>gi|26553511|ref|NP_757445.1| ATP synthase subunit delta [Mycoplasma penetrans HF-2] >gi|26453517|dbj|BAC43849.1| ATP synthase subunit delta [Mycoplasma penetrans HF-2] (188 aa)
Score = 765, Expect = 7.3e-80, Identities = 188/188 (100%), Positives = 188/188 (100%)
  Q:     1 MEEKNHIDHYANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIENNKEV 188
           MEEKNHIDHYANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIENNKEV
  S:     1 MEEKNHIDHYANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIENNKEV 188
>gi|6014717|gb|AAF01477.1| F1FO ATPase delta subunit [Acetobacterium woodii] (180 aa)
Score = 173, Expect = 3.8e-11, Identities = 50/175 (28%), Positives = 102/175 (58%)
  Q:    10 YANALYSIWLELDKKNKIIFT-SSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIEN 184
           YA AL+ + ++ D+ ++I     +A D++ S K   ++  ++  ++ + E+K  ++  +     +S+SN Y+KN+L +L D N F+ I +I+ +F +  +EH+N +  R+ +   +++ L   +E   + +  K+V  EN IDKS++GG  +  G+ + D SIK ++ Q+K  + N
  S:     8 YARALFDVAVDKDQLDEIFSDFKTATDLFSSEKKFMDL--MLTPSLNTGEKKGILMRSL-----ESLSNQYVKNYLMILMDKNRFEDIFDIYEAFRKLCNEHKNLVEARVLTVIPLDETLRIALEENLAKRFNKKVILENEIDKSILGGAVVYVGDQIIDGSIKNQLSQMKKQVNN 176
>gi|188587437|ref|YP_001918982.1| ATP synthase F1, delta subunit [Natranaerobius thermophilus JW/NM-WN-LF] >gi|179352124|gb|ACB86394.1| ATP synthase F1, delta subunit [Natranaerobius thermophilus JW/NM-WN-LF] (179 aa)
Score = 169, Expect = 8.8e-11, Identities = 46/170 (27%), Positives = 92/170 (54%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           YA AL+ +  E +K N+I  T S   +   L++N E+  ++   ++   EK ++ +++  DL + I     +++L VL DN     + EI  +F   +   +N     + +P  +++  L+KI+ L +  +   V  E   D+S+IGG+ +  G+ V+DYS+KG+++ ++
  S:     7 YAEALFQLAKEREKINEI--TQSFNQLIERLRSNEEVFKLLSYPVVDIAEKKQVADELTADLEQEI-----RDYLKVLIDNKRTDELAEIHDTFLDLVRTEENRTLCEVKTPIPLDEDELKKIQDLLAQMSEGEVEIETTTDESIIGGIVVRIGDRVFDYSLKGQLNSLR 169
>gi|56421896|ref|YP_149214.1| F0F1 ATP synthase subunit delta [Geobacillus kaustophilus HTA426] >gi|56381738|dbj|BAD77646.1| F0F1-type ATP synthasedelta chain [Geobacillus kaustophilus HTA426] (178 aa)
Score = 164, Expect = 3.9e-10, Identities = 46/170 (27%), Positives = 89/170 (52%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKR-VRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           YA+AL+ I LE  + ++I      + +  +L  N E + ++    +S ++K  ++ + F  +S  + N      L +L + + F  + E+   F   +D+ +       YS   +  + L  +  +F+ K GK+ +  ENIID  LIGG+K+  GN +YD S+ G++++I+
  S:    10 YASALFQIALEQGQLDRI--EEDVRAVRQALAENGEFLSLLSYPKLSLDQKKALIREAFAGVSTPVQNT-----LLLLLERHRFGLVPELAEQFLALVDDARGIAKAVAYSARPLTDEELRALSDVFAQKVGKQTLEIENIIDPELIGGVKLRIGNRIYDGSVSGQLERIR 173
>gi|83591197|ref|YP_431206.1| ATP synthase F1, delta subunit [Moorella thermoacetica ATCC 39073] >gi|1929510|gb|AAB51463.1| ATP synthase subunit delta >gi|83574111|gb|ABC20663.1| ATP synthase F1, delta subunit [Moorella thermoacetica ATCC 39073] (178 aa)
