>gi|26553510|ref|NP_757444.1| ATP synthase subunit B [Mycoplasma penetrans HF-2] >gi|26453516|dbj|BAC43848.1| ATP synthase subunit B [Mycoplasma penetrans HF-2] (195 aa)
Score = 685, Expect = 1.5e-70, Identities = 195/195 (100%), Positives = 195/195 (100%)
  Q:     1 METINNVFDSVISLQSAIPDNSQIINQIFPNVYVLIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLTAKLESSSKEK 195
           METINNVFDSVISLQSAIPDNSQIINQIFPNVYVLIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLTAKLESSSKEK
  S:     1 METINNVFDSVISLQSAIPDNSQIINQIFPNVYVLIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLTAKLESSSKEK 195
>gi|12045265|ref|NP_073076.1| F0F1 ATP synthase subunit B [Mycoplasma genitalium G37] >gi|1352042|sp|P47643|ATPF_MYCGE ATP synthase B chain precursor >gi|3844995|gb|AAC71631.1| ATP synthase F0, B subunit [Mycoplasma genitalium G37] >gi|166078863|gb|ABY79481.1| ATP synthase F0, B subunit [synthetic Mycoplasma genitalium JCVI-1.0] (208 aa)
Score = 171, Expect = 5.8e-11, Identities = 47/166 (28%), Positives = 96/166 (57%)
  Q:    21 NSQIINQIFPNVYVLIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLTA 186
           +S +IN++FPN +V I H+++   LL L+I L WKPT+ ++  R   ++ +++ A + + ++   L  S  +  ++   + EI++ A  +A + K +IE  A  +A+ +  +   +I+K+   L+++   E  +LA+  A   + KKID++ +++ ID  + DL A
  S:    37 SSSVINELFPNFWVFITHLLAFFILLTLMIFLFWKPTQRFLNNRKNLLEAQIKQANELEKQARNLLEESNQRHEKALIVSKEIVDQANYEALQLKSEIEKTANRQANLMIFQARQEIEKERRSLKEQSIKESVELAMLAAQELILKKIDQKSDREFIDKFIRDLEA 202
>gi|188039637|ref|ZP_02998342.1| ATP synthase F0, B subunit [Ureaplasma urealyticum serovar 8] >gi|188530855|ref|ZP_03005148.1| ATP synthase F0, B subunit [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gi|188568717|ref|ZP_03005471.1| ATP synthase F0, B subunit [Ureaplasma urealyticum serovar 2] >gi|188592530|ref|ZP_03005855.1| ATP synthase F0, B subunit [Ureaplasma urealyticum serovar 10] (205 aa)
Score = 167, Expect = 2.0e-10, Identities = 49/163 (30%), Positives = 89/163 (54%)
  Q:    22 SQIINQIFPNVYVLIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           ++IIN +FPNV+V IA VI++  +  LV+ L WKPT   ++ R + I +++  AE A+ E+ + L  ++ + L ++   AEII  A+ ++   ++ +E  A   A +I S     I  +  E  +R   E  + A   A   + K++  E+N K++D  + +L
  S:    38 AEIINTLFPNVWVFIAQVIAMCVVFSLVLWLVWKPTNKMLDKRREYIAKEITDAENAKQEALQYLENAKSEHLAAQAETAEIIAKAKSESLTLRELLEKEAREAADKIISSAKISIANERRENLERLQTEAREAAYIAAEALMKKELSREDNDKLVDQFIKEL 200
>gi|83319804|ref|YP_424075.1| ATP synthase F0, B subunit [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|83283690|gb|ABC01622.1| ATP synthase F0, B subunit [Mycoplasma capricolum subsp. capricolum ATCC 27343] (181 aa)
Score = 163, Expect = 6.1e-10, Identities = 52/173 (30%), Positives = 97/173 (56%)
  Q:    12 ISLQSAIPDNSQIINQIFPNVYVLIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           I++ +      +II  +FPN+   IAH+++ I L++++ +L +KP K  IE + ++I   +  A + Q ++   +  +   L E+K  +  II  A +DAE  K KI   A  +A  I+S   + IK+++++ +      +  LA+ +A   LSK+ID+  NKK+I++ + DL
  S:     8 IAINATTQGVPKIIESLFPNLPNFIAHLLATIVLVIVLAKLVYKPYKQMIEKQRQKITEVLSDAIEKQTQANIKIKQANSLLEEAKTESVSIINTARVDAEIQKNKIIDNANLQAKNIQSYAQNSIKQEKIKAQLEIKNTIVNLAINSAEKILSKEIDKNTNKKLIEEFIKDL 180
>gi|13357692|ref|NP_077966.1| F0F1 ATP synthase subunit B [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|170762248|ref|YP_001752218.1| ATP synthase F0, B subunit [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171920294|ref|ZP_02931646.1| ATP synthase F0, B subunit [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|183508843|ref|ZP_02958291.1| ATP synthase F0, B subunit [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186701972|ref|ZP_02554407.2| ATP synthase F0, B subunit [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|11279154|pir||F82929 ATP synthase B chain UU135 [imported] - Ureaplasma urealyticum >gi|6899094|gb|AAF30541.1|AE002114_8 ATP synthase B chain [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168827825|gb|ACA33087.1| ATP synthase F0, B subunit [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171902707|gb|EDT48996.1| ATP synthase F0, B subunit [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|182675815|gb|EDT87720.1| ATP synthase F0, B subunit [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186700735|gb|EDU19017.1| ATP synthase F0, B subunit [Ureaplasma parvum serovar 6 str. ATCC 27818] (205 aa)
Score = 162, Expect = 7.5e-10, Identities = 48/163 (29%), Positives = 88/163 (53%)
  Q:    22 SQIINQIFPNVYVLIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           ++IIN +FPNV+V IA VI++  +  LV+ L WKPT   ++ R + I +++  AE A+ E+ + L  ++ + L ++    EII  A+ ++   ++ +E  A   A +I S     I  +  E  +R   E  + A   A   + K++  E+N K++D  + +L
  S:    38 AEIINTLFPNVWVFIAQVIAMCVVFSLVLWLVWKPTNKMLDKRREYIAKEITDAENAKQEALQYLENAKSEHLAAQAQTLEIIAKAKSESLTLRESLEKEAREAADKIISSAKISIANERRENLERLQSEAREAAYIAAEALMKKELSREDNDKLVDQFIKEL 200
>gi|144575258|gb|AAZ53426.2| ATP synthase subunit B [Mycoplasma hyopneumoniae 7448] (188 aa)
Score = 161, Expect = 1.0e-09, Identities = 53/168 (31%), Positives = 97/168 (57%)
  Q:    28 IFPNVYVLIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLTAKL---ESSSKEK 195
           I PNVYVL A ++S + L L +    ++P K YI+ R   +Q  ++   K+ +E+EK    S+ KLLE+K    E+ E ++++A K  +  +  A++ A Q+ +EG   + + E E++ +  + V  +A+E    +L K+  ++ NK +   ++ DL  +L   E+SSK+K
  S:    15 IIPNVYVLGATIVSFLVLFLFITYFVYRPLKKYIKKRKDFLQNHIDLTIKSNVEAEKLEKKSQQKLLETKEFCIELKEKSQIEANKFLEDAKKTAIDNARQLINEGQKVLLEYENEIKSKYYMNVINVAVEICQKYLEKQ--DKNNKILQQSLIADLEKELRKRENSSKKK 183
>gi|72080391|ref|YP_287449.1| ATP synthase subunit B [Mycoplasma hyopneumoniae 7448] (196 aa)
Score = 161, Expect = 1.0e-09, Identities = 53/168 (31%), Positives = 97/168 (57%)
  Q:    28 IFPNVYVLIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLTAKL---ESSSKEK 195
           I PNVYVL A ++S + L L +    ++P K YI+ R   +Q  ++   K+ +E+EK    S+ KLLE+K    E+ E ++++A K  +  +  A++ A Q+ +EG   + + E E++ +  + V  +A+E    +L K+  ++ NK +   ++ DL  +L   E+SSK+K
  S:    23 IIPNVYVLGATIVSFLVLFLFITYFVYRPLKKYIKKRKDFLQNHIDLTIKSNVEAEKLEKKSQQKLLETKEFCIELKEKSQIEANKFLEDAKKTAIDNARQLINEGQKVLLEYENEIKSKYYMNVINVAVEICQKYLEKQ--DKNNKILQQSLIADLEKELRKRENSSKKK 191
>gi|54020002|ref|YP_115566.1| ATP synthase subunit B [Mycoplasma hyopneumoniae 232] >gi|53987175|gb|AAV27376.1| ATP synthase B chain [Mycoplasma hyopneumoniae 232] (188 aa)
Score = 159, Expect = 1.5e-09, Identities = 52/168 (30%), Positives = 97/168 (57%)
  Q:    28 IFPNVYVLIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLTAKL---ESSSKEK 195
           I PNVYVL A ++S + L L +    ++P K YI+ R   +Q  ++   K+ +E+EK    S+ KLLE+K    ++ E ++++A K  +  +  A++ A Q+ +EG   + + E E++ +  + V  +A+E    +L K+  ++ NK +   ++ DL  +L   E+SSK+K
  S:    15 IIPNVYVLGATIVSFLILFLFITYFVYRPLKKYIKKRKDFLQSHIDLTIKSNVEAEKLEKKSQQKLLETKEFCTDLKEKSQIEANKFLEDAKKTAIDNARQLINEGQKVLLEYENEIKSKYYMNVINVAVEICQKYLEKQ--DKNNKILQQSLIADLEKELKKRENSSKKK 183
>gi|144227442|gb|AAZ44139.2| ATP synthase subunit B [Mycoplasma hyopneumoniae J] (188 aa)
Score = 158, Expect = 2.3e-09, Identities = 52/168 (30%), Positives = 97/168 (57%)
  Q:    28 IFPNVYVLIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLTAKL---ESSSKEK 195
           I PNVYVL A ++S + L L +    ++P K YI+ R   +Q  ++   K+ +E+EK    S+ KLLE+K    E+ E ++++A +  +  +  A++ A Q+ +EG   + + E E++ +  + V  +A+E    +L K+  ++ NK +   ++ DL  +L   E+SSK+K
  S:    15 IIPNVYVLGATIVSFLILFLFITYFVYRPLKKYIKKRKDFLQNHIDLTIKSNVEAEKLEKKSQQKLLETKEFCIELKEKSQIEANEFLEDAKKTAIDNARQLINEGQKVLLEYENEIKSKYYMNVINVAVEICQKYLEKQ--DKNNKILQQSLIADLEKELKKRENSSKKK 183
>gi|167924981|ref|ZP_02512072.1| ATP SYNTHASE B CHAIN [Mycoplasma mycoides subsp. mycoides LC str. GM12] (181 aa)
Score = 157, Expect = 2.3e-09, Identities = 46/162 (28%), Positives = 95/162 (58%)
  Q:    23 QIINQIFPNVYVLIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           +I+  +FPN+   IAH+++ I L++++ +L +KP K  IE + ++I   +  A + Q ++   +  +   L ++K  +  I++ A +DAE  K KI   A  +A  I+S   + IK+++++ +      +  LA+ +A   L+K+ID++ NK++I++ + DL
  S:    19 KIVESLFPNLPNFIAHLLATIILVIVLTKLVYKPYKQMIEKQRQKITEVLSDAIEKQTQANIKIKQANTLLEDAKTESVSILKTARMDAEIQKNKIIDNANLQAKNIQSYAQNSIKQEKIKAQLEIKNTIVNLAINSAEKILNKEIDKKTNKQLIEEFIKDL 180
>gi|31544506|ref|NP_853084.1| F0F1 ATP synthase subunit B [Mycoplasma gallisepticum R] >gi|31541351|gb|AAP56652.1| AtpF [Mycoplasma gallisepticum R] (235 aa)
Score = 157, Expect = 2.4e-09, Identities = 53/182 (29%), Positives = 105/182 (57%)
  Q:     3 TINNVFDSVISLQSAIPDNSQ---IINQIFPNVYVLIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           + N +  S I    +IP+  Q   I+N+ FPN +V +AH I+L  ++LL I L WKPTK ++  R++ IQ ++  A + + +++  L  ++ +   ++  A EII  A   A + K  +E  A  KA++I    +++I KQE  L++     +  +ALE     + K + +E++++++++++ +L
  S:    50 SFNFLIISAIVSSCSIPEELQAKTIVNEFFPNFWVFVAHTIALSIIILLGIFLLWKPTKRFLAKRSELIQAEINNANEIKKQAQFLLDNAKKQKQNAELQAREIINLATNQAYRLKNDLETDAKRKANRIIENAHAEIIKQESILKRELEGRIVDVALEATSTLIQKNVAKEDHERLVNELLRNL 234
>gi|42561407|ref|NP_975858.1| ATP synthase B chain [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|42492905|emb|CAE77500.1| ATP SYNTHASE B CHAIN [Mycoplasma mycoides subsp. mycoides SC str. PG1] (181 aa)
Score = 157, Expect = 2.4e-09, Identities = 46/162 (28%), Positives = 95/162 (58%)
  Q:    23 QIINQIFPNVYVLIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           +I+  +FPN+   IAH+++ I L++++ +L +KP K  IE +T++I   +  A + Q ++   +  +   L ++K  +  I++ A +DAE  K KI   A  +A  I+S   + IK+++++ +      +  LA+ +A   L+K+ID+  NK++I++ + +L
  S:    19 KIVESLFPNLPNFIAHLLATIILVIVLTKLVYKPYKQMIEKQTQKITEVLSDAIEKQTQANIKIKQANTLLEDAKTESVSILKTARIDAEIQKNKIIDNANLQAKNIQSYAQNSIKQEKIKAQLEIKNTIVNLAINSAEKILNKEIDKNTNKQLIEEFIKEL 180
>gi|71893404|ref|YP_278850.1| ATP synthase subunit B [Mycoplasma hyopneumoniae J] (196 aa)
Score = 157, Expect = 2.5e-09, Identities = 52/168 (30%), Positives = 97/168 (57%)
  Q:    28 IFPNVYVLIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLTAKL---ESSSKEK 195
           I PNVYVL A ++S + L L +    ++P K YI+ R   +Q  ++   K+ +E+EK    S+ KLLE+K    E+ E ++++A +  +  +  A++ A Q+ +EG   + + E E++ +  + V  +A+E    +L K+  ++ NK +   ++ DL  +L   E+SSK+K
  S:    23 IIPNVYVLGATIVSFLILFLFITYFVYRPLKKYIKKRKDFLQNHIDLTIKSNVEAEKLEKKSQQKLLETKEFCIELKEKSQIEANEFLEDAKKTAIDNARQLINEGQKVLLEYENEIKSKYYMNVINVAVEICQKYLEKQ--DKNNKILQQSLIADLEKELKKRENSSKKK 191
>gi|110004062|emb|CAK98401.1| putative atp synthase b chain protein [Spiroplasma citri] (176 aa)
Score = 152, Expect = 8.9e-09, Identities = 45/171 (26%), Positives = 96/171 (56%)
  Q:    14 LQSAIPDNSQIINQIFPNVYVLIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           L S   + ++IINQ+FPN++V IAHVI+ + LL+L+ +  + P +  + AR  +I+  ++ A + Q +++ +   +   L  +K  A  II  A  +AE  + ++   A  +  Q+  + + +I+K++ +        +  +A   A   L K+I++E+N+K++++ + +L
  S:     5 LMSKPIEPAEIINQLFPNLWVFIAHVIATVILLILLSKWVYNPFRKAMRARRNKIRELIQDAAEKQAKAKIDQKEASKLLTTAKVEANSIIVAARTEAEAKRHQVLETAKAEVMQLNEQAHKEIQKEKEQYYDDIRKSIINVAFNAAEKLLGKEINKEKNEKLVEEFIKEL 175
>gi|50364926|ref|YP_053351.1| ATP synthase subunit B [Mesoplasma florum L1] >gi|50363482|gb|AAT75467.1| ATP synthase subunit B [Mesoplasma florum L1] (177 aa)
Score = 148, Expect = 2.7e-08, Identities = 44/162 (27%), Positives = 90/162 (55%)
  Q:    23 QIINQIFPNVYVLIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           +II  +FPN+   IAHVI+ I L++++ +L +KP +  I+ R  +I   +  A + Q E+   +  +   L ++K  ++ II+ +++DA+  K  I + A   A  I+++    I ++  ++E      +  +A + A   L  +I++ +NKKI+D+ + +L
  S:    14 EIITSLFPNLPNFIAHVIATIVLVVILSKLMYKPFRKTIKDRRNKINELLSEAVQKQTEANIGVRKAEALLQDAKTESSLIIQTSKVDADIQKTHIISEAHKYADIIKNQAEKDIAQERSKIEAEIKTTIVNVAFDAAEQILQTEINKTKNKKIVDEFIENL 175
>gi|33860134|sp|P33256|ATPF_MYCGA ATP synthase B chain precursor (198 aa)
Score = 148, Expect = 3.3e-08, Identities = 53/182 (29%), Positives = 105/182 (57%)
  Q:     3 TINNVFDSVISLQSAIPDNSQ---IINQIFPNVYVLIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           + N +  S I    +IP+  Q   I+N+ FPN +V +AH I+L  ++LL I L WKPTK ++  R++ IQ ++  A + + +++  L  ++ +   ++  A EII  A   A + K  +E  A  KA++I    +++I KQE  L++     +  +ALE     + K + +E++++++++++ +L
  S:    13 SFNFLIISAIVSSCSIPEELQAKTIVNEFFPNFWVFVAHTIALSIIILLGIFLLWKPTKRFLAKRSELIQAEINNANEIKKQAQFLLDNAKKQKQNAELQAREIINLATNQAYRLKNDLETDAKRKANRIIENAHAEIIKQESILKRELEGRIVDVALEATSTLIQKNVAKEDHERLVNELLRNL 197
>gi|44298|emb|CAA45547.1| adenosinetriphosphatase [Mycoplasma gallisepticum] (198 aa)
Score = 145, Expect = 6.6e-08, Identities = 53/182 (29%), Positives = 105/182 (57%)
  Q:     3 TINNVFDSVISLQSAIPDNSQ---IINQIFPNVYVLIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           + N +  S I    +IP+  Q   I+N+ FPN +V +AH I+L  ++LL I L WKPTK ++  R++ IQ ++  A + + +++  L  ++ +   ++  A EII  A   A + K  +E  A  KA++I    +++I KQE  L++     +  +ALE     + K + +E++++++++++ +L
  S:    13 SFNFLIISAIVSSCSIPEELQAKTIVNEFFPNFWVFVAHTIALSIIILLGIFLLWKPTKRFLAKRSELIQAEINNANEIKKQAQLLLDNAKKQKQNAELQAREIINLATNQAYRLKNDLETDAKLKANRIIENAHAEIIKQESILKRELEGRIVDVALEATSTLIKKNVAKEDHERLVNELLRNL 197
>gi|15828741|ref|NP_326101.1| ATP synthase B chain [Mycoplasma pulmonis UAB CTIP] >gi|14089683|emb|CAC13443.1| ATP SYNTHASE B CHAIN [Mycoplasma pulmonis] (180 aa)
Score = 145, Expect = 6.6e-08, Identities = 49/157 (31%), Positives = 86/157 (54%)
  Q:    27 QIFPNVYVLIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVND 183
           ++FP++ +++A + +L+  +  +    +KP +  I+ R + IQ  ++AA K + +S +NL  S  KL E++  A+EII +++ DAE      +  A  K+ +I  +   +IK++E E  +    E+   A   A   L K+ID    KKIIDDI  D
  S:    21 RLFPSIPLMLATLAALVISIFFLTYFFYKPIRKNIKKRKQYIQDNIDAANKLKQQSLENLEESNKKLNEAREQASEIINSSKRDAELIVINYKMSAQKKSEEILKKAQLEIKRKEEEFLRTSREEIIDAATIIAKKILIKEIDSNYEKKIIDDISFD 177
>gi|119358471|ref|YP_913115.1| ATP synthase F0, B subunit [Chlorobium phaeobacteroides DSM 266] >gi|119355820|gb|ABL66691.1| ATP synthase F0, B subunit [Chlorobium phaeobacteroides DSM 266] (175 aa)
Score = 142, Expect = 1.6e-07, Identities = 51/158 (32%), Positives = 90/158 (56%)
  Q:    30 PNVYVLIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNL-----EVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLTAK 187
           PN  ++    +S + +LL++ +LAW P  S +E R K IQ  ++ A KA+ E+E+ L  +R  L ++   + +II   +   EK +  I   A  +A+++ S     + K+E+E EKR+ L     EV++LA+  A   +   +D +  KKI+D ++ DL+ K
  S:    16 PNPGLIFWTTVSFVIVLLILRKLAWGPIISALEEREKGIQSSIDRAHKAKDEAEEILRKNRELLAKADAESDKIIREGKEYGEKLRAGIAEKAQAEAAKMIS-----MAKEEIEQEKRRALDVLRNEVAELAVMGAEKIIKTSLDADMQKKIVDSMIQDLSTK 173
>gi|193213684|ref|YP_001999637.1| ATP synthase F0, B subunit [Chlorobaculum parvum NCIB 8327] >gi|193087161|gb|ACF12437.1| ATP synthase F0, B subunit [Chlorobaculum parvum NCIB 8327] (175 aa)
Score = 139, Expect = 3.1e-07, Identities = 44/158 (27%), Positives = 91/158 (57%)
  Q:    30 PNVYVLIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNL-----EVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLTAK 187
           PN  ++    ++ + +L+++ ++AW P  S +E R K IQ  ++ A  A+ E+E  L  ++  L ++   A +II   +  A+K + +     L + +Q+ES+      K+E+E EKR+ L     EV+ +A++ A   +   +D ++ K +++D++N++ AK
  S:    16 PNPGLIFWTAVTFVIVLVILKKIAWGPIVSMLEEREKGIQSAIDRAHTAKEEAESILKKNKEMLAKADAEADKIIREGKEYADKVRSE-----LTEKAQVESQKMIAAAKEEIEQEKRRALDVLRNEVADMAVKGAEKIIRTTLDADKQKAVVNDMINEMAAK 173
>gi|118586240|ref|ZP_01543700.1| ATP synthase, b subunit [Oenococcus oeni ATCC BAA-1163] >gi|118433324|gb|EAV40030.1| ATP synthase, b subunit [Oenococcus oeni ATCC BAA-1163] (179 aa)
Score = 138, Expect = 4.4e-07, Identities = 40/154 (25%), Positives = 85/154 (55%)
  Q:    39 VISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLTAKLESSS 192
           +++ I L+ ++ +LAW P    ++AR  +I   +++A K++ E++K   ++   L ES++ A  ++ENA   +E+  KKI  +A   A  I  +     ++ + +       E++ L++  A   + K+I   ++K +IDD +++L  + E+SS
  S:    21 LLTFILLMFILKKLAWGPITKIMDARANQINDDLDSAAKSKNEAKKLQTVADTNLKESQSQATALMENARKSSEEQSKKIVDLAQAHADSINRQAQIDARQIKDDALDSAKDEIADLSVSIASRIIGKEITASKHKALIDDFISELEKQQENSS 174
>gi|49484331|ref|YP_041555.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus MRSA252] >gi|81650653|sp|Q6GEW8|ATPF_STAAR ATP synthase B chain >gi|49242460|emb|CAG41176.1| putative ATP synthase subunit b [Staphylococcus aureus subsp. aureus MRSA252] (173 aa)
Score = 137, Expect = 5.0e-07, Identities = 42/149 (28%), Positives = 86/149 (57%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVND 183
           +I  V++ I LL L+ + AW P K  ++ R ++I R ++ AE+A+L ++K    ++ KL E++    +I+E+A++ A + +++I   A  +A+ +     S+I  Q+       N +VS+L++  A   L K+I E++ K ++D  + +
  S:    21 VIVQVLTFIVLLALLKKFAWGPLKDVMDKRERDINRDIDDAEQAKLNAQKLEEENKQKLKETQEEVQKILEDAKVQARQQQEQIIHEANVRANGMIETAQSEINSQKERAIADINNQVSELSVLIASKVLRKEISEQDQKALVDKYLKE 169
>gi|116493069|ref|YP_804804.1| F0F1-type ATP synthase, subunit b [Pediococcus pentosaceus ATCC 25745] >gi|116103219|gb|ABJ68362.1| F0F1-type ATP synthase, subunit b [Pediococcus pentosaceus ATCC 25745] (173 aa)
Score = 137, Expect = 5.4e-07, Identities = 38/150 (25%), Positives = 77/150 (51%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           ++ + I  I L+ L+ + AW P  + ++ R   I   +++AE++++E+EK     +  L  S   A  II NA+    K ++ I   A N+A  ++ +    I+++  +  K    +++ L++E A   + K++DE   K +ID  +  L
  S:    20 MLFYAILFIVLMALIAKFAWGPVNAMLKERADRISNDIDSAEQSRIEAEKLAKQRKEALDNSHAEATSIINNAKDSGAKERELIIGNAQNEAKSLKDKAKQDIEQERADALKSAQDDIASLSIEIASKVIKKELDENSQKDLIDSYIEGL 169
>gi|35436127|gb|AAO45680.1| AtpB [Streptococcus mitis] (164 aa)
Score = 137, Expect = 5.5e-07, Identities = 45/144 (31%), Positives = 78/144 (54%)
  Q:    41 SLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           S I LL+LV + AW    S  E R ++I   ++ AE+A+ ++E        +L  S+  A  IIENA+  AEK+K  I A A  +A +++ +   +I + + E  +    EV+ L +  AG  +S+ +D   +K++ID  ++ L
  S:    18 SFILLLVLVKKYAWSNLTSIFEQRAEKIAADIDGAEQARQKAEVLAQKREDELAGSRKEAKTIIENAKETAEKSKASILADAKLEAGRLKEKANQEIAQNKAEALQSVKGEVADLTISLAGKIISQNLDGHAHKELIDQYIDQL 161
>gi|15925097|ref|NP_372631.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus Mu50] >gi|15927681|ref|NP_375214.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus N315] >gi|21283760|ref|NP_646848.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus MW2] >gi|49486900|ref|YP_044121.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus MSSA476] >gi|57652129|ref|YP_186914.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus COL] >gi|82751708|ref|YP_417449.1| F0F1 ATP synthase subunit B [Staphylococcus aureus RF122] >gi|87162300|ref|YP_494708.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus USA300] >gi|88196011|ref|YP_500824.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|148268558|ref|YP_001247501.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus JH9] >gi|150394622|ref|YP_001317297.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus JH1] >gi|151222223|ref|YP_001333045.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus str. Newman] >gi|156980422|ref|YP_001442681.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus Mu3] >gi|161510314|ref|YP_001575973.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|168728867|ref|ZP_02761144.1| putative ATP synthase subunit b [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|81648901|sp|Q6G7K3|ATPF_STAAS ATP synthase B chain >gi|81694059|sp|Q5HE93|ATPF_STAAC ATP synthase B chain >gi|81704255|sp|Q7A0C4|ATPF_STAAW ATP synthase B chain >gi|81705321|sp|Q7A4E7|ATPF_STAAN ATP synthase B chain >gi|81781174|sp|Q99SF1|ATPF_STAAM ATP synthase B chain >gi|13701901|dbj|BAB43193.1| ATP synthase B chain [Staphylococcus aureus subsp. aureus N315] >gi|14247880|dbj|BAB58269.1| ATP synthase B chain [Staphylococcus aureus subsp. aureus Mu50] >gi|21205202|dbj|BAB95896.1| ATP synthase B chain [Staphylococcus aureus subsp. aureus MW2] >gi|49245343|emb|CAG43818.1| putative ATP synthase subunit b [Staphylococcus aureus subsp. aureus MSSA476] >gi|57286315|gb|AAW38409.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus COL] >gi|82657239|emb|CAI81680.1| ATP synthase B chain [Staphylococcus aureus RF122] >gi|87128274|gb|ABD22788.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|87203569|gb|ABD31379.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|147741627|gb|ABQ49925.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus JH9] >gi|149947074|gb|ABR53010.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus JH1] >gi|150375023|dbj|BAF68283.1| ATP synthase subunit b [Staphylococcus aureus subsp. aureus str. Newman] >gi|156722557|dbj|BAF78974.1| ATP synthase B chain [Staphylococcus aureus subsp. aureus Mu3] >gi|160369123|gb|ABX30094.1| F-ATPase superfamily proton( H+)- or sodium (Na+)-translocating F-type ATPase epsilon subunit subunit B [Staphylococcus aureus subsp. aureus USA300_TCH1516] (173 aa)
Score = 137, Expect = 6.1e-07, Identities = 42/149 (28%), Positives = 86/149 (57%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVND 183
           +I  V++ I LL L+ + AW P K  ++ R ++I R ++ AE+A+L ++K    ++ KL E++    +I+E+A++ A + +++I   A  +A+ +     S+I  Q+       N +VS+L++  A   L K+I E++ K ++D  + +
  S:    21 VIVQVLTFIVLLALLKKFAWGPLKDVMDKRERDINRDIDDAEQAKLNAQKLEEENKQKLKETQEEVQKILEDAKVQARQQQEQIIHEANVRANGMIETAQSEINSQKERAIADINNQVSELSVLIASKVLRKEISEQDQKALVDKYLKE 169
>gi|116490719|ref|YP_810263.1| F0F1-type ATP synthase, subunit b [Oenococcus oeni PSU-1] >gi|116091444|gb|ABJ56598.1| F0F1-type ATP synthase, subunit b [Oenococcus oeni PSU-1] (176 aa)
Score = 136, Expect = 7.7e-07, Identities = 39/153 (25%), Positives = 84/153 (54%)
  Q:    39 VISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLTAKLESS 191
           +++ I L+ ++ +LAW P    ++AR  +I   +++A K++ E++K   ++   L ES++ A  ++ENA   +E+  KKI  +A   A  I  +     ++ + +       E++ L++  A   + K+I   ++K +IDD +++L  + E+S
  S:    18 LLTFILLMFILKKLAWGPITKIMDARANQINDDLDSAAKSKNEAKKLQTVADTNLKESQSQATALMENARKSSEEQSKKIVDLAQAHADSINRQAQIDARQIKDDALDSAKDEIADLSVSIASRIIGKEITASKHKALIDDFISELEKQQENS 170
>gi|167627182|ref|YP_001677682.1| F0F1 ATP synthase subunit B [Francisella philomiragia subsp. philomiragia ATCC 25017] >gi|167597183|gb|ABZ87181.1| ATP synthase, F0 sector, subunit B [Francisella philomiragia subsp. philomiragia ATCC 25017] (156 aa)
Score = 135, Expect = 9.0e-07, Identities = 41/147 (27%), Positives = 80/147 (54%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIV 181
           LI  +I+    +   ++  W P +  ++ R ++I   + +A++A  E E     S   L E+K  A EI+ENA + A K  ++ +  A+  A +I+S   ++I++++++ ++    EV  LA+  A   +S  +DE+ +KKI+ D V
  S:     7 LIGQMITFAIFVGFTMKFVWPPLRKALDERREKIAEGLASADRASRELEVAKRQSAEILREAKAKATEIVENAYVRAHKVDEQAKEEAIAAADKIKSMAMAEIEQEKVKAKEELKHEVVSLAMAAASKIISANVDEQSSKKILKDFV 153
>gi|189347958|ref|YP_001944487.1| ATP synthase F0, B subunit [Chlorobium limicola DSM 245] >gi|189342105|gb|ACD91508.1| ATP synthase F0, B subunit [Chlorobium limicola DSM 245] (175 aa)
Score = 135, Expect = 9.0e-07, Identities = 47/158 (29%), Positives = 85/158 (53%)
  Q:    30 PNVYVLIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNL-----EVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLTAK 187
           PN  ++    ++ + +LL++ +LAW P  S +E R K IQ  ++ A  A+ E+E  L  +R  L ++   +  II   +   EK +++     + + +Q E++      K E+E EKR+ L     EV+ LA+  A   +   +D +  KKI+D ++ DL +K
  S:    16 PNPGLIFWTAVTFVIVLLILKQLAWGPIISALEEREKGIQSSIDRAYSAKDEAEAILRKNRDMLAKADLESERIIREGKEYGEKLRQE-----MAEKAQFEAKKMIASAKDEIEQEKRRALDVLRNEVADLAIMGAEKIIKSSLDADTQKKIVDSMIRDLASK 173
>gi|138896939|ref|YP_001127392.1| F0F1 ATP synthase subunit B [Geobacillus thermodenitrificans NG80-2] >gi|134268452|gb|ABO68647.1| ATPase subunit b [Geobacillus thermodenitrificans NG80-2] (207 aa)
Score = 135, Expect = 1.1e-06, Identities = 40/150 (26%), Positives = 86/150 (57%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           +I  +++ I L+LL+ + AW P    ++ R + I  +++ AEK + E+EK L   R  L +S+  A  I+ENA   AE+ K++I A A  +A +++     +I++++ +       +V+ L++  A   + +++ E++ +K+I+  + D+
  S:    51 IIFQLVAFILLMLLLRKFAWGPLMGVMKQREEHIANEIDQAEKRRQEAEKLLEEQRELLKQSRQEAQTILENARKLAEEQKEQIVASARAEAERVKEAAKQEIEREKEQAMAALREQVASLSVLIASKVIERELTEQDQRKLIEAYIKDI 200
>gi|194337849|ref|YP_002019643.1| ATP synthase F0, B subunit [Pelodictyon phaeoclathratiforme BU-1] >gi|194310326|gb|ACF45026.1| ATP synthase F0, B subunit [Pelodictyon phaeoclathratiforme BU-1] (175 aa)
Score = 134, Expect = 1.1e-06, Identities = 48/158 (30%), Positives = 85/158 (53%)
  Q:    30 PNVYVLIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNL-----EVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLTAK 187
           PN  ++    I+ + +LL++ ++AW P    +E R K IQ  ++ A  A+ ESE  L  +R  L ++   + +II   +  A+K +  I      + +Q E++      K E+E EKR+ L     EV+ LA++ A   +   +D +  KKI+D ++ DL+ K
  S:    16 PNPGLIFWTAITFVIVLLILKKIAWGPIIGALEEREKGIQSSIDRAHSAKEESEAILRKNRELLAKADAESDKIIREGKDYADKLRADI-----TEKAQSEAKKMIATAKDEIEQEKRRALDVLRNEVADLAVKGAEKIIKTTLDADMQKKIVDSMIQDLSTK 173
>gi|114567892|ref|YP_755046.1| F0F1-type ATP synthase subunit b-like protein [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|114338827|gb|ABI69675.1| F0F1-type ATP synthase subunit b-like protein [Syntrophomonas wolfei subsp. wolfei str. Goettingen] (173 aa)
Score = 133, Expect = 1.7e-06, Identities = 41/155 (26%), Positives = 84/155 (54%)
  Q:    29 FPNVYVLIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVND 183
           F N+Y +    ++ + LL L+ + A+ P  + +E RT  I+  ++ AE+ +LE E+    +   L ES+  A EI+  A   AE++K +I A A  +++ I+++  ++I+    + +         LA+  A   LS+ I+++++K ++   VN+
  S:    13 FGNLYAIGWSAVNFLVLLALMYKFAYGPINNMLEQRTNAIEGSLKHAEEVKLEVEQMRKETASNLAESRKEAQEIVARATKAAEESKNEIIAKAKEESTLIKNKAAAEIQAATEQAKLELKDSAVSLAILAAEKVLSRAINDDDHKNLVKQFVNE 167
>gi|87121033|ref|ZP_01076924.1| ATP synthase subunit B [Marinomonas sp. MED121] >gi|86163525|gb|EAQ64799.1| ATP synthase subunit B [Marinomonas sp. MED121] (156 aa)
Score = 133, Expect = 1.8e-06, Identities = 42/150 (28%), Positives = 75/150 (50%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           LI   IS  F +   ++  W P  + +E R+K+I   +EAA +A  + E     +   L ESK  AAEIIE A   A +   + +  AL    ++     S+I++  +  ++    +VS+LAL  A   L   +DE+ + ++++ +  +L
  S:     7 LIGQAISFAFFVWFCMKFVWPPVIAALEERSKKIADGLEAANRASRDLELAQEKATHTLRESKEQAAEIIEQANKRANQIIDEAKEQALADGQRLRDAANSEIEQDVIRAKEALRAQVSQLALIGAEKILGASVDEKAHSELVEKLAQEL 156
>gi|407170|emb|CAA81449.1| Adenosine Triphosphatase [Streptococcus pneumoniae] >gi|1589420|prf||2211259C F0F1 ATPase:SUBUNIT=b (164 aa)
Score = 132, Expect = 2.0e-06, Identities = 43/144 (29%), Positives = 77/144 (53%)
  Q:    41 SLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           S I LL+L+ + AW       E R ++I   ++ AE+A+ ++E        +L  S+  A  IIENA+  AE++K  I A A  +A +++ +   +I + + E  +    EV+ L +  AG  +SK +D   +K++ID  ++ L
  S:    18 SFILLLVLIKKFAWSNITGIFEERAEKIASDIDRAEEARQKAEVLAQKREDELAGSRKEAKTIIENAKETAEQSKANILADAKVEAGRLKEKANQEIAQNKAEALQSVKGEVADLTVSLAGKIISKNLDSHAHKELIDQYIDQL 161
>gi|148988556|ref|ZP_01819989.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP6-BS73] >gi|168483879|ref|ZP_02708831.1| ATP synthase F0, B subunit [Streptococcus pneumoniae CDC1873-00] >gi|168487555|ref|ZP_02712063.1| ATP synthase F0, B subunit [Streptococcus pneumoniae CDC1087-00] >gi|147925757|gb|EDK76832.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP6-BS73] >gi|172042717|gb|EDT50763.1| ATP synthase F0, B subunit [Streptococcus pneumoniae CDC1873-00] >gi|183569630|gb|EDT90158.1| ATP synthase F0, B subunit [Streptococcus pneumoniae CDC1087-00] (164 aa)
Score = 132, Expect = 2.2e-06, Identities = 42/144 (29%), Positives = 76/144 (52%)
  Q:    41 SLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           S I LL+L+ + AW       E R ++I   ++ AE+A+ ++E        +L  S+  A  IIENA+  AE++K  I A A  +A  ++ +   +I + ++E  +    EV+ L +  AG  +S+ +D   +K +ID  ++ L
  S:    18 SFILLLVLIKKFAWSNITGIFEERAEKIASDIDRAEEARQKAEVLAQKREDELAGSRKEAKTIIENAKETAEQSKANILADAKLEAGHLKEKANQEIAQNKVEALQSVKGEVADLTISLAGKIISQNLDSHAHKALIDQYIDQL 161
>gi|126653445|ref|ZP_01725541.1| AtpF [Bacillus sp. B14905] >gi|126589801|gb|EAZ83934.1| AtpF [Bacillus sp. B14905] (173 aa)
Score = 132, Expect = 2.2e-06, Identities = 40/147 (27%), Positives = 82/147 (55%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIV 181
           +IA ++  + L+ L+ ++AW P    ++ R + +  ++EAAEKA+ +S + L   +  L E++  A  I+E A+   E  K +I   A N+A++++     +I+ ++ +       EV  L++  A   LSK+I E +N+ +I++ +
  S:    20 IIATLVIFLVLMFLLKKVAWGPLMGIMQQREELVASEIEAAEKARKDSHQFLEEQKSLLKEARTEAQSIVEGAKKQGELQKDEILTAARNEANRLKESALREIESEKEKAIAAVRDEVVSLSVLAASKVLSKEISEADNRALIEETI 166
>gi|15901359|ref|NP_345963.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae TIGR4] >gi|15903407|ref|NP_358957.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae R6] >gi|111657414|ref|ZP_01408167.1| hypothetical protein SpneT_02001384 [Streptococcus pneumoniae TIGR4] >gi|116515510|ref|YP_816801.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae D39] >gi|148984855|ref|ZP_01818108.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP3-BS71] >gi|148992604|ref|ZP_01822272.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP9-BS68] >gi|148997428|ref|ZP_01825033.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP11-BS70] >gi|149003274|ref|ZP_01828170.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP14-BS69] >gi|149007582|ref|ZP_01831217.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP18-BS74] >gi|149011746|ref|ZP_01832942.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP19-BS75] >gi|149021779|ref|ZP_01835786.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP23-BS72] >gi|168489672|ref|ZP_02713871.1| ATP synthase F0, B subunit [Streptococcus pneumoniae SP195] >gi|168492581|ref|ZP_02716724.1| ATP synthase F0, B subunit [Streptococcus pneumoniae CDC0288-04] >gi|168493413|ref|ZP_02717556.1| ATP synthase F0, B subunit [Streptococcus pneumoniae CDC3059-06] >gi|168575967|ref|ZP_02721882.1| ATP synthase F0, B subunit [Streptococcus pneumoniae MLV-016] >gi|169832491|ref|YP_001694918.1| ATP synthase F0, B subunit [Streptococcus pneumoniae Hungary19A-6] >gi|182684466|ref|YP_001836213.1| ATP synthase subunit B [Streptococcus pneumoniae CGSP14] >gi|194396745|ref|YP_002038142.1| ATP synthase F0, B chain [Streptococcus pneumoniae G54] >gi|61219603|sp|P0A2Z2|ATPF_STRPN ATP synthase B chain (Subunit I) >gi|61219605|sp|P0A2Z3|ATPF_STRR6 ATP synthase B chain (Subunit I) >gi|15004343|gb|AAK77043.1|AF334396_3 H+-transporting ATP synthase subunit b [Streptococcus pneumoniae] >gi|15004348|gb|AAK77047.1|AF334397_3 H+-transporting ATP synthase subunit b [Streptococcus pneumoniae] >gi|18253301|gb|AAL66413.1|AF368465_3 proton-translocating ATPase b subunit [Streptococcus pneumoniae] >gi|14973002|gb|AAK75603.1| ATP synthase F0, B subunit [Streptococcus pneumoniae TIGR4] >gi|15459012|gb|AAL00168.1| Proton-translocating ATPase, F0 sector, subunit b [Streptococcus pneumoniae R6] >gi|116076086|gb|ABJ53806.1| ATP synthase F0, B subunit [Streptococcus pneumoniae D39] >gi|147756483|gb|EDK63524.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP11-BS70] >gi|147758734|gb|EDK65731.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP14-BS69] >gi|147760941|gb|EDK67911.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP18-BS74] >gi|147764177|gb|EDK71109.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP19-BS75] >gi|147922877|gb|EDK73993.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP3-BS71] >gi|147928621|gb|EDK79635.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP9-BS68] >gi|147930015|gb|EDK81002.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP23-BS72] >gi|168994993|gb|ACA35605.1| ATP synthase F0, B subunit [Streptococcus pneumoniae Hungary19A-6] >gi|182629800|gb|ACB90748.1| ATP synthase subunit B [Streptococcus pneumoniae CGSP14] >gi|183571984|gb|EDT92512.1| ATP synthase F0, B subunit [Streptococcus pneumoniae SP195] >gi|183573266|gb|EDT93794.1| ATP synthase F0, B subunit [Streptococcus pneumoniae CDC0288-04] >gi|183576602|gb|EDT97130.1| ATP synthase F0, B subunit [Streptococcus pneumoniae CDC3059-06] >gi|183578325|gb|EDT98853.1| ATP synthase F0, B subunit [Streptococcus pneumoniae MLV-016] >gi|194356412|gb|ACF54860.1| ATP synthase F0, B chain [Streptococcus pneumoniae G54] (164 aa)
Score = 132, Expect = 2.3e-06, Identities = 42/144 (29%), Positives = 76/144 (52%)
  Q:    41 SLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           S I LL+L+ + AW       E R ++I   ++ AE+A+ ++E        +L  S+  A  IIENA+  AE++K  I A A  +A  ++ +   +I + ++E  +    EV+ L +  AG  +S+ +D   +K +ID  ++ L
  S:    18 SFILLLVLIKKFAWSNITGIFEERAEKIASDIDRAEEARQKAEVLAQKREDELAGSRKEAKTIIENAKETAEQSKANILADAKLEAGHLKEKANQEIAQNKVEALQSVKGEVADLTISLAGKIISQNLDSHAHKALIDQYIDQL 161
>gi|35436123|gb|AAO45677.1| AtpB [Streptococcus viridans] (164 aa)
Score = 131, Expect = 2.4e-06, Identities = 43/144 (29%), Positives = 77/144 (53%)
  Q:    41 SLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           S I LL+L+ + AW       E R ++I   ++ AE+A+ ++E        +L  S+  A  IIENA+  AEK+K  I A A  +A +++ +   +I + + E  +    EV+ L +  AG  +S+ +D   +K++ID  ++ L
  S:    18 SFILLLVLIKKFAWSNITGIFEERAEKIASDIDRAEEARQKAEVLAQKREDELAGSRKEAKTIIENAKETAEKSKASILADAKLEAGRLKEKANQEIAQNKAEALQSVKGEVADLTISLAGKIISENLDGHAHKELIDQYIDQL 161
>gi|28378942|ref|NP_785834.1| F0F1 ATP synthase subunit B [Lactobacillus plantarum WCFS1] >gi|28271779|emb|CAD64685.1| H(+)-transporting two-sector ATPase, B subunit [Lactobacillus plantarum WCFS1] (171 aa)
Score = 131, Expect = 2.7e-06, Identities = 38/145 (26%), Positives = 75/145 (51%)
  Q:    40 ISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           IS I L+ L+  +AWKP    +  R  +I   +++A+K++ E+       R  L  S+  A+EI+ +A+   EK +  I A A N+A+Q +      I+++  +  K    +V+ +++  A   + K++D E  + +I+  +  L
  S:    22 ISFIVLMALISVVAWKPITKMMADRADKIANDIDSAQKSRQEASDLADQRRDALSHSRAEASEIVADAKKSGEKQRSSIVADAQNEATQYKQNARKDIEQERQDALKNVQSDVADISVAIATKIIKKQLDPEGQQALINSYIEGL 166
>gi|145220542|ref|YP_001131251.1| ATP synthase F0, B subunit [Prosthecochloris vibrioformis DSM 265] >gi|145206706|gb|ABP37749.1| ATP synthase F0, B subunit [Prosthecochloris vibrioformis DSM 265] (175 aa)
Score = 130, Expect = 3.3e-06, Identities = 45/158 (28%), Positives = 83/158 (52%)
  Q:    30 PNVYVLIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNL-----EVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLTAK 187
           PN  ++    I+ + +LL++ ++AW P    +E R K IQ  ++ A  A+ E+E  L  ++  L +++  +  II      A+K + +I      + +  ES+      K E+E EKR+ L     EV+ LA+  A   +   +D E  +K++D ++ DL+ K
  S:    16 PNPGLIFWTAITFVLVLLILKKIAWGPILGALEEREKGIQSSIDRAYGAKEEAEAILRQNKETLAKAEAESDRIIREGREFADKIRAEI-----TEKAHTESQKMIGAAKDEIEQEKRRALDVLRNEVADLAVRGAEKIIRASLDGEVQRKVVDSMIADLSTK 173
>gi|35436116|gb|AAO45674.1| AtpB [Streptococcus viridans] (164 aa)
Score = 130, Expect = 3.7e-06, Identities = 42/144 (29%), Positives = 77/144 (53%)
  Q:    41 SLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           S I LL+L+ + AW       E R ++I   ++ AE+A+ ++E        +L  S+  A  IIENA+  AE++K  I A A  +A +++ +   +I + + E  +    EV+ L +  AG  +S+ +D   +K++ID  ++ L
  S:    18 SFILLLVLIKKFAWSNITGIFEERAEKIASDIDRAEEARQKAEVLAQKREDELAGSRKEAKTIIENAKETAEQSKANILADAKLEAGRLKEKANQEIAQNKAEALQSVKGEVADLTISLAGKIISQNLDGHAHKELIDQYIDQL 161
>gi|51891225|ref|YP_073916.1| ATP synthase B subunit [Symbiobacterium thermophilum IAM 14863] >gi|51854914|dbj|BAD39072.1| ATP synthase B subunit [Symbiobacterium thermophilum IAM 14863] (162 aa)
Score = 130, Expect = 4.0e-06, Identities = 46/159 (28%), Positives = 84/159 (52%)
  Q:    27 QIFPNVYVLIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLT 185
           QIFP    LI  +I+   LL  + R  +KP    I+AR  EI   ++ A + + E+E+       ++  ++  A EII  A  +A   K++IEA A  +A++I  +    I++++ +       EV+ LA+  AG  + K +D+ E++++ D  V ++T
  S:     2 QIFPQTNELIWTIINFAVLLWGMHRFLYKPLLGAIQAREDEINANLKKAAEDRAEAERLRREFEAQIANAQREAQEIINKAVKNATAVKEQIEAEARARAAEILEQATQTIEREKAKAVAELRREVADLAVAVAGKVIEKSLDDAEHRRLADSFVTEVT 160
>gi|169826596|ref|YP_001696754.1| ATP synthase B chain [Lysinibacillus sphaericus C3-41] >gi|168991084|gb|ACA38624.1| ATP synthase B chain [Lysinibacillus sphaericus C3-41] (173 aa)
Score = 129, Expect = 4.1e-06, Identities = 41/147 (27%), Positives = 81/147 (55%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIV 181
           +IA +   + L+ L+ ++AW P    ++ R + +  ++EAAEKA+ ES + L   +  L E++  A  I+E A+   E  K +I   A N+A++++     +I+ ++ +       EV  L++  A   LSK+I E +N+ +I++ +
  S:    20 IIATLAIFLVLMFLLKKVAWGPLMGIMQQREELVASEIEAAEKARKESHQFLEEQKSLLKEARTEAQSIVEGAKKQGELQKDEILTAARNEANRLKESALREIESEKEKAIAAVRDEVVSLSVLAASKVLSKEISEADNRALIEETI 166
>gi|78187938|ref|YP_375981.1| ATP synthase F0, subunit B [Pelodictyon luteolum DSM 273] >gi|78167840|gb|ABB24938.1| ATP synthase F0, subunit B [Pelodictyon luteolum DSM 273] (175 aa)
Score = 128, Expect = 5.5e-06, Identities = 48/146 (32%), Positives = 80/146 (54%)
  Q:    40 ISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNL-----EVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLT 185
           I+ + +L+++ ++AW P  S +E R K IQ  ++ A  A+ ESE  L  +R  L ++   A  +I      AEK + +I      KA Q ES+      K+E+E EKR+ L     EV+ LA+  A   +   +D +  KK++D ++ DL+
  S:    26 ITFVLVLIILKKIAWGPIISALEEREKGIQSSIDRAHGAKEESEAILRQNRELLAKADAEADRVIREGREYAEKIRAEIT----EKAHQ-ESQKMISAAKEEIEQEKRRALAELRNEVADLAVRGAEKIIRGVLDADVQKKVVDSMIQDLS 171
>gi|56421897|ref|YP_149215.1| F0F1 ATP synthase subunit B [Geobacillus kaustophilus HTA426] >gi|56381739|dbj|BAD77647.1| F0F1-type ATP synthaseB chain [Geobacillus kaustophilus HTA426] (177 aa)
Score = 128, Expect = 5.5e-06, Identities = 40/150 (26%), Positives = 86/150 (57%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           +I  ++  I LL L+ + AW+P  + ++ R + I  +++ AEK + E+EK L   R  + +S+  A  +IENA   AE+ K++I A A  +A +++     +I++++ +       +V+ L++  A   + K++ E++ +K+I+  + D+
  S:    21 IIYQLLMFIILLALLRKFAWQPLMNIMKQREEHIANEIDQAEKRRQEAEKLLEEQRELMKQSRQEAQALIENARKLAEEQKEQIVASARAEAERVKEVAKKEIEREKEQAMAALREQVASLSVLIASKVIEKELTEQDQRKLIEAYIKDV 170
>gi|70725929|ref|YP_252843.1| F0F1 ATP synthase subunit B [Staphylococcus haemolyticus JCSC1435] >gi|88909587|sp|Q4L7Y8|ATPF_STAHJ ATP synthase B chain >gi|68446653|dbj|BAE04237.1| ATP synthase B chain [Staphylococcus haemolyticus JCSC1435] (176 aa)
Score = 128, Expect = 6.4e-06, Identities = 40/149 (26%), Positives = 83/149 (55%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVND 183
           +I  VI+   LL L+ + AW P K  ++ R ++I R ++ AE+A+L ++K    ++  L ++++    I+E+A + A K  ++I   A  +A+ +     S+I  ++       N +VS+L++  A   L K+I E++ K+++D  + +
  S:    24 VIVTVITFAILLALLKKFAWGPLKEVMDKRERDINRDIDEAEEAKLNAQKLEEENKKTLKQTQDEVQRILEDARVQARKQHEEIIHEANIRANGMIETAQSEINSEKERALADINNQVSELSVLIASKVLKKEISEQDQKELVDKYLKE 172
