1| ATP synthase subunit 6 [Ustilago avenae] (236 aa)
Score = 102, Expect = 1.5e-02, Identities = 57/221 (25%), Positives = 103/221 (46%)
  Q:    36 VITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTL--GTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGF-----LDWLVGSIQAFVFVVLTLCY 256
           ++T+ + L L     + K+L P++     +  + +   + + LV   +G     + P+I+++F +I + N+   V +   T  T++  ++GL  T+  G  ILG++  K  FF  F+        SG  + +     P  +   +    S+ +RL+AN +AG  +L +       MF         G    L +L  +PF  F     L+  V  IQA+VF +LT  Y
  S:    30 ILTVYLVLALHIMGSNNKQLIPSR----WSISLESCFASVQGLVKSQIGGANEMYLPFIYSLFFFILIANLSGNVPY-GFTVATSIMVSIGLSMTIFIGVTILGLQLHKVHFFSFFV-------PSGTPLGLVPLLVPIELISYLARAFSLGVRLFANTVAGHTLLKILSGFLAPMF-------TSGAITALITL--IPFCIFIALIGLEISVSFIQAYVFCILTASY 236
>gi|110225672|ref|YP_665678.1| ATP synthase F0 subunit 6 [Nephroselmis olivacea] >gi|6066187|gb|AAF03205.1|AF110138_37 ATP synthase F0 subunit 6 [Nephroselmis olivacea] (250 aa)
Score = 102, Expect = 1.5e-02, Identities = 49/180 (27%), Positives = 84/180 (46%)
  Q:    77 TLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLF--YALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           +LV E +G +   + P IFTVF ++ + N+I ++ +    T+   VTF L L   +G  I+G +     FF  FL            + +        I       +S+ +RL+AN+MAG  ++ +   ++  M+       V    P +I+F+L       FL+  V  +QA+VF +L   Y
  S:    73 SLVDEQVGGKGQAYFPLIFTVFTFLLMANLIGMIPYSFTTTSHMVVTFGLSLSLFIGITIVGFQTHGLHFFSFFLPAGAP-------LALAPLLVVLEIVSYSFRAVSLGVRLFANMMAGHTLVKILAGFSWSMLSVGGLLAVASVIPFLIVFAL------TFLEIGVACLQAYVFTILLCIY 242
>gi|152965232|ref|YP_001361016.1| ATP synthase F0, A subunit [Kineococcus radiotolerans SRS30216] >gi|151359749|gb|ABS02752.1| ATP synthase F0, A subunit [Kineococcus radiotolerans SRS30216] (262 aa)
Score = 102, Expect = 1.5e-02, Identities = 49/183 (26%), Positives = 83/183 (45%)
  Q:    82 IMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFY--IKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLE-PGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPE 264
           I  K+F KF P +FT F  I + N+  V+       +  + F L L     TIIL + Y       K    ++  +      K ++P  F    ++ +++  ++I+LRL+ N+ AG LIL LF      MF      L+  G   I  +     F  F+++L    QA+V+ +L   + + +   E
  S:    85 IGSKDFRKFVPLLFTFFSVILVNNLFGVIPPIQYPTMGRIAFPLAL-----TIILYLVYHTVGIRKKGFAAYFAGVVPHGLPKPIVPLVFLLEVLSIVVIQPVTITLRLFGNMFAGHLILVLFITGAEYMFLHGGFGLKLVGVPTIAMAFVLTLFELFVEFL----QAYVYTMLAATFIASALADE 261
>gi|190571031|ref|YP_001975389.1| ATP synthase F0, A subunit [Wolbachia pipientis] >gi|190357303|emb|CAQ54731.1| ATP synthase F0, A subunit [Wolbachia pipientis] (241 aa)
Score = 102, Expect = 1.5e-02, Identities = 51/179 (28%), Positives = 83/179 (46%)
  Q:    84 GKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTE 262
           G + ++  P IFTVF +I  CN++ V+ +    T+   VTFAL +       I+G K +   F    L K      +   ++I  F        ++ P IS+S+RL AN++AG  I+ +     + M         P P      LF +   GF +  V  +QA++F +LT  Y S + +
  S:    79 GSKGLEHIPLIFTVFIFILSCNLVGVLPYSFTVTSHVIVTFALSMVVFTYITIVGFKERGVEFLRILLPKGTPSWLAPIIIIIKLF------AYLVRP-ISLSIRLAANMIAGHTIIKVIAGFVINM----NIFFTPAP-----FLFIIALIGF-EVFVAVLQAYIFTILTCVYLSDAVK 241
>gi|177670766|ref|ZP_02943856.1| ATP synthase F0, A subunit [Micrococcus luteus NCTC 2665] >gi|172072194|gb|EDT58231.1| ATP synthase F0, A subunit [Micrococcus luteus NCTC 2665] (266 aa)
Score = 102, Expect = 1.6e-02, Identities = 43/185 (23%), Positives = 88/185 (47%)
  Q:    81 EIMG-KEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEE 265
           +I+G K F ++ P +F +F ++ L N+   +        +    A GL   +  I +G+  ++    Y    K  +        ++P       I++ I+  ++ SLRL A +++G +I+ L  A    +  +  ++   G  +++  L +V  + FL+ L+  +QAFVF +LT  Y  G+ +  +
  S:    85 DILGEKNFKQWVPLLFAIFFFVLLNNLFGAIPVLQLPTFSHAGAAYGLALIVYAIWIGVGIKRHGVRY---LKLAVVPSGVPGWILPLLVPLEIISNFIVRPLTHSLRLMATMLSGHMIVMLAGAGAAYLITQTDSLALQGTGILVI-LGSVALY-FLELLIMYLQAFVFTLLTAIYIQGAIDAND 265
>gi|167471134|ref|ZP_02335838.1| F0F1 ATP synthase subunit A [Rickettsia africae ESF-5] (242 aa)
Score = 102, Expect = 1.6e-02, Identities = 52/222 (23%), Positives = 103/222 (46%)
  Q:    35 IVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLF--YALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           +++  I+ L   Y  F  +KL P++     A  ++NL+     ++ + +G +  KF P IF++F +I  CN++ +  +    T+   VTF L +   L   I+G       F   FL         G  + +        +   +   +S+SLRL AN+MAG ++L +   + + ++++ +      P P +++   F +         V  +QA++F +L+  Y
  S:    33 MLLASILALTYFYLAFYNRKLVPSRLQVS-AEIVYNLVA---DMLNQNIGVKGRKFIPLIFSLFIFILFCNLLGMTPYSFTTTSHIIVTFTLAILVFLMVTIVGFVKHGLRFLTLFL-------PHGTPLWLAPLMIVIELFTYLARPVSLSLRLAANMMAGHVLLKVIAGFTVSLMIYLK----FLPIPIMVILIGFEI--------FVAILQAYIFTILSCMY 234
>gi|117414274|gb|ABK34545.1| ATP synthase subunit 6 [Moesziomyces eriocauli] (235 aa)
Score = 102, Expect = 1.6e-02, Identities = 55/221 (24%), Positives = 101/221 (45%)
  Q:    36 VITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTL--GTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           ++T+ + L L     + K+L P++     +  + +   +   LV   +G     + P+I+++F +I + N+   V +   T  T++  ++GL  T+  G  ILG++  K  FF  F+        SG  + +     P  +   +    S+ +RL+AN +AG  +L +       MF      +     +I FS+F       L+  V  IQA+VF +LT  Y
  S:    29 ILTVYLVLALHIMGSNNKQLIPSR----WSISLESSFASVHGLVKSQIGAANEMYLPFIYSLFFFILIANLSGNVPY-GFTVATSIMVSIGLSMTIFIGVTILGLRLHKVHFFSFFV-------PSGTPLGLVPLLVPIELISYLARAFSLGVRLFANTVAGHTLLKILSGFLAPMFTSG--AITAVITLIPFSIFIALIG--LEIAVSFIQAYVFCILTASY 235
>gi|163840187|ref|YP_001624592.1| F0F1 ATP synthase subunit A [Renibacterium salmoninarum ATCC 33209] >gi|162953663|gb|ABY23178.1| ATP synthase A chain [Renibacterium salmoninarum ATCC 33209] (266 aa)
Score = 102, Expect = 1.6e-02, Identities = 48/179 (26%), Positives = 82/179 (45%)
  Q:    82 IMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTV--TFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFG-ITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGS 260
           I  ++FIKF P +FT+F +I + NI   +        + V   +AL        IILG+K     +     FK  +   +G    + +   P   I++ ++   + SLRL+A ++AG +I+ L               L  G  +++   F   +   L+ L+  +QA+VF +LT  Y  GS
  S:    88 IGNRDFIKFVPVLFTLFFFILVNNIFGAIPLLEIPTFSHVGGAYALAGVVYFTWIILGVKRNGWKY-----FKLSV-VPTGVPWYLLFMVIPIEIISNYLVRPATHSLRLFATMLAGHMIV-LMAGYGTEFLLEQENFLVKGASILIVVGFIAMY--MLEMLIMVLQAYVFTLLTATYIEGS 260
>gi|21999638|gb|AAM87701.1| ATPase subunit 6 [Cortinarius alboviolaceus] (206 aa)
Score = 102, Expect = 1.6e-02, Identities = 38/150 (25%), Positives = 70/150 (46%)
  Q:    61 PKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENP-TALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMF 210
           P   A F+     +  ++V E +G +  K+ P+I+++F ++ + N+IS V +    TA   V+  L L   +G  IL +K     FF  F+        SG  +++        +   +   +S+ +RL+ANI AG  +L +       +F
  S:    43 PNNWAIFLETTYASLSSMVREQIGNQSEKYFPFIYSLFFFLLIGNLISNVPYSFAVTASGIVSLGLSLTIFIGVTILALKIHGIKFFSFFI-------PSGTPLILVPLLVLIELISYLARAVSLGVRLFANITAGHTLLKILSTYLFKLF 186
>gi|158425884|ref|YP_001527176.1| F0F1 ATP synthase subunit A [Azorhizobium caulinodans ORS 571] >gi|158332773|dbj|BAF90258.1| H+-transporting two-sector ATPase A subunit [Azorhizobium caulinodans ORS 571] (250 aa)