Score = 158, Expect = 1.7e-09, Identities = 45/176 (25%), Positives = 89/176 (50%)
  Q:     1 MEEKNHIDHYANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKID 176
           M E+N    YA AL++I  E     +  F +  +++  +L  N +   ++   +I   EK K+++ IF D+     N  LKNFL ++      + + E+   F + +D+ +N L + + S   + + +L  ++   +  T + +R  + ++  LIGG+ I  G+ V D S+K K++
  S:     1 MSEQNVARRYARALFNIAREQGTAGE--FANGLEEVSRTLAENSDFRRVLYHQLIPVREKQKLIDTIFPDI-----NPLLKNFLHLVLAKGRERALPEMAAQFRRLVDQAENILPVEVTSAITLREDILAGLKERLAGITRRNIRLSSRVNPELIGGVVIRLGDRVLDASVKKKLE 169
>gi|1168584|sp|P42008|ATPD_BACST ATP synthase delta chain >gi|534851|dbj|BAA07252.1| ATPase subunit delta [Geobacillus stearothermophilus] (178 aa)
Score = 157, Expect = 2.2e-09, Identities = 45/170 (26%), Positives = 91/170 (53%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRY-ENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           YA+AL+ I LE  + ++I      + +  +L  N E + ++ +  +S E+K  ++ ++F  +S  +     KN L +L + + F  + E+   F    ++ +       YS   +  + L+ +  +F+ K GK   + ENI++  LIGG+K+  GN +YD S+ G++++I+
  S:    10 YASALFQIALEQQQLDRI--EEDVRAVRQALAENGEFLSLLSNPNLSLEKKKALVREVFAGVSAPV-----KNTLLLLLERHRFGLVPELADQFIALANDARGIAEAIAYSARPLTDEELQALSDVFAKKVGKATLHIENIVEPELIGGVKLRIGNRIYDGSVSGQLERIQ 173
>gi|728924|sp|P41011|ATPD_BACCA ATP synthase delta chain >gi|533287|dbj|BAA07246.1| ATPase subunit delta [Bacillus caldotenax] (178 aa)
Score = 155, Expect = 4.7e-09, Identities = 45/170 (26%), Positives = 86/170 (50%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKR-VRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           YA+AL+ I LE  + ++I        +  +L  N E + ++    +S ++K  ++ + F   S  + N      L +L + + F  + E+   F   +D+ +       YS   +  + L  +  +F+ K GK+ +  ENIID  LIGG+ +  GN +YD S+ G++++I+
  S:    10 YASALFQIALEQGQLDRI--EEDVPAVRQALAENGEFLSLLSYPKLSLDQKKALIREAFAGASTPVQNT-----LLLLLERHSFGLVPELAEQFLALVDDARGIAKAVAYSARRLTDEELRALSDVFAQKVGKQTLEIENIIDPELIGGVNVRIGNRIYDGSVSGQLERIR 173
>gi|163942996|ref|YP_001647880.1| F0F1 ATP synthase subunit delta [Bacillus weihenstephanensis KBAB4] >gi|163865193|gb|ABY46252.1| ATP synthase F1, delta subunit [Bacillus weihenstephanensis KBAB4] (180 aa)
Score = 152, Expect = 9.6e-09, Identities = 53/177 (29%), Positives = 91/177 (51%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGK-RVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIENNK 186
           YA AL+ I  E  K    +F    + +      N E+   +    ISKE+K   L  +F  +S+SI N      L++L DN     + EI   +    +E +N     +YS  ++ ++    I   F+ KTGK  +R +N++D+ L+GG+K+  GN +YD S++GK+ +I+  +  N+
  S:    10 YAVALFKIAKE--KHVLEMFEEELRLVQNVFTKNGELHSFLTQPNISKEQKKTFLANVFASVSESILNT-----LYILIDNKRIDILPEIANEYVVLANEERNVADATVYSIRLLSEEEKLNIAEAFAKKTGKDAIRVKNVVDEDLLGGIKVRIGNRIYDGSLQGKLARIQRELMKNR 180
