>gi|26553509|ref|NP_757443.1| ATP synthase subunit C [Mycoplasma penetrans HF-2] >gi|26453515|dbj|BAC43847.1| ATP synthase subunit C [Mycoplasma penetrans HF-2] (78 aa)
Score = 301, Expect = 3.2e-26, Identities = 78/78 (100%), Positives = 78/78 (100%)
  Q:     1 MNITNQGYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVFVAR 78
           MNITNQGYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVFVAR
  S:     1 MNITNQGYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVFVAR 78
>gi|110004061|emb|CAK98400.1| putative atp synthase c chain transmembrane protein [Spiroplasma citri] (100 aa)
Score = 187, Expect = 5.5e-13, Identities = 41/71 (57%), Positives = 58/71 (81%)
  Q:     6 QGYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVFV 76
           +G + +GAGLA I   G GIGQG++  K+VEA+ARNPEV SK+R+QYI++AA+TE+G++Y  +IAI+L FV
  S:    28 KGMSLLGAGLAAIGCCGSGIGQGYTGGKAVEAIARNPEVESKVRTQYIIAAAITESGSIYALVIAIILAFV 98
>gi|144575098|gb|AAZ43822.2| ATP synthase C chain [Mycoplasma synoviae 53] (111 aa)
Score = 172, Expect = 2.6e-11, Identities = 39/72 (54%), Positives = 57/72 (79%)
  Q:     7 GYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVFVAR 78
           G   +GAGLAMI  +G G+GQG++A K+VEAV RNPE++SKIR+ +I+ A + ET ++Y FI+A+LL+FV +
  S:    40 GVVAVGAGLAMIGAIGSGLGQGYAAGKTVEAVGRNPEMISKIRATFIIGAGIAETASIYSFIVALLLIFVGK 111
>gi|71894425|ref|YP_278533.1| ATP synthase C chain [Mycoplasma synoviae 53] (105 aa)
Score = 167, Expect = 1.1e-10, Identities = 39/72 (54%), Positives = 57/72 (79%)
  Q:     7 GYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVFVAR 78
           G   +GAGLAMI  +G G+GQG++A K+VEAV RNPE++SKIR+ +I+ A + ET ++Y FI+A+LL+FV +
  S:    34 GVVAVGAGLAMIGAIGSGLGQGYAAGKTVEAVGRNPEMISKIRATFIIGAGIAETASIYSFIVALLLIFVGK 105
>gi|15828742|ref|NP_326102.1| ATP synthase C chain [Mycoplasma pulmonis UAB CTIP] >gi|14089684|emb|CAC13444.1| ATP SYNTHASE C CHAIN [Mycoplasma pulmonis] (92 aa)
Score = 164, Expect = 2.3e-10, Identities = 41/73 (56%), Positives = 51/73 (69%)
  Q:     4 TNQGYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVFV 76
           T  G   +GAGLA I   G G+GQG SA ++ EAV RNPE + KIRS  I+  A++E+ +LY FIIAILLVFV
  S:    19 TGAGLVAVGAGLASIGNFGTGLGQGLSAGRAAEAVGRNPEAIKKIRSLMIIGMAISESASLYSFIIAILLVFV 91
>gi|72080390|ref|YP_287448.1| F0F1 ATP synthase subunit C [Mycoplasma hyopneumoniae 7448] >gi|71913514|gb|AAZ53425.1| ATP synthase C chain [Mycoplasma hyopneumoniae 7448] (101 aa)
Score = 154, Expect = 3.2e-09, Identities = 30/72 (41%), Positives = 54/72 (75%)
  Q:     6 QGYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVFVA 77
           + +A++GAGLAMI ++GVG GQG++A K+ +A+ARNPE   ++    ++  A++ET ++Y  ++A++L+FV 
  S:    30 KAFAYLGAGLAMIGVIGVGAGQGYAAGKACDAIARNPEAQKQVFRVLVIGTAISETSSIYALLVALILIFVG 101
>gi|71893403|ref|YP_278849.1| F0F1 ATP synthase subunit C [Mycoplasma hyopneumoniae J] >gi|71851530|gb|AAZ44138.1| ATP synthase C chain [Mycoplasma hyopneumoniae J] (101 aa)
Score = 154, Expect = 3.6e-09, Identities = 30/72 (41%), Positives = 54/72 (75%)
  Q:     6 QGYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVFVA 77
           + +A++GAGLAMI ++GVG GQG++A K+ +A+ARNPE   ++    ++  A++ET ++Y  ++A++L+FV 
  S:    30 KAFAYLGAGLAMIGVIGVGAGQGYAAGKACDAIARNPEAQKQVFRVLVIGTAISETSSIYALLVALILIFVG 101
>gi|54020001|ref|YP_115565.1| F0F1 ATP synthase subunit C [Mycoplasma hyopneumoniae 232] >gi|53987174|gb|AAV27375.1| ATP synthase C chain [Mycoplasma hyopneumoniae 232] (101 aa)
Score = 154, Expect = 3.6e-09, Identities = 30/72 (41%), Positives = 54/72 (75%)
  Q:     6 QGYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVFVA 77
           + +A++GAGLAMI ++GVG GQG++A K+ +A+ARNPE   ++    ++  A++ET ++Y  ++A++L+FV 
  S:    30 KAFAYLGAGLAMIGVIGVGAGQGYAAGKACDAIARNPEAQKQVFRVLVIGTAISETSSIYALLVALILIFVG 101
>gi|47459049|ref|YP_015911.1| ATP synthase c chain [Mycoplasma mobile 163K] >gi|47458378|gb|AAT27700.1| ATP synthase c chain [Mycoplasma mobile 163K] (99 aa)
Score = 152, Expect = 6.6e-09, Identities = 40/70 (57%), Positives = 48/70 (68%)
  Q:     7 GYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVFV 76
           G   +GAGLAMI  LG G+GQG SA K+ EAV RNPE  +KIR   I+   + ET A+Y  IIAILL+FV
  S:    29 GLVAVGAGLAMIGALGTGLGQGVSAGKAAEAVGRNPEAEAKIRLMMIIGMGIAETAAIYSLIIAILLIFV 98
>gi|193216467|ref|YP_001999709.1| ATP synthase C chain [Mycoplasma arthritidis 158L3-1] >gi|193001790|gb|ACF07005.1| ATP synthase C chain [Mycoplasma arthritidis 158L3-1] (90 aa)
Score = 150, Expect = 1.0e-08, Identities = 36/70 (51%), Positives = 50/70 (71%)
  Q:     7 GYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVFV 76
           G   + AGLA++    V +GQG + AK+VEA+ RNPE  SKIRS  I+  A+ ET ++YCFIIA+L++FV
  S:    21 GLTMVAAGLAIMGAGVVSVGQGMAVAKAVEAIGRNPEATSKIRSTLIMGLAIVETASIYCFIIALLIIFV 90
>gi|160914783|ref|ZP_02076997.1| hypothetical protein EUBDOL_00790 [Eubacterium dolichum DSM 3991] >gi|158433323|gb|EDP11612.1| hypothetical protein EUBDOL_00790 [Eubacterium dolichum DSM 3991] (80 aa)
Score = 148, Expect = 1.6e-08, Identities = 38/70 (54%), Positives = 50/70 (71%)
  Q:     6 QGYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +G A +GAG+AMIA LG GIGQG +A+K  EAV RNPE   KIRS  +L  A+ ET  +Y  +IA++L+F
  S:     8 KGMAMLGAGIAMIAGLGPGIGQGIAASKGAEAVGRNPEAAGKIRSIMVLGIAMAETTGIYALVIALILIF 77
>gi|167755043|ref|ZP_02427170.1| hypothetical protein CLORAM_00547 [Clostridium ramosum DSM 1402] >gi|167705093|gb|EDS19672.1| hypothetical protein CLORAM_00547 [Clostridium ramosum DSM 1402] (75 aa)
Score = 147, Expect = 2.3e-08, Identities = 38/74 (51%), Positives = 55/74 (74%)
  Q:     3 ITNQGYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVFV 76
           +T+ G   IGAG+A+ A LG GIG+G  A+K+VEA+ RNPE+  KIR+  IL  A+TET A+Y  +I+++L+FV
  S:     1 MTDVGLIAIGAGIAVCAGLGTGIGEGICASKAVEALGRNPEMEGKIRTLMILGIALTETAAIYGLLISLILLFV 74
>gi|83319513|ref|YP_424074.1| ATP synthase F0, subunit c [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|83283399|gb|ABC01331.1| ATP synthase F0, subunit c [Mycoplasma capricolum subsp. capricolum ATCC 27343] (101 aa)
Score = 146, Expect = 3.3e-08, Identities = 35/67 (52%), Positives = 49/67 (73%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVFV 76
           +IGAGLA + ILG G+GQG     +  A+ RNPE+ SK+ S  I+SA ++E+GA+Y  +IAILL+FV
  S:    34 YIGAGLASVGILGTGVGQGLIGQGACLAIGRNPEMASKVTSTMIVSAGISESGAIYSLVIAILLIFV 100
>gi|42561408|ref|NP_975859.1| ATP synthase C chain [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|42492906|emb|CAE77501.1| ATP SYNTHASE C CHAIN [Mycoplasma mycoides subsp. mycoides SC str. PG1] (101 aa)
Score = 145, Expect = 3.4e-08, Identities = 35/67 (52%), Positives = 49/67 (73%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVFV 76
           +IGAGLA + ILG G+GQG     +  A+ RNPE+ SK+ S  I+SA ++E+GA+Y  +IAILL+FV
  S:    34 YIGAGLASVGILGTGVGQGLIGQGACLAIGRNPEMASKVTSTMIVSAGISESGAIYSLVIAILLIFV 100
>gi|167924980|ref|ZP_02512071.1| ATP SYNTHASE C CHAIN [Mycoplasma mycoides subsp. mycoides LC str. GM12] (101 aa)
Score = 145, Expect = 3.6e-08, Identities = 35/67 (52%), Positives = 49/67 (73%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVFV 76
           +IGAGLA + ILG G+GQG     +  A+ RNPE+ SK+ S  I+SA ++E+GA+Y  +IAILL+FV
  S:    34 YIGAGLASVGILGTGVGQGLIGQGACLAIGRNPEMASKVTSTMIVSAGISESGAIYSLVIAILLIFV 100
>gi|169335788|ref|ZP_02862981.1| hypothetical protein ANASTE_02213 [Anaerofustis stercorihominis DSM 17244] >gi|169258526|gb|EDS72492.1| hypothetical protein ANASTE_02213 [Anaerofustis stercorihominis DSM 17244] (84 aa)
Score = 143, Expect = 6.0e-08, Identities = 33/70 (47%), Positives = 47/70 (67%)
  Q:     7 GYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVFV 76
            ++ +GAGLAMI  LG G+GQG +  K+ E+VAR PE    I    ++  AV ET A+YC +IA++L+FV
  S:    11 AFSALGAGLAMIGALGTGVGQGNATGKACESVARQPEAEGTILRTLLVGCAVAETSAIYCLVIALILLFV 80
>gi|167750152|ref|ZP_02422279.1| hypothetical protein EUBSIR_01121 [Eubacterium siraeum DSM 15702] >gi|167656895|gb|EDS01025.1| hypothetical protein EUBSIR_01121 [Eubacterium siraeum DSM 15702] (93 aa)
Score = 141, Expect = 1.1e-07, Identities = 35/69 (50%), Positives = 45/69 (65%)
  Q:     7 GYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           G + IGAGLAMIA LG GIG+G+   K+VEA+ R PE    I    I+  A+ ET  LY  +IA+LL+F
  S:    17 GASAIGAGLAMIAGLGPGIGEGFCGGKAVEAIGRQPEASGAITRTMIIGDALAETTGLYSLVIALLLMF 85
>gi|169351556|ref|ZP_02868494.1| hypothetical protein CLOSPI_02336 [Clostridium spiroforme DSM 1552] >gi|169291778|gb|EDS73911.1| hypothetical protein CLOSPI_02336 [Clostridium spiroforme DSM 1552] (77 aa)
Score = 141, Expect = 1.2e-07, Identities = 38/74 (51%), Positives = 52/74 (70%)
  Q:     3 ITNQGYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVFV 76
           +T+ G   I AG+A+ A LG GIG+G  A+K+VEA+ RNPE   KIR+  IL  A+TET A+Y  +I+ LL+FV
  S:     1 MTDVGLIAIAAGIAVCAGLGTGIGEGICASKAVEAIGRNPEAEGKIRTTMILGIALTETVAIYGLLISFLLLFV 74
>gi|50364925|ref|YP_053350.1| ATP synthase subunit C [Mesoplasma florum L1] >gi|50363481|gb|AAT75466.1| ATP synthase subunit C [Mesoplasma florum L1] (104 aa)
Score = 141, Expect = 1.2e-07, Identities = 34/74 (45%), Positives = 50/74 (67%)
  Q:     4 TNQGYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVFVA 77
           T +G   +GAG+A+I + G GIGQG     +  A+ RNPE+  KI S  I++A + E+GA+Y  ++AILL+FVA
  S:    31 TGEGLKLLGAGVAIIGVAGAGIGQGAVGQGACMAIGRNPEMAPKITSTMIIAAGIAESGAIYALVVAILLIFVA 104
>gi|34763447|ref|ZP_00144394.1| ATP synthase C chain, sodium ion specific [Fusobacterium nucleatum subsp. vincentii ATCC 49256] >gi|27886888|gb|EAA24013.1| ATP synthase C chain, sodium ion specific [Fusobacterium nucleatum subsp. vincentii ATCC 49256] (89 aa)
Score = 138, Expect = 2.7e-07, Identities = 35/69 (50%), Positives = 49/69 (71%)
  Q:     7 GYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           G + +GAGLAMIA LG GIG+G++A K+VE+VAR PE    I S  IL  AV E+  +Y  +IA++L++
  S:    12 GCSAVGAGLAMIAGLGPGIGEGYAAGKAVESVARQPEARGSIISTMILGQAVAESTGIYSLVIALILLY 80
>gi|13508342|ref|NP_110292.1| F0F1 ATP synthase subunit C [Mycoplasma pneumoniae M129] >gi|2493074|sp|Q59550|ATPL_MYCPN ATP synthase C chain (Lipid-binding protein) >gi|1209761|gb|AAC43654.1| ATP synthase c chain >gi|1673907|gb|AAB95887.1| ATP synthase C chain [Mycoplasma pneumoniae M129] (105 aa)
Score = 137, Expect = 3.5e-07, Identities = 30/69 (43%), Positives = 49/69 (71%)
  Q:     9 AFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVFVA 77
           A+IGAG+ M+    VG+GQG+   K+VEAVARNPEV  ++     + +A++E+ ++Y  +IA +L+FV+
  S:    35 AYIGAGITMVGGATVGLGQGYIFGKAVEAVARNPEVEKQVFKLIFIGSAISESSSIYSLLIAFILIFVS 103
>gi|19703705|ref|NP_603267.1| F0F1 ATP synthase subunit C [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >gi|19713829|gb|AAL94566.1| ATP synthase C chain, sodium ion specific [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] (89 aa)
Score = 136, Expect = 3.7e-07, Identities = 35/69 (50%), Positives = 49/69 (71%)
  Q:     7 GYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           G + +GAGLAMIA LG GIG+G++A K+VE+VAR PE    I S  IL  AV E+  +Y  +IA++L++
  S:    12 GCSAVGAGLAMIAGLGPGIGEGYAAGKAVESVARQPEARGSIISTMILGQAVAESTGIYSLVIALILLY 80
>gi|148322976|gb|EDK88226.1| F-type two-sector ATPase, F(0) subunit C [Fusobacterium nucleatum subsp. polymorphum ATCC 10953] (89 aa)
Score = 136, Expect = 3.8e-07, Identities = 35/69 (50%), Positives = 49/69 (71%)
  Q:     7 GYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           G + +GAGLAMIA LG GIG+G++A K+VE+VAR PE    I S  IL  AV E+  +Y  +IA++L++
  S:    12 GCSAVGAGLAMIAGLGPGIGEGYAAGKAVESVARQPEARGSIISTMILGQAVAESTGIYSLVIALILLY 80
>gi|89210208|ref|ZP_01188600.1| ATP synthase F0, C subunit [Halothermothrix orenii H 168] >gi|89160281|gb|EAR79937.1| ATP synthase F0, C subunit [Halothermothrix orenii H 168] (83 aa)
Score = 136, Expect = 4.3e-07, Identities = 34/67 (50%), Positives = 48/67 (71%)
  Q:     9 AFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           + +GAG+AM+A +G GIGQG++A K+VEAVAR PE    I +  +L  AV E+  +Y  +IAILL+F
  S:    17 SLLGAGIAMVAGIGPGIGQGYAAGKAVEAVARQPEARGNILTTMLLGQAVAESTGIYSLVIAILLIF 83
>gi|12045266|ref|NP_073077.1| F0F1 ATP synthase subunit C [Mycoplasma genitalium G37] >gi|66880520|ref|ZP_00405501.1| COG0636: F0F1-type ATP synthase, subunit c/Archaeal/vacuolar-type H+-ATPase, subunit K [Mycoplasma genitalium G-37] >gi|1352047|sp|P47644|ATPL_MYCGE ATP synthase C chain (Lipid-binding protein) >gi|3844996|gb|AAC71632.1| ATP synthase F0, C subunit [Mycoplasma genitalium G37] >gi|166079033|gb|ABY79651.1| ATP synthase F0, C subunit [synthetic Mycoplasma genitalium JCVI-1.0] (102 aa)
Score = 136, Expect = 4.7e-07, Identities = 34/69 (49%), Positives = 50/69 (72%)
  Q:     9 AFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVFVA 77
           A+IGAG+ MIA   VGIGQG+   K+VEA+ARNPEV  ++     + +AV+E+ A+Y  +I+ +L+FVA
  S:    32 AYIGAGVTMIAGSTVGIGQGYIFGKAVEAIARNPEVEKQVFKLIFIGSAVSESTAIYGLLISFILIFVA 100
>gi|168333939|ref|ZP_02692171.1| ATP synthase F0, C subunit [Epulopiscium sp. 'N.t. morphotype B'] (87 aa)
Score = 135, Expect = 5.0e-07, Identities = 36/65 (55%), Positives = 45/65 (69%)
  Q:    11 IGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           IGAGLAMIA +G GIGQG++A K  EAV R PE  S +    +L AAV ET  +Y  I+AI+L+F
  S:    15 IGAGLAMIAGIGPGIGQGYAAGKGAEAVGRQPEAQSDVVRTMLLGAAVAETTGIYGLIVAIILLF 79
>gi|4713918|gb|AAC45088.2| F1FO ATPase c2 subunit [Acetobacterium woodii] >gi|6014715|gb|AAF01475.1| F1FO ATPase c3 subunit [Acetobacterium woodii] (82 aa)
Score = 135, Expect = 5.2e-07, Identities = 35/65 (53%), Positives = 45/65 (69%)
  Q:    11 IGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           IGAG+AMIA +G GIGQG++A K  EAV R PE  S I    +L AAV ET  +Y  I+A++L+F
  S:    13 IGAGIAMIAGVGPGIGQGFAAGKGAEAVGRQPEAQSDIIRTMLLGAAVAETTGIYGLIVALILLF 77
>gi|158321585|ref|YP_001514092.1| F0F1 ATP synthase subunit C [Alkaliphilus oremlandii OhILAs] >gi|158141784|gb|ABW20096.1| ATP synthase F0, C subunit [Alkaliphilus oremlandii OhILAs] (88 aa)
Score = 129, Expect = 2.6e-06, Identities = 35/65 (53%), Positives = 42/65 (64%)
  Q:    11 IGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           IGAGLAMIA LG GIGQG +A K  EAV R PE    I    +L  AV ET  +Y  +IA++L+F
  S:    16 IGAGLAMIAGLGPGIGQGIAAGKGAEAVGRQPEAQGDILRTMLLGQAVAETTGIYSLVIALILLF 80
>gi|150388188|ref|YP_001318237.1| F0F1 ATP synthase subunit C [Alkaliphilus metalliredigens QYMF] >gi|149948050|gb|ABR46578.1| ATP synthase F0, C subunit [Alkaliphilus metalliredigens QYMF] (88 aa)
Score = 129, Expect = 2.7e-06, Identities = 35/65 (53%), Positives = 43/65 (66%)
  Q:    11 IGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           IGAGLAMIA +G GIGQG++A K  E V R PE    I    +L AAV ET  +Y  IIA++L+F
  S:    16 IGAGLAMIAGIGPGIGQGYAAGKGAEGVGRQPEAQGDIVRTMLLGAAVAETTGIYGLIIALILLF 80
>gi|160942710|ref|ZP_02089952.1| hypothetical protein FAEPRAM212_00186 [Faecalibacterium prausnitzii M21/2] >gi|158445984|gb|EDP22987.1| hypothetical protein FAEPRAM212_00186 [Faecalibacterium prausnitzii M21/2] (93 aa)
Score = 129, Expect = 3.1e-06, Identities = 33/67 (49%), Positives = 46/67 (68%)
  Q:    11 IGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVFVA 77
           IGAG A+IA +G GIG+G +AA + EAV R PE  S + S  IL  A++ET  +Y F+  +LL+F+A
  S:    18 IGAGCALIAGIGPGIGEGNAAAAACEAVGRQPECKSDVTSTLILGVALSETTGIYGFVTGLLLIFLA 84
>gi|153809942|ref|ZP_01962610.1| hypothetical protein RUMOBE_00323 [Ruminococcus obeum ATCC 29174] >gi|149834120|gb|EDM89200.1| hypothetical protein RUMOBE_00323 [Ruminococcus obeum ATCC 29174] (92 aa)
Score = 128, Expect = 3.3e-06, Identities = 30/67 (44%), Positives = 44/67 (65%)
  Q:    11 IGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVFVA 77
           IGAG A+IA +G GIG+G + A ++EA+ R PE    + S  +L  A+ ET  +Y F+  +LL+FVA
  S:    17 IGAGCALIAGIGPGIGEGNAVASALEAIGRQPECKGDVTSTMLLGCAIAETTGIYGFVTGLLLIFVA 83
>gi|2662061|dbj|BAA23683.1| proton-translocating ATPase, c subunit [Ruminococcus albus] (87 aa)
Score = 128, Expect = 3.8e-06, Identities = 27/69 (39%), Positives = 46/69 (66%)
  Q:     7 GYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           G + +GAGLAMIA +G GIG+G++  K++E++AR PE          +  A+ E+  +Y F++A++L+F
  S:    10 GCSALGAGLAMIAGIGPGIGEGYAVGKTIESIARQPEAQGDCTRTMFIGVAMAESTGIYAFVVALILMF 78
>gi|31544505|ref|NP_853083.1| hypothetical protein MGA_1167 [Mycoplasma gallisepticum R] >gi|33860136|sp|P33258|ATPL_MYCGA ATP synthase C chain (Lipid-binding protein) >gi|31541350|gb|AAP56651.1| AtpE [Mycoplasma gallisepticum R] (96 aa)
Score = 127, Expect = 4.9e-06, Identities = 37/78 (47%), Positives = 57/78 (73%)
  Q:     1 MNITNQGYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVFVAR 78
           + +TN   A+IGAG+AM A  GVG+GQG+++     A+ARNPE++ KI+  +I+ +A+ E+ A+Y  IIA +L+FVAR
  S:    19 VTLTNHVGAYIGAGMAMTAAAGVGVGQGFASGLCATALARNPELLPKIQLFWIVGSAIAESSAIYGLIIAFILIFVAR 96
>gi|6014714|gb|AAF01474.1| F1FO ATPase c1 subunit [Acetobacterium woodii] (182 aa)
Score = 126, Expect = 6.0e-06, Identities = 31/70 (44%), Positives = 48/70 (68%)
  Q:     6 QGYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +G++ +G GLAM+A +G GIGQG++A K  EAV +NP   + I    +L AAV ET  ++  +IA++L+F
  S:    25 KGFSALGIGLAMVAGVGPGIGQGFAAGKGAEAVGKNPTKSNDIVMIMLLGAAVAETSGIFSLVIALILLF 94
Score = 107, Expect = 8.4e-04, Identities = 27/65 (41%), Positives = 42/65 (64%)
  Q:    11 IGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           + +G+AMIA +G G GQG++A K  EAV   PE+ S I    +L  AV +T  +Y  I+A++L++
  S:   113 MASGIAMIAGIGPGTGQGYAAGKGAEAVGIRPEMKSAILRVMLLGQAVAQTTGIYALIVALILMY 177
>gi|44297|emb|CAA45546.1| adenosinetriphosphatase [Mycoplasma gallisepticum] (96 aa)
Score = 125, Expect = 7.3e-06, Identities = 36/78 (46%), Positives = 57/78 (73%)
  Q:     1 MNITNQGYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVFVAR 78
           + +TN   A+IGAG+AM A  GVG+GQG+++     A+ARNPE++ KI+  +I+ +A+ E+ ++Y  IIA +L+FVAR
  S:    19 VTLTNHVGAYIGAGMAMTAAAGVGVGQGFASGLCATALARNPELLPKIQLFWIVGSAIAESSSIYGLIIAFILIFVAR 96
>gi|167941892|ref|ZP_02528967.1| ATP synthase F0, C subunit [Ureaplasma urealyticum serovar 8] >gi|167959547|ref|ZP_02546617.1| ATP synthase F0, C subunit [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gi|167972503|ref|ZP_02554780.1| ATP synthase F0, C subunit family protein [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|167974524|ref|ZP_02556801.1| ATP synthase F0, C subunit family protein [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|167975073|ref|ZP_02557350.1| ATP synthase F0, C subunit family protein [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|167988347|ref|ZP_02570018.1| ATP synthase F0, C subunit family protein [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|168337476|ref|ZP_02694091.1| ATP synthase F0, C subunit [Ureaplasma urealyticum serovar 10] >gi|168362153|ref|ZP_02695332.1| ATP synthase F0, C subunit family protein [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|168807699|ref|ZP_02828758.1| ATP synthase F0, C subunit [Ureaplasma urealyticum serovar 2] >gi|195867727|ref|ZP_03079728.1| ATP synthase F0, C subunit family protein [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|171903575|gb|EDT49864.1| ATP synthase F0, C subunit family protein [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|184209439|gb|EDU06482.1| ATP synthase F0, C subunit family protein [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188018794|gb|EDU56834.1| ATP synthase F0, C subunit family protein [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188997901|gb|EDU66998.1| ATP synthase F0, C subunit family protein [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|195659995|gb|EDX53375.1| ATP synthase F0, C subunit family protein [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|195660582|gb|EDX53838.1| ATP synthase F0, C subunit family protein [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (109 aa)
Score = 125, Expect = 8.5e-06, Identities = 33/68 (48%), Positives = 47/68 (69%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVFVA 77
           +IG G+ M+A   VG+ QG+S A +V+AVARNPE   KI S  I+  A+ E  A+Y  I++IL++FVA
  S:    42 YIGTGITMLAAGAVGLMQGFSTANAVQAVARNPEAQPKILSTMIVGLALAEAVAIYALIVSILIIFVA 109
>gi|118445005|ref|YP_879001.1| F0F1 ATP synthase subunit C [Clostridium novyi NT] >gi|168185927|ref|ZP_02620562.1| ATP synthase F0 subunit c [Clostridium botulinum C str. Eklund] >gi|118135461|gb|ABK62505.1| ATP synthase F0 subunit c [Clostridium novyi NT] >gi|169296143|gb|EDS78276.1| ATP synthase F0 subunit c [Clostridium botulinum C str. Eklund] (84 aa)
Score = 125, Expect = 8.7e-06, Identities = 37/69 (53%), Positives = 47/69 (68%)
  Q:     7 GYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           G   IGAGLA IA +G GIG G + AK+VE V+R PE   KI S  I+ +A++E  A+Y F+IAILLV 
  S:    10 GMCAIGAGLASIACIGGGIGTGNATAKAVEGVSRQPEASGKILSTMIIGSALSEATAIYGFLIAILLVL 78
>gi|13357693|ref|NP_077967.1| ATP synthase C chain [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|167972129|ref|ZP_02554406.1| ATP synthase F0, C subunit family protein [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|168282254|ref|ZP_02689921.1| ATP synthase F0, C subunit [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|168308404|ref|ZP_02691079.1| ATP synthase F0, C subunit [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|170762112|ref|YP_001752219.1| ATP synthase F0, C subunit [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|17367034|sp|Q9PR08|ATPL_UREPA ATP synthase C chain (Lipid-binding protein) >gi|11356744|pir||G82929 ATP synthase C chain UU136 [imported] - Ureaplasma urealyticum >gi|6899095|gb|AAF30542.1|AE002114_9 ATP synthase C chain [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168827689|gb|ACA32951.1| ATP synthase F0, C subunit [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171902625|gb|EDT48914.1| ATP synthase F0, C subunit [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|182675799|gb|EDT87704.1| ATP synthase F0, C subunit [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186700696|gb|EDU18978.1| ATP synthase F0, C subunit family protein [Ureaplasma parvum serovar 6 str. ATCC 27818] (109 aa)
Score = 124, Expect = 9.0e-06, Identities = 33/68 (48%), Positives = 47/68 (69%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVFVA 77
           +IG G+ M+A   VG+ QG+S A +V+AVARNPE   KI S  I+  A+ E  A+Y  I++IL++FVA
  S:    42 YIGTGITMLAAGAVGLMQGFSTANAVQAVARNPEAQPKILSTMIVGLALAEAVAIYALIVSILIIFVA 109
>gi|66360700|pdb|1YCE|A Chain A, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus >gi|66360701|pdb|1YCE|B Chain B, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus >gi|66360702|pdb|1YCE|C Chain C, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus >gi|66360703|pdb|1YCE|D Chain D, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus >gi|66360704|pdb|1YCE|E Chain E, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus >gi|66360705|pdb|1YCE|F Chain F, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus >gi|66360706|pdb|1YCE|G Chain G, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus >gi|66360707|pdb|1YCE|H Chain H, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus >gi|66360708|pdb|1YCE|I Chain I, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus >gi|66360709|pdb|1YCE|J Chain J, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus >gi|66360710|pdb|1YCE|K Chain K, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus >gi|66360711|pdb|1YCE|L Chain L, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus >gi|66360712|pdb|1YCE|M Chain M, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus >gi|66360713|pdb|1YCE|N Chain N, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus >gi|66360714|pdb|1YCE|O Chain O, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus >gi|66360715|pdb|1YCE|P Chain P, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus >gi|66360716|pdb|1YCE|Q Chain Q, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus >gi|66360717|pdb|1YCE|R Chain R, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus >gi|66360718|pdb|1YCE|S Chain S, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus >gi|66360719|pdb|1YCE|T Chain T, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus >gi|66360720|pdb|1YCE|U Chain U, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus >gi|66360721|pdb|1YCE|V Chain V, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus >gi|66360722|pdb|1YCE|AA Chain a, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus >gi|66360723|pdb|1YCE|BB Chain b, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus >gi|66360724|pdb|1YCE|CC Chain c, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus >gi|66360725|pdb|1YCE|DD Chain d, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus >gi|66360726|pdb|1YCE|EE Chain e, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus >gi|66360727|pdb|1YCE|FF Chain f, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus >gi|66360728|pdb|1YCE|GG Chain g, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus >gi|66360729|pdb|1YCE|HH Chain h, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus >gi|66360730|pdb|1YCE|II Chain i, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus >gi|66360731|pdb|1YCE|JJ Chain j, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus >gi|66360732|pdb|1YCE|KK Chain k, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus >gi|66360733|pdb|1YCE|LL Chain l, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus >gi|66360734|pdb|1YCE|MM Chain m, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus >gi|66360735|pdb|1YCE|NN Chain n, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus >gi|66360736|pdb|1YCE|OO Chain o, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus >gi|66360737|pdb|1YCE|PP Chain p, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus >gi|66360738|pdb|1YCE|QQ Chain q, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus >gi|66360739|pdb|1YCE|RR Chain r, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus >gi|66360740|pdb|1YCE|SS Chain s, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus >gi|66360741|pdb|1YCE|TT Chain t, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus >gi|66360742|pdb|1YCE|UU Chain u, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus >gi|66360743|pdb|1YCE|VV Chain v, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus >gi|22266794|gb|AAM94908.1|AF522463_3 subunit c [Ilyobacter tartaricus] (89 aa)
Score = 124, Expect = 9.0e-06, Identities = 31/65 (47%), Positives = 46/65 (70%)
  Q:    11 IGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +GAG AMIA +G G+GQG++A K+VE+VAR PE    I S  +L  AV E+  +Y  +IA++L++
  S:    16 VGAGTAMIAGIGPGVGQGYAAGKAVESVARQPEAKGDIISTMVLGQAVAESTGIYSLVIALILLY 80
>gi|77964176|gb|ABB13421.1| ATP synthase subunit c [Clostridium paradoxum] (84 aa)
Score = 124, Expect = 9.2e-06, Identities = 32/65 (49%), Positives = 44/65 (67%)
  Q:    11 IGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           IGAGLAMIA +G GIGQG++A K  EAV + PE    I    +L AAV E+  +Y  ++A++L+F
  S:    12 IGAGLAMIAGIGPGIGQGFAAGKGAEAVGKQPEAQGDILRTMLLGAAVAESTGIYALVVALILLF 76
>gi|162447841|ref|YP_001620973.1| F-type H+-transporting ATPase c chain [Acholeplasma laidlawii PG-8A] >gi|161985948|gb|ABX81597.1| F-type H+-transporting ATPase c chain [Acholeplasma laidlawii PG-8A] (86 aa)
Score = 119, Expect = 3.8e-05, Identities = 32/67 (47%), Positives = 44/67 (65%)
  Q:     7 GYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILL 73
           G A++GAG++++A    GIGQG +AA++VEAV R PE   KI    IL  A+ ET  +Y  IIA +L
  S:    17 GLAYLGAGISILAAGLAGIGQGLAAARAVEAVGRQPEASGKITVTMILGQAMVETSGIYALIIAFIL 83
>gi|188587440|ref|YP_001918985.1| ATP synthase F0, C subunit [Natranaerobius thermophilus JW/NM-WN-LF] >gi|179352127|gb|ACB86397.1| ATP synthase F0, C subunit [Natranaerobius thermophilus JW/NM-WN-LF] (185 aa)
Score = 119, Expect = 3.9e-05, Identities = 29/65 (44%), Positives = 44/65 (67%)
  Q:    11 IGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           IGAG AMIA +G GIGQG++A K  E+V  NP+   ++    +L AAV ET  ++  ++A++L+F
  S:    30 IGAGFAMIAGIGPGIGQGFAAGKGAESVGTNPKRGRQVTVVMLLGAAVAETSGIFALVVALILLF 94
Score = 96, Expect = 1.8e-02, Identities = 26/60 (43%), Positives = 36/60 (60%)
  Q:    11 IGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIA 70
           +GAGL+MIA +G GIGQG++A K  E V   PE    I    +L  AV +T  +Y  +I+
  S:   113 LGAGLSMIAGIGPGIGQGYAAGKGAETVGVRPEHHGNIVKVMLLGQAVGQTTGIYALVIS 172
>gi|168333938|ref|ZP_02692170.1| ATP synthase F0, C subunit [Epulopiscium sp. 'N.t. morphotype B'] (178 aa)
Score = 117, Expect = 6.7e-05, Identities = 33/69 (47%), Positives = 48/69 (69%)
  Q:     7 GYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQ-YILSAAVTETGALYCFIIAILLVF 75
           G + IGAGLAMIA  G GIGQG++A K+ EA+ +NPE   K  +   +L AAV ET  ++  ++AI+++F
  S:    22 GASAIGAGLAMIAGXGPGIGQGFAAGKAAEAMGKNPEHGGKPATLVMLLGAAVAETSGIFSLVVAIIMLF 91
Score = 107, Expect = 9.6e-04, Identities = 34/66 (51%), Positives = 47/66 (71%)
  Q:    11 IGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVFV 76
           +GAGLAMIA +G GIGQG++A K+ EAV + P++ S I    +L  AV +T  +Y  IIA+LL+FV
  S:   110 LGAGLAMIAGIGPGIGQGYAAGKAAEAVGKRPKLQSAIVRTMLLGQAVAQTTGIYALIIALLLLFV 175
>gi|71842278|ref|YP_277366.1| ATP synthase CF0 C subunit [Emiliania huxleyi] >gi|52547760|gb|AAU81915.1| ATP synthase CF0 C chain [Emiliania huxleyi] >gi|60101521|gb|AAX13865.1| ATP synthase CF0 C chain [Emiliania huxleyi] (82 aa)
Score = 117, Expect = 6.7e-05, Identities = 34/75 (45%), Positives = 49/75 (65%)
  Q:     1 MNITNQGYAFIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           MN    G + I AGLA+ +A +G GIGQG +AA++VE +AR PE   KIR   +LS A  E+  +Y  ++A+ L+F
  S:     1 MNPIVSGASVIAAGLAIGLASIGPGIGQGTAAAQAVEGLARQPEAEGKIRGTLLLSLAFMESLTIYGLVVALCLLF 76
>gi|113170456|ref|YP_717248.1| AtpH [Ostreococcus tauri] >gi|112806863|emb|CAL36370.1| AtpH [Ostreococcus tauri] (101 aa)
Score = 117, Expect = 7.2e-05, Identities = 29/67 (43%), Positives = 44/67 (65%)
  Q:     9 AFIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           + +GAGLA+ +  +G GIGQG +A ++VE +AR PE   KIR   +LS A  E   +Y  ++A+ L+F
  S:    28 SVVGAGLAIGLGAIGPGIGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALALMF 95
>gi|160902216|ref|YP_001567797.1| ATP synthase F0, C subunit [Petrotoga mobilis SJ95] >gi|160359860|gb|ABX31474.1| ATP synthase F0, C subunit [Petrotoga mobilis SJ95] (96 aa)
Score = 116, Expect = 8.8e-05, Identities = 27/67 (40%), Positives = 48/67 (71%)
  Q:    10 FIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVFV 76
            +GAG+AM I  +G G+G+G   A +++A+AR PE+   + ++ +L+ AVTE+  LY  ++A++L+FV
  S:    27 LLGAGVAMGIGAIGPGVGEGNIGAHAMDAMARQPEMSGNLTTRMLLAMAVTESTGLYSLVVALILLFV 94
>gi|150388187|ref|YP_001318236.1| ATP synthase F0, C subunit [Alkaliphilus metalliredigens QYMF] >gi|149948049|gb|ABR46577.1| ATP synthase F0, C subunit [Alkaliphilus metalliredigens QYMF] (184 aa)
Score = 116, Expect = 8.9e-05, Identities = 31/67 (46%), Positives = 42/67 (62%)
  Q:     9 AFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           + IGAGLAMIA +G GIGQG++A K  E V + P+    I     L  AV +T  +Y  IIA++L+F
  S:   110 SVIGAGLAMIAGIGPGIGQGYAAGKGTEMVGKRPQYQPMIVRTMFLGQAVAQTTGIYALIIALVLMF 176
Score = 107, Expect = 1.0e-03, Identities = 27/65 (41%), Positives = 41/65 (63%)
  Q:    11 IGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           I AGLAMIA +G GIGQG++A K  EA + NP+         +L AAV ET  +   ++A+++++
  S:    29 IAAGLAMIAGIGPGIGQGFAAGKGAEAASLNPKSAKSASMVMLLGAAVAETSGILSLVVALIMLY 93
>gi|74004280|ref|XP_545452.2| PREDICTED: similar to ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c, isoform 1 [Canis familiaris] (393 aa)
Score = 116, Expect = 9.1e-05, Identities = 25/66 (37%), Positives = 36/66 (54%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C I+A L+ F
  S:   326 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLIVAFLIFF 391
>gi|114581903|ref|XP_525965.2| PREDICTED: similar to mitochondrial ATP synthase subunit 9 precursor [Pan troglodytes] (281 aa)
Score = 115, Expect = 1.2e-04, Identities = 24/66 (36%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A L++F
  S:   214 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILF 279
>gi|88608692|ref|YP_506284.1| F0F1 ATP synthase subunit C [Neorickettsia sennetsu str. Miyayama] >gi|88600861|gb|ABD46329.1| ATP synthase F0, C chain [Neorickettsia sennetsu str. Miyayama] (75 aa)
Score = 114, Expect = 1.6e-04, Identities = 27/72 (37%), Positives = 44/72 (61%)
  Q:     6 QGYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVFVA 77
           +G  F+G GL+++ +LG  IG     +  +  +ARNPE   K++      AA+TE   L+ F++A+LL+FVA
  S:     4 EGLKFLGIGLSVVGMLGAAIGVSNIFSMMLNGIARNPESEEKLKKYVYAGAALTEAMGLFSFVLALLLIFVA 75
>gi|88807377|ref|ZP_01122889.1| ATP synthase subunit C [Synechococcus sp. WH 7805] >gi|88788591|gb|EAR19746.1| ATP synthase subunit C [Synechococcus sp. WH 7805] (113 aa)
Score = 113, Expect = 2.0e-04, Identities = 24/55 (43%), Positives = 36/55 (65%)
  Q:    21 LGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +G GIGQG +A ++VE +AR PE   KIR   +LS A  E   +Y  ++A++L+F
  S:    53 IGPGIGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALVLLF 107
>gi|124022189|ref|YP_001016496.1| F0F1 ATP synthase subunit C [Prochlorococcus marinus str. MIT 9303] >gi|33635321|emb|CAE21646.1| ATP synthase C chain [Prochlorococcus marinus str. MIT 9313] >gi|123962475|gb|ABM77231.1| F0F1-type ATP synthase, subunit c/Archaeal/vacuolar-type H+-ATPase, subunit K [Prochlorococcus marinus str. MIT 9303] (122 aa)
Score = 112, Expect = 2.6e-04, Identities = 29/75 (38%), Positives = 46/75 (61%)
  Q:     1 MNITNQGYAFIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           M+      + + AGLA+ +  +G GIGQG +A  +VE +AR PE   KIR   +LS A  E+  +Y  ++A++L+F
  S:    41 MDSITTAASVVAAGLAVGLGAIGPGIGQGTAAGGAVEGIARQPEAEGKIRGTLLLSFAFMESLTIYGLVVALVLLF 116
>gi|114672|sp|P21905|ATPL_PROMO ATP synthase C chain, sodium ion specific (Lipid-binding protein) >gi|45602|emb|CAA46895.1| ATPase c subunit [Propionigenium modestum] >gi|45612|emb|CAA37840.1| ATPase subunit c [Propionigenium modestum] >gi|45645|emb|CAA37912.1| unnamed protein product [Propionigenium modestum] >gi|45650|emb|CAA41369.1| F0 subunit [Propionigenium modestum] >gi|249183|gb|AAB22156.1| sodium dependent ATPase F1 subunit c [Propionigenium modestum, Peptide, 89 aa] (89 aa)