Score = 102, Expect = 1.6e-02, Identities = 58/186 (31%), Positives = 94/186 (50%)
  Q:    78 LVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPW----ISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEP 263
           +V E  G E + F P +F++F ++F+ N+I +V +    TA   VT AL L      +I G     + F + F+        SG    +P F  PF +   ++ +    IS+SLRL+AN++AG + L +F A  +V       +   G  +  F + A+     L+ LV  +QA+VF VLT  Y + +  P
  S:    73 MVRESAGTEGMVFFPLVFSLFVFVFVANVIGLVPYTFTITAHIVVTAALALLVIGTVVIYGFYKHGTHFLHLFV-------PSG----VPAFLLPFIVLIEVISFLSRPISLSLRLFANMLAGHIALKVF-AFFVVGLGSAGFLGWLGATLPFFMIVALT---ALELLVAILQAYVFAVLTSIYLNDAVHP 248
>gi|107736221|ref|YP_626517.1| ATP synthase F0 subunit 6 [Briareum asbestinum] >gi|100913621|gb|ABF69708.1| ATP synthase F0 subunit 6 [Briareum asbestinum] (235 aa)
Score = 102, Expect = 1.7e-02, Identities = 48/182 (26%), Positives = 75/182 (41%)
  Q:    75 FKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           F  LV +    +  ++   I T+F +I   N++ +  +   PTA   VTF L     +   ILGI   +  F    +        SG  + +            I   IS+ +RL AN+ AG L+  +  +    M      VL  GP +++       F   L+  V  IQA+VF +LT  Y
  S:    58 FLGLVKDSTANKGTQYFTLIITLFTFIAGLNLLGLFPYVFTPTAHIVVTFGLSFSILIAVTILGITQFRWDFASMLM-------PSGAPLALAPLLVSIETLSYISRAISLGIRLAANLSAGHLLFAILASFGFAMINNGMLVLSLGPILVMV------FITLLEIAVALIQAYVFCMLTAIY 227
>gi|91975310|ref|YP_567969.1| F0F1 ATP synthase subunit A [Rhodopseudomonas palustris BisB5] >gi|91681766|gb|ABE38068.1| ATP synthase F0, A subunit [Rhodopseudomonas palustris BisB5] (250 aa)
Score = 102, Expect = 1.7e-02, Identities = 48/186 (25%), Positives = 86/186 (46%)
  Q:    78 LVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYAL-----PMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEP 263
           ++    GKE +KF P +F++F +I + N+I ++ +    ++   VT AL L   +  +  G+      FF  F+        SG  V I        +    +  +S S+RL+AN++AG + L +F +       +        +L  G  V + +         L+ LV  +QA+VF +LT  Y + +  P
  S:    73 IIRSTAGKEGMKFFPLVFSLFMFIAVSNLIGIIPYTFTVSSHLIVTVALALLVFVIVLFYGLYKNGLKFFKLFV-------PSGVPVYILPLVVFIEVISFFLKPVSHSVRLFANMLAGHIALKVFASFVGMLGALGFLGWMGAILPLGLTVAVTA---------LEILVAFLQAYVFTILTCIYLNDAMHP 248
>gi|154819671|gb|ABS88118.1| ATP synthase subunit 6 [Simplicillium lamellicola] (232 aa)
Score = 101, Expect = 1.7e-02, Identities = 46/164 (28%), Positives = 73/164 (44%)
  Q:    90 FTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLT 253
           + P+I+T+F ++ + N+I +V +    T    +TFAL     LG  ILG +     FF   +            V+I +          +   +S+ LRL ANI AG ++L +       +          G   ++  LF V F G L+  +  IQA VFVVL+
  S:    77 YFPFIYTLFVFVLINNLIGMVPYSFASTGHFALTFALSFTIVLGATILGFQKHGLKFFSLLVPAGCPLGLLPLLVIIEFI-------SYLARNVSLGLRLAANITAGHMLLSILSGFVYNIMNSGIIFFILG---LIPLLFIVAFSG-LELAIAFIQAQVFVVLS 230
>gi|167768296|ref|ZP_02440349.1| hypothetical protein CLOSS21_02852 [Clostridium sp. SS2/1] >gi|167709820|gb|EDS20399.1| hypothetical protein CLOSS21_02852 [Clostridium sp. SS2/1] (227 aa)
Score = 101, Expect = 1.8e-02, Identities = 50/235 (21%), Positives = 103/235 (43%)
  Q:    28 RSEITSIIVITIIMTLVLVYY-NFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTE 262
           +S +T+ +++ I++ L +++  N  +    P    + +  FI+N +G        ++G++  ++ P++ T+  Y+   NI      + PT    VT  L + +    I  GI  +          K YI +      M+        I ++    +S+ +RL+ N++   +++ L             T + P       ++  +PF  + D+  G +QA+VFV+LT  + S S E
  S:    30 QSAVTTWVIMAIVVLLCIIFVRNLKVIPEGPQVYVEALVGFIYNFIGG-------LVGEKGKRYIPFLGTILIYLGCANISGFFRAKPPTKDLNVTAGLAIISLFLIIYSGIHEKG--------LKGYIHSYVEPMPMMA----AINILELFTRPLSLCMRLFGNVLGAFVLMELI------------THIAP-------AIVPLPFSCYFDFFDGLLQAYVFVLLTSLFISESIE 227
>gi|169665119|gb|ACA63349.1| ATP synthase subunit 6 [Bondarzewia montana] (201 aa)
Score = 101, Expect = 1.8e-02, Identities = 48/175 (27%), Positives = 83/175 (47%)
  Q:    36 VITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGL-FTTL-GTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMF 210
           V+ +I+ + L Y   +  K+ P+K   GI      +     T+V E +GKE   + P+I+ +F YI + N++  + +   T  T++   +GL FT L G  ILG+   K  FF  F+        SG  + +            +   +S+ +RL+AN++AG  +L +       MF
  S:     8 VLVLILIIGLHYMGNNDSKIIPSKWSIGIESIFITI----NTMVKEQLGKEI--YLPFIYALFFYILIANLLGNIPYSY-TVTTSIIVTIGLSFTILTGVTILGLYIHKLHFFSYFV-------PSGTPLALVPLLVLIETVSYLARALSLGIRLFANVVAGHTLLKILSTFLYQMF 170
>gi|11465638|ref|NP_049309.1| ATP synthase F0 subunit 6 [Porphyra purpurea] >gi|4106945|gb|AAD03112.1| ATP synthase F0 subunit 6 [Porphyra purpurea] (256 aa)
Score = 101, Expect = 1.9e-02, Identities = 39/133 (29%), Positives = 64/133 (48%)
  Q:    77 TLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWI----SISLRLWANIMAGALILGLFYALPMVM 209
           TLV + +G +   + P+I+T+F  I  CN+I +V +    T+    TF L L   +G  I+G +     FF  FL K            +P F  P  +    + +I    +IS+RL+AN+ +G  +L +       M
  S:    79 TLVKDNLGTKGYHYFPFIYTIFSIILYCNLIGMVPYSFTVTSHIAFTFGLALAIYIGINIIGFRAHGIKFFTIFLPK-----------GVPLFIVPLVVAIEFVSYIVKVFTISIRLFANMTSGHTLLKIIAGFVWTM 205
>gi|125975085|ref|YP_001038995.1| F0F1 ATP synthase subunit A [Clostridium thermocellum ATCC 27405] >gi|196251791|ref|ZP_03150457.1| ATP synthase F0, A subunit [Clostridium thermocellum DSM 4150] >gi|125715310|gb|ABN53802.1| ATP synthase F0, A subunit [Clostridium thermocellum ATCC 27405] >gi|196198731|gb|EDX93562.1| ATP synthase F0, A subunit [Clostridium thermocellum DSM 4150] (251 aa)
Score = 101, Expect = 2.0e-02, Identities = 57/230 (24%), Positives = 101/230 (43%)
  Q:    33 SIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVV-----------------------GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGL-FYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTE 262
           S+I++ I+M  ++++     +KL     P+G    +  ++        + MG     F PYI TV  ++ + N+ ++                            PT    VT  L L + +   + GI+ +K S + K  F+            +P    PF + D ++  +S+  R++ NI+   +I+ L ++A P V+         P    I F LF            G +QA+VFV LT  Y   + E
  S:    32 SVIMMWIVMAFLIIFSLVFTRKL--KTIPEGKQNVVEVIVEFIYNFAKDSMGHNGKLFAPYIGTVLLFLIVSNMAAIFNVIPSSEDIYHWTGIEYFKDLNFAIRPPTKDVNVTLTLALMSMVAVALAGIRVKKVSGWLKSFFE-----------PVPLML-PFKMLDYVIRPVSLCFRMFGNILGAVIIMELVYFAFPAVL---------PAFLSIYFDLFD-----------GILQAYVFVFLTSIYMGEAVE 251
>gi|71385927|gb|AAZ31256.1| ATPase subunit 6 [Clavaria zollingeri] (242 aa)
Score = 101, Expect = 2.0e-02, Identities = 43/187 (22%), Positives = 86/187 (45%)
  Q:    70 NLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENP-TALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWL-----VGSIQAFVFVVLTLCY 256
           +L  +  ++V E +G     + P+I+++FC++   N+I  V +    T    V   L     +G  +LG+     ++F  F+        SG  +++    +       +   +S+ +RL+AN++AG  ++ +       MF  +         +++F L  +PF  F+  L     V  IQ++VF +L   Y
  S:    62 SLFSSINSMVREQIGMSNEIYLPFIYSLFCFVLFANLIGNVPYSFVITTSAVVCLGLSFTIFIGVTLLGLSIHNLNYFSFFV-------PSGCPLVLVPMLSLIEFVSYLSRSVSLGVRLFANLLAGHSLVKILSTFIYKMFTTN---------ILIFILTLIPFVIFVAILALELGVSIIQSYVFCILVCSY 238