>gi|138896938|ref|YP_001127391.1| F0F1 ATP synthase subunit delta [Geobacillus thermodenitrificans NG80-2] >gi|196249755|ref|ZP_03148451.1| ATP synthase F1, delta subunit [Geobacillus sp. G11MC16] >gi|134268451|gb|ABO68646.1| ATPase delta subunit [Geobacillus thermodenitrificans NG80-2] >gi|196210631|gb|EDY05394.1| ATP synthase F1, delta subunit [Geobacillus sp. G11MC16] (178 aa)
Score = 151, Expect = 1.3e-08, Identities = 44/170 (25%), Positives = 90/170 (52%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKR-VRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           YA+AL+ I LE  + ++I      + +  +L  N E + ++ +  +S ++K  ++ + F  +S  + +      L +L + + F  + E+   F    ++ +       YS   +  + L+ +  +F+ K GK  +R ENI+D  LIGG+K+  GN +YD S+ G++++I+
  S:    10 YASALFQIALEQQQLDQI--EEDIRAVRQALAENGEFLSLLSNPKLSLDKKKALVREAFAGVSAPVQHT-----LLLLLERHRFGIVPELAEQFIALANDARGIAEAVAYSARPLTDEELQALSDVFAKKVGKETLRIENIVDPELIGGVKLRIGNRIYDGSVSGQLERIQ 173
>gi|172058684|ref|YP_001815144.1| ATP synthase F1, delta subunit [Exiguobacterium sibiricum 255-15] >gi|171991205|gb|ACB62127.1| ATP synthase F1, delta subunit [Exiguobacterium sibiricum 255-15] (177 aa)
Score = 151, Expect = 1.3e-08, Identities = 44/176 (25%), Positives = 90/176 (51%)
  Q:     4 KNHI-DHYANALYSIWLE---LDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           ++H+   YA AL+ + LE   LD+       +  + +   L    E+  ++++  IS EE  ++L   F        N  + N + V+ +N+    +L +   F   L+EH+N     + S + +  + L  ++  F  K+GK +  EN++D ++IGG+++  G   YD +I+ K+ +++
  S:     2 RDHVAGRYAKALFDLALEHHVLDQAE-----ADVRTLGEVLHATPELASVLENPSISAEELKQVLQTSFTGF-----NTIVLNTILVMVENDRASEVLSLPEHFIALLNEHRNVATAIVTSAYKLSDEELTNVKETFGQKSGKTLEVENVVDTNVIGGLRVQIGYTTYDGTIETKLTRLE 171
>gi|30023340|ref|NP_834971.1| F0F1 ATP synthase subunit delta [Bacillus cereus ATCC 14579] >gi|42784478|ref|NP_981725.1| F0F1 ATP synthase subunit delta [Bacillus cereus ATCC 10987] >gi|47569803|ref|ZP_00240474.1| ATP synthase F1, delta subunit [Bacillus cereus G9241] >gi|166984517|ref|ZP_02255858.1| F0F1 ATP synthase subunit delta [Bacillus cereus AH187] >gi|167940244|ref|ZP_02527319.1| F0F1 ATP synthase subunit delta [Bacillus cereus AH1134] >gi|168136014|ref|ZP_02579243.1| F0F1 ATP synthase subunit delta [Bacillus cereus B4264] >gi|168162318|ref|ZP_02597551.1| F0F1 ATP synthase subunit delta [Bacillus cereus H3081.97] >gi|29898901|gb|AAP12172.1| ATP synthase delta chain [Bacillus cereus ATCC 14579] >gi|42740410|gb|AAS44333.1| ATP synthase F1, delta subunit [Bacillus cereus ATCC 10987] >gi|47553545|gb|EAL11925.1| ATP synthase F1, delta subunit [Bacillus cereus G9241] (180 aa)
Score = 150, Expect = 1.6e-08, Identities = 44/144 (30%), Positives = 79/144 (54%)
  Q:    43 NYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGK-RVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIENNK 186
           N E+   +    ISKE+K   L  +F  +S+SI N      L++L DN     + EI   +    +E +N     +YS  ++ ++    I   F+ +TGK  +R +N++D+ L+GG+K+  GN +YD S++GK+ +I+  +  N+
  S:    41 NGELHSFLTQPNISKEQKKTFLANVFGSVSESILNT-----LYILIDNKRIDILPEIADEYVVLANEERNVADATVYSTRLLSEEEKLNIAEAFAKRTGKDAIRVKNVVDEDLLGGIKVRIGNRIYDGSLQGKLARIQRELMKNR 180