Score = 111, Expect = 3.0e-04, Identities = 26/59 (44%), Positives = 41/59 (69%)
  Q:    17 MIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           MIA +G G+GQG++A K+VE+VAR PE    I S  +L  A+ E+  +Y  +IA++L++
  S:    22 MIAGIGPGVGQGYAAGKAVESVARQPEAKGDIISTMVLGQAIAESTGIYSLVIALILLY 80
>gi|22653456|gb|AAN04072.1| ATP synthase F0 subunit 9 [Amoebidium parasiticum] (74 aa)
Score = 110, Expect = 4.8e-04, Identities = 30/70 (42%), Positives = 43/70 (61%)
  Q:     6 QGYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           QG  F+GAGLA I + G GIG G   +  + A +RNP +  ++ S  IL  A+TE  AL+  +IA L++F
  S:     3 QGLKFVGAGLATIGLTGAGIGIGMVFSALLNATSRNPSLKQQLFSNAILGFALTEAIALFALMIAFLILF 72
>gi|118411027|ref|YP_874422.1| ATP synthase CF0 C chain subunit III [Phaeodactylum tricornutum] >gi|116739774|gb|ABK20645.1| ATP synthase CF0 C chain subunit III [Phaeodactylum tricornutum] (82 aa)
Score = 109, Expect = 4.9e-04, Identities = 30/67 (44%), Positives = 46/67 (68%)
  Q:     9 AFIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           + IGAGL++ +A +G GIGQG +A ++VE +AR PE  +KIR   +LS A  E   +Y  ++A+ L+F
  S:     9 SVIGAGLSIGLAAIGPGIGQGTAAGQAVEGIARQPEAENKIRGVLLLSLAFMEALTIYGLVVALALLF 76
>gi|159904115|ref|YP_001551459.1| F0F1 ATP synthase subunit C [Prochlorococcus marinus str. MIT 9211] >gi|159889291|gb|ABX09505.1| F0F1-type ATP synthase, subunit c/Archaeal/vacuolar-type H+-ATPase, subunit K [Prochlorococcus marinus str. MIT 9211] (111 aa)
Score = 109, Expect = 5.1e-04, Identities = 29/75 (38%), Positives = 46/75 (61%)
  Q:     1 MNITNQGYAFIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           M+      + + AGLA+ +  +G GIGQG +A  +VE +AR PE   KIR   +LS A  E+  +Y  ++A++L+F
  S:    30 MDSITTAASVVAAGLAVGLGAIGPGIGQGSAAQGAVEGIARQPEAEGKIRGTLLLSFAFMESLTIYGLVVALVLLF 105
>gi|73996376|ref|XP_534788.2| PREDICTED: similar to ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c isoform 2a precursor [Canis familiaris] (252 aa)
Score = 109, Expect = 5.2e-04, Identities = 24/66 (36%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A L++F
  S:   185 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILF 250
>gi|37522478|ref|NP_925855.1| F0F1 ATP synthase subunit C [Gloeobacter violaceus PCC 7421] >gi|35213479|dbj|BAC90850.1| ATP synthase C chain of CF(0) [Gloeobacter violaceus PCC 7421] (82 aa)
Score = 109, Expect = 5.5e-04, Identities = 24/55 (43%), Positives = 37/55 (67%)
  Q:    21 LGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +G GIGQG +A+K+ E +AR PE   KIR   +LS A  E+  +Y  +++I+L+F
  S:    22 IGPGIGQGNAASKAAEGIARQPEAEGKIRGTLLLSLAFMESLTIYGLLVSIVLLF 76
>gi|22711899|ref|NP_683779.1| ATP synthase CF0 C subunit [Chaetosphaeridium globosum] >gi|22416903|gb|AAM96503.1| CF0 subunit III of ATP synthase [Chaetosphaeridium globosum] (81 aa)
Score = 108, Expect = 7.1e-04, Identities = 33/75 (44%), Positives = 47/75 (62%)
  Q:     1 MNITNQGYAFIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           MN      + I AGLA+ +A +G GIGQG +A ++VE +AR PEV  KIR   +LS A  E   +Y  ++A+ L+F
  S:     1 MNPLIASASVIAAGLAVGLASIGPGIGQGTAAGQAVEGIARQPEVDGKIRGTLLLSLAFMEALTIYGLVVALALLF 76
>gi|158520817|ref|YP_001528687.1| ATP synthase F0, C subunit [Desulfococcus oleovorans Hxd3] >gi|158509643|gb|ABW66610.1| ATP synthase F0, C subunit [Desulfococcus oleovorans Hxd3] (321 aa)
Score = 108, Expect = 7.9e-04, Identities = 30/67 (44%), Positives = 45/67 (67%)
  Q:     9 AFIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           A IGAGLA+ +A +G  IG+G +A  + E +AR P+   +I S  +L  AVTE+  +Y  +I+I+LVF
  S:   171 AVIGAGLAVGLAAIGPAIGEGRAAQTACEGIARKPQAAVQITSLMLLGMAVTESTGVYGLLISIILVF 238
Score = 97, Expect = 1.4e-02, Identities = 24/69 (34%), Positives = 44/69 (63%)
  Q:     9 AFIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVFVA 77
           A  GA L+M +  +G  +G+G++AA + EA+ R+PE   +I    ++  A+ ET A++  +IA++L+F  
  S:    11 AISGAALSMGLGAIGAAVGEGYTAACANEAIGRSPERSGEIFKSMLMGEAIAETSAIFALLIAMMLLFTG 80
Score = 90, Expect = 8.9e-02, Identities = 21/68 (30%), Positives = 44/68 (64%)
  Q:     9 AFIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVFV 76
           + +GAGL M +  +G GIG+G++A ++++ V RN +    +    ++  AV+E+  +Y  ++A +++FV
  S:   252 SLLGAGLCMGLGAIGPGIGEGFAAGEAIKWVGRNEQHAGVLTRTMLVGQAVSESTGIYALVVAFVMIFV 320
>gi|157092927|gb|ABV22118.1| chloroplast ATP synthase subunit C [Alexandrium tamarense] (145 aa)
Score = 108, Expect = 8.0e-04, Identities = 24/65 (36%), Positives = 44/65 (67%)
  Q:    11 IGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +GAG A+ +A +G G+GQG ++ + ++ ++R PEV   +R   +LS A  E+  +Y  +IA++L+F
  S:    74 VGAGFAIGLAAIGSGVGQGIASGRCIDGISRQPEVADDLRGVLLLSLAFMESLTIYGLVIALVLLF 139
>gi|73966422|ref|XP_851758.1| PREDICTED: similar to ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c isoform 2a precursor [Canis familiaris] (202 aa)
Score = 107, Expect = 8.5e-04, Identities = 24/66 (36%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A L++F
  S:   135 FIGAGTAPVRVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSHAILGFALSEAMGLFCLMLAFLILF 200
>gi|196179758|gb|EDX74752.1| ATP synthase F0, C subunit [Microcoleus chthonoplastes PCC 7420] (81 aa)
Score = 107, Expect = 9.1e-04, Identities = 24/55 (43%), Positives = 36/55 (65%)
  Q:    21 LGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +G GIGQG +A ++VE +AR PE   KIR   +LS A  E   +Y  ++A++L+F
  S:    22 IGPGIGQGNAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALVLLF 76
>gi|189501406|ref|YP_001960876.1| ATP synthase F0, C subunit [Chlorobium phaeobacteroides BS1] >gi|189496847|gb|ACE05395.1| ATP synthase F0, C subunit [Chlorobium phaeobacteroides BS1] (78 aa)
Score = 107, Expect = 9.4e-04, Identities = 31/71 (43%), Positives = 47/71 (66%)
  Q:     5 NQGYAFIGAGL-AMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           N+   ++GAG+ A +A+LG G+G G  A  + E  ARNPE  + IR+  I++AA+ E  AL+  +IA+LLV 
  S:     6 NEALGYLGAGIGAGLAVLGAGLGIGQIAGSACEGTARNPEATADIRTTMIIAAALIEGVALFGEVIAVLLVL 77
>gi|11466046|ref|NP_039507.1| ATPase 9 [Schizosaccharomyces pombe] >gi|23505435|ref|NP_700364.1| ATP synthase F0 subunit 9 [Schizosaccharomyces octosporus] >gi|3915611|sp|P21537|ATP9_SCHPO ATP synthase protein 9, mitochondrial (Lipid-binding protein) >gi|2654252|emb|CAA38292.1| ATPase 9 [Schizosaccharomyces pombe] >gi|23397384|gb|AAN31939.1| ATP synthase F0 subunit 9 [Schizosaccharomyces octosporus] (74 aa)
Score = 107, Expect = 1.0e-03, Identities = 27/72 (37%), Positives = 41/72 (56%)
  Q:     6 QGYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVFVA 77
           Q   +IGAGLA I + G G+G G   +  +   +RNP V   + S  IL  A+TE   L+C ++A L+++ A
  S:     3 QAAKYIGAGLATIGVSGAGVGIGLIFSNLISGTSRNPSVRPHLFSMAILGFALTEATGLFCLMLAFLIIYAA 74
>gi|9653244|ref|NP_062490.1| ATP synthase F0 subunit 9 [Chondrus crispus] >gi|1352021|sp|P48880|ATP9_CHOCR ATP synthase protein 9, mitochondrial (Lipid-binding protein) >gi|1334491|emb|CAA87613.1| ATP synthetase, subunit 9 [Chondrus crispus] (76 aa)
Score = 106, Expect = 1.2e-03, Identities = 32/75 (42%), Positives = 43/75 (57%)
  Q:     1 MNITNQGYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           MN+T Q    IGAGLA I + GVG G G      V A ARNP +  ++    IL  A+TE  AL+  ++A L++F
  S:     1 MNVTLQSAKMIGAGLATIGLTGVGAGVGIVFGSLVMAYARNPSLKQQLFGYTILGFALTEAVALFALMMAFLILF 75
>gi|110816060|ref|YP_684392.1| ATP synthase F0 subunit 9 [Oltmannsiellopsis viridis] >gi|86450271|gb|ABC96350.1| ATP synthase F0 subunit 9 [Oltmannsiellopsis viridis] (74 aa)
Score = 106, Expect = 1.2e-03, Identities = 30/66 (45%), Positives = 41/66 (62%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
            IGAG+A I +LG GIG G+       AVARNP V  ++    IL +A+TE  AL+  +IA++L F
  S:     8 LIGAGIATIGVLGSGIGIGFLFGSFFNAVARNPSVNKQLFPSVILGSALTEAIALFALMIALVLKF 73
>gi|149268294|ref|XP_001474573.1| PREDICTED: hypothetical protein [Mus musculus] >gi|149268379|ref|XP_001476530.1| PREDICTED: hypothetical protein [Mus musculus] >gi|149269538|ref|XP_001472331.1| PREDICTED: hypothetical protein [Mus musculus] (173 aa)
Score = 106, Expect = 1.3e-03, Identities = 24/66 (36%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A L++F
  S:   106 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILF 171
>gi|157092931|gb|ABV22120.1| chloroplast ATP synthase subunit C [Alexandrium tamarense] (149 aa)
Score = 106, Expect = 1.3e-03, Identities = 24/65 (36%), Positives = 44/65 (67%)
  Q:    11 IGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +GAG A+ +A +G G+GQG ++ + ++ ++R PEV   +R   +LS A  E+  +Y  +IA++L+F
  S:    78 VGAGFAIGLAAIGSGVGQGIASGRCIDGISRQPEVADDLRGVLLLSLAFMESLTIYGLVIALVLLF 143
>gi|23752286|ref|NP_705624.1| ATP synthase F0 subunit 9 [Schizosaccharomyces japonicus] >gi|23506670|gb|AAN37917.1| ATP synthase F0 subunit 9 [Schizosaccharomyces japonicus] (74 aa)
Score = 106, Expect = 1.3e-03, Identities = 25/72 (34%), Positives = 42/72 (58%)
  Q:     6 QGYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVFVA 77
           Q   ++GAGLA I + G G+G G   +  +   +RNP +  ++ S  IL  A+TE   L+C ++A L+++ A
  S:     3 QAMKYVGAGLATIGVSGAGVGIGLIFSSLINGTSRNPSLRPQLFSMAILGFALTEATGLFCLMLAFLIIYAA 74
>gi|119510743|ref|ZP_01629870.1| ATP synthase subunit C [Nodularia spumigena CCY9414] >gi|119464607|gb|EAW45517.1| ATP synthase subunit C [Nodularia spumigena CCY9414] (81 aa)
Score = 106, Expect = 1.3e-03, Identities = 24/55 (43%), Positives = 36/55 (65%)
  Q:    21 LGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +G GIGQG +A ++VE +AR PE   KIR   +LS A  E   +Y  ++A++L+F
  S:    22 IGPGIGQGNAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALVLLF 76
>gi|17227505|ref|NP_484053.1| F0F1 ATP synthase subunit C [Nostoc sp. PCC 7120] >gi|75908829|ref|YP_323125.1| F0F1 ATP synthase subunit C [Anabaena variabilis ATCC 29413] >gi|114662|sp|P12409|ATPL_ANASP ATP synthase C chain (Lipid-binding protein) >gi|79756|pir||C31090 H+-transporting two-sector ATPase (EC 3.6.3.14) lipid-binding protein - Anabaena sp >gi|141999|gb|AAA21987.1| ATP synthase subunit c [Nostoc sp. PCC 7120] >gi|17134987|dbj|BAB77533.1| ATP synthase subunit c [Nostoc sp. PCC 7120] >gi|75702554|gb|ABA22230.1| ATP synthase F0, C subunit [Anabaena variabilis ATCC 29413] (81 aa)
Score = 106, Expect = 1.3e-03, Identities = 24/55 (43%), Positives = 36/55 (65%)
  Q:    21 LGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +G GIGQG +A ++VE +AR PE   KIR   +LS A  E   +Y  ++A++L+F
  S:    22 IGPGIGQGNAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALVLLF 76
>gi|11467369|ref|NP_043226.1| ATP synthase CF0 C subunit [Cyanophora paradoxa] >gi|1352045|sp|P48086|ATPH_CYAPA ATP synthase C chain (ATPase subunit III) (Lipid-binding protein) >gi|1016170|gb|AAA81257.1| c subunit of the F0 portion of ATP synthase (81 aa)
Score = 106, Expect = 1.3e-03, Identities = 25/55 (45%), Positives = 36/55 (65%)
  Q:    21 LGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +G GIGQG +A ++VE +AR PEV  KIR   +LS A  E   +Y  ++A+ L+F
  S:    22 IGPGIGQGTAAGQAVEGIARQPEVDGKIRGTLLLSLAFMEALTIYGLVVALALLF 76
>gi|461591|sp|Q05366|ATPL_SYNP1 ATP synthase C chain (Lipid-binding protein) >gi|480488|pir||S36961 H+-transporting two-sector ATPase (EC 3.6.3.14) chain c - Synechococcus sp >gi|49215|emb|CAA49871.1| ATP synthase (c); H(+)-transporting ATP synthase [Synechococcus sp.] (82 aa)
Score = 106, Expect = 1.3e-03, Identities = 23/54 (42%), Positives = 36/54 (66%)
  Q:    22 GVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           G GIGQG ++ ++VE +AR PE   KIR   +L+ A  E+  +Y  +IA++L+F
  S:    23 GPGIGQGNASGQAVEGIARQPEAEGKIRGTLLLTLAFMESLTIYGLVIALVLLF 76
>gi|148377617|ref|YP_001256493.1| ATP synthase C chain [Mycoplasma agalactiae PG2] >gi|148291663|emb|CAL59049.1| ATP synthase C chain [Mycoplasma agalactiae PG2] (75 aa)
Score = 106, Expect = 1.4e-03, Identities = 36/70 (51%), Positives = 51/70 (72%)
  Q:     6 QGYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +G   IG G++MI+ LGVG+GQG +A K+ EAV RNPE  SKIR+  ++  AV E+ A+Y  +I+ILL+F
  S:     3 KGLIAIGIGISMISGLGVGLGQGLAAGKAAEAVGRNPEAASKIRTMMLVGQAVAESAAIYALVISILLMF 72
>gi|11467019|ref|NP_041926.1| ATP synthase CF0 C subunit [Euglena gracilis] >gi|231611|sp|P10603|ATPH_EUGGR ATP synthase C chain (ATPase subunit III) (Lipid-binding protein) >gi|14380|emb|CAA77930.1| ATP synthase CFo subunit III [Euglena gracilis] >gi|415769|emb|CAA50113.1| ATP synthase, CF0-subunit III [Euglena gracilis] (81 aa)
Score = 105, Expect = 1.4e-03, Identities = 28/67 (41%), Positives = 44/67 (65%)
  Q:     9 AFIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           + IGAGLA+ +  +G GIGQG ++ K++E +AR PE   KIR   +LS A  E   +Y  ++A+ ++F
  S:     9 SVIGAGLAIGLGAIGPGIGQGTASGKAIEGLARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALAIIF 76
>gi|153012208|ref|YP_001381723.1| ATP synthase CF0 subunit III [Medicago truncatula] (81 aa)
Score = 105, Expect = 1.5e-03, Identities = 29/67 (43%), Positives = 44/67 (65%)
  Q:     9 AFIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           + I AGLA+ +A +G G+GQG +A ++VE +AR PE   KIR   +LS A  E   +Y  ++A+ L+F
  S:     9 SVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEDKIRGTLLLSLAFMEALTIYGLVVALALLF 76
>gi|157092929|gb|ABV22119.1| chloroplast ATP synthase subunit C [Alexandrium tamarense] (148 aa)
Score = 105, Expect = 1.5e-03, Identities = 24/65 (36%), Positives = 44/65 (67%)
  Q:    11 IGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +GAG A+ +A +G G+GQG ++ + ++ ++R PEV   +R   +LS A  E+  +Y  +IA++L+F
  S:    77 VGAGFAIGLAAIGSGVGQGIASGRCIDGISRQPEVADDLRGVLLLSLAFMESLTIYGLVIALVLLF 142
>gi|11466684|ref|NP_039280.1| ATP synthase CF0 C subunit [Marchantia polymorpha] >gi|13518334|ref|NP_084693.1| ATP synthase CF0 C subunit [Oenothera elata subsp. hookeri] >gi|34501431|ref|NP_904218.1| ATP synthase CF0 C subunit [Physcomitrella patens subsp. patens] >gi|68164790|ref|YP_247586.1| ATP synthase CF0 C subunit [Cucumis sativus] >gi|108773117|ref|YP_635626.1| ATP synthase CF0 C subunit [Solanum tuberosum] >gi|115531901|ref|YP_784057.1| ATP synthase CF0 subunit III [Pelargonium x hortorum] >gi|115605009|ref|YP_784460.1| ATP synthase CF0 subunit III [Piper cenocladum] >gi|169142714|ref|YP_001687141.1| ATP synthase subunit III [Oenothera argillicola] >gi|169142864|ref|YP_001687287.1| ATP synthase subunit III [Oenothera glazioviana] >gi|169142949|ref|YP_001687371.1| ATP synthase subunit III [Oenothera biennis] >gi|169143035|ref|YP_001687455.1| ATP synthase subunit III [Oenothera parviflora] >gi|170784729|ref|YP_001718645.1| ATP synthase CF0 subunit III [Trachelium caeruleum] >gi|60391816|sp|P62481|ATPH_MARPO ATP synthase C chain (ATPase subunit III) (Lipid-binding protein) >gi|60391815|sp|P62480|ATPH_OENHO ATP synthase C chain (Lipid-binding protein) (ATPase subunit III) >gi|122248898|sp|Q2VEI9|ATPH_SOLTU ATP synthase C chain (Lipid-binding protein) (ATPase subunit III) >gi|11653|emb|CAA28066.1| atpH [Marchantia polymorpha] >gi|6723749|emb|CAB67158.1| ATP synthase subunit III [Oenothera elata subsp. hookeri] >gi|30844140|gb|AAP36991.1| ATPase subunit III [Cucumis sativus] >gi|34494801|dbj|BAC85068.1| ATP synthase III subunit [Physcomitrella patens subsp. patens] >gi|37725739|gb|AAO38178.1| ATPase subunit III [Cucumis sativus] >gi|67511385|emb|CAJ00745.1| ATP synthase CF0 C chain [Cucumis sativus] >gi|74027089|gb|AAZ94639.1| ATPase subunit III [Cucumis sativus] >gi|82754616|gb|ABB90030.1| ATP synthase CF0 C chain [Solanum tuberosum] >gi|88656791|gb|ABD47044.1| ATP synthase CF0 subunit III [Solanum tuberosum] >gi|112253738|gb|ABI14459.1| ATP synthase CF0 subunit III [Piper cenocladum] >gi|112382055|gb|ABI17248.1| ATP synthase CF0 subunit III [Pelargonium x hortorum] >gi|115432791|gb|ABI97404.1| ATP synthase CF0 subunit III [Cucumis sativus] >gi|115498290|gb|ABI98732.1| ATP synthase CF0 subunit III [Cucumis sativus] >gi|156598451|gb|ABU85485.1| ATP synthase CF0 subunit III [Passiflora biflora] >gi|156598749|gb|ABU85629.1| ATP synthase CF0 subunit III [Trachelium caeruleum] >gi|157267477|gb|ABV26470.1| ATP synthase CF0 subunit III [Trachelium caeruleum] >gi|159792952|gb|ABW98708.1| ATP synthase subunit III [Oenothera argillicola] >gi|159793122|gb|ABW98876.1| ATP synthase subunit III [Oenothera biennis] >gi|159895476|gb|ABX10041.1| ATP synthase subunit III [Oenothera glazioviana] >gi|159895561|gb|ABX10125.1| ATP synthase subunit III [Oenothera parviflora] (81 aa)
Score = 105, Expect = 1.6e-03, Identities = 32/75 (42%), Positives = 46/75 (61%)
  Q:     1 MNITNQGYAFIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           MN      + I AGLA+ +A +G GIGQG +A ++VE +AR PE   KIR   +LS A  E   +Y  ++A+ L+F
  S:     1 MNPLISAASVIAAGLAVGLASIGPGIGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALALLF 76
>gi|108796777|ref|YP_636450.1| ATP synthase CF0 C subunit [Staurastrum punctulatum] >gi|61393545|gb|AAX45686.1| CF0 subunit III of ATP synthase [Staurastrum punctulatum] (81 aa)
Score = 105, Expect = 1.6e-03, Identities = 32/75 (42%), Positives = 46/75 (61%)
  Q:     1 MNITNQGYAFIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           MN      + I AGLA+ +A +G GIGQG +A ++VE +AR PE   KIR   +LS A  E   +Y  ++A+ L+F
  S:     1 MNPVISAASVIAAGLAVGLASIGPGIGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALALLF 76
>gi|51209984|ref|YP_063648.1| ATP synthase CF0 C subunit [Gracilaria tenuistipitata var. liui] >gi|399085|sp|Q02851|ATPH_ANTSP ATP synthase C chain (ATPase subunit III) (Lipid-binding protein) >gi|14173|emb|CAA44980.1| atpH [Antithamnion sp.] >gi|50657738|gb|AAT79723.1| ATP synthase CF0 C chain subunit III [Gracilaria tenuistipitata var. liui] (82 aa)
Score = 105, Expect = 1.6e-03, Identities = 26/55 (47%), Positives = 37/55 (67%)
  Q:    21 LGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +G GIGQG +AA +VE +AR PEV  KIR   +LS A  E+  +Y  ++A+ L+F
  S:    22 IGPGIGQGSAAANAVEGIARQPEVEGKIRGTLLLSLAFMESLTIYGLVVALSLLF 76
>gi|186684953|ref|YP_001868149.1| ATP synthase F0, C subunit [Nostoc punctiforme PCC 73102] >gi|186467405|gb|ACC83206.1| ATP synthase F0, C subunit [Nostoc punctiforme PCC 73102] (81 aa)
Score = 105, Expect = 1.6e-03, Identities = 23/52 (44%), Positives = 35/52 (67%)
  Q:    24 GIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           GIGQG +A ++VE +AR PE   KIR   +L+ A  E+  +Y  +IA++L+F
  S:    25 GIGQGNAAGQAVEGIARQPEAEGKIRGTLLLTLAFMESLTIYGLVIALVLLF 76
>gi|119933584|ref|XP_001256922.1| PREDICTED: similar to H(+)-transporting ATP synthase [Bos taurus] (170 aa)
Score = 105, Expect = 1.6e-03, Identities = 24/66 (36%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A L++F
  S:   103 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILF 168
>gi|150251445|ref|YP_001312178.1| ATP synthase CF0 C chain [Cycas taitungensis] >gi|149941495|dbj|BAF64919.1| ATP synthase CF0 C chain [Cycas taitungensis] >gi|156597943|gb|ABU85239.1| ATP synthase CF0 subunit III [Cycas micronesica] (81 aa)
Score = 105, Expect = 1.7e-03, Identities = 31/75 (41%), Positives = 46/75 (61%)
  Q:     1 MNITNQGYAFIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           MN      + I AGLA+ +A +G G+GQG +A ++VE +AR PE   KIR   +LS A  E   +Y  ++A+ L+F
  S:     1 MNPLIPAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALALLF 76
>gi|119368486|ref|YP_913174.1| ATP synthase III subunit [Gossypium barbadense] >gi|119224848|dbj|BAF41234.1| ATP synthase III subunit [Gossypium barbadense] (81 aa)
Score = 105, Expect = 1.8e-03, Identities = 31/75 (41%), Positives = 47/75 (62%)
  Q:     1 MNITNQGYAFIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           MN      + I AGLA+ +A +G G+GQG +A ++VE +AR PE   KIR   +LS A  E  ++Y  ++A+ L+F
  S:     1 MNPLISAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALSIYGLVVALALLF 76
>gi|146186464|gb|ABQ09284.1| AtpH [Arthrospira platensis HN01] (82 aa)
Score = 105, Expect = 1.8e-03, Identities = 27/74 (36%), Positives = 41/74 (55%)
  Q:     2 NITNQGYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           N+T        A    I  +G G+GQG +A ++VE +AR PE   KIR   +LS A  E   +Y  ++A++L+F
  S:     4 NLTTAASVIAAALAVGIGSIGPGLGQGQAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALVLLF 77
>gi|119484693|ref|ZP_01619175.1| ATP synthase subunit C [Lyngbya sp. PCC 8106] >gi|119457511|gb|EAW38635.1| ATP synthase subunit C [Lyngbya sp. PCC 8106] (81 aa)
Score = 105, Expect = 1.8e-03, Identities = 23/55 (41%), Positives = 36/55 (65%)
  Q:    21 LGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +G GIGQG +A ++VE +AR PE   KIR   +LS A  E   +Y  +++++L+F
  S:    22 IGPGIGQGNAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVSLVLLF 76
>gi|87125413|ref|ZP_01081259.1| ATP synthase subunit C [Synechococcus sp. RS9917] >gi|148240357|ref|YP_001225744.1| F0F1 ATP synthase subunit C [Synechococcus sp. WH 7803] >gi|86167182|gb|EAQ68443.1| ATP synthase subunit C [Synechococcus sp. RS9917] >gi|147848896|emb|CAK24447.1| ATP synthase C chain [Synechococcus sp. WH 7803] (82 aa)
Score = 105, Expect = 1.8e-03, Identities = 24/55 (43%), Positives = 36/55 (65%)
  Q:    21 LGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +G GIGQG +A ++VE +AR PE   KIR   +LS A  E   +Y  ++A++L+F
  S:    22 IGPGIGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALVLLF 76
>gi|159161147|ref|YP_001542434.1| ATP synthase CF0 subunit III [Ceratophyllum demersum] >gi|148508430|gb|ABQ81437.1| ATP synthase CF0 subunit III [Ceratophyllum demersum] (81 aa)
Score = 105, Expect = 1.9e-03, Identities = 31/75 (41%), Positives = 46/75 (61%)
  Q:     1 MNITNQGYAFIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           MN      + I AGLA+ +A +G G+GQG +A ++VE +AR PE   KIR   +LS A  E   +Y  ++A+ L+F
  S:     1 MNPLISSASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALALLF 76
>gi|83591199|ref|YP_431208.1| ATP synthase F0, C subunit [Moorella thermoacetica ATCC 39073] >gi|1929508|gb|AAB51461.1| ATP synthase subunit c >gi|83574113|gb|ABC20665.1| ATP synthase F0, C subunit [Moorella thermoacetica ATCC 39073] (74 aa)
Score = 105, Expect = 1.9e-03, Identities = 29/65 (44%), Positives = 43/65 (66%)
  Q:     9 AFIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILL 73
            FIG GLA+ +A LG G+GQG ++  ++E +AR PE    IR+  +L+ A  E   L+ F+IAIL+
  S:     5 GFIGVGLAIGLAALGSGLGQGIASRGALEGMARQPEASGDIRTTLLLALAFMEALTLFSFVIAILM 70
>gi|157092939|gb|ABV22124.1| chloroplast ATP synthase subunit C [Alexandrium affine] (145 aa)
Score = 104, Expect = 1.9e-03, Identities = 24/65 (36%), Positives = 44/65 (67%)
  Q:    11 IGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +GAG A+ +A +G G+GQG ++ + ++ ++R PEV   +R   +LS A  E+  +Y  +IA++L+F
  S:    74 VGAGFAIGLAAIGSGVGQGIASGRCIDGISRQPEVADDLRGVLLLSLAFMESLTIYGLVIALVLLF 139
>gi|109096967|ref|XP_001107007.1| PREDICTED: ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C2 (subunit 9) isoform 2 [Macaca mulatta] (198 aa)
Score = 104, Expect = 1.9e-03, Identities = 24/66 (36%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A L++F
  S:   131 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILF 196
>gi|114651|sp|P08212|ATPH_PEA ATP synthase C chain (Lipid-binding protein) (ATPase subunit III) >gi|311714|emb|CAA29350.1| atpH protein [Pisum sativum] >gi|552815|gb|AAA84541.1| ATP synthase CF0 subunit III (81 aa)
Score = 104, Expect = 1.9e-03, Identities = 31/75 (41%), Positives = 46/75 (61%)
  Q:     1 MNITNQGYAFIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           MN      + I AGLA+ +A +G G+GQG +A ++VE +AR PE   KIR   +LS A  E   +Y  ++A+ L+F
  S:     1 MNPLIAAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEDKIRGTLLLSLAFMEALTIYGLVVALALLF 76
>gi|163723701|ref|ZP_02131235.1| ATP synthase F0, C subunit [Desulfatibacillum alkenivorans AK-01] >gi|161403188|gb|EDQ27422.1| ATP synthase F0, C subunit [Desulfatibacillum alkenivorans AK-01] (325 aa)
Score = 104, Expect = 1.9e-03, Identities = 28/67 (41%), Positives = 45/67 (67%)
  Q:     9 AFIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           AFIG GLAM    +G  +G+G++AA +  A++RNPEV   +    ++  AV E+ A++  ++A+LLVF
  S:    12 AFIGGGLAMGFGAIGAAVGEGYAAANANAAISRNPEVSGDVFKTMLVGQAVAESAAIFALVVAMLLVF 79
Score = 92, Expect = 5.6e-02, Identities = 22/68 (32%), Positives = 43/68 (63%)
  Q:     9 AFIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVFV 76
           A + AG+ M I  +G G+G+G++A  +V  +ARN    +++    ++  AV E+  +Y  ++A++L+FV
  S:   256 ALLSAGICMGIGAIGPGVGEGFAAQSAVGWIARNENATAELTRTMLVGQAVAESTGIYALVVALVLIFV 324
>gi|11467684|ref|NP_050736.1| ATP synthase CF0 C subunit [Guillardia theta] >gi|5915733|sp|O78479|ATPH_GUITH ATP synthase C chain (ATPase subunit III) (Lipid-binding protein) >gi|3603009|gb|AAC35670.1| ATP synthase CF0 subunit III [Guillardia theta] (82 aa)
Score = 104, Expect = 1.9e-03, Identities = 29/75 (38%), Positives = 48/75 (64%)
  Q:     1 MNITNQGYAFIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           MN      + + +GL++ +A +G GIGQG +AA++VE +AR PE   +IR   +LS A  E+  +Y  ++A+ L+F
  S:     1 MNPIVSAASVVASGLSVGLAAIGPGIGQGTAAAQAVEGIARQPEAEGRIRGTLLLSLAFMESLTIYGLVVALALLF 76
>gi|11465712|ref|NP_053856.1| ATP synthase CF0 C subunit [Porphyra purpurea] >gi|90994437|ref|YP_536927.1| ATP synthase CF0 C subunit [Porphyra yezoensis] >gi|1703750|sp|P51246|ATPH_PORPU ATP synthase C chain (Lipid-binding protein) (ATPase subunit III) >gi|122225825|sp|Q1XDP1|ATPH_PORYE ATP synthase C chain (Lipid-binding protein) (ATPase subunit III) >gi|1276712|gb|AAC08132.1| ATP synthase CF0 C chain (lipid-binding) (subunit III) [Porphyra purpurea] >gi|90819001|dbj|BAE92370.1| ATP synthase CFO C chain lipid-binding subunit III [Porphyra yezoensis] (82 aa)
Score = 104, Expect = 1.9e-03, Identities = 26/55 (47%), Positives = 37/55 (67%)
  Q:    21 LGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +G GIGQG +AA +VE +AR PEV  KIR   +LS A  E+  +Y  ++A+ L+F
  S:    22 IGPGIGQGSAAANAVEGIARQPEVEGKIRGTLLLSLAFMESLTIYGLVVALSLLF 76
>gi|56751190|ref|YP_171891.1| F0F1 ATP synthase subunit C [Synechococcus elongatus PCC 6301] >gi|81299143|ref|YP_399351.1| F0F1 ATP synthase subunit C [Synechococcus elongatus PCC 7942] >gi|114676|sp|P08445|ATPL_SYNP6 ATP synthase C chain (Lipid-binding protein) >gi|48013|emb|CAA28924.1| unnamed protein product [Synechococcus elongatus PCC 6301] >gi|56686149|dbj|BAD79371.1| H+-transporting two-sector ATPase [Synechococcus elongatus PCC 6301] >gi|81168024|gb|ABB56364.1| ATP synthase F0, C subunit [Synechococcus elongatus PCC 7942] (81 aa)
Score = 104, Expect = 2.0e-03, Identities = 24/55 (43%), Positives = 36/55 (65%)
  Q:    21 LGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +G GIGQG +A ++VE +AR PE   KIR   +LS A  E   +Y  ++A++L+F
  S:    22 IGPGIGQGSAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALVLLF 76
>gi|194476682|ref|YP_002048861.1| ATP synthase subunit C [Paulinella chromatophora] >gi|171191689|gb|ACB42651.1| ATP synthase subunit C [Paulinella chromatophora] (82 aa)
Score = 104, Expect = 2.0e-03, Identities = 24/55 (43%), Positives = 35/55 (63%)
  Q:    21 LGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +G GIGQG +A  +VE +AR PE   KIR   +LS A  E   +Y  ++A++L+F
  S:    22 IGPGIGQGTAAGSAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALVLLF 76
>gi|157871007|ref|XP_001684053.1| ATPase subunit 9, putative [Leishmania major] >gi|68127121|emb|CAJ04716.1| ATPase subunit 9, putative [Leishmania major] (252 aa)
Score = 104, Expect = 2.0e-03, Identities = 25/73 (34%), Positives = 41/73 (56%)
  Q:     3 ITNQGYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           ++ QG  ++G GLA IA+ GVG+G G      +   AR P +   + +  IL  A+TE   L+  ++A L++F
  S:   179 LSVQGLHYVGTGLAAIALGGVGLGIGAIFGCLLIGCARQPNLTKMLFNYAILGFALTEAIGLFALMLAFLMLF 251
>gi|7525020|ref|NP_051046.1| ATP synthase CF0 C subunit [Arabidopsis thaliana] >gi|139387239|ref|YP_001123360.1| ATPase III subunit [Capsella bursa-pastoris] >gi|139389405|ref|YP_001123102.1| ATPase III subunit [Olimarabidopsis pumila] >gi|139389629|ref|YP_001123186.1| ATPase III subunit [Arabis hirsuta] >gi|139389788|ref|YP_001123449.1| ATPase III subunit [Crucihimalaya wallichii] >gi|139389937|ref|YP_001123537.1| ATPase III subunit [Draba nemorosa] >gi|6685247|sp|P56760|ATPH_ARATH ATP synthase C chain (ATPase subunit III) (Lipid-binding protein) >gi|5881681|dbj|BAA84372.1| ATPase III subunit [Arabidopsis thaliana] >gi|134286299|dbj|BAF49926.1| ATPase III subunit [Olimarabidopsis pumila] >gi|134286384|dbj|BAF50010.1| ATPase III subunit [Arabis hirsuta] >gi|134286560|dbj|BAF50184.1| ATPase III subunit [Capsella bursa-pastoris] >gi|134286650|dbj|BAF50273.1| ATPase III subunit [Crucihimalaya wallichii] >gi|134286739|dbj|BAF50361.1| ATPase III subunit [Draba nemorosa] (81 aa)
Score = 104, Expect = 2.0e-03, Identities = 31/75 (41%), Positives = 46/75 (61%)
  Q:     1 MNITNQGYAFIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           MN      + I AGLA+ +A +G G+GQG +A ++VE +AR PE   KIR   +LS A  E   +Y  ++A+ L+F
  S:     1 MNPLVSAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALALLF 76
>gi|11465941|ref|NP_054483.1| ATP synthase CF0 C subunit [Nicotiana tabacum] >gi|18860298|ref|NP_569616.1| ATP synthase CF0 C subunit [Psilotum nudum] >gi|28202154|ref|NP_777395.1| ATP synthase CF0 C subunit [Anthoceros formosae] >gi|32480830|ref|NP_862741.1| ATP synthase CF0 C subunit [Calycanthus floridus var. glaucus] >gi|34500901|ref|NP_904086.1| ATP synthase CF0 C subunit [Amborella trichopoda] >gi|49574590|ref|NP_848047.2| ATP synthase CF0 C subunit [Adiantum capillus-veneris] >gi|50346769|ref|YP_053142.1| ATP synthase CF0 C subunit [Nymphaea alba] >gi|52220797|ref|YP_086953.1| ATP synthase CF0 C subunit [Panax ginseng] >gi|75755646|ref|YP_319752.1| ATP synthase CF0 C subunit [Acorus calamus] >gi|78102518|ref|YP_358659.1| ATP synthase CF0 C subunit [Nicotiana sylvestris] >gi|78103240|ref|YP_358563.1| ATP synthase CF0 C subunit [Phalaenopsis aphrodite subsp. formosana] >gi|81176242|ref|YP_398321.1| ATP synthase CF0 C subunit [Lactuca sativa] >gi|81301549|ref|YP_398846.1| ATP synthase CF0 C subunit [Nicotiana tomentosiformis] >gi|89280622|ref|YP_514839.1| ATP synthase CF0 C subunit [Solanum lycopersicum] >gi|91208889|ref|YP_538922.1| ATP synthase CF0 C subunit [Gossypium hirsutum] >gi|91983979|ref|YP_567063.1| ATP synthase CF0 C subunit [Vitis vinifera] >gi|94502483|ref|YP_588109.1| ATP synthase CF0 C subunit [Helianthus annuus] >gi|108802630|ref|YP_636286.1| ATP synthase CF0 C subunit [Eucalyptus globulus subsp. globulus] >gi|110227066|ref|YP_665545.1| ATP synthase CF0 C subunit [Populus alba] >gi|114107033|ref|YP_740189.1| ATP synthase CF0 subunit III [Liriodendron tulipifera] >gi|114107120|ref|YP_740104.1| ATP synthase CF0 subunit III [Daucus carota] >gi|114329643|ref|YP_740462.1| ATP synthase CF0 subunit III [Citrus sinensis] >gi|114329733|ref|YP_740552.1| ATP synthase CF0 subunit III [Platanus occidentalis] >gi|114329955|ref|YP_740637.1| ATP synthase CF0 subunit III [Nandina domestica] >gi|114804252|ref|YP_762248.1| ATP synthase CF0 subunit III [Morus indica] >gi|115391889|ref|YP_778477.1| ATPase subunit III [Jasminum nudiflorum] >gi|115604921|ref|YP_784373.1| ATP synthase CF0 subunit III [Drimys granadensis] >gi|116617095|ref|YP_817469.1| ATP synthase CF0 subunit III [Coffea arabica] >gi|121720600|ref|YP_001001521.1| ATP synthase CF0 subunit III [Nuphar advena] >gi|122893977|ref|YP_001004173.1| ATP synthase CF0 subunit III [Ranunculus macranthus] >gi|134093184|ref|YP_001109486.1| ATP synthase CF0 subunit III [Populus trichocarpa] >gi|139388081|ref|YP_001123273.1| ATPase III subunit [Barbarea verna] >gi|139388897|ref|YP_001123624.1| ATPase III subunit [Lepidium virginicum] >gi|139389083|ref|YP_001123801.1| ATPase III subunit [Nasturtium officinale] >gi|139389251|ref|YP_001123017.1| ATPase III subunit [Aethionema grandiflorum] >gi|139390139|ref|YP_001123712.1| ATPase III subunit [Lobularia maritima] >gi|139390335|ref|YP_001122933.1| ATPase III subunit [Aethionema cordifolium] >gi|149390255|ref|YP_001294085.1| ATP synthase CF0 subunit III [Chloranthus spicatus] >gi|149390341|ref|YP_001294339.1| ATP synthase CF0 subunit III [Dioscorea elephantipes] >gi|149390429|ref|YP_001294257.1| ATP synthase CF0 subunit III [Illicium oligandrum] >gi|149390527|ref|YP_001294171.1| ATP synthase CF0 subunit III [Buxus microphylla] >gi|156618813|ref|YP_001430095.1| ATP synthase CF0 C chain [Cuscuta reflexa] >gi|159161240|ref|YP_001542518.1| ATP synthase CF0 subunit III [Cuscuta exaltata] >gi|161622297|ref|YP_001586169.1| ATP synthase CF0 subunit III [Acorus americanus] >gi|161784179|ref|YP_001595495.1| ATPase III subunit [Lemna minor] >gi|167391792|ref|YP_001671670.1| ATP synthase CF0 C chain [Carica papaya] >gi|169794060|ref|YP_001718424.1| ATP synthase CF0 subunit III [Manihot esculenta] >gi|183217733|ref|YP_001837352.1| ATP synthase CF0 subunit III [Guizotia abyssinica] >gi|189162258|ref|YP_001936504.1| ATP synthase CF0 C subunit [Fagopyrum esculentum subsp. ancestrale] >gi|47115596|sp|P61172|ATPH_ANTFO ATP synthase C chain (ATPase subunit III) (Lipid-binding protein) >gi|68565054|sp|Q85FN2|ATPH_ADICA ATP synthase C chain (ATPase subunit III) (Lipid-binding protein) >gi|114654|sp|P06286|ATPH_TOBAC ATP synthase C chain (Lipid-binding protein) (ATPase subunit III) >gi|122248451|sp|Q2MIB3|ATPH_SOLLC ATP synthase C chain (Lipid-binding protein) (ATPase subunit III) >gi|11812|emb|CAA77343.1| ATPase III subunit [Nicotiana tabacum] >gi|343484|gb|AAA84678.1| ATPase subunit III >gi|18389451|dbj|BAB84203.1| ATP synthase subunit CF0 III [Psilotum nudum] >gi|27807856|dbj|BAC55331.1| ATPase III subunit [Anthoceros formosae] >gi|27807955|dbj|BAC55422.1| ATPase III subunit [Anthoceros formosae] >gi|32399366|emb|CAD28708.1| ATPase III subunit [Calycanthus floridus var. glaucus] >gi|34481616|emb|CAD45095.2| ATPase III subunit [Amborella trichopoda] >gi|48475988|gb|AAP29379.2| ATP synthase CF0 C chain [Adiantum capillus-veneris] >gi|50250314|emb|CAF28580.1| ATPase III subunit [Nymphaea alba] >gi|51235300|gb|AAT98496.1| atpAse subunit III [Panax ginseng] >gi|58802770|gb|AAW82490.1| ATP synthase CF0 C chain [Phalaenopsis aphrodite subsp. formosana] >gi|60460796|gb|AAX21016.1| ATP synthase CF0 subunit III [Eucalyptus globulus subsp. globulus] >gi|61992026|gb|AAX58147.1| ATPase subunit III [Lactuca sativa] >gi|62149320|dbj|BAD93462.1| ATP synthase CF0 C chain [Silene latifolia] >gi|69215264|gb|AAZ03823.1| ATP synthase CF0 C chain [Acorus americanus] >gi|69215266|gb|AAZ03824.1| ATP synthase CF0 C chain [Ginkgo biloba] >gi|69215268|gb|AAZ03825.1| ATP synthase CF0 C chain [Nuphar advena] >gi|69215270|gb|AAZ03826.1| ATP synthase CF0 C chain [Ranunculus macranthus] >gi|69215272|gb|AAZ03827.1| ATP synthase CF0 C chain [Typha latifolia] >gi|69215274|gb|AAZ03828.1| ATP synthase CF0 C chain [Yucca schidigera] >gi|74381696|emb|CAI53781.1| ATPase III subunit [Acorus calamus] >gi|77799545|dbj|BAE46634.1| ATPase III subunit [Nicotiana sylvestris] >gi|78100304|gb|ABB20945.1| ATP synthase CF0 subunit III [Morus indica] >gi|78675160|dbj|BAE47586.1| ATP synthase CF0 C chain [Lactuca sativa] >gi|80750908|dbj|BAE47984.1| ATPase III subunit [Nicotiana tomentosiformis] >gi|84371970|gb|ABC56287.1| ATP synthase CF0 subunit III [Lycopersicon esculentum] >gi|84682191|gb|ABC60445.1| ATP synthase CF0 subunit III [Nuphar advena] >gi|85540791|gb|ABC70743.1| ATP synthase CF0 subunit III [Ranunculus macranthus] >gi|85687403|gb|ABC73615.1| ATP synthase CF0 subunit III [Gossypium hirsutum] >gi|88656887|gb|ABD47138.1| ATP synthase CF0 subunit III [Helianthus annuus] >gi|88656975|gb|ABD47225.1| ATP synthase CF0 subunit III [Lactuca sativa] >gi|88696757|gb|ABD48482.1| ATPase III subunit [Lemna minor] >gi|89241658|emb|CAJ32380.1| ATP synthase CF0 C chain [Solanum lycopersicum] >gi|91701637|gb|ABE47521.1| ATP synthase CF0 subunit III [Vitis vinifera] >gi|109945504|dbj|BAE97192.1| ATP synthase CF0 C chain [Populus alba] >gi|110456210|gb|ABG74615.1| ATPase subunit III [Jasminum nudiflorum] >gi|112032649|gb|ABH88284.1| ATP synthase CF0 subunit III [Drimys granadensis] >gi|113200895|gb|ABI32411.1| ATP synthase CF0 subunit III [Daucus carota] >gi|113200981|gb|ABI32496.1| ATP synthase CF0 subunit III [Liriodendron tulipifera] >gi|113952609|gb|ABI49007.1| ATP synthase CF0 subunit III [Citrus sinensis] >gi|114054371|gb|ABI49765.1| ATP synthase CF0 subunit III [Platanus occidentalis] >gi|114054457|gb|ABI49850.1| ATP synthase CF0 subunit III [Nandina domestica] >gi|116242151|gb|ABJ89666.1| ATP synthase CF0 subunit III [Coffea arabica] >gi|133712046|gb|ABO36689.1| ATP synthase CF0 subunit III [Populus trichocarpa] >gi|134286128|dbj|BAF49757.1| ATPase III subunit [Aethionema cordifolium] >gi|134286213|dbj|BAF49841.1| ATPase III subunit [Aethionema grandiflorum] >gi|134286472|dbj|BAF50097.1| ATPase III subunit [Barbarea verna] >gi|134286827|dbj|BAF50448.1| ATPase III subunit [Lepidium virginicum] >gi|134286916|dbj|BAF50536.1| ATPase III subunit [Lobularia maritima] >gi|134287006|dbj|BAF50625.1| ATPase III subunit [Nasturtium officinale] >gi|146744175|gb|ABQ43247.1| ATP synthase CF0 subunit III [Chloranthus spicatus] >gi|146762272|gb|ABQ45236.1| ATP synthase CF0 subunit III [Buxus microphylla] >gi|147917382|gb|ABQ52506.1| ATP synthase CF0 subunit III [Illicium oligandrum] >gi|148668033|gb|ABR01417.1| ATP synthase CF0 subunit III [Dioscorea elephantipes] >gi|156555998|emb|CAM98381.1| ATP synthase CF0 C chain [Cuscuta reflexa] >gi|156573657|gb|ABU85162.1| ATP synthase CF0 subunit III [Anethum graveolens] >gi|156598101|gb|ABU85316.1| ATP synthase CF0 subunit III [Elaeis oleifera] >gi|156598293|gb|ABU85408.1| ATP synthase CF0 subunit III [Musa acuminata] >gi|156598596|gb|ABU85555.1| ATP synthase CF0 subunit III [Scaevola aemula] >gi|157695872|gb|ABV66141.1| ATP synthase CF0 subunit III [Manihot esculenta] >gi|158938665|gb|ABW83682.1| ATP synthase CF0 subunit III [Cuscuta exaltata] >gi|160369840|gb|ABX38731.1| ATP synthase CF0 subunit III [Acorus americanus] >gi|166065344|gb|ABY79719.1| ATP synthase CF0 C subunit [Fagopyrum esculentum subsp. ancestrale] >gi|166344119|gb|ABY86769.1| ATP synthase CF0 C chain [Carica papaya] >gi|179366248|gb|ACB86519.1| ATP synthase CF0 subunit III [Guizotia abyssinica] >gi|194132097|gb|ACF33351.1| ATP synthase CF0 subunit III [Gonystylus bancanus] >gi|224347|prf||1102209A ATPase III,H translocating >gi|225272|prf||1211235G ATPase III (81 aa)