>gi|148543698|ref|YP_001271068.1| ATP synthase F0, B subunit [Lactobacillus reuteri F275] >gi|184153108|ref|YP_001841449.1| ATP synthase B subunit [Lactobacillus reuteri F275] >gi|194468261|ref|ZP_03074247.1| ATP synthase F0, B subunit [Lactobacillus reuteri 100-23] >gi|148530732|gb|ABQ82731.1| ATP synthase F0, B subunit [Lactobacillus reuteri F275] >gi|154705566|gb|ABS84209.1| ATP synthase F0 B subunit [Lactobacillus reuteri] >gi|183224452|dbj|BAG24969.1| ATP synthase B subunit [Lactobacillus reuteri F275] >gi|194453114|gb|EDX42012.1| ATP synthase F0, B subunit [Lactobacillus reuteri 100-23] (172 aa)
Score = 128, Expect = 6.4e-06, Identities = 36/150 (24%), Positives = 76/150 (50%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           L+ ++++ I L+LLV   AWKP    ++ R  +I   ++ A +++  +EK     + +L  S+  AAEI+ NA+   E  + +I   A   A  ++ +     ++   +       +V+ L++E A   + K++  ++ K++ID  +  L
  S:    18 LVFYIVTFIILMLLVKHFAWKPVTDMMKKRADKIANDIDNAARSRESAEKMAAKRQAELQSSRQEAAEIVSNAKKSGETQRAQIVETAQKDAQALKQQAQKDAEQARRDALNSAKDDVANLSIEIASKLIQKELKADDQKELIDSYIEGL 167
>gi|189501405|ref|YP_001960875.1| ATP synthase F0, B subunit [Chlorobium phaeobacteroides BS1] >gi|189496846|gb|ACE05394.1| ATP synthase F0, B subunit [Chlorobium phaeobacteroides BS1] (175 aa)
Score = 127, Expect = 7.2e-06, Identities = 39/156 (25%), Positives = 81/156 (51%)
  Q:    30 PNVYVLIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLT 185
           PN  ++    ++ + +L ++ +  W P  S +E R K I+  ++ A+ A+ E+E  L+ +R  L ++   A +II   +   +K K +I   A  +AS++ S    +I +++         EV+ LA++ A   +   +D E+ K I+D ++ +L+
  S:    16 PNPGLIFWTTVTFLIVLFILKKFTWGPMLSALEEREKGIKNSIDRAQSAKEEAEAVLNKNRQLLAQAGADADKIIREGKEYGDKLKAEITEKAHLEASRMISSAKDEIDQEKRRALTELRTEVADLAVKGAEKIIMANLDAEKQKNIVDSMIQELS 171
>gi|78188050|ref|YP_378388.1| ATP synthase F0, subunit B [Chlorobium chlorochromatii CaD3] >gi|78170249|gb|ABB27345.1| ATP synthase F0, subunit B [Chlorobium chlorochromatii CaD3] (175 aa)
Score = 127, Expect = 8.3e-06, Identities = 45/158 (28%), Positives = 89/158 (56%)
  Q:    30 PNVYVLIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNL-----EVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLTAK 187
           PN  ++    I+ + +LL++ ++AW P    +E R K IQ  ++ AEKA+ E+E  L  +R  L ++   + +I+   +  AEK +  I   A  +A+++ +       K+E+E EKR+ L     EV+ LA+  A   + + ++ +  KK++  ++ D+++K
  S:    16 PNPGLIFWTAITFVIVLLILKKIAWGPIIGALEEREKGIQSSIDRAEKAKDEAEAILRKNRELLSKADAESEKIVREGKEYAEKLRTDITEKAHTEAAKMIASA-----KEEIEQEKRRALDVLRNEVADLAVLGAERIIRESLNADMQKKVVASMIQDMSSK 173
>gi|196249756|ref|ZP_03148452.1| ATP synthase F0, B subunit [Geobacillus sp. G11MC16] >gi|196210632|gb|EDY05395.1| ATP synthase F0, B subunit [Geobacillus sp. G11MC16] (180 aa)
Score = 127, Expect = 8.4e-06, Identities = 40/150 (26%), Positives = 85/150 (56%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           +I  +++ I L+LL+   AW P    ++ R + I  +++ AEK + E+EK L   R  L +S+  A  I+ENA   AE+ K++I A A  +A +++     +I++++ +       +V+ L++  A   + +++ E++ +K+I+  + D+
  S:    24 IIFQLVAFILLMLLLRIFAWGPLMGVMKQREEHIANEIDQAEKRRQEAEKLLEEQRELLKQSRQEAQTILENARKLAEEQKEQIVASARAEAERVKEAAKQEIEREKEQAMAALREQVASLSVLIASKVIERELTEQDQRKLIEAYIKDI 173
>gi|194335033|ref|YP_002016893.1| ATP synthase F0, B subunit [Prosthecochloris aestuarii DSM 271] >gi|194312851|gb|ACF47246.1| ATP synthase F0, B subunit [Prosthecochloris aestuarii DSM 271] (175 aa)
Score = 127, Expect = 9.0e-06, Identities = 44/156 (28%), Positives = 84/156 (53%)
  Q:    30 PNVYVLIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNL-----EVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLT 185
           PN  ++    ++ + +LL++ + AW P    +E R K IQ  ++ A  A+ E+E  L  ++  L ++   A +I+   +   EK +  I   A ++A+++ S       K+E+E EKR+ L     EV+ LA++ A   L   +D ++ K I+  ++ DL+
  S:    16 PNPGLIFWTAVTFVIVLLILKKFAWGPILGALEEREKAIQSSIDRAHTAKDEAEAALRKNKELLTKADAEAEKILREGKEYGEKLRADIVEKAHSEATKMISSA-----KEEIEQEKRRALDELRNEVADLAVQGAEKILMANLDADKQKAIVSSMIQDLS 171
>gi|117618536|ref|YP_858683.1| F0F1 ATP synthase subunit B [Aeromonas hydrophila subsp. hydrophila ATCC 7966] >gi|117559943|gb|ABK36891.1| ATP synthase F0, B subunit [Aeromonas hydrophila subsp. hydrophila ATCC 7966] (156 aa)
Score = 126, Expect = 9.6e-06, Identities = 40/150 (26%), Positives = 79/150 (52%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           L+   I+    ++  ++  W P  + IEAR K I   + +AE+A+ + +     +  +L E+K  AAEIIE A     +   +  A A ++  +I ++G ++I+ +    ++    +V+ LA+  A   L+++ID+  N  I+D +V +L
  S:     7 LLGQAIAFFIFVVFCMKYVWPPLMAAIEARQKAIADGLSSAERAKKDLDLAKANATDQLKEAKLQAAEIIEQANKRKAQIIDEAAAGAHSEREKILAQGRAEIEAERHRAKEELRKQVAALAIAGAEKILARQIDQAANSDIVDKLVAEL 156
>gi|152977496|ref|YP_001377013.1| F0F1 ATP synthase subunit B [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|152026248|gb|ABS24018.1| ATP synthase F0, B subunit [Bacillus cereus subsp. cytotoxis NVH 391-98] (168 aa)
Score = 126, Expect = 1.2e-05, Identities = 38/146 (26%), Positives = 82/146 (56%)
  Q:    39 VISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           ++  + LL+++ + AW P    ++ R + +  +++AAEK   E++K +   R  L +S+  A E+IE A+  AE+ K  I A A  +A  I++    +I++++ +       +V+ L+++ A   + K++ EE+  K+I D + ++
  S:    19 LVVFLILLVMLRKFAWGPLMGIMKEREEHVASEIDAAEKNHAEAKKLVEEQREMLKQSRVEAQELIERAKKQAEEQKDGIIAAAKEEAESIKTSAVQEIQREKEQAIATLQEQVASLSVQIASKVIEKELKEEDQVKLIRDYIKEV 164
>gi|88811297|ref|ZP_01126553.1| ATP synthase F0, subunit B [Nitrococcus mobilis Nb-231] >gi|88791836|gb|EAR22947.1| ATP synthase F0, subunit B [Nitrococcus mobilis Nb-231] (154 aa)
Score = 125, Expect = 1.2e-05, Identities = 45/150 (30%), Positives = 71/150 (47%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           L   + S      LV R  W P  + +E R K +   + AAE+ Q E E     +R  LLE+K  A EII NA+  A++  +  +  A  +  +I S   S++ +Q     +    EV  LA+E A   L +KID + N + ++ +   L
  S:     5 LFGQLASFALFSYLVYRFLWDPITNMLEERRKRVADGLAAAERGQREQELAEKHAREVLLEAKEQANEIIANAQRRADEIVEGAKDDARIEGERIVSAARSEVDQQINLAREGLRREVVALAIEGAEQVLKRKIDAKTNSEALEKLAAQL 154
>gi|47459048|ref|YP_015910.1| ATP synthase b chain [Mycoplasma mobile 163K] >gi|47458377|gb|AAT27699.1| ATP synthase b chain [Mycoplasma mobile 163K] (184 aa)
Score = 125, Expect = 1.4e-05, Identities = 45/158 (28%), Positives = 91/158 (57%)
  Q:    28 IFPNVYVLIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIV-NDLT 185
           IFP+  +++A ++S   LL+++ +L +KP K  ++ R   IQ  ++ + K   +S + L  S I++L++K  A  II++A++ AE+ K      A +K+ Q+  E    I++Q++   K    E+ ++A E     LS+   + E+ K +++++ ND+T
  S:    25 IFPSWPIMLATLVSFTILLVVLTKLIYKPVKKMMKNRRDFIQNNIDESTKQVEKSNELLEKSNIEILDAKIKANTIIKDAQILAEEIKNNSIKDAKDKSKQLLEETKIYIRQQKVLFAKESKKEIVEIAGEMTKKILSESDVKLEDSKFLENLLKNDIT 183
>gi|27468622|ref|NP_765259.1| F0F1 ATP synthase subunit B [Staphylococcus epidermidis ATCC 12228] >gi|57867660|ref|YP_189278.1| F0F1 ATP synthase subunit B [Staphylococcus epidermidis RP62A] >gi|81673862|sp|Q5HMB5|ATPF_STAEQ ATP synthase B chain >gi|81842667|sp|Q8CNJ3|ATPF_STAES ATP synthase B chain >gi|27316169|gb|AAO05303.1|AE016749_249 ATP synthase B chain [Staphylococcus epidermidis ATCC 12228] >gi|57638318|gb|AAW55106.1| ATP synthase F0, B subunit [Staphylococcus epidermidis RP62A] (171 aa)
Score = 125, Expect = 1.5e-05, Identities = 36/145 (24%), Positives = 85/145 (58%)
  Q:    39 VISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVND 183
           +++ + L++L+ + AW P K  ++ R ++I + ++ AE+A++ ++K    +R  L E+++   +I+++A++ A K  ++I   A  KA+ +     S+I  Q+       N +VS+L++  A   L K+I E++ K++++  + +
  S:    23 LVTFVILIILLKKFAWGPLKEVMDKRERDINKDIDDAEQAKINAQKLEEENRKTLKETQDEVQKILDDAKIQARKQHEEIIHEANEKANGMIETAQSEINSQKERAISDINNQVSELSVLIASKVLRKEISEQDQKELVEKYLKE 167
>gi|13508341|ref|NP_110291.1| F0F1 ATP synthase subunit B [Mycoplasma pneumoniae M129] >gi|2493069|sp|Q50327|ATPF_MYCPN ATP synthase B chain precursor >gi|1209762|gb|AAC43655.1| ATP synthase b chain >gi|1673908|gb|AAB95888.1| ATP synthase B chain [Mycoplasma pneumoniae M129] (207 aa)
Score = 125, Expect = 1.5e-05, Identities = 43/167 (25%), Positives = 97/167 (58%)
  Q:    21 NSQIINQIFPNVYVLIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLTAK 187
           +  +IN++FPN++V +AH+++ + LL L++ L WKPT+ ++  R   ++ ++  A   + +++  L  +  +   S   A EI++ A  +A + K +IE  A  +A+ +  +   +I+K++  ++++   E  +LA+  A   + KK+D + +K  I++ + +L A+
  S:    37 SESVINELFPNLWVFLAHLLAFVILLFLLLFLFWKPTQKFLNQRKALLEEQVNQANSLEQQAQALLQQANQRHENSLVVAKEIVDQANYEALQLKSEIEKKANRQANLMIFQARQEIEKEKRLIQEQSLKESVELAMLAAKELIIKKVDVKADKAFIEEFIRELEAE 203
>gi|167215204|ref|ZP_02285511.1| F0F1 ATP synthase subunit B [Listeria monocytogenes FSL R2-503] (163 aa)
Score = 124, Expect = 1.6e-05, Identities = 39/148 (26%), Positives = 81/148 (54%)
  Q:    37 AHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           +H +S   LL+L+   AWKP    ++ R + I  +++AAE+++ ++E+ L   +  L +++  +  +IENA+   EK +++I   A  ++ +I+ E  S I +++ +       +V  L++  A   + K +DE+E   +I D +  L
  S:    12 SHFLSFAILLVLIRIYAWKPLMGVMKEREEHIGSEIDAAEESRAQAEQLLAEQKSVLQQARVESQTMIENAKQLGEKEREEIVKTARRESERIKEEAKSDIAREKEDAISALREQVGSLSVLIASKVIEKNLDEKEQSNLIQDYIERL 159
>gi|125975087|ref|YP_001038997.1| ATP synthase F0, B subunit [Clostridium thermocellum ATCC 27405] >gi|196251789|ref|ZP_03150455.1| ATP synthase F0, B subunit [Clostridium thermocellum DSM 4150] >gi|125715312|gb|ABN53804.1| ATP synthase F0, B subunit [Clostridium thermocellum ATCC 27405] >gi|196198729|gb|EDX93560.1| ATP synthase F0, B subunit [Clostridium thermocellum DSM 4150] (181 aa)
Score = 124, Expect = 1.6e-05, Identities = 44/155 (28%), Positives = 84/155 (54%)
  Q:    29 FPNVYVLIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVND 183
           F ++   I   ++L+ L  ++ RL +KP   ++E R   I   ME AEK + E+ +  +    +L E+   A +I++ AE  A++  ++I   A N+A  ++ +   +I++++ E  K    EV  LALE A   L   +D EEN+K+++  +++
  S:    23 FIHIPTFIYTALNLVILYFILKRLLFKPVWEFMENRKNSIAESMEKAEKGKAEALELKNKYESELNEAYAKAQKILKEAEEKAKQEYERIIRDAKNEAEALKLKAKEEIEREKNEALKEIRNEVVSLALEAASKVLEANMDTEENRKLVNRFIDE 177
>gi|88860633|ref|ZP_01135270.1| membrane-bound ATP synthase, F0 sector, subunit b [Pseudoalteromonas tunicata D2] >gi|88817228|gb|EAR27046.1| membrane-bound ATP synthase, F0 sector, subunit b [Pseudoalteromonas tunicata D2] (156 aa)
Score = 124, Expect = 1.7e-05, Identities = 40/150 (26%), Positives = 79/150 (52%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           L+  +I+ I  +   ++  W P    IEAR K+I+  + A++KA+ + E   H +  +L E+K  AA+IIE A+  A +   +       +   I ++G S+++ +    ++    +VS LA+  A   L ++I+E  +  I++ +V +L
  S:     7 LLGELIAFIVFVWFCMKYVWPPLNGAIEARQKKIEDGLAASDKAEKDLELARHKATEQLKEAKAQAADIIEQAKKRATQIVDEETTRGHEERENIIAQGRSEVEAERNRAKEELRKQVSALAILGAERILEREINEAAHSDIVEKLVTEL 156
>gi|42784479|ref|NP_981726.1| F0F1 ATP synthase subunit B [Bacillus cereus ATCC 10987] >gi|166984516|ref|ZP_02255857.1| ATP synthase F0, B subunit [Bacillus cereus AH187] >gi|168162317|ref|ZP_02597550.1| ATP synthase F0, B subunit [Bacillus cereus H3081.97] >gi|42740411|gb|AAS44334.1| ATP synthase F0, B subunit [Bacillus cereus ATCC 10987] (168 aa)
Score = 124, Expect = 1.8e-05, Identities = 41/143 (28%), Positives = 81/143 (56%)
  Q:    42 LIFLLLLVI--RLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
            IFLLLLV+  + AW P    ++ R + +  +++AAE++  E++K +   R  L +S+  A E+IE A+  A   K  I A A  +A  I++    +I++++ +       +V+ L+++ A   + K++ EE+  K+I D + ++
  S:    20 FIFLLLLVMLRKFAWGPLMGIMKEREEHVTNEIDAAERSNAEAKKLVEEQREMLKQSRVEAQELIERAKKQAVDQKDAIVAAAKEEAESIKASAVQEIQREKEQAIAALQEQVASLSVQIASKVIEKELKEEDQVKLIRDYIKEV 164
>gi|118603009|ref|YP_904224.1| ATP synthase F0, B subunit [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)] >gi|118567948|gb|ABL02753.1| ATP synthase F0, B subunit [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)] (157 aa)
Score = 124, Expect = 1.9e-05, Identities = 33/151 (21%), Positives = 78/151 (51%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLT 185
           +   +I         ++  W P    +E R K I+  + AAE+ + E E+    ++  + +SK+ AAEII NA   A    +  + VAL +A +++++  +++++  ++       ++S L ++   + L+K++D + ++K++  +   L+
  S:     7 MFGQLIMFTMFTWFCMKFVWPPIVMTMEERKKRIESGLLAAERGRSEQEEMQAKAQEMINQSKDQAAEIIANATRQASNMVEDAKDVALKEAGKVKAQAQAQLEQDTIQTRNELKNQMSDLIMQGVSVVLAKEVDVKVHQKMLGKLSQSLS 157
>gi|21672860|ref|NP_660925.1| ATP synthase F0, B subunit [Chlorobium tepidum TLS] >gi|21645909|gb|AAM71267.1| ATP synthase F0, B subunit [Chlorobium tepidum TLS] (175 aa)
Score = 123, Expect = 2.1e-05, Identities = 42/157 (26%), Positives = 88/157 (56%)
  Q:    30 PNVYVLIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNL-----EVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLTA 186
           PN  ++    ++ + +L+++ + AW P  S +E R K IQ  ++ A  A+ E+E  L  +R  L ++   A +II  A+  A+K +  +   A +++ +I +       K+E+E EKR+ L     EV+ +A++ A   +   +D ++ K +++D++ ++ A
  S:    16 PNPGLIFWTALTFLIVLVILRKTAWGPILSMLEERAKSIQSAIDRAHTAKDEAEAILKKNRDLLAKADAEADKIIREAKEVADKLRADLTEKAHDESRKIIASA-----KEEIEQEKRRALDVLRNEVADMAVKGAEKIIRTTLDADKQKAVVNDMIKEMAA 172
>gi|163762345|ref|ZP_02169410.1| peptide chain release factor 1 [Bacillus selenitireducens MLS10] >gi|160357084|gb|EDP83732.1| peptide chain release factor 1 [Bacillus selenitireducens MLS10] (165 aa)
Score = 123, Expect = 2.2e-05, Identities = 38/153 (24%), Positives = 85/153 (55%)
  Q:    36 IAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLTAKL 188
           +  +++ +FL+ L+ R A+ P    +E R K +  ++++AEK + E+E+ L   R  +  ++  A EI+ENA+  +++    I A A  +A +++    ++I  ++ +       +VS L++  A   + K++DE+E +K+I + + ++   L
  S:    13 VYQILAFLFLMWLLKRYAFGPIMDMMEKREKHVADQIKSAEKNRDEAEQYLKEQREAIQTARQEAKEIVENAKKMSDQQAADIVASARTEAERLKETAKAEINSEKEQAVSALREQVSTLSVLVASKVIEKELDEKEQEKLIQETLKEVGGDL 165
>gi|78042703|ref|YP_361342.1| ATP synthase F0, B subunit [Carboxydothermus hydrogenoformans Z-2901] >gi|77994818|gb|ABB13717.1| ATP synthase F0, B subunit [Carboxydothermus hydrogenoformans Z-2901] (159 aa)
Score = 123, Expect = 2.2e-05, Identities = 41/150 (27%), Positives = 82/150 (54%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
            I  +I+   LL ++  L +KP    IE R K I+  +E A KAQ E+E+        + +++  A EII  A+  A+  K++I A A  +A  + ++  + I +++ +  +    E+  LA+  AG  L++ +  E+++K++D+ +N++
  S:     8 FIWTLINFFVLLFILKILLYKPVLKTIEDRKKSIEESLEKAAKAQEEAERIKAEYDGMIAKAREEAREIIAKAQKTAQAEKEEIIATAQREAQSLLADAKATIAQEKEKALRELRQEIGNLAVLAAGKILNRAVTLEDHQKLVDEFLNEV 157
>gi|21910031|ref|NP_664299.1| F0F1 ATP synthase subunit B [Streptococcus pyogenes MGAS315] >gi|28896271|ref|NP_802621.1| F0F1 ATP synthase subunit B [Streptococcus pyogenes SSI-1] >gi|21904221|gb|AAM79102.1| putative putative proton-translocating ATPase subunit b [Streptococcus pyogenes MGAS315] >gi|28811522|dbj|BAC64454.1| putative proton-translocating ATPase, beta subunit [Streptococcus pyogenes SSI-1] (164 aa)
Score = 123, Expect = 2.2e-05, Identities = 36/144 (25%), Positives = 82/144 (56%)
  Q:    41 SLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           S+I LLLL+ + AW   +S ++ R+++I R ++ AE+++L +++    S+  L  S++ A++II +A+   +    K+ A A ++A +++ +  + I++ + +       E+S L +  A   +   +D+    ++ID  ++DL
  S:    18 SVIVLLLLIKKFAWGAIESILQTRSQQISRDIDQAEQSRLSAQQLEAKSQANLDASRSQASKIISDAKEIGQLQGDKLVAEATDEAKRLKEKALTDIEQSKSDAISAVKTEMSDLTVLLAKKIMGANLDKTAQSQLIDSYLDDL 161
>gi|47569804|ref|ZP_00240475.1| ATP synthase F0, B subunit [Bacillus cereus G9241] >gi|167940245|ref|ZP_02527320.1| ATP synthase F0, B subunit [Bacillus cereus AH1134] >gi|47553546|gb|EAL11926.1| ATP synthase F0, B subunit [Bacillus cereus G9241] (168 aa)
Score = 123, Expect = 2.4e-05, Identities = 41/143 (28%), Positives = 81/143 (56%)
  Q:    42 LIFLLLLVI--RLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
            IFLLLLV+  + AW P    ++ R + +  +++AAE++  E++K +   R  L +S+  A E+IE A+  A   K  I A A  +A  I++    +I++++ +       +V+ L+++ A   + K++ EE+  K+I D + ++
  S:    20 FIFLLLLVMLRKFAWGPLMGIMKEREEHVTNEIDAAERSNAEAKKLVEEQREMLKQSRVEAQELIERAKKQAVDQKDVIVAAAKEEAESIKASAVQEIQREKEQAIAALQEQVASLSVQIASKVIEKELKEEDQVKLIRDYIKEV 164
>gi|110598590|ref|ZP_01386858.1| ATP synthase F0, B subunit [Chlorobium ferrooxidans DSM 13031] >gi|110339824|gb|EAT58331.1| ATP synthase F0, B subunit [Chlorobium ferrooxidans DSM 13031] (175 aa)
Score = 123, Expect = 2.5e-05, Identities = 42/148 (28%), Positives = 81/148 (54%)
  Q:    40 ISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNL-----EVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLTAK 187
           ++ + +LL++ ++AW P  + +E R K IQ  ++ A  A+ E+E  L  +   L ++   + +II   +  A+K +  I      + +Q E++    + K E+E EKR+ L     EV+ LA++ A   +   +D +  KKI+D ++ D + K
  S:    26 VTFVIVLLILKKVAWGPILTALEEREKGIQSSIDRAYHAKDEAEAALRKNSELLAKADAESDKIIREGKDFADKLRTDI-----TEKAQAEAQKMISMAKDEIEQEKRRALNELRTEVADLAVKGAEKIIRGSLDADLQKKIVDSMIQDFSTK 173
>gi|56808119|ref|ZP_00365907.1| COG0711: F0F1-type ATP synthase, subunit b [Streptococcus pyogenes M49 591] >gi|71903221|ref|YP_280024.1| F0F1 ATP synthase subunit B [Streptococcus pyogenes MGAS6180] >gi|94988262|ref|YP_596363.1| F0F1 ATP synthase subunit B [Streptococcus pyogenes MGAS9429] >gi|94992136|ref|YP_600235.1| F0F1 ATP synthase subunit B [Streptococcus pyogenes MGAS2096] >gi|94994057|ref|YP_602155.1| F0F1 ATP synthase subunit B [Streptococcus pyogenes MGAS10750] >gi|71802316|gb|AAX71669.1| ATP synthase B chain [Streptococcus pyogenes MGAS6180] >gi|94541770|gb|ABF31819.1| ATP synthase B chain [Streptococcus pyogenes MGAS9429] >gi|94545644|gb|ABF35691.1| ATP synthase B chain [Streptococcus pyogenes MGAS2096] >gi|94547565|gb|ABF37611.1| ATP synthase B chain [Streptococcus pyogenes MGAS10750] (164 aa)
Score = 123, Expect = 2.5e-05, Identities = 36/144 (25%), Positives = 82/144 (56%)
  Q:    41 SLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           S+I LLLL+ + AW   +S ++ R+++I R ++ AE+++L +++    S+  L  S++ A++II +A+   +    K+ A A ++A +++ +  + I++ + +       E+S L +  A   +   +D+    ++ID  ++DL
  S:    18 SVIVLLLLIKKFAWGAIESILQTRSQQISRDIDQAEQSRLSAQQLEAKSQANLDASRSQASKIISDAKEIGQLQGDKLVAEATDEAKRLKEKALTDIEQSKSDAISAVKTEMSDLTVLLAEKIMGANLDKTAQSQLIDSYLDDL 161
>gi|19745843|ref|NP_606979.1| F0F1 ATP synthase subunit B [Streptococcus pyogenes MGAS8232] >gi|50913940|ref|YP_059912.1| F0F1 ATP synthase subunit B [Streptococcus pyogenes MGAS10394] >gi|94990141|ref|YP_598241.1| F0F1 ATP synthase subunit B [Streptococcus pyogenes MGAS10270] >gi|139474054|ref|YP_001128770.1| F0F1 ATP synthase subunit B [Streptococcus pyogenes str. Manfredo] >gi|19747991|gb|AAL97478.1| putative proton-translocating ATPase, subunit b [Streptococcus pyogenes MGAS8232] >gi|50903014|gb|AAT86729.1| ATP synthase B chain [Streptococcus pyogenes MGAS10394] >gi|94543649|gb|ABF33697.1| ATP synthase B chain [Streptococcus pyogenes MGAS10270] >gi|134272301|emb|CAM30555.1| ATP synthase B chain [Streptococcus pyogenes str. Manfredo] (164 aa)
Score = 123, Expect = 2.6e-05, Identities = 36/144 (25%), Positives = 82/144 (56%)
  Q:    41 SLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           S+I LLLL+ + AW   +S ++ R+++I R ++ AE+++L +++    S+  L  S++ A++II +A+   +    K+ A A ++A +++ +  + I++ + +       E+S L +  A   +   +D+    ++ID  ++DL
  S:    18 SVIVLLLLIKKFAWGAIESILQTRSQQISRDIDQAEQSRLSAQQLETKSQANLDASRSQASKIISDAKEIGQLQGDKLVAEATDEAKRLKEKALTDIEQSKSDAISAVKTEMSDLTVLLAEKIMGANLDKTAQSQLIDSYLDDL 161
>gi|163942997|ref|YP_001647881.1| F0F1 ATP synthase subunit B [Bacillus weihenstephanensis KBAB4] >gi|163865194|gb|ABY46253.1| ATP synthase F0, B subunit [Bacillus weihenstephanensis KBAB4] (168 aa)
Score = 122, Expect = 3.0e-05, Identities = 41/143 (28%), Positives = 80/143 (55%)
  Q:    42 LIFLLLLVI--RLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
            IFLLLLV+  + AW P    ++ R + +  +++AAE++  E++K +   R  L +S+  A E+IE A+  A   K  I A A  +A  I++    +I++++ +       +V+ L++  A   + K++ EE+  K+I D + ++
  S:    20 FIFLLLLVMLRKFAWGPLMGIMKEREEHVTNEIDAAERSNAEAKKLVEEQREMLKQSRVEAQELIERAKKQAVDQKDVIVAAAKEEAESIKTSAVQEIQREKEQAIAALQEQVASLSVHIASKVIEKELKEEDQVKLIRDYIKEV 164
>gi|16804571|ref|NP_466056.1| F0F1 ATP synthase subunit B [Listeria monocytogenes EGD-e] >gi|153175785|ref|ZP_01931089.1| ATP synthase F0, B subunit [Listeria monocytogenes FSL N3-165] >gi|16412021|emb|CAD00611.1| atpF [Listeria monocytogenes] >gi|133729210|gb|EBA30908.1| ATP synthase F0, B subunit [Listeria monocytogenes FSL N3-165] (170 aa)
Score = 122, Expect = 3.1e-05, Identities = 39/146 (26%), Positives = 78/146 (53%)
  Q:    39 VISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           + +   LL+L+   AWKP    ++ R + I  +++AAE+ + +SEK L   +  L +++  +  +IENA+   EK +++I   A  ++ +I+ E  S I +++ +       +V  L++  A   + K +DE+E   +I D +  L
  S:    21 LFAFAILLVLIRIYAWKPLMGIMKEREEHIGSEIDAAEENRAQSEKLLAEQKSVLQQARVESQTMIENAKQLGEKEREEIVKTARRESERIKEEAKSDIAREKEDAISALREQVGSLSVLIASKVIEKNLDEKEQSNLIQDYIERL 166
>gi|153197161|ref|ZP_01941431.1| ATP synthase F0, B subunit [Listeria monocytogenes 10403S] >gi|127633212|gb|EBA22629.1| ATP synthase F0, B subunit [Listeria monocytogenes 10403S] (170 aa)
Score = 121, Expect = 3.9e-05, Identities = 39/140 (27%), Positives = 75/140 (53%)
  Q:    45 LLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           LL+L+   AWKP    ++ R + I  +++AAE+ + +SEK L   +  L +++  +  +IENA+   EK +++I   A  ++ +I+ E  S I +++ +       +V  L++  A   + K +DE E   +I D +  L
  S:    27 LLVLIRIYAWKPLMGIMKEREEHIGSEIDAAEENRAQSEKLLAEQKSVLQQARVESQTMIENAKQLGEKEREEIVKTARRESERIKEEAKSDIAREKEDAISALREQVGSLSVLIASKVIEKNLDEREQSNLIQDYIERL 166
>gi|148377618|ref|YP_001256494.1| ATP synthase B chain [Mycoplasma agalactiae PG2] >gi|148291664|emb|CAL59050.1| ATP synthase B chain [Mycoplasma agalactiae PG2] (189 aa)
Score = 121, Expect = 4.2e-05, Identities = 37/156 (23%), Positives = 85/156 (54%)
  Q:    28 IFPNVYVLIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVND 183
           +FP   + +A +I+ I ++L++  L  KP K  ++AR   IQ+ ++ A+     S++ L+ +  +L E+ + A E+I+NA++  E    +    A NK+ +I  + + +I+ +  ++       ++K A+E +   + K++ +E   ++I + + D
  S:    33 LFPTWPMFLATLIAFILVVLILWFLLHKPIKKAMKARQDYIQKNIDEAKLTNDISKQKLNEANKRLAEAYSEADELIKNAKIHGESVIDEYTHKAKNKSKRIIEKAHMEIESERQKMVDDSKSNIAKAAIEISKKIMQKEVTKESQDEVIKNFLKD 188
>gi|30265332|ref|NP_847709.1| F0F1 ATP synthase subunit B [Bacillus anthracis str. Ames] >gi|47530871|ref|YP_022220.1| F0F1 ATP synthase subunit B [Bacillus anthracis str. 'Ames Ancestor'] >gi|49188145|ref|YP_031398.1| F0F1 ATP synthase subunit B [Bacillus anthracis str. Sterne] >gi|49481651|ref|YP_039301.1| F0F1 ATP synthase subunit B [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|52140253|ref|YP_086578.1| F0F1 ATP synthase subunit B [Bacillus cereus E33L] >gi|65317286|ref|ZP_00390245.1| COG0711: F0F1-type ATP synthase, subunit b [Bacillus anthracis str. A2012] >gi|118480348|ref|YP_897499.1| F0F1 ATP synthase subunit B [Bacillus thuringiensis str. Al Hakam] >gi|165873329|ref|ZP_02217932.1| ATP synthase F0, B subunit [Bacillus anthracis str. A0488] >gi|166996499|ref|ZP_02262959.1| F0F1 ATP synthase subunit B [Bacillus cereus AH820] >gi|167636373|ref|ZP_02394673.1| ATP synthase F0, B subunit [Bacillus anthracis str. A0442] >gi|167642058|ref|ZP_02400284.1| ATP synthase F0, B subunit [Bacillus anthracis str. A0193] >gi|170689700|ref|ZP_02880877.1| ATP synthase F0, B subunit [Bacillus anthracis str. A0465] >gi|170709432|ref|ZP_02899840.1| ATP synthase F0, B subunit [Bacillus anthracis str. A0389] >gi|177656025|ref|ZP_02937132.1| ATP synthase F0, B subunit [Bacillus anthracis str. A0174] >gi|190569415|ref|ZP_03022299.1| ATP synthase F0, B subunit [Bacillus anthracis Tsiankovskii-I] >gi|196036316|ref|ZP_03103714.1| ATP synthase F0, B subunit [Bacillus cereus W] >gi|196039504|ref|ZP_03106809.1| ATP synthase F0, B subunit [Bacillus cereus NVH0597-99] >gi|196045683|ref|ZP_03112913.1| ATP synthase F0, B subunit [Bacillus cereus 03BB108] >gi|30260010|gb|AAP29195.1| ATP synthase F0, B subunit [Bacillus anthracis str. Ames] >gi|47506019|gb|AAT34695.1| ATP synthase F0, B subunit [Bacillus anthracis str. 'Ames Ancestor'] >gi|49182072|gb|AAT57448.1| ATP synthase F0, B subunit [Bacillus anthracis str. Sterne] >gi|49333207|gb|AAT63853.1| ATP synthase F0, subunit B [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|51973722|gb|AAU15272.1| ATP synthase F0, subunit B [Bacillus cereus E33L] >gi|118419573|gb|ABK87992.1| ATP synthase F0, subunit B [Bacillus thuringiensis str. Al Hakam] >gi|164710926|gb|EDR16500.1| ATP synthase F0, B subunit [Bacillus anthracis str. A0488] >gi|167509976|gb|EDR85396.1| ATP synthase F0, B subunit [Bacillus anthracis str. A0193] >gi|167528207|gb|EDR90989.1| ATP synthase F0, B subunit [Bacillus anthracis str. A0442] >gi|170125665|gb|EDS94584.1| ATP synthase F0, B subunit [Bacillus anthracis str. A0389] >gi|170666342|gb|EDT17128.1| ATP synthase F0, B subunit [Bacillus anthracis str. A0465] >gi|172079880|gb|EDT64989.1| ATP synthase F0, B subunit [Bacillus anthracis str. A0174] >gi|190559470|gb|EDV13471.1| ATP synthase F0, B subunit [Bacillus anthracis Tsiankovskii-I] >gi|195991108|gb|EDX55078.1| ATP synthase F0, B subunit [Bacillus cereus W] >gi|196023514|gb|EDX62191.1| ATP synthase F0, B subunit [Bacillus cereus 03BB108] >gi|196029664|gb|EDX68266.1| ATP synthase F0, B subunit [Bacillus cereus NVH0597-99] (168 aa)
Score = 121, Expect = 4.3e-05, Identities = 41/143 (28%), Positives = 80/143 (55%)
  Q:    42 LIFLLLLVI--RLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
            IFLLLLV+  + AW P    ++ R + +  +++AAE+   E++K +   R  L +S+  A E+IE A+  A   K  I A A  +A  I++    +I++++ +       +V+ L+++ A   + K++ EE+  K+I D + ++
  S:    20 FIFLLLLVMLRKFAWGPLMGIMKEREEHVANEIDAAERNNAEAKKLVEEQREMLKQSRVEAQELIERAKKQAVDQKDVIVAAAKEEAESIKASAVQEIQREKEQAIAALQEQVASLSVQIASKVIEKELKEEDQVKLIRDYIKEV 164
>gi|168142837|ref|ZP_02586066.1| ATP synthase F0, B subunit [Bacillus cereus G9842] (168 aa)
Score = 121, Expect = 4.3e-05, Identities = 40/143 (27%), Positives = 81/143 (56%)
  Q:    42 LIFLLLLVI--RLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
            IFL+LLV+  + AW P    ++ R + +  +++AAE++  E++K +   R  L +S+  A E+IE A+  A   K  I A A  +A  I++    +I++++ +       +V+ L+++ A   + K++ EE+  K+I D + ++
  S:    20 FIFLILLVMLRKFAWGPLMGIMKEREEHVTNEIDAAERSNAEAKKLVEEQREMLKQSRVEAQELIERAKKQAVDQKDVIVAAAKEEAESIKASAVQEIQREKEQAIAALQEQVASLSVQIASKVIEKELKEEDQVKLIRDYIKEV 164
>gi|30023341|ref|NP_834972.1| F0F1 ATP synthase subunit B [Bacillus cereus ATCC 14579] >gi|168136013|ref|ZP_02579242.1| F0F1 ATP synthase subunit B [Bacillus cereus B4264] >gi|29898902|gb|AAP12173.1| ATP synthase B chain [Bacillus cereus ATCC 14579] (168 aa)
Score = 120, Expect = 4.5e-05, Identities = 41/143 (28%), Positives = 80/143 (55%)
  Q:    42 LIFLLLLVI--RLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
            IFLLLLV+  + AW P    ++ R + +  +++AAE+   E++K +   R  L +S+  A E+IE A+  A   K  I A A  +A  I++    +I++++ +       +V+ L+++ A   + K++ EE+  K+I D + ++
  S:    20 FIFLLLLVMLRKFAWGPLMGIMKEREEHVANEIDAAERNNAEAKKLVEEQREMLKQSRVEAQELIERAKKQAVDQKDVIVAAAKEEAESIKASAVQEIQREKEQAIAALQEQVASLSVQIASKVIEKELKEEDQVKLIRDYIKEV 164
>gi|134301274|ref|YP_001121242.1| F0F1 ATP synthase subunit B [Francisella tularensis subsp. tularensis WY96-3418] >gi|134049051|gb|ABO46122.1| ATP synthase F0, B subunit [Francisella tularensis subsp. tularensis WY96-3418] (156 aa)
Score = 120, Expect = 5.2e-05, Identities = 40/147 (27%), Positives = 82/147 (55%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIV 181
           LI  +I+    +   ++  W P +  +E R ++I   + +A++A  E E     S   L E+K  A EIIENA + A K  ++ +  A+  A +I+S   ++I++++++ +++   E+  LA+  A   ++  +DE+ +KK+++D V
  S:     7 LIGQMITFAIFVGFTMKFVWPPLRKALEERREKIAEGLASADRASRELEVAKRQSAEILREAKAKATEIIENAYVRAHKVDEQAKEEAIAAADKIKSMAIAEIEQEKVKAKEQLKQELVNLAMAAASKIIAASVDEKASKKVLEDFV 153
>gi|169351555|ref|ZP_02868493.1| hypothetical protein CLOSPI_02335 [Clostridium spiroforme DSM 1552] >gi|169291777|gb|EDS73910.1| hypothetical protein CLOSPI_02335 [Clostridium spiroforme DSM 1552] (167 aa)
Score = 120, Expect = 5.3e-05, Identities = 34/161 (21%), Positives = 85/161 (52%)
  Q:    24 IINQIFPNVYVLIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           I +++FPN+  LI  +++   +L +  +  WKP ++Y   R   I+  +  A+  Q +++  +  S  +   +      I+E A++DA KT+  I   A  +A +       +I+ ++L  +     E+  +A++ A   ++++++++ N+K++D+ + ++
  S:     5 IASKLFPNITTLIVQLLATAVMLYIFKKFLWKPMQNYFAKRADYIEGTVNDAKNMQQKAKALMEASEEQSRAAAKEYRNIVEKAKIDAGKTRDSIIEKANEEAKEKLDRVSKEIEAEKLAAKAEVKSEIVNIAIDVASKIMNQEMNQKTNEKLVDEFIKEI 165
>gi|184154913|ref|YP_001843253.1| F1F0-ATPase B subunit [Lactobacillus fermentum IFO 3956] >gi|183226257|dbj|BAG26773.1| F1F0-ATPase B subunit [Lactobacillus fermentum IFO 3956] (168 aa)
Score = 120, Expect = 5.4e-05, Identities = 31/150 (20%), Positives = 79/150 (52%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           ++ +++S + +  LV   AWKP    ++ R  +I   +++A +++ E++K     + +L  S+  AA I++NA+   E  + +I A A   A  ++++     ++   +  +    +++ L++E A   + K+++ ++ + +ID  +  L
  S:    15 MLFYLVSFLIMAALVWHFAWKPVTQMMQKRADKIANDIDSAAQSREEAQKLAAKRQEELKGSRQEAARIVDNAKQAGESQRAEIIATAQQDAQNLKNQAQKDAEQARQDALRGAKKDIANLSIEIASKLIHKQLNADDQQALIDTYIEGL 164
>gi|46908705|ref|YP_015094.1| F0F1 ATP synthase subunit B [Listeria monocytogenes str. 4b F2365] >gi|47094112|ref|ZP_00231836.1| ATP synthase F0, B subunit [Listeria monocytogenes str. 4b H7858] >gi|153168638|ref|ZP_01928461.1| ATP synthase F0, B subunit [Listeria monocytogenes FSL N1-017] >gi|153204119|ref|ZP_01944969.1| ATP synthase F0, B subunit [Listeria monocytogenes HPB2262] >gi|167015621|ref|ZP_02278154.1| F0F1 ATP synthase subunit B [Listeria monocytogenes FSL J1-194] >gi|167218322|ref|ZP_02287958.1| F0F1 ATP synthase subunit B [Listeria monocytogenes FSL J1-175] >gi|46881977|gb|AAT05271.1| ATP synthase F0, B subunit [Listeria monocytogenes str. 4b F2365] >gi|47017519|gb|EAL08328.1| ATP synthase F0, B subunit [Listeria monocytogenes str. 4b H7858] >gi|133726201|gb|EBA27899.1| ATP synthase F0, B subunit [Listeria monocytogenes FSL N1-017] >gi|133734351|gb|EBA36049.1| ATP synthase F0, B subunit [Listeria monocytogenes HPB2262] (170 aa)
Score = 120, Expect = 5.4e-05, Identities = 37/146 (25%), Positives = 79/146 (54%)
  Q:    39 VISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           + +   LL+L+   AWKP    ++ R + I  +++AAE+++ ++E+ L   +  L +++  +  +IENA+   EK +++I   A  ++ +I+ E  S I +++ +       +V  L++  A   + K +DE+E   +I D +  L
  S:    21 LFAFAILLVLIRIYAWKPLMGVMKEREEHIGSEIDAAEESRAQAEQLLAEQKSVLQQARVESQTMIENAKQLGEKEREEIVKTARRESERIKEEAKSDIAREKEDAISALREQVGSLSVLIASKVIEKNLDEKEQSNLIQDYIERL 166
>gi|15674804|ref|NP_268978.1| F0F1 ATP synthase subunit B [Streptococcus pyogenes M1 GAS] >gi|71910390|ref|YP_281940.1| F0F1 ATP synthase subunit B [Streptococcus pyogenes MGAS5005] >gi|13621934|gb|AAK33699.1| putative proton-translocating ATPase, subunit b [Streptococcus pyogenes M1 GAS] >gi|71853172|gb|AAZ51195.1| ATP synthase B chain [Streptococcus pyogenes MGAS5005] (164 aa)
Score = 120, Expect = 5.6e-05, Identities = 36/144 (25%), Positives = 81/144 (56%)
  Q:    41 SLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           S+I LLLL+ + AW   +S ++ R+++I R ++ AE+++L +++    S+  L  S+  A++II +A+   +    K+ A A ++A +++ +  + I++ + +       E+S L +  A   +   +D+    ++ID  ++DL
  S:    18 SVIVLLLLIKKFAWGAIESILQTRSQQISRDIDQAEQSRLSAQQLEAKSQANLDASRLQASKIISDAKEIGQLQGDKLVAEATDEAKRLKEKALTDIEQSKSDAISAVKTEMSDLTVLLAEKIMGANLDKTAQSQLIDSYLDDL 161
>gi|145301176|ref|YP_001144017.1| F0F1 ATP synthase subunit B [Aeromonas salmonicida subsp. salmonicida A449] >gi|142853948|gb|ABO92269.1| F0F1 ATP synthase subunit B [Aeromonas salmonicida subsp. salmonicida A449] (156 aa)
Score = 120, Expect = 5.8e-05, Identities = 38/150 (25%), Positives = 75/150 (50%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           L+   ++ I  +   ++  W P  + IEAR K I   + +AE+A+ + +     +  +L E+K  AA+IIE A     +   +    A  +  +I ++G ++I  +    ++    +V+ LA+  A   L++ ID+  N  I+D +V +L
  S:     7 LLGQTLAFIIFVWCCMKFVWPPLMAAIEARQKAIADGLSSAERAKKDLDLAKANATDQLKEAKLQAAQIIEQANKRKAQIIDEAAVGAHTEREKILAQGRAEIDAERHRAKEELRKQVAALAIAGAEKILARHIDQAANSDIVDKLVAEL 156
>gi|54114083|gb|AAV29675.1| NT02FT1768 [synthetic construct] (156 aa)
Score = 119, Expect = 6.0e-05, Identities = 39/147 (26%), Positives = 83/147 (56%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIV 181
           LI  +I+    +   ++  W P +  +E R ++I   + +A++A  E E     S   L E+K  A EI+ENA + A K  ++ +  A+  A +I+S   ++I++++++ +++   E+  LA+  A   ++  +DE+ +KK+++D+V
  S:     7 LIGQMITFAIFVGFTMKFVWPPLRKALEERREKIAEGLASADRASRELEVAKRQSAEILREAKAKATEIVENAYVRAHKVDEQAKEEAIAAADKIKSMAIAEIEQEKVKAKEQLKQELVNLAMAAASKIIAASVDEKASKKVLEDLV 153
>gi|89257062|ref|YP_514424.1| F0F1 ATP synthase subunit B [Francisella tularensis subsp. holarctica] >gi|115315418|ref|YP_764141.1| F0F1 ATP synthase subunit B [Francisella tularensis subsp. holarctica OSU18] >gi|156503272|ref|YP_001429337.1| F0F1 ATP synthase subunit B [Francisella tularensis subsp. holarctica FTNF002-00] >gi|167009449|ref|ZP_02274380.1| ATP synthase F0, B subunit [Francisella tularensis subsp. holarctica FSC200] >gi|89144893|emb|CAJ80238.1| ATP synthase B chain [Francisella tularensis subsp. holarctica LVS] >gi|115130317|gb|ABI83504.1| H(+)-transporting two-sector ATPase [Francisella tularensis subsp. holarctica OSU18] >gi|134254110|gb|EBA53204.1| ATP synthase B chain [Francisella tularensis subsp. holarctica 257] >gi|156253875|gb|ABU62381.1| ATP synthase F0, B subunit [Francisella tularensis subsp. holarctica FTNF002-00] >gi|157122869|gb|EDO66986.1| ATP synthase B chain [Francisella tularensis subsp. holarctica FSC022] (156 aa)
Score = 119, Expect = 6.0e-05, Identities = 39/147 (26%), Positives = 82/147 (55%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIV 181
           LI  +I+    +   ++  W P +  +E R ++I   + +A++A  E E     S   L E+K  A EI+ENA + A K  ++ +  A+  A +I+S   ++I++++++ +++   E+  LA+  A   ++  +DE+ +KK+++D V
  S:     7 LIGQMITFAIFIGFTMKFVWPPLRKALEERREKIAEGLASADRASRELEVAKRQSAEILREAKAKATEIVENAYVRAHKVDEQAKEEAIAAADKIKSMAIAEIEQEKVKAKEQLKQELVNLAMAAASKIIAASVDEKASKKVLEDFV 153
>gi|56707239|ref|YP_169135.1| F0F1 ATP synthase subunit B [Francisella tularensis subsp. tularensis SCHU S4] >gi|110669709|ref|YP_666266.1| F0F1 ATP synthase subunit B [Francisella tularensis subsp. tularensis FSC198] >gi|118498212|ref|YP_899262.1| F0F1 ATP synthase subunit B [Francisella tularensis subsp. novicida U112] >gi|187931016|ref|YP_001891000.1| ATP synthase, F0 sector, subunit b [Francisella tularensis subsp. mediasiatica FSC147] >gi|194324396|ref|ZP_03058169.1| ATP synthase F0, B subunit [Francisella tularensis subsp. novicida FTE] >gi|56603731|emb|CAG44693.1| ATP synthase B chain [Francisella tularensis subsp. tularensis SCHU S4] >gi|110320042|emb|CAL08076.1| ATP synthase B chain [Francisella tularensis subsp. tularensis FSC 198] >gi|118424118|gb|ABK90508.1| ATP synthase, F0 sector, subunit b [Francisella tularensis subsp. novicida U112] >gi|151568170|gb|EDN33824.1| hypothetical protein FTBG_01516 [Francisella tularensis subsp. tularensis FSC033] >gi|151571280|gb|EDN36934.1| ATP synthase [Francisella tularensis subsp. novicida GA99-3549] >gi|151572738|gb|EDN38392.1| ATP synthase B chain [Francisella tularensis subsp. novicida GA99-3548] >gi|187711925|gb|ACD30222.1| ATP synthase, F0 sector, subunit b [Francisella tularensis subsp. mediasiatica FSC147] >gi|194321461|gb|EDX18946.1| ATP synthase F0, B subunit [Francisella tularensis subsp. novicida FTE] (156 aa)
Score = 119, Expect = 6.2e-05, Identities = 39/147 (26%), Positives = 82/147 (55%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIV 181
           LI  +I+    +   ++  W P +  +E R ++I   + +A++A  E E     S   L E+K  A EI+ENA + A K  ++ +  A+  A +I+S   ++I++++++ +++   E+  LA+  A   ++  +DE+ +KK+++D V
  S:     7 LIGQMITFAIFVGFTMKFVWPPLRKALEERREKIAEGLASADRASRELEVAKRQSAEILREAKAKATEIVENAYVRAHKVDEQAKEEAIAAADKIKSMAIAEIEQEKVKAKEQLKQELVNLAMAAASKIIAASVDEKASKKVLEDFV 153
>gi|157150236|ref|YP_001450825.1| F0F1 ATP synthase subunit B [Streptococcus gordonii str. Challis substr. CH1] >gi|157075030|gb|ABV09713.1| ATP synthase F0, B subunit [Streptococcus gordonii str. Challis substr. CH1] (164 aa)
Score = 119, Expect = 6.8e-05, Identities = 38/144 (26%), Positives = 74/144 (51%)
  Q:    41 SLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           S + L++L+ + AW    S  E R K+I   +++AE A+  +E         L  S+  AA I+E A+  AEK K  I A    + S+++ +   +I + + E  +    +V+ L+++ A   + + +D+E   ++ID  ++ L
  S:    18 SFLLLIVLIKKFAWGNITSIFEERAKKISDDIDSAESARKNAEVLEQKREEALAGSREEAATIVETAKETAEKNKASILADTTEEVSRLKQKANQEIAQSKAEALRSIKGDVADLSIDLASKIIGQTLDKEAQSQLIDSYIDKL 161
>gi|71894424|ref|YP_278532.1| ATP synthase B chain [Mycoplasma synoviae 53] (180 aa)
Score = 119, Expect = 6.8e-05, Identities = 39/160 (24%), Positives = 86/160 (53%)
  Q:    26 NQIFPNVYVLIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLT 185
           N +FP++ +++A  I+ + + LL+    + P K  I  R + IQ +++ + KA+ +S   L  ++ +L+ES   +  I+ NA+  A++     +  A++ A+++  E    + +++ E +K   + +++ A E A   L ++I +    +II D + D T
  S:    16 NNLFPSIPMMLATFIAFVIVFLLLFFFLYNPVKKMIRKRQEFIQSQIDDSIKAKEDSLAKLSQAQAELIESHKQSVNIVNNAKSKAQEILASYKNKAISDANRLIEETQIDLNERKKEFDKNSRILIAETATEIAQRILKREISKSTQDEIIKDFLEDKT 175
>gi|47096956|ref|ZP_00234532.1| ATP synthase F0, B subunit [Listeria monocytogenes str. 1/2a F6854] >gi|153180622|ref|ZP_01933665.1| ATP synthase F0, B subunit [Listeria monocytogenes F6900] >gi|153184891|ref|ZP_01935539.1| ATP synthase F0, B subunit [Listeria monocytogenes J0161] >gi|153192189|ref|ZP_01939234.1| ATP synthase F0, B subunit [Listeria monocytogenes J2818] >gi|168266765|ref|ZP_02688730.1| ATP synthase F0, B subunit [Listeria monocytogenes FSL J2-071] >gi|47014666|gb|EAL05623.1| ATP synthase F0, B subunit [Listeria monocytogenes str. 1/2a F6854] >gi|126942403|gb|EBA20142.1| ATP synthase F0, B subunit [Listeria monocytogenes J0161] >gi|127764517|gb|EBA25049.1| ATP synthase F0, B subunit [Listeria monocytogenes J2818] >gi|133732015|gb|EBA33713.1| ATP synthase F0, B subunit [Listeria monocytogenes F6900] (170 aa)
Score = 119, Expect = 6.9e-05, Identities = 37/140 (26%), Positives = 77/140 (55%)
  Q:    45 LLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           LL+L+   AWKP    ++ R + I  +++AAE+++ ++E+ L   +  L +++  +  +IENA+   EK +++I   A  ++ +I+ E  S I +++ +       +V  L++  A   + K +DE+E   +I D +  L
  S:    27 LLVLIRIYAWKPLMGIMKEREEHIGSEIDAAEESRAQAEQLLAEQKSVLQQARVESQTMIENAKQLGEKEREEIVKTARRESERIKEEAKSDIAREKEDAISALREQVGSLSVLIASKVIEKNLDEKEQSNLIQDYIERL 166
>gi|116618949|ref|YP_819320.1| F0F1-type ATP synthase, subunit b [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|116097796|gb|ABJ62947.1| F0F1-type ATP synthase, subunit b [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (167 aa)
Score = 119, Expect = 7.4e-05, Identities = 32/149 (21%), Positives = 80/149 (53%)
  Q:    39 VISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLTAK 187
           +I+ + L+L++ ++A+ P    ++ R  +I   ++ AE A+ E+EK     + +L E++  A +++ +A+  A+K    I + A ++A+ +  +  +  +K + +       +V+ L++  A   + K++   + + +ID  ++DL  K