>gi|152977495|ref|YP_001377012.1| F0F1 ATP synthase subunit delta [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|152026247|gb|ABS24017.1| ATP synthase F1, delta subunit [Bacillus cereus subsp. cytotoxis NVH 391-98] (180 aa)
Score = 149, Expect = 1.8e-08, Identities = 44/144 (30%), Positives = 80/144 (55%)
  Q:    43 NYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGK-RVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIENNK 186
           N E+   +    ISKE+K   L+ +F  +S+SI N      L++L DN   + +  I   +    +E +N     +YS  ++ ++    I   F+ +TGK  +R +NI+D+ L+GG+K+  GN +YD S++GK+ +I+  +  N+
  S:    41 NEELHSFLTKPNISKEQKKMFLSNVFSSVSESILNT-----LYILVDNKRIEILPAIANEYVTLANEERNVADATVYSTRLLSEEEKLNIAEAFAKRTGKDAIRVKNIVDEDLLGGIKVRIGNRIYDGSLQGKLARIQRELMKNR 180
>gi|30265331|ref|NP_847708.1| F0F1 ATP synthase subunit delta [Bacillus anthracis str. Ames] >gi|47530870|ref|YP_022219.1| F0F1 ATP synthase subunit delta [Bacillus anthracis str. 'Ames Ancestor'] >gi|49188144|ref|YP_031397.1| F0F1 ATP synthase subunit delta [Bacillus anthracis str. Sterne] >gi|49480408|ref|YP_039300.1| F0F1 ATP synthase subunit delta [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|52140252|ref|YP_086577.1| F0F1 ATP synthase subunit delta [Bacillus cereus E33L] >gi|65317285|ref|ZP_00390244.1| COG0712: F0F1-type ATP synthase, delta subunit (mitochondrial oligomycin sensitivity protein) [Bacillus anthracis str. A2012] >gi|118480347|ref|YP_897498.1| F0F1 ATP synthase subunit delta [Bacillus thuringiensis str. Al Hakam] >gi|165873331|ref|ZP_02217934.1| ATP synthase F1, delta subunit [Bacillus anthracis str. A0488] >gi|166996500|ref|ZP_02262960.1| F0F1 ATP synthase subunit delta [Bacillus cereus AH820] >gi|167636403|ref|ZP_02394703.1| ATP synthase F1, delta subunit [Bacillus anthracis str. A0442] >gi|167642059|ref|ZP_02400285.1| ATP synthase F1, delta subunit [Bacillus anthracis str. A0193] >gi|170689701|ref|ZP_02880878.1| ATP synthase F1, delta subunit [Bacillus anthracis str. A0465] >gi|170709424|ref|ZP_02899832.1| ATP synthase F1, delta subunit [Bacillus anthracis str. A0389] >gi|177656033|ref|ZP_02937140.1| ATP synthase F1, delta subunit [Bacillus anthracis str. A0174] >gi|190569417|ref|ZP_03022301.1| ATP synthase F1, delta subunit [Bacillus anthracis Tsiankovskii-I] >gi|196036269|ref|ZP_03103667.1| ATP synthase F1, delta subunit [Bacillus cereus W] >gi|196039595|ref|ZP_03106900.1| ATP synthase F1, delta subunit [Bacillus cereus NVH0597-99] >gi|196045656|ref|ZP_03112886.1| ATP synthase F1, delta subunit [Bacillus cereus 03BB108] >gi|30260009|gb|AAP29194.1| ATP synthase F1, delta subunit [Bacillus anthracis str. Ames] >gi|47506018|gb|AAT34694.1| ATP synthase F1, delta subunit [Bacillus anthracis str. 