Score = 104, Expect = 2.1e-03, Identities = 31/75 (41%), Positives = 46/75 (61%)
  Q:     1 MNITNQGYAFIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           MN      + I AGLA+ +A +G G+GQG +A ++VE +AR PE   KIR   +LS A  E   +Y  ++A+ L+F
  S:     1 MNPLISAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALALLF 76
>gi|85794840|ref|NP_005167.2| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C2 isoform b precursor [Homo sapiens] >gi|114644458|ref|XP_509102.2| PREDICTED: ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C2 isoform 5 [Pan troglodytes] >gi|119617131|gb|EAW96725.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C2 (subunit 9), isoform CRA_a [Homo sapiens] (198 aa)
Score = 104, Expect = 2.2e-03, Identities = 24/66 (36%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A L++F
  S:   131 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILF 196
>gi|11465630|ref|NP_049301.1| ATP synthase F0 subunit 9 [Porphyra purpurea] >gi|4106937|gb|AAD03104.1| ATP synthase F0 subunit 9 [Porphyra purpurea] (76 aa)
Score = 104, Expect = 2.2e-03, Identities = 31/75 (41%), Positives = 44/75 (58%)
  Q:     1 MNITNQGYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           MN+T Q    IGAGLA I + GVG G G      V A +RNP + +++    IL  A+TE  AL+  ++A L++F
  S:     1 MNVTLQSAKMIGAGLATIGLTGVGAGVGIVFGSLVIAYSRNPSLKNELFGYTILGFALTEAIALFALMMAFLILF 75
>gi|172072930|ref|YP_001806691.1| ATP synthase CF0 subunit III [Cryptomeria japonica] >gi|171854949|dbj|BAG16689.1| ATP synthase CF0 subunit III [Cryptomeria japonica] (81 aa)
Score = 104, Expect = 2.2e-03, Identities = 31/75 (41%), Positives = 46/75 (61%)
  Q:     1 MNITNQGYAFIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           MN      + I AGL++ +A +G GIGQG +A ++VE +AR PE   KIR   +LS A  E   +Y  ++A+ L+F
  S:     1 MNPLISAASVIAAGLSVGLASIGPGIGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALALLF 76
>gi|77918560|ref|YP_356375.1| ATP synthase F0, C subunit [Pelobacter carbinolicus DSM 2380] >gi|77544643|gb|ABA88205.1| ATP synthase F0, C subunit [Pelobacter carbinolicus DSM 2380] (88 aa)
Score = 104, Expect = 2.2e-03, Identities = 27/68 (39%), Positives = 43/68 (63%)
  Q:     8 YAFIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +  I AG  M I  LG GIGQG +   ++E VARNP    KI +  ++  A+ E+ A+Y F++A++++F
  S:     6 WVMITAGFGMAIGSLGTGIGQGLAVKSALEGVARNPGASGKILTTMMIGLAMIESLAIYVFVVAMIILF 74
>gi|113475844|ref|YP_721905.1| F0F1 ATP synthase subunit C [Trichodesmium erythraeum IMS101] >gi|110166892|gb|ABG51432.1| ATP synthase F0, C subunit [Trichodesmium erythraeum IMS101] (81 aa)
Score = 104, Expect = 2.2e-03, Identities = 23/55 (41%), Positives = 36/55 (65%)
  Q:    21 LGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +G GIGQG +A ++VE +AR PE   KIR   +LS A  E   +Y  +++++L+F
  S:    22 IGPGIGQGNAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVSLVLLF 76
>gi|13518441|ref|NP_084801.1| ATP synthase CF0 C subunit [Lotus japonicus] >gi|91214146|ref|YP_538768.1| ATP synthase CF0 C subunit [Glycine max] >gi|139387457|ref|YP_001122811.1| ATP synthase CF0 subunit III [Phaseolus vulgaris] >gi|59799157|sp|P69194|ATPH_LOTJA ATP synthase C chain (ATPase subunit III) (Lipid-binding protein) >gi|59799158|sp|P69195|ATPH_SOYBN ATP synthase C chain (Lipid-binding protein) (ATPase subunit III) >gi|169935|gb|AAB01580.1| DCCD-binding protein >gi|13358982|dbj|BAB33199.1| ATPase III subunit [Lotus japonicus] >gi|83595747|gb|ABC25128.1| ATP synthase CF0 subunit III [Glycine max] >gi|112030979|gb|ABH88091.1| ATP synthase CF0 subunit III [Phaseolus vulgaris] >gi|158187144|gb|ABW22777.1| ATP synthase CF0 subunit III [Phaseolus vulgaris] (81 aa)
Score = 103, Expect = 2.5e-03, Identities = 31/75 (41%), Positives = 46/75 (61%)
  Q:     1 MNITNQGYAFIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           MN      + I AGLA+ +A +G G+GQG +A ++VE +AR PE   KIR   +LS A  E   +Y  ++A+ L+F
  S:     1 MNPIISAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALALLF 76
>gi|156618897|ref|YP_001430033.1| ATP synthase CF0 C chain [Cuscuta gronovii] >gi|159106787|ref|YP_001531207.1| ATP synthase CF0 subunit III [Cuscuta obtusiflora] >gi|156555935|emb|CAM98319.1| ATP synthase CF0 C chain [Cuscuta gronovii] >gi|158142511|gb|ABW20552.1| ATP synthase CF0 subunit III [Cuscuta obtusiflora] (81 aa)
Score = 103, Expect = 2.5e-03, Identities = 31/75 (41%), Positives = 45/75 (60%)
  Q:     1 MNITNQGYAFIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           MN      + I AG A+ +A +G GIGQG +A ++VE +AR PE   KIR   +LS A  E   +Y  ++A+ L+F
  S:     1 MNPIISAASVIAAGFAVGLASIGPGIGQGTAAGRAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALALLF 76
>gi|60117212|ref|YP_209546.1| ATP synthase CF0 C subunit [Huperzia lucidula] >gi|50660020|gb|AAT80742.1| ATP synthase CF0 subunit III [Huperzia lucidula] (81 aa)
Score = 103, Expect = 2.6e-03, Identities = 31/75 (41%), Positives = 45/75 (60%)
  Q:     1 MNITNQGYAFIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           MN      + I AGLA+ +A +G G+GQG +A ++VE +AR PE   KIR   +LS A  E   +Y  ++A+ L F
  S:     1 MNPLISAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALALPF 76
>gi|157325517|ref|YP_001468295.1| ATP synthase CF0 subunit III [Ipomoea purpurea] >gi|157056745|gb|ABV02335.1| ATP synthase CF0 subunit III [Ipomoea purpurea] (81 aa)
Score = 103, Expect = 2.7e-03, Identities = 29/67 (43%), Positives = 44/67 (65%)
  Q:     9 AFIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           + I AGLA+ +A +G G+GQG +A ++VE +AR PE   KIR   +LS A  E   +Y  ++A+ L+F
  S:     9 SVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALALLF 76
>gi|163723700|ref|ZP_02131234.1| ATP synthase F0, C subunit [Desulfatibacillum alkenivorans AK-01] >gi|161403187|gb|EDQ27421.1| ATP synthase F0, C subunit [Desulfatibacillum alkenivorans AK-01] (82 aa)
Score = 103, Expect = 2.7e-03, Identities = 26/68 (38%), Positives = 46/68 (67%)
  Q:     9 AFIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVFV 76
             +GAG++M +  +G G+G+G +AAK+ EA+ RNP+    +    ++  AV+E+  +Y  +IA+LL+FV
  S:    13 GLLGAGISMGLGAIGPGVGEGMAAAKACEAIGRNPKEAGLLTRTMLVGQAVSESTGIYSLVIALLLLFV 81
>gi|149072062|ref|YP_001293547.1| ATP synthase CF0 C chain [Rhodomonas salina] >gi|134303013|gb|ABO70817.1| ATP synthase CF0 C chain [Rhodomonas salina] (82 aa)
Score = 103, Expect = 2.7e-03, Identities = 29/75 (38%), Positives = 48/75 (64%)
  Q:     1 MNITNQGYAFIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           MN      + + +GL++ +A +G GIGQG +AA++VE +AR PE   +IR   +LS A  E+  +Y  ++A+ L+F
  S:     1 MNPIVSAASVVASGLSVGLAAIGPGIGQGTAAAQAVEGIARQPEAEGRIRGTLLLSLAFMESLTIYGLVVALALLF 76
>gi|189095365|ref|YP_001936378.1| ATP synthase CF0 C chain [Heterosigma akashiwo] >gi|157694708|gb|ABV65984.1| ATP synthase CF0 C chain [Heterosigma akashiwo] >gi|157777939|gb|ABV70125.1| ATP synthase CF0 C chain [Heterosigma akashiwo] (82 aa)
Score = 103, Expect = 2.8e-03, Identities = 29/67 (43%), Positives = 45/67 (67%)
  Q:     9 AFIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           + I AGL++ +A +G GIGQG +A ++VE +AR PE  +KIR   +LS A  E   +Y  ++A+ L+F
  S:     9 SVIAAGLSVGLAAIGPGIGQGNAAGQAVEGIARQPEAENKIRGTLLLSLAFMEALTIYGLVVALSLLF 76
>gi|157092933|gb|ABV22121.1| chloroplast ATP synthase subunit C [Alexandrium tamarense] (149 aa)
Score = 103, Expect = 2.9e-03, Identities = 24/65 (36%), Positives = 44/65 (67%)
  Q:    11 IGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +GAG A+ +A +G G+GQG ++ + ++ ++R PEV   +R   +LS A  E+  +Y  +IA++L+F
  S:    78 VGAGFAIGLAAIGSGVGQGIASGRCIDGISRQPEVADDLRGVLLLSLAFMESLTIYGLVIALVLLF 143
>gi|157092941|gb|ABV22125.1| chloroplast ATP synthase subunit C [Alexandrium affine] >gi|157092943|gb|ABV22126.1| chloroplast ATP synthase subunit C [Alexandrium affine] (145 aa)
Score = 103, Expect = 2.9e-03, Identities = 24/65 (36%), Positives = 44/65 (67%)
  Q:    11 IGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +GAG A+ +A +G G+GQG ++ + ++ ++R PEV   +R   +LS A  E+  +Y  +IA++L+F
  S:    74 VGAGFAIGLAAIGSGVGQGIASGRCIDGISRQPEVADDLRGVLLLSLAFMESLTIYGLVIALVLLF 139
>gi|11465571|ref|NP_045037.1| ATP synthase CF0 C subunit [Cyanidium caldarium] >gi|14547922|sp|Q9TM30|ATPH_CYACA ATP synthase C chain (ATPase subunit III) (Lipid-binding protein) >gi|6466427|gb|AAF13009.1|AF022186_181 unknown; ATP synthase CF0 C chain (lipid-binding) (subunit III) [Cyanidium caldarium] (82 aa)
Score = 103, Expect = 3.0e-03, Identities = 25/55 (45%), Positives = 36/55 (65%)
  Q:    21 LGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +G GIGQG +AA +VE +AR PE   KIR   +LS A  E+  +Y  ++A+ L+F
  S:    22 IGPGIGQGSAAANAVEGLARQPEAEGKIRGTLLLSLAFMESLTIYGLVVALSLLF 76
>gi|28261704|ref|NP_783219.1| ATP synthase CF0 C subunit [Atropa belladonna] >gi|20068318|emb|CAC88031.1| atpAse subunit III [Atropa belladonna] (81 aa)
Score = 103, Expect = 3.0e-03, Identities = 29/67 (43%), Positives = 44/67 (65%)
  Q:     9 AFIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           + I AGLA+ +A +G G+GQG +A ++VE +AR PE   KIR   +LS A  E   +Y  ++A+ L+F
  S:     9 SVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALALLF 76
>gi|108773237|ref|YP_635717.1| ATP synthase CF0 C subunit [Chara vulgaris] >gi|77157893|gb|ABA61934.1| CF0 subunit III of ATP synthase [Chara vulgaris] (81 aa)
Score = 103, Expect = 3.1e-03, Identities = 30/75 (40%), Positives = 46/75 (61%)
  Q:     1 MNITNQGYAFIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           MN      + I AGLA+ ++ +G G+GQG +A ++VE +AR PE   KIR   +LS A  E   +Y  ++A+ L+F
  S:     1 MNPLISAASVIAAGLAVGLSSIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALALLF 76
>gi|73966257|ref|XP_851984.1| PREDICTED: similar to ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c, isoform 1 isoform 2 [Canis familiaris] >gi|73966259|ref|XP_548181.2| PREDICTED: similar to ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c, isoform 1 isoform 1 [Canis familiaris] (136 aa)
Score = 103, Expect = 3.1e-03, Identities = 24/66 (36%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A L++F
  S:    69 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILF 134
>gi|50593533|ref|NP_001002031.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C2 isoform a precursor [Homo sapiens] >gi|114644462|ref|XP_001137490.1| PREDICTED: ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C2 isoform 4 [Pan troglodytes] (157 aa)
Score = 102, Expect = 3.2e-03, Identities = 24/66 (36%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A L++F
  S:    90 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILF 155
>gi|196240818|ref|ZP_03139584.1| ATP synthase F0, C subunit [Cyanothece sp. PCC 7425] >gi|196214897|gb|EDY09550.1| ATP synthase F0, C subunit [Cyanothece sp. PCC 7425] (82 aa)
Score = 102, Expect = 3.3e-03, Identities = 22/52 (42%), Positives = 35/52 (67%)
  Q:    24 GIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           GIGQG ++ ++VE +AR PE   KIR   +L+ A  E+  +Y  +IA++L+F
  S:    25 GIGQGNASGQAVEGIARQPEAEGKIRGTLLLTLAFMESLTIYGLVIALVLLF 76
>gi|119511016|ref|ZP_01630137.1| ATP synthase c subunit [Nodularia spumigena CCY9414] >gi|119464361|gb|EAW45277.1| ATP synthase c subunit [Nodularia spumigena CCY9414] (91 aa)
Score = 102, Expect = 3.3e-03, Identities = 27/75 (36%), Positives = 49/75 (65%)
  Q:     1 MNITNQGY----AFIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           MNI N G     + I AGL + I  +G  I +GW+ A+++ A+A+ P+  + I     +  A+ E+ A+YCF+++++L+F
  S:     1 MNIDNLGLIGMVSIIMAGLTIAIGSIGPAIAEGWAVARALGAMAQQPDQANTITRTLFVGLAIIESTAIYCFVVSMILIF 80
>gi|58618212|gb|AAW80671.1| chloroplast ATPH isoform 1 [Heterocapsa triquetra] (135 aa)
Score = 102, Expect = 3.3e-03, Identities = 24/65 (36%), Positives = 44/65 (67%)
  Q:    11 IGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +GAG A+ +A +G G+GQG ++ + ++ ++R PEV   +R   +LS A  E+  +Y  +IA++L+F
  S:    64 VGAGFAIGLAAIGSGVGQGIASGRCIDGISRQPEVADDLRGVLLLSLAFMESLTIYGLVIALVLLF 129
>gi|193891039|gb|ACF28673.1| chloroplast ATP synthase [Amphidinium carterae] >gi|193891043|gb|ACF28675.1| chloroplast ATP synthase [Amphidinium carterae] (144 aa)
Score = 102, Expect = 3.3e-03, Identities = 24/65 (36%), Positives = 44/65 (67%)
  Q:    11 IGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +GAG A+ +A +G G+GQG ++ + ++ ++R PEV   +R   +LS A  E+  +Y  +IA++L+F
  S:    73 VGAGFAIGLAAIGSGVGQGIASGRCIDGISRQPEVADDLRGVLLLSLAFMESLTIYGLVIALVLLF 138
>gi|58618216|gb|AAW80673.1| chloroplast ATPH isoform 3 [Heterocapsa triquetra] (140 aa)
Score = 102, Expect = 3.4e-03, Identities = 24/65 (36%), Positives = 44/65 (67%)
  Q:    11 IGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +GAG A+ +A +G G+GQG ++ + ++ ++R PEV   +R   +LS A  E+  +Y  +IA++L+F
  S:    69 VGAGFAIGLAAIGSGVGQGIASGRCIDGISRQPEVADDLRGVLLLSLAFMESLTIYGLVIALVLLF 134
>gi|149639699|ref|XP_001514999.1| PREDICTED: hypothetical protein [Ornithorhynchus anatinus] (161 aa)
Score = 102, Expect = 3.5e-03, Identities = 24/66 (36%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A L++F
  S:    94 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILF 159
>gi|58613491|gb|AAW79332.1| chloroplast ATP synthase subunit C [Heterocapsa triquetra] (140 aa)
Score = 102, Expect = 3.5e-03, Identities = 24/65 (36%), Positives = 44/65 (67%)
  Q:    11 IGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +GAG A+ +A +G G+GQG ++ + ++ ++R PEV   +R   +LS A  E+  +Y  +IA++L+F
  S:    69 VGAGFAIGLAAIGSGVGQGIASGRCIDGISRQPEVADDLRGVLLLSLAFMESLTIYGLVIALVLLF 134
>gi|11466782|ref|NP_039378.1| ATP synthase CF0 C subunit [Oryza sativa Japonica Group] >gi|11467187|ref|NP_043020.1| ATP synthase CF0 C subunit [Zea mays] >gi|11497511|ref|NP_054919.1| ATP synthase CF0 C subunit [Spinacia oleracea] >gi|14017567|ref|NP_114254.1| ATP synthase CF0 C subunit [Triticum aestivum] >gi|48478768|ref|YP_024376.1| ATP synthase CF0 C subunit [Saccharum hybrid cultivar SP-80-3280] >gi|50233966|ref|YP_052744.1| ATP synthase CF0 C subunit [Oryza nivara] >gi|50812523|ref|YP_054626.1| ATP synthase CF0 C subunit [Saccharum officinarum] >gi|91208975|ref|YP_538835.1| ATP synthase CF0 C subunit [Solanum bulbocastanum] >gi|109156592|ref|YP_654211.1| ATP synthase CF0 C subunit [Oryza sativa Indica Group] >gi|118430297|ref|YP_874731.1| ATP synthase CF0 subunit III [Agrostis stolonifera] >gi|118430383|ref|YP_874648.1| ATP synthase CF0 subunit III [Hordeum vulgare subsp. vulgare] >gi|118614487|ref|YP_899402.1| ATP synthase CF0 subunit III [Sorghum bicolor] >gi|159106859|ref|YP_001531278.1| ATP synthase CF0 III [Lolium perenne] >gi|194033144|ref|YP_002000482.1| ATPase III subunit [Brachypodium distachyon] >gi|60391827|sp|P69449|ATPH_MAIZE ATP synthase C chain (ATPase subunit III) (Lipid-binding protein) >gi|60391825|sp|P69447|ATPH_SPIOL ATP synthase C chain (Lipid-binding protein) (ATPase subunit III) >gi|60391826|sp|P69448|ATPH_WHEAT ATP synthase C chain (Lipid-binding protein) (ATPase subunit III) >gi|68565036|sp|Q6ENH9|ATPH_ORYNI ATP synthase C chain (Lipid-binding protein) (ATPase subunit III) >gi|75290177|sp|Q6ENW8|ATPH_SACOF ATP synthase C chain (Lipid-binding protein) (ATPase subunit III) >gi|75291226|sp|Q6L3A2|ATPH_SACHY ATP synthase C chain (Lipid-binding protein) (ATPase subunit III) >gi|148840823|sp|P0C2Z9|ATPH_ORYSA ATP synthase C chain (Lipid-binding protein) (ATPase subunit III) >gi|148840824|sp|P0C300|ATPH_ORYSI ATP synthase C chain (Lipid-binding protein) (ATPase subunit III) >gi|148840825|sp|P0C301|ATPH_ORYSJ ATP synthase C chain (Lipid-binding protein) (ATPase subunit III) >gi|19920163|gb|AAM08595.1|AC092750_29 Putative ATPase III subunit from chromosome 10 chloroplast insertion [Oryza sativa (japonica cultivar-group)] >gi|20143585|gb|AAM12342.1|AC091680_43 ATPase III subunit [Oryza sativa (japonica cultivar-group)] >gi|20146748|gb|AAM12484.1|AC074232_11 ATPase III subunit [Oryza sativa (japonica cultivar-group)] >gi|21327355|gb|AAM48260.1|AC122148_13 Putative ATPase III subunit from chromosome 10 chloroplast insertion [Oryza sativa (japonica cultivar-group)] >gi|11976|emb|CAA33991.1| ATPase III subunit [Oryza sativa (japonica cultivar-group)] >gi|12251|emb|CAA27402.1| unnamed protein product [Spinacia oleracea] >gi|12407|emb|CAA28875.1| unnamed protein product [Zea mays] >gi|342580|gb|AAA84473.1| phosphorylation coupling factor alpha subunit (atpA) >gi|343673|gb|AAA84724.1| ATP synthase proton-translocating subunit >gi|902217|emb|CAA60281.1| ATPase subunit III [Zea mays] >gi|7636092|emb|CAB88712.1| ATPase subunit III [Spinacia oleracea] >gi|13928200|dbj|BAB47029.1| ATPase III subunit [Triticum aestivum] >gi|42795484|gb|AAS46051.1| ATP synthase CF0 C chain; atpH [Oryza sativa (indica cultivar-group)] >gi|42795550|gb|AAS46116.1| ATP synthase CF0 C chain; atpH [Oryza sativa (japonica cultivar-group)] >gi|42795614|gb|AAS46179.1| ATP synthase CF0 C chain; gatpH [Oryza sativa (japonica cultivar-group)] >gi|48478670|gb|AAT44690.1| ATP synthase CF0 C chain [Saccharum hybrid cultivar SP-80-3280] >gi|49614990|dbj|BAD26773.1| ATPase III subunit [Oryza nivara] >gi|49659507|dbj|BAD27288.1| ATP synthase III subunit [Saccharum officinarum] >gi|58613935|gb|AAW79569.1| ATP synthase CF0 subunit III [Thinopyrum elongatum] >gi|84371882|gb|ABC56200.1| ATP synthase CF0 subunit III [Solanum bulbocastanum] >gi|118201037|gb|ABK79408.1| ATP synthase CF0 subunit III [Hordeum vulgare subsp. vulgare] >gi|118201121|gb|ABK79491.1| ATP synthase CF0 subunit III [Sorghum bicolor] >gi|118201206|gb|ABK79575.1| ATP synthase CF0 subunit III [Agrostis stolonifera] >gi|158934393|emb|CAO85971.1| ATP synthase CF0 III [Lolium perenne] >gi|193075552|gb|ACF08635.1| ATPase III subunit [Brachypodium distachyon] >gi|223270|prf||0702201A synthase proteolipid subunit,ATP >gi|226694|prf||1603356V ATPase III (81 aa)
Score = 102, Expect = 3.5e-03, Identities = 31/75 (41%), Positives = 46/75 (61%)
  Q:     1 MNITNQGYAFIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           MN      + I AGLA+ +A +G G+GQG +A ++VE +AR PE   KIR   +LS A  E   +Y  ++A+ L+F
  S:     1 MNPLIAAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALALLF 76
>gi|196189856|gb|EDX84820.1| ATP synthase F0, C subunit [Synechococcus sp. PCC 7335] (81 aa)
Score = 102, Expect = 3.7e-03, Identities = 23/52 (44%), Positives = 34/52 (65%)
  Q:    24 GIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           GIGQG +A ++VE +AR PE   KIR   +LS A  E   +Y  ++A++L+F
  S:    25 GIGQGNAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALVLLF 76
>gi|7524608|ref|NP_042362.1| ATP synthase CF0 C subunit [Pinus thunbergii] >gi|29565569|ref|NP_817149.1| ATP synthase CF0 C subunit [Pinus koraiensis] >gi|1168599|sp|P41603|ATPH_PINTH ATP synthase C chain (Lipid-binding protein) (ATPase subunit III) >gi|75295664|sp|Q7GUD2|ATPH_PINKO ATP synthase C chain (Lipid-binding protein) (ATPase subunit III) >gi|1262602|dbj|BAA04320.1| H+-ATPase III subunit [Pinus thunbergii] >gi|29469668|gb|AAO73996.1| H+-ATPase III subunit [Pinus koraiensis] (81 aa)
Score = 102, Expect = 3.7e-03, Identities = 28/67 (41%), Positives = 44/67 (65%)
  Q:     9 AFIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           + I AGL++ +A +G G+GQG +A ++VE +AR PE   KIR   +LS A  E   +Y  ++A+ L+F
  S:     9 SVIAAGLSVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALALLF 76
>gi|4588725|gb|AAD26194.1|AF114954_1 ATP synthase subunit 9 [Saccharomyces exiguus] (76 aa)
Score = 102, Expect = 3.7e-03, Identities = 25/66 (37%), Positives = 41/66 (62%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +IGAG+A I +LG GIG     A  +  V+RNP +  ++ S  IL  A++E   L+C +++ +L+F
  S:     9 YIGAGIATIGLLGAGIGIAIIFAALINGVSRNPSLKDQLFSYTILGMALSEATGLFCLMVSFMLLF 74
>gi|187763102|ref|YP_001876577.1| ATP synthase CF0 subunit III [Welwitschia mirabilis] >gi|149941380|dbj|BAF64857.1| ATP synthase CF0 C subunit [Gnetum parvifolium] >gi|163311632|gb|ABY26790.1| ATP synthase CF0 subunit III [Welwitschia mirabilis] (81 aa)
Score = 102, Expect = 3.7e-03, Identities = 30/75 (40%), Positives = 46/75 (61%)
  Q:     1 MNITNQGYAFIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           MN      + I AGLA+ +A +G G+GQG +A +++E +AR PE   KIR   +LS A  E   +Y  ++A+ L+F
  S:     1 MNPIISAASVIAAGLAVGLASIGPGVGQGTAAGQALEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALALLF 76
>gi|19424234|ref|NP_598240.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C2 (subunit 9) [Rattus norvegicus] >gi|543879|sp|Q06646|AT5G2_RAT ATP synthase lipid-binding protein, mitochondrial precursor (ATP synthase proteolipid P2) (ATPase protein 9) (ATPase subunit c) >gi|286202|dbj|BAA02426.1| ATP synthase subunit c precursor [Rattus norvegicus] >gi|124504543|gb|AAI28727.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C2 (subunit 9) [Rattus norvegicus] >gi|149031904|gb|EDL86816.1| rCG50567, isoform CRA_a [Rattus norvegicus] >gi|149031905|gb|EDL86817.1| rCG50567, isoform CRA_a [Rattus norvegicus] (141 aa)
Score = 102, Expect = 3.7e-03, Identities = 24/66 (36%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A L++F
  S:    74 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILF 139
>gi|13385960|ref|NP_080744.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 2 [Mus musculus] >gi|51338784|sp|P56383|AT5G2_MOUSE ATP synthase lipid-binding protein, mitochondrial precursor (ATP synthase proteolipid P2) (ATPase protein 9) (ATPase subunit c) >gi|12832200|dbj|BAB22005.1| unnamed protein product [Mus musculus] >gi|12841492|dbj|BAB25231.1| unnamed protein product [Mus musculus] >gi|12848921|dbj|BAB28137.1| unnamed protein product [Mus musculus] >gi|13905060|gb|AAH06813.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 2 [Mus musculus] >gi|26344626|dbj|BAC35962.1| unnamed protein product [Mus musculus] >gi|51980721|gb|AAH81437.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 2 [Mus musculus] >gi|77415523|gb|AAI06139.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 2 [Mus musculus] >gi|148669715|gb|EDL01662.1| mCG118574 [Mus musculus] >gi|148672010|gb|EDL03957.1| mCG17597 [Mus musculus] >gi|148692417|gb|EDL24364.1| mCG113310 [Mus musculus] (146 aa)
Score = 102, Expect = 3.7e-03, Identities = 24/66 (36%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A L++F
  S:    79 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILF 144
>gi|124302892|ref|YP_001023687.1| ATP synthase CF0 subunit III [Angiopteris evecta] >gi|110628290|gb|ABG79586.1| ATP synthase CF0 subunit III [Angiopteris evecta] (81 aa)
Score = 102, Expect = 3.8e-03, Identities = 31/75 (41%), Positives = 45/75 (60%)
  Q:     1 MNITNQGYAFIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           MN      + I AGLA+ +A +G G+GQG +A ++VE +AR PE   KIR   +LS A  E   +Y  ++A+ L F
  S:     1 MNPLISAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALALSF 76
>gi|193891060|gb|ACF28683.1| chloroplast ATP synthase [Amphidinium carterae] (144 aa)
Score = 102, Expect = 3.8e-03, Identities = 24/65 (36%), Positives = 44/65 (67%)
  Q:    11 IGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +GAG A+ +A +G G+GQG ++ + ++ ++R PEV   +R   +LS A  E+  +Y  +IA++L+F
  S:    73 VGAGFAIGLAAIGSGVGQGIASGRCIDGISRQPEVADDLRGVLLLSLAFMESLTIYGLVIALVLLF 138
>gi|193891057|gb|ACF28682.1| chloroplast ATP synthase [Amphidinium carterae] (144 aa)
Score = 102, Expect = 3.9e-03, Identities = 24/65 (36%), Positives = 44/65 (67%)
  Q:    11 IGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +GAG A+ +A +G G+GQG ++ + ++ ++R PEV   +R   +LS A  E+  +Y  +IA++L+F
  S:    73 VGAGFAIGLAAIGSGVGQGIASGRCIDGISRQPEVADDLRGVLLLSLAFMESLTIYGLVIALVLLF 138
>gi|193891049|gb|ACF28678.1| chloroplast ATP synthase [Amphidinium carterae] (143 aa)
Score = 102, Expect = 3.9e-03, Identities = 24/65 (36%), Positives = 44/65 (67%)
  Q:    11 IGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +GAG A+ +A +G G+GQG ++ + ++ ++R PEV   +R   +LS A  E+  +Y  +IA++L+F
  S:    72 VGAGFAIGLAAIGSGVGQGIASGRCIDGISRQPEVADDLRGVLLLSLAFMESLTIYGLVIALVLLF 137
>gi|193891045|gb|ACF28676.1| chloroplast ATP synthase [Amphidinium carterae] (144 aa)
Score = 102, Expect = 4.0e-03, Identities = 24/65 (36%), Positives = 44/65 (67%)
  Q:    11 IGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +GAG A+ +A +G G+GQG ++ + ++ ++R PEV   +R   +LS A  E+  +Y  +IA++L+F
  S:    73 VGAGFAIGLAAIGSGVGQGIASGRCIDGISRQPEVADDLRGVLLLSLAFMESLTIYGLVIALVLLF 138
>gi|193891068|gb|ACF28687.1| chloroplast ATP synthase [Amphidinium carterae] (144 aa)
Score = 102, Expect = 4.0e-03, Identities = 24/65 (36%), Positives = 44/65 (67%)
  Q:    11 IGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +GAG A+ +A +G G+GQG ++ + ++ ++R PEV   +R   +LS A  E+  +Y  +IA++L+F
  S:    73 VGAGFAIGLAAIGSGVGQGNASGRCIDGISRQPEVADDLRGVLLLSLAFMESLTIYGLVIALVLLF 138
>gi|157092951|gb|ABV22130.1| chloroplast ATP synthase subunit C [Heterocapsa triquetra] (140 aa)
Score = 102, Expect = 4.1e-03, Identities = 24/65 (36%), Positives = 44/65 (67%)
  Q:    11 IGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +GAG A+ +A +G G+GQG ++ + ++ ++R PEV   +R   +LS A  E+  +Y  +IA++L+F
  S:    69 VGAGFAIGLAAIGSGVGQGIASGRCIDGISRQPEVADDLRGVLLLSLAFMESLTIYGLVIALVLLF 134
>gi|4469301|emb|CAB38451.1| ATP synthase CF0 C chain [Prototheca wickerhamii] (81 aa)
Score = 102, Expect = 4.2e-03, Identities = 30/67 (44%), Positives = 44/67 (65%)
  Q:     9 AFIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           + I AGLA+ +A +G GIGQG +A  +VE +AR PE   KIR   +LS A  E+  +Y  ++A+ L+F
  S:     9 SVIAAGLAIGLATIGPGIGQGTAAGYAVEGIARQPEAEGKIRGALLLSFAFMESLTIYGLVVALALLF 76
>gi|2493076|sp|Q42969|ATPH_OCHNE ATP synthase C chain (Lipid-binding protein) (ATPase subunit III) >gi|1430911|emb|CAA67536.1| subunit III of ATPase [Ochrosphaera neapolitana] (82 aa)
Score = 102, Expect = 4.2e-03, Identities = 24/52 (46%), Positives = 35/52 (67%)
  Q:    24 GIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           GIGQG +AA++VE +AR PE   KIR   +LS A  E+  +Y  ++A+ L+F
  S:    25 GIGQGTAAAQAVEGLARQPEAEGKIRGTLLLSLAFMESLTIYGLVVALCLLF 76
>gi|114650|sp|P28530|ATPH_PAVLU ATP synthase C chain (Lipid-binding protein) (ATPase subunit III) >gi|12112|emb|CAA45997.1| ATPase subunit [Pavlova lutheri] >gi|228856|prf||1813203B atpH gene (83 aa)
Score = 101, Expect = 4.2e-03, Identities = 30/75 (40%), Positives = 46/75 (61%)
  Q:     1 MNITNQGYAFIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           MN      + I AGL++ +A +G GIGQG +A +++E +AR PE   KIR   +LS A  E   +Y  ++A+ L+F
  S:     1 MNPIISAASVIAAGLSVGLAAIGPGIGQGSAAGQALEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALSLLF 76
>gi|13577|emb|CAA28961.1| unnamed protein product [Saccharomyces cerevisiae] (76 aa)
Score = 101, Expect = 4.3e-03, Identities = 25/66 (37%), Positives = 40/66 (60%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +IGAG++ I +LGVGIG     A  +  V+RNP +   +    IL  A++E   L+C +++ LL+F
  S:     9 YIGAGISTIGLLGVGIGIAIVFAALINGVSRNPSIKDTVFPMAILGFALSEATGLFCLMVSFLLLF 74
>gi|148378157|ref|YP_001252698.1| F0F1 ATP synthase subunit C [Clostridium botulinum A str. ATCC 3502] >gi|153933562|ref|YP_001382558.1| F0F1 ATP synthase subunit C [Clostridium botulinum A str. ATCC 19397] >gi|153934640|ref|YP_001386110.1| F0F1 ATP synthase subunit C [Clostridium botulinum A str. Hall] >gi|153938069|ref|YP_001389514.1| F0F1 ATP synthase subunit C [Clostridium botulinum F str. Langeland] >gi|168177484|ref|ZP_02612148.1| ATP synthase F0, C subunit [Clostridium botulinum NCTC 2916] >gi|168182239|ref|ZP_02616903.1| ATP synthase F0, C subunit [Clostridium botulinum Bf] >gi|170756560|ref|YP_001779779.1| ATP synthase F0, C subunit [Clostridium botulinum B1 str. Okra] >gi|170758436|ref|YP_001785480.1| ATP synthase F0, C subunit [Clostridium botulinum A3 str. Loch Maree] >gi|148287641|emb|CAL81706.1| ATP synthase c chain [Clostridium botulinum A str. ATCC 3502] >gi|152929606|gb|ABS35106.1| ATP synthase F0, C subunit [Clostridium botulinum A str. ATCC 19397] >gi|152930554|gb|ABS36053.1| ATP synthase F0, C subunit [Clostridium botulinum A str. Hall] >gi|152933965|gb|ABS39463.1| ATP synthase F0, C subunit [Clostridium botulinum F str. Langeland] >gi|169121772|gb|ACA45608.1| ATP synthase F0, C subunit [Clostridium botulinum B1 str. Okra] >gi|169405425|gb|ACA53836.1| ATP synthase F0, C subunit [Clostridium botulinum A3 str. Loch Maree] >gi|182670615|gb|EDT82589.1| ATP synthase F0, C subunit [Clostridium botulinum NCTC 2916] >gi|182674589|gb|EDT86550.1| ATP synthase F0, C subunit [Clostridium botulinum Bf] (79 aa)
Score = 101, Expect = 4.3e-03, Identities = 24/55 (43%), Positives = 35/55 (63%)
  Q:    21 LGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +G GIG G +  K+VE V+R PE   KI S  ++ +A +E  A+Y  IIA+ L+F
  S:    23 IGAGIGTGNATGKAVEGVSRQPEASGKIMSTLVIGSAFSEATAIYGLIIALFLIF 77
>gi|193891041|gb|ACF28674.1| chloroplast ATP synthase [Amphidinium carterae] >gi|193891051|gb|ACF28679.1| chloroplast ATP synthase [Amphidinium carterae] >gi|193891064|gb|ACF28685.1| chloroplast ATP synthase [Amphidinium carterae] (143 aa)
Score = 101, Expect = 4.3e-03, Identities = 24/65 (36%), Positives = 44/65 (67%)
  Q:    11 IGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +GAG A+ +A +G G+GQG ++ + ++ ++R PEV   +R   +LS A  E+  +Y  +IA++L+F
  S:    72 VGAGFAIGLAAIGSGVGQGIASGRCIDGISRQPEVADDLRGVLLLSLAFMESLTIYGLVIALVLLF 137
>gi|194217074|ref|XP_001499319.2| PREDICTED: similar to H(+)-transporting ATP synthase [Equus caballus] (136 aa)
Score = 101, Expect = 4.4e-03, Identities = 24/66 (36%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A L++F
  S:    69 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILF 134