  S:    19 IIAFLLLMLILKKVAYGPLTKVLDERADKISSDIDGAEVARQEAEKLASQRQAELAETRQNATKVVNDAKASAQKQSDLIVSAANDRAASVSQQAQTDAQKLKEDAISGAKNDVAALSVAIASKLMQKELSLNDQQALIDAYISDLETK 167
>gi|195977923|ref|YP_002123167.1| ATP synthase B chain AtpF [Streptococcus equi subsp. zooepidemicus str. MGCS10565] >gi|195974628|gb|ACG62154.1| ATP synthase B chain AtpF [Streptococcus equi subsp. zooepidemicus str. MGCS10565] (164 aa)
Score = 118, Expect = 8.2e-05, Identities = 36/144 (25%), Positives = 80/144 (55%)
  Q:    41 SLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           S+I LLLL+   AW   ++ ++AR+++I + ++ AE+A+L +++     +  L  S++ A++I+E A+   +  + +I A A  +A ++++   + I+  + E       E+S L +  A   +   +D+    ++ID  ++DL
  S:    18 SVIVLLLLIKAFAWGAIEAVLQARSQQISQDIDQAEQARLNAQQLEKEGQANLEASRSEASQIVEAAKETGKAQETRIVAEATEEADRLKAVALTDIEHSKSEAISAVKTEMSDLTVLLAEKIMGANLDKAAQSQLIDRYLDDL 161
>gi|144575097|gb|AAZ43821.2| ATP synthase B chain [Mycoplasma synoviae 53] (193 aa)
Score = 118, Expect = 8.6e-05, Identities = 39/160 (24%), Positives = 86/160 (53%)
  Q:    26 NQIFPNVYVLIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLT 185
           N +FP++ +++A  I+ + + LL+    + P K  I  R + IQ +++ + KA+ +S   L  ++ +L+ES   +  I+ NA+  A++     +  A++ A+++  E    + +++ E +K   + +++ A E A   L ++I +    +II D + D T
  S:    29 NNLFPSIPMMLATFIAFVIVFLLLFFFLYNPVKKMIRKRQEFIQSQIDDSIKAKEDSLAKLSQAQAELIESHKQSVNIVNNAKSKAQEILASYKNKAISDANRLIEETQIDLNERKKEFDKNSRILIAETATEIAQRILKREISKSTQDEIIKDFLEDKT 188
>gi|159900581|ref|YP_001546828.1| ATP synthase F0, B subunit [Herpetosiphon aurantiacus ATCC 23779] >gi|159893620|gb|ABX06700.1| ATP synthase F0, B subunit [Herpetosiphon aurantiacus ATCC 23779] (164 aa)
Score = 118, Expect = 8.8e-05, Identities = 34/151 (22%), Positives = 80/151 (52%)
  Q:    34 VLIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           +LI+ +++   L  L+    +KP  + ++AR++ I+  ++ AEK + +  +       KL E++     II  A+  A   + ++  VA N A++IE E   K++++  ++ +    +++ L  ETA   L +++  + + ++I+  ++ L
  S:    10 LLISQIVNFCLLAFLLNTFLYKPVLNALQARSERIRESLDNAEKVKQQLARVDADYEAKLQEARREGQTIISQAQERARAQEAELLVVARNNAAKIEEEARGKVEQERQQVLRGLQGQLASLVTETASNVLGRELQTKGHDELINKSIDQL 160
>gi|161507272|ref|YP_001577226.1| F0F1 ATP synthase subunit B [Lactobacillus helveticus DPC 4571] >gi|160348261|gb|ABX26935.1| H+-transporting ATP synthase subunit b [Lactobacillus helveticus DPC 4571] (169 aa)
Score = 118, Expect = 8.8e-05, Identities = 35/147 (23%), Positives = 74/147 (50%)
  Q:    38 HVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           ++I    LLLL+   AW P    +E R +++   +++A   + ++E   +     L  S+  A +I+ +A+ +A+KT K+I A A   A+ I  +   +  K + +       +V+ ++L  A   ++K +  E+ K ++D  + +L
  S:    21 YLICFAILLLLIKHFAWGPVSDMMEKRRQKVINDLDSAASDRKKAETLANEREAALKNSRQEATQILSDAKANAQKTGKEIVASANEDAAAIRKKANEEAAKAKSDALDSARDQVADISLAIAEKVIAKNLSAEDQKDLVDQFIKEL 167
>gi|116873897|ref|YP_850678.1| F0F1 ATP synthase subunit B [Listeria welshimeri serovar 6b str. SLCC5334] >gi|116742775|emb|CAK21899.1| atpF [Listeria welshimeri serovar 6b str. SLCC5334] (170 aa)
Score = 118, Expect = 9.8e-05, Identities = 36/146 (24%), Positives = 79/146 (54%)
  Q:    39 VISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           + +   LL+L+   AWKP    ++ R + I  +++AAE+++ ++E+ L   +  L +++  +  +IENA+   EK +++I   A  ++ +I+ E  + I +++ +       +V  L++  A   + K +DE+E   +I D +  L
  S:    21 LFAFAILLVLIRIYAWKPLMGVMKEREEHIGSEIDAAEESRAQAEQLLAEQKSVLQQARVESQTMIENAKQLGEKEREEIVKTARRESERIKEEAKTDIAREKEDAISALREQVGSLSVLIASKVIEKNLDEKEQSNLIQDYIERL 166
>gi|188587438|ref|YP_001918983.1| ATP synthase F0, B subunit [Natranaerobius thermophilus JW/NM-WN-LF] >gi|179352125|gb|ACB86395.1| ATP synthase F0, B subunit [Natranaerobius thermophilus JW/NM-WN-LF] (162 aa)
Score = 118, Expect = 1.0e-04, Identities = 40/155 (25%), Positives = 82/155 (52%)
  Q:    30 PNVYVLIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           PN+   +  +++++ L  L+ R  +KP   ++E R  EI++ +E AEK + E+EK       KL  +K+ A EII+ A    E+  K+ +  A  +A  + +    +I +++ +  +    EVS L ++     L+  ID+++ KK++   + ++
  S:     4 PNLVTFVLTIVNILVLFYLLKRFLFKPIGEFMENRKNEIKQNLEDAEKERQEAEKLKEQYYEKLRGAKSEAQEIIQQARQREEEIIKEAKQEAKQEADDMIARAREEINQEQKKAIESLRSEVSDLTIQITERVLNDTIDKDQQKKLVQKYLKEV 158
>gi|16801738|ref|NP_472006.1| F0F1 ATP synthase subunit B [Listeria innocua Clip11262] >gi|167344643|ref|ZP_02290484.1| F0F1 ATP synthase subunit B [Listeria monocytogenes FSL J1-208] >gi|16415213|emb|CAC97903.1| atpF [Listeria innocua] (170 aa)
Score = 117, Expect = 1.0e-04, Identities = 36/146 (24%), Positives = 79/146 (54%)
  Q:    39 VISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           + +   LL+L+   AWKP    ++ R + I  +++AAE+++ ++E+ L   +  L +++  +  +IENA+   EK +++I   A  ++ +I+ E  + I +++ +       +V  L++  A   + K +DE+E   +I D +  L
  S:    21 LFAFAILLVLIRIYAWKPLMGVMKEREEHIGSEIDAAEESRAQAEQLLAEQKSVLQQARVESQTMIENAKQLGEKEREEIVKTARRESERIKEEAKADIAREKEDAISALREQVGSLSVLIASKVIEKNLDEKEQSNLIQDYIERL 166
>gi|119947327|ref|YP_945007.1| ATP synthase F0, B subunit [Psychromonas ingrahamii 37] >gi|119865931|gb|ABM05408.1| ATP synthase F0, B subunit [Psychromonas ingrahamii 37] (156 aa)
Score = 117, Expect = 1.0e-04, Identities = 42/150 (28%), Positives = 74/150 (49%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           L+   I+    +   ++  W P  + IE R K+I   +  AE+A  + E     +  KL E+K  AAEIIE A     +  +  +  A  +  +I ++G ++++     + +   L+VS LA+  A   + + ID+E N  IID +V +L
  S:     7 LLGQAIAFAVFVWFCMKYVWPPLLAAIEDRQKKISDGLTQAERAGKDLELAQAKASEKLKEAKVQAAEIIEQANKRRNQIVEAAKTEAETERQKIIAQGEAEVEVDRNRVREELRLKVSALAIAGAEKIIKRSIDKEANSDIIDKLVAEL 156
>gi|149183574|ref|ZP_01861996.1| ATP synthase (subunit b) [Bacillus sp. SG-1] >gi|148848715|gb|EDL62943.1| ATP synthase (subunit b) [Bacillus sp. SG-1] (170 aa)
Score = 117, Expect = 1.1e-04, Identities = 36/149 (24%), Positives = 79/149 (53%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVND 183
           ++  ++  I LL L+ + AW P    ++ R   I  ++ AAE+++ E+   L   R  L E++  A  +IEN++   E+ +++I A A  +  +++     +I+ Q+ +       +VS L++  A   + K++  E+ +K+I+D + +
  S:    17 ILFQLVMFIVLLALLKKFAWGPLMGIMKEREDHIASEINAAEESRTEANNLLEEQRQLLKEARQEAQTMIENSKKQGEQQREEIIATARAEGERLKEAAKREIETQKEQAVTALREQVSSLSVLIASKVIEKELSAEDQQKLINDYIQE 165
>gi|114619|sp|P26681|ATPF_ENTHR ATP synthase B chain >gi|153569|gb|AAA26855.1| H+ ATPase >gi|153577|gb|AAA26862.1| F1F0-ATPase beta subunit (174 aa)
Score = 117, Expect = 1.1e-04, Identities = 36/150 (24%), Positives = 79/150 (52%)
  Q:    41 SLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLTAKLES 190
           S + L+ L+   AW P    ++ R  +I   +++AEK+++ S K       +LL S++ AA+II+NA+   E +++ I      + ++++S+  + I  +          +V+ L+L+ A   L+K++  E ++ +I+  +  L +  E+
  S:    24 SFLILMFLLKHFAWGPISDILKKREDKIANDLDSAEKSRINSAKMEQEREQQLLASRSDAADIIKNAKESGELSRQNILKETQEEVARLKSKAQTDIMLERDTALNSVKDDVADLSLQIAAKILNKELSPEMHESLINQYIEGLGSSNET 173
>gi|125717632|ref|YP_001034765.1| F0F1 ATP synthase subunit B [Streptococcus sanguinis SK36] >gi|125497549|gb|ABN44215.1| Proton-translocating ATPase, F0 sector, subunit b, putative [Streptococcus sanguinis SK36] (164 aa)
Score = 117, Expect = 1.1e-04, Identities = 41/152 (26%), Positives = 77/152 (50%)
  Q:    33 YVLIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           ++LIA   S + L+ L+ + AW      ++ R ++I   ++ AE A+ ++E         L  S+  A  I+E A+  AEK K  I A A  +A +++++   +I + + E       EV+ L +  A   LS+++D+E   ++ID  +  L
  S:    12 FILIAG--SFLLLVFLIKKFAWGNIIGILDQRAQKISDDIDGAEAARKKAEDLAQKREDALAGSRVEAVSIVETAKETAEKNKAGILANAAEEAGRLKAKANQEIAQNKAEAMSSIKGEVADLTVTLASKILSQELDKEAQSELIDRYIKQL 161
>gi|86160753|ref|YP_467538.1| ATP synthase F0, B subunit [Anaeromyxobacter dehalogenans 2CP-C] >gi|85777264|gb|ABC84101.1| ATP synthase F0, B subunit [Anaeromyxobacter dehalogenans 2CP-C] (179 aa)
Score = 117, Expect = 1.3e-04, Identities = 30/147 (20%), Positives = 79/147 (53%)
  Q:    40 ISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLTA 186
           I+ + +L ++ + AW P    +  R + I+  +++A+K + E+E+ L   +  L +++  AAE+    + + E  ++++ A A  +A ++ +E   +I ++ ++ +     +V  LA++ A   +   +DE+  + ++++ +  L A
  S:    29 ITFLVMLAVLAKFAWGPIVKMLAERERSIREAIDSAKKERAEAERLLAAQKESLSKAQREAAELARRNQQEVEALRQELTAKARKEADELVAEARRQIAEELVKAKAELKAQVVDLAIDAASRLVKANLDEKSQRALVEEYIAQLPA 175
>gi|4100653|gb|AAD00914.1| proton-translocating ATPase b subunit [Streptococcus sanguinis] (164 aa)
Score = 117, Expect = 1.3e-04, Identities = 38/144 (26%), Positives = 72/144 (50%)
  Q:    41 SLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           S + L+ L+ + AW      ++ R ++I   ++ AE A+ ++E         L  S+  A  I+E A+  AEK K  I A A  +A +++++   +I + + E       EV+ L +  A   LS+++D+E   ++ID  +  L
  S:    18 SFLLLVFLIKKFAWGNIVGILDQRAQKISDDIDGAEAARKKAEDLAQKREEALAGSRAEAVAIVETAKETAEKNKAGILADAAEEAGRLKAKANQEIAQNKAEAMSSIKGEVADLTVTLASKILSQELDKEAQSELIDRYIKQL 161
>gi|29377097|ref|NP_816251.1| ATP synthase F0, B subunit [Enterococcus faecalis V583] >gi|29344563|gb|AAO82321.1| ATP synthase F0, B subunit [Enterococcus faecalis V583] (176 aa)
Score = 116, Expect = 1.4e-04, Identities = 35/144 (24%), Positives = 79/144 (54%)
  Q:    41 SLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           + + L+LL+ + AW      +  R ++I   +++AE++++ + K     + +LL S++ AAEII+NA+   E+T++K       + +++  +  + I ++  E       EV+ L+L+ A   L+K++  + ++ +ID  +  L
  S:    26 AFLILMLLLKKYAWGAIVDILTQREEKIANDLDSAEQSRVAAAKMEKERQQQLLSSRSEAAEIIKNAKESGEQTRQKTLKETTAEVTRLREKARTDISQEREEALSSVKNEVADLSLQIAAKILNKELTPDAHEALIDSYIESL 169
>gi|160914782|ref|ZP_02076996.1| hypothetical protein EUBDOL_00789 [Eubacterium dolichum DSM 3991] >gi|158433322|gb|EDP11611.1| hypothetical protein EUBDOL_00789 [Eubacterium dolichum DSM 3991] (172 aa)
Score = 116, Expect = 1.4e-04, Identities = 36/158 (22%), Positives = 75/158 (47%)
  Q:    24 IINQIFPNVYVLIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIV 181
           I N +  +V  +I  ++S + L L      W     Y + R   I   ++A   A+ E E        +L  +K  A EIIE A+  A + +K++ A A  +A  ++++    +++++ + ++     +  +A E A   + K++DE + +  +DD +
  S:     5 ISNYLRLDVVDMIMVLVSTLILCLFAKHFFWDYVSDYFQKRHDAIAADLKAGADAKAEGESYRQQYEQQLAGAKGEAREIIEAAQKHANEERKEVLAKAREEADMLKAKTKQDMEREKAQAQQAMKQTIVDVAFEAAKAIVKKEMDESKQQAYVDDFI 162
>gi|163765106|ref|ZP_02172139.1| ATP synthase F0, B subunit [Anaeromyxobacter sp. K] >gi|196174703|gb|ACG75676.1| ATP synthase F0, B subunit [Anaeromyxobacter sp. K] (179 aa)
Score = 116, Expect = 1.6e-04, Identities = 30/147 (20%), Positives = 79/147 (53%)
  Q:    40 ISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLTA 186
           I+ + +L+++ + AW P    +  R + I+  +++A+K + E+E+ L   +  L +++  AAE+    + + E  ++++ A A  +A ++ +E   +I ++  + +     +V  LA++ A   +   +DE+  + ++++ +  L A
  S:    29 ITFLVMLVVLGKFAWGPIVKMLAERERSIREAIDSAKKERAEAERLLAAQKESLAKAQREAAELARRNQQEVEALRQELTAKARKEADELVAEARRQIAEELGKAKTELKAQVVDLAIDAASRLVKANLDEKAQRALVEEYIAQLPA 175
>gi|118594201|ref|ZP_01551548.1| ATP synthase F0, B subunit [Methylophilales bacterium HTCC2181] >gi|118439979|gb|EAV46606.1| ATP synthase F0, B subunit [Methylophilales bacterium HTCC2181] (156 aa)
Score = 116, Expect = 1.7e-04, Identities = 43/152 (28%), Positives = 74/152 (48%)
  Q:    33 YVLIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           + LIA  ++   L+   +R  W P    IE R KEI   + AA + +   E     ++  L  SK  +AEII  AE  A +     +  A  +A +I +  +S+I ++    ++    EVS+LAL  A   L K+I +E++  ++  +  +L
  S:     5 FTLIAQALAFAILIWFTVRFVWPPLLKAIETRQKEIADGLAAAHEGKASLEIAEKKNQESLSISKQKSAEIISQAEKRANEIVDAAKTEAKVEADRIVAGAHSEIDQEVNRAKEALRAEVSQLALSAAEKILQKEIKKEDHSAMLTKLAKEL 156
>gi|114773194|ref|ZP_01450445.1| F0F1-type ATP synthase, subunit b [alpha proteobacterium HTCC2255] (156 aa)
Score = 116, Expect = 1.7e-04, Identities = 38/150 (25%), Positives = 77/150 (51%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           LI   I+    +   ++  W P    IE R K+I   +EA+++A+ +       +  +L E+K  AA+IIE A+  A     +      ++  +I ++GY++I+ +    ++    +VS LA+  A   L+++ID++    I+  +V++L
  S:     7 LIGQAIAFAVFVWFCMKFVWPPLLGAIEERQKKIADGLEASDRAEQDLADAQAQAAEQLKEAKAQAADIIEQAKKRANVLVDEETQRGHSEREKIIAQGYAEIEAERNRAKEDLRKQVSALAIAGAEKILAREIDKDAQADIVAKLVDEL 156
>gi|170017979|ref|YP_001728898.1| ATP synthase F0, B subunit [Leuconostoc citreum KM20] >gi|169804836|gb|ACA83454.1| ATP synthase F0, B subunit [Leuconostoc citreum KM20] (169 aa)
Score = 115, Expect = 1.7e-04, Identities = 32/149 (21%), Positives = 80/149 (53%)
  Q:    39 VISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLTAK 187
           +IS + L++++ ++A+ P    ++ R ++I   ++ AE A+ E+E      + +L +++  A +++ +A+  A+K    + AVA  +A+ I  +  +  +K + +       +V+ L++  A   + K++   + + +ID  ++DL  K
  S:    21 IISFLVLMVILKKVAYGPLTKVLDERAEKISTDIDGAESARQEAENLAAQRQSELADTRQQATKVVADAKASAQKQSDALVAVAAERANTINQQAQTDAEKLKEDAIANAKNDVAALSVAIASKLMQKELSLNDQQALIDAYISDLETK 169
>gi|52426405|ref|YP_089542.1| F0F1 ATP synthase subunit B [Mannheimia succiniciproducens MBEL55E] >gi|52308457|gb|AAU38957.1| AtpF protein [Mannheimia succiniciproducens MBEL55E] (156 aa)
Score = 115, Expect = 1.7e-04, Identities = 35/150 (23%), Positives = 74/150 (49%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           LI  +I+        ++  W P    IE R   I   + +AEKA+ +   +      ++L +K  A +II+ A        ++++  A N  + I ++G+++++ +   +++   ++V+ LA+  A   + + +DE  N  IID +V +L
  S:     7 LIGQLIAFALFTWFCVKFVWPPIIKAIEERQSSIANALASAEKAKQDQADSQAAVEQEILAAKEEAQKIIDLANKRRNDILEEVKTEAENLKATIIAQGHAEVEAERKRVQEELRVKVASLAIAGAEKIVGRTVDEAANNDIIDKLVAEL 156
>gi|167458501|ref|ZP_02324703.1| ATP synthase F0, B subunit [Anaeromyxobacter dehalogenans 2CP-1] >gi|167415258|gb|EDR81990.1| ATP synthase F0, B subunit [Anaeromyxobacter dehalogenans 2CP-1] (179 aa)
Score = 115, Expect = 1.8e-04, Identities = 30/147 (20%), Positives = 78/147 (53%)
  Q:    40 ISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLTA 186
           I+ + +L ++ + AW P    +  R + I+  +++A+K + E+E+ L   +  L +++  AAE+    + + E  ++++ A A  +A  + +E   +I ++ ++ +     +V  LA++ A   +   +DE+  + ++++ +  L A
  S:    29 ITFLVMLAVLAKFAWGPIVKMLAERERSIREAIDSAKKERAEAERLLAAQKESLAKAQREAAELARRNQQEVEVLRQELTAKARKEADDLVAEARRQIAEELVKAKAELKAQVVDLAIDAASRLVKANLDEKAQRALVEEYIAQLPA 175
>gi|152998461|ref|YP_001343296.1| ATP synthase F0, B subunit [Marinomonas sp. MWYL1] >gi|150839385|gb|ABR73361.1| ATP synthase F0, B subunit [Marinomonas sp. MWYL1] (156 aa)
Score = 115, Expect = 1.9e-04, Identities = 38/150 (25%), Positives = 71/150 (47%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           L+   IS    +   ++  W P  + +E R+K+I   +EAA +A  + E     +   L ESK  AAEIIE A   A +   + +   +    ++     ++I++  +  ++    +VS LA   A   L   IDE+ + +I++ +  +L
  S:     7 LLGQAISFAIFVWFCMKYVWPPVIAALEERSKKIADGLEAANRASRDLELAQEQASQILRESKENAAEIIEQANKRANQMVDEAKEQVIADGKRLREAAQAEIEQDVMRAKEALRAQVSVLAFAGAEKILGATIDEKAHSEIVEQLAKEL 156
>gi|56461723|ref|YP_157004.1| F0F1 ATP synthase subunit B [Idiomarina loihiensis L2TR] >gi|56180733|gb|AAV83455.1| F0F1-type ATP synthase, subunit b [Idiomarina loihiensis L2TR] (156 aa)
Score = 115, Expect = 2.1e-04, Identities = 38/150 (25%), Positives = 74/150 (49%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           LI   I+ I  +   ++  W P    IE R K+I   + A E+AQ + EK       +L E+K  AAEIIE ++    K  ++       +  +I + G+ ++  +   + +    +V+ LA+  A   + ++ID++ +  I++ +V +L
  S:     7 LIGQTIAFIVFVWFCMKFVWPPIIKAIEERQKKIADGLNAGERAQKDLEKAQQEIAEQLKEAKQQAAEIIEQSKKRGAKIVEEETQRGHEEREKIVAAGHEEVAAERNRVREELRKQVAVLAVSGAQKIIEREIDKDAHSDIVEKLVAEL 156
>gi|88771969|gb|EAR03277.1| membrane-bound ATP synthase, F0 sector, subunit b [Alteromonas macleodii 'Deep ecotype'] (156 aa)
Score = 115, Expect = 2.1e-04, Identities = 39/150 (26%), Positives = 76/150 (50%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
            I  +I+    ++  ++  W P  + IE R K+I   +EA+E+A+ + E     +  +L ++K  AAEIIE A+  A +   +       +  +I + GY++I+ +    ++    +VS LA+  A   L ++ID      I++ +V +L
  S:     7 FIGQLIAFAVFVVFCMKYVWPPLMAAIEERQKKIADGLEASERAEKDLELAQAKATEQLKDAKAQAAEIIEQAKKRANQLVDEETQKGHAEREKIIASGYAEIEAERNRAKEDLRKQVSALAVAGAQQILQREIDASAQNDIVEKLVAEL 156
>gi|169188272|ref|ZP_02848418.1| ATP synthase F0, B subunit [Paenibacillus sp. JDR-2] >gi|169004921|gb|EDS51776.1| ATP synthase F0, B subunit [Paenibacillus sp. JDR-2] (160 aa)
Score = 115, Expect = 2.1e-04, Identities = 35/153 (22%), Positives = 85/153 (55%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLTAK 187
           L+  +++ + LL L+ R A+ P  S +E R + +  ++  AE ++ E+E+ L   +  L E++  A +IIE A+  + K    I  VA +++++++ E    I+ ++ +       EV  ++++ A   + K++DE+  +++++  + ++ +K
  S:     8 LVIQLVAFLILLYLLKRYAFGPLLSVMEQRRQYVAEQIANAETSKKEAEQQLEQQKQALQEARKEAYDIIEQAKATSTKQADDIIQVAKSESTRLKDEAVKDIESEKNKAVAALREEVGGISVKIASKIIEKQVDEKSQEQLVNQYLKEVGSK 160
>gi|116333892|ref|YP_795419.1| F0F1 ATP synthase subunit B [Lactobacillus brevis ATCC 367] >gi|116099239|gb|ABJ64388.1| F0F1-type ATP synthase, subunit b [Lactobacillus brevis ATCC 367] (171 aa)
Score = 114, Expect = 2.2e-04, Identities = 30/155 (19%), Positives = 78/155 (50%)
  Q:    36 IAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLTAKLES 190
           I + +  + L+ ++  LAWKP    ++ R  +I   +++AEK++ ++ + +   +  L  S++ A  I+ +A+ + ++ +++I   A      ++      I+++  +        V+ L++E A   + +++  ++ K +ID  +  L  + ES
  S:    17 IFYAVCFLLLMWIIKVLAWKPVTKMMQDRADKISNDIDSAEKSRNDAAELVQKRQAALASSRSEAQTIVNDAKANGQQQREQIVTQAQADVQTLKQNAQKDIEQERQDALSNARNYVADLSIEIASKIIQRELKADDQKALIDSYIEGLGKQHES 171
>gi|85712591|ref|ZP_01043638.1| F0F1-type ATP synthase, subunit b [Idiomarina baltica OS145] >gi|85693582|gb|EAQ31533.1| F0F1-type ATP synthase, subunit b [Idiomarina baltica OS145] (156 aa)
Score = 114, Expect = 2.4e-04, Identities = 38/150 (25%), Positives = 72/150 (48%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           +I   I+    +   ++  W P    IE R K+I   + A E+AQ + EK       +L E+K  AAEIIE A+    K  +        +  +I + G+ +++ +     +    +V+ LA+  A   + ++IDE  ++ I++ +V +L
  S:     7 IIGQTIAFAVFVWFCMKFVWPPIIKAIEERQKKIADGLSAGERAQKDLEKAQEDIAEQLKEAKQQAAEIIEQAKKRGAKIVEDETQRGHEEREKIVASGHEEVEAERHRAREELRKQVAVLAVTGAQKIIEREIDENAHRDIVEKLVAEL 156
>gi|53733038|ref|ZP_00349634.1| COG0711: F0F1-type ATP synthase, subunit b [Haemophilus influenzae R2846] >gi|145630335|ref|ZP_01786116.1| F0F1 ATP synthase subunit B [Haemophilus influenzae 22.4-21] >gi|145636249|ref|ZP_01791918.1| F0F1 ATP synthase subunit B [Haemophilus influenzae PittHH] >gi|145640458|ref|ZP_01796042.1| F0F1 ATP synthase subunit B [Haemophilus influenzae R3021] >gi|148827679|ref|YP_001292432.1| F0F1 ATP synthase subunit B [Haemophilus influenzae PittGG] >gi|144984070|gb|EDJ91507.1| F0F1 ATP synthase subunit B [Haemophilus influenzae R3021] >gi|145270414|gb|EDK10348.1| F0F1 ATP synthase subunit B [Haemophilus influenzae PittHH] >gi|145275044|gb|EDK14906.1| F0F1 ATP synthase subunit B [Haemophilus influenzae 22.4-21] >gi|148718921|gb|ABR00049.1| F0F1 ATP synthase subunit B [Haemophilus influenzae PittGG] (156 aa)
Score = 114, Expect = 2.4e-04, Identities = 38/150 (25%), Positives = 77/150 (51%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           LI  +I+    +   ++  W P  + IE R  +I   + +AE A+ E     ++   +L  +K  A EI++ A     +   +++A A    ++I ++GY++++ +   +++   L+V+ LA+  A   + + IDE  N  IID +V +L
  S:     7 LIGQLIAFALFVWFCMKFVWPPIINAIETRQSQIANALASAEAAKKEQADTKNLVEQELSAAKVQAQEILDAANKRRNEVLDEVKAEAEELKAKIIAQGYAEVEAERKRVQEELRLKVASLAVAGAEKIVGRSIDEAANNDIIDKLVAEL 156
>gi|116494658|ref|YP_806392.1| F0F1-type ATP synthase, subunit b [Lactobacillus casei ATCC 334] >gi|116104808|gb|ABJ69950.1| F0F1-type ATP synthase, subunit b [Lactobacillus casei ATCC 334] (162 aa)
Score = 114, Expect = 2.6e-04, Identities = 31/146 (21%), Positives = 78/146 (53%)
  Q:    39 VISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           +++ + L+L V ++AWKP    +  R ++I   ++ AEK++ +++  +   + +L  S+  A +I+  A+ + EK ++ +   A  + + ++    ++I +   +       +V+ L+L  A   + K+++ ++ K +IDD +  L
  S:    10 LVTFLVLMLAVGKVAWKPVSKMMADRQQKISGDLDYAEKSRKDADALVAKRQEELQHSQADAVKIVNQAKENGEKLRQSLVDAANAEVTTMKKNAQTEIDQARKDALASAKNDVADLSLTIAQKLIGKELNADDQKGLIDDYIKRL 155
>gi|153093203|gb|EDN74214.1| H(+)-transporting two-sector ATPase, F(1) beta subunit [Mannheimia haemolytica PHL213] (156 aa)
Score = 114, Expect = 2.7e-04, Identities = 36/150 (24%), Positives = 73/150 (48%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           LI  +I+    +   ++  W P    IE R   I   + +AEKA+ E   +   +  ++L +K  A  II+ A     +  + ++A A  +  +I  +GY++++ +   +++    +V+ LA+  A   + + +D   N  IID +V +L
  S:     7 LIGQLIAFALFVAFCMKFVWPPLIRVIEERQANIASALASAEKAKQEQADSKAAADQEILRAKEEAQNIIDLATKRRNEILESVQAEAEVERQRIIEQGYAEVESERKRVQEELRQKVAALAIAGAEKIVGRSVDAAANNDIIDKLVAEL 156
>gi|167856125|ref|ZP_02478866.1| F0F1 ATP synthase subunit B [Haemophilus parasuis 29755] >gi|167852766|gb|EDS24039.1| F0F1 ATP synthase subunit B [Haemophilus parasuis 29755] (156 aa)
Score = 114, Expect = 2.7e-04, Identities = 35/150 (23%), Positives = 73/150 (48%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           LI  +I+    +   ++  W P    IE R   I   + +AEKA+ E      +   +L +++  A  II+ A     +  + ++A A  + ++I  +GY++++ +   +++    +V+ LA+  A   + + +D   N  IID +V +L
  S:     7 LIGQLIAFALFVWFCMKFVWPPLIKAIETRQANIADALASAEKAKQEQADTKVLVEQELAKAREEAQHIIDLATKRRNEILESVQAEAEAEKAKIIEQGYAEVENERRRVQEELRQKVAALAVAGAEKIVGRSVDAAANNDIIDKLVAEL 156
>gi|115373534|ref|ZP_01460831.1| ATP synthase F0, B subunit [Stigmatella aurantiaca DW4/3-1] >gi|115369540|gb|EAU68478.1| ATP synthase F0, B subunit [Stigmatella aurantiaca DW4/3-1] (200 aa)
Score = 114, Expect = 2.8e-04, Identities = 36/146 (24%), Positives = 81/146 (55%)
  Q:    39 VISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           +++ I + +++   AW P  S +E R K+I   +E+A++ + E+EK L   +  + E++  AAE++   + D EK + ++   +  +A +++ +   +I+ Q+L+           LA+E AG  LS+++D+ +++ + +  V  L
  S:    42 LVTFILVAVVLRWKAWGPILSLVEEREKQISSAIESAKRERSEAEKLLADQKTAIAEARREAAEMMRKNQQDMEKYRDELMNKSRKEAEELKVQARREIEDQKLKAIAEVRTMAVDLAMEVAGKLLSERMDDAKHRALAEQFVQGL 187
>gi|32476313|ref|NP_869307.1| protein ATP synthase B chain [Rhodopirellula baltica SH 1] >gi|32446858|emb|CAD78764.1| probable protein ATP synthase B chain [Rhodopirellula baltica SH 1] (261 aa)
Score = 113, Expect = 3.0e-04, Identities = 35/136 (25%), Positives = 71/136 (52%)
  Q:    42 LIFLLLLVI--RLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKII 177
           +IFL +L I  +  W      ++AR ++I+  +E+AEKA  E+++ L   ++KL E+ +    ++ +A  DAE   +KI   A  +A+       S I+  +         + SKLA++ A   + +++  +++  +I
  S:   113 IIFLCVLAILSKFVWPAVLGGLQAREEKIREDLESAEKASAEAKQMLSDYQLKLDEAASQVQTMLADARRDAEANGQKIVDAAKVEAAAQRERALSDIENAKKVAMAEMAGQTSKLAMQVARSVVGRELSADDHADLI 250
>gi|163751418|ref|ZP_02158643.1| ATP synthase subunit B [Shewanella benthica KT99] >gi|161328721|gb|EDP99869.1| ATP synthase subunit B [Shewanella benthica KT99] (156 aa)
Score = 113, Expect = 3.4e-04, Identities = 38/150 (25%), Positives = 75/150 (50%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
            I   ++ I  +   ++  W P  + IE R K I   +  A++A  + E     +  +L E+K TA EIIE A     +   + +A A  + ++I ++G ++I+ +   +++    +V+ LA+  A   L + IDE  +  I++ +V +L
  S:     7 FIGQTVAFILFVWFCMKFVWPPLMNAIEERQKRIADGLADADRAVKDLELAQAKATDQLKEAKATANEIIEQANKRKAQIVDEAKAEADTERAKIIAQGQAEIEAERNRVKEDLRKQVAALAIAGAEKILERSIDEAAHSDIVNKLVAEL 156
>gi|153833314|ref|ZP_01985981.1| ATP synthase F0, B subunit [Vibrio harveyi HY01] >gi|156977322|ref|YP_001448228.1| ATP synthase B chain [Vibrio harveyi ATCC BAA-1116] >gi|148870450|gb|EDL69371.1| ATP synthase F0, B subunit [Vibrio harveyi HY01] >gi|156528916|gb|ABU74001.1| hypothetical protein VIBHAR_06108 [Vibrio harveyi ATCC BAA-1116] (156 aa)
Score = 113, Expect = 3.6e-04, Identities = 31/150 (20%), Positives = 74/150 (49%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           +    IS +  + L ++  W P    ++ R  EI + +E  EKA  E E         L E+++ A  II   +   E+   +   +A  + ++I +EG ++++ +  ++ +    E++ L +E+A   +++ +D   N+ +++  +N++
  S:     7 MFGQAISFVIFVWLCMKYVWPPLVKLLDERRAEIAQGLEQTEKAAQELELAKANGEALLTEARSKAQAIINQGKQRQEQMVAEAVDLANQEKARIVAEGKAEVESERSKVRQELKDEMADLVIESASKLINRNLDSSANRDLVNRFINEM 156
>gi|104773791|ref|YP_618771.1| F0F1 ATP synthase subunit B [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|116513797|ref|YP_812703.1| F0F1 ATP synthase subunit B [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|103422872|emb|CAI97534.1| H+ transporting ATPase / ATP synthase, B subunit [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|116093112|gb|ABJ58265.1| F0F1-type ATP synthase, subunit b [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (168 aa)
Score = 113, Expect = 3.7e-04, Identities = 36/147 (24%), Positives = 73/147 (49%)
  Q:    38 HVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           ++I    LLL V   AW P K  +E R +++   ++ A   + ++E   +     L  S+  A +I+ +A+ +A+KT K+I + A+ +AS I  +  +   + E +       EV+ L++  A   ++K +   + K ++D  +  L
  S:    20 YLIVFSILLLAVKHYAWGPVKDMMEKRRQKVIDDLDQAASDRKKAETLANEREAALKNSRQEATQILSDAKSNAQKTGKQIVSEAMAEASAIREKAKADAAQAETDALNEAREEVADLSVTIAEKVIAKNLSAADQKDLVDQFIKGL 166
>gi|167755042|ref|ZP_02427169.1| hypothetical protein CLORAM_00546 [Clostridium ramosum DSM 1402] >gi|167705092|gb|EDS19671.1| hypothetical protein CLORAM_00546 [Clostridium ramosum DSM 1402] (166 aa)
Score = 112, Expect = 4.4e-04, Identities = 37/161 (22%), Positives = 84/161 (52%)
  Q:    24 IINQIFPNVYVLIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           I +++FPNV  +I  ++S   LLL+  +  W P ++Y   R + I+  ++ A+    ++   +  S  +  ++     EI+  A+ DA KTK  I+  A  +      +   +I+ ++ + +     E+ ++A++ A   ++K++D + NK +++D V ++
  S:     4 IASKLFPNVTTIIIQLLSTGVLLLVFKKYLWVPVQNYFAKRAEFIEGTVDEAKDMNEKARALMEESEEQARQAAVQYREIVNLAKEDALKTKATIQEQANQEYKAKLDQARREIEAEKAQAKAAMKQEIVEVAIDVATKVMNKEMDTKTNKALVEDFVEEV 164
>gi|145628864|ref|ZP_01784664.1| F0F1 ATP synthase subunit B [Haemophilus influenzae 22.1-21] >gi|145632750|ref|ZP_01788484.1| F0F1 ATP synthase subunit B [Haemophilus influenzae 3655] >gi|145634519|ref|ZP_01790228.1| F0F1 ATP synthase subunit B [Haemophilus influenzae PittAA] >gi|148825238|ref|YP_001289991.1| F0F1 ATP synthase subunit B [Haemophilus influenzae PittEE] >gi|144979334|gb|EDJ89020.1| F0F1 ATP synthase subunit B [Haemophilus influenzae 22.1-21] >gi|144986945|gb|EDJ93497.1| F0F1 ATP synthase subunit B [Haemophilus influenzae 3655] >gi|145268064|gb|EDK08059.1| F0F1 ATP synthase subunit B [Haemophilus influenzae PittAA] >gi|148715398|gb|ABQ97608.1| F0F1 ATP synthase subunit B [Haemophilus influenzae PittEE] (156 aa)
Score = 112, Expect = 4.4e-04, Identities = 37/150 (24%), Positives = 77/150 (51%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           LI  +I+    +   ++  W P  + IE R  +I   + +AE A+ E     ++   +L  +K  A +I++ A     +   +++A A    ++I ++GY++++ +   +++   L+V+ LA+  A   + + IDE  N  IID +V +L
  S:     7 LIGQLIAFALFVWFCMKFVWPPIINAIETRQSQIANALASAEAAKKEQADTKNLVEQELSAAKVQAQDILDAANKRRNEVLDEVKAEAEELKAKIIAQGYAEVEAERKRVQEELRLKVASLAVAGAEKIVGRSIDEAANNDIIDKLVAEL 156
>gi|33329383|gb|AAQ10086.1| ATP synthase subunit b [Bacillus sp. TA2.A1] (168 aa)
Score = 112, Expect = 4.4e-04, Identities = 39/137 (28%), Positives = 81/137 (59%)
  Q:    51 RLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNL-----EVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLTAK 187
           + A+ P  + +E R  +I++ +E A++ + E+EK L   R  L ++K  A  I+ENA   +EK  ++I      +A++ E + Y  + ++E+E EK K +     E+ +L++  A   + K++D ++ +++IDD + ++  K
  S:    28 KYAFGPLMNVMEKRANQIEKDLEEAKRNRAEAEKLLAEQRANLEQAKKDAKTILENARNTSEKQAEEII-----RAAKAEVDQYKSVARKEIEREKEKAVEALRKEMGQLSVLLASKVIEKELDPKQQQQLIDDFLKEVGTK 164
>gi|90578416|ref|ZP_01234227.1| hypothetical ATP synthase B chain [Vibrio angustum S14] >gi|90441502|gb|EAS66682.1| hypothetical ATP synthase B chain [Vibrio angustum S14] (156 aa)
Score = 112, Expect = 4.5e-04, Identities = 30/150 (20%), Positives = 74/150 (49%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           ++   IS +  + L ++  W P  + I+ R +EI   +   E A  E E         L ++K +A E++E       +  ++ +A    + ++I ++G ++++     L +    E+S + +ETA   +++ +D + N+ +++ ++ D+
  S:     7 MLGQAISFVIFVWLCMKYVWPPLTALIDQRQREIAEGLIHTENASKELELAKANGEKLLDDAKKSANELVEQGNKRRAQIIEEAQAEGEKEKARIIAQGNAEVESDRNRLRQELRAEMSDMVIETAQKLINRNLDTDANRDLVNKLIKDM 156
>gi|53733291|ref|ZP_00349681.1| COG0711: F0F1-type ATP synthase, subunit b [Haemophilus influenzae R2866] >gi|145638601|ref|ZP_01794210.1| F0F1 ATP synthase subunit B [Haemophilus influenzae PittII] >gi|145272196|gb|EDK12104.1| F0F1 ATP synthase subunit B [Haemophilus influenzae PittII] (156 aa)
Score = 112, Expect = 4.5e-04, Identities = 37/150 (24%), Positives = 77/150 (51%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           LI  +I+    +   ++  W P  + IE R  +I   + +AE A+ E     ++   +L  +K  A +I++ A     +   +++A A    ++I ++GY++++ +   +++   L+V+ LA+  A   + + IDE  N  IID +V +L
  S:     7 LIGQLIAFALFVWFCMKFVWPPIINAIETRQSQIANALASAEAAKKEQADTKNLVEQELSAAKLQAQDILDAANKRRNEVLDEVKAEAEELKAKIIAQGYAEVESERKRVQEELRLKVASLAVAGAEKIVGRSIDEAANNDIIDKLVAEL 156
>gi|94501606|ref|ZP_01308123.1| F0F1-type ATP synthase, subunit b [Oceanobacter sp. RED65] >gi|94426289|gb|EAT11280.1| F0F1-type ATP synthase, subunit b [Oceanobacter sp. RED65] (156 aa)
Score = 112, Expect = 4.7e-04, Identities = 35/150 (23%), Positives = 75/150 (50%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           LI  +I+  F +    +  W P  + ++ R K+I   ++AA +A  + +     +  +L E+K  AA+IIE A   A +   + +  A  +  ++++   ++I ++    ++    +VS+LA+  A   L   ID E++  ++D +  +L
  S:     7 LIGQIIAFAFFVAFCWKFVWPPLMNAMQERAKKIADGLDAANRADRDLKLAQEKAGSQLREAKEQAAQIIEQANKRANQIIDEAKDAAHQEGERLKAAAQAEIDQEVNRAKETLRSQVSELAVAGASKILETSIDVEKHNALLDKLAEEL 156
>gi|73662086|ref|YP_300867.1| F0F1 ATP synthase subunit B [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|88909588|sp|Q49Z54|ATPF_STAS1 ATP synthase B chain >gi|72494601|dbj|BAE17922.1| F0F1-type ATP synthase b subunit' [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (175 aa)
Score = 112, Expect = 4.9e-04, Identities = 34/149 (22%), Positives = 83/149 (55%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVND 183
           +I  +++ + LL L+ + AW P K  ++ R  +I + ++ AE+A+L ++K    ++  L E+++   +I+E +++ A K  ++I   A  +A+ +     ++I  ++       N +VS+L++  A   L K+I +++ K +++  + +
  S:    23 IIVTLVTFLILLALLKKFAWGPLKDVMDKREHDINKDIDDAEQAKLNAQKLEEQNKQTLKETQDEVQKILEESKVQARKQHEEIIHEANIRANGMIETAQNEINSEKERAIADINNQVSELSVLIASKVLQKEISDKDQKALVEKYIKE 171
>gi|16272430|ref|NP_438643.1| F0F1 ATP synthase subunit B [Haemophilus influenzae Rd KW20] >gi|68249085|ref|YP_248197.1| F0F1 ATP synthase subunit B [Haemophilus influenzae 86-028NP] >gi|1168593|sp|P43720|ATPF_HAEIN ATP synthase B chain >gi|1573461|gb|AAC22141.1| ATP synthase F0, subunit b (atpF) [Haemophilus influenzae Rd KW20] >gi|68057284|gb|AAX87537.1| ATP synthase B chain [Haemophilus influenzae 86-028NP] (156 aa)
Score = 112, Expect = 4.9e-04, Identities = 37/150 (24%), Positives = 77/150 (51%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           LI  +I+    +   ++  W P  + IE R  +I   + +AE A+ E     ++   +L  +K  A +I++ A     +   +++A A    ++I ++GY++++ +   +++   L+V+ LA+  A   + + IDE  N  IID +V +L
  S:     7 LIGQLIAFALFVWFCMKFVWPPIINAIETRQSQIANALASAEAAKKEQADTKNLVEQELSAAKLQAQDILDAANKRRNEVLDEVKAEAEELKAKIIAQGYAEVEAERKRVQEELRLKVASLAVAGAEKIVGRSIDEAANNDIIDKLVAEL 156
>gi|150388189|ref|YP_001318238.1| ATP synthase F0, B subunit [Alkaliphilus metalliredigens QYMF] >gi|149948051|gb|ABR46579.1| ATP synthase F0, B subunit [Alkaliphilus metalliredigens QYMF] (168 aa)
Score = 112, Expect = 4.9e-04, Identities = 37/150 (24%), Positives = 79/150 (52%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
            I  +I+L  +  ++ +  +KPT  Y+E R K I   ++ AE    E++++     +KL + K   ++II+ A   AEK   +I   A ++A ++     ++I++++ +       E+S+LA+  A   + K +DE  + K+I   ++++
  S:    12 FIFTLINLWIMYWVLKKFLFKPTTEYMEGRKKSIADSIQEAEMKNKEADESKAQYDMKLQDIKKERSQIIDEATKRAEKRGDEIIKAAEDEAEKVIERAMTEIQREKQKSLNEMKNEISQLAIAAATKVIEKDLDEGTHHKMIQQFIDEV 161
>gi|191638157|ref|YP_001987323.1| ATP synthase B chain [Lactobacillus casei] >gi|190712459|emb|CAQ66465.1| ATP synthase B chain [Lactobacillus casei BL23] (162 aa)
Score = 111, Expect = 5.0e-04, Identities = 31/146 (21%), Positives = 76/146 (52%)
  Q:    39 VISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           +++ + L+L V ++AWKP    +  R ++I   ++ AEK++ +++      + +L  S+  A +I+  A+ + EK ++ +   A  + + ++    + I +   +       +V+ L+L  A   + K+++ ++ K +IDD +  L
  S:    10 LVTFLVLMLAVGKVAWKPVSKMMADRQQKISGDLDYAEKSRKDADALAAKRQEELQHSQADAVKIVNQAKENGEKQRQSLVDAANAEVTTMKKNAQTDIDQARKDALASAKNDVADLSLTIAQKLIGKELNADDQKGLIDDYIKRL 155
>gi|161523282|ref|YP_001578294.1| F0F1 ATP synthase subunit B [Burkholderia multivorans ATCC 17616] >gi|189351945|ref|YP_001947573.1| F-type H+-transporting ATPase b chain [Burkholderia multivorans ATCC 17616] >gi|194561961|ref|YP_002096984.1| F0F1-type ATP synthase [Burkholderia dolosa AUO158] >gi|124893585|gb|EAY67465.1| F0F1-type ATP synthase [Burkholderia dolosa AUO158] >gi|160340711|gb|ABX13797.1| ATP synthase F0, B subunit [Burkholderia multivorans ATCC 17616] >gi|189335967|dbj|BAG45037.1| F-type H+-transporting ATPase b chain [Burkholderia multivorans ATCC 17616] (156 aa)
Score = 111, Expect = 5.4e-04, Identities = 34/150 (22%), Positives = 82/150 (54%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           L A ++  + L    ++  W P  + ++ R+K+I   + AAEK + E E        +L +++N   + I +AE  A+   ++I+A A  +A++I ++  ++ ++Q ++  +    EV+ LA++ A   L +++D+  + ++++ +  +L
  S:     7 LFAQMVVFLVLAWFTMKFVWPPLINALDERSKKIADGLAAAEKGKAELEAAHKRVDQELAQARNDGQQRIADAEKRAQAVAEEIKANAQAEAARIVAQAKAEAEQQIVKAREALRGEVAALAVKGAEQILKREVDQTAHAQLLNQLKAEL 156
>gi|24379921|ref|NP_721876.1| F0F1 ATP synthase subunit B [Streptococcus mutans UA159] >gi|26006946|sp|P95785|ATPF_STRMU ATP synthase B chain >gi|24377901|gb|AAN59182.1|AE014985_6 FoF1 membrane-bound proton-translocating ATPase, b subunit [Streptococcus mutans UA159] (165 aa)
Score = 111, Expect = 5.5e-04, Identities = 36/144 (25%), Positives = 77/144 (53%)
  Q:    41 SLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           S I LLLLV + AW    +  +AR ++I + ++ AE ++  ++   +  +++L ++K+ AA+II+NA+   +  + KI   A  +A +++ +    I   + E       +V+ L++  A   ++K +D+     +ID  ++ L
  S:    19 SFILLLLLVKKFAWSQLAAIFKAREEKIAKDIDDAENSRQNAQVLENKRQVELNQAKDEAAQIIDNAKETGKAQESKIITEAHEEAGRLKDKANQDIATSKAEALSSVKADVADLSVLLAEKIMAKNLDKTAQGDLIDSYLDKL 162
>gi|89897662|ref|YP_521149.1| ATP synthase F0 B subunit [Desulfitobacterium hafniense Y51] >gi|109648040|ref|ZP_01371943.1| ATP synthase F0, B subunit [Desulfitobacterium hafniense DCB-2] >gi|89337110|dbj|BAE86705.1| ATP synthase F0 B subunit [Desulfitobacterium hafniense Y51] >gi|109641130|gb|EAT50685.1| ATP synthase F0, B subunit [Desulfitobacterium hafniense DCB-2] (164 aa)
Score = 111, Expect = 5.7e-04, Identities = 33/150 (22%), Positives = 78/150 (52%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           L+  V+S + L+ ++ R AW P  + +E R  +I+  +  AEK +L++E+     + ++ +++  A E+I  A   +E+   +I A A  +A +I+    + I+++      +   +V+ L++  A   + K +D    + +I+  + ++
  S:    10 LVVQVLSFLLLVYILRRFAWNPLINMMEERRSQIEANIANAEKERLQAEQIKREYQEEMRKARQEAQEVIAKATKLSEQRAAEILAAAHGEAEKIKQSALADIERERDRAIAQVQAQVADLSVAVAEKIIRKNLDVRGQEDMIEQFIQEV 159
>gi|127514774|ref|YP_001095971.1| F0F1 ATP synthase subunit B [Shewanella loihica PV-4] >gi|126640069|gb|ABO25712.1| ATP synthase F0, B subunit [Shewanella loihica PV-4] (156 aa)
Score = 111, Expect = 5.8e-04, Identities = 38/150 (25%), Positives = 76/150 (50%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           LI   ++ I  +   ++  W P  + IE R K I   +  A++A  + E     +  +L E+K TA EIIE A     +   + +A A  + ++I ++G ++I+ +   +++    +V+ LA+  A   L + IDE  +  I++ +V ++
  S:     7 LIGQTVAFIIFVWFCMKFVWPPLMNAIEERQKRIADGLADADRAVKDLELAQAKATDQLKEAKATANEIIEQANKRKAQIVDEAKAEADAERAKIIAQGKAEIEAERNRVKEDLRKQVAALAIAGAEKILERSIDEAAHSDIVNKLVAEI 156
>gi|171315830|ref|ZP_02905061.1| ATP synthase F0, B subunit [Burkholderia ambifaria MEX-5] >gi|171099019|gb|EDT43804.1| ATP synthase F0, B subunit [Burkholderia ambifaria MEX-5] (156 aa)
Score = 111, Expect = 5.9e-04, Identities = 33/150 (22%), Positives = 82/150 (54%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           L A ++  + L    ++  W P  + ++ R+K+I   + AAEK + E +        +L +++N   + I +AE  A+   ++I+A A  +A++I ++  ++ ++Q ++  +    EV+ LA++ A   L +++D+  + ++++ +  +L
  S:     7 LFAQMVVFLVLAWFTMKFVWPPLINALDERSKKIADGLAAAEKGKAELDAAHKRVDQELAQARNDGQQRIADAEKRAQAVAEEIKASAQAEAARIVAQAKAEAEQQIVKARETLRGEVAALAVKGAEQILKREVDQTAHAQLLNQLKAEL 156
>gi|165977086|ref|YP_001652679.1| F0F1 ATP synthase subunit B [Actinobacillus pleuropneumoniae serovar 3 str. JL03] >gi|190150981|ref|YP_001969506.1| ATP synthase B chain [Actinobacillus pleuropneumoniae serovar 7 str. AP76] >gi|165877187|gb|ABY70235.1| ATP synthase B chain [Actinobacillus pleuropneumoniae serovar 3 str. JL03] >gi|189916112|gb|ACE62364.1| ATP synthase B chain [Actinobacillus pleuropneumoniae serovar 7 str. AP76] (156 aa)
Score = 111, Expect = 6.0e-04, Identities = 35/150 (23%), Positives = 76/150 (50%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           LI  +I+    +   ++  W P    IE R   I   + +AEKA+ E   +   +  ++L++K  A +II+ A     +  + ++A A  +  +I  +G+++++ +   +++    +V+ LA+  A   + + +D+  N  IID +V +L
  S:     7 LIGQLIAFALFVAFCMKFVWPPLIKAIEERQANIANALASAEKAKQEQADSKAAADQEILKAKEEAQKIIDLATKRRNEILESVQAEAEIERQRIIEQGHAEVESERKRVQEELRQKVAALAVAGAEKIVGRSVDQAANNDIIDKLVAEL 156
>gi|119471631|ref|ZP_01614016.1| membrane-bound ATP synthase, F0 sector, subunit b [Alteromonadales bacterium TW-7] >gi|119445410|gb|EAW26697.1| membrane-bound ATP synthase, F0 sector, subunit b [Alteromonadales bacterium TW-7] (156 aa)
Score = 111, Expect = 6.0e-04, Identities = 36/150 (24%), Positives = 79/150 (52%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           LI  +I+    +L  ++  W P    IEAR K+I+  + A+++A+ + E     +  +L ++K  AA+II+ A+  A     +       +  +I ++G+S+I+ +   + +    +V+ LA+  A   L ++I++  +  I++ +V +L
  S:     7 LIGELIAFTVFVLFCMKFVWPPLNGAIEARQKKIEDGLAASDRAEKDLELAQQKAAEQLKDAKAQAADIIDQAKKRAVLIVDEETVRGQEEREKIIAQGHSEIESERNRVTEELRKQVATLAVVGAERILEREINQAAHSDIVEKLVAEL 156
>gi|728928|sp|P41014|ATPF_BACCA ATP synthase B chain >gi|533286|dbj|BAA07245.1| ATPase subunit b [Bacillus caldotenax] (162 aa)
Score = 111, Expect = 6.1e-04, Identities = 35/138 (25%), Positives = 77/138 (55%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEE 172
           +I  ++  I LL L+ + AW+P  + ++ R + I  +++ AEK + E+EK L   R  + +S+     +IENA   A++ K++I A A  +A +++     +I++++ +       +V+ L++  A   + K++ E++
  S:    22 IIYQLLMFIILLALLRKFAWQPLMNIMKQREEHIANEIDQAEKRRQEAEKLLEEQRELMKQSRQDDEALIENARKLAQEQKEQIVASARGQAERVKEAAKKEIEREKEQAMAALREQVASLSVVIASKVIEKELTEQD 159