>gi|15891950|ref|NP_359664.1| F0F1 ATP synthase subunit A [Rickettsia conorii str. Malish 7] >gi|20454819|sp|Q92JP0|ATP6_RICCN ATP synthase a chain (ATPase protein 6) >gi|15619061|gb|AAL02565.1| ATP synthase A chain [EC:3.6.1.34] [Rickettsia conorii str. Malish 7] (242 aa)
Score = 101, Expect = 2.1e-02, Identities = 51/222 (22%), Positives = 103/222 (46%)
  Q:    35 IVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLF--YALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           +++  I+ L   Y  F  +KL P++     A  ++NL+     ++ + +G +  KF P +F++F +I  CN++ +  +    T+   VTF L +   L   I+G       F   FL         G  + +        +   +   +S+SLRL AN+MAG ++L +   + + ++++ +      P P +++   F +         V  +QA++F +L+  Y
  S:    33 MLLASILALTYFYLAFYNRKLVPSRLQVS-AEIVYNLVA---DMLNQNIGVKGRKFIPLVFSLFIFILFCNLLGMTPYSFTTTSHIIVTFTLAILVFLMVTIVGFVKHGLRFLTLFL-------PHGTPLWLAPLMIVIELFTYLARPVSLSLRLAANMMAGHVLLKVIAGFTVSLMIYLK----FLPIPIMVILIGFEI--------FVAILQAYIFTILSCMY 234
>gi|99082434|ref|YP_614588.1| F0F1 ATP synthase subunit A [Silicibacter sp. TM1040] >gi|99038714|gb|ABF65326.1| ATP synthase F0 A subunit [Silicibacter sp. TM1040] (267 aa)
Score = 101, Expect = 2.1e-02, Identities = 48/191 (25%), Positives = 77/191 (40%)
  Q:    73 GAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFK---FYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEP 263
           G    +V ++ GK+ +KF PYI T+F +I   N + ++      T+   VT  L +   +   I G     + F   F        ++       +I YF  P          +S  +RL  N+MAG  +L +F      +                  +FA+     L+ LV  IQA+VF +LT  Y   +  P
  S:    92 GFIYKMVEDVTGKDAVKFFPYIMTLFMFIVTANFLGLIPMSFTTTSHFAVTAILAMLVFVTVTITGFVLHGAKFLGLFWVSSAPLALRPILAIIELISYFVRP----------VSHCIRLAGNVMAGHAVLKVFAGFAGALG-----------AGAFLPIFAITAVYALEVLVAFIQAYVFTILTCVYLKDALHP 265
>gi|13476163|ref|NP_107733.1| F0F1 ATP synthase subunit A [Mesorhizobium loti MAFF303099] >gi|14026923|dbj|BAB53519.1| Fo ATP synthase subunit A [Mesorhizobium loti MAFF303099] (252 aa)
Score = 101, Expect = 2.1e-02, Identities = 50/186 (26%), Positives = 86/186 (46%)
  Q:    78 LVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVG-FENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEP 263
           ++ +  G + +KF P +F++F ++ + N++ +   F   T+   VTF L +      I+ G       F   F+ K       G  +++     P  +   +   IS+S+RL+AN++AG + L +F    +V       V   G   IL    AV     L+ LV  +QA+VF VLT  Y + +  P
  S:    75 MLRDAAGTQGMKFFPLVFSLFMFVLVANLLGLFPYFFTVTSHIIVTFGLAILVIGTVIVYGFMKHGLGFLKLFVPK-------GVPLVMMVLVVPIEVISFVSRPISLSVRLFANMLAGHITLKVFSGF-VVSLSALGAVGVAGS--ILPLAMAVALTA-LELLVAFLQAYVFAVLTCMYLNDALHP 250
>gi|10803744|ref|NP_066560.1| ATP synthase F0 subunit 6 [Gonostoma gracile] >gi|5509871|dbj|BAA82490.1| adenosine triphosphatase subunit 6 [Gonostoma gracile] (227 aa)
Score = 101, Expect = 2.2e-02, Identities = 44/173 (25%), Positives = 83/173 (47%)
  Q:    89 KFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGST 261
           K+   + ++  ++   NI+ ++ +   PT   ++  +L +   L T+ LG++ Q +      L       +    ++IP       I+ +I P +++ +RL AN+ AG L++GL   + M  F    T+L   P + + S+  +     L+  V  IQAFVFV+L   Y   +T
  S:    68 KWATILMSLLTFLITLNILGLLPYTFTPTTQLSLNLSLAIPLWLSTVALGLQNQPTVSLGHLL------PEGTPSLLIPVLITIETISLLIRP-LALGVRLTANLTAGHLLIGL---VSMAAF----TLLPTAPLLAILSIIPLFLLTLLEIAVAMIQAFVFVLLLSLYLQENT 227
>gi|157827897|ref|YP_001494139.1| F0F1 ATP synthase subunit A [Rickettsia rickettsii str. 'Sheila Smith'] >gi|165932585|ref|YP_001649374.1| F0F1 ATP synthase subunit A [Rickettsia rickettsii str. Iowa] >gi|157800378|gb|ABV75631.1| F0F1 ATP synthase subunit A [Rickettsia rickettsii str. 'Sheila Smith'] >gi|165907672|gb|ABY71968.1| ATP synthase A chain [Rickettsia rickettsii str. Iowa] (242 aa)
Score = 101, Expect = 2.2e-02, Identities = 51/222 (22%), Positives = 103/222 (46%)
  Q:    35 IVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLF--YALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           +++  I+ L   Y  F  +KL P++     A  ++NL+     ++ + +G +  KF P +F++F +I  CN++ +  +    T+   VTF L +   L   I+G       F   FL         G  + +        +   +   +S+SLRL AN+MAG ++L +   + + ++++ +      P P +++   F +         V  +QA++F +L+  Y
  S:    33 MLLASILALTYFYLAFYKRKLVPSRLQVS-AEIVYNLVA---DMLNQNIGVKGRKFIPLVFSLFIFILFCNLLGMTPYSFTATSHIIVTFTLAILVFLIVTIVGFVKHGLRFLTLFL-------PHGTPLWLAPLMIVIELFTYLARPVSLSLRLAANMMAGHVLLKVIAGFTVSLMIYLK----FLPIPIMVILIGFEI--------FVAILQAYIFTILSCMY 234
>gi|169665142|gb|ACA63360.1| ATP synthase subunit 6 [Dendrocorticium roseocarneum] (207 aa)
Score = 101, Expect = 2.2e-02, Identities = 56/205 (27%), Positives = 100/205 (48%)
  Q:    33 SIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTL--GTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFL 237
           SIIV+ +I++L  +  N S  KL P+K   G+     +L  +  T+V E +GKE   + P+I+++F +I + N+   V + + T  T++  ++GL  T+  G  IL +   K  FF  F+        SG  + +        +   +   IS+ +RL+AN++AG  ++ +       MF            ++LF +  +PF  FL
  S:    16 SIIVLFLIVSLHYMANNDS--KLLPSKWSIGLE----SLFASINTMVREQIGKEV--YLPFIYSLFFFILISNLTGNVPY-SFTLGTSIIVSIGLSFTIWVGVTILALSIHKVKFFSYFI-------PSGTPLPLLPLLVLIELVSYVARAISLGVRLFANLVAGHTLMKILATFLYQMF---------SGSLVLFVVTLLPFGLFL 197
>gi|117414288|gb|ABK34552.1| ATP synthase subunit 6 [Ustilago davisii] (235 aa)
Score = 101, Expect = 2.2e-02, Identities = 55/221 (24%), Positives = 100/221 (45%)
  Q:    36 VITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTL--GTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           ++T+ + L L     + K+L P++     +  + +   +   LV   +G     + P+I+++F +I + N+   V +   T  T++  ++GL  T+  G  ILG++  K  FF  F+        SG  + +     P  +   +    S+ +RL+AN  AG  +L +       MF      +     +I FS+F       L+  V  IQA+VF +LT  Y
  S:    29 ILTVYLVLALHIMGSNNKQLIPSR----WSISLESSFASVHGLVKSQIGAANEMYLPFIYSLFFFILIANLSGNVPY-GFTVATSIMVSIGLSMTIFIGVTILGLRLHKVHFFSFFV-------PSGTPLGLVPLLVPIELISYLARAFSLGVRLFANTTAGHTLLKILSGFLAPMFTSG--AITAVITLIPFSIFIALIG--LEIAVSFIQAYVFCILTASY 235
>gi|84796305|gb|ABC66226.1| ATP synthase subunit 6 [Thanatephorus cucumeris] (250 aa)
Score = 101, Expect = 2.2e-02, Identities = 49/191 (25%), Positives = 86/191 (45%)
  Q:    72 LGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTL--GTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPF------HGFLDWLVGSIQAFVFVVLTLCYWSGSTE 262
             +  T+V + +G     + P+I+++F +I + N+   V + N T  T++  +LGL  T+  G  IL +   K  FF  F+        SG  + +        +       +S+ +RL+AN+MAG  ++ +       +F            V++  L  VPF      H   +W    IQ++VF  LT  Y   + E
  S:    69 FASVNTMVRDQIGTANEVYLPFIYSLFFFIIIANLTGNVPY-NYTITTSIVVSLGLSLTIFIGVTILALSIHKVRFFSFFI-------PSGCPLGLVPLLVLIELISYFARAVSLGVRLFANLMAGHTLMKILSTFLFQLFNSG---------VVVAILTLVPFARIRGYHRIRNW-CSIIQSYVFCTLTCSYIKDALE 249
>gi|19552429|ref|NP_600431.1| F0F1 ATP synthase subunit A [Corynebacterium glutamicum ATCC 13032] >gi|145295345|ref|YP_001138166.1| F0F1 ATP synthase subunit A [Corynebacterium glutamicum R] >gi|21323973|dbj|BAB98599.1| F0F1-type ATP synthase a subunit [Corynebacterium glutamicum ATCC 13032] >gi|140845265|dbj|BAF54264.1| hypothetical protein [Corynebacterium glutamicum R] (270 aa)
Score = 101, Expect = 2.3e-02, Identities = 58/223 (26%), Positives = 110/223 (49%)