'Ames Ancestor'] >gi|49182071|gb|AAT57447.1| ATP synthase F1, delta subunit [Bacillus anthracis str. Sterne] >gi|49331964|gb|AAT62610.1| ATP synthase F1, delta subunit [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|51973721|gb|AAU15271.1| ATP synthase F1, delta subunit [Bacillus cereus E33L] >gi|118419572|gb|ABK87991.1| ATP synthase F1, delta subunit [Bacillus thuringiensis str. Al Hakam] >gi|164710928|gb|EDR16502.1| ATP synthase F1, delta subunit [Bacillus anthracis str. A0488] >gi|167509977|gb|EDR85397.1| ATP synthase F1, delta subunit [Bacillus anthracis str. A0193] >gi|167528237|gb|EDR91019.1| ATP synthase F1, delta subunit [Bacillus anthracis str. A0442] >gi|170125657|gb|EDS94576.1| ATP synthase F1, delta subunit [Bacillus anthracis str. A0389] >gi|170666343|gb|EDT17129.1| ATP synthase F1, delta subunit [Bacillus anthracis str. A0465] >gi|172079888|gb|EDT64997.1| ATP synthase F1, delta subunit [Bacillus anthracis str. A0174] >gi|190559472|gb|EDV13473.1| ATP synthase F1, delta subunit [Bacillus anthracis Tsiankovskii-I] >gi|195991061|gb|EDX55031.1| ATP synthase F1, delta subunit [Bacillus cereus W] >gi|196023487|gb|EDX62164.1| ATP synthase F1, delta subunit [Bacillus cereus 03BB108] >gi|196029755|gb|EDX68357.1| ATP synthase F1, delta subunit [Bacillus cereus NVH0597-99] (180 aa)
Score = 148, Expect = 2.4e-08, Identities = 51/177 (28%), Positives = 92/177 (51%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGK-RVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIENNK 186
           YA AL+ I  E  K    +F    + +    + N E+   +    ISKE+K   L  +F  +S+SI N      L++L DN     + +I   +    +E +N     +YS  ++ ++    I   F+ +TGK  +R +N++D+ L+GG+K+  GN +YD S++GK+ +I+  +  N+
  S:    10 YAVALFKIAKE--KHVLEMFEEELRLVQNVYEKNGELHSFLTQPNISKEQKKTFLANVFGSVSESILNT-----LYILIDNKRIDILSDIANEYVVLANEERNVADATVYSTRLLSEEEKLNIAEAFAKRTGKDAIRVKNVVDEDLLGGIKVRIGNRIYDGSLQGKLARIQRELMKNR 180
>gi|82751707|ref|YP_417448.1| F0F1 ATP synthase subunit delta [Staphylococcus aureus RF122] >gi|82657238|emb|CAI81679.1| ATP synthase delta chain [Staphylococcus aureus RF122] (179 aa)
Score = 148, Expect = 2.5e-08, Identities = 49/172 (28%), Positives = 90/172 (52%)
  Q:     8 DHYANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNII-SKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTG-KRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           + YA AL+ +   LD  N          I  ++K+  E + ++DSN   + E++ +++N +F D+     N Y+KN ++VL DN     I ++F +F    + H N  F  I S + + ++ L+KI  L + +T   +V  +  I+  LIGG ++  G  V D S++  + Q++
  S:     6 NKYAKALFDV--SLDTNNLETINEELTVINEAVKDKIEQLKMVDSNPTQTAEQRRELINGVFIDI-----NPYIKNMMYVLADNRHISLIADVFKAFQSLYNGHYNQDFATIESTYELSQEELDKIVKLVTQQTKLSKVIVDTKINPDLIGGFRVKVGTTVLDGSVRNDLVQLQ 172