>gi|27364450|ref|NP_759978.1| F0F1 ATP synthase subunit B [Vibrio vulnificus CMCP6] >gi|27360569|gb|AAO09505.1|AE016800_110 ATP synthase F0, B subunit [Vibrio vulnificus CMCP6] (154 aa)
Score = 111, Expect = 6.1e-04, Identities = 38/150 (25%), Positives = 71/150 (47%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           L+   IS    +   ++  W P    IE R K+I   ++AAE+A  + +     +  +L E+K TA EIIE A     +   +    A  +  +I ++  ++++ +          +V+ LA+  A   L + ID++ +K I+D+I   L
  S:     5 LLGQAISFAMFVWFCMKYVWPPIMQAIEERQKKIADGLQAAERAAKDLDLAQANASSQLKEAKRTATEIIEQANKRKAQILDEAREDAQTERQKILAQAEAQLEAERNRARDELRKQVATLAVAGAEKILERSIDKDAHKDILDNITAKL 154
>gi|37681439|ref|NP_936048.1| F0F1 ATP synthase subunit B [Vibrio vulnificus YJ016] >gi|38503000|sp|Q8DDH2|ATPF_VIBVU ATP synthase B chain >gi|37200191|dbj|BAC96019.1| F0F1-type ATP synthase, subunit b [Vibrio vulnificus YJ016] (156 aa)
Score = 111, Expect = 6.1e-04, Identities = 38/150 (25%), Positives = 71/150 (47%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           L+   IS    +   ++  W P    IE R K+I   ++AAE+A  + +     +  +L E+K TA EIIE A     +   +    A  +  +I ++  ++++ +          +V+ LA+  A   L + ID++ +K I+D+I   L
  S:     7 LLGQAISFAMFVWFCMKYVWPPIMQAIEERQKKIADGLQAAERAAKDLDLAQANASSQLKEAKRTATEIIEQANKRKAQILDEAREDAQTERQKILAQAEAQLEAERNRARDELRKQVATLAVAGAEKILERSIDKDAHKDILDNITAKL 156
>gi|134300985|ref|YP_001114481.1| ATP synthase F0, B subunit [Desulfotomaculum reducens MI-1] >gi|134053685|gb|ABO51656.1| ATP synthase F0, B subunit [Desulfotomaculum reducens MI-1] (189 aa)
Score = 111, Expect = 6.5e-04, Identities = 34/149 (22%), Positives = 84/149 (56%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVND 183
           L+A + + + LL+L+  +A+KP  + +E R + I+  + AAE+ + ++E+     +  L  S+  A E++  A  +AE+  ++I   A  +A++++    S+I++++         +V+ L++  AG  + +K++++  K +++  V +
  S:    35 LLAQMFNFLVLLILLRAVAYKPFMNMLEKRRELIEGSIAAAEEDKKQAEQLRATLQADLQRSREQATEMMARATKNAEEQAQQIIEAAKAEAARVKDSALSEIQREKERAVAELRDQVATLSILVAGKIIDQKLNDDVQKDLVNKFVKE 183
>gi|109900597|ref|YP_663852.1| F0F1 ATP synthase subunit B [Pseudoalteromonas atlantica T6c] >gi|109702878|gb|ABG42798.1| ATP synthase F0, B subunit [Pseudoalteromonas atlantica T6c] (156 aa)
Score = 110, Expect = 6.8e-04, Identities = 36/150 (24%), Positives = 73/150 (48%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           L   +++ IF +   ++  W P    IE R K+I   + A+E+ + + E     +  +L E+K  AA IIE A+    +   +    A  +   I ++G+++I+ +    ++    +V+ LA+  A   L ++ID      I++ +V +L
  S:     7 LFGELLAFIFFVWFCMKFVWPPIMGAIEERQKKIADGLAASERGEKDLELAQAKATEQLKEAKTQAAGIIEQAKKRGSQIVDEETQRAHQERENIIAQGHAEIEAERNRAKEDLRKQVAALAVAGAERILERQIDAAAQSDIVEKLVAEL 156
>gi|186477777|ref|YP_001859247.1| ATP synthase F0, B subunit [Burkholderia phymatum STM815] >gi|184194236|gb|ACC72201.1| ATP synthase F0, B subunit [Burkholderia phymatum STM815] (156 aa)
Score = 110, Expect = 7.3e-04, Identities = 39/154 (25%), Positives = 80/154 (51%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLTAKL 188
           L A ++  + L    ++  W P  + ++ R+K+I   + AAEK +LE E        +L +++N   + I +AE  A     +I+A A  +A++I ++  +   +Q ++  +    EV+ LA++ A   L +++D+  +     D++N L A+L
  S:     7 LFAQMVVFLILAWFTMKFVWPPLINALDERSKKIADGLSAAEKGKLELEAAHKRVDQELSQARNEGQQRIADAEKRAVAVADEIKAQAQAEAARIIAQAKADADQQIVKAREALRGEVAALAVKGAEQILKREVDQAAHA----DLLNQLKAEL 156
>gi|115350149|ref|YP_771988.1| F0F1 ATP synthase subunit B [Burkholderia ambifaria AMMD] >gi|170699470|ref|ZP_02890513.1| ATP synthase F0, B subunit [Burkholderia ambifaria IOP40-10] >gi|172059168|ref|YP_001806820.1| ATP synthase F0, B subunit [Burkholderia ambifaria MC40-6] >gi|115280137|gb|ABI85654.1| ATP synthase F0, B subunit [Burkholderia ambifaria AMMD] >gi|170135619|gb|EDT03904.1| ATP synthase F0, B subunit [Burkholderia ambifaria IOP40-10] >gi|171991685|gb|ACB62604.1| ATP synthase F0, B subunit [Burkholderia ambifaria MC40-6] (156 aa)
Score = 110, Expect = 7.5e-04, Identities = 33/150 (22%), Positives = 82/150 (54%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           L A ++  + L    ++  W P  + ++ R+K+I   + AAEK + E +        +L +++N   + I +AE  A+   ++I+A A  +A++I ++  ++ ++Q ++  +    EV+ LA++ A   L +++D+  + ++++ +  +L
  S:     7 LFAQMVVFLVLAWFTMKFVWPPLINALDERSKKIADGLAAAEKGKAELDAAHKRVDQELAQARNDGQQRIADAEKRAQAVAEEIKANAQAEAARIVAQAKAEAEQQIVKAREALRGEVASLAVKGAEQILKREVDQTAHAQLLNQLKAEL 156
>gi|134294234|ref|YP_001117969.1| F0F1 ATP synthase subunit B [Burkholderia vietnamiensis G4] >gi|134137391|gb|ABO53134.1| ATP synthase F0, B subunit [Burkholderia vietnamiensis G4] (156 aa)
Score = 110, Expect = 7.8e-04, Identities = 33/150 (22%), Positives = 82/150 (54%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           L A ++  + L    ++  W P  + ++ R+K+I   + AAEK + E +        +L +++N   + I +AE  A+   ++I+A A  +A++I ++  ++ ++Q ++  +    EV+ LA++ A   L +++D+  + ++++ +  +L
  S:     7 LFAQMVVFLVLAWFTMKFVWPPLINALDERSKKIADGLAAAEKGKAELDAAHKRVDQELAQARNDGQQRIADAEKRAQAVAEEIKANAQAEAARIVAQAKAEAEQQIVKARETLRGEVAALAVKGAEQILKREVDQTAHAQLLNQLKAEL 156
>gi|107024495|ref|YP_622822.1| F0F1 ATP synthase subunit B [Burkholderia cenocepacia AU 1054] >gi|116688126|ref|YP_833749.1| F0F1 ATP synthase subunit B [Burkholderia cenocepacia HI2424] >gi|170731473|ref|YP_001763420.1| ATP synthase F0, B subunit [Burkholderia cenocepacia MC0-3] >gi|194557679|ref|YP_002092705.1| F0F1-type ATP synthase, subunit b [Burkholderia cenocepacia PC184] >gi|105894684|gb|ABF77849.1| ATP synthase F0, B subunit [Burkholderia cenocepacia AU 1054] >gi|116646215|gb|ABK06856.1| ATP synthase F0, B subunit [Burkholderia cenocepacia HI2424] >gi|124871470|gb|EAY63186.1| F0F1-type ATP synthase, subunit b [Burkholderia cenocepacia PC184] >gi|169814715|gb|ACA89298.1| ATP synthase F0, B subunit [Burkholderia cenocepacia MC0-3] (156 aa)
Score = 110, Expect = 8.3e-04, Identities = 33/150 (22%), Positives = 82/150 (54%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           L A ++  + L    ++  W P  + ++ R+K+I   + AAEK + E +        +L +++N   + I +AE  A+   ++I+A A  +A++I ++  ++ ++Q ++  +    EV+ LA++ A   L +++D+  + ++++ +  +L
  S:     7 LFAQMVVFLVLAWFTMKFVWPPLINALDERSKKIADGLAAAEKGKAELDAAHKRVDQELAQARNDGQQRIADAEKRAQAVAEEIKANAQAEAARIVAQAKAEAEQQIVKAREALRGEVAALAVKGAEQILKREVDQTAHAQLLNQLKAEL 156
>gi|77361908|ref|YP_341483.1| F0F1 ATP synthase subunit B [Pseudoalteromonas haloplanktis TAC125] >gi|76876819|emb|CAI88041.1| membrane-bound ATP synthase, F0 sector, subunit b [Pseudoalteromonas haloplanktis TAC125] (156 aa)
Score = 109, Expect = 8.5e-04, Identities = 36/150 (24%), Positives = 79/150 (52%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           LI  +I+    +L  ++  W P    IEAR K+I+  + A+++A+ + E     +  +L ++K  AA+II+ A+  A     +       +  +I ++G+S+I+ +   + +    +V+ LA+  A   L ++I++  +  I++ +V +L
  S:     7 LIGELIAFTVFVLFCMKFVWPPLNGAIEARQKKIEDGLAASDRAEKDLELAQKKAAEQLKDAKVQAADIIDQAKKRAVLIVDEETVRGQQEREKIIAQGHSEIESERNRVTEELRKQVATLAVVGAQRILEREINQAAHSDIVEKLVAEL 156
>gi|90409085|ref|ZP_01217209.1| ATP synthase subunit B [Psychromonas sp. CNPT3] >gi|90309812|gb|EAS37973.1| ATP synthase subunit B [Psychromonas sp. CNPT3] (156 aa)
Score = 109, Expect = 9.1e-04, Identities = 38/150 (25%), Positives = 70/150 (46%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           L+   I+ I  +   ++  W P    IEAR K I   +  AE+A  + +     +  KL E+K  AAEII+ A     +   + +     +  +I ++G ++++ +     +    +V+ LA+  A   +   ID+  N  IID +V +L
  S:     7 LLGQAIAFIMFVWFCMKFVWPPLLDAIEARQKLIADGLTQAERAGKDLQLAQAKATDKLKEAKVQAAEIIDQANKRRAQIVDEAKTEGETERQKIITQGTAEVESERNRAREELRQQVTILAIAGAEKIIKHSIDKNANSDIIDKLVTEL 156
>gi|29655225|ref|NP_820917.1| F0F1 ATP synthase subunit B [Coxiella burnetii RSA 493] >gi|153206129|ref|ZP_01945392.1| ATP synthase F0, B subunit [Coxiella burnetii 'MSU Goat Q177'] >gi|154706921|ref|YP_001423606.1| F0F1 ATP synthase subunit B [Coxiella burnetii Dugway 5J108-111] >gi|161831252|ref|YP_001597757.1| F0F1 ATP synthase subunit B [Coxiella burnetii RSA 331] >gi|165918762|ref|ZP_02218848.1| ATP synthase F0, B subunit [Coxiella burnetii RSA 334] >gi|29542497|gb|AAO91431.1| ATP synthase F0, B subunit [Coxiella burnetii RSA 493] >gi|120577259|gb|EAX33883.1| ATP synthase F0, B subunit [Coxiella burnetii 'MSU Goat Q177'] >gi|154356207|gb|ABS77669.1| ATP synthase F0, B subunit [Coxiella burnetii Dugway 5J108-111] >gi|161763119|gb|ABX78761.1| ATP synthase F0, B subunit [Coxiella burnetii RSA 331] >gi|165917590|gb|EDR36194.1| ATP synthase F0, B subunit [Coxiella burnetii RSA 334] (156 aa)
Score = 109, Expect = 9.4e-04, Identities = 36/150 (24%), Positives = 77/150 (51%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           LI  ++  +  + L ++  W P    +EAR K I   + AAE+ + E E     S+ +L E+K  AA IIE A   A    ++ +  A  + + +     ++I+++    +     ++S +A+  A   L +++D+  N +++D++V+++
  S:     7 LIVQMLVFVVFIGLTMKFIWPPLTKALEARRKNIADGLAAAEEGRKELELAEIKSKEQLTEAKTQAAHIIEQANQRANHIVEEAKNKAREEGAHLIQLAKNEIEQEYNAAKTELLKQISTIAVAGAQKILQREVDKASNDRLVDELVSEI 156
>gi|33151288|ref|NP_872641.1| F0F1 ATP synthase subunit B [Haemophilus ducreyi 35000HP] >gi|33147508|gb|AAP95030.1| ATP synthase B chain [Haemophilus ducreyi 35000HP] (156 aa)
Score = 109, Expect = 9.6e-04, Identities = 35/150 (23%), Positives = 75/150 (50%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           LI  +I+    +   ++  W P    IE R   I   + +AEKA+ E   +  ++  +++++K  A +II+ A     +  + ++A A  +  +I  +G+++I  +   +++    +V+ LA+  A   + + +D   N  IID +V +L
  S:     7 LIGQLIAFALFVAFCMKYVWPPLIKAIEERQANIANALSSAEKAKQEQADSKVLAEQEIIKAKEEAQKIIDLATKRRNEILESVQADAEVERQRIIEQGHAEIDSERKRVQEELRQKVAALAVAGAERIVGRSVDTAANNDIIDKLVAEL 156
>gi|170694316|ref|ZP_02885470.1| ATP synthase F0, B subunit [Burkholderia graminis C4D1M] >gi|187925867|ref|YP_001897509.1| ATP synthase F0, B subunit [Burkholderia phytofirmans PsJN] >gi|170140739|gb|EDT08913.1| ATP synthase F0, B subunit [Burkholderia graminis C4D1M] >gi|187717061|gb|ACD18285.1| ATP synthase F0, B subunit [Burkholderia phytofirmans PsJN] (156 aa)
Score = 109, Expect = 9.9e-04, Identities = 38/154 (24%), Positives = 80/154 (51%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLTAKL 188
           L A ++  + L    ++  W P  + ++ R+K+I   + AAEK + E E        +L +++N   + I +AE  A     +I+A A  +A++I ++  +  ++Q ++  +    EV+ LA++ A   L +++D+  +     D++N L A+L
  S:     7 LFAQMVVFLILAWFTMKFVWPPLINALDERSKKIADGLSAAEKGKAELEAAHKRVDQELAQARNDGQQRIADAEKRAVAVADEIKAQAQAEAARIIAQAKADAEQQVVKARETLRGEVAALAVKGAEQILKREVDQAAHA----DLLNQLKAEL 156
>gi|53802695|ref|YP_112549.1| ATP synthase F0, B subunit [Methylococcus capsulatus str. Bath] >gi|53756456|gb|AAU90747.1| ATP synthase F0, B subunit [Methylococcus capsulatus str. Bath] (157 aa)
Score = 109, Expect = 1.0e-03, Identities = 36/143 (25%), Positives = 72/143 (50%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKII 177
           L   +++   L+   ++  W P    +E R K+I   + AAEK + E E     +   L E+K+ AAEI+  A+  A     + +  A  +  +I +   S+I ++    ++    +VS LA+  A   L +++D++++K+I+
  S:     7 LFGQMVTFALLVWFTMKYVWPPLLQALEERKKKIAEGLAAAEKGKHEMELAEKRATAALKEAKDQAAEIVNQAQKRANALVDESKEAAKIEGERILANARSEIDRELENAKEELRKQVSALAISAAEKILQREVDQKKHKEIL 149
>gi|92115403|ref|YP_575331.1| F0F1 ATP synthase subunit B [Chromohalobacter salexigens DSM 3043] >gi|91798493|gb|ABE60632.1| ATP synthase F0, B subunit [Chromohalobacter salexigens DSM 3043] (156 aa)
Score = 109, Expect = 1.1e-03, Identities = 35/150 (23%), Positives = 73/150 (48%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           LI   I+    +   ++  W P    ++ R K+I   ++AA +A  + E     +  +L ESK  AA+IIE A   A +  ++    A  +  ++      +I+++    ++    +V+ LA++ A   L   IDE ++++++D +  +L
  S:     7 LIGQAIAFAVFVWFCMKFVWPPVMQALQERQKKIADGLDAASRATRDLELAQEQAAEQLKESKEQAAQIIEQAHKRANQMIEEARDNARLEGERMIESARGEIEQETQRAKEELRTQVAALAIQGAERILDSSIDEAKHRELVDKLAAEL 156
>gi|163731068|ref|ZP_02138534.1| F0F1 ATP synthase subunit B [Vibrio fischeri MJ11] >gi|161395628|gb|EDQ19931.1| F0F1 ATP synthase subunit B [Vibrio fischeri MJ11] (156 aa)
Score = 109, Expect = 1.1e-03, Identities = 39/150 (26%), Positives = 69/150 (46%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           L+   I+    +   ++  W P    IE R K+I   + AAE+A  + +     +  +L E+K  A EIIE A     +   +    AL +  +I ++G ++++ +          +V+ LA+  A   L + ID E  K I+D+I   L
  S:     7 LLGQAIAFTLFVWFCMKYVWPPIMEAIEERQKKIADGLSAAERAAKDLDLAQANASDQLKEAKRAATEIIEQANKRKSQILDEAREEALVERQKILTQGEAELESERNRARDELRKQVATLAVIGAEKILERSIDVEAQKDILDNITAKL 156
>gi|163789452|ref|ZP_02183891.1| ATP synthase F0, B subunit [Carnobacterium sp. AT7] >gi|159875306|gb|EDP69371.1| ATP synthase F0, B subunit [Carnobacterium sp. AT7] (171 aa)
Score = 109, Expect = 1.1e-03, Identities = 33/133 (24%), Positives = 76/133 (57%)
  Q:    52 LAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           +AWKP  + +E R + I   ++ AE  +LE+E+ L + + +L +++N ++ IIE A   A+K +++  A A  + ++++ E    I+ +  +       ++S+L+L+ A   + K++  E + ++I++ +  L
  S:    32 VAWKPLMAMMEKREQLIAGNIDDAEAKKLEAERLLKVQQQQLEDTRNRSSAIIEQARDSADKLEREQLAAAKAEIARLKEEAKKAIELERKQALASAQNDISRLSLDIAEKLIGKELSNEGHAELIEEYIERL 164
>gi|167587932|ref|ZP_02380320.1| F0F1 ATP synthase subunit B [Burkholderia ubonensis Bu] (156 aa)
Score = 108, Expect = 1.1e-03, Identities = 33/150 (22%), Positives = 81/150 (54%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           L A ++  + L    ++  W P  + ++ R K+I   + AAEK + E +        +L +++N   + I +AE  A+   ++I+A A  +A++I ++  ++ ++Q ++  +    EV+ LA++ A   L +++D+  + ++++ +  +L
  S:     7 LFAQMVVFLVLAWFTMKFVWPPLINALDERAKKIADGLAAAEKGKAELDAAHKRVDQELAQARNDGQQRIADAEKRAQAVAEEIKANAQAEAARIVAQAKAEAEQQIVKAREALRGEVATLAVKGAEQILKREVDQTAHAQLLNQLKAEL 156
>gi|186457094|ref|ZP_02967406.1| ATP synthase F0, B subunit [bacterium Ellin514] >gi|184206730|gb|EDU03777.1| ATP synthase F0, B subunit [bacterium Ellin514] (180 aa)
Score = 108, Expect = 1.1e-03, Identities = 40/152 (26%), Positives = 73/152 (48%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAA-EIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLTA 186
            IA VIS + +  L+ + A++P    ++ R K I+  +  AEK + E      ++R ++L   NT A ++IE A   A K ++     A+ +A+QI ++       +      +   EV +L + T      K +  E+ K+++DD    L A
  S:    29 FIAQVISFLIVAGLLYKFAYQPILKILDERRKRIEESLANAEKIKAEVAST-EVARQEILAKANTQANKLIEEARAAANKVRETETQKAIGEAAQIIAKAREATVAERAAEMAKLRREVGQLVVRTTAQVTGKILTPEDQKRLVDDTNKQLAA 180
>gi|59713175|ref|YP_205951.1| F0F1 ATP synthase subunit B [Vibrio fischeri ES114] >gi|59481276|gb|AAW87063.1| ATP synthase F0, B subunit [Vibrio fischeri ES114] (154 aa)
Score = 108, Expect = 1.1e-03, Identities = 39/150 (26%), Positives = 69/150 (46%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           L+   I+    +   ++  W P    IE R K+I   + AAE+A  + +     +  +L E+K  A EIIE A     +   +    AL +  +I ++G ++++ +          +V+ LA+  A   L + ID E  K I+D+I   L
  S:     5 LLGQAIAFTLFVWFCMKYVWPPIMEAIEERQKKIADGLSAAERAAKDLDLAQANASDQLKEAKRAATEIIEQANKRKSQILDEAREEALVERQKILTQGEAELESERNRARDELRKQVATLAVIGAEKILERSIDVEAQKDILDNITAKL 154
>gi|62318459|dbj|BAD94433.1| b subunit of F1F0-ATP synthase [Acidithiobacillus ferrooxidans] (159 aa)
Score = 108, Expect = 1.3e-03, Identities = 35/150 (23%), Positives = 76/150 (50%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           LI  +++ + L+ L+ +  + P +  ++ R  +I   + AAE+ + E       +   + E+K+ AAEII NAE    + +++ +  A  +A +I +   ++I  +     +    +V +L +      L ++ID++ ++ IID +V  L
  S:    10 LIVQLVTFVILVALLYKYMYGPLRKVMDDRRAKIADGLAAAERGKEEMALAQKRATELVREAKDKAAEIIANAERRGVELREEAQGKAREEADRIIASARAEIDVETNRAREVLRGQVVELVVNGTQRILHREIDDQAHRDIIDRMVGQL 159
>gi|1773262|gb|AAD13379.1| ATPase, b subunit [Streptococcus mutans] (165 aa)
Score = 108, Expect = 1.3e-03, Identities = 35/144 (24%), Positives = 76/144 (52%)
  Q:    41 SLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           S I LLLLV + AW    +  + R ++I + ++ AE ++  ++   +  +++L ++K+ AA+II+NA+   +  + KI   A  +A +++ +    I   + E       +V+ L++  A   ++K +D+     +ID  ++ L
  S:    19 SFILLLLLVKKFAWSQLAAIFKTREEKIAKDIDDAENSRQNAQVLENKRQVELNQAKDEAAQIIDNAKETGKAQESKIITEAHEEAGRLKDKANQDIATSKAEALSSVKADVADLSVLLAEKIMAKNLDKTAQGDLIDSYLDKL 162
>gi|58337086|ref|YP_193671.1| F0F1 ATP synthase subunit B [Lactobacillus acidophilus NCFM] >gi|6652829|gb|AAF22494.1|AF098522_4 F1F0-ATPase subunit b [Lactobacillus acidophilus] >gi|58254403|gb|AAV42640.1| H+-transporting ATP synthase chain b [Lactobacillus acidophilus NCFM] (169 aa)
Score = 108, Expect = 1.3e-03, Identities = 33/149 (22%), Positives = 73/149 (48%)
  Q:    36 IAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           I +++    L+LL+   AW P    +E R ++I   +++A   + ++E   +     L  S+  A +I+ +A+ +A+ T K+I A A   A+ I  +   +  K + +       +V+ +++  A   ++K +  E+ K ++D  +  L
  S:    19 IWYLLCFAILMLLIKHYAWGPVSDMMEKRRQKIISDLDSAASDRKKAETLANEREAALKNSRQEATQILSDAKTNAQNTSKEIVASANEDAAAIRKKANEEAAKAKSDALDAARDQVADISVAIAEKVIAKNLSAEDQKDLVDQFIKGL 167
>gi|152978014|ref|YP_001343643.1| F0F1 ATP synthase subunit B [Actinobacillus succinogenes 130Z] >gi|150839737|gb|ABR73708.1| ATP synthase F0, B subunit [Actinobacillus succinogenes 130Z] (156 aa)
Score = 108, Expect = 1.3e-03, Identities = 36/150 (24%), Positives = 75/150 (50%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           LI  +I+        ++  W P    IE R   I   + +AE A+ E      ++  ++ ++K  A EII++A     +   +++A A    ++I  +GY++++ +   +++   ++V+ LA+  A   + + +DE  N  IID +V +L
  S:     7 LIGQLIAFALFTWFCVKFVWPPIIKAIEERQSSIANALASAEAARKEQADTKTLAEEEITKAKIQAQEIIDSANKRRNEVLDEVKAEAETLKAKIIEQGYAEVEAERKRVQEELRVKVASLAIAGAEKIVGRTVDEAANNDIIDKLVAEL 156
>gi|728929|sp|P41172|ATPF_THIFE ATP synthase B chain >gi|154670|gb|AAA53123.1| F1F0-ATPase b subunit (159 aa)
Score = 108, Expect = 1.3e-03, Identities = 35/150 (23%), Positives = 76/150 (50%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           LI  +++ + L+ L+ +  + P +  ++ R  +I   + AAE+ + E       +   + E+K+ AAEII NAE    + +++ +  A  +A +I +   ++I  +     +    +V +L +      L ++ID++ ++ IID +V  L
  S:    10 LIVQLVTFVILVALLYKYMYGPLRKVMDDRRAKIADGLAAAERGKEEMALAQKRATELVREAKDKAAEIIANAERRGVELREEAQGKAREEADRIIASARAEIDVETNRAREVLRGQVVELVVNGTQRILHREIDDQTHRDIIDRMVGQL 159
>gi|117922565|ref|YP_871757.1| F0F1 ATP synthase subunit B [Shewanella sp. ANA-3] >gi|117614897|gb|ABK50351.1| ATP synthase F0, B subunit [Shewanella sp. ANA-3] (156 aa)
Score = 108, Expect = 1.3e-03, Identities = 38/150 (25%), Positives = 77/150 (51%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           LI   ++ I  +   ++  W P  + IEAR K I   +  A++A  + E     +  +L E+K TA EIIE A     +  ++ +A A  + ++I ++G ++I+ +   +++    +V+ LA+  A   L + ID   +  I++ +V ++
  S:     7 LIGQTVAFIIFVWFCMKFVWPPLMNAIEARQKRIADGLADADRAVKDLELAQAKATDQLKEAKATANEIIEQANKRKAQIVEEAKAEADAERAKIIAQGKAEIEAERNRVKEDLRKQVATLAIMGAEKILERSIDPAAHSDIVNKLVAEI 156
>gi|14916964|sp|P22481|ATPF_BACPF ATP synthase B chain >gi|12061042|gb|AAG48359.1|AF330160_6 ATP synthase b subunit [Bacillus pseudofirmus] (163 aa)
Score = 108, Expect = 1.3e-03, Identities = 36/151 (23%), Positives = 82/151 (54%)
  Q:    38 HVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLTAKL 188
            +++   LL  + + A KP    +E R + I  ++ +AEK + +SE  +   R  L +++  A EII+NA+  +E+  + I   A N A +I+    ++I++++ +       +V+ L++  A   + K+++E E +K++ + + ++  +L
  S:    13 QLLAFSVLLFFLSKFALKPLLGIMEKREQMINEQISSAEKNRKDSEAFIAEQRQALEQARMEANEIIQNAKKLSEQQGQDIVKAARNDAERIKESAVAEIQREKEQAVSALREQVAGLSVLIATKVIEKELNEAEQEKLVQEYLKEVGEEL 163
>gi|24376223|ref|NP_720267.1| F0F1 ATP synthase subunit B [Shewanella oneidensis MR-1] >gi|24351283|gb|AAN57710.1|AE015907_8 ATP synthase F0, B subunit [Shewanella oneidensis MR-1] (156 aa)
Score = 108, Expect = 1.3e-03, Identities = 37/150 (24%), Positives = 76/150 (50%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           LI   ++ I  +   ++  W P  + IEAR K I   +  A++A  + E     +  +L E+K TA EIIE A     +  ++ +  A  + ++I ++G ++I+ +   +++    +V+ LA+  A   L + ID   +  I++ +V ++
  S:     7 LIGQTVAFIIFVWFCMKFVWPPLMNAIEARQKRIADGLADADRAVKDLELAQAKATDQLKEAKVTANEIIEQANKRKAQIVEEAKTEADAERAKIIAQGKAEIEAERNRVKEDLRKQVATLAIMGAEKILERSIDPAAHSDIVNKLVAEI 156
>gi|91785737|ref|YP_560943.1| F0F1 ATP synthase subunit B [Burkholderia xenovorans LB400] >gi|91689691|gb|ABE32891.1| ATP synthase F0, subunit B [Burkholderia xenovorans LB400] (156 aa)
Score = 108, Expect = 1.4e-03, Identities = 37/154 (24%), Positives = 80/154 (51%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLTAKL 188
           L A ++  + L    ++  W P  + ++ R+K+I   + AAEK + E E        +L +++N   + + +AE  A     +I+A A  +A++I ++  +  ++Q ++  +    EV+ LA++ A   L +++D+  +     D++N L A+L
  S:     7 LFAQMVVFLILAWFTMKFVWPPLINALDERSKKIADGLSAAEKGKAELEAAHKRVDQELAQARNDGQQRVADAEKRAVAVADEIKAQAQAEAARIIAQAKADAEQQVVKARETLRGEVAALAVKGAEQILKREVDQAAHA----DLLNQLKAEL 156
>gi|194684372|emb|CAR46014.1| ATP synthase B chain [Proteus mirabilis HI4320] (156 aa)
Score = 108, Expect = 1.4e-03, Identities = 36/150 (24%), Positives = 77/150 (51%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           ++   I+ +  +L  ++  W P  + IE R KEI   + +AE+A+ + +     +  +L ++K  A  IIE+A     +  ++ +A A  + S+I ++  S+++ +     +    +V+ LA+  A   + + +DE  N  I+D +V +L
  S:     7 ILGQAIAFVLFVLFCMKYVWPPIMAAIEKRQKEIADGLSSAERAKKDLDLAKADAGEQLAKAKAEAQAIIESANKQRTQMIEEAKAEAEQERSKIVAQAQSELEAERKRAREELRKQVAMLAIAGAEKIIERSVDEAANSDIVDKLVAEL 156
>gi|110835591|ref|YP_694450.1| ATP synthase F0, B subunit [Alcanivorax borkumensis SK2] >gi|110648702|emb|CAL18178.1| ATP synthase F0, B subunit [Alcanivorax borkumensis SK2] (156 aa)
Score = 108, Expect = 1.4e-03, Identities = 32/150 (21%), Positives = 77/150 (51%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           LI   I     +   ++  W P    ++ R ++I   + AA++A+ + E     +   L ESK  AAEII+ A   A +  ++ +  A  +  ++ ++ +S+I ++  +  ++   +V+ LAL  A   L  +++++++ ++++ +  +L
  S:     7 LIGQAIWFALFVFFCMKFVWPPISRALDERKQKIAEGLSAADRAERDLELAQEKATANLKESKEKAAEIIDQANRRANQIVEEAKDAARAEGERLIAKAHSEIDQEVNQAREQLRKDVAVLALSGAEKVLGGEVNQDKHTQLLEQLAAEL 156
>gi|32034344|ref|ZP_00134544.1| COG0711: F0F1-type ATP synthase, subunit b [Actinobacillus pleuropneumoniae serovar 1 str. 4074] >gi|126209114|ref|YP_001054339.1| F0F1 ATP synthase subunit B [Actinobacillus pleuropneumoniae L20] >gi|126097906|gb|ABN74734.1| ATP synthase B chain [Actinobacillus pleuropneumoniae L20] (156 aa)
Score = 107, Expect = 1.5e-03, Identities = 35/150 (23%), Positives = 75/150 (50%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           LI  +I+    +   ++  W P    IE R   I   + +AEKA+ E   +   +  ++L++K  A +II+ A     +  + ++A A  +  +I  +G+++++ +   +++    +V+ LA+  A   +   +D+  N  IID +V +L
  S:     7 LIGQLIAFALFVAFCMKFVWPPLIKAIEERQANIANALASAEKAKQEQADSKAAADQEILKAKEEAQKIIDLATKRRNEILETVQAEAEIERQRIIEQGHAEVESERKRVQEELRQKVAALAVAGAEKIVGCSVDQAANNDIIDKLVAEL 156
>gi|196193574|gb|EDX88533.1| ATP synthase F0, B subunit [Alcanivorax sp. DG881] (156 aa)
Score = 107, Expect = 1.5e-03, Identities = 33/150 (22%), Positives = 75/150 (50%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           LI   I     +   ++  W P    ++ R ++I   + AA++A+ + E     +   L ESK  AAEII+ A   A +  ++ +  A  +  ++ ++  S+I ++  +  ++   EV+ LAL  A   L  +++++ + ++++ +  +L
  S:     7 LIGQAIWFALFVFFCMKFVWPPISRALDERKQKIAEGLSAADRAERDLELAQEKATANLKESKEKAAEIIDQANRRANQIVEEAKDAARTEGERLIAKAQSEIDQEVNQAREQLRKEVAVLALSGAEKVLGNEVNQDAHTQLLEQLAAEL 156
>gi|171323832|ref|ZP_02912350.1| ATP synthase F0, B subunit [Geobacillus sp. WCH70] >gi|171090143|gb|EDT36455.1| ATP synthase F0, B subunit [Geobacillus sp. WCH70] (179 aa)
Score = 107, Expect = 1.7e-03, Identities = 35/134 (26%), Positives = 75/134 (55%)
  Q:    51 RLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           + A+ P    ++ R + I  ++E AEK + E+EK L   R  + +S+  A E+IENA   AE+ K++I A A  +A +++     +I++++ +       +V+ L++  A   + K++ E++  K+I + + ++
  S:    42 KYAFGPLMGVMKQREEHIANEIEQAEKHRKEAEKLLEEQRELMKQSRQEAQELIENARKMAEEQKEQIIASARAEAERLKETAKKEIEREKEQAMAALREQVASLSVLIASKVIEKELTEQDQAKLISEYIQEV 175
>gi|15642761|ref|NP_232394.1| F0F1 ATP synthase subunit B [Vibrio cholerae O1 biovar eltor str. N16961] >gi|121591532|ref|ZP_01678795.1| ATP synthase F0, B subunit [Vibrio cholerae 2740-80] >gi|147674150|ref|YP_001218417.1| F0F1 ATP synthase subunit B [Vibrio cholerae O395] >gi|153820050|ref|ZP_01972717.1| ATP synthase F0, B subunit [Vibrio cholerae NCTC 8457] >gi|153821985|ref|ZP_01974652.1| ATP synthase F0, B subunit [Vibrio cholerae B33] >gi|15213932|sp|Q9KNH1|ATPF_VIBCH ATP synthase B chain >gi|9657369|gb|AAF95907.1| ATP synthase F0, B subunit [Vibrio cholerae O1 biovar El Tor str. N16961] >gi|121546617|gb|EAX56809.1| ATP synthase F0, B subunit [Vibrio cholerae 2740-80] >gi|126509407|gb|EAZ72001.1| ATP synthase F0, B subunit [Vibrio cholerae NCTC 8457] >gi|126520524|gb|EAZ77747.1| ATP synthase F0, B subunit [Vibrio cholerae B33] >gi|146316033|gb|ABQ20572.1| ATP synthase F0, B subunit [Vibrio cholerae O395] (156 aa)
Score = 107, Expect = 1.7e-03, Identities = 38/150 (25%), Positives = 72/150 (48%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           L+   IS    +   ++  W P    IE R K+I   ++AAE+A+ + +     +  +L E+K TA E+IE A     +   +    A  +  +I ++  ++I+ +          +V+ LA+  A   L + ID++ +K I+D+I   L
  S:     7 LLGQAISFGMFVWFCMKYVWPPIIKAIEDRQKKIADGLQAAERAKKDLDLAQANASDQLKEAKRTATELIEQANKRKAQIIDEAREEAQAERQKILTQAEAEIEAERNRARDELRKQVATLAIAGAEKILERSIDKDTHKDILDNITAKL 156
>gi|113972256|ref|YP_736049.1| F0F1 ATP synthase subunit B [Shewanella sp. MR-4] >gi|114049505|ref|YP_740055.1| F0F1 ATP synthase subunit B [Shewanella sp. MR-7] >gi|113886940|gb|ABI40992.1| ATP synthase F0, B subunit [Shewanella sp. MR-4] >gi|113890947|gb|ABI44998.1| ATP synthase F0, B subunit [Shewanella sp. MR-7] (156 aa)
Score = 107, Expect = 1.7e-03, Identities = 38/150 (25%), Positives = 77/150 (51%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           LI   ++ I  +   ++  W P  + IEAR K I   +  A++A  + E     +  +L E+K TA EIIE A     +  ++ +A A  + ++I ++G ++I+ +   +++    +V+ LA+  A   L + ID   +  I++ +V ++
  S:     7 LIGQTVAFIIFVWFCMKFVWPPLMNAIEARQKRIADGLADADRAVKDLELAQAKATDQLKEAKVTANEIIEQANKRKAQIVEEAKAEADAERAKIIAQGKAEIEAERNRVKEDLRKQVATLAIMGAEKILERSIDPAAHSDIVNKLVAEI 156
>gi|187930581|ref|YP_001901068.1| ATP synthase F0, B subunit [Ralstonia pickettii 12J] >gi|187727471|gb|ACD28636.1| ATP synthase F0, B subunit [Ralstonia pickettii 12J] (156 aa)
Score = 107, Expect = 1.7e-03, Identities = 39/154 (25%), Positives = 80/154 (51%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLTAKL 188
           L+A ++    L  +V +  W P    ++ R K+I   + AA+K + E E         L E++N  A+ I +AE  A+ T  +I+  A  +A++I ++  ++ ++Q +   +    +V+ LA++ A   L +++    N ++  D++N L A+L
  S:     7 LVAQMVVFFILWWVVAKFIWPPLVKALDERAKKIADGLAAADKGKAELELANKRVDQALTEARNEGAQRIADAEKRAQMTADEIKQNAQAEAARIIAQAKAEAEQQTVRARESLRDQVAVLAVKGAEQILKREV----NAQVHADLLNQLKAEL 156
>gi|78064761|ref|YP_367530.1| F0F1 ATP synthase subunit B [Burkholderia sp. 383] >gi|77965506|gb|ABB06886.1| ATP synthase F0, subunit B [Burkholderia sp. 383] (156 aa)
Score = 106, Expect = 2.0e-03, Identities = 32/150 (21%), Positives = 82/150 (54%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           L A ++  + L    ++  W P  + ++ R+K+I   + AAEK + E +        +L +++N   + I +AE  A+   ++I++ A  +A++I ++  ++ ++Q ++  +    EV+ LA++ A   L +++D+  + ++++ +  +L
  S:     7 LFAQMVVFLVLAWFTMKFVWPPLINALDERSKKIADGLAAAEKGKAELDAAHKRVDQELAQARNDGQQRIADAEKRAQAVAEEIKSNAQAEAARIIAQAKAEAEQQIVKAREALRGEVATLAVKGAEQILKREVDQTAHAQLLNQLKAEL 156
>gi|110277399|gb|ABG57228.1| AtpB [Streptococcus mitis] (140 aa)
Score = 106, Expect = 2.0e-03, Identities = 37/121 (30%), Positives = 64/121 (52%)
  Q:    41 SLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAG 161
           S I LL+L+ + AW       E R ++I   +++AE+A+ ++E        +L  S+  A  IIENA+  AEK+K  I A A  +A +++ +   +I + + E  +    EV+ L +  AG
  S:    18 SFILLLVLIKKFAWSNITGIFEERAEKIATDIDSAEEARQKAEVLAQKREDELAGSRKEAKAIIENAKQTAEKSKASILADAKLEAGRLKEKANQEIAQNKAEALQSVKGEVADLTISLAG 138
>gi|145596146|ref|YP_001160443.1| ATP synthase F0, B subunit [Salinispora tropica CNB-440] >gi|145305483|gb|ABP56065.1| ATP synthase F0, B subunit [Salinispora tropica CNB-440] (175 aa)
Score = 106, Expect = 2.2e-03, Identities = 41/161 (25%), Positives = 79/161 (49%)
  Q:    26 NQIFPNVYVLIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKI-DEEENKKIIDDIVNDLTA 186
           N I P    L+   I+   L+ ++++      ++  +AR   I+  ++ AE AQ E+ + L   R +L E +  AA I ++A  DAE  ++ I A A  ++ +I + G  ++  +   + +    EV  LA++ AG  + + + DE      +D  +N L +
  S:    10 NPILPIWQELVVGTIAFALLVFVLLKFVMPRMETMYQARVDAIEGGLKRAEAAQAEANQLLEQYRAQLAEVRTEAARIRDDARADAEGIRQDILAKAREESDRIIAAGKEQLVAERTTIVRELRTEVGTLAVDLAGKIVGESLADEARRAGTVDRFLNGLES 171
>gi|83746952|ref|ZP_00943998.1| ATP synthase B chain [Ralstonia solanacearum UW551] >gi|83726372|gb|EAP73504.1| ATP synthase B chain [Ralstonia solanacearum UW551] (156 aa)
Score = 106, Expect = 2.2e-03, Identities = 38/154 (24%), Positives = 80/154 (51%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLTAKL 188
           L+A ++    L  +V +  W P    ++ R K+I   + AA+K + E E         L E++N  A+ I +AE  A+ +  +I+  A  +A++I ++  ++ ++Q +   +    +V+ LA++ A   L +++    N ++  D++N L A+L
  S:     7 LVAQMVVFFILWWVVAKFIWPPLVKALDERAKKIADGLAAADKGKAELELANKRVEQALTEARNEGAQRIADAEKRAQMSADEIKQNAQAEAARIIAQAKAEAEQQTVRARESLRDQVATLAVKGAEQILKREV----NAQVHTDLLNQLKAEL 156
>gi|148245078|ref|YP_001219772.1| F0F1-type ATP synthase B subunit [Candidatus Vesicomyosocius okutanii HA] >gi|146326905|dbj|BAF62048.1| F0F1-type ATP synthase B subunit [Candidatus Vesicomyosocius okutanii HA] (157 aa)
Score = 106, Expect = 2.2e-03, Identities = 31/151 (20%), Positives = 74/151 (49%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLT 185
           +   +I         ++  W P    +E R K I+  + AAE+ + E  +    ++  + +SK+ AAEII NA   A    +  + +AL +A +++ +  +++++  + +      +VS L ++     L K++D + +++++  +   L+
  S:     7 MFGQLIMFAMFTWFCMKFIWPPIVMAMEERQKRIEGGLLAAERGRFEKAEAQIKAKEIINQSKSLAAEIIANATRQALNMVEDAKYIALKEAGKVKEQAQAQLEQDTICVRNELKNQVSDLVIQGVNAVLDKEVDVKLHQQMLGKLSESLS 157
>gi|6625699|gb|AAF19358.1|AF188265_4 ATP synthase subunit b [Salmonella typhimurium] (156 aa)
Score = 106, Expect = 2.3e-03, Identities = 35/150 (23%), Positives = 75/150 (50%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           ++   I+++  +L  ++  W P  + IE R KEI   + +AE+A  + +     +  +L ++K  A  IIE A     +   + +A A  + ++I ++  ++I+ +     +    +V+ LA+  A   + + +DE  N  I+D +V +L
  S:     7 ILGQAIAIVLFVLFCMKYVWPPLMAAIEKRQKEIANGLASAERAHKDLDLAKASATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVAQAQAEIEAERKRAREELRKQVAILAVAGAEKIIERSVDEAANSDIVDKLVAEL 156
>gi|153885485|ref|ZP_02006642.1| ATP synthase F0, B subunit [Ralstonia pickettii 12D] >gi|151578385|gb|EDN42784.1| ATP synthase F0, B subunit [Ralstonia pickettii 12D] (156 aa)
Score = 106, Expect = 2.4e-03, Identities = 38/154 (24%), Positives = 81/154 (52%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLTAKL 188
           L+A ++    L  +V +  W P    ++ R K+I   + AA+K + E E         L E++N  A+ I +AE  A+ + ++I+  A  +A++I ++  ++ ++Q +   +    +V+ LA++ A   L +++    N ++  D++N L A+L
  S:     7 LVAQMVVFFILWWVVAKFIWPPLVKALDERAKKIADGLAAADKGKAELELANKRVEQALTEARNEGAQRIADAEKRAQMSAEEIKQNAQAEAARIIAQAKAEAEQQTVRARESLRDQVATLAVKGAEQILKREV----NAQVHADLLNQLKAEL 156
>gi|83649677|ref|YP_438112.1| F0F1 ATP synthase subunit B [Hahella chejuensis KCTC 2396] >gi|83637720|gb|ABC33687.1| F0F1-type ATP synthase, subunit b [Hahella chejuensis KCTC 2396] (156 aa)
Score = 105, Expect = 2.5e-03, Identities = 36/150 (24%), Positives = 71/150 (47%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           +I   I+    ++  ++  W P    +  R K+I   ++AAE AQ + E        +L E+K  AAEIIE A   A +  ++ +  A  +  ++ +   ++I +++   ++    EV+ LAL  A   L   +D   +  ++D +  +L
  S:     7 MIGQAIAFFIFVVFCMKYVWPPVIQALREREKKIADGLQAAEHAQKDLELAQEKVAKQLREAKQQAAEIIEQANKRANQMLEEAKDQARTEGERLITAAKAEIDQEKNRAKESLRAEVAALALAGAEKILETSVDAGAHSNMLDKLAAEL 156
>gi|147679151|ref|YP_001213366.1| F0F1-type ATP synthase, subunit b [Pelotomaculum thermopropionicum SI] >gi|146275248|dbj|BAF60997.1| F0F1-type ATP synthase, subunit b [Pelotomaculum thermopropionicum SI] (162 aa)
Score = 105, Expect = 2.5e-03, Identities = 33/149 (22%), Positives = 78/149 (52%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVND 183
           L+A ++  I LL+ +  +A+KP    +  R++ I+R + AAEK + ++E+       ++  ++  A EII+ A    E+   +I   A N+  +++    ++I++++ +       +V  L++  AG  +++ +  E   +I+ D + +
  S:     8 LLAQIVDFIILLIFLRLVAYKPLMKLLSERSEHIERNIAAAEKERQQAEQLRASYEAEMRRAREQAQEIIQKATKAGEEQALQIIENAKNETVRMKETALAEIEREKQKAMAELRDQVVTLSILVAGKIINRSMSSEIQHEIVRDFIKE 156
>gi|148145|gb|AAA24741.1| proton-translocating ATPase b subunit (uncF; gtg start codon) (156 aa)
Score = 105, Expect = 2.6e-03, Identities = 35/150 (23%), Positives = 74/150 (49%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           ++   I+ +  +L  ++  W P  + IE R KEI   + +AE+A  + +     +  +L ++K  A  IIE A     +   + +A A  + ++I ++  ++I+ +     +    +V+ LA+  A   + + +DE  N  I+D +V +L
  S:     7 ILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKASANDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVAQAQAEIEAERKRAREELRKQVAILAVAGAEKIIERSVDEAANSDIVDKLVAEL 156
>gi|121729378|ref|ZP_01682045.1| ATP synthase F0, B subunit [Vibrio cholerae V52] >gi|153212960|ref|ZP_01948554.1| ATP synthase F0, B subunit [Vibrio cholerae 1587] >gi|153224016|ref|ZP_01954178.1| ATP synthase F0, B subunit [Vibrio cholerae MAK 757] >gi|153803701|ref|ZP_01958287.1| ATP synthase F0, B subunit [Vibrio cholerae MZO-3] >gi|153827185|ref|ZP_01979852.1| ATP synthase F0, B subunit [Vibrio cholerae MZO-2] >gi|153829657|ref|ZP_01982324.1| ATP synthase F0, B subunit [Vibrio cholerae 623-39] >gi|121628659|gb|EAX61131.1| ATP synthase F0, B subunit [Vibrio cholerae V52] >gi|124116186|gb|EAY35006.1| ATP synthase F0, B subunit [Vibrio cholerae 1587] >gi|124117894|gb|EAY36637.1| ATP synthase F0, B subunit [Vibrio cholerae MAK 757] >gi|124120763|gb|EAY39506.1| ATP synthase F0, B subunit [Vibrio cholerae MZO-3] >gi|125620541|gb|EAZ48909.1| ATP synthase F0, B subunit [Vibrio cholerae V51] >gi|148874833|gb|EDL72968.1| ATP synthase F0, B subunit [Vibrio cholerae 623-39] >gi|149738908|gb|EDM53232.1| ATP synthase F0, B subunit [Vibrio cholerae MZO-2] >gi|150422989|gb|EDN14939.1| ATP synthase F0, B subunit [Vibrio cholerae AM-19226] (156 aa)
Score = 105, Expect = 2.8e-03, Identities = 37/150 (24%), Positives = 72/150 (48%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           L+   I+    +   ++  W P    IE R K+I   ++AAE+A+ + +     +  +L E+K TA E+IE A     +   +    A  +  +I ++  ++I+ +          +V+ LA+  A   L + ID++ +K I+D+I   L
  S:     7 LLGQAIAFGMFVWFCMKYVWPPIIKAIEDRQKKIADGLQAAERAKKDLDLAQANASDQLKEAKRTATELIEQANKRKAQIIDEAREEAQAERQKILTQAEAEIEAERNRARDELRKQVATLAIAGAEKILERSIDKDTHKDILDNITAKL 156
>gi|170767001|ref|ZP_02901454.1| ATP synthase F0, B subunit [Escherichia albertii TW07627] >gi|170124439|gb|EDS93370.1| ATP synthase F0, B subunit [Escherichia albertii TW07627] (156 aa)
Score = 105, Expect = 2.8e-03, Identities = 35/150 (23%), Positives = 75/150 (50%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           ++   I+ +  +L  ++  W P  + IE R KEI   + +AE+A+ + +     +  +L ++K  A  IIE A     +   + +A A  + ++I ++  ++I+ +     +    +V+ LA+  A   + + +DE  N  I+D +V +L
  S:     7 ILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAKKDLDLAQANATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVAQAQAEIEAERKRAREELRKQVAILAVAGAEKIIERSVDEAANSDIVDKLVAEL 156
>gi|119776780|ref|YP_929520.1| F0F1 ATP synthase subunit B [Shewanella amazonensis SB2B] >gi|119769280|gb|ABM01851.1| ATP synthase F0, B subunit [Shewanella amazonensis SB2B] (156 aa)
Score = 105, Expect = 3.0e-03, Identities = 38/150 (25%), Positives = 77/150 (51%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           LI   ++ I  +   ++  W P  + IE R K I   +  A++A  + E     +  +L E+K TA EIIE+A     +  ++ +A A  + ++I ++G ++I+ +   +++    +V+ LAL  A   L + ID   +  I++ +V ++
  S:     7 LIGQTVAFIIFVWFCMKYVWPPLMNAIEERQKRIADGLANADRAAKDLELAQAKATEQLKEAKATANEIIESANKRKAQIVEEAKAEADAERARIIAQGKAEIEAERNRVKEELRKQVATLALAGAEKILERSIDAAAHSDIVEKLVAEI 156
>gi|90023610|ref|YP_529437.1| F0F1 ATP synthase subunit B [Saccharophagus degradans 2-40] >gi|89953210|gb|ABD83225.1| ATP synthase F0, B subunit [Saccharophagus degradans 2-40] (156 aa)
Score = 105, Expect = 3.1e-03, Identities = 34/150 (22%), Positives = 76/150 (50%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           LI   ++ I  +L  ++  W    + +E R K I   +EAA++A  + E     +  +L E+K  AA I+E A     +  ++ +  A+ +  +I++   ++I++Q  +  +    +V+ LA++ A   L   +D + + +++D +  +L
  S:     7 LIGQSLTFIAFILFCMKYVWPQLIAMMEEREKRIAEGLEAADRADKDLELAQKKAGKQLTEAKEQAATIVEQANKRGNQIVEEAKEAAVAEGERIKAAAQAEIERQVAQAREELRGKVAALAIQGAEKVLGTTVDAKAHSEMLDKLAAEL 156