  Q:    34 IIVITIIMT-LVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYE-IMGK-EFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILG-LFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           I++I ++MT +V+V++ ++M+K  P   P G+  F    L   +  + E I+GK E  +F P + T+F    L N+ +++   N ++ + + F + +    G I       K   F+K++    +       + +      F  T I+ P ++++LRL AN +AG +IL  LF A     F+ +      G  +++  LF V      + +V  +QA++F +L   Y
  S:    43 IVLIRLLMTAVVVVFFLWAMRK--PKLVPHGVQNFAEYALDFVRIHIAEDILGKKEGRRFLPILATIFFAALLMNLATIIPGLNISSNSRIAFPI-VMAVAGYIAFIYAGSKRYGFFKYVKSSVVIPNIPPALHVLVVPIEFFSTFILRP-VTLALRLMANFLAGHIILVLLFSATNFFFFQFNGWTAMSGVTILMAVLFTV-----YEIIVIFLQAYIFALLVAVY 260
>gi|111018479|ref|YP_701451.1| F0F1 ATP synthase subunit A [Rhodococcus sp. RHA1] >gi|110818009|gb|ABG93293.1| probable H(+)-transporting two-sector ATPase subunit A [Rhodococcus sp. RHA1] (339 aa)
Score = 100, Expect = 2.4e-02, Identities = 59/227 (25%), Positives = 114/227 (50%)
  Q:    30 EITSIIVITIIMT-LVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFK-TLVYEIMGKEFIK-FTPYIFTVFCYIFLCNIISVVGFEN--PTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTK---SGNKVMIPYFFNPFG-ITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVI--LFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           E+  ++++ I+++ L+++++  +++   P   P+G+       L   +  +  EI+GKE  K F P I T+F  +   N+ S++ F N  P A   +   L     +    +GIK        K+ F  Y+K+     G  + + +   P   I+  ++   ++ +RL AN++AG ++L LF++     F      +  G + +  + SL A     F + LV  +QA+VF +LT  Y
  S:   107 ELDRLMLVRILLSGLMMLFFVIALRS--PKIIPRGVQNIGEIALDFVRINIAEEILGKEQGKRFLPVITTIFFLVLASNLGSIIPFINISPNARIGMPLVLAALAYIVFNYVGIK--------KYGFFKYVKSSIVVPGVPLPLHFLLVPIEFISTFVLRPFTLMVRLMANMLAGHILLVLFFSATQYFF-----FVSGGFQAVFGVASLAAGIAFTFFELLVIFLQAYVFALLTSVY 329
>gi|163754721|ref|ZP_02161843.1| ATP synthase, subunit A (H(+)-transporting two-sector ATPase) [Kordia algicida OT-1] >gi|161325662|gb|EDP96989.1| ATP synthase, subunit A (H(+)-transporting two-sector ATPase) [Kordia algicida OT-1] (354 aa)
Score = 100, Expect = 2.4e-02, Identities = 41/178 (23%), Positives = 83/178 (46%)
  Q:    85 KEFIKFTPYIFTVFCYIFLCNIISVVGF-ENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTE 262
           K+++K+ PY+ T+F +I++ N++ +V    N T     T  L + T     +L + +  ++ ++K +F        G  V +     P     I     ++ +RL+ANI AG +I+    +L  +           G   +L ++F +     L+++V  +QA++F  LT  +   + E
  S:   193 KKYMKYVPYLLTLFFFIWVNNLLGLVPTGANLTGNIATTMVLAVLT-----LLIVNFSGNANYWKHIFWM-----PGVPVPMKIILAPIEFVGIFTKPFALMIRLFANITAGHIIILSLVSLIFIF-------QWAGTPSMLLAIFIM----ILEFVVAFVQAYIFTFLTALFIGMAVE 350
>gi|84796269|gb|ABC66213.1| ATP synthase subunit 6 [Ceratobasidium sp. CBS 569.83] (212 aa)
Score = 100, Expect = 2.5e-02, Identities = 43/175 (24%), Positives = 87/175 (49%)
  Q:    36 VITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTL--GTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMF 210
           ++ + +TL L + + + +KL P+K     +  + +   +  T+V + +G     + P+I+++F +I + N+   V + N T  T++  +LGL  T+  G  IL +   K  FF  F+        SG  + +        +   +   +S+ +RL+AN++AG  +L +  +L   MF
  S:    30 IVLLFLTLGLHFVSSNNRKLVPSK----WSIALESSFASINTMVRDQIGTTNEVYLPFIYSLFFFIIIANLTGNVPY-NYTITTSIVVSLGLSLTIFIGVTILALSIHKVRFFSFFI-------PSGTPLALVPLLVLIELISYLARAVSLGVRLFANMVAGHTLLKILSSLLFTMF 194
>gi|107735870|ref|YP_626457.1| ATP synthase F0 subunit 6 [Metarhizium anisopliae] >gi|57904572|gb|AAW58827.1| ATP synthase F0 subunit 6 [Metarhizium anisopliae] (261 aa)
Score = 100, Expect = 2.6e-02, Identities = 48/167 (28%), Positives = 75/167 (44%)
  Q:    90 FTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSL------FAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           + P+I+T+F +I + N+I ++ +    T    +TFAL     LG  ILG       FF   +            V+I +          +   +S+ LRL ANI AG ++L +              ++  G  +I F L      F + F G L+  +  IQA VFVVL+  Y
  S:    97 YFPFIYTLFIFILVNNLIGMIPYSFASTGHFALTFALSFTIVLGATILGFSKHGLKFFSLLVPAGCPLGLLPLLVIIEFI-------SYLARNVSLGLRLAANITAGHMLLAILSGFVY-------NIMNSG--IIFFILGLIPLTFIIAFSG-LELAIAFIQAQVFVVLSTSY 253
>gi|172040390|ref|YP_001800104.1| ATP synthase A chain [Corynebacterium urealyticum DSM 7109] >gi|171851694|emb|CAQ04670.1| ATP synthase A chain [Corynebacterium urealyticum DSM 7109] (266 aa)
Score = 100, Expect = 2.6e-02, Identities = 62/223 (27%), Positives = 116/223 (52%)
  Q:    34 IIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKT-LVYEIMGK-EFIKFTPYIFTVFCYIFLCNIISVVGFEN--PTALTTVTFALGLFTTLGTIILGIK------YQKSSFFYKFLFKFYIKTKSGNKVMIPY-FFNPFGITDIIMPWISISLRLWANIMAGALIL-GLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           ++V  +++ +V++++  +M+K  P   P+GI       L   +  +  EI+GK E  +F P I  +F  +   N+ +++ F N  P+A   +   L L   +  I  G+K      Y KSS     L  F       + +++P  FF+ F     I+  +++++RL AN++AG +IL  LF A     ++ +   L  G  ++    FA+ F  F + ++  +QA++F +LT  Y
  S:    40 MLVRILMIAIVVIFFLIAMRK--PKLVPRGIQNVGEIALDFVRIHIAEEILGKKEGRRFLPVIAAIFFTVVAANLPTLIPFLNISPSARVGLPLVLALVAYVVFIYAGVKRYGFGKYMKSSLVIPGLPTFI------HFIVVPIEFFSTF-----ILRPVTLTIRLMANMLAGHIILVMLFSATNFFFWQLNGWSLVAGGTMV----FAIAFSLF-ELMIVFLQAYIFALLTAVY 256
>gi|62736222|ref|YP_227581.1| ATP synthase subunit 6 [Candida orthopsilosis] >gi|62177734|gb|AAX73026.1| ATP synthase subunit 6 [Candida orthopsilosis] >gi|170785421|gb|ACB37778.1| ATP synthase subunit 6 [Candida orthopsilosis] (246 aa)
Score = 100, Expect = 2.6e-02, Identities = 56/232 (24%), Positives = 109/232 (46%)
  Q:    31 ITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE---NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTE 262
           IT+  +  II++L++V+Y+  ++         G++  +  +      LV   +G++   + P IFT+F +I + N+IS++ +    +   +  V+F+L L+  +G ++LG+      FF  F+        SG  + +                IS+ LRL ANI++G L++ +  +L + +          G    +  + AV     L++ +  IQA+VF +L   Y   S E
  S:    25 ITNYTLYLIIVSLIIVFYSSIIRHNFLGSSRWGVS--VIAIYDTILNLVNGQIGRKGGYYFPLIFTIFNFILIANLISMIPYSFAISAQLVAVVSFSLALW--IGNVVLGLYLHGWGFFALFV-------PSGTPLALVPVLVLIEALSYASRAISLGLRLGANILSGHLLMLILGSLIISLMSSSLLGFVSG----IIPILAVVAITILEFGIAIIQAYVFSILLSGYIKDSVE 244
>gi|29829429|ref|NP_824063.1| F0F1 ATP synthase subunit A [Streptomyces avermitilis MA-4680] >gi|29606536|dbj|BAC70598.1| putative F-type proton-transporting ATPase a chain [Streptomyces avermitilis MA-4680] (269 aa)
Score = 100, Expect = 2.7e-02, Identities = 52/236 (22%), Positives = 110/236 (46%)
  Q:    25 FEYRSEITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGK-EFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGS 260
           FE+   I  +++ TII+ +   +  F+  KL P K  + I    ++ +   + +VYE +GK E  K+ P + ++F ++++ NI S++      A + + F  GL   +  + + + ++K  F   F          G    +  FF    ++++++   + ++RL+AN+ AG ++L +F      +          G      S   V      +  + ++QA+VF++L+  Y  G+
  S:    40 FEFNKPILLVLLSTIIV-IGFFWAAFNKPKLIPGKL-QMIGELGYDFVR--RGVVYETLGKREGDKYVPLMVSLFFFVWMMNIWSIIPVAQFPATSIIAFPAGLAAVVYVLWVSLTFKKHGFVGAFKNITGYDKSLGPVFPVVMFFE--FLSNLLIRPFTHAVRLFANMFAGHVLLLIFTIASWYLLN------GIGIAYAGVSFLMVLVMTVFELFIQALQAYVFILLSCSYIQGA 264
>gi|110598588|ref|ZP_01386856.1| ATP synthase F0, A subunit [Chlorobium ferrooxidans DSM 13031] >gi|110339822|gb|EAT58329.1| ATP synthase F0, A subunit [Chlorobium ferrooxidans DSM 13031] (338 aa)
Score = 100, Expect = 2.7e-02, Identities = 55/212 (25%), Positives = 96/212 (45%)