>gi|57652128|ref|YP_186913.1| F0F1 ATP synthase subunit delta [Staphylococcus aureus subsp. aureus COL] >gi|87160574|ref|YP_494707.1| F0F1 ATP synthase subunit delta [Staphylococcus aureus subsp. aureus USA300] >gi|88196010|ref|YP_500823.1| F0F1 ATP synthase subunit delta [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|151222222|ref|YP_001333044.1| F0F1 ATP synthase subunit delta [Staphylococcus aureus subsp. aureus str. Newman] >gi|161510313|ref|YP_001575972.1| F0F1 ATP synthase subunit delta [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|168728866|ref|ZP_02761143.1| F-ATPase superfamily proton (H+)- or sodium (Na+)-translocating F-type ATPase delta subunit [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|81694060|sp|Q5HE94|ATPD_STAAC ATP synthase delta chain >gi|57286314|gb|AAW38408.1| ATP synthase F1, delta subunit [Staphylococcus aureus subsp. aureus COL] >gi|87126548|gb|ABD21062.1| ATP synthase F1, delta subunit [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|87203568|gb|ABD31378.1| ATP synthase F1, delta subunit [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|150375022|dbj|BAF68282.1| ATP synthase F1, delta subunit [Staphylococcus aureus subsp. aureus str. Newman] >gi|160369122|gb|ABX30093.1| F-ATPase superfamily proton (H+)- or sodium (Na+)-translocating F-type ATPase delta subunit [Staphylococcus aureus subsp. aureus USA300_TCH1516] (179 aa)
Score = 148, Expect = 2.5e-08, Identities = 49/172 (28%), Positives = 90/172 (52%)
  Q:     8 DHYANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNII-SKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTG-KRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           + YA AL+ +   LD  N          I  ++K+  E + ++DSN   + E++ +++N +F D+     N Y+KN ++VL DN     I ++F +F    + H N  F  I S + + ++ L+KI  L + +T   +V  +  I+  LIGG ++  G  V D S++  + Q++
  S:     6 NKYAKALFDV--SLDTNNLETINEELTVINEAVKDKIEQLRMVDSNPTQTAEQRRELINGVFTDI-----NPYIKNMMYVLADNRHISLIADVFKAFQSLYNGHYNQDFATIESTYELSQEELDKIVKLVTQQTKLSKVIVDTKINPDLIGGFRVKVGTTVLDGSVRNDLVQLQ 172
>gi|75763711|ref|ZP_00743388.1| ATP synthase delta chain [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|168142838|ref|ZP_02586067.1| F0F1 ATP synthase subunit delta [Bacillus cereus G9842] >gi|74488803|gb|EAO52342.1| ATP synthase delta chain [Bacillus thuringiensis serovar israelensis ATCC 35646] (180 aa)
Score = 147, Expect = 3.1e-08, Identities = 44/144 (30%), Positives = 79/144 (54%)
  Q:    43 NYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGK-RVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIENNK 186
           N E+   +    ISKE+K   L  +F  +S+SI N      L++L DN     + EI   +    +E +N     +YS  ++ ++    I   F+ +TGK  +R +N++D+ L+GG+K+  GN +YD S++GK+ +I+  +  N+
  S:    41 NGELHSFLTQPNISKEQKKTFLANVFGSVSESILNT-----LYILIDNKRIDILPEIADEYVVLANEERNVADATVYSIRLLSEEEKLNIAEAFAKRTGKDAIRVKNVVDEDLLGGIKVRIGNRIYDGSLQGKLARIQRELMKNR 180