>gi|15804336|ref|NP_290375.1| F0F1 ATP synthase subunit B [Escherichia coli O157:H7 EDL933] >gi|15833932|ref|NP_312705.1| F0F1 ATP synthase subunit B [Escherichia coli O157:H7 str. Sakai] >gi|16131604|ref|NP_418192.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia coli str. K-12 substr. MG1655] >gi|24115039|ref|NP_709549.1| F0F1 ATP synthase subunit B [Shigella flexneri 2a str. 301] >gi|26250482|ref|NP_756522.1| F0F1 ATP synthase subunit B [Escherichia coli CFT073] >gi|30064959|ref|NP_839130.1| F0F1 ATP synthase subunit B [Shigella flexneri 2a str. 2457T] >gi|74314238|ref|YP_312657.1| F0F1 ATP synthase subunit B [Shigella sonnei Ss046] >gi|82546103|ref|YP_410050.1| F0F1 ATP synthase subunit B [Shigella boydii Sb227] >gi|82779072|ref|YP_405421.1| F0F1 ATP synthase subunit B [Shigella dysenteriae Sd197] >gi|89110271|ref|AP_004051.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia coli W3110] >gi|91213263|ref|YP_543249.1| F0F1 ATP synthase subunit B [Escherichia coli UTI89] >gi|110644077|ref|YP_671807.1| F0F1 ATP synthase subunit B [Escherichia coli 536] >gi|110807560|ref|YP_691080.1| F0F1 ATP synthase subunit B [Shigella flexneri 5 str. 8401] >gi|157156607|ref|YP_001465227.1| F0F1 ATP synthase subunit B [Escherichia coli E24377A] >gi|157163218|ref|YP_001460536.1| F0F1 ATP synthase subunit B [Escherichia coli HS] >gi|168709489|ref|ZP_02741766.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC4045] >gi|168716587|ref|ZP_02748864.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC4206] >gi|168735322|ref|ZP_02767599.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC4115] >gi|168748534|ref|ZP_02773556.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC4113] >gi|168753638|ref|ZP_02778645.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC4401] >gi|168759936|ref|ZP_02784943.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC4501] >gi|168766236|ref|ZP_02791243.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC4486] >gi|168772215|ref|ZP_02797222.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC4196] >gi|168779971|ref|ZP_02804978.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC4076] >gi|168786579|ref|ZP_02811586.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC869] >gi|168790961|ref|ZP_02815968.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC4042] >gi|168798784|ref|ZP_02823791.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC508] >gi|170022227|ref|YP_001727181.1| ATP synthase F0, B subunit [Escherichia coli ATCC 8739] >gi|170083237|ref|YP_001732557.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia coli str. K12 substr. DH10B] >gi|170680530|ref|YP_001746066.1| ATP synthase F0, B subunit [Escherichia coli SMS-3-5] >gi|187730481|ref|YP_001882427.1| ATP synthase F0, B subunit [Shigella boydii CDC 3083-94] >gi|188495894|ref|ZP_03003164.1| ATP synthase F0, B subunit [Escherichia coli 53638] >gi|191165830|ref|ZP_03027668.1| ATP synthase F0, B subunit [Escherichia coli B7A] >gi|191170575|ref|ZP_03032128.1| ATP synthase F0, B subunit [Escherichia coli F11] >gi|193063838|ref|ZP_03044925.1| ATP synthase F0, B subunit [Escherichia coli E22] >gi|193069162|ref|ZP_03050119.1| ATP synthase F0, B subunit [Escherichia coli E110019] >gi|194428101|ref|ZP_03060645.1| ATP synthase F0, B subunit [Escherichia coli B171] >gi|194431089|ref|ZP_03063382.1| ATP synthase F0, B subunit [Shigella dysenteriae 1012] >gi|194435957|ref|ZP_03068060.1| ATP synthase F0, B subunit [Escherichia coli 101-1] >gi|195936363|ref|ZP_03081745.1| F0F1 ATP synthase subunit B [Escherichia coli O157:H7 str. EC4024] >gi|81175153|sp|P0ABA0|ATPF_ECOLI ATP synthase B chain >gi|81175151|sp|P0ABA2|ATPF_ECO57 ATP synthase B chain >gi|81175152|sp|P0ABA1|ATPF_ECOL6 ATP synthase B chain >gi|81175154|sp|P0ABA3|ATPF_SHIFL ATP synthase B chain >gi|12518593|gb|AAG58939.1|AE005605_7 membrane-bound ATP synthase, F0 sector, subunit b [Escherichia coli O157:H7 EDL933] >gi|26110912|gb|AAN83096.1|AE016769_211 ATP synthase B chain [Escherichia coli CFT073] >gi|146321|gb|AAA83871.1| integral membrane proton channel F0 subunit B [Escherichia coli] >gi|148135|gb|AAA24733.1| ATP synthase b subunit [Escherichia coli] >gi|290585|gb|AAA62088.1| ATP synthase F0 subunit b >gi|581045|emb|CAA23516.1| unnamed protein product [Escherichia coli] >gi|581046|emb|CAA23523.1| atpF [Escherichia coli] >gi|581249|emb|CAA25778.1| unnamed protein product [Escherichia coli] >gi|1790174|gb|AAC76759.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia coli str. K-12 substr. MG1655] >gi|13364153|dbj|BAB38101.1| membrane-bound ATP synthase subunit b AtpF [Escherichia coli O157:H7 str. Sakai] >gi|24054298|gb|AAN45256.1| membrane-bound ATP synthase, F0 sector, subunit b [Shigella flexneri 2a str. 301] >gi|30043220|gb|AAP18941.1| membrane-bound ATP synthase, F0 sector, subunit b [Shigella flexneri 2a str. 2457T] >gi|73857715|gb|AAZ90422.1| membrane-bound ATP synthase, F0 sector, subunit b [Shigella sonnei Ss046] >gi|81243220|gb|ABB63930.1| membrane-bound ATP synthase, F0 sector, subunit b [Shigella dysenteriae Sd197] >gi|81247514|gb|ABB68222.1| membrane-bound ATP synthase, F0 sector, subunit b [Shigella boydii Sb227] >gi|85676302|dbj|BAE77552.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia coli W3110] >gi|91074837|gb|ABE09718.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli UTI89] >gi|110345669|gb|ABG71906.1| ATP synthase B chain [Escherichia coli 536] >gi|110617108|gb|ABF05775.1| membrane-bound ATP synthase, F0 sector, subunit b [Shigella flexneri 5 str. 8401] >gi|157068898|gb|ABV08153.1| ATP synthase F0, B subunit [Escherichia coli HS] >gi|157078637|gb|ABV18345.1| ATP synthase F0, B subunit [Escherichia coli E24377A] >gi|169757155|gb|ACA79854.1| ATP synthase F0, B subunit [Escherichia coli ATCC 8739] >gi|169891072|gb|ACB04779.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia coli str. K12 substr. DH10B] >gi|170518248|gb|ACB16426.1| ATP synthase F0, B subunit [Escherichia coli SMS-3-5] >gi|187427473|gb|ACD06747.1| ATP synthase F0, B subunit [Shigella boydii CDC 3083-94] >gi|187771617|gb|EDU35461.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC4196] >gi|188016977|gb|EDU55099.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC4113] >gi|188491093|gb|EDU66196.1| ATP synthase F0, B subunit [Escherichia coli 53638] >gi|189002279|gb|EDU71265.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC4076] >gi|189358998|gb|EDU77417.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC4401] >gi|189364601|gb|EDU83020.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC4486] >gi|189369852|gb|EDU88268.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC4501] >gi|189373288|gb|EDU91704.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC869] >gi|189378758|gb|EDU97174.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC508] >gi|190904154|gb|EDV63865.1| ATP synthase F0, B subunit [Escherichia coli B7A] >gi|190909383|gb|EDV68969.1| ATP synthase F0, B subunit [Escherichia coli F11] >gi|192930553|gb|EDV83160.1| ATP synthase F0, B subunit [Escherichia coli E22] >gi|192957486|gb|EDV87932.1| ATP synthase F0, B subunit [Escherichia coli E110019] >gi|194413859|gb|EDX30137.1| ATP synthase F0, B subunit [Escherichia coli B171] >gi|194420544|gb|EDX36620.1| ATP synthase F0, B subunit [Shigella dysenteriae 1012] >gi|194425500|gb|EDX41484.1| ATP synthase F0, B subunit [Escherichia coli 101-1] (156 aa)
Score = 105, Expect = 3.1e-03, Identities = 35/150 (23%), Positives = 74/150 (49%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           ++   I+ +  +L  ++  W P  + IE R KEI   + +AE+A  + +     +  +L ++K  A  IIE A     +   + +A A  + ++I ++  ++I+ +     +    +V+ LA+  A   + + +DE  N  I+D +V +L
  S:     7 ILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKASATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVAQAQAEIEAERKRAREELRKQVAILAVAGAEKIIERSVDEAANSDIVDKLVAEL 156
>gi|149200617|ref|ZP_01877621.1| ATP synthase F0, B subunit [Lentisphaera araneosa HTCC2155] >gi|149136291|gb|EDM24740.1| ATP synthase F0, B subunit [Lentisphaera araneosa HTCC2155] (190 aa)
Score = 104, Expect = 3.4e-03, Identities = 32/145 (22%), Positives = 70/145 (48%)
  Q:    40 ISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           I    LL +  ++AWKP  + ++AR   I+  +E A++   +       ++  + +++ +A  I+  A+  A+K  K+I   A  +A  +       I+    +       E ++LA+  AG  + + +D E+++ + D I++ L
  S:    46 ICFFSLLFVGGKIAWKPILANLDARETRIRESLENADRIDSQLADTEASTKKLISDAEASAKSIVTGAKETAQKLAKEINDTAKAEAQSLRENALKDIENARAKAVSSLRDESAELAVTLAGKLIGENLDSEKSRVLTDKIIDTL 190
>gi|120600839|ref|YP_965413.1| F0F1 ATP synthase subunit B [Shewanella sp. W3-18-1] >gi|124547717|ref|ZP_01706563.1| ATP synthase F0, B subunit [Shewanella putrefaciens 200] >gi|146295040|ref|YP_001185464.1| F0F1 ATP synthase subunit B [Shewanella putrefaciens CN-32] >gi|120560932|gb|ABM26859.1| ATP synthase F0, B subunit [Shewanella sp. W3-18-1] >gi|124508981|gb|EAY53067.1| ATP synthase F0, B subunit [Shewanella putrefaciens 200] >gi|145566730|gb|ABP77665.1| ATP synthase F0, B subunit [Shewanella putrefaciens CN-32] (156 aa)
Score = 104, Expect = 3.4e-03, Identities = 39/150 (26%), Positives = 75/150 (50%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           L+   IS    +   I+  W P  + IE R K+I   +  A +A  + E     +  +L E+K TA EIIE A     +  ++ +A A  + ++I ++G ++I+ +   ++     +V+ LA+  A   L + ID+  +  I+D +V ++
  S:     7 LLGQAISFALFVWFCIKFVWPPLMNAIEERQKKIADGLADAGRAAKDLELAQAKATEQLKEAKVTANEIIEQANKRKAQIVEEAKAEADAERAKIIAQGKAEIENERSRVKDDLRKQVAALAVLGAERILERSIDQAAHSDIVDKLVAEI 156
>gi|121534923|ref|ZP_01666742.1| ATP synthase F0, B subunit [Thermosinus carboxydivorans Nor1] >gi|121306522|gb|EAX47445.1| ATP synthase F0, B subunit [Thermosinus carboxydivorans Nor1] (167 aa)
Score = 104, Expect = 3.5e-03, Identities = 37/150 (24%), Positives = 81/150 (54%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           LIA +I+ + L+ ++ ++A+KP    +  R   I   + AA++ +  +E+     + +L E++  A  I+E A   AE+TK++I   A  + +++  E  ++I ++      +   EV  L++  A   + + +DE+ N K+++D ++ L
  S:     8 LIAQIINFLILVAILTKVAYKPLMQALADRQARIAESIAAADRERAAAEELRREYQQQLAEARTQAQAIVEKAMKLAEQTKEQILEEARAEHARLLKEAQAEIARERERALAQMKNEVVSLSIAAATKIIGQNLDEKANAKLVEDFIDKL 157
>gi|123444377|ref|YP_001008342.1| F0F1 ATP synthase subunit B [Yersinia enterocolitica subsp. enterocolitica 8081] >gi|122091338|emb|CAL14224.1| ATP synthase subunit B protein [Yersinia enterocolitica subsp. enterocolitica 8081] (156 aa)
Score = 104, Expect = 3.6e-03, Identities = 35/150 (23%), Positives = 74/150 (49%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           ++   I+ +  +L  ++  W P  + IE R KEI   + +AE+A+ + +     +  +L ++K  A  IIE A     +   + +A A  + ++I ++  ++I  +     +    +V+ LA+  A   + + +DE  N  I+D +V +L
  S:     7 ILGQAIAFVLFVLFCMKYIWPPIMAAIEKRQKEIADGLSSAERAKKDLDLAQANATDQLKKAKAEAQVIIEQASKRKAQILDEAKAEAEQERNKIVAQAQAEIDAERKRAREELRKQVAMLAIAGAEKIIERSVDEAANSDIVDKLVAEL 156
>gi|49080382|gb|AAT50011.1| PA5558 [synthetic construct] (157 aa)
Score = 104, Expect = 3.6e-03, Identities = 31/150 (20%), Positives = 74/150 (49%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           LI   ++    +L  ++  W P  + ++ R K+I   ++AA +A  + E     +  +L E+K  AAEI+E A+  A +   +    A  +  +++++  ++I+++   ++     +V  LA+  A   L   ID   +++++  +  ++
  S:     7 LIGQSVAFFIFVLFCMKFVWPPVIAALQERQKKIADGLDAANRAARDLELAHEKAGQQLREAKAQAAEIVEQAKKRANQIVDEARDQARTEGERLKAQAQAEIEQELNSVKDALRAQVGALAVTGAEKILGASIDANAHEQLVSKLAAEI 156
>gi|110277419|gb|ABG57244.1| AtpB [Streptococcus mitis] (140 aa)
Score = 104, Expect = 3.6e-03, Identities = 36/121 (29%), Positives = 63/121 (52%)
  Q:    41 SLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAG 161
           S I LL+L+ + AW       E R ++I   +++AE+A+ ++E        +L  S+  A  IIENA+  AEK+K  I   A  +A +++ +   +I + + E  +    EV+ L +  AG
  S:    18 SFILLLVLIKKFAWSNITGIFEERAEKIASDIDSAEEARQKAEVLAQKREDELAGSRKEAKAIIENAKASAEKSKASILVDAKLEAGRLKEKANQEIAQNKAEALQSVKGEVADLTISLAG 138
>gi|77166524|ref|YP_345049.1| F0F1 ATP synthase subunit B [Nitrosococcus oceani ATCC 19707] >gi|76884838|gb|ABA59519.1| ATP synthase F0, subunit B [Nitrosococcus oceani ATCC 19707] (156 aa)
Score = 104, Expect = 3.7e-03, Identities = 35/147 (23%), Positives = 75/147 (51%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIV 181
           LI  +++   L+  V R  W P  + +E R K +   + AAE+ + E E     ++  L E+K  AAEII  A+  A +  ++ +  A  +  +++    ++I+++     +    +V  +A+  A   L +++DE+ N+ ++ ++V
  S:     7 LIGQMVAFGILVWFVNRFLWGPLTNLMEERKKRVADGLAAAERGKHERELAEKRAKETLHEAKEKAAEIITQAQKRAGEIIEEAKEAAQAEGERLKVSANAEIQQEMNRAREDLRGQVVSIAVAGASKILKRELDEKANEALVKELV 153
>gi|114565199|ref|YP_752713.1| F0F1 ATP synthase subunit B [Shewanella frigidimarina NCIMB 400] >gi|114336492|gb|ABI73874.1| ATP synthase F0, B subunit [Shewanella frigidimarina NCIMB 400] (156 aa)
Score = 104, Expect = 3.8e-03, Identities = 36/150 (24%), Positives = 74/150 (49%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           L    ++ I  +   ++  W P  + IE R K+I   +  A +A  + E     +  +L E+K TA EIIE A     +  ++ +  A  + ++I ++G ++I+ +   ++     +V+ LA+  A   L + ID E +  I++ +V ++
  S:     7 LFGQTVAFILFVWFCMKFVWPPLMNAIEERQKKIADGLADAGRAAKDLELAQIKATEQLKEAKVTANEIIEQANKRKAQIVEEAKVEAQTERAKIIAQGQAEIENERNRVKDDLRKQVALLAIAGAEKILERTIDPEAHSDIVNKLVAEI 156
>gi|110277379|gb|ABG57212.1| AtpB [Streptococcus pseudopneumoniae] (140 aa)
Score = 104, Expect = 3.9e-03, Identities = 36/121 (29%), Positives = 63/121 (52%)
  Q:    41 SLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAG 161
           S I LL+L+ + AW       E R ++I   +++AE+A+ ++E        +L  S+  A  IIENA+  AEK+K  I   A  +A +++ +   +I + + E  +    EV+ L +  AG
  S:    18 SFILLLVLIKKFAWSNITGIFEERAEKIATDIDSAEEARQKAEVLAQKREDELAGSRKEAKAIIENAKTTAEKSKASILVDAKLEAGRLKEKANQEIAQNKAEALQSVKGEVADLTISLAG 138
>gi|37524076|ref|NP_927420.1| F0F1 ATP synthase subunit B [Photorhabdus luminescens subsp. laumondii TTO1] >gi|36783499|emb|CAE12339.1| ATP synthase B chain [Photorhabdus luminescens subsp. laumondii TTO1] (156 aa)
Score = 104, Expect = 4.0e-03, Identities = 33/150 (22%), Positives = 73/150 (48%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           ++   I+ +  ++  ++  W P  + IE R KEI   + +AE+A+ + +     +  ++ ++K  A  IIE A     +     +A A  + ++I ++  ++I  +     +    +V+ LA+  A   + + +DE  N  I+D +V +L
  S:     7 ILGQAIAFVLFVMFCMKFVWPPIMAAIEKRQKEIADGLSSAERAKKDLDLAQANATDQMKKAKVEAQVIIEQANKQKAQILDDAKAEAEQERNRIVTQAQAEIDAERKRAREELRKQVAMLAIAGAEKIIERSVDEAANSDIVDKLVAEL 156
>gi|182679693|ref|YP_001833839.1| H+transporting two-sector ATPase B/B' subunit [Beijerinckia indica subsp. indica ATCC 9039] >gi|182635576|gb|ACB96350.1| H+transporting two-sector ATPase B/B' subunit [Beijerinckia indica subsp. indica ATCC 9039] (259 aa)
Score = 104, Expect = 4.1e-03, Identities = 35/158 (22%), Positives = 73/158 (46%)
  Q:    33 YVLIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLTAKLES 190
           + L    I+++ L+ ++ R  +KP  + +EAR   I R ++ A   ++ +E     +R ++       A  ++ AE +A+   + I A A ++A ++     + I +   +         S+LA++ AG  LS+  +E      I+ +   L A  E+
  S:     6 WTLGLQAINVLILIWILSRFLFKPVAAIVEARRASIARLLDEAHATRVAAEAEREKARQEVTSLATARAAALQKAEDEAKAETETILANARSEAGKLREAAKADIARARQDEAAAMADHASQLAVDIAGKLLSRLPEEARISGFIEGLAQGLAALPEA 163
>gi|110277384|gb|ABG57216.1| AtpB [Streptococcus mitis] >gi|110277389|gb|ABG57220.1| AtpB [Streptococcus mitis] (140 aa)
Score = 104, Expect = 4.2e-03, Identities = 36/121 (29%), Positives = 63/121 (52%)
  Q:    41 SLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAG 161
           S I LL+L+ + AW       E R ++I   +++AE+A+ ++E        +L  S+  A  IIENA+  AEK+K  I   A  +A +++ +   +I + + E  +    EV+ L +  AG
  S:    18 SFILLLVLIKKFAWSNITGIFEERAEKIATDIDSAEEARQKAEVLAQKREDELAGSRKEAKAIIENAKATAEKSKASILVDAKLEAGRLKEKANQEIAQNKAEALQSVKGEVADLTISLAG 138
>gi|15600751|ref|NP_254245.1| F0F1 ATP synthase subunit B [Pseudomonas aeruginosa PAO1] >gi|116053709|ref|YP_794036.1| F0F1 ATP synthase subunit B [Pseudomonas aeruginosa UCBPP-PA14] >gi|194548751|ref|YP_002083779.1| ATP synthase B chain [Pseudomonas aeruginosa C3719] >gi|194554088|ref|YP_002089115.1| ATP synthase B chain [Pseudomonas aeruginosa 2192] >gi|81783492|sp|Q9HT16|ATPF_PSEAE ATP synthase B chain >gi|9951898|gb|AAG08943.1|AE004967_14 ATP synthase B chain [Pseudomonas aeruginosa PAO1] >gi|115588930|gb|ABJ14945.1| ATP synthase B chain [Pseudomonas aeruginosa UCBPP-PA14] >gi|126169697|gb|EAZ55208.1| ATP synthase B chain [Pseudomonas aeruginosa C3719] >gi|126196481|gb|EAZ60544.1| ATP synthase B chain [Pseudomonas aeruginosa 2192] (156 aa)
Score = 104, Expect = 4.2e-03, Identities = 31/150 (20%), Positives = 74/150 (49%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           LI   ++    +L  ++  W P  + ++ R K+I   ++AA +A  + E     +  +L E+K  AAEI+E A+  A +   +    A  +  +++++  ++I+++   ++     +V  LA+  A   L   ID   +++++  +  ++
  S:     7 LIGQSVAFFIFVLFCMKFVWPPVIAALQERQKKIADGLDAANRAARDLELAHEKAGQQLREAKAQAAEIVEQAKKRANQIVDEARDQARTEGERLKAQAQAEIEQELNSVKDALRAQVGALAVTGAEKILGASIDANAHEQLVSKLAAEI 156
>gi|91795101|ref|YP_564752.1| F0F1 ATP synthase subunit B [Shewanella denitrificans OS217] >gi|91717103|gb|ABE57029.1| ATP synthase F0, B subunit [Shewanella denitrificans OS217] (156 aa)
Score = 103, Expect = 4.2e-03, Identities = 36/150 (24%), Positives = 75/150 (50%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           LI   ++ +  +   ++  W P  + IE R K I   +  A++A  + E     +  +L E+K TA EIIE A     +   + +A A  + ++I ++G ++I+ +   +++    +V+ LA+  A   L + ID   +  I++ +V ++
  S:     7 LIGQSVAFLIFVWFCMKFVWPPLMNAIEERQKRIADGLADADRAVKDLELARSKATDQLKEAKATANEIIEQANKRKAQIVDEAKAEADAERAKIIAQGKAEIEAERNRVKEDLRKQVATLAILGAEKILERSIDPAAHSDIVNKLVAEI 156
>gi|15603355|ref|NP_246429.1| F0F1 ATP synthase subunit B [Pasteurella multocida subsp. multocida str. Pm70] >gi|12721874|gb|AAK03574.1| AtpF [Pasteurella multocida subsp. multocida str. Pm70] (156 aa)
Score = 103, Expect = 4.3e-03, Identities = 35/150 (23%), Positives = 75/150 (50%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           LI  +I+    +   ++  W P    IE R + I   + +AE A+ E      +   ++ E+K  A +II+ A     +  ++++  A    ++I  +GY++++ +   +++   ++V+ LA+  A   + + +DE  N  IID +V +L
  S:     7 LIGQLIAFAIFVAFCMKFVWPPIIKAIEERQRSIANALASAEAARKEQADTKALVEQEITEAKMQAQQIIDLANKRRNEILEEVKVEAEATKAKIIEQGYAEVEAERKRVQEELRVKVASLAIAGAEKIVGRTVDEAANSDIIDKLVAEL 156
>gi|66048349|ref|YP_238190.1| F0F1 ATP synthase subunit B [Pseudomonas syringae pv. syringae B728a] >gi|63259056|gb|AAY40152.1| ATP synthase F0, subunit B [Pseudomonas syringae pv. syringae B728a] (156 aa)
Score = 103, Expect = 4.5e-03, Identities = 31/150 (20%), Positives = 74/150 (49%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           LI   ++    +L  ++  W P  + +  R K+I   ++AA +A  + E     +  +L E+K  AAEIIE A+    +   +    A  +A +++++  ++I+++   ++     ++  LA+  A   L   ID+  + ++++ +  ++
  S:     7 LIGQSVAFFIFVLFCMKFVWPPVIAALHERQKKIADGLDAASRAARDLELAQEKAGQQLREAKAQAAEIIEQAKKRGTQIVDEARETARVEADRVKAQAQAEIEQELNGVKDALRAQLGSLAVNGAEKILGATIDQNAHAELVNKLAAEI 156
>gi|114616|sp|P20601|ATPF_BACME ATP synthase B chain >gi|142557|gb|AAA82522.1| ATP synthase b subunit (172 aa)
Score = 103, Expect = 4.5e-03, Identities = 33/150 (22%), Positives = 82/150 (54%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           ++  ++  + LL L+ + A+ P    ++ R + I  +++ AEK   E++K +   R  L +S+     ++ENA   AE  K++I A A  ++ ++++    +I++Q+ +       +V+ L++  A   + K++ E++ +K+I + + ++
  S:    19 ILFQLVMFLILLALLQKFAFGPVMGIMKKREEHIAGEIDEAEKQNEEAKKLVEEQREILKQSRQEVQVMMENARKSAEDKKEEIVAAAREESERLKAAAKQEIEQQKDQAVAALREQVASLSVLIASKVIEKELSEQDQEKLIHEYIQEV 168
>gi|149072064|ref|YP_001293545.1| ATP synthase CF1 subunit f [Rhodomonas salina] >gi|134303015|gb|ABO70819.1| ATP synthase CF1 subunit f [Rhodomonas salina] (181 aa)
Score = 103, Expect = 4.6e-03, Identities = 39/158 (24%), Positives = 81/158 (51%)
  Q:    31 NVYVLIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLTAKL 188
           N   L A+V+++  LL  V+ L      S +E R +++   ++ AE+  +++   L  S  +L +++    EI + AE  A   K+ I A       ++ + G S I+K EL+++K+    +++LA++   + L + +      K+ID  +++L  +L
  S:    24 NPNFLEANVLNIAILLSGVVYLGRNFLTSALEVRQQKVAEAIQEAEERLVQANSRLLESEKQLTQAQAVIEEIKKEAEKTARTVKESILAQGKLDIERLTNNGKSSIEKAELQIKKQIQQHITELAIQKVTVQLKEYMTPNLQSKVIDSNISNLGGQL 181
>gi|167036421|ref|YP_001671652.1| F0F1 ATP synthase subunit B [Pseudomonas putida GB-1] >gi|170724360|ref|YP_001752048.1| ATP synthase F0, B subunit [Pseudomonas putida W619] >gi|166862909|gb|ABZ01317.1| ATP synthase F0, B subunit [Pseudomonas putida GB-1] >gi|169762363|gb|ACA75679.1| ATP synthase F0, B subunit [Pseudomonas putida W619] (156 aa)
Score = 103, Expect = 4.6e-03, Identities = 32/150 (21%), Positives = 77/150 (51%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           LI   ++ +  +L  ++  W P  + ++ R K+I   ++AA +A  + E     +  +L E+K  AAEIIE ++  A +  ++    A  +A +++++  ++I+++    +     +V  LA+  A   L   ID+  + ++++ +  ++
  S:     7 LIGQSVAFLIFVLFCMKYVWPPVITALQERQKKIADGLDAANRAARDLELAQEKAGQQLREAKAQAAEIIEQSKKRAAQLVEEARDQARVEADRVKAQALAEIEQELNSAKDALRAQVGALAVGGAEKILGATIDQNAHAELVNKLAAEI 156
>gi|188535587|ref|YP_001909384.1| ATP synthase, F0 complex, b subunit [Erwinia tasmaniensis] >gi|188030629|emb|CAO98525.1| ATP synthase, F0 complex, b subunit [Erwinia tasmaniensis] (156 aa)
Score = 103, Expect = 4.7e-03, Identities = 34/150 (22%), Positives = 73/150 (48%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           ++   I+ I  +   ++  W P  + IE R KE+   + +AE+A+ + +     +  +L ++K+ A  IIE A     +     +A A  + ++I ++  ++I  +     +    +V+ LA+  A   + + +DE  N  I+D +V +L
  S:     7 ILGQAIAFILFVAFCMKYVWPPLMAAIEKRQKEVADGLASAERAKKDLDLAQASATDQLKKAKDDAQVIIEQANKRRAQILDDAKAEAEQERNKIVTQAQAEIDAERKRAREELRKQVAMLAVAGAEKIIERSVDEAANSDIVDKLVAEL 156
>gi|149117391|ref|ZP_01844084.1| ATP synthase F0, B subunit [Shewanella baltica OS223] >gi|153002865|ref|YP_001368546.1| F0F1 ATP synthase subunit B [Shewanella baltica OS185] >gi|160877612|ref|YP_001556928.1| F0F1 ATP synthase subunit B [Shewanella baltica OS195] >gi|146862540|gb|EDK48203.1| ATP synthase F0, B subunit [Shewanella baltica OS223] >gi|151367483|gb|ABS10483.1| ATP synthase F0, B subunit [Shewanella baltica OS185] >gi|160863134|gb|ABX51668.1| ATP synthase F0, B subunit [Shewanella baltica OS195] (156 aa)
Score = 103, Expect = 4.9e-03, Identities = 36/150 (24%), Positives = 75/150 (50%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           LI   ++ I  +   ++  W P  + IE R K I   +  A++A  + E     +  +L E+K TA EIIE A     +  ++ +  A  + ++I ++G ++I+ +   +++    +V+ LA+  A   L + ID   +  I++ +V ++
  S:     7 LIGQTVAFIIFVWFCMKFVWPPLMNAIEERQKRIADGLADADRAVKDLELAQAKATDQLKEAKVTANEIIEQANKRKAQIVEEAKTEADAERAKIIAQGKAEIEAERNRVKEDLRKQVATLAIMGAEKILERSIDPAAHSDIVNKLVAEI 156
>gi|148550499|ref|YP_001270601.1| F0F1 ATP synthase subunit B [Pseudomonas putida F1] >gi|148514557|gb|ABQ81417.1| ATP synthase F0, B subunit [Pseudomonas putida F1] (156 aa)
Score = 103, Expect = 4.9e-03, Identities = 32/150 (21%), Positives = 77/150 (51%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           LI   ++ +  +L  ++  W P  + ++ R K+I   ++AA +A  + E     +  +L E+K  AAEIIE ++  A +  ++    A  +A +++++  ++I+++    +     +V  LA+  A   L   ID+  + ++++ +  ++
  S:     7 LIGQSVAFLIFVLFCMKYVWPPVITALQERQKKIADGLDAANRAARDLELAQEKAGQQLREAKAQAAEIIEQSKKRAAQLVEEAREQARVEADRVKAQALAEIEQELNSAKDALRAQVGALAVGGAEKILGATIDQNAHAELVNKLAAEI 156
>gi|53724012|ref|YP_104458.1| F0F1 ATP synthase subunit B [Burkholderia mallei ATCC 23344] >gi|76810287|ref|YP_331599.1| F0F1 ATP synthase subunit B [Burkholderia pseudomallei 1710b] >gi|83720034|ref|YP_443804.1| F0F1 ATP synthase subunit B [Burkholderia thailandensis E264] >gi|121598244|ref|YP_994638.1| F0F1 ATP synthase subunit B [Burkholderia mallei SAVP1] >gi|124385618|ref|YP_001027571.1| F0F1 ATP synthase subunit B [Burkholderia mallei NCTC 10229] >gi|126440159|ref|YP_001060965.1| F0F1 ATP synthase subunit B [Burkholderia pseudomallei 668] >gi|126449447|ref|YP_001082531.1| F0F1 ATP synthase subunit B [Burkholderia mallei NCTC 10247] >gi|126454664|ref|YP_001068265.1| F0F1 ATP synthase subunit B [Burkholderia pseudomallei 1106a] >gi|134281630|ref|ZP_01768338.1| ATP synthase F0, B subunit [Burkholderia pseudomallei 305] >gi|161359680|ref|ZP_02105547.1| F0F1 ATP synthase subunit B [Burkholderia pseudomallei 1106b] >gi|161371882|ref|ZP_02111445.1| F0F1 ATP synthase subunit B [Burkholderia pseudomallei 1710a] >gi|167001254|ref|ZP_02267053.1| F0F1 ATP synthase subunit B [Burkholderia mallei PRL-20] >gi|167582838|ref|ZP_02375712.1| F0F1 ATP synthase subunit B [Burkholderia thailandensis TXDOH] >gi|167620978|ref|ZP_02389609.1| F0F1 ATP synthase subunit B [Burkholderia thailandensis Bt4] >gi|167721826|ref|ZP_02405062.1| F0F1 ATP synthase subunit B [Burkholderia pseudomallei DM98] >gi|167740798|ref|ZP_02413572.1| F0F1 ATP synthase subunit B [Burkholderia pseudomallei 14] >gi|167818013|ref|ZP_02449693.1| F0F1 ATP synthase subunit B [Burkholderia pseudomallei 91] >gi|167826376|ref|ZP_02457847.1| F0F1 ATP synthase subunit B [Burkholderia pseudomallei 9] >gi|167847895|ref|ZP_02473403.1| F0F1 ATP synthase subunit B [Burkholderia pseudomallei B7210] >gi|167896452|ref|ZP_02483854.1| F0F1 ATP synthase subunit B [Burkholderia pseudomallei 7894] >gi|167904854|ref|ZP_02492059.1| F0F1 ATP synthase subunit B [Burkholderia pseudomallei NCTC 13177] >gi|167913132|ref|ZP_02500223.1| F0F1 ATP synthase subunit B [Burkholderia pseudomallei 112] >gi|167921069|ref|ZP_02508160.1| F0F1 ATP synthase subunit B [Burkholderia pseudomallei BCC215] >gi|194316585|ref|YP_002012827.1| ATP synthase F0, B subunit [Burkholderia mallei ATCC 10399] >gi|194502147|ref|YP_002031725.1| ATP synthase F0, B subunit [Burkholderia pseudomallei 1655] >gi|194512636|ref|YP_002025160.1| ATP synthase F0, B subunit [Burkholderia pseudomallei Pasteur 52237] >gi|194518219|ref|YP_002053676.1| ATP synthase F0, B subunit [Burkholderia pseudomallei S13] >gi|194523417|ref|YP_002058949.1| ATP synthase F0, B subunit [Burkholderia mallei FMH] >gi|194528403|ref|YP_002063925.1| ATP synthase F0, B subunit [Burkholderia mallei JHU] >gi|194569808|ref|YP_002104810.1| ATP synthase F0, B subunit [Burkholderia pseudomallei 406e] >gi|194576166|ref|YP_002111049.1| ATP synthase F0, B subunit [Burkholderia mallei 2002721280] >gi|52427435|gb|AAU48028.1| ATP synthase F0, B subunit [Burkholderia mallei ATCC 23344] >gi|76579740|gb|ABA49215.1| ATP synthase F0, B subunit [Burkholderia pseudomallei 1710b] >gi|83653859|gb|ABC37922.1| ATP synthase F0, B subunit [Burkholderia thailandensis E264] >gi|121227054|gb|ABM49572.1| ATP synthase F0, B subunit [Burkholderia mallei SAVP1] >gi|124293638|gb|ABN02907.1| ATP synthase F0, B subunit [Burkholderia mallei NCTC 10229] >gi|126219652|gb|ABN83158.1| ATP synthase F0, B subunit [Burkholderia pseudomallei 668] >gi|126228306|gb|ABN91846.1| ATP synthase F0, B subunit [Burkholderia pseudomallei 1106a] >gi|126242317|gb|ABO05410.1| ATP synthase F0, B subunit [Burkholderia mallei NCTC 10247] >gi|134247297|gb|EBA47383.1| ATP synthase F0, B subunit [Burkholderia pseudomallei 305] >gi|147747427|gb|EDK54503.1| ATP synthase F0, B subunit [Burkholderia mallei FMH] >gi|147752413|gb|EDK59479.1| ATP synthase F0, B subunit [Burkholderia mallei JHU] >gi|148026487|gb|EDK84572.1| ATP synthase F0, B subunit [Burkholderia mallei 2002721280] >gi|157808474|gb|EDO85644.1| ATP synthase F0, B subunit [Burkholderia pseudomallei 406e] >gi|157934177|gb|EDO89847.1| ATP synthase F0, B subunit [Burkholderia pseudomallei Pasteur 52237] >gi|160695740|gb|EDP85710.1| ATP synthase F0, B subunit [Burkholderia mallei ATCC 10399] >gi|169651542|gb|EDS84235.1| ATP synthase F0, B subunit [Burkholderia pseudomallei S13] >gi|184214559|gb|EDU11602.1| ATP synthase F0, B subunit [Burkholderia pseudomallei 1655] (156 aa)
Score = 103, Expect = 5.0e-03, Identities = 33/150 (22%), Positives = 79/150 (52%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           L A ++  + L    ++  W P  + ++ R+K+I   + AAEK + E E        +L +++N   + I +AE  A     +I+  A  +A++I ++  ++ ++Q ++  +    EV+ LA++ A   L +++D+  + ++++ +  +L
  S:     7 LFAQMVVFLVLAWFTMKFVWPPLINALDERSKKIADGLAAAEKGKAELEAAHKRVDQELAQARNDGQQRIADAEKRALAVADEIKTNAQAEAARIIAQAKAEAEQQIVKARETLRGEVAALAVKGAEQILKREVDQTAHAELLNQLKAEL 156
>gi|149675735|dbj|BAF64749.1| FOF1-type ATP synthase b subunit [Shewanella livingstonensis] (159 aa)
Score = 103, Expect = 5.1e-03, Identities = 36/150 (24%), Positives = 74/150 (49%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           L    ++ I  +   ++  W P  + IE R K+I   +  A +A  + E     +  +L E+K TA EIIE A     +  ++ +  A  + ++I ++G ++I+ +   ++     +V+ LA+  A   L + ID E +  I++ +V ++
  S:    10 LFGQTVAFILFVWFCMKFVWPPLMNAIEERQKKIADGLADAGRAAKDLELAQIKATEQLKEAKVTANEIIEQANKRKAQIVEEAKVEAQTERAKIIAQGQAEIENERNRVKDDLRKQVALLAIAGAEKILERTIDPEAHSDIVNKLVAEI 159
>gi|110277374|gb|ABG57208.1| AtpB [Streptococcus pseudopneumoniae] (140 aa)
Score = 103, Expect = 5.2e-03, Identities = 36/121 (29%), Positives = 64/121 (52%)
  Q:    41 SLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAG 161
           S I LL+L+ + AW       E R ++I   +++AE+A+ ++E        +L  S+  A  IIENA+  AE++K  I A A  +A +++ +   +I + + E  +    EV+ L +  AG
  S:    18 SFILLLVLIKKFAWSNITGIFEERAEKIATDIDSAEEARQKAEVLAQKREDELAGSRKEAKTIIENAKETAEQSKANILADAKLEAGRLKEKANQEIAQNKAEALQSVKGEVADLTISFAG 138
>gi|126176551|ref|YP_001052700.1| ATP synthase F0, B subunit [Shewanella baltica OS155] >gi|125999756|gb|ABN63831.1| ATP synthase F0, B subunit [Shewanella baltica OS155] (156 aa)
Score = 103, Expect = 5.3e-03, Identities = 36/150 (24%), Positives = 75/150 (50%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           LI   ++ I  +   ++  W P  + IE R K I   +  A++A  + E     +  +L E+K TA EIIE A     +  ++ +  A  + ++I ++G ++I+ +   +++    +V+ LA+  A   L + ID   +  I++ +V ++
  S:     7 LIGQTVAFIIFVWFCMKFVWPPLMNAIEERQKRIADGLADADRAVKDLELAQAKATDQLKEAKVTANEIIEQANKRKAQIVEEAKTEANAERAKIIAQGKAEIEAERNRVKEDLRKQVATLAIMGAEKILERSIDPAAHSDIVNKLVAEI 156
>gi|26992092|ref|NP_747517.1| F0F1 ATP synthase subunit B [Pseudomonas putida KT2440] >gi|24987234|gb|AAN70981.1|AE016742_10 ATP synthase F0, B subunit [Pseudomonas putida KT2440] (156 aa)
Score = 103, Expect = 5.3e-03, Identities = 32/150 (21%), Positives = 76/150 (50%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           LI   ++ +  +L  ++  W P  + ++ R K+I   ++AA +A  + E     +  +L E+K  AAEIIE ++  A +   +    A  +A +++++  ++I+++    +     +V  LA+  A   L   ID+  + ++++ +  ++
  S:     7 LIGQSVAFLIFVLFCMKYVWPPVITALQERQKKIADGLDAANRAARDLELAQEKAGQQLREAKAQAAEIIEQSKKRAAQLVDEAREQARVEADRVKAQALAEIEQELNSAKDALRAQVGALAVGGAEKILGATIDQNAHAELVNKLAAEI 156
>gi|15616320|ref|NP_244625.1| F0F1 ATP synthase subunit B [Bacillus halodurans C-125] >gi|15213931|sp|Q9K6H1|ATPF_BACHD ATP synthase B chain >gi|10176382|dbj|BAB07477.1| ATP synthase subunit b [Bacillus halodurans C-125] (162 aa)
Score = 103, Expect = 5.3e-03, Identities = 33/154 (21%), Positives = 86/154 (55%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLTAKL 188
           +I  +I+   LL L+ + A KP    +E R + I  +++ A+K +  +++ L   R+ + +++  A EI++ A+  +E+  ++I   A  +  +++    ++I++++ +       +V+ L++  A   + K++DE+E +K+I + + ++  +L
  S:     9 IIYQLIAFCVLLWLLSKFALKPLMGVMEKREQMINDQIDQADKDRKAAQEYLEQQRLAVEKAREEAQEIVQKAKKLSEQQGQEIVEAARAEGERLKEAALAEIQREKEQAVASLREQVASLSVLIATKVIEKELDEKEQEKLIAEYLKEVGEEL 162
>gi|85060388|ref|YP_456090.1| F0F1 ATP synthase subunit B [Sodalis glossinidius str. 'morsitans'] >gi|84780908|dbj|BAE75685.1| ATP synthase subunit B [Sodalis glossinidius str. 'morsitans'] (156 aa)
Score = 103, Expect = 5.4e-03, Identities = 36/150 (24%), Positives = 73/150 (48%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           ++   I+ +  +L  ++  W P  + IE R KEI   + +AE+A+ + +     +   L ++K  A  IIE A     +   + +A A  + ++I ++  ++I  +     +    +V+ LAL  A   + + +D+  N  I+D IV +L
  S:     7 ILGQAIAFVLFVLFCMKYVWPPLMASIEKRQKEIADGLASAERAKKDLDIAQAEATDHLKQAKVEAQAIIEQANKRKAQVVDEAKAEAEAERNKILAQAQAEIDAERKRAREELRKQVAMLALAGAEKIIERSVDDAANSDIVDKIVAEL 156
>gi|167838428|ref|ZP_02465287.1| F0F1 ATP synthase subunit B [Burkholderia thailandensis MSMB43] (156 aa)
Score = 102, Expect = 5.6e-03, Identities = 33/150 (22%), Positives = 77/150 (51%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           L A ++  + L    ++  W P  + ++ R+K+I   + AAEK Q E          +L ++++   + I  AE  A+   ++I+A A  +A++I ++  +   +Q ++  +    EV+ LA++ A   L +++D   + ++++ +  +L
  S:     7 LFAQMVVFLILAWFTMKFVWPPLINALDERSKKIADGLSAAEKGQAELAAAHKRVDQELAQARSDGQQRIAEAEKRAQAVAEEIKANAQAEAARIIAQAKADADQQIVKARETLRGEVASLAVKGAEQILKREVDHTAHAELLNQLKAEL 156
>gi|89074724|ref|ZP_01161182.1| ATP synthase subunit B [Photobacterium sp. SKA34] >gi|89049488|gb|EAR55049.1| ATP synthase subunit B [Photobacterium sp. SKA34] (156 aa)
Score = 102, Expect = 5.6e-03, Identities = 38/154 (24%), Positives = 74/154 (48%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLTAKL 188
           L+   I+  F ++  ++  W P    IE R K+I   + AA++A  + +     +  +L E+K  A+E+IE A     +   + +  A  +  +I S+G ++I+ +          +V+ LA+  A   + + ID +       DI+N +TA+L
  S:     7 LLGQAIAFFFFVMFCMKYVWPPIMEAIEERQKKIADGLAAADRAAKDLDLAQANASDQLKEAKRAASELIEQANKRKAQIIDEAKTEAQTEREKILSQGMAEIEAERNRARDELRKQVATLAVIGAEKIIERSIDVDAQT----DILNKVTAEL 156
>gi|156936116|ref|YP_001440032.1| F0F1 ATP synthase subunit B [Enterobacter sakazakii ATCC BAA-894] >gi|156534370|gb|ABU79196.1| hypothetical protein ESA_04010 [Enterobacter sakazakii ATCC BAA-894] (156 aa)
Score = 102, Expect = 5.7e-03, Identities = 35/150 (23%), Positives = 75/150 (50%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           ++   I+ +  +L  ++  W P  + IE R KEI   + +AE+A+ + E     +  +L ++K  A  IIE A     +   + +A A  + ++I ++  ++I+ +     +    +V+ LA+  A   + + +DE  N  I++ +V +L
  S:     7 ILGQAIAFVLFVLFCMKYVWPPIMAAIEKRQKEIADGLSSAERAKKDLELAQSNATDQLKKAKAEAQVIIEQANKRRAQILDEAKAEAEQERNKIVAQAQAEIEAERKRAREELRKQVAILAVAGAEKIIERSVDEAANSDIVNKLVAEL 156
>gi|15082069|gb|AAK84015.1|AF393838_4 H+-ATPase F0-part b-subunit [Lactococcus lactis subsp. lactis] (168 aa)
Score = 102, Expect = 5.7e-03, Identities = 34/144 (23%), Positives = 71/144 (49%)
  Q:    41 SLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           + I LL+L+   AW    S   +R K+I   ++AAE    ++   +   + +L  SK  AA II+ A   A + + K+ A+A  +A+ ++      I+++  E       +V+ ++++ A   + + +D    +++ID  +  L
  S:    23 AFIILLVLLRLFAWNAITSVFASRAKKISDDIDAAEANNKQAADLVKQRQAELAASKEEAANIIQVANDTASQNRAKVLAIANEEATSLKKRAQEDIEQERKEALNTVKGDVADISVQIAEKLIGQSLDASAQQELIDSYLAKL 166
>gi|152985533|ref|YP_001351671.1| F0F1 ATP synthase subunit B [Pseudomonas aeruginosa PA7] >gi|150960691|gb|ABR82716.1| ATP synthase F0, B subunit [Pseudomonas aeruginosa PA7] (156 aa)
Score = 102, Expect = 5.8e-03, Identities = 31/150 (20%), Positives = 74/150 (49%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           LI   ++    +L  ++  W P  + ++ R K+I   ++AA +A  + E     +  +L E+K  AAEI+E A+  A +   +    A  +  +++++  ++I+++   ++     +V  LA+  A   L   ID   +++++  +  ++
  S:     7 LIGQSVAFFIFVLFCMKFVWPPVIAALQERQKKIADGLDAANRAARDLELAHEKAGQQLREAKAQAAEIVEQAKKRANQIVDEARDQARAEGERLKAQAQAEIEQELNSVKDALRAQVGTLAVTGAEKILGASIDANAHEQLVSKLAAEI 156
>gi|407182|emb|CAA81458.1| adenosine triphosphatase [Streptococcus oralis] (127 aa)
Score = 102, Expect = 5.9e-03, Identities = 34/103 (33%), Positives = 56/103 (54%)
  Q:    41 SLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELE 143
           S I L++LV + AW    S  E R  +I   ++ AE+A+ ++E        +L  S+N A  IIENA+  AEK+K  I A A  +A +++ +   +I + + E
  S:    18 SFILLIVLVKKYAWSNLTSVFEERANKIAADIDGAEQARQKAETLAQKREDELAGSRNEAKTIIENAKETAEKSKADILADAKVEAGRLKEKANQEIAQNKAE 120
>gi|104784438|ref|YP_610936.1| F0F1 ATP synthase subunit B [Pseudomonas entomophila L48] >gi|95113425|emb|CAK18153.1| ATP synthase F0, B subunit [Pseudomonas entomophila L48] (156 aa)
Score = 102, Expect = 6.5e-03, Identities = 32/150 (21%), Positives = 76/150 (50%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           LI   ++ +  +L  ++  W P  + ++ R K+I   ++AA +A  + E        +L E+K  AAEIIE ++  A +   +    A  +A +++++  ++I+++   ++     +V  LA+  A   L   ID+  + ++++ +  ++
  S:     7 LIGQSVAFLIFVLFCMKYVWPPVITALQERQKKIADGLDAANRAARDLELAQEKVGQQLREAKAQAAEIIEQSKKRAAQLVDEAREQARVEADRVKAQAQAEIEQELNSVKDALRAQVGALAVGGAEKILGATIDQNAHAELVNKLAAEI 156
>gi|146313758|ref|YP_001178832.1| F0F1 ATP synthase subunit B [Enterobacter sp. 638] >gi|145320634|gb|ABP62781.1| ATP synthase F0, B subunit [Enterobacter sp. 638] (156 aa)
Score = 102, Expect = 6.9e-03, Identities = 35/150 (23%), Positives = 73/150 (48%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           ++   I+ I  +   ++  W P  + IE R KEI   + +AE+A+ + +     +  +L ++K  A  IIE A     +   + +A A  + ++I ++  ++I  +     +    +V+ LA+  A   + + +DE  N  I+D +V +L
  S:     7 ILGQAIAFILFVWFCMKYVWPPLMAAIEKRQKEIADGLASAERAKKDLDLAQANATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVAQAQAEIDAERKRAREELRKQVAILAVAGAEKIIERSVDEAANSDIVDKLVAEL 156
>gi|90409879|ref|ZP_01217896.1| hypothetical ATP synthase B chain [Photobacterium profundum 3TCK] >gi|90329232|gb|EAS45489.1| hypothetical ATP synthase B chain [Photobacterium profundum 3TCK] (156 aa)
Score = 102, Expect = 6.9e-03, Identities = 27/150 (18%), Positives = 73/150 (48%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           ++   IS +  + L ++  W P  + I+ R +EI   +   + A  E E         ++E+K +A++++E       +  +  +     + ++I ++G S+++ +   L +    E+S L +E+A   + + +D   N++ ++ ++ ++
  S:     7 MLGQAISFVIFVWLCMKYVWPPLTALIDERQREIAEGLSQMDLAAKELELAKANGDQLMVEAKQSASDLVEQGNKRRSQIIEDAKLEGDTEKARIIAQGQSELESERNRLRQELRQEMSDLVIESAEKLIKRNLDNAANREFVNKLITEM 156
>gi|110277409|gb|ABG57236.1| AtpB [Streptococcus mitis] (140 aa)
Score = 102, Expect = 7.1e-03, Identities = 36/121 (29%), Positives = 63/121 (52%)
  Q:    41 SLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAG 161
           S I LL+L+ + AW       E R ++I   ++ AE+A+ ++E        +L  S+  A  IIENA+  AE++K  I A A  +A +++ +   +I + + E  +    EV+ L +  AG
  S:    18 SFILLLVLIKKFAWSNITGIFEERAEKIASDIDRAEEARQKAEVLAQKREDELAGSRKEAKTIIENAKDTAEQSKANILADAKLEAGRLKEKANQEIAQNKAEALQSVKGEVADLTISLAG 138
>gi|77461951|ref|YP_351458.1| F0F1 ATP synthase subunit B [Pseudomonas fluorescens PfO-1] >gi|77385954|gb|ABA77467.1| ATP synthase F0, subunit B [Pseudomonas fluorescens PfO-1] (156 aa)
Score = 101, Expect = 7.4e-03, Identities = 32/150 (21%), Positives = 75/150 (50%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           LI   ++ +  +L  ++  W P  + +  R K+I   ++AA +A  + E     +  +L E+K  AAEIIE A+    +  ++    A   A +++ +  ++I+++   ++ +   +V  LA+  A   L   ID+  + ++++ +  ++
  S:     7 LIGQSVAFLIFVLFCMKFVWPPVIAALHERQKKIADGLDAASRAARDLELAQEKAGQQLREAKAQAAEIIEQAKKRGNQIVEEAVEKARIDADRVKVQAQAEIEQELNSVKDKLRAQVGLLAVGGAEKILGATIDQNAHAELVNQLAAEI 156
>gi|167454998|ref|ZP_02321221.1| F0F1 ATP synthase subunit B [Listeria monocytogenes FSL J2-064] (166 aa)
Score = 101, Expect = 7.4e-03, Identities = 34/144 (23%), Positives = 77/144 (53%)
  Q:    39 VISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVN 182
           + +   LL+L+   AWKP    ++ R + I  +++AAE+++ ++E+ L   +  L +++  +  +IENA+   EK +++I   A  ++ +I+ E  S I +++ +       +V  L++  A   + KK   ++N   +  I++
  S:    21 LFAFAILLVLIRIYAWKPLMGVMKEREEHIGSEIDAAEESRAQAEQLLAEQKSVLQQARVESQTMIENAKQLGEKEREEIVKTARRESERIKEEAKSDIAREKEDAISALREQVGSLSVLIASKVIRKKYWMKKNNLTLSKIIS 164
>gi|183597133|ref|ZP_02958626.1| hypothetical protein PROSTU_00372 [Providencia stuartii ATCC 25827] >gi|188023443|gb|EDU61483.1| hypothetical protein PROSTU_00372 [Providencia stuartii ATCC 25827] (156 aa)
Score = 101, Expect = 7.5e-03, Identities = 35/150 (23%), Positives = 73/150 (48%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           ++   I+ +  +   ++  W P  + IE R KEI   + +AE+A+   E     +  +L ++K  A  IIE A     +  ++ +A A  + ++I ++  ++I  +     +    +V+ LA+  A   + + +DE  N  I+D +V +L
  S:     7 ILGQAIAFVLFVWFCMKYVWPPIMAAIEKRQKEIADGLSSAERAKKNLELAQTDATDRLKKAKAEAQVIIEQANKQRNQMIEEAKAEAEAERTKIVAQAQAEIDAERKRAREELRKQVAMLAVAGAEKIIERSVDEAANSDIVDKLVAEL 156