  Q:    53 KKLDPNKPPKGIAFFIFNLLGAFKTLVYEI-MGKEFIKFTPYIFTVFCYIFLCNIISVVGF-ENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFL---FKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGF---LDWLVGSIQAFVFVVLTLCYWSGSTEPE 264
           K ++  + PKG+A  +  L+   +  V +  +G  + K  PY+ TVF +I  CN+  ++ +    T    VT  L +FT + T I  +K      F K L     + +        +I  F  PF +T          +RL+AN+ AG +I+     +  ++              I+ +  +VPF  F   L+  V  +QAF+F +L+  +   +T  E
  S:   128 KNMNARQAPKGVANTMEALIDFVRLDVAKSNIGPGYEKHLPYLITVFMFILFCNLFGLIPYGATATGNINVTLTLAVFTFIITQIAALKAHGFVGFVKHLTAGTHWALWIIIVPIEIIGLFTKPFALT----------VRLFANMTAGHIIILSLIFISFIL-----------KSYIVAAAVSVPFAIFIYLLELFVAFLQAFIFTMLSALFIGLATAHE 326
>gi|29570609|ref|NP_818783.1| ATP synthase subunit 6 [Candida glabrata CBS138] >gi|54035711|sp|Q85Q99|ATP6_CANGA ATP synthase subunit a precursor (ATPase protein 6) (ATP synthase subunit 6) >gi|29500874|emb|CAD54424.1| ATP synthase subunit 6 [Candida glabrata] (260 aa)
Score = 100, Expect = 2.7e-02, Identities = 46/176 (26%), Positives = 80/176 (45%)
  Q:    81 EIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENP-TALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPG--PEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           +I GK++  + P+I+T+F +I + N+IS++ +    TA      +L +   LG  IL +      FF  F+        SG  + +        +   +    S+ LRL ANI +G L++ +   L M   + +   L  G  P  I+  +  + F       +  IQA+VF +L   Y
  S:    87 QIKGKDWGYYFPFIYTLFMFILISNLISMIPYSYALTAQFVFIISLSMIIWLGITILSLFKHGWVFFSLFV-------PSGTALPLVPLLVVIELLSYVARAFSLGLRLSANIFSGHLLMAILAGLTMTFVQINIFTLILGFIPLAIILIIMCLEFG------IAIIQAYVFSILASSY 252
>gi|4469300|emb|CAB38450.1| ATP synthase CF0 A chain (subunit IV) [Prototheca wickerhamii] (239 aa)
Score = 100, Expect = 2.8e-02, Identities = 63/226 (27%), Positives = 98/226 (43%)
  Q:    31 ITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMG-KEFIKFTPYIFTVFCYIFLCNIISVV-----------GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYAL-PMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           ITS +V+ +I+ + L+  N      D    P+ +  F   +    + L    +G KE++K+ P++ T+F +IF+ N    +               PT     T AL L T+      GI   K    Y   FK YI   +        F  P  I +     +S+S RL+ NI+A  L++G+   L P+V+         P P ++L  LF             +IQA VF  L   Y
  S:    32 ITSWLVLGLIIGISLIANN------DLKLIPENLQNFTEYITEFIRDLAKAQIGEKEYLKWVPFLGTIFLFIFVSNWTGALFPWRVFKLPSGELAAPTNDINTTVALALLTSFAYFYAGI--SKKGLLY---FKRYISPVA--------FLLPINILEDFTKPLSLSFRLFGNILADELVVGVLITLVPLVI---------PIP-IMLLGLFT-----------SAIQALVFATLAGAY 230
>gi|21673855|ref|NP_661920.1| F0F1 ATP synthase subunit A [Chlorobium tepidum TLS] >gi|21646989|gb|AAM72262.1| ATP synthase F0, A subunit [Chlorobium tepidum TLS] (221 aa)
Score = 100, Expect = 2.8e-02, Identities = 44/173 (25%), Positives = 82/173 (47%)
  Q:    89 KFTPYIFTVFCYIFLCNIISVV-GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSG-NKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGST 261
           K+ P+I  +F +I   N+ +V+ G+E PT   + T AL L   +   + GI   +SS         Y+KT +    +M+P     F I   +   +++++RL+ N+M+G +IL +   +  ++F   P ++                   L  L G +QA++F +L   Y + +T
  S:    77 KYLPFIAALFLFIATANLCTVIPGYEPPTGSLSTTAALALSVFIAVPLFGIA--ESSLVG------YLKTYAEPTPIMLP-----FNIVGELTRTMALAVRLFGNMMSGDMILVILLTISPLVF---PVLMN-----------------ILGLLTGMVQAYIFSILATVYIAAAT 218
>gi|13508|emb|CAA24054.1| unnamed protein product [Saccharomyces cerevisiae] >gi|7537352|gb|AAA32145.2| ATPase subunit [Saccharomyces cerevisiae] (259 aa)
Score = 100, Expect = 2.8e-02, Identities = 47/176 (26%), Positives = 83/176 (47%)
  Q:    81 EIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENP-TALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPG--PEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           +I GK +  + P IFT+F +IF+ N+IS++ +    +A      +L +   LG  ILG+      FF  F+        +G  + +            I   IS+ LRL +NI+AG L++ +   L       +   L  G  P  ++ ++        L++ +G IQ++V+ +LT  Y
  S:    86 QIGGKNWGLYFPMIFTLFMFIFIANLISMIPYSFALSAHLVFIISLSIVIWLGNTILGLYKHGWVFFSLFV-------PAGTPLPLVPLLVIMETLSYIARAISLGLRLGSNILAGHLLMVILAGLTFNFMLINLFTLVFGFVPLAMILAIM------ILEFAIGIIQSYVWTILTASY 251
>gi|153002867|ref|YP_001368548.1| F0F1 ATP synthase subunit A [Shewanella baltica OS185] >gi|151367485|gb|ABS10485.1| ATP synthase F0, A subunit [Shewanella baltica OS185] (278 aa)
Score = 100, Expect = 2.9e-02, Identities = 53/171 (30%), Positives = 86/171 (50%)
  Q:    92 PYIFTVFCYIFLCNIISVVGFE----------------NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDW--LVGSIQAFVFVVLTLCYWSGSTE 262
           P   T+F ++F+ N + ++  +                 PT    +TF+L +   L  I   IK +  S F K L          +K MIP       +T I  P IS++LRL+ N+ AG LI    + L  +M+         G  ++L +L      G+L +  LV ++QAF+F++LT+ Y S + E
  S:   106 PLALTIFVWVFMMNFMDMIPVDWLPHAASLMGIPYLKAVPTTDVNITFSLAIGVFLLIIFYSIKVKGVSGFVKEL----TLQPFNHKAMIPVNLLLETVTLIAKP-ISLALRLFGNLYAGELI----FILIALMY---------GTNLLLSTLGVTLQLGWLIFHILVITLQAFIFMMLTIVYLSMAHE 276
>gi|86141106|ref|ZP_01059665.1| ATP synthase F0, A subunit [Flavobacterium sp. MED217] >gi|85833048|gb|EAQ51497.1| ATP synthase F0, A subunit [Leeuwenhoekiella blandensis MED217] (395 aa)
Score = 100, Expect = 2.9e-02, Identities = 40/171 (23%), Positives = 82/171 (47%)
  Q:    86 EFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           ++ K+  ++ TVF +I++ N++ +  F  N T    VT  L LFT        +++  +  ++K +F           V++     P  +  ++    S+ +RL+ANI AG +++    AL + +  +   V   G  ++L    +V     ++ LV  +QAF+F +L+  +
  S:   207 KYRKYMSFLLTVFFFIWVSNLLGMTPFGFNITGQIAVTVCLALFT-----FFIVQFSGNKDYWKHIFWM-----PDVPVIMKIILIPIEVLGMLTKPFSLLIRLFANITAGHVVVMGLIALMITLKAQFGAVGSTGLSLVLTLFISV-----IEILVAFLQAFIFTMLSALF 363
>gi|189501407|ref|YP_001960877.1| ATP synthase F0, A subunit [Chlorobium phaeobacteroides BS1] >gi|189496848|gb|ACE05396.1| ATP synthase F0, A subunit [Chlorobium phaeobacteroides BS1] (338 aa)
Score = 100, Expect = 2.9e-02, Identities = 51/218 (23%), Positives = 98/218 (44%)
  Q:    39 IIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEI-MGKEFIKFTPYIFTVFCYIFLCNIISVVGF-ENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGF---LDWLVGSIQAFVFVVLTLCY 256
           +I+ LV  Y     K +  N+ P G+A  +  L+   +  V +  +G+ + K  PY+ TVF +I + N++ ++ +  + T    VT  L +FT   T +  IK      +   L        +G    +     P  +  +     ++++RL+AN+ AG +I+     +  ++              I+    +VPF  F   L+  V  +QAF+F +L+  +
  S:   118 LILLLVFGYVGNKYKSIKSNEAPGGVANAMEALVEFIRLDVAKSNIGEGYEKHMPYLLTVFVFILVLNLLGLIPYGASATGNINVTLTLSVFTFFITQVSAIKSNGIKGYLAHL-------TAGTHWALWIIMIPIEVIGLFTKPFALTIRLFANMTAGHIIILSLIFISFIL-----------KSYIVAIFVSVPFSIFIYLLEIFVSFLQAFIFTMLSALF 322
>gi|169836751|ref|ZP_02869939.1| ATP synthase A chain, sodium ion specific [candidate division TM7 single-cell isolate TM7a] (204 aa)
Score = 100, Expect = 3.0e-02, Identities = 40/154 (25%), Positives = 66/154 (42%)
  Q:   112 FENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEE 265
           F  PTA    T  L L   +  + + IK +    + K LF+              +F  P  + DI    ++ S+RL+ N++AG +I+GL Y+L      +  T             + +    +LD  +G +QAFVF +L+  Y   +   EE