>gi|8392939|ref|NP_059007.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c, isoform 1 [Rattus norvegicus] >gi|543878|sp|Q06645|AT5G1_RAT ATP synthase lipid-binding protein, mitochondrial precursor (ATP synthase proteolipid P1) (ATPase protein 9) (ATPase subunit c) >gi|286200|dbj|BAA02425.1| ATP synthase subunit c precursor [Rattus norvegicus] >gi|149053967|gb|EDM05784.1| rCG33837, isoform CRA_a [Rattus norvegicus] >gi|149053968|gb|EDM05785.1| rCG33837, isoform CRA_a [Rattus norvegicus] >gi|149053969|gb|EDM05786.1| rCG33837, isoform CRA_a [Rattus norvegicus] (136 aa)
Score = 101, Expect = 4.4e-03, Identities = 24/66 (36%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A L++F
  S:    69 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILF 134
>gi|57164181|ref|NP_001009468.1| H(+)-transporting ATP synthase [Ovis aries] >gi|461593|sp|Q06056|AT5G2_SHEEP ATP synthase lipid-binding protein, mitochondrial precursor (ATP synthase proteolipid P2) (ATPase protein 9) (ATPase subunit c) >gi|1203|emb|CAA49530.1| H(+)-transporting ATP synthase [Ovis aries] (143 aa)
Score = 101, Expect = 4.4e-03, Identities = 24/66 (36%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A L++F
  S:    76 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILF 141
>gi|124112041|ref|YP_001019099.1| CF0 subunit III of ATP synthase [Chlorokybus atmophyticus] >gi|124012157|gb|ABD62173.2| CF0 subunit III of ATP synthase [Chlorokybus atmophyticus] (82 aa)
Score = 101, Expect = 4.5e-03, Identities = 29/67 (43%), Positives = 44/67 (65%)
  Q:     9 AFIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           + + AGLA+ +A +G GIGQG +A ++VE +AR PE   KIR   +LS A  E   +Y  ++A+ L+F
  S:     9 SVLAAGLAVGLASIGPGIGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALALLF 76
>gi|193891047|gb|ACF28677.1| chloroplast ATP synthase [Amphidinium carterae] >gi|193891053|gb|ACF28680.1| chloroplast ATP synthase [Amphidinium carterae] (143 aa)
Score = 101, Expect = 4.7e-03, Identities = 24/65 (36%), Positives = 44/65 (67%)
  Q:    11 IGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +GAG A+ +A +G G+GQG ++ + ++ ++R PEV   +R   +LS A  E+  +Y  +IA++L+F
  S:    72 VGAGFAIGLAAIGSGVGQGIASGRCIDGISRQPEVADDLRGVLLLSLAFMESLTIYGLVIALVLLF 137
>gi|154466817|gb|ABS82569.1| ATPase subunit III [Olea europaea] (70 aa)
Score = 101, Expect = 4.7e-03, Identities = 28/64 (43%), Positives = 41/64 (64%)
  Q:    12 GAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           G GLA+  A +G G+GQG +A ++VE +AR PE   KIR   +LS A  E   +Y  ++A+ L+F
  S:     1 GLGLAVGFASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALALLF 65
>gi|161350041|ref|NP_895298.2| F0F1 ATP synthase subunit C [Prochlorococcus marinus str. MIT 9313] (82 aa)
Score = 101, Expect = 4.7e-03, Identities = 29/75 (38%), Positives = 46/75 (61%)
  Q:     1 MNITNQGYAFIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           M+      + + AGLA+ +  +G GIGQG +A  +VE +AR PE   KIR   +LS A  E+  +Y  ++A++L+F
  S:     1 MDSITTAASVVAAGLAVGLGAIGPGIGQGTAAGGAVEGIARQPEAEGKIRGTLLLSFAFMESLTIYGLVVALVLLF 76
>gi|157092935|gb|ABV22122.1| chloroplast ATP synthase subunit C [Alexandrium tamarense] (148 aa)
Score = 101, Expect = 4.8e-03, Identities = 24/65 (36%), Positives = 44/65 (67%)
  Q:    11 IGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +GAG A+ +A +G G+GQG ++ + ++ ++R PEV   +R   +LS A  E+  +Y  +IA++L+F
  S:    77 VGAGFAIGLAAIGSGVGQGIASGRCIDGISRQPEVADDLRGVLLLSLAFMESLTIYGLVIALVLLF 142
>gi|33862011|ref|NP_893572.1| F0F1 ATP synthase subunit C [Prochlorococcus marinus subsp. pastoris str. CCMP1986] >gi|78779932|ref|YP_398044.1| F0F1 ATP synthase subunit C [Prochlorococcus marinus str. MIT 9312] >gi|123966867|ref|YP_001011948.1| F0F1 ATP synthase subunit C [Prochlorococcus marinus str. MIT 9515] >gi|123969189|ref|YP_001010047.1| F0F1 ATP synthase subunit C [Prochlorococcus marinus str. AS9601] >gi|126696983|ref|YP_001091869.1| F0F1 ATP synthase subunit C [Prochlorococcus marinus str. MIT 9301] >gi|157414056|ref|YP_001484922.1| F0F1 ATP synthase subunit C [Prochlorococcus marinus str. MIT 9215] >gi|33640379|emb|CAE19914.1| H+-transporting ATP synthase c subunit [Prochlorococcus marinus subsp. pastoris str. CCMP1986] >gi|78713431|gb|ABB50608.1| ATP synthase F0, C subunit [Prochlorococcus marinus str. MIT 9312] >gi|91070171|gb|ABE11092.1| ATP synthase subunit C [uncultured Prochlorococcus marinus clone HF10-11D6] >gi|123199299|gb|ABM70940.1| ATP synthase subunit c [Prochlorococcus marinus str. AS9601] >gi|123201233|gb|ABM72841.1| ATP synthase subunit c [Prochlorococcus marinus str. MIT 9515] >gi|126544026|gb|ABO18268.1| ATP synthase subunit c [Prochlorococcus marinus str. MIT 9301] >gi|157388631|gb|ABV51336.1| ATP synthase subunit c [Prochlorococcus marinus str. MIT 9215] (81 aa)
Score = 101, Expect = 4.8e-03, Identities = 28/75 (37%), Positives = 46/75 (61%)
  Q:     1 MNITNQGYAFIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           M+      + + AGLA+ +  +G G+GQG +A  +VE +AR PE   KIR   +LS A  E+  +Y  ++A++L+F
  S:     1 MDSITSAASVVAAGLAVGLGAIGPGLGQGNAAQGAVEGIARQPEAEGKIRGTLLLSFAFMESLTIYGLVVALVLLF 76
>gi|166406825|gb|ABY87376.1| mitochondrial ATP synthase subunit 9 precursor-like protein [Haliotis diversicolor] (157 aa)
Score = 101, Expect = 4.9e-03, Identities = 26/71 (36%), Positives = 39/71 (54%)
  Q:     5 NQGYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +Q   +IGAG A + + G G G G      V   ARNP +  ++ S  IL  A++E   L+C ++A LL+F
  S:    85 DQAAKYIGAGAATVGVAGSGAGIGSVFGSLVIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMMAFLLLF 155
>gi|28603708|ref|NP_788786.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C2 [Bos taurus] >gi|114680|sp|P07926|AT5G2_BOVIN ATP synthase lipid-binding protein, mitochondrial precursor (ATP synthase proteolipid P2) (ATPase protein 9) (ATPase subunit c) >gi|99|emb|CAA28846.1| P2 subunit [Bos taurus] >gi|28189645|dbj|BAC56437.1| similar to mit-ATP synthase proteolipid P2 subunit precursor [Bos taurus] >gi|84202593|gb|AAI11614.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C2 (subunit 9) [Bos taurus] >gi|224831|prf||1202261B ATP synthase proteolipid P2 (143 aa)
Score = 101, Expect = 4.9e-03, Identities = 24/66 (36%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A L++F
  S:    76 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILF 141
>gi|33241057|ref|NP_875999.1| F0F1 ATP synthase subunit C [Prochlorococcus marinus subsp. marinus str. CCMP1375] >gi|72382823|ref|YP_292178.1| F0F1 ATP synthase subunit C [Prochlorococcus marinus str. NATL2A] >gi|124026558|ref|YP_001015673.1| F0F1 ATP synthase subunit C [Prochlorococcus marinus str. NATL1A] >gi|33238586|gb|AAQ00652.1| ATP synthase subunit c [Prochlorococcus marinus subsp. marinus str. CCMP1375] >gi|72002673|gb|AAZ58475.1| ATP synthase F0, C subunit [Prochlorococcus marinus str. NATL2A] >gi|123961626|gb|ABM76409.1| ATP synthase subunit c [Prochlorococcus marinus str. NATL1A] (82 aa)
Score = 101, Expect = 5.0e-03, Identities = 29/75 (38%), Positives = 46/75 (61%)
  Q:     1 MNITNQGYAFIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           M+      + + AGLA+ +  +G GIGQG +A  +VE +AR PE   KIR   +LS A  E+  +Y  ++A++L+F
  S:     1 MDSITTAASVVAAGLAVGLGAIGPGIGQGSAAQGAVEGIARQPEAEGKIRGTLLLSFAFMESLTIYGLVVALVLLF 76
>gi|108796673|ref|YP_636517.1| ATP synthase CF0 C subunit [Zygnema circumcarinatum] >gi|61393657|gb|AAX45799.1| CF0 subunit III of ATP synthase [Zygnema circumcarinatum] (81 aa)
Score = 101, Expect = 5.4e-03, Identities = 29/67 (43%), Positives = 44/67 (65%)
  Q:     9 AFIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           + I AGLA+ +A +G G+GQG +A ++VE +AR PE   KIR   +LS A  E   +Y  ++A+ L+F
  S:     9 SVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALALLF 76
>gi|11466377|ref|NP_038380.1| ATP synthase CF0 C subunit [Mesostigma viride] >gi|12585190|sp|Q9MUT0|ATPH_MESVI ATP synthase C chain (ATPase subunit III) (Lipid-binding protein) >gi|7259520|gb|AAF43821.1|AF166114_33 CF0 subunit III of ATP synthase [Mesostigma viride] (82 aa)
Score = 100, Expect = 5.5e-03, Identities = 27/67 (40%), Positives = 45/67 (67%)
  Q:     9 AFIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           + + AGLA+ +A +G G+GQG +A +++E +AR PE   KIR   +LS A  E+  +Y  ++A+ L+F
  S:     9 SVLAAGLAVGLASIGPGVGQGTAAGQALEGIARQPEAEGKIRGTLLLSFAFMESLTIYGLVVALALLF 76
>gi|74204278|dbj|BAE39897.1| unnamed protein product [Mus musculus] (136 aa)
Score = 100, Expect = 5.6e-03, Identities = 24/66 (36%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A L++F
  S:    69 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILF 134
>gi|94987500|ref|YP_595433.1| F0F1-type ATP synthase, subunit c [Lawsonia intracellularis PHE/MN1-00] >gi|94731749|emb|CAJ55112.1| F0F1-type ATP synthase, subunit c [Lawsonia intracellularis PHE/MN1-00] (115 aa)
Score = 100, Expect = 5.9e-03, Identities = 28/75 (37%), Positives = 44/75 (58%)
  Q:     1 MNITNQGYAFIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           ++ ++ G A  G  + M +A LG GIGQG     + E +ARNPE   KI+   IL  A  E+ A+Y  +I ++++F
  S:    35 LDPSSLGLAIFGCAIGMALAALGCGIGQGLGLKGACEGIARNPEASGKIQVALILGLAFIESLAIYALVINLIILF 110
>gi|73975799|ref|XP_850856.1| PREDICTED: similar to ATP synthase lipid-binding protein, mitochondrial precursor (ATP synthase proteolipid P2) (ATPase protein 9) (ATPase subunit C) [Canis familiaris] (197 aa)
Score = 100, Expect = 5.9e-03, Identities = 24/66 (36%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A L++F
  S:   130 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILF 195
>gi|31982497|ref|NP_031532.2| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c, isoform 1 [Mus musculus] >gi|12842227|dbj|BAB25522.1| unnamed protein product [Mus musculus] >gi|12843525|dbj|BAB26015.1| unnamed protein product [Mus musculus] >gi|12844952|dbj|BAB26561.1| unnamed protein product [Mus musculus] >gi|12846607|dbj|BAB27233.1| unnamed protein product [Mus musculus] >gi|12846923|dbj|BAB27363.1| unnamed protein product [Mus musculus] >gi|12847554|dbj|BAB27617.1| unnamed protein product [Mus musculus] >gi|13277978|gb|AAH03854.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 1 [Mus musculus] >gi|66267548|gb|AAH94664.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 1 [Mus musculus] >gi|123243747|emb|CAM18271.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 1 [Mus musculus] >gi|148684064|gb|EDL16011.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 1, isoform CRA_a [Mus musculus] >gi|148684065|gb|EDL16012.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 1, isoform CRA_a [Mus musculus] >gi|148684066|gb|EDL16013.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 1, isoform CRA_a [Mus musculus] (136 aa)
Score = 100, Expect = 5.9e-03, Identities = 24/66 (36%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A L++F
  S:    69 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILF 134
>gi|68534968|ref|NP_001020389.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C1 [Sus scrofa] >gi|55274178|gb|AAV48969.1| mitochondrial H+ transporting ATP synthase subunit c isoform 1 [Sus scrofa] (136 aa)
Score = 100, Expect = 6.0e-03, Identities = 24/66 (36%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A L++F
  S:    69 FIGAGAATVGVAGSGAGIGTVFGSMIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILF 134
>gi|58618214|gb|AAW80672.1| chloroplast ATPH isoform 2 [Heterocapsa triquetra] (140 aa)
Score = 100, Expect = 6.0e-03, Identities = 24/65 (36%), Positives = 44/65 (67%)
  Q:    11 IGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +GAG A+ +A +G G+GQG ++ + ++ ++R PEV   +R   +LS A  E+  +Y  +IA++L+F
  S:    69 VGAGFAIGLAAIGSGVGQGIASGRCIDGISRQPEVADDLRGVLLLSLAFMESLTIYGLVIALVLLF 134
>gi|68565129|sp|Q5RAP9|AT5G2_PONAB ATP synthase lipid-binding protein, mitochondrial precursor (ATP synthase proteolipid P2) (ATPase protein 9) (ATPase subunit c) >gi|55728845|emb|CAH91161.1| hypothetical protein [Pongo abelii] (141 aa)
Score = 100, Expect = 6.0e-03, Identities = 24/66 (36%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A L++F
  S:    74 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILF 139
>gi|195996711|ref|XP_002108224.1| ATPase subunit 9 [Trichoplax adhaerens] >gi|190589000|gb|EDV29022.1| ATPase subunit 9 [Trichoplax adhaerens] (109 aa)
Score = 100, Expect = 6.1e-03, Identities = 26/74 (35%), Positives = 39/74 (52%)
  Q:     2 NITNQGYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           N  +    FIGAG A + + G G G G      V   ARNP +  ++ S  IL  A++E   L+C ++A L++F
  S:    34 NDIDSAAKFIGAGAATVGVAGSGAGIGTVFGSLVIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMMAFLILF 107
>gi|41179053|ref|NP_958409.1| ATP synthase CF0 C subunit [Chlamydomonas reinhardtii] >gi|14285361|sp|Q37304|ATPH_CHLRE ATP synthase C chain (ATPase subunit III) (Lipid-binding protein) >gi|944997|emb|CAA62149.1| ATPH subunit of ATPase [Chlamydomonas reinhardtii] >gi|28269776|tpg|DAA00954.1| TPA_inf: TPA_exp: CF0 ATP synthase subunit III [Chlamydomonas reinhardtii] (82 aa)
Score = 100, Expect = 6.2e-03, Identities = 30/75 (40%), Positives = 46/75 (61%)
  Q:     1 MNITNQGYAFIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           MN      + + AGLA+ +A +G G+GQG +A  +VE +AR PE   KIR   +LS A  E+  +Y  ++A+ L+F
  S:     1 MNPIVAATSVVSAGLAVGLAAIGPGMGQGTAAGYAVEGIARQPEAEGKIRGALLLSFAFMESLTIYGLVVALALLF 76
>gi|461583|sp|P35013|ATPH_GALSU ATP synthase C chain (ATPase subunit III) (Lipid-binding protein) >gi|629433|pir||S39516 H+-transporting two-sector ATPase (EC 3.6.3.14) lipid-binding protein - red alga (Cyanidium caldarium) chloroplast >gi|429174|emb|CAA48021.1| H(+)-transporting ATP synthase [Galdieria sulphuraria] (83 aa)
Score = 100, Expect = 6.4e-03, Identities = 24/55 (43%), Positives = 36/55 (65%)
  Q:    21 LGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +G GIGQG ++A++VE +AR PE   KIR   +LS A  E   +Y  ++A+ L+F
  S:    22 IGPGIGQGTASAQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALSLLF 76
>gi|91091934|ref|XP_967645.1| PREDICTED: similar to GA14517-PA [Tribolium castaneum] (140 aa)
Score = 100, Expect = 6.5e-03, Identities = 25/66 (37%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A LL+F
  S:    73 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMMAFLLLF 138
>gi|193891066|gb|ACF28686.1| chloroplast ATP synthase [Amphidinium carterae] (144 aa)
Score = 100, Expect = 6.6e-03, Identities = 24/65 (36%), Positives = 43/65 (66%)
  Q:    11 IGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +GAG A+ +A +G G+GQG ++ + ++ ++R PEV   +R   +LS A  E+  +Y  +IA++L F
  S:    73 VGAGFAIGLAAIGSGVGQGIASGRCIDGISRQPEVADDLRGVLLLSLAFMESLTIYGLVIALVLPF 138
>gi|109114219|ref|XP_001091011.1| PREDICTED: ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C1 (subunit 9) isoform 1 [Macaca mulatta] >gi|109114221|ref|XP_001091128.1| PREDICTED: ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C1 (subunit 9) isoform 2 [Macaca mulatta] >gi|109114223|ref|XP_001091260.1| PREDICTED: ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C1 (subunit 9) isoform 3 [Macaca mulatta] (135 aa)
Score = 100, Expect = 6.8e-03, Identities = 24/66 (36%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A L++F
  S:    68 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILF 133
>gi|169142784|ref|YP_001687209.1| ATP synthase CF0 subunit III [Aneura mirabilis] >gi|153973810|gb|ABS54470.1| ATP synthase CF0 subunit III [Aneura mirabilis] (81 aa)
Score = 100, Expect = 6.8e-03, Identities = 31/75 (41%), Positives = 44/75 (58%)
  Q:     1 MNITNQGYAFIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           MN      + I AGLA+ +A +G GIGQG +A ++VE +AR PE   KIR   + S A  E   +Y  ++A+ L F
  S:     1 MNPLIPAASVIAAGLAVGLASIGPGIGQGTAAGQAVEGIARQPEAEGKIRGTLLSSPASMEALTIYGLVVALALSF 76
>gi|30584765|gb|AAP36635.1| Homo sapiens ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 1 [synthetic construct] >gi|61372842|gb|AAX43922.1| ATP synthase H+ transporting mitochondrial F0 complex subunit c isoform 1 [synthetic construct] >gi|61372846|gb|AAX43923.1| ATP synthase H+ transporting mitochondrial F0 complex subunit c isoform 1 [synthetic construct] (137 aa)
Score = 100, Expect = 6.9e-03, Identities = 24/66 (36%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A L++F
  S:    69 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILF 134
>gi|4885081|ref|NP_005166.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C1 precursor [Homo sapiens] >gi|50659069|ref|NP_001002027.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C1 precursor [Homo sapiens] >gi|55646787|ref|XP_511941.1| PREDICTED: ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C1 isoform 4 [Pan troglodytes] >gi|114666317|ref|XP_001172721.1| PREDICTED: ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C1 isoform 2 [Pan troglodytes] >gi|114666320|ref|XP_001172743.1| PREDICTED: ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C1 isoform 3 [Pan troglodytes] >gi|461588|sp|P05496|AT5G1_HUMAN ATP synthase lipid-binding protein, mitochondrial precursor (ATP synthase proteolipid P1) (ATPase protein 9) (ATPase subunit c) >gi|38430|emb|CAA49532.1| P1 gene for c subunit of human mitochondrial ATP synthase [Homo sapiens] >gi|285908|dbj|BAA02420.1| ATP synthase subunit c precursor [Homo sapiens] >gi|5262507|emb|CAB45704.1| hypothetical protein [Homo sapiens] >gi|13436356|gb|AAH04963.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C1 (subunit 9) [Homo sapiens] >gi|30583299|gb|AAP35894.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 1 [Homo sapiens] >gi|49065324|emb|CAG38480.1| ATP5G1 [Homo sapiens] >gi|60655527|gb|AAX32327.1| ATP synthase mitochondrial F0 complex subunit c isoform 1 [synthetic construct] >gi|60823066|gb|AAX36631.1| ATP synthase mitochondrial F0 complex subunit c isoform 1 [synthetic construct] >gi|117644094|emb|CAL38315.1| hypothetical protein [synthetic construct] >gi|119615111|gb|EAW94705.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C1 (subunit 9), isoform CRA_a [Homo sapiens] >gi|119615112|gb|EAW94706.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C1 (subunit 9), isoform CRA_a [Homo sapiens] >gi|189053168|dbj|BAG34790.1| unnamed protein product [Homo sapiens] (136 aa)
Score = 100, Expect = 7.0e-03, Identities = 24/66 (36%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A L++F
  S:    69 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILF 134
>gi|48101426|ref|XP_392672.1| PREDICTED: similar to CG1746-PA, isoform A isoform 1 [Apis mellifera] >gi|66531719|ref|XP_623661.1| PREDICTED: similar to CG1746-PA, isoform A isoform 2 [Apis mellifera] (142 aa)
Score = 100, Expect = 7.1e-03, Identities = 25/66 (37%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A LL+F
  S:    75 FIGAGAATVGVAGSGAGIGSVFGSLIVGYARNPSLKQQLFSYAILGFALSEAMGLFCLMMAFLLLF 140
>gi|95929953|ref|ZP_01312693.1| ATP synthase F0, C subunit [Desulfuromonas acetoxidans DSM 684] >gi|95133922|gb|EAT15581.1| ATP synthase F0, C subunit [Desulfuromonas acetoxidans DSM 684] (88 aa)
Score = 99, Expect = 7.3e-03, Identities = 26/69 (37%), Positives = 42/69 (60%)
  Q:     7 GYAFIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
            +  I AG  M I   G G+GQG +   +VE VARNP    KI +  ++  A+ E+ A+Y F++A++++F
  S:     5 AWCMIAAGFGMAIGSFGTGLGQGLAIKSAVEGVARNPSASGKILTTMMIGLAMIESLAIYVFVVAMIILF 74
>gi|15896124|ref|NP_349473.1| F0F1 ATP synthase subunit C [Clostridium acetobutylicum ATCC 824] >gi|5915735|sp|O08310|ATPL_CLOAB ATP synthase C chain (Lipid-binding protein) >gi|15025916|gb|AAK80813.1|AE007784_10 FoF1-type ATP synthase C subunit [Clostridium acetobutylicum ATCC 824] >gi|1905950|gb|AAB50192.1| F-type ATP synthase subunit c >gi|4323563|gb|AAD16421.1| ATP synthase subunit c [Clostridium acetobutylicum] (81 aa)
Score = 99, Expect = 7.3e-03, Identities = 30/70 (42%), Positives = 42/70 (60%)
  Q:     7 GYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVFV 76
           G  ++GAGLA I  +G G+G G    K+VEA+ R PE  SK+    I+  A  E  +LY   +AI+L+FV
  S:    11 GMQYLGAGLAAIGCIGGGVGIGTVTGKAVEAIGRQPESASKVMPTMIMGLAFAEVTSLYALFVAIMLLFV 80
>gi|149286944|gb|ABR23371.1| mitochondrial F1F0-ATP synthase subunit c/ATP9/proteolipid [Ornithodoros parkeri] (138 aa)
Score = 99, Expect = 7.4e-03, Identities = 25/66 (37%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A LL+F
  S:    71 FIGAGAATVGVAGSGAGIGSVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMMAFLLLF 136
>gi|71746718|ref|XP_822414.1| ATPase subunit 9 [Trypanosoma brucei TREU927] >gi|70832082|gb|EAN77586.1| ATPase subunit 9, putative [Trypanosoma brucei] (118 aa)
Score = 99, Expect = 7.4e-03, Identities = 27/73 (36%), Positives = 42/73 (57%)
  Q:     3 ITNQGYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           I+ QG  ++G GLA IA+ GVG+G G      + A AR P +   + +  IL  A+TE   L+  ++A L++F
  S:    45 ISVQGLHYVGTGLAAIALAGVGLGIGTIFGNLLVACARQPNLTKMLFNYAILGFALTEAIGLFALMLAFLMLF 117
>gi|109074231|ref|XP_001104905.1| PREDICTED: ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C1 (subunit 9) [Macaca mulatta] (135 aa)
Score = 99, Expect = 7.6e-03, Identities = 24/66 (36%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A L++F
  S:    68 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILF 133
>gi|78184061|ref|YP_376496.1| F0F1 ATP synthase subunit C [Synechococcus sp. CC9902] >gi|116071308|ref|ZP_01468577.1| ATP synthase subunit C [Synechococcus sp. BL107] >gi|78168355|gb|ABB25452.1| ATP synthase F0, C subunit [Synechococcus sp. CC9902] >gi|116066713|gb|EAU72470.1| ATP synthase subunit C [Synechococcus sp. BL107] (81 aa)
Score = 99, Expect = 7.6e-03, Identities = 23/55 (41%), Positives = 36/55 (65%)
  Q:    21 LGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +G GIGQG ++  +VE +AR PE   KIR   +LS A  E+  +Y  ++A++L+F
  S:    22 IGPGIGQGTASGGAVEGIARQPEAEGKIRGTLLLSLAFMESLTIYGLVVALVLLF 76
>gi|74005789|ref|XP_853361.1| PREDICTED: similar to ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c, isoform 1 [Canis familiaris] (115 aa)
Score = 99, Expect = 7.6e-03, Identities = 24/66 (36%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A L++F
  S:    48 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILF 113
>gi|156619217|gb|ABU88287.1| ATP synthase CF0 subunit III [Chlamydomonas moewusii] (82 aa)
Score = 99, Expect = 7.8e-03, Identities = 30/75 (40%), Positives = 46/75 (61%)
  Q:     1 MNITNQGYAFIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           MN      + + AGLA+ +A +G G+GQG +A  +VE +AR PE   KIR   +LS A  E+  +Y  ++A+ L+F
  S:     1 MNPIIAAASVVSAGLAVGLAAIGPGVGQGTAAGYAVEGIARQPEAEGKIRGALLLSFAFMESLTIYGLVVALALLF 76
>gi|109096969|ref|XP_001106939.1| PREDICTED: ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C2 (subunit 9) isoform 1 [Macaca mulatta] (141 aa)
Score = 99, Expect = 7.8e-03, Identities = 24/66 (36%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A L++F
  S:    74 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILF 139
>gi|126308255|ref|XP_001367285.1| PREDICTED: similar to P1 subunit [Monodelphis domestica] (136 aa)
Score = 99, Expect = 7.9e-03, Identities = 24/66 (36%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A L++F
  S:    69 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILF 134
>gi|177664420|ref|ZP_02940222.1| ATP synthase F0, C subunit [Cyanothece sp. PCC 8801] >gi|196244740|ref|ZP_03143466.1| ATP synthase F0, C subunit [Cyanothece sp. PCC 8802] >gi|172076256|gb|EDT61668.1| ATP synthase F0, C subunit [Cyanothece sp. PCC 8801] >gi|196207484|gb|EDY02277.1| ATP synthase F0, C subunit [Cyanothece sp. PCC 8802] (81 aa)
Score = 99, Expect = 8.1e-03, Identities = 22/55 (40%), Positives = 35/55 (63%)
  Q:    21 LGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +G G GQG ++ ++V  +AR PE   KIR   +LS A  E+  +Y  +IA++L+F
  S:    22 IGPGFGQGNASGEAVSGIARQPEAEGKIRGTLLLSLAFMESLTIYGLVIALVLLF 76
>gi|33865026|ref|NP_896585.1| F0F1 ATP synthase subunit C [Synechococcus sp. WH 8102] >gi|78213707|ref|YP_382486.1| F0F1 ATP synthase subunit C [Synechococcus sp. CC9605] >gi|148242981|ref|YP_001228138.1| F0F1 ATP synthase subunit C [Synechococcus sp. RCC307] >gi|33638710|emb|CAE07005.1| ATP synthase subunit c [Synechococcus sp. WH 8102] >gi|78198166|gb|ABB35931.1| ATP synthase F0, C subunit [Synechococcus sp. CC9605] >gi|147851291|emb|CAK28785.1| ATP synthase C chain [Synechococcus sp. RCC307] (82 aa)
Score = 99, Expect = 8.1e-03, Identities = 23/55 (41%), Positives = 36/55 (65%)
  Q:    21 LGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +G GIGQG ++  +VE +AR PE   KIR   +LS A  E+  +Y  ++A++L+F
  S:    22 IGPGIGQGTASGGAVEGIARQPEAEGKIRGTLLLSLAFMESLTIYGLVVALVLLF 76
>gi|193891055|gb|ACF28681.1| chloroplast ATP synthase [Amphidinium carterae] (144 aa)
Score = 99, Expect = 8.2e-03, Identities = 24/65 (36%), Positives = 43/65 (66%)
  Q:    11 IGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +GAG A+ +A +G G+GQG ++ + ++ ++R PEV    R   +LS A  E+  +Y  +IA++L+F
  S:    73 VGAGFAIGLAAIGSGVGQGIASGRCIDGISRQPEVADDPRGVLLLSLAFMESLTIYGLVIALVLLF 138
>gi|156619088|gb|ABU88222.1| ATP synthase CF0 subunit III [Floydiella terrestris] (83 aa)
Score = 99, Expect = 8.2e-03, Identities = 30/75 (40%), Positives = 46/75 (61%)
  Q:     1 MNITNQGYAFIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           MN      + I AGL++ +A +G G+GQG +A  +VE +AR PE   KIR   +LS A  E+  +Y  ++A+ L+F
  S:     1 MNPLVAAASVIAAGLSVGLAAIGPGMGQGTAAGYAVEGIARQPEAEGKIRGALLLSFAFMESLTIYGLVVALALLF 76
>gi|18700491|dbj|BAB85212.1| ATP lipid-binding protein like protein [Marsupenaeus japonicus] (128 aa)
Score = 99, Expect = 8.2e-03, Identities = 25/66 (37%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A LL+F
  S:    61 FIGAGAATVGVAGSGAGIGSVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMMAFLLLF 126
>gi|114644464|ref|XP_001137325.1| PREDICTED: ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C2 isoform 2 [Pan troglodytes] >gi|114644466|ref|XP_001137401.1| PREDICTED: ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C2 isoform 3 [Pan troglodytes] >gi|461592|sp|Q06055|AT5G2_HUMAN ATP synthase lipid-binding protein, mitochondrial precursor (ATP synthase proteolipid P2) (ATPase protein 9) (ATPase subunit c) >gi|38432|emb|CAA49533.1| P2 gene for c subunit of mitochondrial ATP synthase [Homo sapiens] >gi|285910|dbj|BAA02421.1| ATP synthase subunit c precursor [Homo sapiens] >gi|18088565|gb|AAH20826.1| ATP5G2 protein [Homo sapiens] >gi|119617132|gb|EAW96726.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C2 (subunit 9), isoform CRA_b [Homo sapiens] >gi|123980928|gb|ABM82293.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C2 (subunit 9) [synthetic construct] >gi|123995743|gb|ABM85473.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C2 (subunit 9) [synthetic construct] (141 aa)
Score = 99, Expect = 8.4e-03, Identities = 24/66 (36%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A L++F
  S:    74 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILF 139
>gi|166796912|gb|AAI59383.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C3 (subunit 9) [Xenopus tropicalis] (142 aa)
Score = 99, Expect = 8.5e-03, Identities = 24/66 (36%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A L++F
  S:    75 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILF 140
>gi|195341714|ref|XP_002037451.1| GM12097 [Drosophila sechellia] >gi|194131567|gb|EDW53610.1| GM12097 [Drosophila sechellia] (138 aa)
Score = 99, Expect = 8.6e-03, Identities = 26/66 (39%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A I + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A LL+F
  S:    71 FIGAGAATIGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMMAFLLLF 136
>gi|117660743|gb|ABK55635.1| mitochondrial ATP5G2 [Sus scrofa] (155 aa)
Score = 99, Expect = 8.6e-03, Identities = 24/66 (36%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A L++F
  S:    88 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCPMVAFLILF 153
>gi|115349969|ref|YP_764403.1| CF0 subunit III of ATP synthase [Stigeoclonium helveticum] >gi|98990183|gb|ABF60150.1| CF0 subunit III of ATP synthase [Stigeoclonium helveticum] (83 aa)
Score = 99, Expect = 8.6e-03, Identities = 24/58 (41%), Positives = 37/58 (63%)
  Q:    18 IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +A +G G+GQG +A  +VE +AR PE   KIR   +LS A  E+  +Y  ++A+ L+F
  S:    19 LAAIGPGMGQGTAAGYAVEGIARQPEAEGKIRGALLLSFAFMESLTIYGLVVALALLF 76
>gi|16329331|ref|NP_440059.1| F0F1 ATP synthase subunit C [Synechocystis sp. PCC 6803] >gi|114677|sp|P27182|ATPL_SYNY3 ATP synthase C chain (Lipid-binding protein) >gi|47509|emb|CAA41131.1| ATPase subunit c [Synechocystis sp. PCC 6803] >gi|1651812|dbj|BAA16739.1| ATP synthase subunit c [Synechocystis sp. PCC 6803] (81 aa)
Score = 99, Expect = 8.7e-03, Identities = 22/55 (40%), Positives = 36/55 (65%)
  Q:    21 LGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +G GIGQG ++ ++V  +AR PE   KIR   +L+ A  E+  +Y  +IA++L+F
  S:    22 IGPGIGQGNASGQAVSGIARQPEAEGKIRGTLLLTLAFMESLTIYGLVIALVLLF 76
>gi|113955150|ref|YP_731514.1| F0F1 ATP synthase subunit C [Synechococcus sp. CC9311] >gi|113882501|gb|ABI47459.1| ATP synthase F0, C subunit [Synechococcus sp. CC9311] (81 aa)
Score = 99, Expect = 8.8e-03, Identities = 23/55 (41%), Positives = 36/55 (65%)
  Q:    21 LGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +G GIGQG ++  +VE +AR PE   KIR   +LS A  E+  +Y  ++A++L+F
  S:    22 IGPGIGQGSASQGAVEGIARQPEAEGKIRGTLLLSLAFMESLTIYGLVVALVLLF 76
>gi|58618220|gb|AAW80675.1| chloroplast ATPH isoform 5 [Heterocapsa triquetra] >gi|157092945|gb|ABV22127.1| chloroplast ATP synthase subunit C [Heterocapsa triquetra] >gi|157092947|gb|ABV22128.1| chloroplast ATP synthase subunit C [Heterocapsa triquetra] >gi|157092949|gb|ABV22129.1| chloroplast ATP synthase subunit C [Heterocapsa triquetra] (140 aa)
Score = 99, Expect = 8.8e-03, Identities = 24/65 (36%), Positives = 44/65 (67%)
  Q:    11 IGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +GAG A+ +A +G G+GQG ++ + ++ ++R PEV   +R   +LS A  E+  +Y  +IA++L+F
  S:    69 VGAGFAIGLAAIGSGVGQGIASGRCIDGISRQPEVADDLRGVLLLSLAFMESLTIYGLVIALVLLF 134
>gi|57164393|ref|NP_001009396.1| H(+)-transporting ATP synthase [Ovis aries] >gi|461590|sp|P17605|AT5G1_SHEEP ATP synthase lipid-binding protein, mitochondrial precursor (ATP synthase proteolipid P1) (ATPase protein 9) (ATPase subunit c) >gi|1201|emb|CAA49529.1| H(+)-transporting ATP synthase [Ovis aries] (136 aa)
Score = 99, Expect = 8.8e-03, Identities = 24/66 (36%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A L++F
  S:    69 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILF 134
>gi|170077361|ref|YP_001733999.1| ATP synthase C chain (Lipid-binding protein) [Synechococcus sp. PCC 7002] >gi|169885030|gb|ACA98743.1| ATP synthase C chain (Lipid-binding protein) [Synechococcus sp. PCC 7002] (81 aa)
Score = 99, Expect = 8.9e-03, Identities = 23/55 (41%), Positives = 34/55 (61%)
  Q:    21 LGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +G GIGQG +A  + E +AR PE   KIR   +LS A  E   +Y  ++A++L+F
  S:    22 IGPGIGQGNAAGSAAEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALVLLF 76
>gi|108773034|ref|YP_635944.1| ATP synthase CF0 C subunit [Scenedesmus obliquus] >gi|88696600|gb|ABD48226.1| CF0 subunit III of ATP synthase [Scenedesmus obliquus] (82 aa)
Score = 99, Expect = 8.9e-03, Identities = 30/75 (40%), Positives = 46/75 (61%)
  Q:     1 MNITNQGYAFIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           MN      + + AGLA+ +A +G G+GQG +A  +VE +AR PE   KIR   +LS A  E+  +Y  ++A+ L+F
  S:     1 MNPIVAAASVVSAGLAVGLAAIGPGMGQGTAAGYAVEGIARQPEAEGKIRGALLLSFAFMESLTIYGLVVALALLF 76
>gi|7524781|ref|NP_045783.1| ATP synthase CF0 C subunit [Chlorella vulgaris] >gi|3023353|sp|P56297|ATPH_CHLVU ATP synthase C chain (ATPase subunit III) (Lipid-binding protein) >gi|2224374|dbj|BAA57858.1| ATP synthase CF0 C chain (lipid-binding) (subunit III) [Chlorella vulgaris] (82 aa)
Score = 99, Expect = 8.9e-03, Identities = 23/55 (41%), Positives = 35/55 (63%)
  Q:    21 LGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +G G+GQG +A  +VE +AR PE   KIR   +LS A  E+  +Y  ++A+ L+F
  S:    22 IGPGMGQGTAAGYAVEGIARQPEAEGKIRGALLLSFAFMESLTIYGLVVALALLF 76
>gi|30468234|ref|NP_849121.1| ATP synthase CF0 C subunit [Cyanidioschyzon merolae strain 10D] >gi|30409334|dbj|BAC76283.1| ATP synthase CF0 C chain subunit III [Cyanidioschyzon merolae strain 10D] (81 aa)
Score = 99, Expect = 9.0e-03, Identities = 25/55 (45%), Positives = 36/55 (65%)
  Q:    21 LGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +G GIGQG +AA +VE +AR PE   KIR   +LS A  E+  +Y  ++A+ L+F
  S:    22 IGPGIGQGSAAANAVEGLARQPEAEGKIRGTLLLSLAFMESLTIYGLVVALSLLF 76
>gi|158334076|ref|YP_001515248.1| F0F1 ATP synthase subunit C [Acaryochloris marina MBIC11017] >gi|158304317|gb|ABW25934.1| ATP synthase F0, C subunit [Acaryochloris marina MBIC11017] (81 aa)
Score = 99, Expect = 9.1e-03, Identities = 23/58 (39%), Positives = 36/58 (62%)
  Q:    18 IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           I+ +G  + QG +A K+VE +AR PE   KIR   +L  A  E+  +Y  +IA++L+F
  S:    19 ISTIGPALAQGNAAGKAVEGIARQPEAEGKIRGTLLLCLAFMESLTIYGLVIALVLLF 76
>gi|116073692|ref|ZP_01470954.1| F0F1 ATP synthase subunit C [Synechococcus sp. RS9916] >gi|116068997|gb|EAU74749.1| F0F1 ATP synthase subunit C [Synechococcus sp. RS9916] (82 aa)
Score = 99, Expect = 9.1e-03, Identities = 23/55 (41%), Positives = 36/55 (65%)
  Q:    21 LGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +G GIGQG ++  +VE +AR PE   KIR   +LS A  E+  +Y  ++A++L+F
  S:    22 IGPGIGQGSASQGAVEGIARQPEAEGKIRGTLLLSLAFMESLTIYGLVVALVLLF 76
>gi|166367753|ref|YP_001660026.1| F0F1 ATP synthase subunit C [Microcystis aeruginosa NIES-843] >gi|159027209|emb|CAO89303.1| atpE [Microcystis aeruginosa PCC 7806] >gi|166090126|dbj|BAG04834.1| ATP synthase CF0 C chain [Microcystis aeruginosa NIES-843] (81 aa)
Score = 98, Expect = 9.4e-03, Identities = 21/55 (38%), Positives = 36/55 (65%)
  Q:    21 LGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +G G+GQG ++ ++V  +AR PE   +IR   +LS A  E+  +Y  +IA++L+F
  S:    22 IGPGVGQGTASGEAVSGIARQPEAEGRIRGTLLLSLAFMESLTIYGLVIALVLLF 76
>gi|189347959|ref|YP_001944488.1| ATP synthase F0, C subunit [Chlorobium limicola DSM 245] >gi|189342106|gb|ACD91509.1| ATP synthase F0, C subunit [Chlorobium limicola DSM 245] (73 aa)
Score = 98, Expect = 9.6e-03, Identities = 30/70 (42%), Positives = 46/70 (65%)