>gi|16124233|ref|NP_407546.1| F0F1 ATP synthase subunit B [Yersinia pestis CO92] >gi|22128007|ref|NP_671430.1| F0F1 ATP synthase subunit B [Yersinia pestis KIM] >gi|45443755|ref|NP_995294.1| F0F1 ATP synthase subunit B [Yersinia pestis biovar Microtus str. 91001] >gi|51598255|ref|YP_072446.1| F0F1 ATP synthase subunit B [Yersinia pseudotuberculosis IP 32953] >gi|108810160|ref|YP_654076.1| F0F1 ATP synthase subunit B [Yersinia pestis Antiqua] >gi|108814142|ref|YP_649909.1| F0F1 ATP synthase subunit B [Yersinia pestis Nepal516] >gi|145601148|ref|YP_001165224.1| F0F1 ATP synthase subunit B [Yersinia pestis Pestoides F] >gi|150260941|ref|ZP_01917669.1| ATP synthase subunit B protein [Yersinia pestis CA88-4125] >gi|153949255|ref|YP_001403122.1| F0F1 ATP synthase subunit B [Yersinia pseudotuberculosis IP 31758] >gi|162419287|ref|YP_001608476.1| F0F1 ATP synthase subunit B [Yersinia pestis Angola] >gi|165926217|ref|ZP_02222049.1| ATP synthase F0, B subunit [Yersinia pestis biovar Orientalis str. F1991016] >gi|165939951|ref|ZP_02228488.1| ATP synthase F0, B subunit [Yersinia pestis biovar Orientalis str. IP275] >gi|166009539|ref|ZP_02230437.1| ATP synthase F0, B subunit [Yersinia pestis biovar Antiqua str. E1979001] >gi|166213226|ref|ZP_02239261.1| ATP synthase F0, B subunit [Yersinia pestis biovar Antiqua str. B42003004] >gi|167401599|ref|ZP_02307093.1| ATP synthase F0, B subunit [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167422830|ref|ZP_02314583.1| ATP synthase F0, B subunit [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167425492|ref|ZP_02317245.1| ATP synthase F0, B subunit [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|170026426|ref|YP_001722931.1| ATP synthase F0, B subunit [Yersinia pseudotuberculosis YPIII] >gi|186897464|ref|YP_001874576.1| ATP synthase F0, B subunit [Yersinia pseudotuberculosis PB1/+] >gi|21961155|gb|AAM87681.1|AE014015_6 membrane-bound ATP synthase, F0 sector, subunit b [Yersinia pestis KIM] >gi|45438625|gb|AAS64171.1| ATP synthase subunit B protein [Yersinia pestis biovar Microtus str. 91001] >gi|51591537|emb|CAH23209.1| ATP synthase subunit B protein [Yersinia pseudotuberculosis IP 32953] >gi|108777790|gb|ABG20309.1| ATP synthase subunit B protein [Yersinia pestis Nepal516] >gi|108782073|gb|ABG16131.1| ATP synthase subunit B protein [Yersinia pestis Antiqua] >gi|115349712|emb|CAL22693.1| ATP synthase subunit B protein [Yersinia pestis CO92] >gi|145212844|gb|ABP42251.1| ATP synthase subunit B protein [Yersinia pestis Pestoides F] >gi|149290349|gb|EDM40426.1| ATP synthase subunit B protein [Yersinia pestis CA88-4125] >gi|152960750|gb|ABS48211.1| ATP synthase F0, B subunit [Yersinia pseudotuberculosis IP 31758] >gi|162352102|gb|ABX86050.1| ATP synthase F0, B subunit [Yersinia pestis Angola] >gi|165912077|gb|EDR30717.1| ATP synthase F0, B subunit [Yersinia pestis biovar Orientalis str. IP275] >gi|165922077|gb|EDR39254.1| ATP synthase F0, B subunit [Yersinia pestis biovar Orientalis str. F1991016] >gi|165991461|gb|EDR43762.1| ATP synthase F0, B subunit [Yersinia pestis biovar Antiqua str. E1979001] >gi|166205524|gb|EDR50004.1| ATP synthase F0, B subunit [Yersinia pestis biovar Antiqua str. B42003004] >gi|166958222|gb|EDR55243.1| ATP synthase F0, B subunit [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167048981|gb|EDR60389.1| ATP synthase F0, B subunit [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167055506|gb|EDR65299.1| ATP synthase F0, B subunit [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|169752960|gb|ACA70478.1| ATP synthase F0, B subunit [Yersinia pseudotuberculosis YPIII] >gi|186700490|gb|ACC91119.1| ATP synthase F0, B subunit [Yersinia pseudotuberculosis PB1/+] (156 aa)
Score = 101, Expect = 7.5e-03, Identities = 33/150 (22%), Positives = 74/150 (49%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           ++   I+ +  ++  ++  W P  + IE R +EI   + +AE+A+ + +     +  +L ++K  A  IIE A     +   + +A A  + ++I ++  ++I  +     +    +V+ LA+  A   + + +DE  N  I+D +V +L
  S:     7 ILGQAIAFVLFVIFCMKYVWPPIMAAIEKRQQEIADGLSSAERAKKDLDLAQANATDQLKKAKAEAQVIIEQASKRKAQILDEAKAEAEQERNKIVAQAQAEIDAERKRAREELRKQVAMLAIAGAEKIIERSVDEAANSDIVDKLVAEL 156
>gi|110277394|gb|ABG57224.1| AtpB [Streptococcus mitis] >gi|110277414|gb|ABG57240.1| AtpB [Streptococcus mitis] (140 aa)
Score = 101, Expect = 7.5e-03, Identities = 36/121 (29%), Positives = 63/121 (52%)
  Q:    41 SLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAG 161
           S I LL+L+ + AW       E R ++I   ++ AE+A+ ++E        +L  S+  A  IIENA+  AE++K  I A A  +A +++ +   +I + + E  +    EV+ L +  AG
  S:    18 SFILLLVLIKKFAWSNITGIFEERAEKIASDIDRAEEARQKAEVLAQKREDELAGSRKEAKTIIENAKETAEQSKANILADAKLEAGRLKEKANQEIAQNKAEALQSVKGEVADLTISLAG 138
>gi|157144372|ref|YP_001451691.1| F0F1 ATP synthase subunit B [Citrobacter koseri ATCC BAA-895] >gi|157081577|gb|ABV11255.1| hypothetical protein CKO_00076 [Citrobacter koseri ATCC BAA-895] (156 aa)
Score = 101, Expect = 8.1e-03, Identities = 34/150 (22%), Positives = 72/150 (48%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           ++   I+ +  +L  ++  W P  + IE R KEI   + +AE+A  + +     +  +L ++K  A  IIE A     +   + +  A  + ++I ++  ++I  +     +    +V+ LA+  A   + + +DE  N  I+D +V +L
  S:     7 ILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKASATDQLKKAKAEAQVIIEQANKRRAQILDEAKTEAEQERTKIVAQAQAEIDAERKRAREELRKQVAILAVAGAEKIIERSVDEAANSDIVDKLVAEL 156
>gi|71736509|ref|YP_277284.1| F0F1 ATP synthase subunit B [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71557062|gb|AAZ36273.1| ATP synthase F0, B subunit [Pseudomonas syringae pv. phaseolicola 1448A] (156 aa)
Score = 101, Expect = 8.2e-03, Identities = 30/150 (20%), Positives = 74/150 (49%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           LI   ++    ++  ++  W P  + +  R K+I   ++AA +A  + E     +  +L E+K  AAEIIE A+    +   +    A  +A +++++  ++I+++   ++     ++  LA+  A   L   ID+  + ++++ +  ++
  S:     7 LIGQSVAFFIFVIFCMKFVWPPVIAALHERQKKIADGLDAASRAARDLELAQEKAGQQLREAKAQAAEIIEQAKKRGTQIVDEARETARVEADRVKAQAQAEIEQELNGVKDALRAQLGSLAVNGAEKILGATIDQNAHAELVNKLAAEI 156
>gi|91777096|ref|YP_546852.1| F0F1 ATP synthase subunit B [Methylobacillus flagellatus KT] >gi|91711083|gb|ABE51011.1| ATP synthase F0, B subunit [Methylobacillus flagellatus KT] (156 aa)
Score = 101, Expect = 8.3e-03, Identities = 40/150 (26%), Positives = 72/150 (48%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           LIA  IS   L+    +  W    + IE R K I   + AAE+ + E +     S   + ++K  A  II  AE  A +  ++ +A A  +  +I +   ++I ++    ++    +VS LA+  A   L K+ID + +  +++ I N+L
  S:     7 LIAQAISFAILIWFTTKFVWPYLLNAIETRQKTIADGLAAAERGKQELDMATQRSAEVVNDAKQKATSIIAQAEKRASEIVEEAKANAKAEGDRIIAGAKAEIDQEVNRAKEGLRQQVSALAVAGAEKILRKEIDAKAHADLLNAIANEL 156
>gi|114630|sp|P09221|ATPF_BACP3 ATP synthase B chain precursor >gi|77456|pir||S01399 H+-transporting two-sector ATPase (EC 3.6.3.14) chain b precursor - thermophilic bacterium PS-3 >gi|581473|emb|CAA30650.1| unnamed protein product [Bacillus sp. PS3] (163 aa)
Score = 101, Expect = 8.4e-03, Identities = 38/138 (27%), Positives = 73/138 (52%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEE 172
           +I  ++  I LL L+ + AW+P  + ++ R + I  K    +  + E+EK L   R  + +S+  A  +IENA   AE+ K++I A A     + E+E   +  K+E+E EK + +   +  + +  + ++ K+ E+E
  S:    22 IIYQLLMFIILLALLRKFAWQPLMNIMKQREEHIATKSTRRKNDRQEAEKLLEEQRELMKQSRQEAQALIENAASLAEEQKEQIVASA-----RAEAERVKEAAKKEIEREKEQAMAALREQVASLSVLIASKVIEKE 154
>gi|70733503|ref|YP_263278.1| F0F1 ATP synthase subunit B [Pseudomonas fluorescens Pf-5] >gi|68347802|gb|AAY95408.1| ATP synthase F0, B subunit [Pseudomonas fluorescens Pf-5] (156 aa)
Score = 101, Expect = 8.5e-03, Identities = 31/150 (20%), Positives = 75/150 (50%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           LI   ++ +  +L  ++  W P  + +  R K+I   ++AA +A  + E     +  +L E+K  AAEIIE A+    +   +    A  +A +++++  ++I+++   ++     ++  LA+  A   L   ID+  + ++++ +  ++
  S:     7 LIGQSVAFLIFVLFCMKFIWPPVIAALHERQKKIADGLDAASRAARDLELAQDKAGQQLREAKAQAAEIIEQAKKRGSQIVDEAREQARVEAERVKAQAQAEIEQELNGVKDALRAQLGSLAVNGAEKILGATIDQNAHAELVNKLAAEI 156
>gi|91226234|ref|ZP_01261074.1| F0F1 ATP synthase subunit B [Vibrio alginolyticus 12G01] >gi|91189245|gb|EAS75524.1| F0F1 ATP synthase subunit B [Vibrio alginolyticus 12G01] (156 aa)
Score = 101, Expect = 8.8e-03, Identities = 38/150 (25%), Positives = 70/150 (46%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           L+   IS    +   ++  W P    IE R K+I   ++AAE+A  + +     +  +L E+K TA EIIE A     +   +    A  +  +I ++  ++++ +          +V+ LA+  A   L + ID++  K I+D+I   L
  S:     7 LLGQAISFALFVWFCMKYVWPPLMQAIEERQKKIADGLQAAERAAKDLDLAQANASDQLKEAKRTATEIIEQANKRKSQILDEAREEAQAERQKILAQAEAELEAERNRARDELRKQVATLAVAGAEKILERSIDKDAQKDILDNITAKL 156
>gi|84385789|ref|ZP_00988819.1| hypothetical ATP synthase B chain [Vibrio splendidus 12B01] >gi|86145160|ref|ZP_01063491.1| hypothetical ATP synthase B chain [Vibrio sp. MED222] >gi|84379105|gb|EAP95958.1| hypothetical ATP synthase B chain [Vibrio splendidus 12B01] >gi|85836737|gb|EAQ54857.1| hypothetical ATP synthase B chain [Vibrio sp. MED222] (156 aa)
Score = 101, Expect = 8.8e-03, Identities = 28/150 (18%), Positives = 70/150 (46%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           +    IS +  + L ++  W P  + ++ R KEI   +  +E A  E E         + ++K    E+IE  +    +           + ++I  +G ++++ +  +L +    +++   +++A   +SK +D E N+ ++D ++++L
  S:     7 MFGQAISFVIFVWLCMKYVWPPLTAMLDERQKEIADGLRHSENAAKELELAKSNGAQLVADAKKNVTELIEQGKKRRNEIITLAHQEGEQEKARILEQGRAELEGERQKLRRELQADMADAVIQSAQKLISKNLDSETNRALVDQMISEL 156
>gi|17548038|ref|NP_521440.1| F0F1 ATP synthase subunit B [Ralstonia solanacearum GMI1000] >gi|17430344|emb|CAD17109.1| probable atp synthase b chain transmembrane protein [Ralstonia solanacearum] (156 aa)
Score = 101, Expect = 9.0e-03, Identities = 37/154 (24%), Positives = 79/154 (51%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLTAKL 188
           L+A ++    L  +V +  W P    ++ R K+I   + AA+K + E E         L E++   A+ I +AE  A+ T  +I+  A  +A++I ++  ++ ++Q + + +    +V+ LA++ A   L +++    N ++  D++  L A+L
  S:     7 LVAQMVVFFILWWVVAKFIWPPLVKALDERAKKIADGLAAADKGKAELELANKRVEQALTEARTEGAQRIADAEKRAQMTADEIKQNAQAEAARIVAQAKAEAEQQAVRVRESLRDQVAVLAVKGAEQILKREV----NAQVHADLLTQLKAEL 156
>gi|152972645|ref|YP_001337791.1| F0F1 ATP synthase subunit B [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] >gi|150957494|gb|ABR79524.1| ATP synthase subunit B [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] (154 aa)
Score = 100, Expect = 9.4e-03, Identities = 34/150 (22%), Positives = 73/150 (48%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           ++   I+ +  +   ++  W P  + IE R KEI   + +AE+A+ + +     +  +L ++K  A  IIE A     +   + +A A  + ++I ++  ++I  +     +    +V+ LA+  A   + + +DE  N  I+D +V +L
  S:     5 ILGQAIAFVIFVWFCMKYVWPPLMAAIEKRQKEISDGLASAERAKKDLDLAQANATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVAQAQAEIDAERKRAREELRKQVAILAVAGAEKIIERSVDEAANSDIVDKLVAEL 154
>gi|76800063|ref|ZP_00781968.1| ATP synthase F0, B subunit [Streptococcus agalactiae 18RS21] >gi|76584627|gb|EAO61436.1| ATP synthase F0, B subunit [Streptococcus agalactiae 18RS21] (165 aa)
Score = 100, Expect = 9.4e-03, Identities = 35/144 (24%), Positives = 69/144 (47%)
  Q:    41 SLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           S++ L +L+   AWK      EAR ++I   ++ AE+A+ ++E        +L  +K  A +II+NA+        +I + A  +A +++ + +  I + + E       EV+ L +  A   +   +D+E    +ID  +  L
  S:    19 SVLLLFILIKTFAWKQITGIFEAREQKIANDIDTAEQARQQAEAFATKREEELSNAKTEANQIIDNAKETGLAKGDQIISEAKTEADRLKEKAHQDIAQNKAEALADVKGEVADLTVLLAEKIMVSNLDKEAQSNLIDSYIXKL 162
>gi|153007322|ref|YP_001381647.1| ATP synthase F0, B subunit [Anaeromyxobacter sp. Fw109-5] >gi|152030895|gb|ABS28663.1| ATP synthase F0, B subunit [Anaeromyxobacter sp. Fw109-5] (175 aa)
Score = 100, Expect = 9.6e-03, Identities = 30/147 (20%), Positives = 76/147 (51%)
  Q:    40 ISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLTA 186
           I+ + LL ++ + AW P    +  R + I+  +++A++ + E+E+ L   +  L ++   AAE+    + + E  ++++ A A  +A  + +    +I++++ +        V+ LA++ A   +   +D+   +K+++D +  L A
  S:    25 ITFLVLLFVLGKFAWGPIVKMLAERERTIREAIDSAKRERTEAERLLAEQKALLGKAAREAAELARRNQQEVEAMRQELTARARKEADDLVATARKQIEEEKTKAMSELRAVVADLAIDAASRLVKANLDDASQRKLVEDYIAQLPA 171
>gi|193215091|ref|YP_001996290.1| ATP synthase F0, B subunit [Chloroherpeton thalassium ATCC 35110] >gi|193088568|gb|ACF13843.1| ATP synthase F0, B subunit [Chloroherpeton thalassium ATCC 35110] (175 aa)
Score = 100, Expect = 1.0e-02, Identities = 37/136 (27%), Positives = 77/136 (56%)
  Q:    52 LAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLTAK 187
           LAW P  S +E R K IQ  ++ A  A+ ++EK L  ++  + +++  A  II+  +  AEK + +I   A  +A +I ++  ++I++++ +       EV+ LA++ A   +   +D E++K +++ ++ DL+ K
  S:    38 LAWGPILSALEEREKSIQSAIDRANSAKDDAEKLLSKNKDAMNKAEVEADRIIKEGKEYAEKMRNEIVTKAQEEAKKIAAQAKAEIEQEKQQALNALRDEVATLAVKGAEKIIRMNLDAEKHKAVVEGMLEDLSTK 173
>gi|110277404|gb|ABG57232.1| AtpB [Streptococcus mitis] (140 aa)
Score = 100, Expect = 1.0e-02, Identities = 35/121 (28%), Positives = 63/121 (52%)
  Q:    41 SLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAG 161
           S I LL+L+ + AW       E R ++I   ++ AE+A+ ++E        +L  S+  A  +IENA+  AE++K  I A A  +A +++ +   +I + + E  +    EV+ L +  AG
  S:    18 SFILLLVLIKKFAWSNITGIFEERAEKIASDIDRAEEARQKAEVLAQKREDELAGSRKEAKTVIENAKETAEQSKANILADAKLEAGRLKEKANQEIAQNKAEALQSVKGEVADLTISLAG 138
>gi|28899847|ref|NP_799452.1| F0F1 ATP synthase subunit B [Vibrio parahaemolyticus RIMD 2210633] >gi|153838481|ref|ZP_01991148.1| ATP synthase F0, B subunit [Vibrio parahaemolyticus AQ3810] >gi|38502968|sp|Q87KA4|ATPF_VIBPA ATP synthase B chain >gi|28808099|dbj|BAC61336.1| ATP synthase F0, B subunit [Vibrio parahaemolyticus RIMD 2210633] >gi|149748104|gb|EDM58963.1| ATP synthase F0, B subunit [Vibrio parahaemolyticus AQ3810] (156 aa)
Score = 100, Expect = 1.0e-02, Identities = 38/150 (25%), Positives = 70/150 (46%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           L+   IS    +   ++  W P    IE R K+I   ++AAE+A  + +     +  +L E+K TA EIIE A     +   +    A  +  +I ++  ++++ +          +V+ LA+  A   L + ID++  K I+D+I   L
  S:     7 LLGQAISFALFVWFCMKYVWPPLMQAIEERQKKIADGLQAAERAAKDLDLAQANASDQLKEAKRTATEIIEQANKRKSQIIDEAREEAQAERQKILAQAEAELEAERNRARDELRKQVATLAVAGAEKILERTIDKDAQKDILDNITAKL 156
>gi|15673750|ref|NP_267924.1| F0F1 ATP synthase subunit B [Lactococcus lactis subsp. lactis Il1403] >gi|116512627|ref|YP_811534.1| F0F1 ATP synthase subunit B [Lactococcus lactis subsp. cremoris SK11] >gi|125624729|ref|YP_001033212.1| F0F1 ATP synthase subunit B [Lactococcus lactis subsp. cremoris MG1363] >gi|61219599|sp|P0A2Z0|ATPF_LACLA ATP synthase B chain >gi|61219602|sp|P0A2Z1|ATPF_LACLM ATP synthase B chain >gi|6048349|gb|AAF02204.1|AF059739_4 H+-ATPase F0-part b-subunit [Lactococcus lactis subsp. cremoris] >gi|12724791|gb|AAK05866.1|AE006407_2 ATP synthase subunit b (EC 3.6.1.34) [Lactococcus lactis subsp. lactis Il1403] >gi|116108281|gb|ABJ73421.1| F0F1-type ATP synthase, subunit b [Lactococcus lactis subsp. cremoris SK11] >gi|124493537|emb|CAL98518.1| ATP synthase F0, B subunit [Lactococcus lactis subsp. cremoris MG1363] (168 aa)
Score = 100, Expect = 1.0e-02, Identities = 34/144 (23%), Positives = 70/144 (48%)
  Q:    41 SLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           + I LL+L+   AW    S   +R K+I   ++AAE    ++   +   + +L  SK  AA II+ A   A + + K+ A A  +A+ ++      I+++  E       +V+ ++++ A   + + +D    +++ID  +  L
  S:    23 AFIILLVLLRLFAWNAITSVFASRAKKISDDIDAAEANNKQAADLVKQRQAELAGSKEEAANIIQVANDTASQNRAKVLATANEEATSLKKRAQEDIEQERKEALNTVKGDVADISVQIAEKLIGQSLDASAQQELIDSYLAKL 166
>gi|22537022|ref|NP_687873.1| F0F1 ATP synthase subunit B [Streptococcus agalactiae 2603V/R] >gi|25010932|ref|NP_735327.1| F0F1 ATP synthase subunit B [Streptococcus agalactiae NEM316] >gi|76788233|ref|YP_329604.1| F0F1 ATP synthase subunit B [Streptococcus agalactiae A909] >gi|76799296|ref|ZP_00781463.1| ATP synthase F0, B subunit [Streptococcus agalactiae 18RS21] >gi|77406457|ref|ZP_00783513.1| ATP synthase F0, B subunit [Streptococcus agalactiae H36B] >gi|77407986|ref|ZP_00784736.1| ATP synthase F0, B subunit [Streptococcus agalactiae COH1] >gi|77410700|ref|ZP_00787059.1| ATP synthase F0, B subunit [Streptococcus agalactiae CJB111] >gi|77414097|ref|ZP_00790265.1| ATP synthase F0, B subunit [Streptococcus agalactiae 515] >gi|22533879|gb|AAM99745.1|AE014231_3 ATP synthase F0, B subunit [Streptococcus agalactiae 2603V/R] >gi|23095311|emb|CAD46521.1| H+-transporting ATP synthase b chain [Streptococcus agalactiae NEM316] >gi|76563290|gb|ABA45874.1| ATP synthase F0, B subunit [Streptococcus agalactiae A909] >gi|76585356|gb|EAO61947.1| ATP synthase F0, B subunit [Streptococcus agalactiae 18RS21] >gi|77159849|gb|EAO70992.1| ATP synthase F0, B subunit [Streptococcus agalactiae 515] >gi|77163236|gb|EAO74188.1| ATP synthase F0, B subunit [Streptococcus agalactiae CJB111] >gi|77173444|gb|EAO76563.1| ATP synthase F0, B subunit [Streptococcus agalactiae COH1] >gi|77174926|gb|EAO77739.1| ATP synthase F0, B subunit [Streptococcus agalactiae H36B] (165 aa)
Score = 100, Expect = 1.1e-02, Identities = 35/144 (24%), Positives = 69/144 (47%)
  Q:    41 SLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           S++ L +L+   AWK      EAR ++I   ++ AE+A+ ++E        +L  +K  A +II+NA+        +I + A  +A +++ + +  I + + E       EV+ L +  A   +   +D+E    +ID  +  L
  S:    19 SVLLLFILIKTFAWKQITGIFEAREQKIANDIDTAEQARQQAEAFATKREEELSNAKTEANQIIDNAKETGLAKGDQIISEAKTEADRLKEKAHQDIAQNKAEALADVKGEVADLTVLLAEKIMVSNLDKEAQSNLIDSYIKKL 162
>gi|114632|sp|P12989|ATPF_VIBAL ATP synthase B chain >gi|581814|emb|CAA34177.1| unnamed protein product [Vibrio alginolyticus] (156 aa)
Score = 100, Expect = 1.1e-02, Identities = 38/150 (25%), Positives = 70/150 (46%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           L+   IS    +   ++  W P    IE R K+I   ++AAE+A  + +     +  +L E+K TA EIIE A     +   +    A  +  +I ++  ++++ +          +V+ LA+  A   L + ID++  K I+D+I   L
  S:     7 LLGQAISFALFVWFCMKYVWPPLMKAIEERQKKIADGLQAAERAAKDLDLAQANASDQLKEAKRTATEIIEQANKRKSQILDEAREEAQAERQKILAQAEAELEAERNRARDDLRKQVATLAVAGAEKILERSIDKDAQKDILDNITAKL 156
>gi|114322020|ref|YP_743703.1| F0F1 ATP synthase subunit B [Alkalilimnicola ehrlichei MLHE-1] >gi|114228414|gb|ABI58213.1| ATP synthase F0, B subunit [Alkalilimnicola ehrlichei MLHE-1] (146 aa)
Score = 100, Expect = 1.2e-02, Identities = 33/146 (22%), Positives = 69/146 (47%)
  Q:    39 VISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           +IS    +   ++  W P ++ +  R K+I   + A E+ Q E ++        L E++  A+++I  A     +  ++    A  +A ++ ++  S+I  +  +       EV  LA+  +   L ++ID + +K +IDD+V  L
  S:     1 MISFALFVWFTMKYVWPPIQTAMADRQKQIADGLAAGERGQKELDQAKSEVDKMLREAREQASQVIAQANKRQSELVEQAREEARQEAERVLAQARSEIDTEISQARDALRKEVVNLAVAGSSRILKREIDAKAHKDLIDDLVKQL 146
>gi|193216468|ref|YP_001999710.1| ATP synthase B chain [Mycoplasma arthritidis 158L3-1] >gi|193001791|gb|ACF07006.1| ATP synthase B chain [Mycoplasma arthritidis 158L3-1] (176 aa)
Score = 99, Expect = 1.3e-02, Identities = 37/142 (26%), Positives = 76/142 (53%)
  Q:    40 ISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIV 181
           ++LI ++ +V  L +KP K  ++ R   IQ  ++ + KA+  + K       K++ES   A +IIE A+L+ E+       V+  KA  I  +    + K + E E ++   + + A+E A   + ++I +++N K+I++++
  S:    33 LTLILVVTIVTLLVYKPLKKMLKNRQNFIQNNIDESIKAKEAALKVQEEIDEKIIESSKHANQIIEQAKLERERIINNGIEVSNKKAEIIIEQANILVTKSQAEFENKQRKIIVENAVEIAKKIIGREIRDKDNLKMIEEML 174
>gi|120556783|ref|YP_961134.1| ATP synthase F0, B subunit [Marinobacter aquaeolei VT8] >gi|120326632|gb|ABM20947.1| ATP synthase F0, B subunit [Marinobacter aquaeolei VT8] (156 aa)
Score = 99, Expect = 1.3e-02, Identities = 32/150 (21%), Positives = 74/150 (49%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           LI   I+    +   ++  W P  + +EAR K+I   + AA++A L+ E     +  +L ++K  AA +I+ A   A +  +  +  A  +  ++  +  ++I+++ ++       EV+ LA+  A   L   +D + + ++++ +  +L
  S:     7 LIGQSIAFAIFVWFCVKYVWPPITAAMEARQKKIADGLSAADRASLDLELAQEKATKELQKAKEEAAALIDQANKRAAQIVEASKEDARKEGEKLIEQARAEIQQERVQARDALRAEVATLAVAGAEKILETSVDAKAHSEMLEKLAAEL 156
>gi|28872702|ref|NP_795321.1| F0F1 ATP synthase subunit B [Pseudomonas syringae pv. tomato str. DC3000] >gi|28855958|gb|AAO59016.1| ATP synthase F0, B subunit [Pseudomonas syringae pv. tomato str. DC3000] (156 aa)
Score = 99, Expect = 1.3e-02, Identities = 31/150 (20%), Positives = 73/150 (48%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           LI   ++    +L  ++  W P  + +  R K+I   ++AA +A  + E        +L E+K  AAEIIE A+    +   +    A  +A +++++  ++I+++   ++     ++  LA+  A   L   ID+  + ++++ +  ++
  S:     7 LIGQSVAFFIFVLFCMKYVWPPVIAALHERQKKIADGLDAASRAARDLELAQDKVGQQLREAKAQAAEIIEQAKKRGTQIVDEARETARVEADRVKAQAQAEIEQELNGVKDALRAQLGSLAVNGAEKILGATIDQNAHAELVNKLAAEI 156
>gi|149190478|ref|ZP_01868749.1| F0F1 ATP synthase subunit B [Vibrio shilonii AK1] >gi|148835732|gb|EDL52698.1| F0F1 ATP synthase subunit B [Vibrio shilonii AK1] (156 aa)
Score = 99, Expect = 1.3e-02, Identities = 38/150 (25%), Positives = 71/150 (47%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           L+   IS    +   ++  W P  + IE R K+I   + AAE+A  + +     +  ++ E+K TA E+IE A     +   +    AL +  +I ++  ++I+ +          +V+ LA+  A   L + ID++  K I+D+I   L
  S:     7 LLGQAISFALFVWFCMKYVWPPIMNAIEERQKKIADGLVAAERAAKDLDLAQANASDQMKEAKRTATEVIEQANKRKAQIVDEAREEALAERQKILAQAEAEIEAERNRARDELRKQVATLAVAGAEKILERSIDKDAQKDILDNITAKL 156
>gi|71891797|ref|YP_277526.1| F0F1 ATP synthase subunit B [Candidatus Blochmannia pennsylvanicus str. BPEN] >gi|71795903|gb|AAZ40654.1| ATP synthase, F0 sector, subunit b [Candidatus Blochmannia pennsylvanicus str. BPEN] (160 aa)
Score = 99, Expect = 1.3e-02, Identities = 36/153 (23%), Positives = 74/153 (48%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLTAK 187
           ++   IS +  +   ++  W P  S IE R KEI   + +A  A+ ESE+    + + L +++  A EII+ A     +   + +  A  + S+I S+   +I  +   +      ++S+L +E     +   I+E  +  ++++I+N L+ K
  S:     7 ILGQTISFVLFVWFCMKYVWYPFISIIEKRQKEISDNLVSATHAKTESERVNAEALLCLRQARVKAQEIIKQANKCKMQIINEAKHEAEKEQSRILSQAREQIIYERKRVTDELRKQISELVIEGTEKVIEHSINEMIDIDLLNNIINTLSYK 159
>gi|146296979|ref|YP_001180750.1| ATP synthase F0, B subunit [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145410555|gb|ABP67559.1| ATP synthase F0, B subunit [Caldicellulosiruptor saccharolyticus DSM 8903] (163 aa)
Score = 99, Expect = 1.3e-02, Identities = 36/145 (24%), Positives = 78/145 (53%)
  Q:    39 VISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVND 183
           +I+ + L L+  +  +K   +++E R+K IQ +++ A K++ E+ K        L ++   A EI++NA ++A+K   KI   A  +A++I      ++  ++ +       +   +AL  A   + K ++ EEN+KI+++I ++
  S:    15 IINFLILYLIYRKFFFKKVTAFMEKRSKMIQEQLDFAAKSKEEAIKLKEEYENILSQAHAKANEIVQNAMIEAQKQADKIIEDAKLEANKIIENALKQLDIEKKKQINELKNQFVSIALLAASKVIEKNLNTEENRKIVENIFDE 159
>gi|16762457|ref|NP_458074.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica serovar Typhi str. CT18] >gi|16767153|ref|NP_462768.1| F0F1 ATP synthase subunit B [Salmonella typhimurium LT2] >gi|29143945|ref|NP_807287.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] >gi|56415737|ref|YP_152812.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|62182351|ref|YP_218768.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|161505606|ref|YP_001572718.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] >gi|161616989|ref|YP_001590954.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|167994873|ref|ZP_02575963.1| hypothetical protein Sententer_01000051_0100025727 [Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701] >gi|168224036|ref|ZP_02649268.1| hypothetical protein Senterenterica_26865 [Salmonella enterica subsp. enterica serovar Agona str. SL483] >gi|168229024|ref|ZP_02654255.1| hypothetical protein Sententeric_24865 [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433] >gi|168263235|ref|ZP_02685208.1| hypothetical protein Salmentericaenterica_19283 [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] >gi|168464796|ref|ZP_02698688.1| ATP synthase F0, B subunit [Salmonella enterica subsp. enterica serovar Newport str. SL317] >gi|168478089|ref|ZP_02707112.1| hypothetical protein Salmoentericaenterica_25861 [Salmonella enterica subsp. enterica serovar Virchow str. SL491] >gi|194444961|ref|YP_002043115.1| ATP synthase F0, B subunit [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194450958|ref|YP_002047898.1| ATP synthase F0, B subunit [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194472738|ref|ZP_03078722.1| ATP synthase F0, B subunit [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|194737006|ref|YP_002116810.1| ATP synthase F0, B subunit [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|25290581|pir||AB0954 ATP synthase chain B [imported] - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) >gi|16422443|gb|AAL22727.1| membrane-bound ATP synthase, F0 sector, subunit b [Salmonella typhimurium LT2] >gi|16504762|emb|CAD03126.1| ATP synthase subunit B [Salmonella enterica subsp. enterica serovar Typhi] >gi|29139581|gb|AAO71147.1| ATP synthase subunit B [Salmonella enterica subsp. enterica serovar Typhi Ty2] >gi|56129994|gb|AAV79500.1| ATP synthase subunit B [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|62129984|gb|AAX67687.1| membrane-bound ATP synthase, F0 sector, subunit b [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|160866953|gb|ABX23576.1| hypothetical protein SARI_03782 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] >gi|161366353|gb|ABX70121.1| hypothetical protein SPAB_04810 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|194403624|gb|ACF63846.1| ATP synthase F0, B subunit [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194409262|gb|ACF69481.1| ATP synthase F0, B subunit [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194459102|gb|EDX47941.1| ATP synthase F0, B subunit [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|194712508|gb|ACF91729.1| ATP synthase F0, B subunit [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|195632223|gb|EDX50707.1| ATP synthase F0, B subunit [Salmonella enterica subsp. enterica serovar Newport str. SL317] (156 aa)
Score = 99, Expect = 1.4e-02, Identities = 42/150 (28%), Positives = 73/150 (48%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAE------LDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           ++   I+ I  +   ++  W P  + IE R KEI   + +AE+A  + +     +  +L ++K  A  IIE A       LD  KT+ + E   +   +Q E E   K  ++EL  +      V+ LA+  A   + + +DE  N  I+D +V +L
  S:     7 ILGQAIAFILFVWFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKASATDQLKKAKAEAQVIIEQANKRRAQILDEAKTEAEQERTKIVAQAQAEIEAERKRAREELRKQ------VAILAVAGAEKIIERSVDEAANSDIVDKLVAEL 156
>gi|148975560|ref|ZP_01812431.1| hypothetical ATP synthase B chain [Vibrionales bacterium SWAT-3] >gi|145964988|gb|EDK30239.1| hypothetical ATP synthase B chain [Vibrionales bacterium SWAT-3] (156 aa)
Score = 99, Expect = 1.4e-02, Identities = 28/150 (18%), Positives = 71/150 (47%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           +    IS +  + L ++  W P  + ++ R KEI   +  +E A  E E         + ++K    E+IE  +    +        A  + ++I  +G ++++ +  +L +    +++   +++A   ++K +D E N+ ++D ++++L
  S:     7 MFGQAISFVIFVWLCMKYVWPPLTAMLDERQKEIADGLRHSENAAKELELAKSNGAQLVEDAKRNVTELIEQGKKRRNEIISLAHEEAEQEKARILEQGRAELESERQKLRRELQADMADAVIQSAQKLINKNLDSETNRALVDQLISEL 156
>gi|50842723|ref|YP_055950.1| F0F1 ATP synthase subunit B [Propionibacterium acnes KPA171202] >gi|50840325|gb|AAT82992.1| ATP synthase B chain [Propionibacterium acnes KPA171202] (184 aa)
Score = 99, Expect = 1.5e-02, Identities = 38/155 (24%), Positives = 82/155 (52%)
  Q:    38 HVISLIFLLLLVIRLAWKPTKSYI-------EARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKI-DEEENKKIIDDIVNDLTAKLESSS 192
           H I +I  ++LV+ L W   K+ +       E RT+ IQ  +E AE+AQ E++  L   + +L  +++ AA+I ++A+    +   ++ A A  +A +I     ++I+ +  +  +    E+  LA   A   + + + D++  +  +D  ++ L  +  +S+
  S:    15 HPIEIIVGVILVLLLTWLIAKAVVPRFEKLYEERTETIQGGIERAERAQAEAKAALEKYQAQLASARDEAAQIRDDAKSQGAQIIAEMRANAQEEADRITERANAQIQAERDQAVREVRAEIGGLATTLASRIVGESLQDDQRVQATVDRFLSSLADEPSASN 177
>gi|167628986|ref|YP_001679485.1| ATP synthase f0, b subunit [Heliobacterium modesticaldum Ice1] >gi|167591726|gb|ABZ83474.1| ATP synthase f0, b subunit [Heliobacterium modesticaldum Ice1] (169 aa)
Score = 99, Expect = 1.6e-02, Identities = 29/150 (19%), Positives = 83/150 (55%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
            +A +IS + L+ ++ ++A+KP    ++ R ++++  +  AE    E+ +    +  +L +++  A ++I  A    E+  ++I A A  +A++++ +  + I++++ +  +     V  L++  A   + K +DE   ++++D+++N++
  S:    15 FLAMLISFLILVFILQQVAFKPILKALDERRQKVEESISRAENDLEEANRMRAENAAELAKARQEAHDLIARATKVGEEKAQEIVAAAQAEANRLKEKAVADIQREKEKALEELRSHVVNLSILAAEKVIRKNLDEPTQRQLVDEVINEV 164
>gi|56965613|ref|YP_177347.1| F0F1 ATP synthase subunit B [Bacillus clausii KSM-K16] >gi|56911859|dbj|BAD66386.1| F0F1-type ATP synthase B chain [Bacillus clausii KSM-K16] (161 aa)
Score = 99, Expect = 1.6e-02, Identities = 33/151 (21%), Positives = 82/151 (54%)
  Q:    38 HVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLTAKL 188
            +++   LLL++ + A KP    ++ R   I  ++++AE+ + E+EK L   R ++ +++  A E+IENA+   E+  +++   A  +A +I  +  ++I+ ++ +       +V+ L++  A   + K++D  E  +++ + +   + +L
  S:    11 QLLAFAVLLLILSKFALKPLLGVMQKRQDMINEQIDSAEQNRKEAEKLLAEQREEMQKARVEARELIENAKKAGEQQGQEMVRAAKEEAQRIHQQALAEIQNEKDQAVAALREQVASLSVLIAQKVIEKELDASEQDQLVQEYLKQASEEL 161
>gi|157368253|ref|YP_001476242.1| F0F1 ATP synthase subunit B [Serratia proteamaculans 568] >gi|157320017|gb|ABV39114.1| ATP synthase F0, B subunit [Serratia proteamaculans 568] (156 aa)
Score = 98, Expect = 1.6e-02, Identities = 33/150 (22%), Positives = 72/150 (48%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           ++   I+ +  +   ++  W P  + IE R  EI   + +AE+A+ + +     +  +L  +K  A  IIE A     +   + +A A  + ++I ++  ++I+ +     +    +V+ LA+  A   + + +DE  N  I+D +V +L
  S:     7 ILGQAIAFVLFVWFCMKYVWPPIMAAIEKRQGEIADGLASAERAKKDLDLAQANATDQLKTAKAEAQVIIEQANKRKAQIMDEAKAEAEQERNKIVAQAQAEIEAERKRAREELRKQVAMLAIAGAEKIIERSVDEAANSDIVDKLVAEL 156
>gi|77964177|gb|ABB13422.1| ATP synthase subunit b [Clostridium paradoxum] (169 aa)
Score = 98, Expect = 1.6e-02, Identities = 33/150 (22%), Positives = 79/150 (52%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           ++  +++ I + L++ +L +KP   ++  R + I   ++ AE+ + E+         K+  SK    EII+ A   AE    +I   A N+A+++  + + +I++++ ++      E+S +A+  A   +   ID+ +++K+I D + ++
  S:    13 VVFQIVNTIVMYLILKKLLFKPVTKFMNDRQESIANSIKEAEETKKEAYALKAEYEAKINASKEEGQEIIKEASRKAEMRADEIIKNAQNEANRLMEKAHIEIEREKQKVVNELKDEISNIAILAASKVIEADIDKNKHEKLISDFIKEV 162
>gi|89092251|ref|ZP_01165205.1| ATP synthase F0, B subunit [Oceanospirillum sp. MED92] >gi|89083339|gb|EAR62557.1| ATP synthase F0, B subunit [Oceanospirillum sp. MED92] (156 aa)
Score = 98, Expect = 1.7e-02, Identities = 31/150 (20%), Positives = 77/150 (51%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           +I   I+    ++  ++  W P  + +  R K+I   ++AA++A+ + +     +   + + K  AA IIE A   A +   + +  AL +A+++++   ++++++  +  +    +V+ LAL  A   L   IDE+ + ++++ +  +L
  S:     7 IIGQAIAFFIFVVFCMKYVWPPITAALAERKKKIAEGLDAADRAERDLQLAQEKATENMRKGKEEAAAIIEQANKRANQIIDEAKEKALEEANRVKAAKEAELEQEVNQAREALRAQVATLALAGAEKVLEASIDEKAHAQLVEKLAAEL 156
>gi|153834317|ref|ZP_01986984.1| ATP synthase F0, B subunit [Vibrio harveyi HY01] >gi|148869325|gb|EDL68339.1| ATP synthase F0, B subunit [Vibrio harveyi HY01] (156 aa)
Score = 98, Expect = 1.7e-02, Identities = 37/150 (24%), Positives = 70/150 (46%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           L+   IS    +   ++  W P    IE R K+I   ++AAE+A  + +     +  +L E+K TA EII+ A     +   +    A  +  +I ++  ++++ +          +V+ LA+  A   L + ID++  K I+D+I   L
  S:     7 LLGQAISFALFVWFCMKYVWPPLMQAIEERQKKIADGLQAAERAAKDLDLAQANASDQLKEAKRTATEIIDQANKRKSQIIDEAREEAQAERQKILAQAEAELEAERNRARDELRKQVATLAVAGAEKILERSIDKDAQKDILDNITAKL 156
>gi|163803601|ref|ZP_02197467.1| F0F1 ATP synthase subunit B [Vibrio campbellii AND4] >gi|159172595|gb|EDP57453.1| F0F1 ATP synthase subunit B [Vibrio campbellii AND4] (156 aa)
Score = 98, Expect = 1.7e-02, Identities = 37/150 (24%), Positives = 69/150 (46%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           L+   IS    +   ++  W P    IE R K+I   ++AAE+A  + +     +  +L E+K TA EII+ A     +   +    A  +   I ++  ++++ +          +V+ LA+  A   L + ID++  K I+D+I   L
  S:     7 LLGQAISFALFVWFCMKYVWPPLMQAIEERQKKIADGLQAAERAAKDLDLAQANASDQLKEAKRTATEIIDQANKRKSQILDEAREEAQAERQNILAQAEAELEAERNRARDELRKQVATLAVAGAEKILERTIDKDAQKDILDNITAKL 156
>gi|15963433|dbj|BAB69467.1| H+-ATPase b subunit [Lactococcus lactis subsp. lactis] (168 aa)
Score = 98, Expect = 1.8e-02, Identities = 33/144 (22%), Positives = 69/144 (47%)
  Q:    41 SLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           + I LL+L+   AW    S   +R K+I   ++AAE    ++   +   + +L  SK  AA II+ A   A + + K+ A A  + + ++      I+++  E       +V+ ++++ A   + + +D    +++ID  +  L
  S:    23 AFIILLVLLRLFAWNAITSVFASRAKKISDDIDAAEANNKQAADLVKQRQAELAGSKEEAANIIQVANDTASQNRAKVLATANRRDTSLKKRAQEDIEQERKEALNTVKGDVADISVQIAEKLIGQSLDASAQQELIDSYLAKL 166
>gi|162457649|ref|YP_001620016.1| H(+)-transporting two-sector ATPase [Sorangium cellulosum 'So ce 56'] >gi|161168231|emb|CAN99536.1| H(+)-transporting two-sector ATPase [Sorangium cellulosum 'So ce 56'] (333 aa)
Score = 98, Expect = 1.8e-02, Identities = 35/159 (22%), Positives = 77/159 (48%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNL-EVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLTAKLESSSK 193
            +A V++   L L+V+R   KP    ++ R + I ++++ A + + E+E  L     KL   + T AE+       AE  K  + A A  +  ++  +   +  +QEL+  +   L E  + A+  A   L ++I +++  ++ +D +  + A + + ++
  S:   165 FLASVLNFGLLALIVVRFGRKPIAEALKKRKQTITQELDNASRLKQEAELRLEEYEDKLTRLEETLAELKAEHAAQAEVEKAHVLAEAEQRRVRMRRDAEFR-AEQELKAARAMLLQEAVQNAVVAAEELLRQRIGQQDLDRVNEDYLKAIPAAVSAGAR 323
>gi|167564622|ref|ZP_02357538.1| F0F1 ATP synthase subunit B [Burkholderia oklahomensis EO147] >gi|167571764|ref|ZP_02364638.1| F0F1 ATP synthase subunit B [Burkholderia oklahomensis C6786] (146 aa)
Score = 98, Expect = 1.8e-02, Identities = 32/146 (21%), Positives = 75/146 (51%)
  Q:    39 VISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           ++  + L    ++  W P  + ++ R+K+I   + AAEK Q E          +L +++N   + I  AE  A+   ++I+A A  +A++I ++  +   +Q ++  +    EV+ LA++ A   L +++D   + ++++ +  +L
  S:     1 MVVFLILAWFTMKFVWPPLINALDERSKKIADGLSAAEKGQAELAAAHKRVDQELAQARNEGQQRIAEAEKRAQAVAEEIKANAQAEAARIIAQAKADADQQIVKARETLRGEVASLAVKGAEQILKREVDHTAHAELLNQLKAEL 146
>gi|581169|emb|CAA23592.1| unnamed protein product [Escherichia coli] (156 aa)
Score = 98, Expect = 1.9e-02, Identities = 33/150 (22%), Positives = 72/150 (48%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           ++   I+ +  +L  ++  W P  +  E R KEI   + +AE+A  + +     +  +L ++K     IIE A     +   + +A A  + ++I ++  ++I+ +     +    +V+ LA+  A   + + +DE  N  I+D +V +L
  S:     7 ILGQAIAFVLFVLFCMKYVWPPLMAAFEKRQKEIADGLASAERAHKDLDLAKASATDQLKKAKAEDQVIIEQANKRRSQILDEAKAEAEQERTKIVAQAQAEIEAERKRAREELRKQVAILAVAGAEKIIERSVDEAANSDIVDKLVAEL 156
>gi|78486506|ref|YP_392431.1| F0F1 ATP synthase subunit B [Thiomicrospira crunogena XCL-2] >gi|78364792|gb|ABB42757.1| ATP synthase F0, B subunit [Thiomicrospira crunogena XCL-2] (156 aa)
Score = 98, Expect = 1.9e-02, Identities = 34/150 (22%), Positives = 74/150 (49%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           L+  +I+ + L+  V ++ W P    +E R K+I   + AAEK + E E     ++  L E+K  A  ++  AE    +  +  +  A  +A +I++   ++++++     +    EVS L +  A   L+K++D   +  +++ +V  +
  S:     7 LLIQIIAFVLLIWFVNKVLWGPLSKLMEDRQKKIADGLSAAEKGKHELELAEQRAKEVLKEAKAQAQNVLSQAEKRGSEIVEDAKIKATEEADRIKAAAQAELEQEVSRAREDLRKEVSTLVVSGAEKILNKEVDAAAHNDMLETLVKSI 156
>gi|167748912|ref|ZP_02421039.1| hypothetical protein ANACAC_03686 [Anaerostipes caccae DSM 14662] >gi|167651534|gb|EDR95663.1| hypothetical protein ANACAC_03686 [Anaerostipes caccae DSM 14662] (161 aa)
Score = 98, Expect = 2.0e-02, Identities = 35/152 (23%), Positives = 78/152 (51%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLTA 186
           L+   ++LI   L++ +L ++P    IE R + I  ++E AE+   ++         +L  +   AA I++ A+   ++  +KI   A  +AS+I ++    I+ +  +  +    E++++A+  A   + + +D+  N+KI+DD + +  A
  S:     8 LLWTFVNLIVFFLILKKLLFQPVMGMIEKREQMISGQIEDAEQKNTQAGLLKEKYEAELKNANQEAAMIVKTAKERGKEEYEKILRDAGAEASKIIADASKTIETEREKAVQGIQNEIAQVAIAAASKVIQENVDQASNEKILDDFLREAGA 159
>gi|168245306|ref|ZP_02670238.1| hypothetical protein Senterienterica_26926 [Salmonella enterica subsp. enterica serovar Heidelberg str. SL486] (149 aa)
Score = 98, Expect = 2.0e-02, Identities = 42/149 (28%), Positives = 72/149 (48%)
  Q:    36 IAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAE------LDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           +   I+ I  +   ++  W P  + IE R KEI   + +AE+A  + +     +  +L ++K  A  IIE A       LD  KT+ + E   +   +Q E E   K  ++EL  +      V+ LA+  A   + + +DE  N  I+D +V +L
  S:     1 LGQAIAFILFVWFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKASATDQLKKAKAEAQVIIEQANKRRAQILDEAKTEAEQERTKIVAQAQAEIEAERKRAREELRKQ------VAILAVAGAEKIIERSVDEAANSDIVDKLVAEL 149
>gi|90415390|ref|ZP_01223324.1| ATP synthase B chain [marine gamma proteobacterium HTCC2207] >gi|90332713|gb|EAS47883.1| ATP synthase B chain [marine gamma proteobacterium HTCC2207] (156 aa)
Score = 98, Expect = 2.0e-02, Identities = 31/150 (20%), Positives = 73/150 (48%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           L   +++  F +   ++  W      +E R K+I   ++AA++A  + E   + +  ++ E+K  AA I++ A   A +   + +  A  +  +++    ++I+++    ++     V+ LAL  A   L   ID++ N+ ++D++   L
  S:     7 LFGQMVTFAFFVWFCMKFVWPVIIESMEERQKKIADGLDAADRALRDLELAQNKATDQMKEAKQEAAGIVDQANKRANQIVDEAKVQARTEGDRLKVAAEAEIEQEINRAKEELRTTVAGLALAGAEEVLEASIDDKANRALVDNLAEQL 156
>gi|55820563|ref|YP_139005.1| F0F1 ATP synthase subunit B [Streptococcus thermophilus LMG 18311] >gi|55822453|ref|YP_140894.1| F0F1 ATP synthase subunit B [Streptococcus thermophilus CNRZ1066] >gi|116627372|ref|YP_819991.1| F0F1 ATP synthase subunit B [Streptococcus thermophilus LMD-9] >gi|55736548|gb|AAV60190.1| H+-translocating ATPase b subunit [Streptococcus thermophilus LMG 18311] >gi|55738438|gb|AAV62079.1| proton-translocating ATPase, b subunit [Streptococcus thermophilus CNRZ1066] >gi|116100649|gb|ABJ65795.1| F0F1-type ATP synthase, subunit b [Streptococcus thermophilus LMD-9] (165 aa)
Score = 98, Expect = 2.1e-02, Identities = 34/144 (23%), Positives = 70/144 (48%)
  Q:    41 SLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           S+  L  L+ + AW        AR K+I   +++AE A+ E+E  +   + +L  ++  A +II+ A+   +  + KI A A ++A +++ +    I +  +E       EV+ L +  A   + + +D +    +ID  ++ L
  S:    19 SVFLLYYLIRKFAWDQITGIFVAREKKIATDIDSAENARQEAEILVQKRQEELAAARTEATQIIDEAKKTGKTKESKIIAEAYDEAKRLKEKANQDIAQSWVEALAGVKGEVADLTVLLAEKVMKQNLDAKAQSDLIDSYLDQL 162
>gi|52843179|ref|YP_096978.1| F0F1 ATP synthase subunit B [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] >gi|54295824|ref|YP_128239.1| F0F1 ATP synthase subunit B [Legionella pneumophila str. Lens] >gi|54298990|ref|YP_125359.1| F0F1 ATP synthase subunit B [Legionella pneumophila str. Paris] >gi|148361326|ref|YP_001252533.1| F0F1 ATP synthase subunit B [Legionella pneumophila str. Corby] >gi|52630290|gb|AAU29031.1| ATP synthase F0, B subunit [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] >gi|53752775|emb|CAH14210.1| hypothetical protein [Legionella pneumophila str. Paris] >gi|53755656|emb|CAH17158.1| hypothetical protein [Legionella pneumophila str. Lens] >gi|148283099|gb|ABQ57187.1| ATP synthase F0, B subunit [Legionella pneumophila str. Corby] (156 aa)