  S:    63 FRTPTADPNTTIGLSLVVIVVFLAVSIKQKSLKGYIKSLFEPM------------WFMFPLNVVDIFSKVLNTSMRLFGNMLAGLVIVGLLYSLVGRGLLQSMTNNMLKGSFSFSVGWPMLIQLYLDLFIGIVQAFVFTILSSVYIGEALGEEE 204
>gi|113954505|ref|YP_731515.1| F0F1 ATP synthase subunit A [Synechococcus sp. CC9311] >gi|113881856|gb|ABI46814.1| ATP synthase F0, A subunit [Synechococcus sp. CC9311] (241 aa)
Score = 100, Expect = 3.0e-02, Identities = 63/226 (27%), Positives = 106/226 (46%)
  Q:    31 ITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIK-FTPYIFTVFCYIFLCN---------IISVVGFE--NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILG-LFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           ++S I+I  ++  VLV      K L  ++ PKG    +  L    + L  + +G+++ + + P+I T+F +IF+ N         +I +   E   PTA    T A+ L  TL     G+  +   FF     + Y++      +M+P     F I +     +S+S RL+ NI+A  L +G L Y +P+++         P P V+L  LF             +IQA +F  L   Y
  S:    34 LSSWILIGALLAFVLV----GTKNL--SRDPKGAQNLLEFLWDYIRDLSRDQIGEKYYREWLPFIGTLFLFIFVSNWGGALIPWKVIELPEGELGAPTADINTTVAMALLVTLAYFYAGLSKKGWRFF-----ELYVEP---TPIMLP-----FKIIEEFTKPLSLSFRLFGNILADELAVGVLVYLVPLIV---------PLP-VMLLGLFT-----------SAIQALIFATLAAFY 232
>gi|169261432|gb|ACA52296.1| ATPase subunit 6 [Ceriporia viridans] (232 aa)
Score = 99, Expect = 3.0e-02, Identities = 46/176 (26%), Positives = 87/176 (49%)
  Q:    77 TLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTT--LGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGF-----LDWLVGSIQAFVFVVL 252
           ++V E +G+E   + P+I+++F +I + N++  V +   T  T++  ++GL  T  +   ILG+   K +FF  F+        SG  + +        +   +    S+ +RL+AN++AG  ++ +       MF            V++F +  +PF  F     L+  V  IQA+VF +L
  S:    69 SMVREQLGREI--YFPFIYSLFFFILIANLVGNVPYSY-TITTSIMVSIGLSFTILIAVTILGLSIHKLAFFSFFV-------PSGTPLALVPLLVLIELVSYLARAFSLGIRLFANVVAGHTLMKILATFLYQMF---------SAGVVMFIVTLIPFGLFLAIMGLELAVSFIQAYVFTIL 232
>gi|16356987|ref|NP_443221.1| ATP synthase F0 subunit 6 [Chauliodus sloani] >gi|16266778|dbj|BAB69980.1| ATPase subunit 6 [Chauliodus sloani] (228 aa)
Score = 99, Expect = 3.0e-02, Identities = 45/163 (27%), Positives = 77/163 (47%)
  Q:    94 IFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKV-MIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           + ++  +I   NI+ ++ +   PT L +   AL +   L T+++G+++Q +  F   L         G  + +IP        + +I P +S+++RL AN+ AG L+L L               L   PE+ L +  AV     L+  V  IQA+VFV+L   Y
  S:    73 LVSIIVFIAAHNILGLLPYTFVPTCLLSFNLALAVPIWLATVLMGLRHQPTITFGHLL-------PEGTPIPLIPLMIVIESFSLLIRP-VSLAVRLTANMTAGHLLLKLIST-------ATGAALAKAPELGLLAFPAVVGFSILEVAVAMIQAYVFVLLVTLY 222
>gi|32476310|ref|NP_869304.1| protein ATP synthase A chain [Rhodopirellula baltica SH 1] >gi|32446855|emb|CAD78761.1| probable protein ATP synthase A chain [Rhodopirellula baltica SH 1] (349 aa)
Score = 99, Expect = 3.1e-02, Identities = 46/181 (25%), Positives = 83/181 (45%)
  Q:    89 KFTPYIFTVFCYIFLCNIISVVGF-----------------ENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWIS-------ISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEEESQV 269
           K+  YI+TVF +I   NI+ V+ F                  + T   ++T  L L + +  I +GI+   +  F+     F      G  +M+     P  +   ++ W+S       +++RL+  +MAG L+L  F  L   +F         G  V +  +        L+  V  +QAF+F  LT+ + +     E +  +
  S:   120 KYIHYIWTVFFFILFANILGVIPFGYMLQLITGNDAFSHWGGSATGNLSLTSMLALTSLIAIIFIGIRETSAKDFFN---HFNPIGWDGGILML-----PIALMLYVLEWLSLLVKCFVLAMRLFGTMMAGHLVLAAFVGL---IFAAGEASKGMGYAVSVPVVLVATSLTLLELFVCCLQAFIFTFLTVLFIAAMATHEHDEHL 313
>gi|58337084|ref|YP_193669.1| F0F1 ATP synthase subunit A [Lactobacillus acidophilus NCFM] >gi|58254401|gb|AAV42638.1| H+-transporting ATP synthase chain a [Lactobacillus acidophilus NCFM] (237 aa)
Score = 99, Expect = 3.2e-02, Identities = 58/227 (25%), Positives = 106/227 (46%)
  Q:    30 EITSIIVITIIMTLVLVYYNFSMKKLD--PNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISV---------VGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGP-EVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           ++T II  T++   V +   +  +K++  PNK      + +    G  K  V ++  ++ +    Y F +F +I+  N + +         V  ++PTA    T +  + T L +   G++        +F    Y+K    N      F  P  + +    ++++SLRL+ NI AG ++L L           +      GP  +IL +  A+ + GF    +GSIQA+VFV L++ Y
  S:    15 DLTGIIGSTLMALAVFLICVWLARKVEMKPNKRQNVFEYLLDFTDGIVKDNVSDVDAQKHLSL--YAFVLFLFIWFMNQLGMFLEVKVDDWVFIKSPTADPVATMSFAMMTLLLSFTFGVQ--------RFGVGGYLK----NYAQPVGFLLPVNVIEEFTNFLTLSLRLYGNIYAGEVLLTLI---------GNDLAHAGGPFTLILAAPLAMVWQGF-SVFIGSIQAYVFVTLSMVY 229
>gi|34763448|ref|ZP_00144395.1| ATP synthase A chain, sodium ion specific [Fusobacterium nucleatum subsp. vincentii ATCC 49256] >gi|27886889|gb|EAA24014.1| ATP synthase A chain, sodium ion specific [Fusobacterium nucleatum subsp. vincentii ATCC 49256] (218 aa)
Score = 99, Expect = 3.3e-02, Identities = 54/187 (28%), Positives = 81/187 (43%)
  Q:    81 EIMGKEFIKFTPYIFTVFCYIFLCNIISVV----------------GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFY-ALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEEES 267
           +I+G    K+  +  ++F +IFL NII+                   F  PTA    T  L L  T   I + IK          +F +         VM+P       +       ++IS+RL+ N+ AG +I+GL Y A+P  +    P  L                H + D   G +Q+FVFV L++ Y  GS    E S
  S:    46 QILGVWKKKYYTFFASLFLFIFLSNIITFFPIPWFSIRDGMFVIYPAFRAPTADLNTTIGLALIVTTLFISINIKNNG-------VFGYLKGFADPTPVMLP-----LNVVGEFAKPLNISMRLFGNMFAGMVIMGLIYMAVPYFI----PAAL----------------HLYFDLFAGLVQSFVFVTLSMVYVQGSIGDTEYS 217
>gi|11466643|ref|NP_066326.1| ATP synthase F0 subunit 6 [Malawimonas jakobiformis] >gi|10178681|gb|AAG13693.1|AF295546_19 ATP synthase F0 subunit 6 [Malawimonas jakobiformis] (248 aa)
Score = 99, Expect = 3.3e-02, Identities = 53/183 (28%), Positives = 91/183 (49%)
  Q:    78 LVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPT--VLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGS 260
           LV E +G++  K+ P+IF +F +I   N+I ++ +    T+   VTF L L   +G  I+G  + K  FF  FL        +G+ V++  F     +        S+++RL+AN+M+G  +L +       M        VL+  P +++F +        L+  +  +QA+VFVVLT  Y + S
  S:    72 LVNENIGEKGNKYFPFIFILFIFILTLNLIGMIPYSFTVTSHIIVTFFLSLSIFIGVTIIGFMHHKIHFFSFFL-------PAGSPVVLAPFLVVIELISYTSRAFSLAIRLFANMMSGHSLLKILAGFSWTMLSAGGLFYVLQLIPLIVVFLITG------LEIGIAFLQAYVFVVLTCIYLNDS 244
>gi|567919|gb|AAA67534.1| oli2 [Saccharomyces cerevisiae] >gi|7544635|gb|AAA32149.2| ATPase subunit 6 (oli2) [Saccharomyces cerevisiae] >gi|152030929|gb|ABS28692.1| ATP synthase F0 subunit 6 [Saccharomyces cerevisiae YJM789] (259 aa)
Score = 99, Expect = 3.4e-02, Identities = 47/176 (26%), Positives = 83/176 (47%)
  Q:    81 EIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENP-TALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPG--PEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           +I GK +  + P IFT+F +IF+ N+IS++ +    +A      +L +   LG  ILG+      FF  F+        +G  + +            I   IS+ LRL +NI+AG L++ +   L       +   L  G  P  ++ ++        L++ +G IQ++V+ +LT  Y
  S:    86 QIGGKNWGLYFPMIFTLFMFIFIANLISMIPYSFALSAHLVFIISLSIVIWLGNTILGLYKHGWVFFSLFV-------PAGTPLPLVPLLVIIETLSYIARAISLGLRLGSNILAGHLLMVILAGLTFNFMLINLFTLVFGFVPLAMILAIM------ILEFAIGIIQSYVWTILTASY 251