>gi|15925096|ref|NP_372630.1| F0F1 ATP synthase subunit delta [Staphylococcus aureus subsp. aureus Mu50] >gi|15927680|ref|NP_375213.1| F0F1 ATP synthase subunit delta [Staphylococcus aureus subsp. aureus N315] >gi|21283759|ref|NP_646847.1| F0F1 ATP synthase subunit delta [Staphylococcus aureus subsp. aureus MW2] >gi|49486899|ref|YP_044120.1| F0F1 ATP synthase subunit delta [Staphylococcus aureus subsp. aureus MSSA476] >gi|148268557|ref|YP_001247500.1| F0F1 ATP synthase subunit delta [Staphylococcus aureus subsp. aureus JH9] >gi|150394621|ref|YP_001317296.1| F0F1 ATP synthase subunit delta [Staphylococcus aureus subsp. aureus JH1] >gi|156980421|ref|YP_001442680.1| F0F1 ATP synthase subunit delta [Staphylococcus aureus subsp. aureus Mu3] >gi|54036775|sp|P63659|ATPD_STAAW ATP synthase delta chain >gi|54036792|sp|P99109|ATPD_STAAN ATP synthase delta chain >gi|54040845|sp|P63658|ATPD_STAAM ATP synthase delta chain >gi|60389596|sp|Q6G7K4|ATPD_STAAS ATP synthase delta chain >gi|13701900|dbj|BAB43192.1| ATP synthase delta chain [Staphylococcus aureus subsp. aureus N315] >gi|14247879|dbj|BAB58268.1| ATP synthase delta chain [Staphylococcus aureus subsp. aureus Mu50] >gi|21205201|dbj|BAB95895.1| ATP synthase delta chain [Staphylococcus aureus subsp. aureus MW2] >gi|49245342|emb|CAG43817.1| putative ATP synthase delta chain [Staphylococcus aureus subsp. aureus MSSA476] >gi|147741626|gb|ABQ49924.1| ATP synthase F1, delta subunit [Staphylococcus aureus subsp. aureus JH9] >gi|149947073|gb|ABR53009.1| ATP synthase F1, delta subunit [Staphylococcus aureus subsp. aureus JH1] >gi|156722556|dbj|BAF78973.1| ATP synthase delta chain [Staphylococcus aureus subsp. aureus Mu3] (179 aa)
Score = 147, Expect = 3.5e-08, Identities = 49/172 (28%), Positives = 90/172 (52%)
  Q:     8 DHYANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNII-SKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTG-KRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           + YA AL+ +   LD  N          I  ++K+  E + ++DSN   + E++ +++N +F D+     N Y+KN ++VL DN     I ++F +F    + H N  F  I S + + ++ L+KI  L + +T   +V  +  I+  LIGG ++  G  V D S++  + Q++
  S:     6 NKYAKALFDV--SLDTNNLETINEELTVINEAVKDKIEQLKMVDSNPTQTAEQRRELINGVFTDI-----NPYIKNMMYVLADNRHISLIADVFKAFQSLYNGHYNQDFATIESTYELSQEELDKIVKLVTQQTKLSKVIVDTKINPDLIGGFRVKVGTTVLDGSVRNDLVQLQ 172
>gi|2662063|dbj|BAA23685.1| proton-translocating ATPase, delta subunit [Ruminococcus albus] (182 aa)
Score = 144, Expect = 7.0e-08, Identities = 44/175 (25%), Positives = 84/175 (48%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIEN 184
           Y+ AL+ +  E DK  K+    S  +         + +  + S +IS +EK+  +  +F D   ++    L +FL +  + N   ++ EI+  F +  ++    L +   +   +  +L +++       TGKR+     IDKS+IGG+ + +GN   D S+K ++D +K  I N
  S:     9 YSTALFELCTEQDKLEKVFSDYSEFEALMKNSECADYLRFLASPLISGQEKSDSIKAVFGDKIDAL----LLDFLCLTAEKNRADKLDEIYGEFRKMYNDKLGLLEVTAVTAQPMTAELRDRLTDKLGRTTGKRIVLTEEIDKSIIGGIIVRYGNTELDSSVKTRLDNLKAQITN 179
>gi|49484330|ref|YP_041554.1| F0F1 ATP synthase subunit delta [Staphylococcus aureus subsp. aureus MRSA252] >gi|60389621|sp|Q6GEW9|ATPD_STAAR ATP synthase delta chain >gi|49242459|emb|CAG41175.1| putative ATP synthase delta chain [Staphylococcus aureus subsp. aureus MRSA252] (179 aa)
Score = 144, Expect = 8.4e-08, Identities = 49/172 (28%), Positives = 89/172 (51%)