Score = 97, Expect = 2.3e-02, Identities = 35/150 (23%), Positives = 75/150 (50%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           LI  ++     +L  ++L W P    +E R  +I   + AAE+ + E E   H  + +L ++K  +A+II+ A   A +  +  +  A  +A         +I +Q    ++    +V+KLA+  A   L +++D + N +++D+++ ++
  S:     7 LIVQMLVFAAFVLFTMKLVWPPLAKALEERQDKIADGLAAAERGRKELELAQHRVKDELKQAKAHSADIIDKANKRASEIIEAAKEAAKREAQIQAKLAQEQIAQQVNHAKEELRKQVAKLAITGAEKILMREVDAKANSELLDNLIEEI 156
>gi|156972761|ref|YP_001443667.1| F0F1 ATP synthase subunit B [Vibrio harveyi ATCC BAA-1116] >gi|156524355|gb|ABU69441.1| hypothetical protein VIBHAR_00426 [Vibrio harveyi ATCC BAA-1116] (156 aa)
Score = 97, Expect = 2.7e-02, Identities = 36/150 (24%), Positives = 70/150 (46%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           L+   IS    +   ++  W P    IE R K+I   ++AAE+A  + +     +  ++ E+K TA EII+ A     +   +    A  +  +I ++  ++++ +          +V+ LA+  A   L + ID++  K I+D+I   L
  S:     7 LLGQAISFALFVWFCMKYVWPPLMQAIEERQKKIADGLQAAERAAKDLDLAQANASDQMKEAKRTATEIIDQANKRKSQIIDEAREEAQAERQKILAQAEAELEAERNRARDELRKQVATLAVAGAEKILERTIDKDAQKDILDNITAKL 156
>gi|195995537|ref|XP_002107637.1| hypothetical protein TRIADDRAFT_51343 [Trichoplax adhaerens] >gi|190588413|gb|EDV28435.1| hypothetical protein TRIADDRAFT_51343 [Trichoplax adhaerens] (7662 aa)
Score = 96, Expect = 2.9e-02, Identities = 43/121 (35%), Positives = 68/121 (56%)
  Q:    74 AAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIE-----AVALNK---ASQIESEGYSKIKKQELELE---KRKNLEVS-KLALETAGIF--LSKKIDEEENKKIIDDIVNDLTAKLESSSKE 194
           A +K Q   E N H+   +L+E+KN + +  +  EL AE  KK+ E      + LN    A+ ++     K  K+ +E+E   K K+LE   KL LE       + ++  EE+NK + ++IV  + AKLE    E
  S:  6853 ATKKQQQVDEANGHM---ELIEAKNESIKKQKECELTAEAVKKQTELSTRAMIELNNVETATAVKKITAVKPDKKVIEIEAELKEKHLEDQIKLRLEHREEMAEIERQAQEEQNKAL-EEIVEGMAAKLEEEDVE 6983
>gi|153815541|ref|ZP_01968209.1| hypothetical protein RUMTOR_01777 [Ruminococcus torques ATCC 27756] >gi|145847183|gb|EDK24101.1| hypothetical protein RUMTOR_01777 [Ruminococcus torques ATCC 27756] (166 aa)
Score = 96, Expect = 2.9e-02, Identities = 37/149 (24%), Positives = 68/149 (45%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVND 183
           L+  +I++I L LL+     KP    +E R + I   +++A+ AQ  + K        L  +K  + +I+ENA   A+    +I   A NKA  + +     I+ +  +       E++ LA+ +A      K DEE   ++ D  + +
  S:     8 LVYTIINVIILYLLLRHFLIKPVTDIMEKRKQLIADGLQSAQDAQDGALKMKQEYEAALNGAKQESVQIVENARKSAKAEYDRILEEAGNKADSMIASAKETIRIEREKTIHELKGEITGLAIASAAKIAGGKSDEERESQLFDQFLRE 156
>gi|118726894|ref|ZP_01575509.1| ATP synthase F0, B subunit [Clostridium cellulolyticum H10] >gi|118663709|gb|EAV70355.1| ATP synthase F0, B subunit [Clostridium cellulolyticum H10] (161 aa)
Score = 96, Expect = 3.0e-02, Identities = 35/154 (22%), Positives = 78/154 (50%)
  Q:    30 PNVYVLIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVND 183
           P+ Y  I   ++LI L L + +  +KP  + +E R   I++ ++ A+ A+LE+ +       ++   K    +++  A   A +   +I A A   A  I  +G  +++++  E+ K+   +++ LA+  A   + + +D E NK ++D  +++
  S:     4 PDGYTFIFVALNLIILFLFMRKFLFKPVTNLMEERKSSIEQGLKDADNAKLEATEARKKYDEQIKNIKLDGDKLLNEARARAAREYDEILASAKRDALAIVEKGREEVERERAEMLKQVKQQIAVLAISAATKVVQQNMDSETNKSLVDKFIDE 157
>gi|50123432|ref|YP_052599.1| F0F1 ATP synthase subunit B [Pectobacterium atrosepticum SCRI1043] >gi|49613958|emb|CAG77411.1| ATP synthase B chain [Erwinia carotovora subsp. atroseptica SCRI1043] (156 aa)
Score = 96, Expect = 3.1e-02, Identities = 34/150 (22%), Positives = 73/150 (48%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           ++   I+ +  +   ++  W P  + IE R KEI   + +AE+A+ +       +  +L ++K  A  IIE A     +   + +A A  + ++I ++  ++I+ +     +    +V+ LA+  A   + + +DE  N  I+D +V +L
  S:     7 ILGQAIAFVLFVWFCMKYVWPPMMAAIEKRQKEIADGLASAERAKKDLNLAQANATDQLKKAKADAQVIIEQANKRRAQILDEAKAEAEAERNKIVAQAQAEIEAERKRAREELRKQVAVLAIAGAEKIIERSVDEAANSDIVDKLVAEL 156
>gi|153809941|ref|ZP_01962609.1| hypothetical protein RUMOBE_00322 [Ruminococcus obeum ATCC 29174] >gi|149834119|gb|EDM89199.1| hypothetical protein RUMOBE_00322 [Ruminococcus obeum ATCC 29174] (167 aa)
Score = 96, Expect = 3.2e-02, Identities = 33/150 (22%), Positives = 76/150 (50%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
            IA + +L   + L+ R  +KP    +E R  +   +++ A KA+ E+E         + E+K  A +I+  A+  A    +++   A ++ + ++ +    I ++  +       E+  +A+E AG  + ++I+EE++ K+I+D + ++
  S:    14 FIATICNLFIQVYLIKRFLFKPVNEMLEKRRAKADAEIQDAVKAKEEAEVMKAEYEKNMQEAKEKANDIVLTAQKTAAVQSEEMLKEASSQVTAMKEKAEKDIAQERRKAVNEIKGEIGGMAVEIAGKVIEREINEEDHTKLINDFIENV 163
>gi|54310646|ref|YP_131666.1| F0F1 ATP synthase subunit B [Photobacterium profundum SS9] >gi|46915089|emb|CAG21864.1| Putative AtpF, ATP synthase F0, B subunit [Photobacterium profundum SS9] (156 aa)
Score = 95, Expect = 3.6e-02, Identities = 33/150 (22%), Positives = 73/150 (48%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           L+   I+  F +   ++  W P    IE R  +I   + AA++A  +       +  +L E+K+ A+E+IE A     +   + +A A  +  +I ++G ++I+ +          +V+ LA+  A   L + ID++ + ++++ +  +L
  S:     7 LLGQAIAFFFFVTFCMKYVWPPLMEAIEERQAKIADGLVAADRAAKDLNLAQANASEQLKEAKHAASELIEQANKRRAQIVDEAKAEAQAEREKILAQGLAEIESERNRARDELRKQVATLAVIGAEKILERSIDKDVHAELLNKVTAEL 156
>gi|113461836|ref|YP_719905.1| F0F1 ATP synthase subunit B [Haemophilus somnus 129PT] >gi|170718143|ref|YP_001785172.1| ATP synthase F0, B subunit [Haemophilus somnus 2336] >gi|112823879|gb|ABI25968.1| ATP synthase, F0 subunit B [Haemophilus somnus 129PT] >gi|168826272|gb|ACA31643.1| ATP synthase F0, B subunit [Haemophilus somnus 2336] (156 aa)
Score = 95, Expect = 3.7e-02, Identities = 35/150 (23%), Positives = 74/150 (49%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           LI  +I+    +   ++  W P    IE R + I   + +AE A+ E      +   ++ +++  A EI++ A     +  ++++  A     +I  +G+++I+ +   +++   ++V+ LA+  A   + + IDE  N  IID +V DL
  S:     7 LIGQLIAFAIFVWFCMKYVWPPIIKAIEERQRSIANALASAEAAKKEQSDTKVLVEQEINQARIKAQEIVDLANKRRNEILEEVKIEAEALREKIIEQGHAEIESERKRVQEELRIKVASLAIAGAEKIVGRNIDEAANNDIIDKLVADL 156
>gi|77918553|ref|YP_356368.1| F0F1-type ATP synthase, subunit B [Pelobacter carbinolicus DSM 2380] >gi|77920725|ref|YP_358540.1| F0F1-type ATP synthase, subunit B [Pelobacter carbinolicus DSM 2380] >gi|77544636|gb|ABA88198.1| F0F1-type ATP synthase, subunit B [Pelobacter carbinolicus DSM 2380] >gi|77546808|gb|ABA90370.1| F0F1-type ATP synthase, subunit B [Pelobacter carbinolicus DSM 2380] (191 aa)
Score = 95, Expect = 3.8e-02, Identities = 27/124 (21%), Positives = 59/124 (47%)
  Q:    56 PTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDD 179
           P K  + AR + +   +E A + Q  +E+     R +L ++    A++  + + ++    ++IE  A   A  I SE      ++     K+ + E  +LA+E A   L ++I  ++  +++D+
  S:    61 PLKRALSARRQRVAEALEQARQMQASAERRFAACRQQLADADAQIAQLTADLKAESALQCQRIEEQARKMADDIRSEATRSAAREIEAARKQLHQEAVRLAMELAEQRLKQQIAPQDQARLVDE 184
>gi|168823194|ref|ZP_02835194.1| hypothetical protein Salentericaenterica_27677 [Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537] (147 aa)
Score = 95, Expect = 3.9e-02, Identities = 34/147 (23%), Positives = 70/147 (47%)
  Q:    38 HVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
             I+ I  +   ++  W P  + IE R KEI   + +AE+A  + +     +  +L ++K  A  IIE A     +   + +  A  + ++I ++  ++I+ +     +    +V+ LA+  A   + + +DE  N  I+D +V +L
  S:     1 QAIAFILFVWFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKASATDQLKKAKAEAQVIIEQANKRRAQILDEAKTEAEQERTKIVAQAQAEIEAERKRAREELRKQVAILAVAGAEKIIERSVDEAANSDIVDKLVAEL 147
>gi|74318819|ref|YP_316559.1| F-type H+-transporting ATP synthase, subunit B [Thiobacillus denitrificans ATCC 25259] >gi|74058314|gb|AAZ98754.1| F-type H+-transporting ATP synthase, subunit B [Thiobacillus denitrificans ATCC 25259] (156 aa)
Score = 95, Expect = 4.0e-02, Identities = 31/150 (20%), Positives = 72/150 (48%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           LI   I+ IF +   ++  W P  + +E R K+I   + AA++ + E E     +   + ++K  AAE+I  AE  A +  ++ +  A  +  +  +   + I+++     +    +V+ LA+  A   L ++++ + +  ++  +  +L
  S:     7 LIGQSITFIFFVWFSMKFVWPPIMNALETRKKQIADGLAAADRGKHELELAAKKAGDNMRDAKAQAAEVIAQAEKRAAQIVEEAKLAAKEEGDRQLAAAQANIEQEANRAREGLREQVAALAVAGAEKILRREVNAQTHADLLSQLKAEL 156
>gi|93007155|ref|YP_581592.1| F0F1 ATP synthase subunit B [Psychrobacter cryohalolentis K5] >gi|92394833|gb|ABE76108.1| ATP synthase F0, B subunit [Psychrobacter cryohalolentis K5] (156 aa)
Score = 95, Expect = 4.0e-02, Identities = 33/150 (22%), Positives = 70/150 (46%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           LI   I+    ++  ++  W P    I  R ++I   + AAEKA+ +        + +L  +K  AA +IE A   A +  +  ++ A  +  +I  +  + I ++  +  +    +V++LA+  A   L  K+D +++  ++D +   L
  S:     7 LIGQAIAFAIFVMFCMKFVWPPLIGAINDRQRKIAEGLNAAEKAKADLATAERDVQQELDLAKTKAAALIEQANKSANQLVEDAKSQAQVEGERIRQQAQASIDQEINQARESLRAQVAELAVLGAEKILQDKVDVQKHASMLDQLAAKL 156
>gi|84393412|ref|ZP_00992169.1| ATP synthase subunit B [Vibrio splendidus 12B01] >gi|84375928|gb|EAP92818.1| ATP synthase subunit B [Vibrio splendidus 12B01] (154 aa)
Score = 95, Expect = 4.1e-02, Identities = 37/154 (24%), Positives = 72/154 (46%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLTAKL 188
           L+   I+    +   ++  W P    IE R K+I   + AAE+A  +       +  ++ E+K TA E+I+ A     +   +    A  +  +I ++  ++I+ +          +V+ LA+  A   L + ID    K + +D++N++TAKL
  S:     5 LLGQAIAFSLFVWFCMKYVWPPIMQAIEERQKKIADGLVAAERAAKDLNLAQANASEQMKEAKRTATEVIDQANKRKAQIIDEAREEAQAERQKILTQAEAEIEAERTRARDDLRKQVATLAIAGAEKILERTID----KDVHNDLLNNITAKL 154
>gi|73543032|ref|YP_297552.1| F0F1 ATP synthase subunit B [Ralstonia eutropha JMP134] >gi|72120445|gb|AAZ62708.1| ATP synthase F0, subunit B [Ralstonia eutropha JMP134] (156 aa)
Score = 95, Expect = 4.2e-02, Identities = 36/154 (23%), Positives = 77/154 (50%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLTAKL 188
             A ++    L  +V +  W P    ++ R K+I   + AAEK + E E         + E++   A+ + +AE  A+ T ++I+  A  +A++I ++  ++ ++Q     +    +V+ LA++ A   L +++    N ++  D++N L A+L
  S:     7 FFAQMVVFFILWWVVAKFIWPPLVKALDERAKKIADGLAAAEKGKAELELANKRVDQAMAEARTEGAQRVADAEKRAQLTAEEIKQNAQAEAARIIAQAKAEAEQQVTRARESLRDQVAVLAVKGAEQILKREV----NAQVHSDLLNQLKAEL 156
>gi|170077359|ref|YP_001733997.1| ATP synthase B chain (subunit I) [Synechococcus sp. PCC 7002] >gi|169885028|gb|ACA98741.1| ATP synthase B chain (Subunit I) [Synechococcus sp. PCC 7002] (175 aa)
Score = 95, Expect = 4.2e-02, Identities = 35/154 (22%), Positives = 79/154 (51%)
  Q:    31 NVYVLIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           N  +L  ++I+L  ++ ++     K   + +E R  +I   +E AE    ++++ L  ++  L +++  AA+I E+A++ AEKTK+ I A   ++  ++++    ++  ++ ++       V++LAL      L   +DE    K++D  +  L
  S:    18 NFDILETNIINLAIIIGVLYVYGSKFIGNILETRKSKIVADLEDAENRAKKAQEALTKAQKDLEQAQAQAAKIREDAKVAAEKTKQDILAKGRDEVEKLKASAVKELSTEQAKVITELKRRVAELALAKVEAQLRSDLDESAQAKLVDRSIAQL 171
>gi|23100434|ref|NP_693901.1| H(+)-transporting ATP synthase B chain [Oceanobacillus iheyensis HTE831] >gi|22778667|dbj|BAC14935.1| H(+)-transporting ATP synthase B chain [Oceanobacillus iheyensis HTE831] (175 aa)
Score = 95, Expect = 4.5e-02, Identities = 31/132 (23%), Positives = 73/132 (55%)
  Q:    53 AWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           AW P  S +E R   +  ++E+AE+++ E+EK    +  +L + K  A ++IE+A+    K ++ I   A  +A +I+    + I+ ++    +    +V+ L++  A   + K++ E++ +K+I++ + ++
  S:    40 AWGPLMSKMEERENYVANEIESAEQSRAEAEKASKDAAEQLNQVKAEAQKMIEDAKAAGAKQEQAIIDSAREEADRIKEAAQADIQNEKERAIQALQDKVASLSVLIASKVIEKELSEQDQEKLINEYIQEV 171
>gi|71066582|ref|YP_265309.1| F0F1 ATP synthase subunit B [Psychrobacter arcticus 273-4] >gi|71039567|gb|AAZ19875.1| ATP synthase Fo, B subunit [Psychrobacter arcticus 273-4] (156 aa)
Score = 95, Expect = 4.6e-02, Identities = 33/150 (22%), Positives = 70/150 (46%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           LI   I+    ++  ++  W P    I  R ++I   + AAEKA+ +        + +L  +K  AA +IE A   A +  +  ++ A  +  +I  +  + I ++  +  +    +V++LA+  A   L  K+D +++  ++D +   L
  S:     7 LIGQAIAFAIFVMFCMKFVWPPLIGAINDRQRKIAEGLNAAEKAKADLATAERDVQQELDLAKTKAAALIEQANKSANQLVEDAKSQAQVEGERIRQQAQAAIDQEINQARESLRAQVAELAVLGAEKILQDKVDVQKHASMLDQLAAKL 156
>gi|53721007|ref|YP_109993.1| F0F1 ATP synthase subunit B [Burkholderia pseudomallei K96243] >gi|67643087|ref|ZP_00441836.1| COG0711: F0F1-type ATP synthase, subunit b [Burkholderia mallei GB8 horse 4] >gi|52211421|emb|CAH37412.1| ATP synthase B chain [Burkholderia pseudomallei K96243] (146 aa)
Score = 94, Expect = 4.8e-02, Identities = 31/146 (21%), Positives = 77/146 (52%)
  Q:    39 VISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           ++  + L    ++  W P  + ++ R+K+I   + AAEK + E E        +L +++N   + I +AE  A     +I+  A  +A++I ++  ++ ++Q ++  +    EV+ LA++ A   L +++D+  + ++++ +  +L
  S:     1 MVVFLVLAWFTMKFVWPPLINALDERSKKIADGLAAAEKGKAELEAAHKRVDQELAQARNDGQQRIADAEKRALAVADEIKTNAQAEAARIIAQAKAEAEQQIVKARETLRGEVAALAVKGAEQILKREVDQTAHAELLNQLKAEL 146
>gi|108800843|ref|YP_641040.1| F0F1 ATP synthase subunit delta [Mycobacterium sp. MCS] >gi|119869983|ref|YP_939935.1| F0F1 ATP synthase subunit delta [Mycobacterium sp. KMS] >gi|126436441|ref|YP_001072132.1| F0F1 ATP synthase subunit delta [Mycobacterium sp. JLS] >gi|108771262|gb|ABG09984.1| ATP synthase F1, delta subunit [Mycobacterium sp. MCS] >gi|119696072|gb|ABL93145.1| ATP synthase F1, delta subunit [Mycobacterium sp. KMS] >gi|126236241|gb|ABN99641.1| ATP synthase F1, delta subunit [Mycobacterium sp. JLS] (443 aa)
Score = 94, Expect = 4.9e-02, Identities = 33/158 (20%), Positives = 80/158 (50%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIK--KQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKK-IIDDIVNDLTAKLESSS 192
            I  +I    ++ L++R    P +  + A+ + ++R++E +  A  +  +        + E+K  A  +++ A  DAEK  +++ A A  +  +I+ +G ++++  +Q+L  E R +L    +A   A   +   + +++N+   +D  +++L A   S +
  S:     4 FIGQLIGFAVIVFLLVRFVVPPVRRMMTAQQETVRRQLEESSTAANKVAQADQQHAKAVEEAKADARRVVDEARSDAEKIAEQMRAQADAEVERIKVQGQAQVQLLRQQLIRELRSHLGTESVA--RARELVRDHVSDDDNRSATVDRFLDELDAMAPSDA 162
>gi|59802443|ref|YP_209155.1| F0F1 ATP synthase subunit B [Neisseria gonorrhoeae FA 1090] >gi|194100107|ref|YP_002003247.1| AtpF [Neisseria gonorrhoeae NCCP11945] >gi|59719338|gb|AAW90743.1| putative ATP synthase B chain [Neisseria gonorrhoeae FA 1090] >gi|193935397|gb|ACF31221.1| AtpF [Neisseria gonorrhoeae NCCP11945] (156 aa)
Score = 94, Expect = 4.9e-02, Identities = 33/150 (22%), Positives = 76/150 (50%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           L A +I    L+   ++  W P    ++ R  +I   + AAE+ + + E+        L E +N  +E++ NAE  A K  ++ +  A ++A++I ++  + ++++     +    +V+ LA++ A   L  ++D  ++ K++D +  +L
  S:     7 LFAQIIVFFGLVWFTMKFVWPPIAKALDERAAKIAEGLAAAERGKSDFEQAEKKVAELLAEGRNQVSEMVANAEKRAAKIVEEAKEQASSEAARIAAQAKADVEQELFRARESLRDQVAVLAVKGAESILRSEVDASKHAKLLDTLKQEL 156
>gi|28202155|ref|NP_777396.1| ATP synthase CF0 B subunit [Anthoceros formosae] >gi|48474821|sp|Q85AL8|ATPF_ANTFO ATP synthase B chain (ATPase subunit I) >gi|27807857|dbj|BAC55332.1| ATPase I subunit [Anthoceros formosae] >gi|27807957|dbj|BAC55423.1| ATPase I subunit [Anthoceros formosae] (184 aa)
Score = 94, Expect = 4.9e-02, Identities = 36/148 (24%), Positives = 76/148 (51%)
  Q:    31 NVYVLIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIID 178
           N  +L  ++I+L  +L L++        + ++ R + I   +  AE+   E+   L  ++I+L +++  A EI  N   + EK K+ +  +A   + ++E    + I+ +E    ++   +VS+LALE A   L+  ++ E + ++ID
  S:    23 NTNLLETNLINLGVVLGLLVYFGKGVLNNLLDKRKQTILSTIRDAEERYKEATDKLKQAQIRLQQAELKANEIRVNGLSEMEKEKQDLINIADEDSKRLEDSKNATIRFEEQRAIEQVRQQVSRLALERASEVLNNCLNSELHSRMID 170
>gi|160881858|ref|YP_001560826.1| ATP synthase F0, B subunit [Clostridium phytofermentans ISDg] >gi|160430524|gb|ABX44087.1| ATP synthase F0, B subunit [Clostridium phytofermentans ISDg] (194 aa)
Score = 94, Expect = 5.1e-02, Identities = 37/164 (22%), Positives = 83/164 (50%)
  Q:    21 NSQIINQIFPNVYVLIAHV----ISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           ++ ++N+IF     L+  V    +++  L L++  L + P +  ++ R   I+ +M+++ K + E+ +       K+ E+     EI+      A K +  I   A  +AS+I      +I+  + +++     E+  +A   AG  ++  IDE + K++ID+ +N++
  S:    20 DTSLVNRIFGLDMQLVVDVAIMGLAIFVLFLILSYLLFNPARELLQKRQDRIKEEMDSSAKDKKEATQLKTNYEAKIKEASKEVDEILSEGRKKALKRENDIVDEAKVEASRIVDRANKEIELNKSKMKDEVKQEMIAVASVMAGKIIAGNIDETKQKQLIDEALNEM 187
>gi|194291170|ref|YP_002007077.1| membrane-bound ATP synthase, F0 sector, subunit b [Cupriavidus taiwanensis] >gi|193225005|emb|CAQ71016.1| membrane-bound ATP synthase, F0 sector, subunit b [Cupriavidus taiwanensis] (156 aa)
Score = 94, Expect = 5.3e-02, Identities = 36/154 (23%), Positives = 76/154 (49%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLTAKL 188
             A ++    L  +V +  W P    ++ R K+I   + AAEK + E E         + E++   A+ + +AE  A+ T  +I+  A  +A++I ++  ++ ++Q     +    +V+ LA++ A   L +++    N ++  D++N L A+L
  S:     7 FFAQMVVFFILWWVVAKFIWPPLVKALDERAKKIADGLAAAEKGKAELELANKRVDQAMAEARTEGAQRVADAEKRAQLTADEIKQNAQAEAARIIAQAKAEAEQQATRAREALRDQVAVLAVKGAEQILKREV----NAQVHADLLNQLKAEL 156
>gi|124302891|ref|YP_001023686.1| ATP synthase CF0 subunit I [Angiopteris evecta] >gi|110628289|gb|ABG79585.1| ATP synthase CF0 subunit I [Angiopteris evecta] (187 aa)
Score = 94, Expect = 5.3e-02, Identities = 36/134 (26%), Positives = 71/134 (52%)
  Q:    61 IEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLTAKLESSSKE 194
           +E R + I   +  AE+   E+ + L+ +R +L ++K  A EI  N     E+ K+ +   A   + ++E    S I+ +E    ++   +VS+LALE A   L+ +++ E + ++ID  +  L A +ES++ +
  S:    53 LENRKQTILSTIHDAEERYEEATEKLNQARTRLQQAKVKADEIRVNGLTQMEREKQDLINAADEDSRRLEDSKNSTIRFEEQRAIEQVRQQVSRLALERALESLNTRLNNELHSRMIDYHIGLLRA-MESTTDQ 185
>gi|108760214|ref|YP_628675.1| ATP synthase F0, B subunit [Myxococcus xanthus DK 1622] >gi|108464094|gb|ABF89279.1| ATP synthase F0, B subunit [Myxococcus xanthus DK 1622] (172 aa)
Score = 94, Expect = 5.4e-02, Identities = 34/140 (24%), Positives = 74/140 (52%)
  Q:    53 AWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLTAKLESSS 192
           AW P  S +E R K+I   +E+A++ + E+EK L   +  + E++  AAE++     + EK ++++ A +  +A +++     +I +Q+ +           LA+E AG  +S+++D+ + + + +  V  L     S++
  S:    26 AWGPILSLVEEREKQIASSIESAKRERAEAEKLLADQKTAIAEARREAAEMMRRNTQEMEKFREELMAKSRKEAEELKLSARREIDEQKAKAIAEVRSMAVDLAMEVAGKLISERMDDSKQRALAEQFVQGLPLNSTSAT 165
>gi|116750012|ref|YP_846699.1| H+-transporting two-sector ATPase, B/B' subunit [Syntrophobacter fumaroxidans MPOB] >gi|116699076|gb|ABK18264.1| H+-transporting two-sector ATPase, B/B' subunit [Syntrophobacter fumaroxidans MPOB] (203 aa)
Score = 94, Expect = 5.7e-02, Identities = 31/147 (21%), Positives = 69/147 (46%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIV 181
            +A  +  +    ++ +L  KP   +  +R  EIQR +   E  Q E+E+N    + KL   +    +I++    + E  ++KI   A  +A  +  +    I+++     ++  LE+S+L++  A   L K +  ++  +++ D +
  S:    50 FLARTLVFVITFSILFKLLKKPIAGFFSSRKAEIQRLLSELELKQKEAEQNHAECKAKLAALEVETKKIVDELIAEGEVERQKIIEAAEKQADYLRQQADVAIQQEIKAAREKLKLEISELSVAAAEEILRKNMKAKDQDRLVRDFM 196
>gi|90581147|ref|ZP_01236946.1| ATP synthase subunit B [Vibrio angustum S14] >gi|90437668|gb|EAS62860.1| ATP synthase subunit B [Vibrio angustum S14] (156 aa)
Score = 93, Expect = 6.1e-02, Identities = 32/150 (21%), Positives = 70/150 (46%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           L+   I+    ++  ++  W P    IE R K+I   + AA++A  + +     +  +L E+K  A+E+IE A     +   + +  A  +  +I ++G ++I+ +          +V+ LA+  A   + + ID +    I++ +  +L
  S:     7 LLGQAIAFFLFVVFCMKYVWPPIMEAIEERQKKIADGLAAADRAAKDLDLAQANASDQLKEAKRAASELIEQANKRKAQIIDEAKTEAQTEREKILAQGMAEIEAERNRARDELRKQVATLAVIGAEKIIERSIDVDAQADILNKVTAEL 156
>gi|113869577|ref|YP_728066.1| F0F1 ATP synthase subunit B [Ralstonia eutropha H16] >gi|113528353|emb|CAJ94698.1| Membrane-bound ATP synthase, F0 sector,subunitb [Ralstonia eutropha H16] (156 aa)
Score = 93, Expect = 6.2e-02, Identities = 36/154 (23%), Positives = 76/154 (49%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLTAKL 188
             A ++    L  +V +  W P    ++ R K+I   + AAEK + E E         + E++   A+ + +AE  A+ T  +I+  A  +A++I ++  ++ ++Q     +    +V+ LA++ A   L +++    N ++  D++N L A+L
  S:     7 FFAQMVVFFILWWVVAKFIWPPLVKALDERAKKIADGLAAAEKGKAELELANKRVDQAMAEARTEGAQRVADAEKRAQLTADEIKQNAQAEAARIIAQAKAEAEQQVTRAREALRDQVAVLAVKGAEQILKREV----NAQVHTDLLNQLKAEL 156
>gi|126647162|ref|ZP_01719672.1| ATP synthase F0, subunit B [Algoriphagus sp. PR1] >gi|126577210|gb|EAZ81458.1| ATP synthase F0, subunit B [Algoriphagus sp. PR1] (164 aa)
Score = 93, Expect = 6.2e-02, Identities = 37/160 (23%), Positives = 78/160 (48%)
  Q:    25 INQIFPNVYVLIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKI-DEEENKKIIDDIVNDL 184
           ++ I P+  ++I  ++  + LL ++I+ AWKP  + +E R   I+  ++AAE A+ E       +   L E++     I++ A   + K  ++ +  A+   +Q+       I+ ++         +V+ L LE     L K + D++  K ++D+ + DL
  S:     1 MDLITPSSGLIIWQLLGFLALLFILIKFAWKPMLAALEERESSIENALKAAETARNEMANLKAENEKLLAEARAERDTILKKAHDASNKMIEEAKEEAVKTGAQMIENAKEVIETEKKAALADVKTQVATLTLEVTEKLLRKNLSDDKSQKTLVDEFIKDL 161
>gi|94312429|ref|YP_585639.1| F0F1 ATP synthase subunit B [Ralstonia metallidurans CH34] >gi|93356281|gb|ABF10370.1| ATP synthase F0, B subunit [Ralstonia metallidurans CH34] (156 aa)
Score = 93, Expect = 6.5e-02, Identities = 36/154 (23%), Positives = 76/154 (49%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLTAKL 188
             A ++    L  +V +  W P    ++ R K+I   + AAEK + E E         + E++   A+ + +AE  A+ T  +I+  A  +A++I ++  ++ ++Q     +    +V+ LA++ A   L +++    N ++  D++N L A+L
  S:     7 FFAQMVVFFILWWVVAKFIWPPLVKALDERAKKIADGLAAAEKGKAELELANKRVDQAMAEARTEGAQRVADAEKRAQLTADEIKQNAQAEAARIIAQAKAEAEQQVTRARESLRDQVAVLAVKGAEQILKREV----NAQVHADLLNQLKAEL 156
>gi|15677768|ref|NP_274932.1| F0F1 ATP synthase subunit B [Neisseria meningitidis MC58] >gi|15793513|ref|NP_283335.1| F0F1 ATP synthase subunit B [Neisseria meningitidis Z2491] >gi|121635594|ref|YP_975839.1| F0F1 ATP synthase subunit B [Neisseria meningitidis FAM18] >gi|161869275|ref|YP_001598442.1| F0F1 ATP synthase subunit B [Neisseria meningitidis 053442] >gi|7227196|gb|AAF42267.1| ATP synthase F0, B subunit [Neisseria meningitidis MC58] >gi|120867300|emb|CAM11071.1| ATP synthase B chain [Neisseria meningitidis FAM18] >gi|121051499|emb|CAM07792.1| ATP synthase B chain [Neisseria meningitidis Z2491] >gi|161594828|gb|ABX72488.1| ATP synthase B chain [Neisseria meningitidis 053442] (156 aa)
Score = 93, Expect = 6.5e-02, Identities = 32/150 (21%), Positives = 76/150 (50%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           L A +I    L+   ++  W P    ++ R  ++   + AAE+ + + E+        L E +N  +E++ NAE  A K  ++ +  A ++A++I ++  + ++++     +    +V+ LA++ A   L  ++D  ++ K++D +  +L
  S:     7 LFAQIIVFFGLVWFTMKFVWPPIAKALDERAAKVAEGLAAAERGKSDFEQAEKKVAELLAEGRNQVSEMVANAEKRAAKIVEEAKEQASSEAARIAAQAKADVEQELFRARESLREQVAVLAVKGAESILRSEVDASKHAKLLDTLKQEL 156
>gi|11467682|ref|NP_050734.1| ATP synthase CF0 B chain [Guillardia theta] >gi|5915731|sp|O78477|ATPF_GUITH ATP synthase B chain (ATPase subunit I) >gi|3603007|gb|AAC35668.1| ATP synthase CF0 subunit I [Guillardia theta] (182 aa)
Score = 93, Expect = 6.7e-02, Identities = 37/158 (23%), Positives = 78/158 (49%)
  Q:    31 NVYVLIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLTAKL 188
           N  +L A+V+++  LL  VI L      S +E+R +++   ++ AE+   ++   L  +  +L +++    +I + AE  A   K+ I A       ++ + G S I+K EL+++K+    ++ LA++     +   + +    K+ID  +  L  K+
  S:    25 NPNILEANVLNIAILLSGVIYLGRNFLTSALESRQQKVTEAIQEAEERLQQANVKLLDAEKQLTQAQTVIEQIKKEAEKTARTVKETILAQGKLDIERLTNNGKSSIEKAELQIKKQIQQHITDLAIKKVSAQMETFMTDNLQVKVIDTNIASLGGKI 182
>gi|121999212|ref|YP_001003999.1| F0F1 ATP synthase subunit B [Halorhodospira halophila SL1] >gi|121590617|gb|ABM63197.1| ATP synthase F0, B subunit [Halorhodospira halophila SL1] (146 aa)
Score = 93, Expect = 6.8e-02, Identities = 29/146 (19%), Positives = 70/146 (47%)
  Q:    39 VISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           +IS    +   ++  W P +  +  R K+I   + A E+ + E +K        L +++  A++II  A     +  ++  A A ++A +I +    +I ++     +    +VS +A++ +   L +++D + +K +ID++   +
  S:     1 MISFALFVWFTMKFVWPPIQQALADRQKQIADGLAAGERGKEELDKAQAEVEAMLRDAREQASQIINQANKRQAEMIEEARAEARSEADRILASAREEIDQEIQRAREDLRKQVSTIAVQASSQILKREVDAKAHKDLIDELATQI 146
>gi|158806|gb|AAA29020.1| Wnt protein (1004 aa)
Score = 93, Expect = 7.1e-02, Identities = 45/146 (30%), Positives = 74/146 (50%)
  Q:    50 IRLAWKPTKSYIEARTKE-------IQRKMEAAEKAQLESEK----NLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEE----NKKIIDDIVNDLTAKLESSSKEK 195
           +  A+K    +I++R KE       ++RK E   K ++ S+     N+ I R K +++KN  + ++ N        +K  EA    + S I +E +    +  LELE+R   E+           L+ KIDEEE     +KI  +IVN    K E   ++K
  S:   665 LEFAYKFATDFIDSREKETNRETRGVKRKREEINKNRMHSDDTNAFNIGIKRNKNVDAKNDTSLVVRN-------VRKSTEA----ENSHILNENFD---QHLLELEQRITKEI-----------LTSKIDEEEMIKLQEKIKQEIVNTKFFKGEQQPRKK 800
>gi|89095626|ref|ZP_01168520.1| F0F1-type ATP synthaseB chain [Bacillus sp. NRRL B-14911] >gi|89089372|gb|EAR68479.1| F0F1-type ATP synthaseB chain [Bacillus sp. NRRL B-14911] (177 aa)
Score = 93, Expect = 7.7e-02, Identities = 34/142 (23%), Positives = 76/142 (53%)
  Q:    42 LIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVND 183
            I LL L+ + AW P    ++ R + I  ++ AAE++++E+ K L   R  L E++  A  +IE A+   +  +++I A A  +A +++     +I +Q+ +       +V+ L++  A   + K++   + +K+I++ + +
  S:    31 FIILLALLKKFAWGPLMGIMKQREEHIANEIGAAEQSRVEANKLLEEQRSLLKEARTDAQNLIEGAKKQGDVQREEIIAAARAEAERVKESAKLEIDQQKEKAVAAIREQVASLSVLIASKVIEKELSAADQEKLINEYIQE 172
>gi|10039448|dbj|BAB13356.1| H+-ATPase b subunit [Brevibacterium flavum] (188 aa)
Score = 93, Expect = 7.9e-02, Identities = 34/157 (21%), Positives = 77/157 (49%)
  Q:    28 IFPNVYVLIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKI-DEEENKKIIDDIVNDL 184
           +FP +Y ++  +I  + +L++  +L     +  +  R   I+  ++ AE AQ+E++  L     +L E++  AAEI E A    ++ + +++  A  ++++I   G  ++  Q  ++      E+ + ++  A   L  ++ D  +    ID  + DL
  S:    23 LFPPLYDIVWSLIPFLIILIVFWKLVLPKFQEVLTEREDRIKGGIQRAEAAQVEAKAALEKYNAQLAEARTEAAEIREQARERGKQIEAELKDKANEESNRIIESGSKQLLAQREQVVNELRREMGQNSINLAEHLLGDQLSDNVKRSGTIDRFLADL 180
>gi|149188275|ref|ZP_01866569.1| hypothetical ATP synthase B chain [Vibrio shilonii AK1] >gi|148837864|gb|EDL54807.1| hypothetical ATP synthase B chain [Vibrio shilonii AK1] (156 aa)
Score = 92, Expect = 8.3e-02, Identities = 27/150 (18%), Positives = 76/150 (50%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           ++   IS +  + L ++  W P  + ++ R  EI   ++    A  E E         + E++  A  IIE  +    +  ++   +A  + ++I +EG ++++ ++ ++ +    E++ L +E+A   + K +D + N+++++ +++++
  S:     7 MLGQAISFVIFVWLCMKYVWPPLVTLLDERRDEIATGIKNTAAAAKELELAKANGESIVAEAREKAQSIIELGQQRQNQLVEEAAELAQKEKAKIIAEGKAEVESEKSKVRQELKSEMADLVIESASKLIRKNLDSKSNRELVEHMISEM 156
>gi|119715994|ref|YP_922959.1| ATP synthase F0, B subunit [Nocardioides sp. JS614] >gi|119536655|gb|ABL81272.1| ATP synthase F0, B subunit [Nocardioides sp. JS614] (189 aa)
Score = 92, Expect = 8.3e-02, Identities = 35/160 (21%), Positives = 74/160 (46%)
  Q:    25 INQIFPNVYVLIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKI-DEEENKKIIDDIVNDL 184
           +N + P+   ++  ++    LL  V +      +     RT+ I+  + AAE  Q E++  L     +L E+++ AA I E A     +   ++   A   A++I   G ++I+ +  +       EV  LA   AG  + + + D++ + ++++  + DL
  S:    15 LNPLLPHAIEIVLSLVVFGLLLFAVWKFVTPRFEQIYTERTQAIEGGLAAAETKQAEADAKLADLEQQLSEARHEAARIREEAREQGAQIIAEMREQAQADAARIVEHGKTQIEAERQQAVTSLRAEVGTLATSLAGRIVGESLEDDDRSARVVERFLADL 175
>gi|34501430|ref|NP_904217.1| ATP synthase CF0 B subunit [Physcomitrella patens subsp. patens] >gi|34494800|dbj|BAC85067.1| ATP synthase I subunit [Physcomitrella patens subsp. patens] (184 aa)
Score = 92, Expect = 8.4e-02, Identities = 42/162 (25%), Positives = 84/162 (51%)
  Q:    31 NVYVLIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLTAKLESSS 192
           N  +L  ++I+L  ++ L++        + +  R + I   ++ AE+   E+   L+ +R +L  +K  A EI  N     E+ KK++   A   + ++E    + I+ +E    ++   +VS+LALE A   L+K+++ E + ++ID  +  L A +ES+S
  S:    23 NTNLLETNLINLSVVVGLLVYFGKGVLNNLLSNRKQTILSTIKDAEERYNEATDKLNQARERLERAKVKADEIRVNGLSQIEREKKELINAADEDSKRLEDSKNATIRFEEQRAIEQVRQQVSRLALERALEALNKRLNSELHSRVIDYHIGLLRA-MESTS 183
>gi|170782293|ref|YP_001710626.1| ATP synthase B chain [Clavibacter michiganensis subsp. sepedonicus] >gi|169156862|emb|CAQ02030.1| ATP synthase B chain [Clavibacter michiganensis subsp. sepedonicus] (181 aa)
Score = 92, Expect = 8.5e-02, Identities = 40/159 (25%), Positives = 80/159 (50%)
  Q:    28 IFPNVYVLIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETA-GIFLSKKIDEEENKKIIDDIVNDLTA 186
           + P VY ++   +  + LL+++ + A     + ++ RT+ I   +E AE+AQ E++        +L+E++  A  I E A +DA     +I+  A   A++I + G  +I+ +  +       EV  LA++ A G+      D++ +  ++D  + DL A
  S:    11 LLPAVYDIVWSAVVFVVLLVVIWKYALPRVYAMLDGRTEAIAGGIEKAERAQAEADAAKAELTAQLVEARAEAGRIREQARVDASVIAAEIKEQATADAARITASGTQQIEAERQQAVVSLRSEVGSLAIDLASGVIGQSLADDQRSTALVDRFLADLEA 170
>gi|17136810|ref|NP_476924.1| Wnt oncogene analog 5 CG6407-PA [Drosophila melanogaster] >gi|44888995|sp|P28466|WNT5_DROME Protein Wnt-5 precursor (dWnt-5) (dWnt-3) >gi|7293478|gb|AAF48853.1| CG6407-PA [Drosophila melanogaster] >gi|33636577|gb|AAQ23586.1| RE25179p [Drosophila melanogaster] (1004 aa)
Score = 92, Expect = 8.8e-02, Identities = 45/146 (30%), Positives = 74/146 (50%)
  Q:    50 IRLAWKPTKSYIEARTKE-------IQRKMEAAEKAQLESEK----NLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEE----NKKIIDDIVNDLTAKLESSSKEK 195
           +  A+K    +I++R KE       ++RK E   K ++ S+     N+ I R K +++KN  + ++ N        +K  EA    + S I +E +    +  LELE+R   E+           L+ KIDEEE     +KI  +IVN    K E   ++K
  S:   665 LEFAYKFATDFIDSREKETNRETRGVKRKREEINKNRMHSDDTNAFNIGIKRNKNVDAKNDTSLVVRN-------VRKSTEA----ENSHILNENFD---QHLLELEQRITKEI-----------LTSKIDEEEMIKLQEKIKQEIVNTKFFKGEQQPRKK 800
>gi|146284506|ref|YP_001174659.1| ATP synthase B chain [Pseudomonas stutzeri A1501] >gi|145572711|gb|ABP81817.1| ATP synthase B chain [Pseudomonas stutzeri A1501] (156 aa)
Score = 92, Expect = 9.4e-02, Identities = 31/150 (20%), Positives = 72/150 (48%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           L    ++    +   ++L W P  + + AR K+I   ++AA +AQ + +         L E+K  AA+IIE A   A    ++ +  A  +  ++ +   ++I+++      +   +V+ LA+  A   L  ++D + + ++++ + + L
  S:     7 LFGQTLAFAIFVWFCMKLVWPPITAAMAARQKKIAEGLDAAGRAQQDLKLAQDKVSHTLRETKEQAAQIIEQANKHANAIIEEAKQQARVEGERLVAGARAEIEQEVNRARDQLRSQVAALAVAGAEKILESQVDAKVHNELVEKLASQL 156
>gi|160902215|ref|YP_001567796.1| ATP synthase F0, B subunit [Petrotoga mobilis SJ95] >gi|160359859|gb|ABX31473.1| ATP synthase F0, B subunit [Petrotoga mobilis SJ95] (163 aa)
Score = 92, Expect = 9.4e-02, Identities = 34/154 (22%), Positives = 75/154 (48%)
  Q:    36 IAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLTAKLE 189
           I +++  +  + L+ RL +KP     + R KE+++ +  AEK +LE++        +L E+     EI+  A+  A+   K  +  A  +   I  +   + ++ +    +     +  LA+  + + L ++ID+++N+++I   +N L  K E
  S:     9 IVNLVGFLAFMFLMYRLLYKPYFDMTDKRKKEVEKNLNEAEKLRLEAQLKKEELDKQLSEADEKRREILSEADEQAKSIIKAAQGEAQEQRKFILDKAEKEAEEIKESAARELQSRIVSLAVTISSMILKEQIDKKKNEELIRRAINSLKDKGE 162
>gi|145588211|ref|YP_001154808.1| ATP synthase F0, B subunit [Polynucleobacter sp. QLW-P1DMWA-1] >gi|145046617|gb|ABP33244.1| ATP synthase F0, B subunit [Polynucleobacter sp. QLW-P1DMWA-1] (156 aa)
Score = 92, Expect = 9.6e-02, Identities = 32/150 (21%), Positives = 72/150 (48%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           L A +I    L  +V R  W P    ++ R+ +I   + AAE+ +       + +  +L +++    + +  AE  A+ +  +I A A  +A++I ++      +Q     +    EV+ LA++ A   L +++D + + +++D +  +L
  S:     7 LFAQMIVFFVLWWVVARFVWPPLVKALDERSSKIADGLAAAERGKEALALASNEAEQELTKARQEGVQRVAEAEKRAQMSADEIRANAQAEAARIITQAKQDADQQVTSAREVLRAEVAVLAVKGAEQILRREVDAKAHGQLLDQLKAEL 156
>gi|71909719|ref|YP_287306.1| ATP synthase F0, subunit B [Dechloromonas aromatica RCB] >gi|71849340|gb|AAZ48836.1| ATP synthase F0, subunit B [Dechloromonas aromatica RCB] (156 aa)
Score = 92, Expect = 9.9e-02, Identities = 32/150 (21%), Positives = 72/150 (48%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           LI   I     + + ++  W P +  +  R  +I   + AAE+ + E E     S   L E+K  +A+ +  AE  A++  ++ +  A  +A ++ +   ++I+++    +++    V++LA+  A   L K+I+   +  ++  +  DL
  S:     7 LIGQAIWFALFIWITMKYVWPPLQKAMADRQAQIAEGLAAAERGKHEQELAAKRSADALREAKEKSADFVAQAEKRAQQIVEEAKGTAKIEADKVVAGAKAEIEQEVERAKQQLRERVAELAVAGAEKILRKEINASAHADMLAALKQDL 156
>gi|187603979|ref|ZP_02990190.1| ATP synthase F0, B subunit [Exiguobacterium sp. AT1b] >gi|187484041|gb|EDU22034.1| ATP synthase F0, B subunit [Exiguobacterium sp. AT1b] (175 aa)
Score = 92, Expect = 1.0e-01, Identities = 32/141 (22%), Positives = 68/141 (48%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKK 175
           +I  + + + LL L+ + AW P    +  R + +  ++E AEK++ ++E  +   R  L  ++  + E+++ +   AE  + ++   A  +A QI+ E    I+++    ++    EV   AL  A   L   +  +E K+
  S:    20 MIFTIFTFLVLLALLKKFAWGPLLGMMRQREEYVANEIELAEKSRKDAEHYVVEQRDALSAARTESKEMLDASRRQAEAEQARLVEQARLEAEQIKIEAEKAIERERELAKQSLQTEVVTQALSAARHVLQSDLKGDEAKQ 160
>gi|7907|emb|CAA46002.1| DWnt-3 [Drosophila melanogaster] (1010 aa)
Score = 92, Expect = 1.0e-01, Identities = 45/146 (30%), Positives = 74/146 (50%)
  Q:    50 IRLAWKPTKSYIEARTKE-------IQRKMEAAEKAQLESEK----NLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEE----NKKIIDDIVNDLTAKLESSSKEK 195
           +  A+K    +I++R KE       ++RK E   K ++ S+     N+ I R K +++KN  + ++ N        +K  EA    + S I +E +    +  LELE+R   E+           L+ KIDEEE     +KI  +IVN    K E   ++K
  S:   671 LEFAYKFATDFIDSREKETNRETRGVKRKREEINKNRMHSDDTNAFNIGIKRNKNVDAKNDTSLVVRN-------VRKSTEA----ENSHILNENFD---QHLLELEQRITKEI-----------LTSKIDEEEMIKLQEKIKQEIVNTKFFKGEQQPRKK 806
>gi|42518861|ref|NP_964791.1| F0F1 ATP synthase subunit B [Lactobacillus johnsonii NCC 533] >gi|41583147|gb|AAS08757.1| ATP synthase B chain [Lactobacillus johnsonii NCC 533] (166 aa)
Score = 92, Expect = 1.0e-01, Identities = 31/136 (22%), Positives = 63/136 (46%)
  Q:    49 VIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           V   AW P    +E R +++   ++ AE  + ++E   +     L +SK  A +I+  A+ +AEKTK  I + A  +A+ I         + + +       +V+ +++  A   +SK +   + K ++D  +  L
  S:    29 VKHFAWGPVTKMMEERRQKVISDLDQAESDRKKAELLANQREAALKDSKQEATQILSTAKSNAEKTKNNIISQADQEAAAIRKRASEDAAQAKTDALNEARDQVADISVAIAEKVISKNLSAADQKDLVDQFIKGL 164
>gi|194892510|ref|XP_001977675.1| GG18113 [Drosophila erecta] >gi|190649324|gb|EDV46602.1| GG18113 [Drosophila erecta] (999 aa)
Score = 91, Expect = 1.1e-01, Identities = 45/146 (30%), Positives = 74/146 (50%)
  Q:    50 IRLAWKPTKSYIEARTKE-------IQRKMEAAEKAQLESEK----NLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEE----NKKIIDDIVNDLTAKLESSSKEK 195
           +  A+K    +I++R KE       ++RK E   K ++ S+     N+ I R K +++KN  + ++ N        +K  EA    + S I +E +    +  LELE+R   E+           L+ KIDEEE     +KI  +IVN    K E   ++K
  S:   660 LEFAYKFATDFIDSREKEANRETRGVKRKREEINKNRMHSDDTNAFNIGIKRNKNVDAKNDTSLVVRN-------VRKSTEA----ENSHILNENFD---QHLLELEQRITKEI-----------LTSKIDEEEMIKLQEKIKQEIVNTKFFKGEQQPRKK 795
>gi|77455278|gb|ABA86448.1| CG6407 [Drosophila melanogaster] (996 aa)
Score = 91, Expect = 1.1e-01, Identities = 45/146 (30%), Positives = 74/146 (50%)
  Q:    50 IRLAWKPTKSYIEARTKE-------IQRKMEAAEKAQLESEK----NLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEE----NKKIIDDIVNDLTAKLESSSKEK 195
           +  A+K    +I++R KE       ++RK E   K ++ S+     N+ I R K +++KN  + ++ N        +K  EA    + S I +E +    +  LELE+R   E+           L+ KIDEEE     +KI  +IVN    K E   ++K
  S:   664 LEFAYKFATDFIDSREKETNRETRGVKRKREEINKNRMHSDDTNAFNIGIKRNKNVDAKNDTSLVVRN-------VRKSTEA----ENSHILNENFD---QHLLELEQRITKEI-----------LTSKIDEEEMIKLQEKIKQEIVNTKFFKGEQQPRKK 799
>gi|15616634|ref|NP_239846.1| F0F1 ATP synthase subunit B [Buchnera aphidicola str. APS (Acyrthosiphon pisum)] >gi|11131206|sp|P57120|ATPF_BUCAI ATP synthase B chain >gi|25290590|pir||D84930 H+-transporting two-sector ATPase (EC 3.6.3.14) B chain [imported] - Buchnera sp. (strain APS) >gi|10038697|dbj|BAB12732.1| ATP synthase B chain [Buchnera aphidicola str. APS (Acyrthosiphon pisum)] (161 aa)
Score = 91, Expect = 1.2e-01, Identities = 37/151 (24%), Positives = 75/151 (49%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLE---SEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLT 185
           ++   IS +  +   ++  W P    IE R KEI+  +  A+KA+ E    EK +H +   ++++K  A+ I+ +A        +     AL ++ +I     S+I        K  + EV  L++  A   + K I +++N++++D++V  L+
  S:     7 ILGQAISFVLFVWFCMKYIWPPIILAIETRQKEIKESLTNAKKARDELYILEKKIHQN---IIDAKQKASNILNSANKQKVSILEDARNQALEESKKIILNTQSEINIAITHARKNLHKEVVDLSISMAEKIIKKNISKDDNQELLDELVTSLS 157
>gi|154249026|ref|YP_001409851.1| ATP synthase F0, B subunit [Fervidobacterium nodosum Rt17-B1] >gi|154152962|gb|ABS60194.1| ATP synthase F0, B subunit [Fervidobacterium nodosum Rt17-B1] (161 aa)
Score = 91, Expect = 1.2e-01, Identities = 34/148 (22%), Positives = 81/148 (54%)
  Q:    36 IAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVND 183
           +  +++ +FLL ++ +L +KP    +E R ++I+ ++  AEK + ++E+    +  +L  ++  A +II +A  ++EK  ++ +  A  +A +I    Y +I+KQ+ E   +     ++LA+  A   L   +DE+  ++ +  ++ +
  S:    11 VVQLLNFLFLLWILNKLLYKPFLGMMEKRKEKIEGEIVEAEKLRKQAEEIKKNAEEELKNARIRAEQIIASANSESEKIVEEAKQKAQKEAEKILQNAYLEIEKQKQEALAQVQTIATELAINLAMKVLKGTLDEKAKREYLAKVIKE 158
>gi|77455288|gb|ABA86453.1| CG6407 [Drosophila erecta] (984 aa)
Score = 91, Expect = 1.2e-01, Identities = 45/146 (30%), Positives = 74/146 (50%)
  Q:    50 IRLAWKPTKSYIEARTKE-------IQRKMEAAEKAQLESEK----NLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEE----NKKIIDDIVNDLTAKLESSSKEK 195
           +  A+K    +I++R KE       ++RK E   K ++ S+     N+ I R K +++KN  + ++ N        +K  EA    + S I +E +    +  LELE+R   E+           L+ KIDEEE     +KI  +IVN    K E   ++K
  S:   652 LEFAYKFATDFIDSREKEANRETRGVKRKREEINKNRMHSDDTNAFNIGIKRNKNVDAKNDTSLVVRN-------VRKSTEA----ENSHILNENFD---QHLLELEQRITKEI-----------LTSKIDEEEMIKLQEKIKQEIVNTKFFKGEQQPRKK 787
>gi|83856031|ref|ZP_00949560.1| ATP synthase F0, subunit B [Croceibacter atlanticus HTCC2559] >gi|83849831|gb|EAP87699.1| ATP synthase F0, subunit B [Croceibacter atlanticus HTCC2559] (164 aa)
Score = 91, Expect = 1.3e-01, Identities = 36/156 (23%), Positives = 76/156 (48%)
  Q:    30 PNVYVLIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKI-DEEENKKIIDDIVNDLT 185
           P   +++  VI+ + L  L+ + AWKP    +  R   I+  +++AE A+ E E     +   L E++     II+ A    +K        A  KA QI  +  + I  ++         +V+ L+++ A   + +++ ++E+  K+++D++ D+T