>gi|115490023|gb|ABI97591.1| ATP synthase subunit 6 [Hysterangium sp. AHF602] (218 aa)
Score = 99, Expect = 3.4e-02, Identities = 47/205 (22%), Positives = 94/205 (45%)
  Q:    33 SIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTT--LGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFL 237
           S+IV+ +I++L L +        D    P   A  + +L  +   +V E +G     + P+I+++FC+I + N+I    + + T  +++  ++GL  T  +G  I+G+      FF  F+        SG  + +        +T  +   +S+ +RL AN+ AG ++L +       +F            +I+ +L  +PF  F+
  S:    18 SLIVLVLIISLHLAFKGTGFN--DTKLIPSQWAIALESLFASINAIVREQIGLRNEIYLPFIYSLFCFIIIANLIGNTPY-SFTITSSIILSVGLSFTIFIGVTIIGLAKHGLHFFSFFI-------PSGTPLALVPLLVLIEVTSYLARALSLGIRLLANVSAGHMLLKILSTFLYQLF---------SSSLIIATLTLIPFSIFI 205
>gi|84796276|gb|ABC66215.1| ATP synthase subunit 6 [Ceratobasidium sp. CBS 758.79] (224 aa)
Score = 99, Expect = 3.5e-02, Identities = 46/199 (23%), Positives = 93/199 (46%)
  Q:    36 VITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTT--LGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFH 234
           ++ + +TL L + + + +KL P+K     +  + +   +  T+V + +G     + P+I+++F +I + N+   V + N T  T++  +LGL  T  +G  IL +   K  FF  F+        SG  + +        +   +   +S+ +RL+AN+MAG  ++ +       +F         G  V +F+L    +H
  S:    25 IVLLFLTLGLHFVSSNNRKLVPSK----WSIALESSFASINTMVRDQIGTANEVYLPFIYSLFFFIIIANLTGNVPY-NYTITTSIVVSLGLSVTIFIGVTILALSIHKVRFFSFFI-------PSGCPLGLVPLLVLIELISYLARAVSLGVRLFANLMAGHTLMKILSTFLFQLF-------NTGIVVAVFTLIPFVYH 206
>gi|115490013|gb|ABI97586.1| ATP synthase subunit 6 [Hysterangium sp. T19263] (217 aa)
Score = 99, Expect = 3.6e-02, Identities = 47/205 (22%), Positives = 94/205 (45%)
  Q:    33 SIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTT--LGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFL 237
           S+IV+ +I++L L +        D    P   A  + +L  +   +V E +G     + P+I+++FC+I + N+I    + + T  +++  ++GL  T  +G  I+G+      FF  F+        SG  + +        +T  +   +S+ +RL AN+ AG ++L +       +F            +I+ +L  +PF  F+
  S:    18 SLIVLVLIISLHLAFKGTGFN--DTKLIPSQWAIALESLFASINAIVREQIGLRNEIYLPFIYSLFCFIIIANLIGNTPY-SFTITSSIILSVGLSFTIFIGVTIIGLAKHGLHFFSFFI-------PSGTPLALVPLLVLIEVTSYLARALSLGIRLLANVSAGHMLLKILSTFLYQLF---------SSSLIIATLTLIPFSIFI 205
>gi|117414272|gb|ABK34544.1| ATP synthase subunit 6 [Moesziomyces bullatus] (236 aa)
Score = 99, Expect = 3.6e-02, Identities = 54/218 (24%), Positives = 100/218 (45%)
  Q:    36 VITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTL--GTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLT 253
           ++T+ + L L     + K+L P++     +  + +   +   LV   +G     + P+I+++F +I + N+   V +   T  T++  ++GL  T+  G  ILG++  K  FF  F+        SG  + +     P  +   +    S+ +RL+AN +AG  +L +       MF      +     +I FS+F       L+  V  IQA+VF +LT
  S:    29 ILTVYLVLALHIMGSNNKQLIPSR----WSISLESSFASVHGLVKSQIGAANEMYLPFIYSLFFFILIANLSGNVPY-GFTVATSIMVSIGLSMTIFIGVTILGLRLHKVHFFSFFV-------PSGTPLGLVPLLVPIELISYLARAFSLGVRLFANTVAGHTLLKILSGFLAPMFTSG--AITAVITLIPFSIFIALIG--LEIAVSFIQAYVFCILT 232
>gi|11466378|ref|NP_038381.1| ATP synthase CF0 A subunit [Mesostigma viride] >gi|12585189|sp|Q9MUS9|ATPI_MESVI Chloroplast ATP synthase a chain precursor (ATPase subunit IV) >gi|7259521|gb|AAF43822.1|AF166114_34 CF0 subunit IV of ATP synthase [Mesostigma viride] (247 aa)
Score = 99, Expect = 3.7e-02, Identities = 60/241 (24%), Positives = 107/241 (44%)
  Q:    22 WKPFEYRSEITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKE-FIKFTPYIFTVFCYIFLCN---------IISVVGFE--NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYAL-PMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTE 262
           W+  ++      ++V   +MT+++    F  + L     P G   F+  +L   + L    +G+E +  + P+I T+F +IF+ N         +I +   E   PT     T AL L T++     G   +   +F +++        S   V++P       + D   P +S+S RL+ NI+A  L++G+   L P+V+         P P ++L  LF             +IQA +F  L   Y   + E
  S:    27 WQIGDFEVHGQVLLVSWFVMTIIISLSIFGTRNL--QTIPTGTQNFVEYVLEFIRDLAKTQIGEEDYRSWVPFIGTIFLFIFVSNWSGALVPWKLIEIPNGELAAPTNDINTTAALALLTSISYFYAGFSKKGLRYFKRYI--------SPTPVLLPINL----LEDFTKP-LSLSFRLFGNILADELVVGVLITLVPLVV---------PMP-LMLLGLFT-----------SAIQALIFATLAAAYIGEAVE 244
>gi|38638272|ref|NP_943689.1| ATP synthase F0 subunit 6 [Chara vulgaris] >gi|32966586|gb|AAP92169.1| ATP synthase F0 subunit 6 [Chara vulgaris] (252 aa)
Score = 99, Expect = 3.7e-02, Identities = 43/168 (25%), Positives = 76/168 (45%)
  Q:    89 KFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLF--YALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           +F P+IF  F ++  CN+I ++ +    T+   VTF L L   +G  I+G +     F    L         G  + +  F     +       +S+ +RL+AN+MAG  ++ +   +A  M+       +    P +I+F+L        L+  V  +QA+VF +L   Y
  S:    87 RFFPFIFVTFTFLLFCNLIGMIPYSFTVTSHFVVTFGLSLSLFIGVTIVGFQTHGLHFLSFLL-------PQGVPLPLAPFLVLLELISYCFRALSLGIRLFANMMAGHSLVKILSGFAWTMLSMGGIMYLAHLAPFLIVFALTG------LELGVAVLQAYVFTILICIY 244
>gi|19703706|ref|NP_603268.1| ATP synthase A chain, sodium ion specific [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >gi|19713830|gb|AAL94567.1| ATP synthase A chain, sodium ion specific [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] (218 aa)
Score = 99, Expect = 3.8e-02, Identities = 53/180 (29%), Positives = 79/180 (43%)
  Q:    81 EIMGKEFIKFTPYIFTVFCYIFLCNIISVV----------------GFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFY-ALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGS 260
           +I+G    K+  +  ++F +IFL NII+                   F  PTA    T  L L  T   I + IK    S + K              VM+P       +       ++IS+RL+ N+ AG +I+GL Y A+P  +    P  L                H + D   G +Q+FVFV L++ Y  GS
  S:    46 QILGVWKKKYYTFFASLFLFIFLSNIITFFPIPWFSIKNGIFTIYPAFRAPTADLNTTIGLALIVTTLFISINIKNNGVSGYLKGF-------ADPTPVMLP-----LNVVGEFAKPLNISMRLFGNMFAGMVIMGLIYMAVPYFV----PAAL----------------HLYFDLFAGLVQSFVFVTLSMVYVQGS 210
>gi|196185945|gb|EDX80921.1| ATP synthase F0, A subunit [Brevundimonas sp. BAL3] (261 aa)
Score = 98, Expect = 4.0e-02, Identities = 45/186 (24%), Positives = 78/186 (41%)
  Q:    71 LLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLF--YALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           + G    L   I+G E  K+ P++FT+F  I   NI+ +      T+   +T    L T    +++G       FF  F          G  + +            ++  ++++LRL+ N++ G + L +F  + + + +      V      V   SL  V     L++LV  +QAFVF VL   Y
  S:    70 VFGLIDNLADSIIGHEGRKYFPFVFTLFMLILGMNILGLFLTFTATSQLAITVTFALITFGLVLVVGFAKNGLGFFKLFW-------PMGAPLALRPVVGLIEFVSFLLRPVTLALRLFGNMLGGHVALKIFAGFVVSLGLLGLGGGVGLLAFPVAALSLGMVVALTALEFLVAFLQAFVFAVLACIY 250
>gi|2662060|dbj|BAA23682.1| proton-translocating ATPase, a subunit [Ruminococcus albus] (243 aa)
Score = 98, Expect = 4.0e-02, Identities = 55/228 (24%), Positives = 94/228 (41%)
  Q:    35 IVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYA----------LPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTE 262
           ++I ++  L L        K  P    + +A    N +     +V + MG++ + + PYI  +     L  +IS+VG  + TA   VT A  + T    +++     K++ F  +L  F              F  P  +   I    S++ RL+ N+  G +I GL Y+          L         +VL+ G   +L   F        D   G IQA++F  LT+   + + E