  Q:     6 QGYAFIGAGL-AMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +G  F+GAG+ A +A++G G+G G  AA + E  AR PE  S+IR+  I++AA+ E  AL+  +I +LL  
  S:     2 EGLGFLGAGIGAGLAVIGAGLGIGNIAASAAEGTARQPEATSEIRTTMIIAAALIEGVALFGEVICVLLAL 72
>gi|149541038|ref|XP_001519284.1| PREDICTED: similar to ATP synthase lipid binding protein p3 [Ornithorhynchus anatinus] (122 aa)
Score = 98, Expect = 9.7e-03, Identities = 24/66 (36%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A L++F
  S:    55 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILF 120
>gi|52346088|ref|NP_001005087.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C3 (subunit 9) [Xenopus tropicalis] >gi|49903762|gb|AAH77012.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C3 (subunit 9) [Xenopus tropicalis] >gi|89268626|emb|CAJ83365.1| atp5g3 [Xenopus tropicalis] (142 aa)
Score = 98, Expect = 1.0e-02, Identities = 24/66 (36%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A L++F
  S:    75 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILF 140
>gi|28603764|ref|NP_788822.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C1 (subunit 9) [Bos taurus] >gi|416684|sp|P32876|AT5G1_BOVIN ATP synthase lipid-binding protein, mitochondrial precursor (ATP synthase proteolipid P1) (ATPase protein 9) (ATPase subunit c) >gi|96|emb|CAA28845.1| P1 subunit [Bos taurus] >gi|74355040|gb|AAI02953.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C1 (subunit 9) [Bos taurus] >gi|224830|prf||1202261A ATP synthase proteolipid P1 (136 aa)
Score = 98, Expect = 1.0e-02, Identities = 24/66 (36%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A L++F
  S:    69 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILF 134
>gi|87301256|ref|ZP_01084097.1| ATP synthase subunit C [Synechococcus sp. WH 5701] >gi|87284224|gb|EAQ76177.1| ATP synthase subunit C [Synechococcus sp. WH 5701] (72 aa)
Score = 98, Expect = 1.0e-02, Identities = 28/65 (43%), Positives = 42/65 (64%)
  Q:    11 IGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           + AGLA+ +  +G GIGQG +A  +VE +AR PE   KIR   +LS A  E   +Y  ++A++L+F
  S:     1 MAAGLAVGLGAIGPGIGQGTAAGGAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALVLLF 66
>gi|118411108|ref|YP_874502.1| ATP synthase CF0 C chain subunit III [Thalassiosira pseudonana] >gi|116739855|gb|ABK20725.1| ATP synthase CF0 C chain subunit III [Thalassiosira pseudonana] (82 aa)
Score = 98, Expect = 1.0e-02, Identities = 23/52 (44%), Positives = 34/52 (65%)
  Q:    24 GIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           GIGQG +A ++VE +AR PE  +KIR   +LS A  E   +Y  ++A+ L+F
  S:    25 GIGQGNAAGQAVEGIARQPEAENKIRGTLLLSLAFMEALTIYGLVVALALLF 76
>gi|154503957|ref|ZP_02041017.1| hypothetical protein RUMGNA_01783 [Ruminococcus gnavus ATCC 29149] >gi|153795384|gb|EDN77804.1| hypothetical protein RUMGNA_01783 [Ruminococcus gnavus ATCC 29149] (74 aa)
Score = 98, Expect = 1.0e-02, Identities = 32/65 (49%), Positives = 44/65 (67%)
  Q:    11 IGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           IGAG+A++  +G G+G G +  K+V+A+AR PE  SKI    IL  A+ E  A+Y FII IL+VF
  S:     7 IGAGIAVLTGIGAGVGIGIATGKAVDAIARQPEAESKISKNLILGCALAEATAIYGFIIGILIVF 71
>gi|22003998|dbj|BAC06448.1| mitochondrial ATP synthase c-subunit (P3) precursor [Cyprinus carpio] (140 aa)
Score = 98, Expect = 1.1e-02, Identities = 25/66 (37%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A LL+F
  S:    73 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLLLF 138
>gi|158514029|sp|A1XQS5|AT5G1_PIG ATP synthase lipid-binding protein, mitochondrial precursor (ATP synthase proteolipid P1) (ATPase protein 9) (ATPase subunit c) >gi|117660669|gb|ABK55631.1| mitochondrial ATP5G1 [Sus scrofa] (136 aa)
Score = 98, Expect = 1.1e-02, Identities = 24/66 (36%), Positives = 36/66 (54%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A+ E   L+C ++A L++F
  S:    69 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALFEAMGLFCLMVAFLILF 134
>gi|196257286|ref|ZP_03155822.1| ATP synthase F0, C subunit [Cyanothece sp. PCC 7822] >gi|196200886|gb|EDX95705.1| ATP synthase F0, C subunit [Cyanothece sp. PCC 7822] (81 aa)
Score = 98, Expect = 1.1e-02, Identities = 21/55 (38%), Positives = 36/55 (65%)
  Q:    21 LGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +G GIGQG ++ ++V  +AR PE   KIR   +L+ A  E+  +Y  +I+++L+F
  S:    22 IGPGIGQGNASGQAVSGIARQPEAEGKIRGTLLLTLAFMESLTIYGLVISLVLLF 76
>gi|195394561|ref|XP_002055911.1| GJ10646 [Drosophila virilis] >gi|194142620|gb|EDW59023.1| GJ10646 [Drosophila virilis] (138 aa)
Score = 98, Expect = 1.1e-02, Identities = 25/66 (37%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A LL+F
  S:    71 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMMAFLLLF 136
>gi|77736329|ref|NP_001029864.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C3 [Bos taurus] >gi|109940311|sp|Q3ZC75|AT5G3_BOVIN ATP synthase lipid-binding protein, mitochondrial precursor (ATP synthase proteolipid P3) (ATPase protein 9) (ATPase subunit c) >gi|73586705|gb|AAI02869.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C3 (subunit 9) [Bos taurus] (141 aa)
Score = 98, Expect = 1.1e-02, Identities = 24/66 (36%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A L++F
  S:    74 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILF 139
>gi|52346136|ref|NP_001005112.1| MGC89969 protein [Xenopus tropicalis] >gi|49904303|gb|AAH77049.1| MGC89969 protein [Xenopus tropicalis] >gi|115530779|emb|CAL49358.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 1 [Xenopus tropicalis] (130 aa)
Score = 98, Expect = 1.1e-02, Identities = 24/66 (36%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A L++F
  S:    63 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILF 128
>gi|147903501|ref|NP_001085928.1| MGC82833 protein [Xenopus laevis] >gi|49119456|gb|AAH73551.1| MGC82833 protein [Xenopus laevis] (130 aa)
Score = 98, Expect = 1.1e-02, Identities = 24/66 (36%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A L++F
  S:    63 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILF 128
>gi|6226533|ref|NP_009319.1| F0-ATP synthase subunit 9 (ATPase-associated proteolipid), encoded on the mitochondrial genome; mutation confers oligomycin resistance; expression is specifically dependent on the nuclear genes AEP1 and AEP2; Oli1p [Saccharomyces cerevisiae] >gi|48428794|sp|P61828|ATP9_SACDO ATP synthase protein 9, mitochondrial (Lipid-binding protein) >gi|48428795|sp|P61829|ATP9_YEAST ATP synthase protein 9, mitochondrial (Lipid-binding protein) (Oligomycin resistance protein 1) >gi|7436173|pir||S44067 H+-transporting two-sector ATPase (EC 3.6.3.14) lipid-binding protein - yeast (Saccharomyces sp.) mitochondrion >gi|4588695|gb|AAD26181.1|AF114937_1 ATP synthase subunit 9 [Saccharomyces sp. IFO 1815] >gi|4588700|gb|AAD26183.1|AF114940_1 ATP synthase subunit 9 [Saccharomyces sp. URFJ 50791] >gi|6797711|gb|AAD26178.3|AF114930_1 ATP synthase subunit 9 [Saccharomyces bayanus] >gi|6797713|gb|AAD26176.3|AF114924_1 ATP synthase subunit 9 [Saccharomyces pastorianus] >gi|6797715|gb|AAD26174.3|AF114920_1 ATP synthase subunit 9 [Saccharomyces paradoxus] >gi|6797717|gb|AAD26172.3|AF114916_1 ATP synthase subunit 9 [Saccharomyces pastorianus] >gi|6797719|gb|AAD26170.3|AF114913_1 ATP synthase subunit 9 [Saccharomyces sp. IFO 1802] >gi|6797722|gb|AAD26167.3|AF114908_1 ATP synthase subunit 9 [Saccharomyces paradoxus] >gi|6797725|gb|AAD26164.3|AF114902_1 ATP synthase subunit 9 [Saccharomyces pastorianus] >gi|13573|emb|CAA27605.1| unnamed protein product [Saccharomyces cerevisiae] >gi|58151|emb|CAA30315.1| unnamed protein product [synthetic construct] >gi|396250|emb|CAA80904.1| adenosine triphosphatase subunit 9 [Saccharomyces douglasii] >gi|559291|gb|AAA67535.1| oli1 [Saccharomyces cerevisiae] >gi|3550442|emb|CAA76566.1| mitochondrial ATPase subunit 9 [Saccharomyces sp. CID1] >gi|3550446|emb|CAA76567.1| mitochondrial ATPase subunit 9 [Saccharomyces bayanus] >gi|3550450|emb|CAA76568.1| mitochondrial ATPase subunit 9 [Saccharomyces sp. S6U] >gi|4160380|emb|CAA09838.1| ATP9 [Saccharomyces cerevisiae] >gi|152030931|gb|ABS28694.1| ATP synthase F0 subunit 9 [Saccharomyces cerevisiae YJM789] >gi|224735|prf||1112163A ATPase 9 mutant (76 aa)
Score = 98, Expect = 1.1e-02, Identities = 24/66 (36%), Positives = 39/66 (59%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +IGAG++ I +LG GIG     A  +  V+RNP +   +    IL  A++E   L+C +++ LL+F
  S:     9 YIGAGISTIGLLGAGIGIAIVFAALINGVSRNPSIKDTVFPMAILGFALSEATGLFCLMVSFLLLF 74
>gi|24651599|ref|NP_651852.1| CG1746 CG1746-PA, isoform A [Drosophila melanogaster] >gi|24651601|ref|NP_733422.1| CG1746 CG1746-PB, isoform B [Drosophila melanogaster] >gi|24651603|ref|NP_733423.1| CG1746 CG1746-PC, isoform C [Drosophila melanogaster] >gi|194905019|ref|XP_001981105.1| GG11879 [Drosophila erecta] >gi|7302028|gb|AAF57131.1| CG1746-PB, isoform B [Drosophila melanogaster] >gi|23172756|gb|AAN14267.1| CG1746-PA, isoform A [Drosophila melanogaster] >gi|23172757|gb|AAN14268.1| CG1746-PC, isoform C [Drosophila melanogaster] >gi|41058227|gb|AAR99150.1| GM13193p [Drosophila melanogaster] >gi|190655743|gb|EDV52975.1| GG11879 [Drosophila erecta] (138 aa)
Score = 98, Expect = 1.1e-02, Identities = 25/66 (37%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A LL+F
  S:    71 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMMAFLLLF 136
>gi|162146974|ref|YP_001601435.1| putative ATP synthase [Gluconacetobacter diazotrophicus PAl 5] >gi|187596990|ref|ZP_02983250.1| H+transporting two-sector ATPase C subunit [Gluconacetobacter diazotrophicus PAl 5] >gi|161785551|emb|CAP55122.1| putative ATP synthase [Gluconacetobacter diazotrophicus PAl 5] >gi|187490815|gb|EDU28756.1| H+transporting two-sector ATPase C subunit [Gluconacetobacter diazotrophicus PAl 5] (74 aa)
Score = 98, Expect = 1.2e-02, Identities = 30/66 (45%), Positives = 42/66 (63%)
  Q:    11 IGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVFV 76
           IGAG+A+IA+ GVGIG G   +  V ++ARNP     +    +L  A+TE  ALY  +IA L++FV
  S:     9 IGAGIAVIALAGVGIGLGNIFSTLVSSIARNPAARPHVFGLGMLGFALTEAVALYALLIAFLILFV 74
>gi|157092937|gb|ABV22123.1| chloroplast ATP synthase subunit C [Alexandrium affine] (145 aa)
Score = 98, Expect = 1.2e-02, Identities = 24/65 (36%), Positives = 44/65 (67%)
  Q:    11 IGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +GAG A+ +A +G G+GQG ++ + ++ ++R PEV   +R   +LS A  E+  +Y  +IA++L+F
  S:    74 VGAGFAIGLAAIGSGVGQGIASGRCIDGISRQPEVADDLRGVLLLSLAFMESLTIYGLVIALVLLF 139
>gi|148230635|ref|NP_001080083.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9) isoform 3 [Xenopus laevis] >gi|27371265|gb|AAH41245.1| Cg1746-prov protein [Xenopus laevis] (142 aa)
Score = 98, Expect = 1.2e-02, Identities = 24/66 (36%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A L++F
  S:    75 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILF 140
>gi|67083899|gb|AAY66884.1| ATP synthase C subunit [Ixodes scapularis] (152 aa)
Score = 98, Expect = 1.2e-02, Identities = 25/66 (37%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A LL+F
  S:    85 FIGAGAATVGVAGSGAGIGSVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMMAFLLLF 150
>gi|29825397|gb|AAO92282.1| ATP synthase c-subunit [Dermacentor variabilis] (149 aa)
Score = 98, Expect = 1.2e-02, Identities = 25/66 (37%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A LL+F
  S:    82 FIGAGAATVGVAGSGAGIGSVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMMAFLLLF 147
>gi|118102910|ref|XP_001233603.1| PREDICTED: similar to P1 subunit isoform 3 [Gallus gallus] >gi|118102912|ref|XP_418114.2| PREDICTED: similar to P1 subunit isoform 4 [Gallus gallus] (136 aa)
Score = 98, Expect = 1.2e-02, Identities = 24/66 (36%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A L++F
  S:    69 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILF 134
>gi|118102906|ref|XP_001233576.1| PREDICTED: similar to P1 subunit isoform 1 [Gallus gallus] >gi|118102908|ref|XP_001233587.1| PREDICTED: similar to P1 subunit isoform 2 [Gallus gallus] (136 aa)
Score = 98, Expect = 1.2e-02, Identities = 24/66 (36%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A L++F
  S:    69 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILF 134
>gi|32441699|ref|NP_861469.1| ATPase subunit 9 [Saccharomyces servazzii] >gi|4588729|gb|AAD26195.1|AF114957_1 ATP synthase subunit 9 [Saccharomyces servazzii] >gi|32140115|emb|CAD23424.1| ATPase subunit 9 [Saccharomyces servazzii] (76 aa)
Score = 98, Expect = 1.2e-02, Identities = 25/66 (37%), Positives = 41/66 (62%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +IGAG+A I +LG GIG     +  +  V+RNP +  ++ S  IL  A++E   L+C +I+ +L+F
  S:     9 YIGAGIATIGLLGAGIGIAIVFSALINGVSRNPSLKDQLFSFAILGMALSEATGLFCLMISFILLF 74
>gi|115443538|ref|YP_778557.1| ATP synthase CF0 C chain [Bigelowiella natans] >gi|122233798|sp|Q06J70|ATPH_BIGNA ATP synthase C chain (Lipid-binding protein) (ATPase subunit III) >gi|110810183|gb|ABG91389.1| ATP synthase CF0 C chain [Bigelowiella natans] (81 aa)
Score = 98, Expect = 1.2e-02, Identities = 23/52 (44%), Positives = 34/52 (65%)
  Q:    24 GIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           GIGQG +A  +VE +AR PE   KIR   +LS A  E+  +Y  ++A++L+F
  S:    25 GIGQGTAAGYAVEGIARQPEAEGKIRGALLLSFAFMESLTIYGLVVALVLLF 76
>gi|195112483|ref|XP_002000802.1| GI10430 [Drosophila mojavensis] >gi|193917396|gb|EDW16263.1| GI10430 [Drosophila mojavensis] (138 aa)
Score = 97, Expect = 1.2e-02, Identities = 25/66 (37%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A LL+F
  S:    71 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMMAFLLLF 136
>gi|38048075|gb|AAR09940.1| similar to Drosophila melanogaster CG1746 [Drosophila yakuba] (129 aa)
Score = 97, Expect = 1.2e-02, Identities = 25/66 (37%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A LL+F
  S:    62 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMMAFLLLF 127
>gi|125772503|ref|XP_001357564.1| GA14517-PA [Drosophila pseudoobscura] >gi|194744513|ref|XP_001954738.1| GF16589 [Drosophila ananassae] >gi|195062153|ref|XP_001996145.1| GH14335 [Drosophila grimshawi] >gi|195159000|ref|XP_002020371.1| GL13949 [Drosophila persimilis] >gi|54637296|gb|EAL26698.1| GA14517-PA [Drosophila pseudoobscura] >gi|190627775|gb|EDV43299.1| GF16589 [Drosophila ananassae] >gi|193891937|gb|EDV90803.1| GH14335 [Drosophila grimshawi] >gi|194117140|gb|EDW39183.1| GL13949 [Drosophila persimilis] (138 aa)
Score = 97, Expect = 1.2e-02, Identities = 25/66 (37%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A LL+F
  S:    71 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMMAFLLLF 136
>gi|67920479|ref|ZP_00513999.1| ATP synthase F0, C subunit [Crocosphaera watsonii WH 8501] >gi|126655503|ref|ZP_01726942.1| ATP synthase subunit C [Cyanothece sp. CCY0110] >gi|172039397|ref|YP_001805898.1| ATP synthase F0, C subunit [Cyanothece sp. ATCC 51142] >gi|67857963|gb|EAM53202.1| ATP synthase F0, C subunit [Crocosphaera watsonii WH 8501] >gi|126622982|gb|EAZ93687.1| ATP synthase subunit C [Cyanothece sp. CCY0110] >gi|171700851|gb|ACB53832.1| ATP synthase F0, C subunit [Cyanothece sp. ATCC 51142] (81 aa)
Score = 97, Expect = 1.2e-02, Identities = 21/55 (38%), Positives = 36/55 (65%)
  Q:    21 LGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +G G+GQG ++ ++V  +AR PE   KIR   +L+ A  E+  +Y  +IA++L+F
  S:    22 IGPGLGQGNASGQAVSGIARQPEAEGKIRGTLLLTLAFMESLTIYGLVIALVLLF 76
>gi|194337850|ref|YP_002019644.1| ATP synthase F0, C subunit [Pelodictyon phaeoclathratiforme BU-1] >gi|194310327|gb|ACF45027.1| ATP synthase F0, C subunit [Pelodictyon phaeoclathratiforme BU-1] (73 aa)
Score = 97, Expect = 1.3e-02, Identities = 30/70 (42%), Positives = 46/70 (65%)
  Q:     6 QGYAFIGAGL-AMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +G  F+GAG+ A +A++G G+G G  AA + E VAR PE  + IR+  I++AA+ E  AL+  +I +LL  
  S:     2 EGLGFLGAGIGAGLAVIGAGLGIGNVAASAAEGVARQPEATADIRTTMIIAAALIEGVALFGEVICVLLAL 72
>gi|27923925|ref|NP_778180.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 3 [Mus musculus] >gi|3023368|sp|P56384|AT5G3_MOUSE ATP synthase lipid-binding protein, mitochondrial precursor (ATP synthase proteolipid P3) (ATPase protein 9) (ATPase subunit c) >gi|26346845|dbj|BAC37071.1| unnamed protein product [Mus musculus] >gi|26352852|dbj|BAC40056.1| unnamed protein product [Mus musculus] >gi|71121748|gb|AAH99786.1| Unknown (protein for MGC:124584) [Rattus norvegicus] >gi|109730713|gb|AAI16219.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 3 [Mus musculus] >gi|123857846|emb|CAM15305.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 3 [Mus musculus] >gi|148695207|gb|EDL27154.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 3, isoform CRA_a [Mus musculus] >gi|148695208|gb|EDL27155.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 3, isoform CRA_a [Mus musculus] >gi|149022270|gb|EDL79164.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9) isoform 3, isoform CRA_a [Rattus norvegicus] (141 aa)
Score = 97, Expect = 1.3e-02, Identities = 24/66 (36%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A L++F
  S:    74 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILF 139
>gi|148237171|ref|NP_001088407.1| hypothetical protein LOC495263 [Xenopus laevis] >gi|54261572|gb|AAH84317.1| LOC495263 protein [Xenopus laevis] (130 aa)
Score = 97, Expect = 1.3e-02, Identities = 24/66 (36%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A L++F
  S:    63 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILF 128
>gi|162952022|ref|NP_001106134.1| predicted gene, ENSMUSG00000058357 [Mus musculus] >gi|149262632|ref|XP_001472743.1| PREDICTED: similar to H+ ATP synthase [Mus musculus] >gi|1352046|sp|P48202|AT5G1_MOUSE ATP synthase lipid-binding protein, mitochondrial precursor (ATP synthase proteolipid P1) (ATPase protein 9) (ATPase subunit c) >gi|309288|gb|AAA16434.1| H+ ATP synthase >gi|148670618|gb|EDL02565.1| mCG134178 [Mus musculus] (136 aa)
Score = 97, Expect = 1.3e-02, Identities = 23/66 (34%), Positives = 36/66 (54%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++  L++F
  S:    69 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVTFLILF 134
>gi|22297974|ref|NP_681221.1| F0F1 ATP synthase subunit C [Thermosynechococcus elongatus BP-1] >gi|22294152|dbj|BAC07983.1| ATP synthase subunit c [Thermosynechococcus elongatus BP-1] (99 aa)
Score = 97, Expect = 1.3e-02, Identities = 21/54 (38%), Positives = 35/54 (64%)
  Q:    22 GVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           G G+ QG ++ +++E +AR PE   KIR   +LS A  E+  +Y  +IA++L+F
  S:    40 GPGLAQGNASGQALEGIARQPEAEGKIRGTLLLSLAFMESLTIYGLVIALVLLF 93
>gi|13205|emb|CAA34810.1| unnamed protein product [Oryza sativa (indica cultivar-group)] (87 aa)
Score = 97, Expect = 1.3e-02, Identities = 28/71 (39%), Positives = 42/71 (59%)
  Q:     6 QGYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVFV 76
           +G   IGAG A IA+ G  +G G   + S+ +VARNP +  ++    IL  A+TE  AL+  ++A L+ FV
  S:     3 EGAKSIGAGAATIALAGRAVGIGNVLSSSIHSVARNPSLAKQLFGYAILGFALTEAIALFAPMMAFLISFV 73
>gi|51011614|gb|AAT92216.1| ATP synthase c-subunit [Ixodes pacificus] (152 aa)
Score = 97, Expect = 1.3e-02, Identities = 25/66 (37%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A LL+F
  S:    85 FIGAGAATVGVAGSGAGIGSVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMMAFLLLF 150
>gi|195505392|ref|XP_002099484.1| GE23327 [Drosophila yakuba] >gi|194185585|gb|EDW99196.1| GE23327 [Drosophila yakuba] (138 aa)
Score = 97, Expect = 1.3e-02, Identities = 25/66 (37%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A LL+F
  S:    71 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMMAFLLLF 136
>gi|193786795|dbj|BAG52118.1| unnamed protein product [Homo sapiens] (141 aa)
Score = 97, Expect = 1.3e-02, Identities = 24/66 (36%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A L++F
  S:    74 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPFLKQQLFSYAILGFALSEAMGLFCLMVAFLILF 139
>gi|108773333|ref|YP_635888.1| ATP synthase CF0 C subunit [Oltmannsiellopsis viridis] >gi|82541915|gb|ABB81956.1| CF0 subunit III of ATP synthase [Oltmannsiellopsis viridis] (82 aa)
Score = 97, Expect = 1.4e-02, Identities = 29/75 (38%), Positives = 46/75 (61%)
  Q:     1 MNITNQGYAFIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           MN      + + AGL++ +A +G G+GQG +A  +VE +AR PE   KIR   +LS A  E+  +Y  ++A+ L+F
  S:     1 MNPLIAAASVVAAGLSVGLAAIGPGMGQGTAAGYAVEGIARQPEAEGKIRGALLLSFAFMESLTIYGLVVALALLF 76
>gi|195449282|ref|XP_002072006.1| GK22551 [Drosophila willistoni] >gi|194168091|gb|EDW82992.1| GK22551 [Drosophila willistoni] (138 aa)
Score = 97, Expect = 1.4e-02, Identities = 25/66 (37%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A LL+F
  S:    71 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMMAFLLLF 136
>gi|194335034|ref|YP_002016894.1| ATP synthase F0, C subunit [Prosthecochloris aestuarii DSM 271] >gi|194312852|gb|ACF47247.1| ATP synthase F0, C subunit [Prosthecochloris aestuarii DSM 271] (78 aa)
Score = 97, Expect = 1.4e-02, Identities = 28/71 (39%), Positives = 45/71 (63%)
  Q:     5 NQGYAFIGAGL-AMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           N+   ++GAG+ A +A++G G+G G  A+ + E  AR PE  S IR+  I++AA+ E  AL+  +I +LL  
  S:     6 NESLGYLGAGIGAGLAVIGAGLGIGNIASSAAEGTARQPEATSDIRTTMIIAAALIEGVALFGEVICVLLAL 77
>gi|153805567|ref|YP_001382143.1| CF0 subunit III of ATP synthase [Leptosira terrestris] >gi|134270098|gb|ABO69287.1| CF0 subunit III of ATP synthase [Leptosira terrestris] (82 aa)
Score = 97, Expect = 1.4e-02, Identities = 24/55 (43%), Positives = 35/55 (63%)
  Q:    21 LGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +G GIGQG +A  +VE +AR PE   KIR   +LS A  E+  +Y  ++A+ L+F
  S:    22 IGPGIGQGTAAGYAVEGIARQPEAEGKIRGALLLSFAFMESLTIYGLVVALALLF 76
>gi|71755377|ref|XP_828603.1| ATPase subunit 9 [Trypanosoma brucei TREU927] >gi|2654782|gb|AAC48310.1| ATPase subunit 9 homolog [Trypanosoma brucei brucei] >gi|70833989|gb|EAN79491.1| ATPase subunit 9, putative [Trypanosoma brucei] (118 aa)
Score = 97, Expect = 1.5e-02, Identities = 27/73 (36%), Positives = 42/73 (57%)
  Q:     3 ITNQGYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           I+ QG  ++G GLA IA+ GVG+G G      + A AR P +   + +  IL  A+TE   L+  ++A L++F
  S:    45 ISVQGLHYVGTGLAAIALAGVGLGIGTIFGNLLVACARQPNLTKMLFNYAILGFALTEAIGLFALMLAFLMLF 117
>gi|157112701|ref|XP_001657606.1| ATPase subunit, putative [Aedes aegypti] >gi|108877954|gb|EAT42179.1| ATPase subunit, putative [Aedes aegypti] (125 aa)
Score = 97, Expect = 1.5e-02, Identities = 25/66 (37%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A LL+F
  S:    58 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMMAFLLLF 123
>gi|71648878|ref|XP_813219.1| ATPase subunit 9, putative [Trypanosoma cruzi strain CL Brener] >gi|71653801|ref|XP_815532.1| ATPase subunit 9, putative [Trypanosoma cruzi strain CL Brener] >gi|70878083|gb|EAN91368.1| ATPase subunit 9, putative [Trypanosoma cruzi] >gi|70880593|gb|EAN93681.1| ATPase subunit 9, putative [Trypanosoma cruzi] (108 aa)
Score = 97, Expect = 1.5e-02, Identities = 27/73 (36%), Positives = 42/73 (57%)
  Q:     3 ITNQGYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           I+ QG  ++G GLA IA+ GVG+G G      + A AR P +   + +  IL  A+TE   L+  ++A L++F
  S:    35 ISVQGLHYVGTGLAAIALAGVGLGIGTIFGNLLVACARQPNLTKMLFNYAILGFALTEAIGLFALMLAFLMLF 107
>gi|71418244|ref|XP_810789.1| ATPase subunit 9, putative [Trypanosoma cruzi strain CL Brener] >gi|70875377|gb|EAN88938.1| ATPase subunit 9, putative [Trypanosoma cruzi] (109 aa)
Score = 97, Expect = 1.5e-02, Identities = 27/73 (36%), Positives = 42/73 (57%)
  Q:     3 ITNQGYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           I+ QG  ++G GLA IA+ GVG+G G      + A AR P +   + +  IL  A+TE   L+  ++A L++F
  S:    36 ISVQGLHYVGTGLAAIALAGVGLGIGTIFGNLLVACARQPNLTKMLFNYAILGFALTEAIGLFALMLAFLMLF 108
>gi|157363028|ref|YP_001469795.1| F0F1 ATP synthase subunit C [Thermotoga lettingae TMO] >gi|157313632|gb|ABV32731.1| ATP synthase F0, C subunit [Thermotoga lettingae TMO] (86 aa)
Score = 97, Expect = 1.5e-02, Identities = 26/67 (38%), Positives = 42/67 (62%)
  Q:    10 FIGAGLAMIAILGVGIG-QGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVFV 76
           FIGAG+ M A        +G     +++A+AR PE++  + ++ +LS AV ET  LY  +I+IL++FV
  S:    18 FIGAGICMGAGAIGPGIGEGHVGDGAMQAMARQPELIGVLTTRMLLSQAVCETTGLYSLLISILILFV 85
>gi|114666322|ref|XP_001172711.1| PREDICTED: ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C1 isoform 1 [Pan troglodytes] (127 aa)
Score = 97, Expect = 1.5e-02, Identities = 24/66 (36%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A L++F
  S:    60 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILF 125
>gi|74004876|ref|XP_535971.2| PREDICTED: similar to ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c, isoform 3 [Canis familiaris] (141 aa)
Score = 97, Expect = 1.5e-02, Identities = 24/66 (36%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A L++F
  S:    74 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILF 139
>gi|47217003|emb|CAG01631.1| unnamed protein product [Tetraodon nigroviridis] (136 aa)
Score = 97, Expect = 1.5e-02, Identities = 24/66 (36%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A L++F
  S:    69 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILF 134
>gi|94482844|gb|ABF22459.1| mitochondrial ATP synthase F0 complex subunit c isoform 3 [Takifugu rubripes] (139 aa)
Score = 96, Expect = 1.6e-02, Identities = 24/66 (36%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A L++F
  S:    72 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILF 137
>gi|179255|gb|AAA51806.1| ATPase subunit 9 (100 aa)
Score = 96, Expect = 1.6e-02, Identities = 24/66 (36%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A L++F
  S:    33 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILF 98
>gi|72390954|ref|XP_845771.1| ATPase subunit 9, putative [Trypanosoma brucei TREU927] >gi|62175812|gb|AAX69939.1| ATPase subunit 9, putative [Trypanosoma brucei] >gi|70802307|gb|AAZ12212.1| ATPase subunit 9, putative [Trypanosoma brucei] (117 aa)
Score = 96, Expect = 1.6e-02, Identities = 27/73 (36%), Positives = 42/73 (57%)
  Q:     3 ITNQGYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           I+ QG  ++G GLA IA+ GVG+G G      + A AR P +   + +  IL  A+TE   L+  ++A L++F
  S:    44 ISVQGLHYVGTGLAAIALAGVGLGIGTIFGNLLVACARQPNLTKMLFNYAILGFALTEAIGLFALMLAFLMLF 116
>gi|170044391|ref|XP_001849833.1| mitochondrial ATP synthase lipid binding protein [Culex quinquefasciatus] >gi|167867565|gb|EDS30948.1| mitochondrial ATP synthase lipid binding protein [Culex quinquefasciatus] (138 aa)
Score = 96, Expect = 1.7e-02, Identities = 25/66 (37%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A LL+F
  S:    71 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMMAFLLLF 136
>gi|132444676|ref|YP_636270.3| ATP synthase CF0 C subunit [Pseudendoclonium akinetum] (82 aa)
Score = 96, Expect = 1.7e-02, Identities = 28/67 (41%), Positives = 43/67 (64%)
  Q:     9 AFIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           + I AGL++ +A +G G GQG +A  +VE +AR PE   KIR   +LS A  E+  +Y  ++A+ L+F
  S:     9 SVIAAGLSVGLAAIGPGNGQGVAAGYAVEGIARQPEAEGKIRGALLLSFAFMESLTIYGLVVALALLF 76
>gi|56159668|gb|AAV80692.1| CF0 subunit III of ATP synthase [Pseudendoclonium akinetum] (83 aa)
Score = 96, Expect = 1.7e-02, Identities = 28/67 (41%), Positives = 43/67 (64%)
  Q:     9 AFIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           + I AGL++ +A +G G GQG +A  +VE +AR PE   KIR   +LS A  E+  +Y  ++A+ L+F
  S:    10 SVIAAGLSVGLAAIGPGNGQGVAAGYAVEGIARQPEAEGKIRGALLLSFAFMESLTIYGLVVALALLF 77
>gi|195998197|ref|XP_002108967.1| conserved hypothetical protein [Trichoplax adhaerens] >gi|190589743|gb|EDV29765.1| conserved hypothetical protein [Trichoplax adhaerens] (116 aa)
Score = 96, Expect = 1.7e-02, Identities = 25/66 (37%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      V   ARNP +  ++ S  IL  A++E   L+C ++A L++F
  S:    49 FIGAGAATVGVAGSGAGIGTVFGSLVIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMMAFLILF 114
>gi|52430378|gb|AAU50550.1| ATPase synthase protein 9 [Fundulus heteroclitus] (110 aa)
Score = 96, Expect = 1.7e-02, Identities = 24/66 (36%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A L++F
  S:    43 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILF 108
>gi|4502301|ref|NP_001680.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C3 precursor [Homo sapiens] >gi|16758592|ref|NP_446208.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c, isoform 3 [Rattus norvegicus] >gi|50659074|ref|NP_001002258.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C3 precursor [Homo sapiens] >gi|1352048|sp|P48201|AT5G3_HUMAN ATP synthase lipid-binding protein, mitochondrial precursor (ATP synthase proteolipid P3) (ATPase protein 9) (ATPase subunit c) >gi|51315713|sp|Q71S46|AT5G3_RAT ATP synthase lipid-binding protein, mitochondrial precursor (ATP synthase proteolipid P3) (ATPase protein 9) (ATPase subunit c) >gi|12620380|gb|AAG60677.1|AF315374_1 ATP synthase lipid-binding protein P3 precursor [Rattus norvegicus] >gi|511450|gb|AAA78807.1| mitochondrial ATP synthase subunit 9 precursor >gi|62630225|gb|AAX88970.1| unknown [Homo sapiens] >gi|76827802|gb|AAI06882.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C3 (subunit 9) [Homo sapiens] >gi|119631510|gb|EAX11105.1| hCG16568, isoform CRA_a [Homo sapiens] >gi|119631511|gb|EAX11106.1| hCG16568, isoform CRA_a [Homo sapiens] >gi|119631512|gb|EAX11107.1| hCG16568, isoform CRA_a [Homo sapiens] >gi|189065214|dbj|BAG34937.1| unnamed protein product [Homo sapiens] (142 aa)
Score = 96, Expect = 1.7e-02, Identities = 24/66 (36%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A L++F
  S:    75 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILF 140
>gi|125975086|ref|YP_001038996.1| ATP synthase F0, C subunit [Clostridium thermocellum ATCC 27405] >gi|196251790|ref|ZP_03150456.1| ATP synthase F0, C subunit [Clostridium thermocellum DSM 4150] >gi|125715311|gb|ABN53803.1| ATP synthase F0, C subunit [Clostridium thermocellum ATCC 27405] >gi|196198730|gb|EDX93561.1| ATP synthase F0, C subunit [Clostridium thermocellum DSM 4150] (73 aa)
Score = 96, Expect = 1.7e-02, Identities = 29/70 (41%), Positives = 44/70 (62%)
  Q:     7 GYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVFV 76
           G   I A L ++  +  GIG   + +K+V+AVAR PE   KIR+  +L AA+ E  A+Y F+IA+L+V +
  S:     3 GIVAISASLCVLTGVAAGIGISVATSKAVDAVARQPEAADKIRNIVVLGAALAEATAIYGFVIALLMVLL 72
>gi|157133453|ref|XP_001656257.1| ATPase subunit, putative [Aedes aegypti] >gi|94468368|gb|ABF18033.1| mitochondrial ATP synthase lipid binding protein precursor [Aedes aegypti] >gi|108870848|gb|EAT35073.1| ATPase subunit, putative [Aedes aegypti] (138 aa)
Score = 96, Expect = 1.7e-02, Identities = 25/66 (37%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A LL+F
  S:    71 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMMAFLLLF 136
>gi|56417588|gb|AAV90735.1| mitochondrial ATP synthase lipid binding protein precursor [Aedes albopictus] (138 aa)
Score = 96, Expect = 1.7e-02, Identities = 25/66 (37%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A LL+F
  S:    71 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMMAFLLLF 136
>gi|71421727|ref|XP_811884.1| ATPase subunit 9, putative [Trypanosoma cruzi strain CL Brener] >gi|70876597|gb|EAN90033.1| ATPase subunit 9, putative [Trypanosoma cruzi] (105 aa)
Score = 96, Expect = 1.8e-02, Identities = 27/73 (36%), Positives = 42/73 (57%)
  Q:     3 ITNQGYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           I+ QG  ++G GLA IA+ GVG+G G      + A AR P +   + +  IL  A+TE   L+  ++A L++F
  S:    32 ISVQGLHYVGTGLAAIALAGVGLGIGTIFGNLLVACARQPNLTKMLFNYAILGFALTEAIGLFALMLAFLMLF 104
>gi|11467512|ref|NP_043658.1| ATP synthase CF0 C subunit [Odontella sinensis] >gi|231612|sp|Q00824|ATPH_ODOSI ATP synthase C chain (Lipid-binding protein) (ATPase subunit III) >gi|11947|emb|CAA43153.1| adenosinetriphosphatase [Odontella sinensis] >gi|1185207|emb|CAA91690.1| ATP synthase CFO subunit III [Odontella sinensis] (82 aa)
Score = 96, Expect = 1.8e-02, Identities = 23/52 (44%), Positives = 34/52 (65%)
  Q:    24 GIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           GIGQG +A ++VE +AR PE  +KIR   +LS A  E   +Y  ++A+ L+F
  S:    25 GIGQGNAAGQAVEGIARQPEGENKIRGTLLLSLAFMEALTIYGLVVALALLF 76
>gi|149730746|ref|XP_001499985.1| PREDICTED: similar to ATP synthase lipid-binding protein, mitochondrial precursor (ATP synthase proteolipid P3) (ATPase protein 9) (ATPase subunit c) [Equus caballus] (141 aa)
Score = 96, Expect = 1.8e-02, Identities = 24/66 (36%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A L++F
  S:    74 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILF 139
>gi|190692013|gb|ACE87781.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C3 (subunit 9) protein [synthetic construct] (142 aa)
Score = 96, Expect = 1.9e-02, Identities = 24/66 (36%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A L++F
  S:    75 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILF 140
>gi|126326335|ref|XP_001368353.1| PREDICTED: hypothetical protein [Monodelphis domestica] (141 aa)
Score = 96, Expect = 1.9e-02, Identities = 24/66 (36%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A L++F
  S:    74 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILF 139
>gi|109081176|ref|XP_001086288.1| PREDICTED: ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C3 (subunit 9) [Macaca mulatta] >gi|90078110|dbj|BAE88735.1| unnamed protein product [Macaca fascicularis] (141 aa)
Score = 96, Expect = 1.9e-02, Identities = 24/66 (36%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A L++F
  S:    74 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILF 139
>gi|193891062|gb|ACF28684.1| chloroplast ATP synthase [Amphidinium carterae] (143 aa)
Score = 96, Expect = 1.9e-02, Identities = 23/64 (35%), Positives = 43/64 (67%)
  Q:    11 IGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLV 74