  S:     6 PGFGLVVWTVITFLILFFLLKKFAWKPILGAVHDRETSIKSALDSAEAARREMENLQADNERILQEARTERDSIIKEARSMKDKMIADASDEAQAKADQIIKQAQAAILSEKQAAIADIKNQVANLSIDIAEKVVREELSNKEKQAKLVEDMLGDVT 162
>gi|149375660|ref|ZP_01893429.1| F0F1-type ATP synthase, subunit b [Marinobacter algicola DG893] >gi|149360062|gb|EDM48517.1| F0F1-type ATP synthase, subunit b [Marinobacter algicola DG893] (150 aa)
Score = 91, Expect = 1.3e-01, Identities = 29/150 (19%), Positives = 72/150 (48%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           +I   I+    ++  ++  W P  + ++ R K+I   + A+++A  + E     S  +L E+K  AA +IE A   A +  +  +  A  +  ++  +  ++I+++  +       E++ +A+  A   L   +D  ++ +++D +  +L
  S:     1 MIGQAIAFFIFVVFCMKYVWPPIMAALQERQKKIADGLAASDRAARDLELAQEKSAKELREAKQQAAGLIEQANKRAAQIVEASKDDARKEGQKLIEQAKAEIEQERNQARDALRAEIAAIAVAGAEKILETSVDANKHSEMLDKLAAEL 150
>gi|91203669|emb|CAJ71322.1| conserved hypothetical protein [Candidatus Kuenenia stuttgartiensis] (246 aa)
Score = 91, Expect = 1.4e-01, Identities = 36/154 (23%), Positives = 79/154 (51%)
  Q:    31 NVYVLIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           N++ L+  +I+ + LL ++ R+ +KP +  IE R   I + +E AEK + E+ +    ++ +L + K    +++E    +A K + K+   A  +A++I  +  + I  +++ +E    LE+    LE   +F S  + +  ++++   I   L
  S:     4 NIWTLLFQIINFVVLLYILRRILYKPIREIIEKRRGLIAKTVEDAEKTKKEALELKEKNQKELNKVKELQNQMLEQTREEALKDRSKLLDEANKEAAKINEKEKALIDAEKIRIE----LELKNKTLEMVSVFASNLLKDISDEELHRSIFRKL 153
>gi|114777379|ref|ZP_01452376.1| F0F1-type ATP synthase, subunit b [Mariprofundus ferrooxydans PV-1] >gi|114552161|gb|EAU54663.1| F0F1-type ATP synthase, subunit b [Mariprofundus ferrooxydans PV-1] (160 aa)
Score = 90, Expect = 1.4e-01, Identities = 35/149 (23%), Positives = 74/149 (49%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVND 183
            IA +I  I +++++ +L + P    +EARTK+I+  + AAE           +   +L E+K+ A EII  AE  A +  ++    +  +A QI      ++  +     +    E++ +A++ A   +  ++D + + K+I+ I+ +
  S:     7 FIAQIIVFILMVVVLWKLLYAPLNEAMEARTKKIESGLAAAEAGVAAQANAEALITAQLNEAKSKAHEIIAAAEKRAVEVNEEALNKSRREAEQILDNAREEVGAELERARQSLRQEIAGIAMQAAEKVVEAELDAKRHAKMIEAIIEE 155
>gi|187251919|ref|YP_001876401.1| ATP synthase F0, B subunit [Elusimicrobium minutum Pei191] >gi|186972079|gb|ACC99064.1| ATP synthase F0, B subunit [Elusimicrobium minutum Pei191] (165 aa)
Score = 90, Expect = 1.4e-01, Identities = 39/137 (28%), Positives = 70/137 (51%)
  Q:    51 RLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNL-----EVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLTAK 187
           + AWKP    +EAR  +I +  + A++A+ E++K      ++L      A E +   E  A++ K      A+ K +Q  SE      K+E+E +K + L     E++ +A+E A      K D + +  ++D+IV D+  K
  S:    28 KFAWKPIIGALEARENKISQDKKDAQEARDEAQKIKAELDVRLSNISKEAQEKLAQVEALAKQQKD-----AMIKDAQASSERMIATAKEEIEAQKNQALKEVKKEIADMAVEAAAKIAGVKTDPKTDAALVDNIVKDIINK 164
>gi|163848589|ref|YP_001636633.1| ATP synthase F0, B subunit [Chloroflexus aurantiacus J-10-fl] >gi|187601001|ref|ZP_02987231.1| ATP synthase F0, B subunit [Chloroflexus sp. Y-400-fl] >gi|163669878|gb|ABY36244.1| ATP synthase F0, B subunit [Chloroflexus aurantiacus J-10-fl] >gi|187486829|gb|EDU24800.1| ATP synthase F0, B subunit [Chloroflexus sp. Y-400-fl] (164 aa)
Score = 90, Expect = 1.4e-01, Identities = 28/147 (19%), Positives = 73/147 (49%)
  Q:    31 NVYVLIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKII 177
           N  + IA +I+ + L+ ++  L ++P  + +  RT+ I+  +  AEK + +          ++  ++  AA+I+  A+  A++ + +I A A  +A +++ E  ++ +++ + +      +++ L   TA   L  ++    +  +I
  S:     7 NPTLFIAQLINFLLLIFILRALLYRPVMNLLNERTRRIEESVRDAEKVREQLANARRDYEAEIARARQEAAKIVAQAQERAKQQEAEIIAQARREAERLKEEARAQAEQERIRMLSEAKSQIADLVTLTASRVLGAELQARGHDALI 153
>gi|194476684|ref|YP_002048863.1| ATP synthase subunit B [Paulinella chromatophora] >gi|171191691|gb|ACB42653.1| ATP synthase subunit B [Paulinella chromatophora] (174 aa)
Score = 90, Expect = 1.4e-01, Identities = 31/154 (20%), Positives = 75/154 (48%)
  Q:    31 NVYVLIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           N+  L  ++I+LI ++ ++           +E R + I   +  AE+    +   L+ +++ L E++  AA I+ + +  AE  +   E   ++  + ++ +  + +  + + + +   L+ +  A+E A + L  K+DE  + K+ID  + +L
  S:    18 NLNPLDTNLINLIIVIGVLFTFLRGFLGEMLERRRQAILANLSDAEQNLKNASVALNKAQLDLAEAQERAARILADGKTRAESIRVNSERRTIDAMAALKQDAIADLSAEMVRISEELRLQTALQAIEKAMVTLPTKLDETAHSKLIDQSIVNL 171
>gi|82701440|ref|YP_411006.1| F0F1 ATP synthase subunit B [Nitrosospira multiformis ATCC 25196] >gi|82409505|gb|ABB73614.1| ATP synthase F0, B subunit [Nitrosospira multiformis ATCC 25196] (156 aa)
Score = 90, Expect = 1.6e-01, Identities = 34/152 (22%), Positives = 72/152 (47%)
  Q:    33 YVLIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           + LI+  ++    +   +R  W P    IE R K I   + A E+ + E E     S   + E+K  A++II  AE  A +   + +  A  +  +I     ++++++    ++    +V+ LAL  A   L +++DE+ + +++  +  +L
  S:     5 FTLISQAMAFAIFIWFTVRFVWPPLMRAIENRQKTIAEGLAAGERGKRELELASQRSGDVVREAKQRASDIIAQAEKRAAEIVDEAKVAAREEGDRILVGAKAEVEQEVFRAKEVLRQQVAGLALAGAAKILRREVDEKAHAELLASLKAEL 156
>gi|124522167|ref|ZP_01696876.1| ATP synthase F0, B subunit [Bacillus coagulans 36D1] >gi|124496266|gb|EAY43874.1| ATP synthase F0, B subunit [Bacillus coagulans 36D1] (173 aa)
Score = 90, Expect = 1.6e-01, Identities = 34/131 (25%), Positives = 67/131 (51%)
  Q:    53 AWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVND 183
           A+ P    +  R + I +++E AEK + E+ K L   R  L E++     +IENA   AE     I A A  +A +++     +I++++ +       +V+ L++  A   + K+I E++++K I D + +
  S:    38 AYGPLVEMMRKREEHIAKEIETAEKNREEAAKLLEEQRKLLKEARVEGQNLIENARKQAEVQHDDIVATARQEAERMKDAAKVEIEQEKAKAVAALREQVASLSVMIASKVIEKEISEKDHEKFILDSIKE 168
>gi|20807126|ref|NP_622297.1| F0F1-type ATP synthase b subunit [Thermoanaerobacter tengcongensis MB4] >gi|20515621|gb|AAM23901.1| F0F1-type ATP synthase b subunit [Thermoanaerobacter tengcongensis MB4] (168 aa)
Score = 90, Expect = 1.7e-01, Identities = 38/146 (26%), Positives = 71/146 (48%)
  Q:    31 NVYVLIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKI 176
           N+   +  +I+L+ L  ++ RL +KP   ++E R  +I+  +E A+K + E+         KL  ++N    IIE A+ +AE+   +I   A  +A  I  +   +   ++++       E+S L +E A   L KK+  E+   I
  S:    11 NLSTFVFTIINLLVLYYILKRLLFKPVTKFLEDRENKIKSALEDADKQREEAYSLKAQYEEKLQNAENEGRAIIEKAQKEAEERASEIIKSANKEAESIIEKAKEEAVLEKIKAMHELRAEMSHLIIEAASKVLEKKLPVEDEDLI 156
>gi|67153586|ref|ZP_00415331.1| ATP synthase F0, subunit B [Azotobacter vinelandii AvOP] >gi|67087719|gb|EAM07185.1| ATP synthase F0, subunit B [Azotobacter vinelandii AvOP] (156 aa)
Score = 90, Expect = 1.7e-01, Identities = 38/150 (25%), Positives = 70/150 (46%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNL-------EVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           L    I+    +   ++  W P    ++ R K+I   ++AA +AQ + +         L ES+  A +IIE A        K+  A+  +   Q +SEG   I   + E+E+  N        +V+ LA+  A   L  K+D + + K+++ + + L
  S:     7 LFGQTIAFAIFVWFCMKYVWPPLTQAMQERQKKIAEGLDAAGRAQQDLKLAQEKVSNTLRESREQATQIIEQA-------NKQANAIIEDAKQQAQSEGERLIAGAKAEIEQEVNRAREELRKQVAALAILGAEKILESKVDTKAHNKLVEKLASQL 156
>gi|30248226|ref|NP_840296.1| F0F1 ATP synthase subunit B [Nitrosomonas europaea ATCC 19718] >gi|30180111|emb|CAD84113.1| ATP synthase B/B' CF(0) [Nitrosomonas europaea ATCC 19718] (157 aa)
Score = 89, Expect = 1.8e-01, Identities = 39/157 (24%), Positives = 73/157 (46%)
  Q:    33 YVLIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLTAKLE 189
           + LI+  I+    +L   R  W      IE R ++I   + A E+ + E E     S   L E+K  A+EI+  AE  A    ++ +  A  +  +I +   ++I+ +     +    +V+ LA++ A    SK +  E N K+  D++  + A+L+
  S:     5 FTLISQAIAFSLFILFTARFVWPYLLRAIEERQQKIADGLAAGERGKKELELASQRSSEVLKEAKQRASEIVIQAEKRASDIIEEAKQNARIEGEKIIAGAKAEIQHETFSARESLRQQVAGLAVQGA----SKILRREVNAKVHADLLASIEAELK 157
>gi|194016188|ref|ZP_03054802.1| ATP synthase F0, B subunit [Bacillus pumilus ATCC 7061] >gi|194011661|gb|EDW21229.1| ATP synthase F0, B subunit [Bacillus pumilus ATCC 7061] (173 aa)
Score = 89, Expect = 1.9e-01, Identities = 29/128 (22%), Positives = 70/128 (54%)
  Q:    56 PTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVND 183
           P    ++ R   I  ++ +AE+  +++EK L   R+ L E++  +  +IENA+   EK K++I   A  ++ +++    ++I K++ +       +V+ L++  A   + +++DE+  +K+I + + +
  S:    41 PLLGIMKQREDYIGNEISSAEQKHVQAEKLLEEQRVLLKEAREESHTLIENAKKIGEKQKEEIIQAARQESERLKESARTEIVKEKEQAVAALREQVASLSVLIASKVIERELDEQAQEKLIQEYLKE 168
>gi|171060200|ref|YP_001792549.1| ATP synthase F0, B subunit [Leptothrix cholodnii SP-6] >gi|170777645|gb|ACB35784.1| ATP synthase F0, B subunit [Leptothrix cholodnii SP-6] (156 aa)
Score = 89, Expect = 1.9e-01, Identities = 30/150 (20%), Positives = 74/150 (49%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           L A ++    L    +   W P    ++ R K++   + AA+KA+LE          +L++S+N  A+++ +AE  A+    + +  A  + S+I +   ++  +Q ++  +    +V+ LA++ A   L ++++   + +++  +  +L
  S:     7 LFAQIVVFGILWWFTMTFVWPPITKALDERAKKVADGLAAADKAKLELATANKRVEEQLVQSRNENAKLLADAEKRAQAIVDEAKKRAEEEGSKIVAAAKAEADQQSIQAREVLREQVAALAVKGAEQILKREVNAGVHAELLTRLKTEL 156
>gi|149927028|ref|ZP_01915286.1| putative lipoprotein [Limnobacter sp. MED105] >gi|149824249|gb|EDM83469.1| putative lipoprotein [Limnobacter sp. MED105] (278 aa)
Score = 89, Expect = 1.9e-01, Identities = 31/78 (39%), Positives = 49/78 (62%)
  Q:    53 AWKPTK-SYIEARTKEIQRKMEAAEKAQLESEKNLHISRIK-LLESKNTAAEIIENAELDA-------EKTKKKIEAVALNKASQIE 130
           A  PT+ + IEA  KE+ R+ E   KA+ E EKNLH+  ++ ++E  N  A +   A LDA       ++  K++ A +L K SQ++
  S:    54 ATSPTQDALIEAERKELDREDEQTRKARAEREKNLHLKLVQTMIEQDNAYAAL---AHLDAYDQKWGSDRQSKQLRADSLRKTSQLD 137
>gi|86147158|ref|ZP_01065474.1| ATP synthase subunit B [Vibrio sp. MED222] >gi|85835042|gb|EAQ53184.1| ATP synthase subunit B [Vibrio sp. MED222] (154 aa)
Score = 89, Expect = 2.0e-01, Identities = 38/154 (24%), Positives = 72/154 (46%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLTAKL 188
           L+   I+    +   ++  W P    IE R K+I   + AAE+A  +       +  ++ E+K TA E+I+ A     +   +    A  +  +I ++  ++I+ +          +V+ LA+  A   L + ID    K + DD++N++TAKL
  S:     5 LLGQAIAFSLFVWFCMKYVWPPIMQAIEERQKKIADGLVAAERAAKDLNLAQANASEQMKEAKRTATEVIDQANKRKAQIIDEAREEAQAERQKILAQAEAEIEAERTRARDDLRKQVATLAIAGAEKILERTID----KDVHDDLLNNITAKL 154
>gi|119503559|ref|ZP_01625642.1| ATP synthase subunit B [marine gamma proteobacterium HTCC2080] >gi|119460621|gb|EAW41713.1| ATP synthase subunit B [marine gamma proteobacterium HTCC2080] (156 aa)
Score = 89, Expect = 2.0e-01, Identities = 32/149 (21%), Positives = 75/149 (50%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVND 183
           LI  +I+ +  +   +R  W P  S +  R ++I   + AA++A  + E     +  ++ ++K  AA II+ A   A     + +  A+ +A ++++   ++++++    +++   +VS LAL  A   L  +ID  ++ +++  +  D
  S:     7 LIGQLIAFVAFVAFCMRFVWPPIVSAMAERQQKIADGLAAADRAGHDLELAQKRATEEMADAKREAAVIIDAANKRAAALIDEAKVAAVAEADRVKAAAAAEVEQERARAQEQLMSQVSSLALAGAEKVLGSEIDAAKHAELLKSLTAD 155
>gi|196232473|ref|ZP_03131326.1| ATP synthase F0, B subunit [Chthoniobacter flavus Ellin428] >gi|196223545|gb|EDY18062.1| ATP synthase F0, B subunit [Chthoniobacter flavus Ellin428] (186 aa)
Score = 89, Expect = 2.1e-01, Identities = 33/156 (21%), Positives = 74/156 (47%)
  Q:    31 NVYVLIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLTA 186
           N + L + +IS   +  L+ +LA+KP  + +E R K+I   +  AEK +++  ++    +  L ++   A  +I+ A   A+    +    A+ +A QI ++       +  ++      EV +L ++T      K + + + K+I ++   ++ A
  S:    31 NAWALFSQIISFSIVAFLLHKLAYKPILNVLEERRKKIAEGLANAEKIKVQLAESEARVQEILTKANVDAQRLIDEARASAQVVADRRTQQAIAEAEQIIAKAREATGIEREKIMAELKREVGRLVIDTTSRVTGKVLTQADQKRINEEASREVAA 186
>gi|50083465|ref|YP_044975.1| F0F1 ATP synthase subunit B [Acinetobacter sp. ADP1] >gi|49529441|emb|CAG67153.1| membrane-bound ATP synthase, F0 sector, subunit b [Acinetobacter sp. ADP1] (156 aa)
Score = 89, Expect = 2.2e-01, Identities = 30/150 (20%), Positives = 70/150 (46%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           LI   I+    +   ++  W P  + I  R ++I   + AAEKA+ +        + +L  +K  AA++IE A   A +  ++    A  +  +I  +    + ++     +    +V+ LA++ A   L++++D++ +  +++ +   L
  S:     7 LIGQAIAFAIFVAFCMKFVWPPLINAISERQRKIADGLNAAEKAKADLADAQAQVKQELDAAKAQAAQLIEQANRRAAQLIEEARTQATAEGERIRQQSKETVDQEINAAREELRQQVAALAVDGAEKILNQQVDQQAHAAMLEQLAAKL 156
>gi|116328617|ref|YP_798337.1| F0F1 ATP synthase subunit B [Leptospira borgpetersenii serovar Hardjo-bovis L550] >gi|116331346|ref|YP_801064.1| F0F1 ATP synthase subunit B [Leptospira borgpetersenii serovar Hardjo-bovis JB197] >gi|116121361|gb|ABJ79404.1| B subunit of the H(+)-transporting two-sector ATPase, FO sector [Leptospira borgpetersenii serovar Hardjo-bovis L550] >gi|116125035|gb|ABJ76306.1| B subunit of the H(+)-transporting two-sector ATPase, FO sector [Leptospira borgpetersenii serovar Hardjo-bovis JB197] (173 aa)
Score = 89, Expect = 2.2e-01, Identities = 33/154 (21%), Positives = 75/154 (48%)
  Q:    31 NVYVLIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           N  +++  +I+ + ++L++ + AW      ++ R + +Q  +E A + +LE+E  L     +L  +K+ A  I+  A  DA K K K+      +    + +   +I+  + +  ++   +  ++ +  AG  L K++  E+ K  I+  +N L
  S:    15 NPGLVVWTLITFLVVVLVLKKFAWDVILKALDERAQAVQNDIEKASELRLEAEALLKDYEARLNSAKDEANAIVAEARSDALKLKNKLLEETNQEVKAQKDQAVKEIELAKGKALEQLQTQFVEMTITIAGKVLEKQLKAEDYKAFIETELNKL 168
>gi|148978365|ref|ZP_01814870.1| F0F1 ATP synthase subunit B [Vibrionales bacterium SWAT-3] >gi|145962524|gb|EDK27802.1| F0F1 ATP synthase subunit B [Vibrionales bacterium SWAT-3] (154 aa)
Score = 89, Expect = 2.3e-01, Identities = 34/150 (22%), Positives = 69/150 (46%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           L+   I+    +   ++  W P    IE R K+I   + AAE+A  +       +  ++ E+K TA E+IE A     +   +    A  +  +I ++  ++++ +          +V+ LA+  A   L + ID++ +K ++D+I   L
  S:     5 LLGQAIAFSLFVWFCMKYVWPPIMQAIEERQKKIADGLVAAERAAKDLNLAQANASEQMKEAKRTATEVIEQANKRKAQIIDEAREEAQAERQKILAQAEAELEAERTRARDDLRKQVATLAIAGAEKILERTIDKDVHKDLLDNITAKL 154
>gi|159039544|ref|YP_001538797.1| ATP synthase F0, B subunit [Salinispora arenicola CNS-205] >gi|157918379|gb|ABV99806.1| ATP synthase F0, B subunit [Salinispora arenicola CNS-205] (179 aa)
Score = 88, Expect = 2.4e-01, Identities = 33/147 (22%), Positives = 75/147 (51%)
  Q:    28 IFPNVYVLIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENK 174
           I P    ++  +++   L  ++++  +   +   +AR   I+  ++ AE AQ E+ + L   R +L E+++ AA+I ++A  DAE  ++ I A A  ++ +I + G  ++  +   + +    EV  LA++ A   + + + +E  +
  S:    16 ILPVWQEIVVGLVAFGLLAFVLMKFVFPRMEQTFQARVDAIEGGIKRAEAAQAEANQLLEQYRAQLSEARSDAAKIRDDARADAEGIRQDILAKAREESDRIIAAGKEQLVAERATIVRELRTEVGTLAVDLASKIVGESLADEARR 162
>gi|118046005|ref|ZP_01514660.1| ATP synthase F0, B subunit [Chloroflexus aggregans DSM 9485] >gi|117997560|gb|EAV11746.1| ATP synthase F0, B subunit [Chloroflexus aggregans DSM 9485] (164 aa)
Score = 88, Expect = 2.4e-01, Identities = 29/147 (19%), Positives = 72/147 (48%)
  Q:    31 NVYVLIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKII 177
           N+ + +A +++ + L+ ++  L ++P  + +  RTK I+  +  AEK + +          +L +++  AA I+  A+  A++ + +I A A  +A +++ E   + +++   L      +++ L   TA   L  ++    +  +I
  S:     7 NLNLFLAQLVNFLLLIFILRALLYRPVMNLLNERTKRIEESVRDAEKVREQLANAKRDYEAELAKARQEAARIVAQAQERAKQQEAEIIAQARREAERLKEEARVQAEQERARLLSEAKSQIADLVTLTASRVLGAELQARGHDALI 153
>gi|83815076|ref|YP_445047.1| ATP synthase F0, B subunit [Salinibacter ruber DSM 13855] >gi|83756470|gb|ABC44583.1| ATP synthase F0, B subunit [Salinibacter ruber DSM 13855] (204 aa)
Score = 88, Expect = 2.5e-01, Identities = 32/157 (20%), Positives = 83/157 (52%)
  Q:    28 IFPNVYVLIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           + P+V ++    ++ +  L ++ R  W P    +E R +EI+  ++ AE+A  E++     +     E++  A +I+  A   AE+ +++ +A    +  +++ +  ++I++++    +    EV+ LA+E A   +   +D + +++++DD ++D 
  S:    45 VTPSVGLIFWKTVAFLIFLYILYRFGWGPITESLEEREEEIEHSIQRAEEALEEAKAIQAENEEARREAEQKAQQILREARDSAEELREEEKAKTRREIQEMKEQAQAEIEREKQAALQELRDEVADLAIEAAQKIIENDLDADRHRQLVDDALDDF 201
>gi|15896123|ref|NP_349472.1| F0F1 ATP synthase subunit B [Clostridium acetobutylicum ATCC 824] >gi|5915730|sp|O05098|ATPF_CLOAB ATP synthase B chain >gi|15025915|gb|AAK80812.1|AE007784_9 FoF1-type ATP synthase B subunit [Clostridium acetobutylicum ATCC 824] >gi|1905951|gb|AAB50193.1| F-type ATP synthase subunit b >gi|4323564|gb|AAD16422.1| ATP synthase subunit b [Clostridium acetobutylicum] (159 aa)
Score = 88, Expect = 2.5e-01, Identities = 35/146 (23%), Positives = 72/146 (49%)
  Q:    39 VISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           +++ I L+L++    +      I+ R  E+   ++ A+    E+      S   L +SK     I+EN ++ AEK  ++I A A  +A  I      + ++++ + E     +V +LA+  +   L   I+E E++K+I+D V+ +
  S:    12 IVNFIILMLILKHFFFDKVNKVIDDRNNEVALTIKKADAQNEEARLLKVESEKNLEDSKLQGKTIVENYKVKAEKVSEEITAEAKTEAQNILERAKRETQREKEKAEDEIKNQVVELAVLISSKALENSINEAEHRKLIEDFVSKV 157
>gi|126667604|ref|ZP_01738573.1| F0F1 ATP synthase subunit B [Marinobacter sp. ELB17] >gi|126627873|gb|EAZ98501.1| F0F1 ATP synthase subunit B [Marinobacter sp. ELB17] (187 aa)
Score = 88, Expect = 2.6e-01, Identities = 26/145 (17%), Positives = 71/145 (48%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDD 179
           ++   I+    ++  +++ W P  + ++ R K+I   + A+++A+ + E     S  +L E+K  AA +IE A   A +  +  +  A  +  ++  +  ++I ++  +  +    E+  +A+  A   L   +D  ++ +++++
  S:     7 ILGQAIAFFIFVVFCMKMVWPPVIAALQERQKKIADGLAASDRAERDLELAQEKSAQELREAKQQAAGLIEQANKRAAQIVEASKDDARKEGEKLIEQAKAEIVQELNQAREALRAEIGVIAIAGAEKILETSVDASKHNEMLEN 151
>gi|126661081|ref|ZP_01732163.1| F0F1-type ATP synthase, subunit b [Cyanothece sp. CCY0110] >gi|126617625|gb|EAZ88412.1| F0F1-type ATP synthase, subunit b [Cyanothece sp. CCY0110] (247 aa)
Score = 88, Expect = 2.6e-01, Identities = 30/152 (19%), Positives = 72/152 (47%)
  Q:    33 YVLIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           + ++A +I+ + L+ L+ R  +KP    I+AR KEI+ + +AAEK +  ++   +  + K  E +    EI+ +A+  A++    +   A     Q        +++++ +   R   ++ +   +  G  L    +    +++I+  ++ L
  S:     6 FTIVAQIINFLILVFLLNRFLYKPIVKTIKARQKEIENRWQAAEKEKESAKTEANSYQKKQHELEEKQHEIMTHAQTKADEKYHDLVEEARQDIEQKRKTWQESLEREKAQFFDRFQEKIVQQIYKMTGHALGDLANASLEQQMINQFIHRL 157
>gi|18860297|ref|NP_569615.1| ATP synthase CF0 B subunit [Psilotum nudum] >gi|18389450|dbj|BAB84202.1| ATP synthase subunit CF0 I [Psilotum nudum] (184 aa)
Score = 88, Expect = 2.6e-01, Identities = 38/162 (23%), Positives = 77/162 (47%)
  Q:    31 NVYVLIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLTAKLESSS 192
           N  +   ++I+L  ++ L++ L      + +  R + I   +  AE+   E+   L  +R +L ++K  A EI  N     E+ K+ +   A   + ++E    S I+ +E    ++   +VS+LALE     L  + + E + ++ID  + DL   +E ++
  S:    23 NTNIFEINIINLGIVIGLLVYLGEGVLTNLLVNRKQTILSTIRDAEERYREATDKLKQARARLQQAKVKAGEIRSNGLARMEREKQDLINAADEDSKRLEESKNSTIRFEEQRAIEQVRQQVSRLALERVLESLKSRFNSELHSRMIDYHI-DLIKSMEGTT 183
>gi|139439328|ref|ZP_01772770.1| Hypothetical protein COLAER_01786 [Collinsella aerofaciens ATCC 25986] >gi|133775352|gb|EBA39172.1| Hypothetical protein COLAER_01786 [Collinsella aerofaciens ATCC 25986] (200 aa)
Score = 88, Expect = 2.7e-01, Identities = 31/156 (19%), Positives = 79/156 (50%)
  Q:    28 IFPNVYVLIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKI-DEEENKKIIDDIVND 183
           + P +   I  +I+ + + +++ ++A       +E R K+I+  ++ AEK + E+      S   + +++  AA+I+  A  DAE  + +I   A  +A +I ++ ++ ++ +   +       ++ L++  A   + + + D+ E KK+I+  + +
  S:    37 LIPKMAEFIPALIAFLIIWIVLAKVALPGIMKTMEERGKKIEESLDEAEKTKQEAIAKRAESDSIVTDARRQAADIVLEARKDAESERARIIEAAHKEAEEIIAKAHTTVEDERKSIYAGAASSIADLSVAVATKIVGEALEDDAEQKKLIERYIQE 193
>gi|157694081|ref|YP_001488543.1| F0F1 ATP synthase subunit B [Bacillus pumilus SAFR-032] >gi|157682839|gb|ABV63983.1| H(+)-transporting two-sector ATPase, F(1) subunit B [Bacillus pumilus SAFR-032] (170 aa)
Score = 88, Expect = 2.7e-01, Identities = 29/128 (22%), Positives = 70/128 (54%)
  Q:    56 PTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVND 183
           P    ++ R   I  ++ +AE+  +++EK L   R+ L E++  +  +IENA+   EK K++I   A  ++ +++    ++I K++ +       +V+ L++  A   + +++DE+  +K+I + + +
  S:    38 PLLGIMKQREDYIGNEISSAEQKHVQAEKLLEEQRVLLKEAREESHTLIENAKKIGEKQKEEIIQAARQESERLKDSARTEIVKEKEQAVAALREQVASLSVLIASKVIERELDEQAQEKLIQEYLKE 165
>gi|116629877|ref|YP_815049.1| F0F1 ATP synthase subunit B [Lactobacillus gasseri ATCC 33323] >gi|116095459|gb|ABJ60611.1| F0F1-type ATP synthase, subunit b [Lactobacillus gasseri ATCC 33323] (166 aa)
Score = 88, Expect = 2.7e-01, Identities = 30/136 (22%), Positives = 62/136 (45%)
  Q:    49 VIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           V   AW P    +E R +++   ++ AE  + ++    +     L +SK  A +I+  A+ +AEKTK  I + A  +A+ I         + + +       +V+ +++  A   +SK +   + K ++D  +  L
  S:    29 VKHFAWGPVTKMMEKRRQKVISDLDQAESDRKKAALLANQREAALKDSKQEATQILSTAKRNAEKTKSSIISQADQEAAAIRERASKDAAQAKTDALNEARDQVADISVAIAEKVISKSLSAADQKDLVDQFIKGL 164
>gi|86141104|ref|ZP_01059663.1| ATP synthase F0, subunit B [Flavobacterium sp. MED217] >gi|85833046|gb|EAQ51495.1| ATP synthase F0, subunit B [Leeuwenhoekiella blandensis MED217] (166 aa)
Score = 88, Expect = 2.8e-01, Identities = 45/163 (27%), Positives = 88/163 (53%)
  Q:    23 QIINQIFPNVYVLIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKI-DEEENKKIIDDIVNDLT 185
           Q++N   P ++V+ A  + LI L+LL+ + AWKP  S ++ R + IQ  +EAAEKA+LE +     +   L E++     +++ A     K   + E  A  +A +I ++    I  ++         +V++L+LE A   + +++ D+E+ ++ +D ++ D T
  S:     3 QLLNDFSPGLFVMQA--VILIILILLMKKFAWKPILSSLDEREQGIQGALEAAEKARLEMKNLQADNEKALQEARAERDAMLKEAREIRTKMIAEAEGDAKAQADKIITQAQEAIAAEKRAAVAELKGQVAELSLEIAEKVVKQELSDKEKQQQYVDKMLQDAT 164
>gi|33519487|ref|NP_878319.1| F0F1 ATP synthase subunit B [Candidatus Blochmannia floridanus] >gi|33517150|emb|CAD83532.1| ATP synthase subunit B [Candidatus Blochmannia floridanus] (161 aa)
Score = 87, Expect = 3.1e-01, Identities = 33/151 (21%), Positives = 71/151 (47%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLT 185
           ++  VI+ I  +   ++  W P  S IE R K+I   +E+ + +++ESE+  + +   L ++   + EII+ A     +     +  A  +  +I S+   +I ++   +       VSKL +E+    +   I++  +   +D I+  L+
  S:     7 ILGQVIAFILFVWFCMKYVWNPLMSVIEERQKKIIDSLESIKTSKMESERIRNEALACLKQAHIKSEEIIKYAYECKMQILHTAQNEAYQERDKILSQTQIQIDQERERIISELRNHVSKLVIESTEKVIDTSINKIIDYDFVDKIIKQLS 157
>gi|146309624|ref|YP_001190089.1| ATP synthase F0, B subunit [Pseudomonas mendocina ymp] >gi|145577825|gb|ABP87357.1| ATP synthase F0, B subunit [Pseudomonas mendocina ymp] (156 aa)
Score = 87, Expect = 3.3e-01, Identities = 35/156 (22%), Positives = 70/156 (44%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLTAKLES 190
           L    I+    +   ++  W P    ++ R K+I   ++AA +A+ + +     +   L E+K  AAEI++ A   A    ++ +A A ++  ++ +   ++I  +    + +   +V+ LA+  A   L   +D   +        NDL AKL S
  S:     7 LFGQTIAFAIFVWFCMKFVWPPLTQAMQERQKKIAEGLDAAGRAERDLQLAQERAAQMLRETKEQAAEILDRANKTANAIVEEAKAQARSEGEKLIAGAKAEIDLEVNRAKDQLRAQVAALAVTGAEQILQSTVDGAAH--------NDLVAKLAS 154
>gi|196182740|gb|EDX77725.1| hypothetical protein MC7420_3049 [Microcoleus chthonoplastes PCC 7420] (1045 aa)
Score = 87, Expect = 3.4e-01, Identities = 31/119 (26%), Positives = 66/119 (55%)
  Q:    61 IEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELE-LEKRKNLEVSKLALETAGIFLSKKIDE--------EENKKIIDD 179
           +E + KE+ +KM+  E+ + E+E+  H +  +L E++ +   + + AE          +A+ L++A++   E   +++  + E L+    L++ KL LE +  F  K+I+         E+ KK++ D
  S:   562 VETQLKEVNQKMQFTEEERQEAERKAHDANQQLTEARKSLDNVTQQAEQ---------KAIELDQANREIIEVSQRLESAQSEALKTNAMLQIEKLTLEASQQFPFKQIETLLWAMQAGEQAKKMVKD 680
>gi|148272345|ref|YP_001221906.1| F0F1 ATP synthase subunit B [Clavibacter michiganensis subsp. michiganensis NCPPB 382] >gi|147830275|emb|CAN01209.1| ATP synthase B chain (Subunit I) [Clavibacter michiganensis subsp. michiganensis NCPPB 382] (188 aa)
Score = 87, Expect = 3.5e-01, Identities = 39/159 (24%), Positives = 78/159 (49%)
  Q:    28 IFPNVYVLIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETA-GIFLSKKIDEEENKKIIDDIVNDLTA 186
           + P VY ++   +  + LL+++ + A     + ++ RT+ I   +E AE+AQ E++        +L E++  A  I E A +DA     +I+  A   A++I +    +I+ +  +       EV  LA++ A G+      D++ +  ++D  + DL A
  S:    18 LLPAVYDIVWSAVVFVVLLVVIWKYALPRVYAMLDGRTEAIAGGIEKAERAQAEADAAKAELTAQLAEARAEAGRIREQARVDATAIAAEIKEQATADAARITASAQQQIEAERQQAVVSLRSEVGSLAIDLASGVIGQSLTDDQRSTALVDRFLADLEA 177
>gi|83313095|ref|YP_423359.1| ATP synthase B chain precursor [Magnetospirillum magneticum AMB-1] >gi|82947936|dbj|BAE52800.1| ATP synthase B chain precursor [Magnetospirillum magneticum AMB-1] (178 aa)
Score = 86, Expect = 4.1e-01, Identities = 33/143 (23%), Positives = 70/143 (48%)
  Q:    46 LLLVIRLAWKPTKSYI----EARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLTAKL 188
            +LV+ LA+KP    I    +AR+ +I+ +++ A K + E+++ L   + K  ++   A EII +A+ +AE+  K+          + E     +I + E +  +        +A+  A   + + +   +   ++D+ + DL  KL
  S:    31 FILVVALAFKPVSRAIAAALDARSAKIKSRLDEAHKLREEAQEMLATYQRKQRDAMKEAEEIIAHAKAEAERLAKQAAKDLEVSMKRREQMAMDRIAQAEAQAVREVQNLAVDVAIGAAQKVIGESLSAAQTGSLVDNAIKDLPGKL 177
>gi|23016150|ref|ZP_00055909.1| COG0711: F0F1-type ATP synthase, subunit b [Magnetospirillum magnetotacticum MS-1] (178 aa)
Score = 86, Expect = 4.2e-01, Identities = 33/143 (23%), Positives = 70/143 (48%)
  Q:    46 LLLVIRLAWKPTKSYI----EARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLTAKL 188
            +LV+ LA+KP    I    +AR+ +I+ +++ A K + E+++ L   + K  ++   A EII +A+ +AE+  K+          + E     +I + E +  +        +A+  A   + + +   +   ++D+ + DL  KL
  S:    31 FILVVALAFKPVSRAIAAALDARSAKIKSRLDEAHKLREEAQEMLATYQRKQRDAMKEAEEIIAHAKAEAERLAKQAAKDLEASMKRREQMAMDRIAQAEAQAVREVQNLAVDVAIGAAQKVIGESLSAAQTGALLDNAIKDLPGKL 177
>gi|90961572|ref|YP_535488.1| ATP synthase B chain [Lactobacillus salivarius UCC118] >gi|90820766|gb|ABD99405.1| ATP synthase B chain [Lactobacillus salivarius UCC118] (175 aa)
Score = 86, Expect = 4.3e-01, Identities = 34/116 (29%), Positives = 68/116 (58%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVA--------------------------LNKASQIESEGYSKIKKQELELEKRKNL 150
            I ++++ + LL LV + AW P    +E R  +I   +++AE+A+ ++E+ +    + L  S++ A++II+ A+ + E+ K  I + A                           N  +++  E  SKI ++EL  + +K L
  S:    19 FIFYIVTFLILLALVKKFAWTPITDMMEKRATKISNDIDSAEQARQKAEELVEKRDLALKNSRSEASQIIDRAKKNGEQQKANIVSSAHEEVQTMKANAKKDIQQERQEALDSVKNDVAELSIEIASKIIRKELTADDQKAL 160
>gi|52787608|ref|YP_093437.1| F0F1 ATP synthase subunit B [Bacillus licheniformis ATCC 14580] >gi|163119685|ref|YP_081008.2| F0F1 ATP synthase subunit B [Bacillus licheniformis ATCC 14580] >gi|52350110|gb|AAU42744.1| AtpF [Bacillus licheniformis DSM 13] >gi|145903196|gb|AAU25370.2| ATP synthase (subunit b) [Bacillus licheniformis ATCC 14580] (172 aa)
Score = 86, Expect = 4.5e-01, Identities = 31/129 (24%), Positives = 68/129 (52%)
  Q:    56 PTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           P  + ++ R   I  ++ +AEK   E++K +   +  L E++  +  +IENA+   E+ K +I   A  +A +++    S+I K+  +       +V+ L++  A   + K++DE+  +K+I D + ++
  S:    40 PLLNIMKEREDYITGEISSAEKKNEEAKKLIEEQQALLKEAREESQSLIENAKKLGEQQKDEIIKAARQEAERMKESARSEIVKERDQAVTALREQVASLSVMIASKVIEKELDEQAQEKLIQDYLKEV 168
>gi|154687800|ref|YP_001422961.1| F0F1 ATP synthase subunit B [Bacillus amyloliquefaciens FZB42] >gi|154353651|gb|ABS75730.1| AtpF [Bacillus amyloliquefaciens FZB42] (170 aa)
Score = 86, Expect = 4.6e-01, Identities = 30/129 (23%), Positives = 70/129 (54%)
  Q:    56 PTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           P  + ++ R   I  ++ +AE+   E++K +   R+ L E+K  +  +IENA+   EK K+ I   A  ++ +++    ++I K++ +       +V+ L++  A   + K++DE+  +++I D + ++
  S:    38 PLLNIMKQREDHIAGEITSAEERNKEAQKLIEEQRVLLKEAKQESQSLIENAKKLGEKQKEDIIQAARAESERLKEAARTEIVKEKEQAVSALREQVASLSVLIASKVIEKELDEQAQEQLIQDYLKEV 166
>gi|149911794|ref|ZP_01900398.1| ATP synthase subunit B [Moritella sp. PE36] >gi|149805140|gb|EDM65162.1| ATP synthase subunit B [Moritella sp. PE36] (156 aa)
Score = 86, Expect = 4.9e-01, Identities = 35/150 (23%), Positives = 74/150 (49%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           L+   IS    +L  ++  W P  + IE R ++I   + +A+KA  + +     +  +L ++K  AA II+ A     +   + +  A  + ++I ++  ++++ +   L++    +V+ LA+  A   + + ID   N  I+D IV +L
  S:     7 LLGQAISFTLFVLFCMKYVWPPLIAAIEERQQKIADGLASADKAAKDLKLAEAKATDQLKDAKAQAAVIIDAANKRKSQIVDEAKEEANAERAKILAQAEAEVEAERNRLKEELRKQVAGLAIAGAEKIIERSIDAAANSDIVDKIVAEL 156
>gi|16080738|ref|NP_391566.1| F0F1 ATP synthase subunit B [Bacillus subtilis subsp. subtilis str. 168] >gi|584815|sp|P37814|ATPF_BACSU ATP synthase B chain >gi|433987|emb|CAA82256.1| ATP synthase subunit b [Bacillus subtilis] >gi|2636210|emb|CAB15702.1| ATP synthase (subunit b) [Bacillus subtilis subsp. subtilis str. 168] (170 aa)
Score = 86, Expect = 4.9e-01, Identities = 29/129 (22%), Positives = 71/129 (55%)
  Q:    56 PTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           P  + ++ R   I  ++ +AE+   E+++ +   R+ L E++  +  +IENA+   EK K++I   A  ++ +++    ++I K++ +       +V+ L++  A   + K++DE+  +K+I D + ++
  S:    38 PLLNIMKQREDHIAGEITSAEEKNKEAQQLIEEQRVLLKEARQESQTLIENAKKLGEKQKEEIIQAARAESERLKEAARTEIVKEKEQAVSALREQVASLSVMIASKVIEKELDEQAQEKLIQDYLKEV 166
>gi|192362284|ref|YP_001984264.1| ATP synthase F0, B subunit [Cellvibrio japonicus Ueda107] >gi|190688449|gb|ACE86127.1| ATP synthase F0, B subunit [Cellvibrio japonicus Ueda107] (156 aa)
Score = 86, Expect = 5.0e-01, Identities = 32/150 (21%), Positives = 71/150 (47%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
            I  +++    + L  R  W P  + +  R+K I   ++AA++A+ + E        +L  +K  AA II+ A   A +  ++ +  A  +A ++++   ++I+      ++    +V  LAL  A   L   ID+  + ++++ +  +L
  S:     7 FIGQMVAFAIFIYLTYRYVWPPIVAAMAERSKRIADGLQAADRAEKDLELAQKKVVEQLTSAKKEAAAIIDQANKRAIEIVEEAKLKAQQEAERVKASAQAEIELATSRAKEELRSKVVVLALAGAEKILESSIDQNAHNELVNKLAAEL 156
>gi|167405361|ref|ZP_02310118.1| hypothetical protein LmonocytFSL_20966 [Listeria monocytogenes FSL J2-003] (103 aa)
Score = 86, Expect = 5.1e-01, Identities = 22/81 (27%), Positives = 46/81 (56%)
  Q:    39 VISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIE 119
           + +   LL+L+   AWKP    ++ R + I  +++AAE+ + +SEK L   +  L +++  +  +IENA    ++T++  +
  S:    21 LFAFAILLVLIRIYAWKPLMGIMKEREEHIGSEIDAAEENRAQSEKLLAEQKSVLQQARVESQTMIENANSLVKRTRRNCQ 101
>gi|81096632|ref|ZP_00874969.1| ATP synthase F0, subunit B [Streptococcus suis 89/1591] >gi|146318830|ref|YP_001198542.1| F0F1-type ATP synthase, subunit b [Streptococcus suis 05ZYH33] >gi|146321039|ref|YP_001200750.1| F0F1-type ATP synthase, subunit b [Streptococcus suis 98HAH33] >gi|80977311|gb|EAP40857.1| ATP synthase F0, subunit B [Streptococcus suis 89/1591] >gi|145689636|gb|ABP90142.1| F0F1-type ATP synthase, subunit b [Streptococcus suis 05ZYH33] >gi|145691845|gb|ABP92350.1| F0F1-type ATP synthase, subunit b [Streptococcus suis 98HAH33] (168 aa)
Score = 85, Expect = 5.2e-01, Identities = 31/147 (21%), Positives = 75/147 (51%)
  Q:    41 SLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLTAK 187
           S   L++L+   AW       E R  +I   ++AAE+    +   +     +L++ +  + +II++A   A+  KK+I   A  +   ++ +   +I+ ++ E ++   ++V++LA++ A   + + +D++ +  +ID  ++ L  K
  S:    22 SFAVLIILIRVFAWDKITGIFEERANKIANDIDAAEEKLTAAANLVQQREDELVQGRIESQKIIQDAVERAKLEKKRILEQADVEIQGLKQKAQLEIEAEKREAQENLRVQVAELAVDLASKIILEDLDQQAHSNLIDRYLDKLGDK 168
>gi|19703704|ref|NP_603266.1| ATP synthase B chain, sodium ion specific [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >gi|19713828|gb|AAL94565.1| ATP synthase B chain, sodium ion specific [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] (163 aa)
Score = 85, Expect = 5.3e-01, Identities = 35/152 (23%), Positives = 71/152 (46%)
  Q:    33 YVLIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           Y     +I+   LL +V +   +P    I  R ++I+ ++  A K + E+E+ L  +  ++  S+  A EI++ A+  AE+    +   A      I      +I K + + ++    EV  LA E A   + +K+D+ +   +ID  + ++
  S:     8 YTFFWQIINFFLLLFIVKKYFKEPISKIINERKQKIEAELVEATKNKKEAEQLLKDAEAQINASRKEATEIVKAAQRKAEEEAHNLIREARENRENILKTTELEITKIKNDAKEELGREVKNLAAELAEKIIKEKVDDAQEISLIDKFIAEV 159
>gi|166033112|ref|ZP_02235941.1| hypothetical protein DORFOR_02834 [Dorea formicigenerans ATCC 27755] >gi|166027469|gb|EDR46226.1| hypothetical protein DORFOR_02834 [Dorea formicigenerans ATCC 27755] (166 aa)
Score = 85, Expect = 5.4e-01, Identities = 32/150 (21%), Positives = 70/150 (46%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           L+  +I+L+   LL+ +  +KP    +E R + I   ++ A   Q E+E         L  +K  + +I+ENA ++A++   +I A A  +A          I+ +  +       +++ LA++ A   + ++  ++ N+ I D  +  +
  S:     8 LLWTIINLVVFYLLLKKFLFKPVMGIMEKREQMIADGLKNASDRQEEAESLKKEYESALSGAKEESVKIVENARVEAKRQSDEILADADRRADATIERARKTIETERKQALDGVETQIAGLAMQAARKIVDEETRKQGNQAIYDQFLESV 157
>gi|107104660|ref|ZP_01368578.1| hypothetical protein PaerPA_01005739 [Pseudomonas aeruginosa PACS2] (135 aa)
Score = 85, Expect = 5.7e-01, Identities = 28/135 (20%), Positives = 68/135 (50%)
  Q:    50 IRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           ++  W P  + ++ R K+I   ++AA +A  + E     +  +L E+K  AAEI+E A+  A +   +    A  +  +++++  ++I+++   ++     +V  LA+  A   L   ID   +++++  +  ++
  S:     1 MKFVWPPVIAALQERQKKIADGLDAANRAARDLELAHEKAGQQLREAKAQAAEIVEQAKKRANQIVDEARDQARTEGERLKAQAQAEIEQELNSVKDALRAQVGALAVTGAEKILGASIDANAHEQLVSKLAAEI 135
>gi|76798166|ref|ZP_00780418.1| ATP synthase F0, B subunit [Streptococcus agalactiae 18RS21] >gi|76586474|gb|EAO62980.1| ATP synthase F0, B subunit [Streptococcus agalactiae 18RS21] (145 aa)
Score = 85, Expect = 6.7e-01, Identities = 29/117 (24%), Positives = 58/117 (49%)
  Q:    41 SLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLAL 157
           S++ L +L+   AWK      EAR ++I   ++ AE+A+ ++E        +L  +K  A +II+NA+        +I + A  +A +++ + +  I + + E       EV+ L +
  S:    19 SVLLLFILIKTFAWKQITGIFEAREQKIANDIDTAEQARQQAEAFATKREEELSNAKTEANQIIDNAKETGLAKGDQIISEAKTEADRLKEKAHQDIAQNKAEALADGKGEVADLTV 135
>gi|15606710|ref|NP_214090.1| ATP synthase F0 subunit b [Aquifex aeolicus VF5] >gi|2983928|gb|AAC07477.1| ATP synthase F0 subunit b [Aquifex aeolicus VF5] (144 aa)
Score = 85, Expect = 6.7e-01, Identities = 28/91 (30%), Positives = 53/91 (58%)
  Q:    28 IFPNVYVLIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKI 118
           + PN  +L+   I +IFL++ +  +  KP  + IE+R + I++ +  A+K + E++  L  ++  L ++K  A +IIENA  +AE   + I
  S:     5 VMPNATILVQLFIFVIFLMI-ITNIYVKPYTAVIESREELIKKNLSEAQKLREETQTYLTQAKEVLEDAKKRADQIIENARREAEAQARSI 94
>gi|84701721|ref|ZP_01016296.1| ATP synthase F0, B subunit [Parvularcula bermudensis HTCC2503] >gi|84690967|gb|EAQ16807.1| ATP synthase F0, B subunit [Parvularcula bermudensis HTCC2503] (194 aa)
Score = 84, Expect = 8.4e-01, Identities = 35/158 (22%), Positives = 79/158 (50%)
  Q:    31 NVYVLIAHVISL-IFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLTAKL 188
           N +VL+A +I + IFL   V ++      S++ AR + +QR+++ A   + E+++ L   + +  E++  A  IIE A+ DA+    +  A    + ++       +I + E +         + +A+  A   ++ ++D+    ++ID  +N++  +L
  S:    39 NFWVLLAFLIVVGIFLWQGVPKM----IGSFLSARAEGVQRQLDEARTLREEAQRTLADFQKRQREAETEAEAIIEQAKADAKSVATEARAKLDEQIARRRKAAEDRIARAEAQAIAEIRGRTADMAIAAAREIIANRMDDRSQGQLIDRAINEVGTRL 193
>gi|167750153|ref|ZP_02422280.1| hypothetical protein EUBSIR_01122 [Eubacterium siraeum DSM 15702] >gi|167656896|gb|EDS01026.1| hypothetical protein EUBSIR_01122 [Eubacterium siraeum DSM 15702] (180 aa)
Score = 84, Expect = 8.5e-01, Identities = 34/150 (22%), Positives = 76/150 (50%)
  Q:    35 LIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           ++  +I+ + ++LL      KP    ++ R K + + M+ A+KA+ E+         +L  SK  AA I+ +A   A+  + +I + A  +A+ ++      I++++         E+S + +  A     K+I+ ++N+KIID +++ +
  S:    27 IVFTLINTLIIVLLYFFFLHKPVCKILDERAKTVNKDMDDAQKAKEEAAAVKADYEHRLETSKEEAARIVADATKKAQAREDEIISAANEEAASMKQRAEESIEREKKRAVNEIKEEISDMVVMAASKVAEKEINAQDNEKIIDSVLSQI 176
>gi|118443791|ref|YP_879000.1| F0F1 ATP synthase subunit B [Clostridium novyi NT] >gi|118134247|gb|ABK61291.1| ATP synthase F0, B subunit [Clostridium novyi NT] (159 aa)
Score = 83, Expect = 9.0e-01, Identities = 32/146 (21%), Positives = 77/146 (52%)
  Q:    39 VISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDL 184
           +I+ + LL+++    +KP    I+ R+K+I+  +E A   + ++E+    +  +   +K     I+EN +  AE   ++I + A  +A  I      +I+++  + E     +  +L+LE +   L + IDE+ ++++I++ ++ +
  S:    12 IINFLLLLVVLSYFLFKPVNEIIDKRSKDIEGDIEQARIDKDKAEELRIANEEEYKAAKKEGKIIVENYKAKAENVSEEIISDAHKEAEIIIERAKKEIQREREKAEYEIKNKTIELSLELSKKALERSIDEKMHRELIEEFISKV 157
>gi|11466685|ref|NP_039281.1| ATP synthase CF0 B subunit [Marchantia polymorpha] >gi|114621|sp|P06291|ATPF_MARPO ATP synthase B chain (ATPase subunit I) >gi|453592|emb|CAA28067.1| atpF [Marchantia polymorpha] (184 aa)
Score = 83, Expect = 9.0e-01, Identities = 35/148 (23%), Positives = 73/148 (49%)
  Q:    31 NVYVLIAHVISLIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIID 178
           N  +L  ++I+L  +L L++        + +  R   I   ++ AE+   E+   L+ +R +L ++K  A +I  N     EK K+ +   A   + ++E    + I+ ++    ++   +VS+LALE A   L  +++ E + ++ID
  S:    23 NTNLLETNLINLGVVLGLLVYFGKGVLSNLLNNRKLTILNTIQDAEERYKEATDKLNQARTRLQQAKQKADDIRINGLSQMEKEKQDLINAADEDSKRLEDSKNATIRFEKQRAIEQVRQQVSRLALERALETLKSRLNSELHLRMID 170
>gi|118054093|ref|ZP_01522634.1| ATP synthase F0, B subunit [Comamonas testosteroni KF-1] >gi|117998515|gb|EAV12678.1| ATP synthase F0, B subunit [Comamonas testosteroni KF-1] (156 aa)
Score = 83, Expect = 9.9e-01, Identities = 33/147 (22%), Positives = 71/147 (48%)
  Q:    42 LIFLLLLVIRLAWKPTKSYIEARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKIDEEENKKIIDDIVNDLTAKL 188
            + L L  ++  W P    ++ R ++I   + AA+KA+ E          +L +++N  A  + +AE  A+   ++ +A A  + ++I +   ++  +Q +   +    +V+ LA++ A   L K++    N  I  D++N L  +L
  S:    14 FLVLALFTMKFVWPPIAKALDERAQKIADGLAAADKAKTELTAVNKRVEQELAQTRNETASRLADAERRAQAIIEEAKARATEEGNKIVAAARAEADQQAIAAREALREQVAALAVKGAEQILKKEV----NAGIHADLLNRLKTEL 156
>gi|115445637|ref|NP_001046598.1| Os02g0293300 [Oryza sativa (japonica cultivar-group)] >gi|47847697|dbj|BAD21477.1| putative X1 [Oryza sativa Japonica Group] >gi|113536129|dbj|BAF08512.1| Os02g0293300 [Oryza sativa (japonica cultivar-group)] >gi|125581732|gb|EAZ22663.1| hypothetical protein OsJ_006146 [Oryza sativa (japonica cultivar-group)] (628 aa)
Score = 83, Expect = 9.9e-01, Identities = 34/114 (29%), Positives = 62/114 (54%)
  Q:    63 ARTKEIQRKMEAAEKAQLESEKNLHISRIKLLESKNTAAEIIENAELDAEKTKKKIEAVALNKASQIESEGYSKIKKQELELEKRKNLEVSKLALETAGIFLSKKID---EEENKKI 176
           A+T   +RK+E+  K   E   ++H++RI+  +S     +++E          KK + +ALNK  Q+E +   K +K ELE+++ +   +    +E  G+ + K+ D   EE N+KI
  S:   340 AQTDIERRKLESEMKKNSEQNDSIHMARIEQQKSDKNVLKLVEK--------HKKEKEIALNKILQLEKQLDEK-QKLELEIQQLRGRLLVVQHMEGEGVDVKKRTDELTEELNEKI 447