  S:    28 LIIAVVTLLCLCGLTKRPLKRSPRASAQIVAEMFVNFVNG---MVKQSMGEKMMYYAPYIGALLVSAVLGALISMVGLRSMTADINVTAAWAIVT---FVLITYTKIKTNGFLGYLKSFAQPVA---------FILPLNLISEIATPASMAFRLFGNVAGGMVITGLLYSALGAASTALHLHFEFASWAFSVLQVGIPAVLSIYF--------DLFSGCIQAYIFSTLTMVNVAAAAE 242
>gi|86134711|ref|ZP_01053293.1| ATP synthase A subunit [Tenacibaculum sp. MED152] >gi|85821574|gb|EAQ42721.1| ATP synthase A subunit [Polaribacter dokdonensis MED152] (378 aa)
Score = 98, Expect = 4.0e-02, Identities = 57/236 (24%), Positives = 112/236 (47%)
  Q:    33 SIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYE--IMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVM---------IPYFFNPF-----GITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVI--LFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTEPEEESQ 268
           ++  I ++  L+L +++   K+    + P G +  +  L+   +  + +  I  K + +FT Y+ TVF +I++ N++ ++ F  N T    VT AL +FT +                       + T SGNK           +P    PF      +  +I+   S+ +RL+ANI AG +++    +L  +MF    +    G   +  + S   +     ++ LV  +QA++F +L+  +   + E  EE+ 
  S:   154 TVFGILLVGLLMLFWFSRLAKQYKTKQIPTGFSRVLEPLIIYVRDEIAKPNIGEKHYRRFTGYLMTVFFFIWILNLLGMLPFGFNVTGQIAVTAALAIFTLV-----------------------VYTFSGNKGYWMHMIWMPGVPILIRPFLAIIELVGALIIKPFSLLVRLFANITAGHIVV---MSLIAIMFTLKESFGVAGATFLSSVLSFLII----LIEVLVAFLQAYIFTMLSALFIGMAVEEHEEAH 378
>gi|1352009|sp|P14862|ATP6_COCHE ATP synthase subunit a (ATPase protein 6) >gi|12870|emb|CAA31791.1| unnamed protein product [Cochliobolus heterostrophus] (257 aa)
Score = 98, Expect = 4.1e-02, Identities = 47/185 (25%), Positives = 83/185 (44%)
  Q:    78 LVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCYWSGSTE 262
           +V +I  K    + P+++T+F +I + N+I +V +    T+   +TF+L     LG  +LG K     FF  F+        +G  + +            +   +S+ LRL ANI++G ++L +       +          G   +L   F + F G L+  +  IQ+ VFVVL+  Y   + E
  S:    81 VVNQINNKNGQAYFPFMYTLFIFILINNLIGMVPYSFASTSHFILTFSLSFTVVLGATVLGFKEHGLKFFSLFV-------PAGCPLGLLPLLVLIEFISYLARNVSLGLRLAANILSGHMLLNILSGFTYNIMSSGIIFFILG---LLPLAFIIAFSG-LELGIAFIQSQVFVVLSCSYIKDALE 255
>gi|6652827|gb|AAF22492.1|AF098522_2 F1F0-ATPase subunit a [Lactobacillus acidophilus] (237 aa)
Score = 98, Expect = 4.1e-02, Identities = 56/228 (24%), Positives = 102/228 (44%)
  Q:    29 SEITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISV---------VGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGP-EVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           S +  ++ + + +  V +     MK   PNK      + +    G  K  V ++  ++ +    Y F +F +I+  N + +         V  ++PTA    T +  + T L +   G++        +F    Y+K    N      F  P  + +    ++++SLRL+ NI AG ++L L           +      GP  +IL +  A+ + GF    +GSIQA+VFV L++ Y
  S:    19 SLVQRLMALAVFLICVWLARKVEMK---PNKRQNVFEYLLDFTDGIVKDNVSDVDAQKHLSL--YAFVLFLFIWFMNQLGMFLEVKVDDWVFIKSPTADPVATMSFAMMTLLLSFTFGVQ--------RFGVGGYLK----NYAQPVGFLLPVNVIEEFTNFLTLSLRLYGNIYAGEVLLTLI---------GNDLAHAGGPFTLILAAPLAMVWQGF-SVFIGSIQAYVFVTLSMVY 229
>gi|194033270|ref|YP_002000382.1| CF0 subunit IV of ATP synthase [Oedogonium cardiacum] >gi|156618968|gb|ABU88161.1| ATP synthase CF0 subunit IV [Oedogonium cardiacum] >gi|186968887|gb|ACC97210.1| CF0 subunit IV of ATP synthase [Oedogonium cardiacum] (252 aa)
Score = 98, Expect = 4.3e-02, Identities = 44/184 (23%), Positives = 87/184 (47%)
  Q:    22 WKPFEYRSEITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMGKE-FIKFTPYIFTVFCYIFLCN---------IISVVGFE--NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYAL 205
           W+  +Y+     +I   I++  V+++   +   L P   P G+  F   +    + L    +G+E ++K+ P++ T+F ++F+ N         +I +   E   PT     T +L L T++     GI+ +   +F ++             +    F  P  + +     +S+S RL+ NI+A  LI+G+  AL
  S:    32 WQIGDYQLHGQVLITSWIVLGGVIIFTLLANSDLKP--LPVGLQNFTELVTEFIRDLAKTQIGEEEYLKWVPFLGTIFIFVFVSNWAGALLPWRLIELPNGELAAPTNDINTTVSLALLTSVSYFYAGIRKKGLGYFKRY-------------IQPVVFLLPLNVLEDFSKPLSLSFRLFGNILADELIVGVLVAL 212
>gi|113475845|ref|YP_721906.1| F0F1 ATP synthase subunit A [Trichodesmium erythraeum IMS101] >gi|110166893|gb|ABG51433.1| ATP synthase F0, A subunit [Trichodesmium erythraeum IMS101] (249 aa)
Score = 98, Expect = 4.3e-02, Identities = 44/165 (26%), Positives = 81/165 (49%)
  Q:    30 EITSIIVITIIMTLVLVYYNFSMKKLDPNKPPKGIAFFIFNLLGAFKTLVYEIMG-KEFIKFTPYIFTVFCYIFLCN---------IISVVGFE--NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMA 194
           +I   I++T    + L+     +  L+  + P G+  F+ ++L   ++L  + +G K++  + P+I T+F +IF+ N         +I +   E   PT+    T AL L T++     GI  +   +F            +G    +P F  PF I +     +S+S RL+ NI+A
  S:    30 KIHGQILLTSWFVIALILLAAFISSLNVQRIPSGMQNFMESVLEFIRSLTKDQIGEKDYRPWVPFIGTLFLFIFVSNWSGALVPWKVIELPSGELAAPTSDINTTVALALLTSIAYFYAGISKKGLGYF------------AGYAEPVP-FMVPFKIIEDFTKPLSLSFRLFGNILA 193
>gi|189095624|ref|YP_001936208.1| ATP synthase F0 subunit 6 [Keratoisidinae sp. BAL208-1] >gi|148540954|gb|ABQ86203.1| ATP synthase subunit 6 [Keratoisidinae sp. BAL208-1] (238 aa)
Score = 98, Expect = 4.3e-02, Identities = 49/182 (26%), Positives = 77/182 (42%)
  Q:    75 FKTLVYEIMGKEFIKFTPYIFTVFCYIFLCNIISVVGFE-NPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDWLVGSIQAFVFVVLTLCY 256
           F  LV +    +  ++   I T+F +I   N+  +  +   PTA   VTF L L   +   ILGI   + +F    +        SG  +++            I   IS+ +RL AN+ AG L+  +  +    M      VL  GP +++       F   L+  V  IQA+VF +LT  Y
  S:    61 FLGLVKDSTANKGTQYFTLIITLFVFIAGLNLFGLFPYVFTPTAHIIVTFGLSLSILMAVTILGITRFRWNFASMMM-------PSGAPLLLAPLLVIIETISYISRAISLGVRLAANLSAGHLLFAILASFGFAMISNGMLVLSLGPILVMV------FITLLEIAVALIQAYVFCLLTAIY 230
>gi|170718145|ref|YP_001785174.1| ATP synthase F0, A subunit [Haemophilus somnus 2336] >gi|168826274|gb|ACA31645.1| ATP synthase F0, A subunit [Haemophilus somnus 2336] (265 aa)
Score = 98, Expect = 4.3e-02, Identities = 44/164 (26%), Positives = 79/164 (48%)
  Q:    95 FTVFCYIFLCNIISVVGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPF-------------GITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFH---GFLDWLVGSIQAFVFVVLTLCYWS 258
            T+FC++F+ N I ++  + P     +   +     + T  +      S   +  +  + IK+K     +  Y  +PF              +T +  P IS++ RL+ N+ AG LI    + L  VM+  D  +    P+V+      +P H        LV ++QAF+F++LT+ Y S
  S:    93 LTIFCWVFIMNAIDLIPVDFPPQFAEL-LGIHYLRAVPTADISATLGMSVCVFALIIFYTIKSKGLGGFVKEYTLHPFNHWAFIPVNFLLEAVTLLAKP-ISLAFRLFGNMYAGELI----FVLIAVMYMADNII----PQVL-----GIPLHLIWAIFHILVITLQAFIFMMLTVVYLS 257
>gi|1168556|sp|P42010|ATP6_BACST ATP synthase a chain (ATPase protein 6) >gi|534857|dbj|BAA07250.1| ATPase subunit a [Geobacillus stearothermophilus] (236 aa)
Score = 98, Expect = 4.4e-02, Identities = 47/168 (27%), Positives = 81/168 (48%)
  Q:    89 KFTPYIFTVFCYIFLCNIISV---------VGFENPTALTTVTFALGLFTTLGTIILGIKYQKSSFFYKFLFKFYIKTKSGNKVMIPYFFNPFGITDIIMPWISISLRLWANIMAGALILGLFYALPMVMFRRDPTVLEPGPEVILFSLFAVPFHGFLDW-----LVGSIQAFVFVVLTLCY 256
           +F     T+  Y+F+ N++ +         + +++PTA  TVT  L +     T   G+K + +S +     + Y +        + + F P  I +     +++ LRL+ NI AG ++LGL  +L              G    +  L AV  H  + W      VG+IQAF+F +LT+ Y
  S:    74 RFLTLGVTLIMYVFVANMLGLPFSVHVNGELWWKSPTADATVTLTLAVMVVALTHYYGVKMKGASDY----LRDYTRP-------VAWLF-PLKIIEEFANTLTLGLRLFGNIYAGEILLGLLASL--------------GTHYGV--LGAVGEHSMMVWQAFSIFVGTIQAFIFTMLTMVY 227