           +GAG A+ +A +G G+GQG ++ + ++ ++R PEV   +R   +LS A  E+  +Y  +IA++L+
  S:    72 VGAGFAIGLAAIGSGVGQGIASGRCIDGISRQPEVADDLRGVLLLSLAFMESLTIYGLVIALVLL 136
>gi|47115139|emb|CAG28411.1| ATP5G3 [Homo sapiens] (142 aa)
Score = 96, Expect = 1.9e-02, Identities = 24/66 (36%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A L++F
  S:    75 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILF 140
>gi|4877689|gb|AAD31414.1|AF119068_1 ATPase subunit 9 [Saccharomyces spencerorum] >gi|4877691|gb|AAD31415.1|AF119069_1 ATPase subunit 9 [Saccharomyces spencerorum] (66 aa)
Score = 96, Expect = 1.9e-02, Identities = 23/63 (36%), Positives = 38/63 (60%)
  Q:    13 AGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           AG+A I +LG GIG     A  +  V+RNP +  ++ S  IL  A++E   L+C +++ +L+F
  S:     1 AGIATIGLLGAGIGIAIIFAALINGVSRNPSLKDQLFSYTILGMALSEATGLFCLMVSFMLLF 63
>gi|71423300|ref|XP_812413.1| ATPase subunit 9, putative [Trypanosoma cruzi strain CL Brener] >gi|70877190|gb|EAN90562.1| ATPase subunit 9, putative [Trypanosoma cruzi] (109 aa)
Score = 96, Expect = 2.0e-02, Identities = 27/73 (36%), Positives = 42/73 (57%)
  Q:     3 ITNQGYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           I+ QG  ++G GLA IA+ GVG+G G      + A AR P +   + +  IL  A+TE   L+  ++A L++F
  S:    36 ISVQGLHYVGTGLAAIALAGVGLGIGTIFGNLLVACARQPNLTKMLFNYAILGFALTEAIGLFALMLAFLMLF 108
>gi|110598589|ref|ZP_01386857.1| ATP synthase F0, C subunit [Chlorobium ferrooxidans DSM 13031] >gi|110339823|gb|EAT58330.1| ATP synthase F0, C subunit [Chlorobium ferrooxidans DSM 13031] (75 aa)
Score = 96, Expect = 2.0e-02, Identities = 29/69 (42%), Positives = 44/69 (63%)
  Q:     7 GYAFIGAGL-AMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           G A++GAG+ A +A++G G+G G  AA + E  AR PE  S IR+  I++AA+ E   L+  +I +LL  
  S:     5 GLAYLGAGIGAGLAVIGAGLGIGNIAASATEGTARQPEAASDIRTTMIIAAALIEGVGLFGEVICVLLAL 74
>gi|68565143|sp|Q5RFL2|AT5G3_PONAB ATP synthase lipid-binding protein, mitochondrial precursor (ATP synthase proteolipid P3) (ATPase protein 9) (ATPase subunit c) >gi|55725157|emb|CAH89445.1| hypothetical protein [Pongo abelii] (142 aa)
Score = 96, Expect = 2.0e-02, Identities = 24/66 (36%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A L++F
  S:    75 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILF 140
>gi|118579924|ref|YP_901174.1| ATP synthase F0, C subunit [Pelobacter propionicus DSM 2379] >gi|118502634|gb|ABK99116.1| ATP synthase F0, C subunit [Pelobacter propionicus DSM 2379] (91 aa)
Score = 96, Expect = 2.0e-02, Identities = 25/65 (38%), Positives = 41/65 (63%)
  Q:    11 IGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +GA + M I  LG GIGQG +   +VE V+RNP    KI +  ++  A+ E+ A+Y  +I ++++F
  S:     9 LGAAIGMAIGTLGTGIGQGLAVKSAVEGVSRNPGASGKIMTTMMIGLAMIESLAIYALVICLIILF 74
>gi|74002223|ref|XP_851540.1| PREDICTED: similar to ATP synthase lipid-binding protein, mitochondrial precursor (ATP synthase proteolipid P1) (ATPase protein 9) (ATPase subunit C) [Canis familiaris] (131 aa)
Score = 96, Expect = 2.1e-02, Identities = 23/66 (34%), Positives = 35/66 (53%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A +E   L+C ++A  ++F
  S:    64 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFAFSEAMGLFCLMVAFFILF 129
>gi|78043573|ref|YP_361343.1| ATP synthase F0, C subunit [Carboxydothermus hydrogenoformans Z-2901] >gi|77995688|gb|ABB14587.1| ATP synthase F0, C subunit [Carboxydothermus hydrogenoformans Z-2901] (82 aa)
Score = 95, Expect = 2.1e-02, Identities = 29/68 (42%), Positives = 44/68 (64%)
  Q:     7 GYAFIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLV 74
           G   IGAG+A+    +G GIGQG +A K+ EA+AR PEV   +++  I++ A  ET  +Y  +IA +L+
  S:    10 GLIAIGAGIAVGFGAIGSGIGQGIAAGKAFEAMARQPEVRGTVQTFLIIALAFMETLTIYGLVIAFMLL 78
>gi|186900973|ref|ZP_02973928.1| ATP synthase F0, C subunit [Cyanothece sp. PCC 7424] >gi|186692095|gb|EDU16716.1| ATP synthase F0, C subunit [Cyanothece sp. PCC 7424] (81 aa)
Score = 95, Expect = 2.2e-02, Identities = 21/55 (38%), Positives = 36/55 (65%)
  Q:    21 LGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +G GIGQG ++ ++V  +AR PE   KIR   +L+ A  E+  +Y  +I+++L+F
  S:    22 IGPGIGQGNASGQAVSGIARQPEAEGKIRGTLLLTLAFMESLTIYGLVISLVLLF 76
>gi|47271372|ref|NP_571836.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9) [Danio rerio] >gi|28279669|gb|AAH45894.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9) [Danio rerio] (140 aa)
Score = 95, Expect = 2.2e-02, Identities = 24/66 (36%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A L++F
  S:    73 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILF 138
>gi|13615|emb|CAA24079.1| unnamed protein product [Saccharomyces cerevisiae] >gi|343758|gb|AAA32146.1| H(+)-transporting ATP synthase [Saccharomyces cerevisiae] >gi|343939|gb|AAA32169.1| ATPase proteolipid (76 aa)
Score = 95, Expect = 2.2e-02, Identities = 23/66 (34%), Positives = 38/66 (57%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +IGAG++ I +LG GIG     A  +  V+RNP +   +    I   A++E   L+C +++ LL+F
  S:     9 YIGAGISTIGLLGAGIGIAIVFAALINGVSRNPSIKDTVFPMAIFGFALSEATGLFCLMVSFLLLF 74
>gi|157929876|gb|ABW04126.1| ATP synthase H+ transporting F0 complex subunit c [Epinephelus coioides] (139 aa)
Score = 95, Expect = 2.3e-02, Identities = 24/66 (36%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A L++F
  S:    72 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILF 137
>gi|109010281|ref|XP_001099796.1| PREDICTED: ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C3 (subunit 9) [Macaca mulatta] (141 aa)
Score = 95, Expect = 2.3e-02, Identities = 24/66 (36%), Positives = 36/66 (54%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           F GAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A L+VF
  S:    74 FTGAGAATVGVAGSGAGIGTVFGSLIIGCARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLIVF 139
>gi|94482791|gb|ABF22409.1| mitochondrial ATP synthase F0 complex subunit c isoform 1 [Takifugu rubripes] (137 aa)
Score = 95, Expect = 2.3e-02, Identities = 24/66 (36%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A L++F
  S:    70 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILF 135
>gi|145603091|ref|XP_362034.2| predicted protein [Magnaporthe grisea 70-15] >gi|145011413|gb|EDJ96069.1| predicted protein [Magnaporthe grisea 70-15] (154 aa)
Score = 95, Expect = 2.4e-02, Identities = 25/65 (38%), Positives = 38/65 (58%)
  Q:    12 GAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVFV 76
           GAGLA I + G G+G G      ++ VARNP +  ++ S  IL  A +E   L+  ++A LL++V
  S:    89 GAGLATIGLAGAGVGIGTVFGALIQGVARNPALRGQLFSYAILGFAFSEATGLFALMVAFLLMYV 153
>gi|45239027|ref|NP_987084.1| AMI007Wp [Ashbya gossypii ATCC 10895] >gi|50400377|sp|Q75G38|ATP9_ASHGO ATP synthase protein 9, mitochondrial (Lipid-binding protein) >gi|44978833|gb|AAS50174.1| AMI007Wp [Ashbya gossypii ATCC 10895] (76 aa)
Score = 95, Expect = 2.4e-02, Identities = 24/66 (36%), Positives = 40/66 (60%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +IGAG++ I +LG GIG     A  ++ V+RNP +   +    IL  A++E   L+C +I+ LL++
  S:     9 YIGAGISTIGLLGAGIGIAIVFAALIQGVSRNPSMKDTLFQFAILGFAISEATGLFCLMISFLLLY 74
>gi|42520302|ref|NP_966217.1| F0F1 ATP synthase subunit C [Wolbachia endosymbiont of Drosophila melanogaster] >gi|58698347|ref|ZP_00373262.1| ATP synthase F0, C subunit-related protein [Wolbachia endosymbiont of Drosophila ananassae] >gi|99034173|ref|ZP_01314258.1| hypothetical protein Wendoof_01000947 [Wolbachia endosymbiont of Drosophila willistoni TSC#14030-0811.24] >gi|190571030|ref|YP_001975388.1| ATP synthase F0, C subunit [Wolbachia pipientis] >gi|42410040|gb|AAS14151.1| ATP synthase F0, C subunit [Wolbachia endosymbiont of Drosophila melanogaster] >gi|58535137|gb|EAL59221.1| ATP synthase F0, C subunit-related protein [Wolbachia endosymbiont of Drosophila ananassae] >gi|190357302|emb|CAQ54730.1| ATP synthase F0, C subunit [Wolbachia pipientis] (75 aa)
Score = 95, Expect = 2.4e-02, Identities = 26/68 (38%), Positives = 40/68 (58%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVFVA 77
           FI  GLA+  +LG G+G     +  +  +ARNPE   K++S   + AA+ E   L  F++A+LL+F A
  S:     8 FIAIGLAVFGMLGAGLGIANIFSAMLNGIARNPESEGKMKSYVYIGAAMVEIMGLLAFVLAMLLIFAA 75
>gi|158288718|ref|XP_001688294.1| AGAP000523-PA [Anopheles gambiae str. PEST] >gi|114864975|gb|ABI83790.1| mitochondrial F1F0-ATP synthase subunit c [Anopheles funestus] >gi|157018704|gb|EDO64318.1| AGAP000523-PA [Anopheles gambiae str. PEST] (138 aa)
Score = 95, Expect = 2.4e-02, Identities = 25/66 (37%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A LL+F
  S:    71 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMMAFLLLF 136
>gi|163794976|ref|ZP_02188945.1| ATP synthase C chain [alpha proteobacterium BAL199] >gi|159179795|gb|EDP64322.1| ATP synthase C chain [alpha proteobacterium BAL199] (74 aa)
Score = 95, Expect = 2.5e-02, Identities = 27/65 (41%), Positives = 44/65 (67%)
  Q:    11 IGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           IGAG+A+IA++GVG+G G   +  + ++ARNP   +++    IL  A+TE  AL+  +IA L++F
  S:     9 IGAGIAVIALMGVGVGIGNIFSTLISSIARNPAARNEVFGIGILGFALTEAVALFALLIAFLILF 73
>gi|50750411|ref|XP_421992.1| PREDICTED: similar to mitochondrial ATP synthase subunit 9 [Gallus gallus] (136 aa)
Score = 95, Expect = 2.5e-02, Identities = 24/66 (36%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A L++F
  S:    69 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILF 134
>gi|41056119|ref|NP_957470.1| hypothetical protein LOC394151 [Danio rerio] >gi|28503019|gb|AAH47199.1| Zgc:55970 [Danio rerio] >gi|50925106|gb|AAH78654.1| Zgc:55970 protein [Danio rerio] (139 aa)
Score = 95, Expect = 2.5e-02, Identities = 24/66 (36%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A L++F
  S:    72 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILF 137
>gi|118579039|ref|YP_900289.1| ATP synthase F0, C subunit [Pelobacter propionicus DSM 2379] >gi|118501749|gb|ABK98231.1| ATP synthase F0, C subunit [Pelobacter propionicus DSM 2379] (91 aa)
Score = 95, Expect = 2.6e-02, Identities = 25/64 (39%), Positives = 40/64 (62%)
  Q:    12 GAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           GA + M I  LG  IGQG +   +VE VARNP   SKI +  ++  A+ E+ A+Y  ++ ++++F
  S:    10 GAAIGMAIGTLGTAIGQGMAVKSAVEGVARNPGAASKIMTTMMIGLAMIESLAIYALVVCLIILF 74
>gi|156551904|ref|XP_001606914.1| PREDICTED: similar to mitochondrial F1F0-ATP synthase subunit c isoform 4 [Nasonia vitripennis] >gi|156551906|ref|XP_001606892.1| PREDICTED: similar to mitochondrial F1F0-ATP synthase subunit c isoform 2 [Nasonia vitripennis] >gi|156551908|ref|XP_001606907.1| PREDICTED: similar to mitochondrial F1F0-ATP synthase subunit c isoform 3 [Nasonia vitripennis] >gi|156551910|ref|XP_001606882.1| PREDICTED: similar to mitochondrial F1F0-ATP synthase subunit c isoform 1 [Nasonia vitripennis] (137 aa)
Score = 95, Expect = 2.6e-02, Identities = 25/66 (37%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A LL+F
  S:    70 FIGAGAATVGVAGSGAGIGSVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMMAFLLLF 135
>gi|12597402|gb|AAG60044.1|AF311603_1 ATP synthase lipid binding protein p3 precursor [Danio rerio] (118 aa)
Score = 95, Expect = 2.6e-02, Identities = 24/66 (36%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A L++F
  S:    51 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILF 116
>gi|50878271|ref|NP_998193.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9) [Danio rerio] >gi|47937900|gb|AAH71368.1| Zgc:73293 [Danio rerio] (138 aa)
Score = 95, Expect = 2.6e-02, Identities = 24/66 (36%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A L++F
  S:    71 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILF 136
>gi|150456406|ref|YP_001331014.1| ATP synthase, subunit 9 [Vanderwaltozyma polyspora] >gi|149999733|emb|CAN85575.1| ATP synthase, subunit 9 [Vanderwaltozyma polyspora] (76 aa)
Score = 95, Expect = 2.7e-02, Identities = 24/66 (36%), Positives = 39/66 (59%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +IGAG++ I +LG GIG     A  +  V+RNP +   +    IL  A++E   L+C +I+ LL++
  S:     9 YIGAGISTIGLLGAGIGIAIVFAALINGVSRNPSLRETLFPMAILGFALSEATGLFCLMISFLLIY 74
>gi|124516450|gb|EAY57958.1| F0F1-type ATP synthase, subunit c/Archaeal/vacuol ar-type H+-ATPase, subunit K [Leptospirillum sp. Group II UBA] (76 aa)
Score = 95, Expect = 2.7e-02, Identities = 27/66 (40%), Positives = 38/66 (57%)
  Q:     9 AFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLV 74
           A IG G A I + G G G G+   K +EAVAR PEV  ++     L  A++E  ALY  +IA +++
  S:     7 ALIGMGAAAIGVAGSGAGIGYIFGKMIEAVARQPEVEGRVSKYMWLGFALSEAVALYALVIAFIIM 72
>gi|62642783|ref|XP_574837.1| PREDICTED: similar to ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 2 [Rattus norvegicus] (107 aa)
Score = 94, Expect = 2.7e-02, Identities = 24/66 (36%), Positives = 36/66 (54%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C  +A L++F
  S:    40 FIGAGAATVGVAGSGAGIGTVFGSLIIDYARNPSLKQQLFSYAILGFALSEAMGLFCLTVAFLILF 105
>gi|16124622|ref|NP_419186.1| F0F1 ATP synthase subunit C [Caulobacter crescentus CB15] >gi|13421522|gb|AAK22354.1| ATP synthase F0, C subunit [Caulobacter crescentus CB15] (74 aa)
Score = 94, Expect = 3.0e-02, Identities = 23/66 (34%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +IGAGLAM+ ++G G+G G       +   RNP   ++ R    L  A+TE   ++  +IA L++F
  S:     8 YIGAGLAMLGMIGAGVGLGVMFGNYFQGALRNPTAAAQERPMLFLGMALTEALGIFALVIAFLILF 73
>gi|161087399|gb|ABX56859.1| ATP synthase subunit 9 mitochondrial precursor [Litopenaeus vannamei] (116 aa)
Score = 94, Expect = 3.0e-02, Identities = 25/66 (37%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A LL+F
  S:    49 FIGAGAATVGVAGSGAGIGSVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMMAFLLLF 114
>gi|125812253|ref|XP_001336639.1| PREDICTED: similar to ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9) [Danio rerio] >gi|37589803|gb|AAH59619.1| Zgc:73293 [Danio rerio] (138 aa)
Score = 94, Expect = 3.0e-02, Identities = 24/66 (36%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A L++F
  S:    71 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILF 136
>gi|116009023|gb|ABJ52180.1| AtpH [Phyllostachys pubescens] (73 aa)
Score = 94, Expect = 3.1e-02, Identities = 29/67 (43%), Positives = 44/67 (65%)
  Q:     9 AFIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           + I AGLA+ +A +G G+GQG +A ++VE +AR PE   KIR   +LS A  E   +Y  ++A+ L+F
  S:     5 SVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALALLF 72
>gi|154339177|ref|XP_001562280.1| ATPase subunit 9, putative [Leishmania braziliensis MHOM/BR/75/M2904] >gi|134062863|emb|CAM39310.1| ATPase subunit 9, putative [Leishmania braziliensis] (106 aa)
Score = 94, Expect = 3.1e-02, Identities = 26/73 (35%), Positives = 42/73 (57%)
  Q:     3 ITNQGYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           I+ QG  ++G GLA IA+ GVG+G G      + + AR P +   + +  IL  A+TE   L+  ++A L++F
  S:    33 ISVQGLHYVGTGLAAIALAGVGMGIGTIFGSLLMSCARQPNLTKMLFNYAILGFALTEAIGLFALMLAFLMLF 105
>gi|109898984|ref|YP_662239.1| F0F1 ATP synthase subunit C [Pseudoalteromonas atlantica T6c] >gi|109701265|gb|ABG41185.1| H+-transporting two-sector ATPase, C subunit [Pseudoalteromonas atlantica T6c] (92 aa)
Score = 94, Expect = 3.2e-02, Identities = 22/67 (32%), Positives = 44/67 (65%)
  Q:     9 AFIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           + I AGL + I +LG  + +G + A +++A+A+ P+  S I     +  A+ E+ A+YCF+++++L+F
  S:    11 SIITAGLTIGIGVLGPSLAEGSAVASALKALAQQPDASSTITRTLFVGLAMIESTAIYCFVVSMILLF 78
>gi|38638274|ref|NP_943666.1| ATP synthase F0 subunit 9 [Chara vulgaris] >gi|32966588|gb|AAP92171.1| ATP synthase F0 subunit 9 [Chara vulgaris] (76 aa)
Score = 94, Expect = 3.3e-02, Identities = 27/71 (38%), Positives = 42/71 (59%)
  Q:     6 QGYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVFV 76
           +G   IGAG A IA+ G  +G G   +  + +VARNP +  ++    IL  A+TE  AL+  ++A L++FV
  S:     5 EGAKLIGAGCATIALAGAAVGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIALFALMMAFLILFV 75
>gi|86990311|ref|YP_492534.1| ATP synthase F0 subunit 9 [Hanseniaspora uvarum] >gi|66473328|gb|AAY46309.1| ATP synthase F0 subunit 9 [Hanseniaspora uvarum] (76 aa)
Score = 94, Expect = 3.3e-02, Identities = 23/69 (33%), Positives = 42/69 (60%)
  Q:     7 GYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           G  +IGAG+A + ++G GIG     A  + AV+RNP +   +    IL  +++E+  L+C +I+ +L++
  S:     6 GAKYIGAGIAAVGLIGAGIGIAIVFAALINAVSRNPSMTKTLFPYAILGFSLSESTGLFCLMISFILLY 74
>gi|154337112|ref|XP_001564789.1| ATPase subunit 9, putative [Leishmania braziliensis MHOM/BR/75/M2904] >gi|134061827|emb|CAM38862.1| ATPase subunit 9, putative [Leishmania braziliensis] (106 aa)
Score = 94, Expect = 3.4e-02, Identities = 26/73 (35%), Positives = 42/73 (57%)
  Q:     3 ITNQGYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           I+ QG  ++G GLA IA+ GVG+G G      + + AR P +   + +  IL  A+TE   L+  ++A L++F
  S:    33 ISVQGLHYVGTGLAAIALAGVGMGIGTIFGSLLMSCARQPNLTKMLFNYAILGFALTEAIGLFALMLAFLMLF 105
>gi|193213685|ref|YP_001999638.1| ATP synthase F0, C subunit [Chlorobaculum parvum NCIB 8327] >gi|193087162|gb|ACF12438.1| ATP synthase F0, C subunit [Chlorobaculum parvum NCIB 8327] (75 aa)
Score = 94, Expect = 3.4e-02, Identities = 29/69 (42%), Positives = 44/69 (63%)
  Q:     7 GYAFIGAGL-AMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           G  ++GAG+ A +A++G G+G G  AA + E  AR PE  S IR+  I++AA+ E  AL+  +I +LL  
  S:     5 GLGYLGAGVGAGLAVIGAGLGIGNIAASAAEGTARQPEATSDIRTTMIIAAALIEGVALFGEVICVLLAL 74
>gi|57790531|ref|YP_184726.1| putative ATP synthase, subunit 9 [Kluyveromyces thermotolerans] >gi|57161737|emb|CAG25604.1| putative ATP synthase, subunit 9 [Kluyveromyces thermotolerans] (76 aa)
Score = 94, Expect = 3.4e-02, Identities = 24/66 (36%), Positives = 39/66 (59%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +IGAG++ I +LG GIG     A  +  V+RNP +   +    IL  A++E   L+C +I+ LL++
  S:     9 YIGAGISTIGLLGAGIGIAIVFAALINGVSRNPSLKDTLFPFAILGFALSEATGLFCLMISFLLLY 74
>gi|58618218|gb|AAW80674.1| chloroplast ATPH isoform 4 [Heterocapsa triquetra] (141 aa)
Score = 93, Expect = 3.6e-02, Identities = 24/65 (36%), Positives = 42/65 (64%)
  Q:    11 IGAGLA--MIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +GAG A  + AI   G+GQG ++ + ++ ++R PEV   +R   +LS A  E+  +Y  +IA++L+F
  S:    69 VGAGFAIGLAAIGPSGVGQGIASGRCIDGISRQPEVADDLRGVLLLSLAFMESLTIYGLVIALVLLF 135
>gi|11467780|ref|NP_050831.1| ATP synthase CF0 C subunit [Nephroselmis olivacea] >gi|31562987|sp|Q9TL14|ATPH_NEPOL ATP synthase C chain (ATPase subunit III) (Lipid-binding protein) >gi|5880709|gb|AAD54802.1|AF137379_25 CF0 subunit III of ATP synthase [Nephroselmis olivacea] (82 aa)
Score = 93, Expect = 3.7e-02, Identities = 28/67 (41%), Positives = 43/67 (64%)
  Q:     9 AFIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           + + AGLA+ +A +G GIGQG +A ++V  +AR PE   KIR   +LS A  E   +Y  ++A+ L+F
  S:     9 SVVAAGLAVGLASIGPGIGQGTAAGQAVGGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALALLF 76
>gi|187777258|ref|ZP_02993731.1| hypothetical protein CLOSPO_00810 [Clostridium sporogenes ATCC 15579] >gi|187774186|gb|EDU37988.1| hypothetical protein CLOSPO_00810 [Clostridium sporogenes ATCC 15579] (80 aa)
Score = 93, Expect = 3.8e-02, Identities = 22/54 (40%), Positives = 35/54 (64%)
  Q:    21 LGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLV 74
           +G GIG G +  K+VE V+R PE   KI S  ++ +A +E  A+Y  I+A++L+
  S:    23 IGAGIGTGNATGKAVEGVSRQPEASGKIMSTLLIGSAFSEATAIYGLIVALILI 76
>gi|148746164|dbj|BAF63847.1| putative F0 subunit of ATP synthase [Hydroides elegans] (156 aa)
Score = 93, Expect = 3.8e-02, Identities = 25/69 (36%), Positives = 38/69 (55%)
  Q:     5 NQGYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILL 73
           +Q   +IGAG A   + G G G G      + +VARNP + +++ S  IL  A++E   L+C +IA L 
  S:    66 DQAAKYIGAGCATAGVAGSGAGIGTVFGSLMISVARNPSMKAQLFSYAILGFALSEAMGLFCLMIAFLF 134
>gi|9884626|dbj|BAB02632.1| H+-transporting ATP synthase like [Arabidopsis thaliana] (81 aa)
Score = 93, Expect = 3.8e-02, Identities = 28/76 (36%), Positives = 43/76 (56%)
  Q:     1 MNITNQGYAFIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVFV 76
           MN      + I AGLA+ +A +  G+ QG +A ++VE + R PE   KIR   +LS    E   +Y  ++A+ L+FV
  S:     1 MNPHVSAASVIVAGLAVGLASIEPGVSQGTTAGQAVEGIVRQPEAEGKIRGTLLLSLVFMEALTIYGLLVALTLLFV 77
>gi|50261312|ref|YP_052921.1| ATP synthase F0 subunit 9 [Saprolegnia ferax] >gi|48237625|gb|AAT40674.1| ATP synthase F0 subunit 9 [Saprolegnia ferax] (75 aa)
Score = 93, Expect = 3.9e-02, Identities = 26/70 (37%), Positives = 40/70 (57%)
  Q:     6 QGYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           Q   F+GAGLA I + G G+G G      +  ++RNP +  ++    IL  A+TE  AL+  +IA L++F
  S:     4 QAAKFLGAGLATIGLAGAGVGIGNVFGSLILGISRNPSLQQELMRAAILGFALTEAIALFSLMIAFLILF 73
>gi|4588703|gb|AAD26184.1|AF114942_1 ATP synthase subunit 9 [Saccharomyces barnettii] >gi|4588705|gb|AAD26185.1|AF114943_1 ATP synthase subunit 9 [Saccharomyces barnettii] (64 aa)
Score = 93, Expect = 4.0e-02, Identities = 23/63 (36%), Positives = 38/63 (60%)
  Q:    13 AGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           AG+A I +LG GIG     A  +  V+RNP +  ++ S  IL  A++E   L+C +++ +L+F
  S:     1 AGIATIGLLGAGIGIAIIFAALINGVSRNPSLKDQLFSYTILGMALSEATGLFCLMVSFMLMF 63
>gi|52782701|sp|P92811|ATP9_KLULA ATP synthase protein 9, mitochondrial (Lipid-binding protein) >gi|1857253|gb|AAB48406.1| Fo ATP synthase subunit 9 [Kluyveromyces lactis] (76 aa)
Score = 93, Expect = 4.1e-02, Identities = 23/66 (34%), Positives = 40/66 (60%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +IGAG++ I +LG GIG     +  ++ V+RNP +   +    IL  A++E   L+C +I+ LL++
  S:     9 YIGAGISTIGLLGAGIGIAIVFSALIQGVSRNPSLKDTLFPFAILGFALSEATGLFCLMISFLLLY 74
>gi|77917634|ref|YP_355449.1| ATP synthase F0, C subunit [Pelobacter carbinolicus DSM 2380] >gi|77543717|gb|ABA87279.1| ATP synthase F0, C subunit [Pelobacter carbinolicus DSM 2380] (88 aa)
Score = 93, Expect = 4.1e-02, Identities = 24/68 (35%), Positives = 41/68 (60%)
  Q:     8 YAFIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +  I AG  M    LG  IGQG +   ++E VARNP    KI +  ++  A+ E+ A+Y F+++++++F
  S:     6 WVIITAGFGMAFGSLGTAIGQGLAVKSALEGVARNPGASGKILTTMMIGLAMVESLAIYVFVVSMIILF 74
>gi|194033269|ref|YP_002000386.1| CF0 subunit III of ATP synthase [Oedogonium cardiacum] >gi|156618966|gb|ABU88160.1| ATP synthase CF0 subunit III [Oedogonium cardiacum] >gi|186968886|gb|ACC97209.1| CF0 subunit III of ATP synthase [Oedogonium cardiacum] (83 aa)
Score = 93, Expect = 4.2e-02, Identities = 22/52 (42%), Positives = 32/52 (61%)
  Q:    24 GIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           G+GQG  A  +VE +AR PE   KIR   +LS A  E+  +Y  ++A+ L+F
  S:    25 GVGQGTVAGNAVEGIARQPEAEGKIRGTLLLSFAFMESLTIYGLVVALALLF 76
>gi|32454284|gb|AAP82941.1| putative ATP synthase c-subunit [Paralichthys olivaceus] (120 aa)
Score = 93, Expect = 4.4e-02, Identities = 24/66 (36%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A L++F
  S:    53 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAVGLFCLMVAFLILF 118
>gi|41203476|ref|NP_957736.1| ATP synthase F0 subunit 9 [Emiliania huxleyi] >gi|33114162|gb|AAP94718.1| ATP synthase F0 subunit 9 [Emiliania huxleyi] (74 aa)
Score = 93, Expect = 4.6e-02, Identities = 28/70 (40%), Positives = 42/70 (60%)
  Q:     6 QGYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           Q    IGAGL  IA+ GVG G G   +  + +VARNP ++ ++ +  IL  A TE  AL+  ++A L++F
  S:     3 QAAKLIGAGLCTIALAGVGGGIGTVFSALIISVARNPHLMKQLFAYAILGFAFTEAVALFALMMAFLILF 72
>gi|11466219|ref|NP_066542.1| ATP synthase F0 subunit 9 [Naegleria gruberi] >gi|10444254|gb|AAG17820.1|AF288092_45 ATP synthase F0 subunit 9 [Naegleria gruberi] (72 aa)
Score = 92, Expect = 4.7e-02, Identities = 27/64 (42%), Positives = 40/64 (62%)
  Q:    11 IGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLV 74
           IGAGLA IA+ GVG+G G      +++V+RNP +   + +  IL  A+TE  AL+  +I  LL+
  S:     8 IGAGLATIALSGVGVGIGIIFGNLLDSVSRNPSIAKLLFNYAILGFALTEAIALFTIMIVFLLM 71
>gi|34581013|ref|ZP_00142493.1| ATP synthase C chain [Rickettsia sibirica 246] >gi|167471133|ref|ZP_02335837.1| ATP synthase C chain [Rickettsia africae ESF-5] >gi|28262398|gb|EAA25902.1| ATP synthase C chain [Rickettsia sibirica 246] (74 aa)
Score = 92, Expect = 4.7e-02, Identities = 22/66 (33%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIG GL  I + G  +G     +  + ++ARNP     ++   ++ A +TE   L+ F+IA+LL+F
  S:     8 FIGTGLMAIGMYGAALGVSNIFSSLLSSIARNPSATENLQRMALIGAGLTEAMGLFSFVIAMLLIF 73
>gi|167768297|ref|ZP_02440350.1| hypothetical protein CLOSS21_02853 [Clostridium sp. SS2/1] >gi|167709821|gb|EDS20400.1| hypothetical protein CLOSS21_02853 [Clostridium sp. SS2/1] (72 aa)
Score = 92, Expect = 4.8e-02, Identities = 27/68 (39%), Positives = 41/68 (60%)
  Q:     7 GYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLV 74
           G A IGAG+A++  LG GIG G +   ++ A+AR PE    I    +L  A+ E  ++Y  ++AILL+
  S:     2 GLAAIGAGIAVLTGLGAGIGIGVATNGALGAIARQPEEAGNINKTLLLGCALAEATSIYGLVVAILLI 69
>gi|146221444|gb|ABQ11843.1| ATP synthase F0 subunit 9 [Sympagella nux] (80 aa)
Score = 92, Expect = 5.1e-02, Identities = 25/65 (38%), Positives = 38/65 (58%)
  Q:    11 IGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           IGAG A I + G G G G      + A ARNPE+  ++ +  IL  A++E   L+C ++A LL++
  S:    14 IGAGTATIGVAGSGAGIGTVFGNLMIAYARNPELKQQLFTYAILGFAISEAMGLFCLMMAFLLLY 78
>gi|74325193|ref|YP_316613.1| ATPase subunit 9 [Thalassiosira pseudonana] >gi|74100259|gb|AAZ99420.1| ATPase subunit 9 [Thalassiosira pseudonana] (75 aa)
Score = 92, Expect = 5.2e-02, Identities = 27/70 (38%), Positives = 40/70 (57%)
  Q:     6 QGYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           Q   F+GAGLA I + G G+G G      V  V+RNP +  ++    IL  A+TE  AL+  ++A L++F
  S:     4 QAAKFVGAGLATIGLAGAGVGIGTVFGALVIGVSRNPSLKDELFKLAILGFALTEAIALFSLMMAFLILF 73
>gi|121282040|gb|ABM53594.1| putative ATP synthase C chain [uncultured bacterium CBNPD1 BAC clone 2089] (94 aa)
Score = 92, Expect = 5.3e-02, Identities = 26/58 (44%), Positives = 35/58 (60%)
  Q:    18 IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +A +G GIG G+   K+VEA+AR PE    +R+   L  A TE  AL  F++ ILL F
  S:    36 LAAIGPGIGIGYLVGKAVEAMARQPEAAGMVRTTMFLGIAFTEALALIGFVVFILLKF 93
>gi|148266259|ref|YP_001232965.1| ATP synthase F0, C subunit [Geobacter uraniireducens Rf4] >gi|146399759|gb|ABQ28392.1| ATP synthase F0, C subunit [Geobacter uraniireducens Rf4] (91 aa)
Score = 92, Expect = 5.3e-02, Identities = 23/65 (35%), Positives = 41/65 (63%)
  Q:    11 IGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           + AG+ M +  LG GIGQG +   +VE V+RNP    KI +  ++  A+ E+ A+Y  ++ ++++F
  S:     9 LAAGIGMALGTLGTGIGQGLAVKSAVEGVSRNPGASGKILTTMMIGLAMIESLAIYALVVCLIILF 74
>gi|109018425|ref|XP_001110604.1| PREDICTED: similar to ATP synthase lipid-binding protein, mitochondrial precursor (ATP synthase proteolipid P2) (ATPase protein 9) (ATPase subunit C) [Macaca mulatta] (106 aa)
Score = 92, Expect = 5.4e-02, Identities = 23/71 (32%), Positives = 37/71 (52%)
  Q:     5 NQGYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           N+   FIGAG  ++ + G G G G      +   ARNP +  ++    IL  A+ E   L+C ++A L++F
  S:    34 NRAAKFIGAGATIVGVAGTGAGIGTVCGSLLIGYARNPSLKQQLFFYAILGFALWEALGLFCLMVAFLVLF 104
>gi|58584716|ref|YP_198289.1| F0F1 ATP synthase subunit C [Wolbachia endosymbiont strain TRS of Brugia malayi] >gi|58419032|gb|AAW71047.1| F0F1-type ATP synthase, subunit c [Wolbachia endosymbiont strain TRS of Brugia malayi] (75 aa)
Score = 92, Expect = 5.7e-02, Identities = 25/68 (36%), Positives = 40/68 (58%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVFVA 77
           FI  GL+++ ILG G+G     +  +  +ARNPE   K++    + A + E   L  F++A+LL+FVA
  S:     8 FIAIGLSVLGILGAGLGVANIFSTMLSGLARNPESEGKMKIYVYVGAGMVEFTGLLAFVLAMLLMFVA 75
>gi|78224550|ref|YP_386297.1| ATP synthase F0, C subunit [Geobacter metallireducens GS-15] >gi|78195805|gb|ABB33572.1| ATP synthase F0, C subunit [Geobacter metallireducens GS-15] (91 aa)
Score = 91, Expect = 6.1e-02, Identities = 23/65 (35%), Positives = 39/65 (60%)
  Q:    11 IGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           + AG  M I   G GIGQG +   +VE V+RNP    KI +  ++  A+ E+ A+Y  ++ ++++F
  S:     9 LAAGFGMAIGAFGTGIGQGLAVKSAVEGVSRNPGASGKILTTMMIGLAMIESLAIYVLVVCLIILF 74
>gi|193212724|ref|YP_001998677.1| alternate F1F0 ATPase, F0 subunit C [Chlorobaculum parvum NCIB 8327] >gi|193086201|gb|ACF11477.1| alternate F1F0 ATPase, F0 subunit C [Chlorobaculum parvum NCIB 8327] (93 aa)
Score = 91, Expect = 6.2e-02, Identities = 23/63 (36%), Positives = 43/63 (68%)
  Q:    13 AGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           AGL++ I ++G  +GQG + + ++ A+A+ P+  S I     +  A+ E+ A+YCF+I+I+L+F
  S:    15 AGLSIGIGVIGPALGQGRAVSSALTALAQQPDAASTITRTLFVGLAMIESIAIYCFVISIILIF 78
>gi|115529345|ref|NP_001070199.1| hypothetical protein LOC767764 [Danio rerio] >gi|115292010|gb|AAI22236.1| Zgc:153316 [Danio rerio] (128 aa)
Score = 91, Expect = 6.3e-02, Identities = 25/66 (37%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A LL+F
  S:    61 FIGAGAATVGVAGSGAGIGSVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMMAFLLLF 126
>gi|171681236|ref|XP_001905562.1| unnamed protein product [Podospora anserina] >gi|170940576|emb|CAP65804.1| unnamed protein product [Podospora anserina] (147 aa)
Score = 91, Expect = 6.4e-02, Identities = 26/64 (40%), Positives = 36/64 (56%)
  Q:    12 GAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           GAGLA I + G G+G G   A  +   ARNP + S++ S  IL  A  E   L+  ++A LL+F
  S:    82 GAGLATIGLSGAGVGIGTVFAALINGTARNPALRSQLFSYAILGFAFAEATGLFALMVAFLLLF 145
>gi|58578625|ref|YP_203345.1| ATP synthase F0 subunit 9 [Mortierella verticillata] >gi|57545558|gb|AAW51682.1| ATP synthase F0 subunit 9 [Mortierella verticillata] (73 aa)
Score = 91, Expect = 6.5e-02, Identities = 27/65 (41%), Positives = 40/65 (61%)
  Q:    11 IGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           IGAGLA I + G G+G G   A  V + ARNP + +++ S  IL  A+TE   L+  ++A LL++
  S:     8 IGAGLATIGLAGAGVGIGTVFAALVNSTARNPSIKAQLFSYTILGFALTEAIGLFALMMAFLLLY 72
>gi|12585194|sp|Q9U505|ATP9_MANSE ATP synthase lipid-binding protein, mitochondrial precursor (ATPase protein 9) (ATPase subunit c) >gi|6560655|gb|AAF16705.1|AF117583_1 ATP synthase subunit c [Manduca sexta] (131 aa)
Score = 91, Expect = 6.5e-02, Identities = 25/66 (37%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A LL+F
  S:    64 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMMAFLLLF 129
>gi|145621113|ref|ZP_01777110.1| ATP synthase F0, C subunit [Geobacter bemidjiensis Bem] >gi|191163761|ref|ZP_03025633.1| ATP synthase F0, C subunit [Geobacter sp. M21] >gi|144942578|gb|EDJ77706.1| ATP synthase F0, C subunit [Geobacter bemidjiensis Bem] >gi|190995206|gb|EDV70662.1| ATP synthase F0, C subunit [Geobacter sp. M21] >gi|197089653|gb|ACH40924.1| ATP synthase F0, C subunit [Geobacter bemidjiensis Bem] (91 aa)
Score = 91, Expect = 6.9e-02, Identities = 22/65 (33%), Positives = 40/65 (61%)
  Q:    11 IGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           + AG+ M +  LG GIGQG +   +VE  +RNP    KI +  ++  A+ E+ A+Y  ++ ++++F
  S:     9 LAAGIGMALGTLGTGIGQGLAVKSAVEGTSRNPGASGKILTTMMIGLAMIESLAIYALVVCLIILF 74
>gi|49147211|ref|YP_025804.1| ATP synthase F0 subunit 9 [Pseudendoclonium akinetum] >gi|33439226|gb|AAQ18763.1| ATP synthase F0 subunit 9 [Pseudendoclonium akinetum] (74 aa)
Score = 91, Expect = 7.0e-02, Identities = 27/65 (41%), Positives = 38/65 (58%)
  Q:    11 IGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           IGAG A IA+ G G G G      + AVARNP +  ++ S  IL  A+TE  AL+  ++  L++F
  S:     8 IGAGAATIALAGCGTGIGIVFGSLISAVARNPSLTKQLFSYSILGFALTEAIALFTLMVVFLILF 72
>gi|39995442|ref|NP_951393.1| ATP synthase F0, C subunit [Geobacter sulfurreducens PCA] >gi|39982205|gb|AAR33666.1| ATP synthase F0, C subunit [Geobacter sulfurreducens PCA] (91 aa)
Score = 91, Expect = 7.1e-02, Identities = 23/65 (35%), Positives = 39/65 (60%)
  Q:    11 IGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           + AG  M I   G GIGQG +   +VE V+RNP    KI +  ++  A+ E+ A+Y  ++ ++++F
  S:     9 LAAGFGMAIGAFGTGIGQGLAVKNAVEGVSRNPGASGKILTTMMIGLAMIESLAIYVLVVCLIILF 74
>gi|4877685|gb|AAD31412.1|AF119066_1 ATPase subunit 9 [Saccharomyces kunashirensis] (63 aa)
Score = 91, Expect = 7.1e-02, Identities = 22/62 (35%), Positives = 37/62 (59%)
  Q:    14 GLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           G+A I +LG GIG     A  +  V+RNP +  ++ S  IL  A++E   L+C +++ +L+F
  S:     1 GIATIGLLGAGIGIAIIFAALINGVSRNPSLKDQLFSYTILGMALSEATGLFCLMVSFMLMF 62
>gi|189426192|ref|YP_001953369.1| ATP synthase F0, C subunit [Geobacter lovleyi SZ] >gi|189422451|gb|ACD96849.1| ATP synthase F0, C subunit [Geobacter lovleyi SZ] (91 aa)
Score = 91, Expect = 7.2e-02, Identities = 23/65 (35%), Positives = 39/65 (60%)
  Q:    11 IGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           + AG  M I   G GIGQG +   +VE V+RNP    KI +  ++  A+ E+ A+Y  ++ ++++F
  S:     9 LAAGFGMAIGAFGTGIGQGLAVKSAVEGVSRNPGASGKILTTMMIGLAMIESLAIYVLVVCLIILF 74
>gi|15088736|ref|NP_150106.1| ATP synthase F0 subunit 9 [Hyaloraphidium curvatum] >gi|15077943|gb|AAK83428.1|AF402142_12 ATP synthase F0 subunit 9 [Hyaloraphidium curvatum] (74 aa)
Score = 91, Expect = 7.4e-02, Identities = 25/66 (37%), Positives = 41/66 (62%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
            IGAGLA IA+ G G+G G   A  +  ++RNP V  ++ +  IL  A+TE   L+  ++A++L++
  S:     7 LIGAGLATIALAGAGVGIGLIFASLISGISRNPSVRRELFNMAILGFALTEAIGLFALMMALILLY 72
>gi|4877665|gb|AAD31402.1|AF119056_1 ATPase subunit 9 [Saccharomyces exiguus] >gi|17232873|gb|AAD31409.2|AF119063_1 ATPase subunit 9 [Saccharomyces exiguus] (64 aa)
Score = 91, Expect = 7.5e-02, Identities = 22/62 (35%), Positives = 37/62 (59%)
  Q:    14 GLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           G+A I +LG GIG     A  +  V+RNP +  ++ S  IL  A++E   L+C +++ +L+F
  S:     1 GIATIGLLGAGIGIAIIFAALINGVSRNPSLKDQLFSYTILGMALSEATGLFCLMVSFMLLF 62
>gi|149174228|ref|ZP_01852855.1| H+-transporting two-sector ATPase, C subunit [Planctomyces maris DSM 8797] >gi|148846773|gb|EDL61109.1| H+-transporting two-sector ATPase, C subunit [Planctomyces maris DSM 8797] (92 aa)
Score = 91, Expect = 7.6e-02, Identities = 19/58 (32%), Positives = 38/58 (65%)
  Q:    18 IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           I  +G  +G+G + A+++ A+A+ P+  S I     +  A+ E+ A+YCF+I+++L+F
  S:    21 IGSIGPALGEGRALAQALSAIAQQPDEASTITRTLFVGLAMVESTAIYCFVISMILIF 78
>gi|167768333|ref|ZP_02440386.1| hypothetical protein CLOSS21_02889 [Clostridium sp. SS2/1] >gi|167709857|gb|EDS20436.1| hypothetical protein CLOSS21_02889 [Clostridium sp. SS2/1] (87 aa)
Score = 91, Expect = 7.7e-02, Identities = 33/75 (44%), Positives = 49/75 (65%)
  Q:     1 MNITNQGYAF----IGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           MNI+++ +      IGAGLA+IA +G G+GQG++A +   AV RNP     I S  +L  AV ET  LY  +I ++L++
  S:     1 MNISSEAFVLGCSAIGAGLALIAGIGPGVGQGYAAGQGAAAVGRNPGAKGDITSTMLLGQAVAETTGLYGLVIGLILLY 79
>gi|114328532|ref|YP_745689.1| ATP synthase C chain [Granulibacter bethesdensis CGDNIH1] >gi|114316706|gb|ABI62766.1| ATP synthase C chain [Granulibacter bethesdensis CGDNIH1] (74 aa)
Score = 90, Expect = 9.2e-02, Identities = 28/65 (43%), Positives = 43/65 (66%)
  Q:    11 IGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +GAG+++IA+ GVG+G G   A  + +VARNP    ++ S  IL  A+TE  AL+  +IA L++F
  S:     9 LGAGISVIALAGVGLGIGNIFASLIASVARNPSSRDQVFSIGILGFALTEAVALFALLIAFLILF 73
>gi|167747409|ref|ZP_02419536.1| hypothetical protein ANACAC_02129 [Anaerostipes caccae DSM 14662] >gi|167652771|gb|EDR96900.1| hypothetical protein ANACAC_02129 [Anaerostipes caccae DSM 14662] (87 aa)
Score = 90, Expect = 9.3e-02, Identities = 33/75 (44%), Positives = 49/75 (65%)
  Q:     1 MNITNQGYAF----IGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           MNI+++ +      IGAGLA+IA +G G+GQG++A +   AV RNP     I S  +L  AV ET  LY  +I ++L++
  S:     1 MNISSEAFVLGCSAIGAGLALIAGIGPGVGQGYAAGQGAAAVGRNPGAKGDIMSTMLLGQAVAETTGLYGLVIGLILLY 79
>gi|110225679|ref|YP_665684.1| ATP synthase F0 subunit 9 [Mesostigma viride] >gi|17222550|gb|AAL36723.1|AF353999_3 ATP synthase F0 subunit 9 [Mesostigma viride] (73 aa)
Score = 90, Expect = 9.4e-02, Identities = 28/71 (39%), Positives = 42/71 (59%)
  Q:     6 QGYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVFV 76
           +G   IGAG A IA+ G  +G G   +  + AVA+NP   +K+    IL  A+TE  AL+  ++A L++FV
  S:     2 EGAKLIGAGCATIALAGAAVGIGNVFSSLISAVAQNPFQANKLFGYAILGFALTEAIALFALMMAFLILFV 72
>gi|89266423|gb|ABD65503.1| ATP synthase H+ transporting mitochondrial F0 complex-like [Ictalurus punctatus] (75 aa)
Score = 90, Expect = 9.6e-02, Identities = 24/66 (36%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A L++F
  S:     8 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILF 73
>gi|150406460|ref|YP_001315109.1| ATP synthase F0 subunit 9 [Chlorokybus atmophyticus] >gi|126507697|gb|ABO15094.1| ATP synthase F0 subunit 9 [Chlorokybus atmophyticus] (73 aa)
Score = 90, Expect = 9.9e-02, Identities = 28/71 (39%), Positives = 41/71 (57%)
  Q:     6 QGYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVFV 76
           +G   IGAG A IA+ G  IG G   +  +++VA NP    K+    IL  A+TE  AL+  ++A L++FV
  S:     2 EGAKLIGAGCATIALAGAAIGIGNVFSSLIKSVADNPFQAKKLFGYAILGFALTEAIALFALMMAFLILFV 72
>gi|47230530|emb|CAF99723.1| unnamed protein product [Tetraodon nigroviridis] (89 aa)
Score = 90, Expect = 1.0e-01, Identities = 24/66 (36%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A L++F
  S:    22 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILF 87
>gi|157868914|ref|XP_001683009.1| ATPase subunit 9, putative [Leishmania major] >gi|68223892|emb|CAJ04246.1| ATPase subunit 9, putative [Leishmania major] (106 aa)
Score = 89, Expect = 1.1e-01, Identities = 25/75 (33%), Positives = 42/75 (56%)
  Q:     1 MNITNQGYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           + ++ QG  ++G GLA IA+ GVG+G G      +   AR P +   + +  IL  A+TE   L+  ++A L++F
  S:    31 VTLSVQGLHYVGTGLAAIALGGVGLGIGAIFGCLLIGCARQPNLTKMLFNYAILGFALTEAIGLFALMLAFLMLF 105
>gi|11466567|ref|NP_066457.1| ATP synthase F0 subunit 9 [Rhodomonas salina] >gi|10444154|gb|AAG17728.1|AF288090_4 ATP synthase F0 subunit 9 [Rhodomonas salina] (77 aa)
Score = 89, Expect = 1.1e-01, Identities = 27/65 (41%), Positives = 38/65 (58%)
  Q:    11 IGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           IGAGLA I + GVG G G   A  V + ARNP +  ++    IL  A+TE   L+  ++A L++F
  S:    12 IGAGLATIGLAGVGAGIGIVFAALVNSFARNPSLRQQLFGFTILGFALTEAIGLFALMMAFLILF 76
>gi|161833665|ref|YP_001597861.1| ATP synthase F0 subunit c [Candidatus Sulcia muelleri GWSS] >gi|152206155|gb|ABS30465.1| ATP synthase F0 subunit c [Candidatus Sulcia muelleri GWSS] (74 aa)
Score = 89, Expect = 1.1e-01, Identities = 28/69 (40%), Positives = 44/69 (63%)
  Q:     7 GYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           G + IGAG   IA+LG G+G G   + ++EA+AR PE  +KI++  I+SAA+ E  +L+  +  +L V 
  S:     8 GLSAIGAG---IAVLGAGLGIGKIGSSALEAIARQPEASNKIQTAMIISAALLEGASLFGIVTVLLAVL 73
>gi|21263118|ref|NP_644685.1| ATP synthase subunit 9 [Naumovia castellii] >gi|4588717|gb|AAD26191.1|AF114949_1 ATP synthase subunit 9 [Saccharomyces castellii] >gi|4588719|gb|AAD26192.1|AF114950_1 ATP synthase subunit 9 [Saccharomyces castellii] >gi|21105291|gb|AAM34594.1|AF437291_7 ATP synthase subunit 9 [Saccharomyces castellii] (77 aa)
Score = 89, Expect = 1.1e-01, Identities = 22/68 (32%), Positives = 39/68 (57%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVFVA 77
           +IGAG++   ++G GIG     A  +  V+RNP +   +    IL  A++E   L+C +I+ +L+F+ 
  S:     9 YIGAGISATGLIGAGIGIAIVFAALINGVSRNPSLRDTLFPMAILGFALSEATGLFCLMISFMLMFMG 76
>gi|115767413|ref|XP_788804.2| PREDICTED: similar to mitochondrial ATP synthase c-subunit (P3) precursor, partial [Strongylocentrotus purpuratus] >gi|115967699|ref|XP_001194359.1| PREDICTED: similar to mitochondrial ATP synthase c-subunit (P3) precursor, partial [Strongylocentrotus purpuratus] (117 aa)
Score = 89, Expect = 1.1e-01, Identities = 23/66 (34%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ +  IL  A++E   L+C ++A L++F
  S:    50 FIGAGAATVGLAGSGAGIGTVFGSLIIGYARNPSLKQQLFTYAILGFALSEAMGLFCLMMAFLILF 115
>gi|45657121|ref|YP_001207.1| ATP synthase C chain [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] >gi|45600359|gb|AAS69844.1| ATP synthase C chain [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] (108 aa)
Score = 89, Expect = 1.2e-01, Identities = 25/64 (39%), Positives = 39/64 (60%)
  Q:     7 GYAFIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIA 70
           G  +IG G+A  +AILG  +G G     + E ++R PE   KI++  I++AA+ E  AL+  +IA
  S:    13 GLGYIGVGIAAGVAILGAALGIGRIGGSATEGISRQPEAGGKIQTAMIIAAALIEGAALFALVIA 77
>gi|114798825|ref|YP_760621.1| ATP synthase F0, C subunit [Hyphomonas neptunium ATCC 15444] >gi|114738999|gb|ABI77124.1| ATP synthase F0, C subunit [Hyphomonas neptunium ATCC 15444] (78 aa)
Score = 89, Expect = 1.2e-01, Identities = 26/76 (34%), Positives = 43/76 (56%)
  Q:     2 NITNQGYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVFVA 77
           NIT+ G  ++GAGLA + ++G  +G G   A  ++A  RNP    +      +  A+ E   ++  +IAIL++FVA
  S:     4 NITD-GLKYVGAGLATLGMIGSALGVGNIFASFLDAAMRNPSAAPQQTGNLFIGMALAEALGIFSVLIAILILFVA 78
>gi|159486952|ref|XP_001701500.1| F1F0 ATP synthase subunit 9, isoform B [Chlamydomonas reinhardtii] >gi|158271561|gb|EDO97377.1| F1F0 ATP synthase subunit 9, isoform B [Chlamydomonas reinhardtii] (157 aa)
Score = 89, Expect = 1.2e-01, Identities = 23/65 (35%), Positives = 37/65 (56%)
  Q:    11 IGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +GAG A IA+ GVG G G      +   ARNP +  ++    +L  A+TE+ AL+  ++  L++F
  S:    92 VGAGCATIALAGVGAGLGVMFGSLINGAARNPNIAKQLVGYALLGFALTESIALFSLLVVFLILF 156
>gi|164421159|ref|YP_001648643.1| ATP synthase F0 subunit 9 [Hippospongia lachne] >gi|164421189|ref|YP_001648686.1| ATP synthase F0 subunit 9 [Vaceletia sp. GW948] >gi|158939001|gb|ABW83923.1| ATP synthase F0 subunit 9 [Hippospongia lachne] >gi|158939047|gb|ABW83966.1| ATP synthase F0 subunit 9 [Vaceletia sp. GW948] (77 aa)
Score = 89, Expect = 1.2e-01, Identities = 24/66 (36%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +IGAG A I + G G G G      +   ARNP +  ++ +  IL  A++E   L+C ++A LL+F
  S:    10 YIGAGAATIGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFTYAILGFAISEAMGLFCLMMAFLLLF 75
>gi|164421217|ref|YP_001648670.1| ATP synthase F0 subunit 9 [Igernella notabilis] >gi|158939029|gb|ABW83950.1| ATP synthase F0 subunit 9 [Igernella notabilis] (78 aa)
Score = 89, Expect = 1.3e-01, Identities = 24/66 (36%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A I + G G G G      +   ARNP +  ++ +  IL  A++E   L+C ++A L++F
  S:    11 FIGAGAATIGVAGSGAGIGTVFGNLIIGYARNPSLKQQLFTYAILGFAISEAMGLFCLMMAFLILF 76
>gi|165932584|ref|YP_001649373.1| F0F1 ATP synthase subunit C [Rickettsia rickettsii str. Iowa] >gi|15619060|gb|AAL02564.1| ATP synthase C chain [EC:3.6.1.34] [Rickettsia conorii str. Malish 7] >gi|165907671|gb|ABY71967.1| ATP synthase C chain [Rickettsia rickettsii str. Iowa] (78 aa)
Score = 89, Expect = 1.3e-01, Identities = 21/66 (31%), Positives = 36/66 (54%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIG GL  I + G  +G     +  + ++ARNP     ++   ++ A + E   L+ F+IA+LL+F
  S:    12 FIGTGLMAIGMYGAALGVSNIFSSLLSSIARNPSATENLQRMALIGAGLAEAMGLFSFVIAMLLIF 77
>gi|153007323|ref|YP_001381648.1| ATP synthase F0, C subunit [Anaeromyxobacter sp. Fw109-5] >gi|152030896|gb|ABS28664.1| ATP synthase F0, C subunit [Anaeromyxobacter sp. Fw109-5] (79 aa)
Score = 89, Expect = 1.3e-01, Identities = 29/75 (38%), Positives = 46/75 (61%)
  Q:     3 ITNQGYAFIGAGL-AMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVFVA 77
           +T+   AF+ AG+ A +A+LG G+G G  AA ++E  AR P V   IR+  I++AA+ E   L+  ++ +LL   A
  S:     4 MTSTALAFLSAGIGAGLAVLGAGLGIGKLAAAAMEGSARQPTVAGDIRTSMIIAAALIEGATLFAIVVTLLLAIKA 79
>gi|91206106|ref|YP_538461.1| F0F1 ATP synthase subunit C [Rickettsia bellii RML369-C] >gi|157826461|ref|YP_001495525.1| F0F1 ATP synthase subunit C [Rickettsia bellii OSU 85-389] >gi|123084547|sp|Q1RGZ2|ATPL_RICBR ATP synthase C chain (Lipid-binding protein) >gi|91069650|gb|ABE05372.1| ATP synthase C chain [Rickettsia bellii RML369-C] >gi|157801765|gb|ABV78488.1| F0F1 ATP synthase subunit C [Rickettsia bellii OSU 85-389] (74 aa)
Score = 89, Expect = 1.3e-01, Identities = 21/66 (31%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIG G   I +LG  +G     +  + ++ARNP    +++   ++ A + E   L+ F+IA+LL+F
  S:     8 FIGVGCMAIGMLGAALGVSNIFSSLLNSIARNPSATEQLQRMALIGAGLAEAMGLFSFVIAMLLIF 73
>gi|83594575|ref|YP_428327.1| H+-transporting two-sector ATPase, C subunit [Rhodospirillum rubrum ATCC 11170] >gi|114673|sp|P15014|ATPL_RHORU ATP synthase C chain (Lipid-binding protein) >gi|46372|emb|CAA31247.1| ATPase F-0-subunit c (AA 1 - 75) [Rhodospirillum rubrum] >gi|152600|gb|AAA26456.1| ATP synthase F-0 sector, c subunit >gi|83577489|gb|ABC24040.1| H+-transporting two-sector ATPase, C subunit [Rhodospirillum rubrum ATCC 11170] (75 aa)
Score = 88, Expect = 1.3e-01, Identities = 28/67 (41%), Positives = 39/67 (58%)
  Q:    11 IGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVFVA 77
           IGAGLA I ++G GIG G   A  +  V RNP   S +     +  AVTE  AL+  ++A++L+F A
  S:     9 IGAGLAAIGMIGSGIGVGNIWANLIATVGRNPAAKSTVELYGWIGFAVTEAIALFALVVALILLFAA 75
>gi|149277105|ref|ZP_01883247.1| hypothetical protein PBAL39_09456 [Pedobacter sp. BAL39] >gi|149231982|gb|EDM37359.1| hypothetical protein PBAL39_09456 [Pedobacter sp. BAL39] (71 aa)
Score = 88, Expect = 1.4e-01, Identities = 30/64 (46%), Positives = 43/64 (67%)
  Q:     9 AFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAIL 72
           A IGAGLA+I   G GIG G    K++E +AR PE  SKI++  I++AA+ E  AL+  ++A+L
  S:     6 AAIGAGLAVI---GAGIGIGQVGGKAMEGIARQPEAASKIQTAMIIAAALIEGAALFGVVVALL 66
>gi|153956284|ref|YP_001397049.1| F0F1 ATP synthase subunit C [Clostridium kluyveri DSM 555] >gi|146349142|gb|EDK35678.1| AtpE [Clostridium kluyveri DSM 555] (81 aa)
Score = 88, Expect = 1.4e-01, Identities = 20/43 (46%), Positives = 30/43 (69%)
  Q:    33 KSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           K+VE V+R PE   KI S + +SAA++E  A+Y  +IA++L F
  S:    37 KAVEGVSRQPEASGKILSMFFVSAALSEVTAIYSLLIALILAF 79
>gi|4588722|gb|AAD26193.1|AF114952_1 ATP synthase subunit 9 [Saccharomyces dairenensis] (76 aa)
Score = 88, Expect = 1.4e-01, Identities = 22/66 (33%), Positives = 38/66 (57%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +IGAG++   ++G GIG     A  +  V+RNP +   +    IL  A++E   L+C +I+ +L+F
  S:     9 YIGAGISATGLIGAGIGIAIVFAALINGVSRNPSLRDTLFPMAILGFALSEATGLFCLMISFMLLF 74
>gi|116328618|ref|YP_798338.1| C subunit of the H(+)-transporting two-sector ATPase, F0 sector [Leptospira borgpetersenii serovar Hardjo-bovis L550] >gi|116331347|ref|YP_801065.1| C subunit of the H(+)-transporting two-sector ATPase, F0 sector [Leptospira borgpetersenii serovar Hardjo-bovis JB197] >gi|116121362|gb|ABJ79405.1| C subunit of the H(+)-transporting two-sector ATPase, F0 sector [Leptospira borgpetersenii serovar Hardjo-bovis L550] >gi|116125036|gb|ABJ76307.1| C subunit of the H(+)-transporting two-sector ATPase, F0 sector [Leptospira borgpetersenii serovar Hardjo-bovis JB197] (100 aa)
Score = 88, Expect = 1.4e-01, Identities = 25/64 (39%), Positives = 39/64 (60%)
  Q:     7 GYAFIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIA 70
           G  +IG G+A  +AILG  +G G     + E ++R PE   KI++  I++AA+ E  AL+  +IA
  S:     4 GLGYIGVGIAAGVAILGAALGIGRIGGSATEGISRQPEAGGKIQTAMIIAAALIEGAALFALVIA 68
>gi|117926949|ref|YP_867566.1| ATP synthase F0, C subunit [Magnetococcus sp. MC-1] >gi|117610705|gb|ABK46160.1| ATP synthase F0, C subunit [Magnetococcus sp. MC-1] (75 aa)
Score = 88, Expect = 1.5e-01, Identities = 25/66 (37%), Positives = 39/66 (59%)
  Q:     9 AFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLV 74
           AFIG GLA   + G GIG G+   K++E++AR P   +++     + AA  E  ALY  +IA +++
  S:     7 AFIGMGLAAAGMAGSGIGLGYLFGKTIESIARQPGAEAQMTKYMWIGAAFVEAVALYGLVIAFIIM 72
>gi|4877687|gb|AAD31413.1|AF119067_1 ATPase subunit 9 [Saccharomyces martiniae] (64 aa)
Score = 88, Expect = 1.5e-01, Identities = 23/62 (37%), Positives = 36/62 (58%)
  Q:    14 GLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           G+A I +LG GIG     A  +  V+RNP +   + S  IL  A++E   L+C +I+ +L+F
  S:     1 GIATIGLLGAGIGIAVVFAALINGVSRNPSMKDTLFSYTILGMALSEATGLFCLMISFMLLF 62
>gi|146087746|ref|XP_001465892.1| ATPase subunit 9 [Leishmania infantum JPCM5] >gi|157870055|ref|XP_001683578.1| ATPase subunit 9, putative [Leishmania major] >gi|68126644|emb|CAJ04348.1| ATPase subunit 9, putative [Leishmania major] >gi|134069993|emb|CAM68323.1| ATPase subunit 9, putative [Leishmania infantum] (106 aa)
Score = 88, Expect = 1.5e-01, Identities = 25/73 (34%), Positives = 41/73 (56%)
  Q:     3 ITNQGYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           ++ QG  ++G GLA IA+ GVG+G G      +   AR P +   + +  IL  A+TE   L+  ++A L++F
  S:    33 LSVQGLHYVGTGLAAIALGGVGLGIGAIFGCLLIGCARQPNLTKMLFNYAILGFALTEAIGLFALMLAFLMLF 105
>gi|18311174|ref|NP_563108.1| F0F1 ATP synthase subunit C [Clostridium perfringens str. 13] >gi|110800530|ref|YP_696871.1| F0F1 ATP synthase subunit C [Clostridium perfringens ATCC 13124] >gi|168205571|ref|ZP_02631576.1| ATP synthase F0, C subunit [Clostridium perfringens E str. JGS1987] >gi|168210122|ref|ZP_02635747.1| ATP synthase F0, C subunit [Clostridium perfringens B str. ATCC 3626] >gi|168213704|ref|ZP_02639329.1| ATP synthase F0, C subunit [Clostridium perfringens CPE str. F4969] >gi|168215821|ref|ZP_02641446.1| ATP synthase F0, C subunit [Clostridium perfringens NCTC 8239] >gi|169344217|ref|ZP_02865199.1| ATP synthase F0, C subunit [Clostridium perfringens C str. JGS1495] >gi|182623908|ref|ZP_02951696.1| ATP synthase F0, C subunit [Clostridium perfringens D str. JGS1721] >gi|18145857|dbj|BAB81898.1| ATP synthase C chain [Clostridium perfringens str. 13] >gi|110675177|gb|ABG84164.1| ATP synthase F0, C subunit [Clostridium perfringens ATCC 13124] >gi|169297676|gb|EDS79776.1| ATP synthase F0, C subunit [Clostridium perfringens C str. JGS1495] >gi|170662873|gb|EDT15556.1| ATP synthase F0, C subunit [Clostridium perfringens E str. JGS1987] >gi|170711797|gb|EDT23979.1| ATP synthase F0, C subunit [Clostridium perfringens B str. ATCC 3626] >gi|170714805|gb|EDT26987.1| ATP synthase F0, C subunit [Clostridium perfringens CPE str. F4969] >gi|177910801|gb|EDT73155.1| ATP synthase F0, C subunit [Clostridium perfringens D str. JGS1721] >gi|182382003|gb|EDT79482.1| ATP synthase F0, C subunit [Clostridium perfringens NCTC 8239] (72 aa)
Score = 88, Expect = 1.6e-01, Identities = 29/68 (42%), Positives = 48/68 (70%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVFVA 77
            + AG+A++A +G GIG G + A ++EA AR PE   KI+S +I+ A ++E  A+Y  +++I+L+FVA
  S:     5 LLAAGIAVLAGIGAGIGIGIATAGALEATARQPEASDKIQSLFIMGAGLSEATAIYGLVVSIILLFVA 72
>gi|82702780|ref|YP_412346.1| F0F1 ATP synthase subunit C [Nitrosospira multiformis ATCC 25196] >gi|82410845|gb|ABB74954.1| ATP synthase F0, C subunit [Nitrosospira multiformis ATCC 25196] (93 aa)
Score = 88, Expect = 1.6e-01, Identities = 20/67 (29%), Positives = 44/67 (65%)
  Q:     9 AFIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           + + AGL + I ++G  +G+G + A ++ ++A+ P+V   I     +  A+ E+ A+YCF+++++L+F
  S:    11 SILTAGLTISIGVIGPALGEGKAVATALTSLAQQPDVAGTIARTLFVGLAIIESLAIYCFVVSMILIF 78
>gi|196477471|gb|ACG76999.1| AtpE, ATP synthase F0, C subunit [Phenylobacterium zucineum HLK1] (74 aa)
Score = 88, Expect = 1.6e-01, Identities = 23/66 (34%), Positives = 38/66 (57%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +IGAGLA + ++G GIG G   +  ++   RNP       +  IL AA+TE   +  F++ +L++F
  S:     8 YIGAGLATLGMIGAGIGVGTLFSGFLQGATRNPSAAGGQFTNLILGAALTEALGILAFVLGLLILF 73
>gi|62736231|ref|YP_227559.1| ATP synthase subunit 9 [Candida metapsilosis] >gi|62177743|gb|AAX73034.1| ATP synthase subunit 9 [Candida metapsilosis] >gi|170779376|gb|ACB37040.1| ATP synthase subunit 9 [Candida metapsilosis] (76 aa)
Score = 88, Expect = 1.6e-01, Identities = 23/66 (34%), Positives = 38/66 (57%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +IGAG+A + + G  IG     A  +   +RNP + S +  Q IL  A++E   L+C +I+ LL++
  S:     9 YIGAGIATLGLGGAAIGIAIVFAALINGTSRNPSLRSTLFPQAILGFALSEACGLFCLMISFLLLY 74
>gi|77556486|gb|ABA99282.1| ATP synthase subunit C family protein [Oryza sativa (japonica cultivar-group)] (354 aa)
Score = 88, Expect = 1.7e-01, Identities = 23/56 (41%), Positives = 34/56 (60%)
  Q:    23 VGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVFVAR 78
           VGIG   S+  S+ +VARNP +  ++    IL  A+TE  AL+  ++A L+ FV R
  S:   166 VGIGNVLSS--SIHSVARNPSLAKQLFGYAILGFALTEAIALFAPMMAFLISFVFR 219
>gi|159042995|ref|YP_001531789.1| F0F1 ATP synthase subunit C [Dinoroseobacter shibae DFL 12] >gi|157910755|gb|ABV92188.1| ATP synthase F0, C subunit [Dinoroseobacter shibae DFL 12] (96 aa)
Score = 87, Expect = 1.9e-01, Identities = 19/58 (32%), Positives = 39/58 (67%)
  Q:    18 IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           I  +G  +G+G +A+ ++ A+A+ P+  S +     +S A+ E+ A+YCF++A++L+F
  S:    21 IGAIGPALGEGRAASTALSAIAQQPDAASTLSRTLFVSLAMIESTAIYCFVVAMILIF 78
>gi|11466062|ref|NP_038221.1| ATPase subunit 9 [Pichia canadensis] >gi|1352022|sp|P48881|ATP9_PICCA ATP synthase protein 9, mitochondrial (Lipid-binding protein) >gi|1000985|dbj|BAA06576.1| ATPase subunit 9 [Pichia canadensis] (76 aa)
Score = 87, Expect = 1.9e-01, Identities = 23/66 (34%), Positives = 38/66 (57%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +IGA +A I +LG GIG     A  +   +RNP + + +    IL  A++E   L+C +I+ LL++
  S:     9 YIGAAIATIGLLGAGIGIAIVFAALINGTSRNPSLRNTLFPFAILGFALSEATGLFCLMISFLLLY 74
>gi|13723|emb|CAA34172.1| unnamed protein product [Triticum aestivum] (80 aa)
Score = 87, Expect = 1.9e-01, Identities = 27/73 (36%), Positives = 40/73 (54%)
  Q:     6 QGYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVFVAR 78
           +G   IGAG A I + G  +G G   +  + +VARNP +  +     IL  A+TE  AL+  ++A L+ FV R
  S:     3 EGAKSIGAGAATIVLAGAAVGIGNVLSSLIHSVARNPSLAKQSFGYAILGFALTEAIALFAPMMAFLISFVFR 75
>gi|161723852|ref|NP_359663.2| F0F1 ATP synthase subunit C [Rickettsia conorii str. Malish 7] >gi|20454820|sp|Q92JP1|ATPL_RICCN ATP synthase C chain (Lipid-binding protein) (74 aa)
Score = 87, Expect = 1.9e-01, Identities = 21/66 (31%), Positives = 36/66 (54%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIG GL  I + G  +G     +  + ++ARNP     ++   ++ A + E   L+ F+IA+LL+F
  S:     8 FIGTGLMAIGMYGAALGVSNIFSSLLSSIARNPSATENLQRMALIGAGLAEAMGLFSFVIAMLLIF 73
>gi|91215460|ref|ZP_01252431.1| ATP synthase C subunit [Psychroflexus torquis ATCC 700755] >gi|91186412|gb|EAS72784.1| ATP synthase C subunit [Psychroflexus torquis ATCC 700755] (74 aa)
Score = 87, Expect = 1.9e-01, Identities = 31/75 (41%), Positives = 46/75 (61%)
  Q:     1 MNITNQGYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           M + + G A +GAGLA   +LG GIG G     ++EA+AR PE   KI++  I++AA+ E  AL+  + A+L V 
  S:     1 MELLHVGIAALGAGLA---VLGAGIGVGKIGGSAMEAIARQPEASGKIQTAMIIAAALVEGVALFGVVTALLGVL 72
>gi|23016148|ref|ZP_00055907.1| COG0636: F0F1-type ATP synthase, subunit c/Archaeal/vacuolar-type H+-ATPase, subunit K [Magnetospirillum magnetotacticum MS-1] >gi|83313093|ref|YP_423357.1| ATP synthase C chain [Magnetospirillum magneticum AMB-1] >gi|82947934|dbj|BAE52798.1| ATP synthase C chain [Magnetospirillum magneticum AMB-1] (74 aa)
Score = 87, Expect = 1.9e-01, Identities = 26/66 (39%), Positives = 39/66 (59%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAGLA I ++G GIG G   A  +  V RNP   + +     +  AVTE  AL+  ++A++++F
  S:     8 FIGAGLAAIGMIGSGIGVGNIWANLIATVGRNPSAKANVELYGWIGFAVTEAIALFALVVALMVLF 73
>gi|110578642|ref|YP_667831.1| ATP synthase F0 subunit 9 [Verticillium dahliae] >gi|84682169|gb|ABC60428.1| ATP synthase F0 subunit 9 [Verticillium dahliae] (74 aa)
Score = 87, Expect = 2.0e-01, Identities = 26/72 (36%), Positives = 39/72 (54%)
  Q:     6 QGYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVFVA 77
           Q    IG GLA   ++G G+G G      +  VARNP +  ++ S  IL  A +E   L+  ++A LL++VA
  S:     3 QAAKIIGTGLATTGLIGAGVGIGVVFGALILGVARNPSLRGQLFSYAILGFAFSEATGLFALMMAFLLLYVA 74
>gi|56567124|gb|AAV98567.1| mitochondrial F0 complex H+-transporting ATP synthase subunit c isoform 1 [Macaca mulatta] (68 aa)
Score = 87, Expect = 2.0e-01, Identities = 24/66 (36%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C ++A L++F
  S:     1 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILF 66
>gi|189198047|ref|XP_001935361.1| ATP synthase subunit 9 [Pyrenophora tritici-repentis Pt-1C-BFP] >gi|187981309|gb|EDU47935.1| ATP synthase subunit 9 [Pyrenophora tritici-repentis Pt-1C-BFP] (133 aa)
Score = 87, Expect = 2.0e-01, Identities = 23/66 (34%), Positives = 37/66 (56%)
  Q:    12 GAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVFVA 77
           GAGLA I + G G+G G      ++ VARNP +  ++    +L  A  E   L+  +++ LL++VA
  S:    68 GAGLATIGLAGAGVGIGTVFGGLIQGVARNPSLRGQLFQYAVLGFAFAEATGLFALMMSFLLLYVA 133
>gi|12718935|ref|NP_075437.1| ATP synthetase subunit 9 [Yarrowia lipolytica] >gi|51701316|sp|Q37695|ATP9_YARLI ATP synthase protein 9, mitochondrial (Lipid-binding protein) >gi|473692|gb|AAA78262.1| ATP synthase 9 [Yarrowia lipolytica] >gi|12666830|emb|CAC28104.1| ATP9 protein [Yarrowia lipolytica] (76 aa)
Score = 87, Expect = 2.0e-01, Identities = 25/66 (37%), Positives = 40/66 (60%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +IGAGLA I ++G GIG     A  +  V+RNP +  ++ +  IL  A++E   L+  +IA LL++
  S:     9 YIGAGLASIGLVGAGIGIAIVFAALINGVSRNPALKGQLFTYSILGFALSEATGLFALMIAFLLLY 74
>gi|4588732|gb|AAD26196.1|AF114959_1 ATP synthase subunit 9 [Saccharomyces unisporus] (80 aa)
Score = 87, Expect = 2.1e-01, Identities = 23/56 (41%), Positives = 33/56 (58%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALY 65
           +IGAG+A I +LG GIG     A  +  VARNP +  ++ S  IL  A++E   L+
  S:     9 YIGAGIATIGLLGAGIGIAIVFAALINGVARNPSLKDQLFSYTILGMALSEATGLF 64
>gi|58039572|ref|YP_191536.1| ATP synthase C chain [Gluconobacter oxydans 621H] >gi|58001986|gb|AAW60880.1| ATP synthase C chain [Gluconobacter oxydans 621H] (85 aa)
Score = 87, Expect = 2.1e-01, Identities = 25/65 (38%), Positives = 40/65 (61%)
  Q:    11 IGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +GAG+A+ A+ GVG+G G   +  + +VARNP     +    +L  A+TE  AL+  +IA L++F
  S:    20 LGAGIAVFALAGVGMGLGNIFSTLISSVARNPASRPHVFGIGMLGFALTEAVALFALLIAFLILF 84
>gi|157814421|ref|YP_052723.2| ATP synthase F0 subunit 9 [Candida zemplinina] >gi|157824560|gb|AAR10344.2| ATP synthase F0 subunit 9 [Candida zemplinina] (76 aa)
Score = 87, Expect = 2.1e-01, Identities = 20/66 (30%), Positives = 38/66 (57%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           ++GAG+A I +LG G+G     A  +   ARNP + S + +  +L   + E   L+C +++ +L++
  S:     9 YMGAGMATIGLLGAGMGMAIVFAALMNGTARNPSLRSSLFTYAMLGFGLVEATGLFCLMMSFMLLY 74
>gi|169620263|ref|XP_001803543.1| hypothetical protein SNOG_13334 [Phaeosphaeria nodorum SN15] >gi|160703995|gb|EAT79218.2| hypothetical protein SNOG_13334 [Phaeosphaeria nodorum SN15] (133 aa)
Score = 87, Expect = 2.2e-01, Identities = 23/66 (34%), Positives = 37/66 (56%)
  Q:    12 GAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVFVA 77
           GAGLA I + G G+G G      ++ VARNP +  ++    +L  A  E   L+  +++ LL++VA
  S:    68 GAGLATIGLAGAGVGIGTVFGGLIQGVARNPSLRGQLFQYAVLGFAFAEATGLFALMMSFLLLYVA 133
>gi|189095566|ref|YP_001936272.1| ATP synthase F0 subunit 9 [Aphrocallistes vastus] >gi|150024084|gb|ABR58845.1| ATP synthase F0 subunit 9 [Aphrocallistes vastus] (78 aa)
Score = 87, Expect = 2.2e-01, Identities = 22/66 (33%), Positives = 37/66 (56%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
            IGAG A I + G G G G      +   ARNP++  ++ +  IL  A++E   L+C ++A L+++
  S:    11 LIGAGAATIGVAGRGAGIGTVFGNLIIGYARNPKLKQQLFTYAILGFAISEAMGLFCLMMAFLILY 76
>gi|188587439|ref|YP_001918984.1| ATP synthase F0, C subunit [Natranaerobius thermophilus JW/NM-WN-LF] >gi|179352126|gb|ACB86396.1| ATP synthase F0, C subunit [Natranaerobius thermophilus JW/NM-WN-LF] (86 aa)
Score = 87, Expect = 2.2e-01, Identities = 34/65 (52%), Positives = 44/65 (67%)
  Q:    11 IGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           IGAGLAMIA +G GIGQG++A K  E+V R P+    I    +L AAV ET  +Y  +IA+LL+F
  S:    14 IGAGLAMIAGIGAGIGQGFAAGKGAESVGRQPDAQGDIIRTMLLGAAVAETTGIYALVIALLLLF 78
>gi|49147010|ref|YP_025861.1| ATP synthase A chain subunit 9 [Moniliophthora perniciosa] >gi|34538655|gb|AAQ74263.1| ATP synthase A chain subunit 9 [Crinipellis perniciosa] (73 aa)
Score = 86, Expect = 2.3e-01, Identities = 22/66 (33%), Positives = 40/66 (60%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +IGAGLA   ++G G+G G   +  + + ARNP++  ++ +  IL  A+ E   L+  ++A LL++
  S:     7 YIGAGLACSGLIGAGVGIGVIFSSLISSTARNPQIRGQLFTYAILGFALAEATGLFALMVAFLLLY 72
>gi|157964087|ref|YP_001498911.1| F0F1 ATP synthase subunit C [Rickettsia massiliae MTU5] >gi|157843863|gb|ABV84364.1| ATP synthase C chain [Rickettsia massiliae MTU5] (78 aa)
Score = 86, Expect = 2.3e-01, Identities = 20/66 (30%), Positives = 35/66 (53%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIG G   I + G  +G     +  + ++ARNP     ++   ++ A + E   L+ F+IA+LL+F
  S:    12 FIGTGFMAIGMYGAALGVSNIFSSLLSSIARNPSATENLQRMALIGAGLAEAMGLFSFVIAMLLIF 77
>gi|46579330|ref|YP_010138.1| ATP synthase F0, C subunit [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] >gi|46448744|gb|AAS95397.1| ATP synthase F0, C subunit [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] (82 aa)
Score = 86, Expect = 2.3e-01, Identities = 21/52 (40%), Positives = 29/52 (55%)
  Q:    24 GIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           GIGQG     + E  ARNPE   KI    IL  A  E+ A+Y  ++ ++L+F
  S:    25 GIGQGMGLKAACEGTARNPEAGGKIMVTLILGLAFVESLAIYALVVNLILLF 76
>gi|152995983|ref|YP_001340818.1| F0F1 ATP synthase subunit C [Marinomonas sp. MWYL1] >gi|150836907|gb|ABR70883.1| ATP synthase F0, C subunit [Marinomonas sp. MWYL1] (93 aa)
Score = 86, Expect = 2.3e-01, Identities = 21/67 (31%), Positives = 44/67 (65%)
  Q:     9 AFIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           + I AGL + I +LG  +G+G + A ++ ++A+ P+  + I     +  A+ E+ A+YCF+++++L+F
  S:    11 SIITAGLTIAIGVLGPSLGEGKAVATALTSLAQQPDASATITRTLFVGLAMIESTAIYCFVVSMILLF 78
>gi|146085898|ref|XP_001465387.1| ATPase subunit 9 [Leishmania infantum JPCM5] >gi|134069485|emb|CAM67808.1| ATPase subunit 9, putative [Leishmania infantum] (106 aa)
Score = 86, Expect = 2.4e-01, Identities = 25/73 (34%), Positives = 41/73 (56%)
  Q:     3 ITNQGYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           ++ QG  ++G GLA IA+ GVG+G G      +   AR P +   + +  IL  A+TE   L+  ++A L++F
  S:    33 LSVQGLHYVGTGLAAIALGGVGLGIGAIFGCLLIGCARQPNLTKMLFNYAILGFALTEAIGLFALMLAFLMLF 105
>gi|159487014|ref|XP_001701531.1| F1F0 ATP synthase subunit 9, isoform A [Chlamydomonas reinhardtii] >gi|158271592|gb|EDO97408.1| F1F0 ATP synthase subunit 9, isoform A [Chlamydomonas reinhardtii] (159 aa)
Score = 86, Expect = 2.4e-01, Identities = 23/65 (35%), Positives = 37/65 (56%)
  Q:    11 IGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +GAG A IA+ GVG G G      +   ARNP +  ++    +L  A+TE+ AL+  ++  L++F
  S:    94 VGAGCATIALAGVGAGLGVMFGSLINGAARNPNIAKQLVGYALLGFALTESIALFSLLVVFLILF 158
>gi|94502419|ref|ZP_01308864.1| ATP synthase C chain [Candidatus Sulcia muelleri str. Hc (Homalodisca coagulata)] >gi|94451023|gb|EAT14003.1| ATP synthase C chain [Candidatus Sulcia muelleri str. Hc (Homalodisca coagulata)] (74 aa)
Score = 86, Expect = 2.5e-01, Identities = 27/69 (39%), Positives = 43/69 (62%)
  Q:     7 GYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           G + IGAG   IA+ G G+G G   + ++EA+AR PE  +KI++  I+SAA+ E  +L+  +  +L V 
  S:     8 GLSAIGAG---IAVWGAGLGIGKIGSSALEAIARQPEASNKIQTAMIISAALLEGASLFGIVTVLLAVL 73
>gi|32473397|ref|NP_866391.1| F0F1 ATP synthase subunit C [Rhodopirellula baltica SH 1] >gi|32398077|emb|CAD78172.1| ATP synthase c subunit [Rhodopirellula baltica SH 1] (109 aa)
Score = 86, Expect = 2.5e-01, Identities = 19/67 (28%), Positives = 41/67 (61%)
  Q:     9 AFIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           + I AGL   I  +G    +G + A+++ ++A+ P+  + I     +  A+ E+ A+YCF+++++L+F
  S:    32 SIIMAGLTTAIGSIGPAFAEGRAVAQALNSIAQQPDSSNTITRTLFVGLAMIESTAIYCFVVSMILLF 99
>gi|86160754|ref|YP_467539.1| ATP synthase F0, C subunit [Anaeromyxobacter dehalogenans 2CP-C] >gi|163765107|ref|ZP_02172140.1| ATP synthase F0, C subunit [Anaeromyxobacter sp. K] >gi|85777265|gb|ABC84102.1| ATP synthase F0, C subunit [Anaeromyxobacter dehalogenans 2CP-C] >gi|196174704|gb|ACG75677.1| ATP synthase F0, C subunit [Anaeromyxobacter sp. K] (76 aa)
Score = 86, Expect = 2.5e-01, Identities = 27/73 (36%), Positives = 44/73 (60%)
  Q:     3 ITNQGYAFIGAGL-AMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +T+   A++ AG  A +A+LG G+G G  AA ++E  AR P     IR+  I++AA+ E   L+  ++ +LL F
  S:     1 MTSAALAYLSAGFGAGLAVLGAGLGIGKLAAAAMEGSARQPTAAGDIRTSMIIAAALIEGATLFAIVVCLLLSF 74
>gi|170076619|ref|YP_001733258.1| ATP synthase c subunit [Synechococcus sp. PCC 7002] >gi|169887481|gb|ACB01189.1| ATP synthase c subunit [Synechococcus sp. PCC 7002] (91 aa)
Score = 86, Expect = 2.6e-01, Identities = 20/68 (29%), Positives = 44/68 (64%)
  Q:     9 AFIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVFV 76
           A + AG+ + I  +G  +G+G + A+++ A+A+ P+  + I     +  A+ E+ A+YC +++++L+FV
  S:    11 AMVTAGITIAIGSIGPALGEGMAVARALGAIAQQPDKANMITRTLFVGLAMVESTAIYCLVVSMILLFV 79
>gi|18640462|ref|NP_570151.1| ATP synthase protein 9 [Hypocrea jecorina] >gi|18496643|gb|AAL74176.1|AF447590_13 ATP synthase protein 9 [Hypocrea jecorina] (67 aa)
Score = 86, Expect = 2.6e-01, Identities = 26/64 (40%), Positives = 35/64 (54%)
  Q:     1 MNITNQGYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGAL 64
           M I  Q    IGAGLA + +LG G+G G      +  VARNP + +++ S  IL  A +E  AL
  S:     1 MKIMLQASKIIGAGLATVGVLGAGVGIGVVFGALILGVARNPSLKNQLFSYSILGFAFSEATAL 64
>gi|4877681|gb|AAD31410.1|AF119064_1 ATPase subunit 9 [Saccharomyces exiguus] (63 aa)
Score = 86, Expect = 2.7e-01, Identities = 21/61 (34%), Positives = 36/61 (59%)
  Q:    15 LAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +A I +LG GIG     A  +  V+RNP +  ++ S  IL  A++E   L+C +++ +L+F
  S:     1 IATIGLLGAGIGIAIIFAALINGVSRNPSLKDQLFSYTILGMALSEATGLFCLMVSFMLLF 61
>gi|157825172|ref|YP_001492892.1| F0F1 ATP synthase subunit C [Rickettsia akari str. Hartford] >gi|157799130|gb|ABV74384.1| F0F1 ATP synthase subunit C [Rickettsia akari str. Hartford] (74 aa)
Score = 86, Expect = 2.7e-01, Identities = 22/66 (33%), Positives = 36/66 (54%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIG GL  I I G  +G     +  + ++ARNP     ++   ++ A + E   L+ F+IA+LL+F
  S:     8 FIGIGLMAIGIYGAALGVSNIFSSLLSSIARNPSAAENLQRMALIGAGLAEAMGLFSFVIAMLLIF 73
>gi|158520648|ref|YP_001528518.1| ATP synthase F0, C subunit [Desulfococcus oleovorans Hxd3] >gi|158509474|gb|ABW66441.1| ATP synthase F0, C subunit [Desulfococcus oleovorans Hxd3] (96 aa)
Score = 86, Expect = 2.7e-01, Identities = 20/54 (37%), Positives = 32/54 (59%)
  Q:    24 GIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVFVA 77
           GIGQG     + E VARNPE   KI    ++  A+ E+  +Y  ++A++L+F +
  S:    28 GIGQGLGLKAAAEGVARNPEASGKITVTMLIGLAMIESLCIYALVVALILIFAS 81
>gi|115373496|ref|ZP_01460793.1| conserved domain protein [Stigmatella aurantiaca DW4/3-1] >gi|115369502|gb|EAU68440.1| conserved domain protein [Stigmatella aurantiaca DW4/3-1] (76 aa)
Score = 86, Expect = 2.8e-01, Identities = 27/71 (38%), Positives = 44/71 (61%)
  Q:     3 ITNQGYAFIGAGL-AMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILL 73
           +TN   AF+ AG+ A ++I+G G+G G  AA +++A  R P     IR+  I++AA+ E   L+  ++ ILL
  S:     1 MTNLALAFLAAGIGAGLSIIGAGLGIGKLAAAAMDATGRQPAAGGDIRTTMIIAAALIEGATLFALVVCILL 72
>gi|115304398|ref|YP_762703.1| ATP synthase subunit 9 [Ustilago maydis] >gi|121934265|sp|Q0H8W9|ATP9_USTMA ATP synthase protein 9, mitochondrial (Lipid-binding protein) >gi|72256228|gb|AAZ67018.1| ATP synthase subunit 9 [Ustilago maydis] (73 aa)
Score = 86, Expect = 2.8e-01, Identities = 21/66 (31%), Positives = 42/66 (63%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +IG+G+A + ++G GIG G   A  ++ V+RNP +  ++ +  IL  A++E   L+  +++ LL++
  S:     7 YIGSGVAALGLIGAGIGVGIVFAALIQGVSRNPSLRGQLFTYAILGFALSEATGLFALMVSFLLLY 72
>gi|4877663|gb|AAD31401.1|AF119055_1 ATPase subunit 9 [Saccharomyces dairenensis] (64 aa)
Score = 86, Expect = 2.8e-01, Identities = 22/62 (35%), Positives = 37/62 (59%)
  Q:    14 GLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           G+A I +LG GIG     +  +  V+RNP +  ++ S  IL  A++E   L+C +I+ +L+F
  S:     1 GIATIGLLGAGIGIAIVFSALINGVSRNPSLKDQLFSFAILGMALSEATGLFCLMISFILLF 62
>gi|74272627|gb|ABA01109.1| mitochondrial ATP synthase F0 subunit 9 [Chlamydomonas incerta] (159 aa)
Score = 86, Expect = 2.9e-01, Identities = 23/65 (35%), Positives = 37/65 (56%)
  Q:    11 IGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +GAG A IA+ GVG G G      +   ARNP +  ++    +L  A+TE+ AL+  ++  L++F
  S:    94 VGAGCATIALAGVGAGLGVMFGSLINGAARNPNIAKQLVGYALLGFALTESIALFSLLVVFLILF 158
>gi|146221428|gb|ABQ11828.1| ATP synthase F0 subunit 9 [Iphiteon panicea] (80 aa)
Score = 86, Expect = 2.9e-01, Identities = 23/66 (34%), Positives = 38/66 (57%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
            IGAG A + + G G G G      V A ARNP++  ++ +  IL  A++E   L+C ++A L+++
  S:    13 LIGAGAATVGVAGSGAGIGTVFGSLVIAYARNPKLKQQLFTYAILGFAISEAMGLFCLMMAFLILY 78
>gi|57234631|ref|YP_181302.1| ATP synthase F0, C subunit [Dehalococcoides ethenogenes 195] >gi|73748398|ref|YP_307637.1| ATP synthase F0, C subunit [Dehalococcoides sp. CBDB1] >gi|147669178|ref|YP_001213996.1| ATP synthase F0, C subunit [Dehalococcoides sp. BAV1] >gi|163812957|ref|ZP_02204603.1| ATP synthase F0, C subunit [Dehalococcoides sp. VS] >gi|57225079|gb|AAW40136.1| ATP synthase F0, C subunit [Dehalococcoides ethenogenes 195] >gi|73660114|emb|CAI82721.1| ATP synthase F0, C subunit [Dehalococcoides sp. CBDB1] >gi|146270126|gb|ABQ17118.1| ATP synthase F0, C subunit [Dehalococcoides sp. BAV1] >gi|157403420|gb|EDO69494.1| ATP synthase F0, C subunit [Dehalococcoides sp. VS] (76 aa)
Score = 86, Expect = 2.9e-01, Identities = 27/68 (39%), Positives = 42/68 (61%)
  Q:    10 FIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVFVA 77
            + AGLAM +  +G GIG G     +++A+ RNPE    I +  IL  A  E+ A++  +I+I+L+FVA
  S:     8 LLAAGLAMGLGAIGPGIGVGILGFGALQAIGRNPEAKGSIFTNMILLVAFAESIAIFALVISIVLIFVA 76
>gi|157827896|ref|YP_001494138.1| F0F1 ATP synthase subunit C [Rickettsia rickettsii str. 'Sheila Smith'] >gi|157800377|gb|ABV75630.1| F0F1 ATP synthase subunit C [Rickettsia rickettsii str. 'Sheila Smith'] (72 aa)
Score = 86, Expect = 3.0e-01, Identities = 21/66 (31%), Positives = 36/66 (54%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIG GL  I + G  +G     +  + ++ARNP     ++   ++ A + E   L+ F+IA+LL+F
  S:     6 FIGTGLMAIGMYGAALGVSNIFSSLLSSIARNPSATENLQRMALIGAGLAEAMGLFSFVIAMLLIF 71
>gi|78188049|ref|YP_378387.1| ATP synthase F0, C subunit [Chlorobium chlorochromatii CaD3] >gi|78170248|gb|ABB27344.1| ATP synthase F0, C subunit [Chlorobium chlorochromatii CaD3] (75 aa)
Score = 85, Expect = 3.1e-01, Identities = 25/60 (41%), Positives = 38/60 (63%)
  Q:    16 AMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           A +A++G G+G G  AA + E VAR PE  + IR+  I++AA+ E  AL+  +I +LL  
  S:    15 AGLAVIGAGLGIGNVAASAAEGVARQPEATADIRTTMIIAAALIEGVALFGEVICVLLAL 74
>gi|119358472|ref|YP_913116.1| ATP synthase F0, C subunit [Chlorobium phaeobacteroides DSM 266] >gi|119355821|gb|ABL66692.1| ATP synthase F0, C subunit [Chlorobium phaeobacteroides DSM 266] (75 aa)
Score = 85, Expect = 3.1e-01, Identities = 25/60 (41%), Positives = 38/60 (63%)
  Q:    16 AMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           A +A++G G+G G  AA + E VAR PE  + IR+  I++AA+ E  AL+  +I +LL  
  S:    15 AGLAVIGAGLGIGNVAASAAEGVARQPEATADIRTTMIIAAALIEGVALFGEVICVLLAL 74
>gi|4877669|gb|AAD31404.1|AF119058_1 ATPase subunit 9 [Saccharomyces exiguus] >gi|4877673|gb|AAD31406.1|AF119060_1 ATPase subunit 9 [Saccharomyces exiguus] (62 aa)
Score = 85, Expect = 3.2e-01, Identities = 21/60 (35%), Positives = 35/60 (58%)
  Q:    16 AMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           A I +LG GIG     A  +  V+RNP +  ++ S  IL  A++E   L+C +++ +L+F
  S:     1 ATIGLLGAGIGIAIIFAALINGVSRNPSLKDQLFSYTILGMALSEATGLFCLMVSFMLLF 60
>gi|110802254|ref|YP_699467.1| F0F1 ATP synthase subunit C [Clostridium perfringens SM101] >gi|110682755|gb|ABG86125.1| ATP synthase F0, C subunit [Clostridium perfringens SM101] (72 aa)
Score = 85, Expect = 3.2e-01, Identities = 29/67 (43%), Positives = 47/67 (70%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVFV 76
            + AG+A++A +G GIG G + A ++EA AR PE   KI+S +I+ A ++E  A+Y  +I+I+L+FV
  S:     5 LLAAGIAVLAGIGAGIGIGIATAGAIEATARQPEASDKIQSLFIMGAGLSEATAIYGLVISIILLFV 71
>gi|153811243|ref|ZP_01963911.1| hypothetical protein RUMOBE_01635 [Ruminococcus obeum ATCC 29174] >gi|149832741|gb|EDM87825.1| hypothetical protein RUMOBE_01635 [Ruminococcus obeum ATCC 29174] (74 aa)
Score = 85, Expect = 3.3e-01, Identities = 28/66 (42%), Positives = 44/66 (66%)
  Q:    11 IGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVFV 76
           IGA +A++  +G GIG G + +K+VEA+AR PE  SKI    +L  A+ E  A+Y F+I +L++ +
  S:     7 IGAAIAVLTGIGAGIGIGLATSKAVEAIARQPEAESKISKNLLLGCALAEATAIYGFVIGLLIIIM 72
>gi|11467929|ref|NP_057990.1| ATPase subunit 9 [Scenedesmus obliquus] >gi|8099194|gb|AAF72049.1|AF204057_4 ATP synthase F0 subunit 9 [Scenedesmus obliquus] >gi|7711051|emb|CAB90375.1| ATPase subunit 9 [Scenedesmus obliquus] (73 aa)
Score = 85, Expect = 3.4e-01, Identities = 23/70 (32%), Positives = 39/70 (55%)
  Q:     6 QGYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           Q    IGAG A+IA+ GVG G G      ++   RNP++  ++    +L  A+ E+ AL+  ++  L++F
  S:     3 QARKLIGAGSALIALAGVGAGIGIVFGALIQRARRNPQMAKRLMGYALLGFALCESVALFRLLVTFLILF 72
>gi|164422138|ref|YP_001648752.1| ATP synthase subunit 9 [Mycosphaerella graminicola] >gi|155964401|gb|ABU40268.1| ATP synthase subunit 9 [Mycosphaerella graminicola] (74 aa)
Score = 85, Expect = 3.4e-01, Identities = 26/72 (36%), Positives = 38/72 (52%)
  Q:     6 QGYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVFVA 77
           Q    IG GLA   ++G G+G G      +  VARNP +  ++ S  IL  A  E   L+  ++A LL++VA
  S:     3 QAAKIIGTGLATTGLIGAGVGIGVVFGALILGVARNPSLRGQLFSYAILGFAFAEATGLFALMMAFLLLYVA 74
>gi|164688903|ref|ZP_02212931.1| hypothetical protein CLOBAR_02551 [Clostridium bartlettii DSM 16795] >gi|164602107|gb|EDQ95572.1| hypothetical protein CLOBAR_02551 [Clostridium bartlettii DSM 16795] (81 aa)
Score = 85, Expect = 3.5e-01, Identities = 30/65 (46%), Positives = 43/65 (66%)
  Q:    11 IGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           IGAG+A+ + +G GIGQG++A K  EAV   PE    I S  +L AAV E+  +Y  +I+I+L+F
  S:    12 IGAGIAVCSGIGSGIGQGYAAGKGAEAVGNQPEAKGDIISTMLLGAAVAESTGIYGLVISIILLF 76
>gi|146296980|ref|YP_001180751.1| ATP synthase F0, C subunit [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145410556|gb|ABP67560.1| ATP synthase F0, C subunit [Caldicellulosiruptor saccharolyticus DSM 8903] (70 aa)
Score = 85, Expect = 3.5e-01, Identities = 32/65 (49%), Positives = 44/65 (67%)
  Q:    11 IGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           + AG+AM+A LGVGIG G + AK+ E+V R PE   +I   + + AA+ E  A+Y F+IAILLV 
  S:     4 LAAGIAMLAGLGVGIGIGIATAKAAESVGRQPEAYGRILPLFFIGAALAEAVAIYSFVIAILLVL 68
>gi|160938930|ref|ZP_02086281.1| hypothetical protein CLOBOL_03824 [Clostridium bolteae ATCC BAA-613] >gi|158437893|gb|EDP15653.1| hypothetical protein CLOBOL_03824 [Clostridium bolteae ATCC BAA-613] (74 aa)
Score = 85, Expect = 3.6e-01, Identities = 27/69 (39%), Positives = 44/69 (63%)
  Q:     7 GYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           G   +GAG+A++  +G GIG G + +K+V+A+AR PE   KI    +L  A+ E  A+Y F+I +L++ 
  S:     3 GLIALGAGVAVVTGIGAGIGIGLATSKAVDAIARQPEADGKITKALLLGCALAEATAIYGFVIGLLIIL 71
>gi|4877693|gb|AAD31416.1|AF119070_1 ATPase subunit 9 [Saccharomyces transvaalensis] (64 aa)
Score = 85, Expect = 3.6e-01, Identities = 21/64 (32%), Positives = 39/64 (60%)
  Q:    14 GLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVFVA 77
           G+A I +LG GIG     A  +  V+RNP + +++ +  IL  A++E   L+C +I+ +++F +
  S:     1 GIATIGLLGAGIGIAIVFAALITGVSRNPSMKNQLFTMAILGMALSEATGLFCLMISFMILFAS 64
>gi|160943204|ref|ZP_02090440.1| hypothetical protein FAEPRAM212_00690 [Faecalibacterium prausnitzii M21/2] >gi|158445443|gb|EDP22446.1| hypothetical protein FAEPRAM212_00690 [Faecalibacterium prausnitzii M21/2] (75 aa)
Score = 85, Expect = 3.6e-01, Identities = 26/69 (37%), Positives = 45/69 (65%)
  Q:     7 GYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           G   +GAG+A +  +G GIG G +  K+ EA++R PE   KI++  +L AA+ E  A++ F++A+L++ 
  S:     3 GLVALGAGIAALTGIGGGIGIGIATGKATEAISRQPEASGKIQTNLLLGAALAEGTAIFGFVVALLIIL 71
>gi|24215482|ref|NP_712963.1| ATP synthase F0 subunit C [Leptospira interrogans serovar Lai str. 56601] >gi|24196613|gb|AAN49981.1|AE011443_10 ATP synthase F0, C subunit [Leptospira interrogans serovar Lai str. 56601] (108 aa)
Score = 85, Expect = 3.6e-01, Identities = 24/64 (37%), Positives = 39/64 (60%)
  Q:     7 GYAFIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIA 70
           G  +IG G+A  +AILG  +G G     + E ++R PE   KI++  I++AA+ E  +L+  +IA
  S:    13 GLGYIGVGIAAGVAILGAALGIGRIGGSATEGISRQPEAGGKIQTAMIIAAALIEGVSLFALVIA 77
>gi|120603110|ref|YP_967510.1| ATP synthase F0, C subunit [Desulfovibrio vulgaris subsp. vulgaris DP4] >gi|120563339|gb|ABM29083.1| ATP synthase F0, C subunit [Desulfovibrio vulgaris subsp. vulgaris DP4] (109 aa)
Score = 84, Expect = 4.0e-01, Identities = 21/52 (40%), Positives = 29/52 (55%)
  Q:    24 GIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           GIGQG     + E  ARNPE   KI    IL  A  E+ A+Y  ++ ++L+F
  S:    52 GIGQGMGLKAACEGTARNPEAGGKIMVTLILGLAFVESLAIYALVVNLILLF 103
>gi|20091267|ref|NP_617342.1| F0F1 ATP synthase subunit C [Methanosarcina acetivorans C2A] >gi|19916389|gb|AAM05822.1| H(+)-transporting ATP synthase, subunit C [Methanosarcina acetivorans C2A] (91 aa)
Score = 84, Expect = 4.0e-01, Identities = 17/58 (29%), Positives = 38/58 (65%)
  Q:    18 IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           I +LG  IG+G + A ++ ++A+ P+  + I     +  A+ E+ ++YCF+++++L+F
  S:    24 IGVLGPAIGEGRAVATALSSLAQQPDASATITRTLFVGLAMIESLSIYCFVVSMILIF 81
>gi|28378943|ref|NP_785835.1| F0F1 ATP synthase subunit C [Lactobacillus plantarum WCFS1] >gi|28271780|emb|CAD64686.1| H(+)-transporting two-sector ATPase, C subunit [Lactobacillus plantarum WCFS1] (70 aa)
Score = 84, Expect = 4.0e-01, Identities = 22/64 (34%), Positives = 40/64 (62%)
  Q:    11 IGAGLAMI-AILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLV 74
           I AG+AM  A LG GIG G   +K +E +AR PE+  ++R+   +   + E+  +  F++A++++
  S:     4 IAAGIAMFGAALGAGIGNGLVISKMLEGMARQPELSGQLRTNMFIGVGLIESMPIISFVVALMVM 68
>gi|336896|gb|AAA31736.1| ATPase subunit 9 (74 aa)
Score = 84, Expect = 4.1e-01, Identities = 26/72 (36%), Positives = 38/72 (52%)
  Q:     6 QGYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVFVA 77
           Q    IG GLA   ++G G+G G      +  VARNP +  ++ S  IL  A  E   L+  ++A LL++VA
  S:     3 QSARIIGTGLATTGLIGAGVGIGVVFGALILGVARNPALRGQLFSYAILGFAFAEATGLFALMMAFLLLYVA 74
>gi|402604|emb|CAA52876.1| ATP synthase subunit 9 [Pichia jadinii] (76 aa)
Score = 84, Expect = 4.1e-01, Identities = 21/66 (31%), Positives = 38/66 (57%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +IGA ++ I +LG GIG     A  +   +RNP + + +    IL  A++E   L+C +++ LL++
  S:     9 YIGAAISTIGLLGAGIGIAIVFAALINGTSRNPSLRNTLFPFAILGFALSEATGLFCLMVSFLLLY 74
>gi|67458421|ref|YP_246045.1| F0F1 ATP synthase subunit C [Rickettsia felis URRWXCal2] >gi|75537107|sp|Q4UNH9|ATPL_RICFE ATP synthase C chain (Lipid-binding protein) >gi|67003954|gb|AAY60880.1| ATP synthase C chain [Rickettsia felis URRWXCal2] (74 aa)
Score = 84, Expect = 4.2e-01, Identities = 21/66 (31%), Positives = 36/66 (54%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIG GL  I + G  +G     +  + ++ARNP     ++   ++ A + E   L+ F+IA+LL+F
  S:     8 FIGIGLMAIGMYGAALGVSNIFSSLLSSIARNPSAAENLQRMALIGAGLAEAMGLFSFVIAMLLIF 73
>gi|85860963|ref|YP_463165.1| F0F1 ATP synthase subunit C [Syntrophus aciditrophicus SB] >gi|85724054|gb|ABC78997.1| F0F1-type ATP synthase, subunit c/Archaeal/vacuolar-type proton-ATPase, subunit K [Syntrophus aciditrophicus SB] (92 aa)
Score = 84, Expect = 4.3e-01, Identities = 20/67 (29%), Positives = 43/67 (64%)
  Q:     9 AFIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           + + AGL M +  +G  +G+G +  +++ A+A+ P+  + I     +  A+ E+ A+YCF+I+++L+F
  S:    11 SIVTAGLCMAVGSIGPALGEGNAVKQALTAIAQQPDERNSITRTLFVGLAMIESIAIYCFVISMILIF 78
>gi|163798524|ref|ZP_02192431.1| H+transporting two-sector ATPase C subunit [Methanococcus voltae A3] >gi|158972531|gb|EDP39999.1| H+transporting two-sector ATPase C subunit [Methanococcus voltae A3] (222 aa)
Score = 84, Expect = 4.4e-01, Identities = 30/66 (45%), Positives = 43/66 (65%)
  Q:    11 IGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVFV 76
           IGAGLA+ IA LG GIG G + A     +A +P+  SK+    I+  A+ +T  LY F++AIL++FV
  S:    12 IGAGLAVGIAGLGSGIGAGITGASGAGVLAEDPKQFSKV----IVFQALPQTQGLYGFLVAILILFV 74
>gi|47218104|emb|CAG09976.1| unnamed protein product [Tetraodon nigroviridis] (176 aa)
Score = 84, Expect = 4.6e-01, Identities = 23/63 (36%), Positives = 32/63 (50%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAIL 72
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E   L+C    IL
  S:    71 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCKTSVIL 133
>gi|157803208|ref|YP_001491757.1| F0F1 ATP synthase subunit C [Rickettsia canadensis str. McKiel] >gi|157784471|gb|ABV72972.1| F0F1 ATP synthase subunit C [Rickettsia canadensis str. McKiel] (74 aa)
Score = 84, Expect = 4.6e-01, Identities = 22/66 (33%), Positives = 36/66 (54%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIG GL  I + G  +G     +  + A+ARNP     ++   ++ A + E   L+ F+IA+LL+F
  S:     8 FIGVGLMAIGMYGAALGVSNIFSSLLNAIARNPAAAENLQRMALIGAGLAEAIGLFSFVIAMLLIF 73
>gi|15150714|ref|NP_150380.1| ATP synthase F0 subunit c [Pylaiella littoralis] >gi|21449987|ref|NP_659249.1| ATP synthase F0 subunit c [Laminaria digitata] >gi|84508552|ref|YP_448599.1| ATP synthase F0 subunit c [Fucus vesiculosus] >gi|84508592|ref|YP_448638.1| ATP synthase F0 subunit c [Desmarestia viridis] >gi|15147720|emb|CAC50821.1| ATPase subunit 9 [Pylaiella littoralis] >gi|21425312|emb|CAC87945.1| ATPase subunit 9 [Laminaria digitata] >gi|39653275|gb|AAR29294.1| ATPase subunit 9 [Fucus vesiculosus] >gi|45925624|gb|AAS79025.1| ATPase subunit 9 [Desmarestia viridis] (75 aa)
Score = 84, Expect = 4.7e-01, Identities = 26/70 (37%), Positives = 38/70 (54%)
  Q:     6 QGYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           Q    +GAGLA I + G G+G G      V   ARNP +  ++    IL  A+TE  AL+  ++A L++F
  S:     4 QAAKLLGAGLATIGLAGAGVGIGTVFGALVLGTARNPSLKDELFRIAILGFALTEAIALFALMMAFLILF 73
>gi|902019|gb|AAA70035.1| ATP synthase subunit 9 [Pythium oligandrum] >gi|902021|gb|AAA70037.1| ATP synthase subunit 9 [Pythium oligandrum] (75 aa)
Score = 84, Expect = 4.8e-01, Identities = 30/70 (42%), Positives = 42/70 (60%)
  Q:     6 QGYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           Q   FIGAGLA I + G GIG G   +  V  ++RNP +   +    IL  A+TE+ AL+C +IA L++F
  S:     4 QSAKFIGAGLATIGLAGAGIGIGSVFSSLVLGISRNPSLQQDLTRTAILGFALTESIALFCLMIAFLILF 73
>gi|78186930|ref|YP_374973.1| F0F1 ATP synthase subunit C [Pelodictyon luteolum DSM 273] >gi|78166832|gb|ABB23930.1| ATP synthase F0, C subunit [Pelodictyon luteolum DSM 273] (93 aa)
Score = 84, Expect = 4.9e-01, Identities = 18/58 (31%), Positives = 37/58 (63%)
  Q:    18 IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +  +G  +G+G + A ++EA+A+ P+  S I     +  A+ E+ A+YCF+ +++L+F
  S:    21 VGSIGPALGEGRAVASALEALAQQPDASSSITRTLFVGLAMIESVAIYCFVTSMILIF 78
>gi|71996409|ref|NP_001022966.1| Y82E9BR.3 [Caenorhabditis elegans] >gi|157773069|ref|XP_001664599.1| hypothetical protein CBG11706 [Caenorhabditis briggsae AF16] >gi|13435326|gb|AAK26152.1| Hypothetical protein Y82E9BR.3 [Caenorhabditis elegans] >gi|187030080|emb|CAP30867.1| Hypothetical protein CBG11706 [Caenorhabditis briggsae] (116 aa)
Score = 84, Expect = 4.9e-01, Identities = 22/66 (33%), Positives = 35/66 (53%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +IGAG A + + G G G G      V   ARNP +  ++ S  IL  A++E   L+C  +  +++F
  S:    49 YIGAGAATVGVAGSGAGIGNVFGALVIGYARNPSLKQQLFSYAILGFALSEAMGLFCLTMGFMILF 114
>gi|8954388|ref|NP_059377.1| ATP synthase F0 subunit 9 [Cyanidioschyzon merolae] >gi|4115801|dbj|BAA36539.1| ATP synthase protein 9 [Cyanidioschyzon merolae strain 10D] (76 aa)
Score = 83, Expect = 5.1e-01, Identities = 33/75 (44%), Positives = 43/75 (57%)
  Q:     1 MNITNQGYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           MNIT Q    IGAGLA I + GVG G G   A  V A ARNP +  ++    IL  A+TE   L+  ++A L++F
  S:     1 MNITLQSAKIIGAGLATIGLAGVGAGVGIVFAALVNAYARNPSLKQQLFGYTILGFALTEAVGLFALMMAFLILF 75
>gi|91202299|emb|CAJ75359.1| strongly similar to ATPE encoding subunit c of ATP synthase [Candidatus Kuenenia stuttgartiensis] (93 aa)
Score = 83, Expect = 5.2e-01, Identities = 16/58 (27%), Positives = 39/58 (67%)
  Q:    18 IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +  +G  +G+  +AA+++ ++A+ P+  + I     +S A+ E+ A+YCF++A++++F
  S:    21 VGSIGPALGEARAAAQALSSIAQQPDEANTITRTLFVSMAMIESTAIYCFVVAMIVIF 78
>gi|17232865|gb|AAD31403.2|AF119057_1 ATPase subunit 9 [Saccharomyces exiguus] >gi|17232867|gb|AAD31407.2|AF119061_1 ATPase subunit 9 [Saccharomyces exiguus] >gi|17232869|gb|AAD31405.2|AF119059_1 ATPase subunit 9 [Saccharomyces exiguus] >gi|17232871|gb|AAD31408.2|AF119062_1 ATPase subunit 9 [Saccharomyces exiguus] (61 aa)
Score = 83, Expect = 5.3e-01, Identities = 20/58 (34%), Positives = 34/58 (58%)
  Q:    18 IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           I +LG GIG     A  +  V+RNP +  ++ S  IL  A++E   L+C +++ +L+F
  S:     2 IGLLGAGIGIAIIFAALINGVSRNPSLKDQLFSYTILGMALSEATGLFCLMVSFMLLF 59
>gi|78357743|ref|YP_389192.1| ATP synthase F0, C subunit [Desulfovibrio desulfuricans subsp. desulfuricans str. G20] >gi|78220148|gb|ABB39497.1| ATP synthase F0, C subunit [Desulfovibrio desulfuricans G20] (101 aa)
Score = 83, Expect = 5.3e-01, Identities = 21/52 (40%), Positives = 29/52 (55%)
  Q:    24 GIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           GIGQG     + E  ARNPE   KI    IL  A  E+ A+Y  ++ ++L+F
  S:    49 GIGQGMGLKAACEGTARNPEAGGKIMVTLILGLAFVESLAIYALVVNLMLLF 100
>gi|15678977|ref|NP_276094.1| ATP synthase subunit K [Methanothermobacter thermautotrophicus str. Delta H] >gi|2622056|gb|AAB85455.1| ATP synthase, subunit K [Methanothermobacter thermautotrophicus str. Delta H] (162 aa)
Score = 83, Expect = 5.3e-01, Identities = 32/66 (48%), Positives = 47/66 (71%)
  Q:     9 AFIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLV 74
           A IGAG+A+  A LG G+GQG +AA+SV AVA N ++ ++     I+ + + ET A+Y F+IAILL+
  S:    11 AAIGAGVAVGFAGLGSGLGQGIAAAESVGAVAENSDMFAR----GIIFSTLPETQAIYGFLIAILLL 73
>gi|543870|sp|Q01554|ATP9_TRIRU ATP synthase protein 9, mitochondrial (Lipid-binding protein) >gi|13869|emb|CAA46326.1| ATPase 9 [Trichophyton rubrum] (74 aa)
Score = 83, Expect = 5.4e-01, Identities = 26/72 (36%), Positives = 38/72 (52%)
  Q:     6 QGYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVFVA 77
           Q    IG GLA   ++G G+G G      +  VARNP +   + S  IL  A +E   L+  ++A LL++VA
  S:     3 QAAKIIGTGLATTGLIGAGVGIGVVFGALILGVARNPSLRGLLFSYAILGFAFSEATGLFALMMAFLLLYVA 74
>gi|144898766|emb|CAM75630.1| ATP synthase C chain [Magnetospirillum gryphiswaldense MSR-1] (74 aa)
Score = 83, Expect = 5.5e-01, Identities = 25/66 (37%), Positives = 39/66 (59%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAGLA I ++G GIG G   +  +  V RNP   + +     +  AVTE  AL+  ++A++++F
  S:     8 FIGAGLAAIGMIGSGIGVGNIWSSLIATVGRNPAAKANVELYGWIGFAVTEAIALFALVVALMVLF 73
>gi|119502377|ref|XP_001267677.1| ATP synthase subunit ATP9, putative [Neosartorya fischeri NRRL 181] >gi|119416379|gb|EAW25780.1| ATP synthase subunit ATP9, putative [Neosartorya fischeri NRRL 181] (73 aa)
Score = 83, Expect = 5.5e-01, Identities = 25/71 (35%), Positives = 37/71 (52%)
  Q:     6 QGYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVFV 76
           Q    IG GLA   ++G G+G G      +  VARNP +  ++ S  IL  A  E   L+  ++A LL++V
  S:     3 QAAKIIGTGLATTGLIGAGVGIGVVFGALILGVARNPSLRGQLFSYAILGFAFAEATGLFALMMAFLLLYV 73
>gi|154509267|ref|ZP_02044909.1| hypothetical protein ACTODO_01792 [Actinomyces odontolyticus ATCC 17982] >gi|153798901|gb|EDN81321.1| hypothetical protein ACTODO_01792 [Actinomyces odontolyticus ATCC 17982] (69 aa)
Score = 83, Expect = 5.7e-01, Identities = 24/67 (35%), Positives = 38/67 (56%)
  Q:     7 GYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILL 73
            +A+IG GLA    LG G+G G    K+ EA AR PEV  ++ +  I+ A + E   L  F++ +++
  S:     5 AFAYIGYGLAT---LGPGLGIGLMVGKTQEATARQPEVAGRLFTNMIIGAGMVEALGLIGFVLPLIV 68
>gi|7327287|gb|AAB29031.2| ATP synthase proteolipid subunit [Physarum polycephalum] (83 aa)
Score = 83, Expect = 5.8e-01, Identities = 25/65 (38%), Positives = 35/65 (53%)
  Q:    11 IGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           IGAGLA I + G G G G      V  ++RNP    ++    +L  AVTE  AL   ++A L++F
  S:    18 IGAGLATIGLAGAGTGVGIVFGSLVFGLSRNPAEEQRLFKYAMLGFAVTEAVALLALMMAFLILF 82
>gi|77020005|ref|YP_337886.1| ATP synthase subunit 9 [Aspergillus niger] >gi|81230400|ref|YP_398777.1| ATP synthase subunit 9 [Aspergillus tubingensis] >gi|75486578|gb|ABA19207.1| ATP synthase subunit 9 [Aspergillus niger] >gi|75486806|gb|ABA19208.1| ATP synthase subunit 9 [Aspergillus tubingensis] >gi|75993225|gb|ABA33730.1| ATP synthase subunit 9 [Aspergillus niger] >gi|77157988|gb|ABA62016.1| ATP synthase subunit 9 [Aspergillus tubingensis] (74 aa)
Score = 83, Expect = 6.0e-01, Identities = 24/72 (33%), Positives = 38/72 (52%)
  Q:     6 QGYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVFVA 77
           Q    +G G+A   ++G G+G G      +  VARNP +  ++ S  IL  A  E   L+  ++A LL++VA
  S:     3 QAAKILGTGMATTGLIGAGVGIGIVFGALILGVARNPSLRGQLFSYAILGFAFAEATGLFALMMAFLLLYVA 74
>gi|84508525|ref|YP_448689.1| ATP synthase F0 subunit c [Dictyota dichotoma] >gi|45925693|gb|AAS79074.1| ATPase subunit 9 [Dictyota dichotoma] (75 aa)
Score = 83, Expect = 6.3e-01, Identities = 25/70 (35%), Positives = 38/70 (54%)
  Q:     6 QGYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           Q    +GAGLA I + G G+G G      V   +RNP +  ++    IL  A+TE  AL+  ++A L++F
  S:     4 QAAKILGAGLATIGLAGAGVGIGTVFGALVLGTSRNPSLKDELFRYAILGFALTEAIALFALMMAFLILF 73
>gi|15603901|ref|NP_220416.1| F0F1 ATP synthase subunit C [Rickettsia prowazekii str. Madrid E] >gi|6225075|sp|Q9ZEC2|ATPL_RICPR ATP synthase C chain (Lipid-binding protein) >gi|3860592|emb|CAA14493.1| ATP SYNTHASE C CHAIN (atpE) [Rickettsia prowazekii] (74 aa)
Score = 83, Expect = 6.3e-01, Identities = 21/66 (31%), Positives = 35/66 (53%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIG G   I + G  +G     +  + A+ARNP     ++   ++ A + E   L+ F+IA+LL+F
  S:     8 FIGIGFMAIGMYGAALGVSNIFSSLLSAIARNPSAAENLQRMALIGAGLAEAMGLFSFVIAMLLIF 73
>gi|78187939|ref|YP_375982.1| ATP synthase F0, C subunit [Pelodictyon luteolum DSM 273] >gi|145220543|ref|YP_001131252.1| ATP synthase F0, C subunit [Prosthecochloris vibrioformis DSM 265] >gi|78167841|gb|ABB24939.1| ATP synthase F0, C subunit [Pelodictyon luteolum DSM 273] >gi|145206707|gb|ABP37750.1| ATP synthase F0, C subunit [Prosthecochloris vibrioformis DSM 265] (75 aa)
Score = 83, Expect = 6.6e-01, Identities = 23/56 (41%), Positives = 34/56 (60%)
  Q:    20 ILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           ++G G+G G  AA + E  AR PE  S IR+  I++AA+ E  AL+  +I +LL  
  S:    19 VIGAGLGIGNIAASAAEGTARQPEATSDIRTTMIIAAALIEGVALFGEVICVLLAL 74
>gi|24298785|dbj|BAC22100.1| F-ATPase c-subunit [Thermotoga neapolitana] (85 aa)
Score = 83, Expect = 6.6e-01, Identities = 22/67 (32%), Positives = 39/67 (58%)
  Q:    10 FIGAGLAMIAILGVGIGQGWS-AAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVFV 76
           ++GAGL M            +  A +++A+AR PE+V  I ++ +L+ AV ET  +Y  +IA +++ V
  S:    17 YLGAGLCMGIGAIGPGIGEGNIGAHAMDAMARQPEMVGTITTRMLLADAVAETTGIYSLLIAFMILLV 84
>gi|116749039|ref|YP_845726.1| ATP synthase F0, C subunit [Syntrophobacter fumaroxidans MPOB] >gi|116698103|gb|ABK17291.1| ATP synthase F0, C subunit [Syntrophobacter fumaroxidans MPOB] (90 aa)
Score = 82, Expect = 6.7e-01, Identities = 17/52 (32%), Positives = 34/52 (65%)
  Q:    24 GIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           GIGQG +   +VE +ARNPE   K+    ++  A+ E+ ++Y  +++++L++
  S:    23 GIGQGMAVRGAVEGIARNPEASGKVTVTMLIGLAMIESLSIYALVVSLILIY 74
>gi|15644363|ref|NP_229415.1| F0F1 ATP synthase subunit C [Thermotoga maritima MSB8] >gi|148270306|ref|YP_001244766.1| F0F1 ATP synthase subunit C [Thermotoga petrophila RKU-1] >gi|170289067|ref|YP_001739305.1| ATP synthase F0, C subunit [Thermotoga sp. RQ2] >gi|4982187|gb|AAD36682.1|AE001805_7 ATP synthase F0, subunit c [Thermotoga maritima MSB8] >gi|147735850|gb|ABQ47190.1| ATP synthase F0, C subunit [Thermotoga petrophila RKU-1] >gi|170176570|gb|ACB09622.1| ATP synthase F0, C subunit [Thermotoga sp. RQ2] (85 aa)
Score = 82, Expect = 6.7e-01, Identities = 22/67 (32%), Positives = 39/67 (58%)
  Q:    10 FIGAGLAMIAILGVGIGQGWS-AAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVFV 76
           ++GAGL M            +  A +++A+AR PE+V  I ++ +L+ AV ET  +Y  +IA +++ V
  S:    17 YLGAGLCMGIGAIGPGIGEGNIGAHAMDAMARQPEMVGTITTRMLLADAVAETTGIYSLLIAFMILLV 84
>gi|24080112|ref|NP_705911.1| ATP synthase subunit 9 [Cryptococcus neoformans var. grubii] >gi|23630291|gb|AAN37581.1| ATP synthase subunit 9; CnAATP9p [Cryptococcus neoformans var. grubii] >gi|48526541|gb|AAT45469.1| ATP synthase subunit 9 [Cryptococcus neoformans var. neoformans] >gi|48526545|gb|AAT45472.1| ATP synthase subunit 9 [Cryptococcus neoformans var. grubii] (72 aa)
Score = 82, Expect = 6.8e-01, Identities = 24/66 (36%), Positives = 40/66 (60%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIGAGLA I + G G+G G   +  + +VARNP +  ++ +  IL  A+ E   L+  +I+ L+++
  S:     6 FIGAGLAAIGLSGAGVGIGSIFSSLIASVARNPALRGQLFTYAILGFALAEATGLFALMISFLVLY 71
>gi|83816796|ref|YP_445046.1| ATP synthase F0, C subunit [Salinibacter ruber DSM 13855] >gi|83758190|gb|ABC46303.1| ATP synthase F0, C subunit [Salinibacter ruber DSM 13855] (76 aa)
Score = 82, Expect = 7.0e-01, Identities = 24/58 (41%), Positives = 33/58 (56%)
  Q:    18 IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           I+ +G  IG G  A+ S++  AR PE    IR   I+SA + E  AL+  II +LLV 
  S:    17 ISAVGAAIGIGRLASSSMDGAARQPEAAGDIRGLMIVSAGLIEGVALFALIICLLLVL 74
>gi|170592337|ref|XP_001900925.1| ATP synthase lipid-binding protein, mitochondrial precursor, putative [Brugia malayi] >gi|158591620|gb|EDP30225.1| ATP synthase lipid-binding protein, mitochondrial precursor, putative [Brugia malayi] (113 aa)
Score = 82, Expect = 7.1e-01, Identities = 21/66 (31%), Positives = 34/66 (51%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           ++GAG A + + G G G G      V   ARNP   +++ S  IL  A++E   L+C  +   ++F
  S:    46 YVGAGAATVGVAGSGAGIGNVFGSLVIGYARNPSAKNQLFSYAILGFALSEAMGLFCLCMGFCILF 111
>gi|158340804|ref|YP_001521972.1| F0F1 ATP synthase subunit C [Acaryochloris marina MBIC11017] >gi|158311045|gb|ABW32658.1| ATP synthase C chain [Acaryochloris marina MBIC11017] (95 aa)
Score = 82, Expect = 7.1e-01, Identities = 17/58 (29%), Positives = 37/58 (63%)
  Q:    18 IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           I  +G  +G+G + ++++ A+A+ P+  + I     +  A+ E+ A+YCF+I ++L+F
  S:    21 IGSIGPALGEGRALSQALSALAQQPDEANTITRVLFVGMALVESTAIYCFVITLILIF 78
>gi|4877695|gb|AAD31417.1|AF119071_1 ATPase subunit 9 [Saccharomyces transvaalensis] (65 aa)
Score = 82, Expect = 7.3e-01, Identities = 21/65 (32%), Positives = 39/65 (60%)
  Q:    13 AGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVFVA 77
           +G+A I +LG GIG     A  +  V+RNP + +++ +  IL  A++E   L+C +I+  ++F +
  S:     1 SGIATIGLLGAGIGIAIVFAALITGVSRNPSMKNQLFTMAILGMALSEATGLFCLMISFSILFAS 65
>gi|51473317|ref|YP_067074.1| F0F1 ATP synthase subunit C [Rickettsia typhi str. Wilmington] >gi|81692323|sp|Q68XQ0|ATPL_RICTY ATP synthase C chain (Lipid-binding protein) >gi|51459629|gb|AAU03592.1| H(+)-transporting two-sector ATPase F(0) C subunit; ATP synthase.; Chloroplast ATPase.; F(0)F(1)-ATPase.; F(1)-ATPase.; H(+)-transporting ATP synthase.; H(+)-transporting ATPase.; Mitochondrial ATPase. [Rickettsia typhi str. Wilmington] (74 aa)
Score = 82, Expect = 7.4e-01, Identities = 21/66 (31%), Positives = 35/66 (53%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           FIG G   I + G  +G     +  + A+ARNP     ++   ++ A + E   L+ F+IA+LL+F
  S:     8 FIGIGFMAIGMYGAALGVSNIFSSLLSAIARNPSAAENLQRMALIGAGLAEAMGLFAFVIAMLLIF 73
>gi|126464839|ref|YP_001041815.1| F0F1 ATP synthase subunit C [Rhodobacter sphaeroides ATCC 17029] >gi|126106654|gb|ABN79179.1| ATP synthase F0, C subunit [Rhodobacter sphaeroides ATCC 17029] (83 aa)
Score = 82, Expect = 7.5e-01, Identities = 28/72 (38%), Positives = 44/72 (61%)
  Q:     4 TNQGYAFIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           T Q  + +GA  A+ I  LG  +G+G + A ++EA+AR PE    +     +  A+ ET A+YC +IA+LL+F
  S:     5 TVQIASILGAAFAVGIGSLGPALGEGRAVAAAMEAIARQPEAAGTLSRTLFVGLAMIETMAIYCLVIALLLLF 77
>gi|158263223|gb|ABW24368.1| ATP synthase F0 complex c subunit [Riftia pachyptila] (67 aa)
Score = 82, Expect = 7.6e-01, Identities = 24/65 (36%), Positives = 36/65 (55%)
  Q:    11 IGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           IGAG A + + G G G G      V   ARNP +  ++ S  IL  A++E   L+C ++A L++F
  S:     1 IGAGAATVGVAGSGAGIGSVFGSLVIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMMAFLILF 65
>gi|15187310|ref|NP_150642.1| ATP synthase F0 subunit 9 [Spizellomyces punctatus] >gi|15100095|gb|AAK84258.1|AF404304_1 ATP synthase F0 subunit 9 [Spizellomyces punctatus] (74 aa)
Score = 82, Expect = 7.8e-01, Identities = 22/66 (33%), Positives = 39/66 (59%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
            IGAGLA IA+ G  +G G   A  ++  +RNP +  ++ +  IL  A+TE   L+  ++A++ ++
  S:     7 LIGAGLATIALAGAAVGVGLIFAALIQGTSRNPSLRKELFNTAILGFALTEALGLFALMMALIFLY 72
>gi|114564217|ref|YP_751731.1| F0F1 ATP synthase subunit C [Shewanella frigidimarina NCIMB 400] >gi|114335510|gb|ABI72892.1| ATP synthase F0, C subunit [Shewanella frigidimarina NCIMB 400] (93 aa)
Score = 82, Expect = 8.0e-01, Identities = 19/67 (28%), Positives = 42/67 (62%)
  Q:     9 AFIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           + I AG  + I ++G  +G+G + A ++ ++A+ P+  + I     +  A+ E+ A+YCF++ ++L+F
  S:    11 SIITAGFTITIGVIGPSLGEGKAVATALSSLAQQPDASATITRTLFVGLAMIESTAIYCFVVTMILLF 78
>gi|153853577|ref|ZP_01994957.1| hypothetical protein DORLON_00947 [Dorea longicatena DSM 13814] >gi|149753732|gb|EDM63663.1| hypothetical protein DORLON_00947 [Dorea longicatena DSM 13814] (75 aa)
Score = 82, Expect = 8.7e-01, Identities = 26/57 (45%), Positives = 39/57 (68%)
  Q:    11 IGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCF 67
           IGAG+A++  +G G+G G + +K+V+A+AR PE   KIR+  IL  A+ E  A+Y F
  S:     8 IGAGIAVLTGIGAGVGIGIATSKAVDAIARQPEADGKIRTSLILGCALAEATAIYGF 64
>gi|74003411|ref|XP_545225.2| PREDICTED: similar to 5-hydroxytryptamine receptor 3 subunit C [Canis familiaris] (557 aa)
Score = 81, Expect = 8.8e-01, Identities = 21/56 (37%), Positives = 31/56 (55%)
  Q:    10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTET-GALY 65
           FIGAG A + + G G G G      +   ARNP +  ++ S  IL  A++E  G+L+
  S:    74 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEALGSLF 130
>gi|167458500|ref|ZP_02324702.1| ATP synthase F0, C subunit [Anaeromyxobacter dehalogenans 2CP-1] >gi|167415257|gb|EDR81989.1| ATP synthase F0, C subunit [Anaeromyxobacter dehalogenans 2CP-1] (76 aa)
Score = 81, Expect = 9.3e-01, Identities = 26/73 (35%), Positives = 43/73 (58%)
  Q:     3 ITNQGYAFIGAGL-AMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLVF 75
           +T+   A++ AG  A +A+LG G+G G  AA ++E  AR P     IR+  I++AA+ E   L+  ++ +LL  
  S:     1 MTSFALAYLSAGFGAGLAVLGAGLGIGKLAAAAMEGSARQPTAAGDIRTSMIIAAALIEGATLFAIVVCLLLAL 74
>gi|167628987|ref|YP_001679486.1| ATP synthase f0, c subunit [Heliobacterium modesticaldum Ice1] >gi|167591727|gb|ABZ83475.1| ATP synthase f0, c subunit [Heliobacterium modesticaldum Ice1] (78 aa)
Score = 81, Expect = 9.6e-01, Identities = 23/68 (33%), Positives = 39/68 (57%)
  Q:     6 QGYAFIGAGLAM-IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILL 73
           + +A +GAGLA+ +A  G  IG G   +K+VE +AR P+    +++   +S  + E   +   +IA LL
  S:     4 KAFALLGAGLAVGLAAFGASIGNGMVTSKTVEGIARQPQARGALQTTMFISVGLIEALPIITVVIAFLL 72
>gi|148272344|ref|YP_001221905.1| ATP synthase C chain (Lipid-binding protein) [Clavibacter michiganensis subsp. michiganensis NCPPB 382] >gi|147830274|emb|CAN01208.1| ATP synthase C chain (Lipid-binding protein) [Clavibacter michiganensis subsp. michiganensis NCPPB 382] (77 aa)
Score = 81, Expect = 9.8e-01, Identities = 27/60 (45%), Positives = 34/60 (56%)
  Q:     5 NQGYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGAL 64
           N   A +G GLA I   G GIG G  A K+VEA+AR PE+   +R+   L  A +E  AL
  S:    10 NGNIATVGYGLAAI---GPGIGVGIVAGKTVEAMARQPEMAGSLRTTMFLGIAFSEALAL 66
>gi|150015303|ref|YP_001307557.1| F0F1 ATP synthase subunit C [Clostridium beijerinckii NCIMB 8052] >gi|149901768|gb|ABR32601.1| ATP synthase F0, C subunit [Clostridium beijerinckii NCIMB 8052] (71 aa)
Score = 81, Expect = 1.0e+00, Identities = 26/64 (40%), Positives = 45/64 (70%)
  Q:    11 IGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFIIAILLV 74
           + AG+A+++ +G G+G G +A K+VEAV R PE   ++ + +IL AA+ ET A+Y  ++A +L+
  S:     6 LAAGIAVLSGIGAGVGIGIAAGKAVEAVGRQPEASGRVMTFFILGAALCETTAIYGLVMAFMLM 69