  Q:     8 DHYANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNII-SKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTG-KRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           + YA AL+ +   LD  N          I  ++K+  E + ++DSN   + E++ +++N +F D+     N Y+KN ++VL DN     I ++F +F    + H N  F  I S + + ++ L KI  L + +T   +V  +  I+  LIGG ++  G  V D S++  + Q++
  S:     6 NKYAKALFDV--SLDTNNLETINEELTVINEAVKDKIEQLKMVDSNPTQTAEQRRELINGVFTDI-----NPYIKNMMYVLADNRHISLIADVFKAFQSLYNGHYNQDFATIESTYELSQEELVKIVKLVTQQTKLSKVIVDTKINPDLIGGFRVKVGTTVLDGSVRNDLVQLQ 172
>gi|167750154|ref|ZP_02422281.1| hypothetical protein EUBSIR_01123 [Eubacterium siraeum DSM 15702] >gi|167656897|gb|EDS01027.1| hypothetical protein EUBSIR_01123 [Eubacterium siraeum DSM 15702] (181 aa)
Score = 142, Expect = 1.4e-07, Identities = 47/173 (27%), Positives = 82/173 (47%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNF---FKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNI 182
           Y +AL+S+  E D+K         K +        + + ++ +  I  EEKT ++ ++F        + ++ NFL +L +N+    F+RIL  F   +   +E      + + S   +     EKI    +  TGK V      D  LIGG+ I +GN   D S+K +++Q+K +I
  S:     8 YGDALFSLVTEEDEKALPDILGQLKGVSEVFAAEPDFIKLLRTPTIPIEEKTALVKEVF----DGKVHKFVGNFLCILTENDRLPDFERILAYFTGLY---NEKLGIADVTVTSAMPLSDTAAEKIRAKMAEITGKTVNMTLKTDDKLIGGVVISYGNTTIDGSVKARLEQLKADI 176
>gi|169335790|ref|ZP_02862983.1| hypothetical protein ANASTE_02215 [Anaerofustis stercorihominis DSM 17244] >gi|169258528|gb|EDS72494.1| hypothetical protein ANASTE_02215 [Anaerofustis stercorihominis DSM 17244] (180 aa)
Score = 140, Expect = 2.1e-07, Identities = 44/154 (28%), Positives = 78/154 (50%)
  Q:    35 DIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIENNKEV 188
           D Y  L  + E+  ++      KE+K ++++ +F        NI LKNFLF+L D N    I  I++ F     EH   L + + S   + ++L+  +++  S K  K++     +DK++IGGM +     + D S+K ++D IK  ++  K V
  S:    31 DFYELLNKSEELYTLLSDETFKKEDKKRVIDNVF----DKDDNIMLKNFLFLLVDKNRIGEIKLIYLDFKNLYLEHSGILNVEVKSANELSEELIGSLKNKLSDKFNKKIILSKSVDKNIIGGMILYINGKMIDLSVKNELDMIKRQLKETKIV 180
>gi|17227502|ref|NP_484050.1| F0F1 ATP synthase subunit delta [Nostoc sp. PCC 7120] >gi|114576|sp|P12406|ATPD_ANASP ATP synthase delta chain >gi|79753|pir||F31090 H+-transporting two-sector ATPase (EC 3.6.3.14) delta chain - Anabaena sp >gi|142002|gb|AAA21990.1| ATP synthase subunit delta [Nostoc sp. PCC 7120] >gi|17134984|dbj|BAB77530.1| ATP synthase subunit delta [Nostoc sp. PCC 7120] (183 aa)
Score = 140, Expect = 2.2e-07, Identities = 48/176 (27%), Positives = 89/176 (50%)
  Q:    10 YANALYSIWLELDKKNKII---FTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNN---FFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIENN 185
           YA AL SI      K+K +   F + A+ +   L  N ++ + ID+  I+ E K  ++ +I  + S      YL+NFL +L D     F   IL+ +++  ++L+  Q  L     +  + E +     E + ++   ++V     +D  LIGG+ I  G+ V D SI+G++ ++   + N+
  S:    14 YAQALLSI-----AKSKSLTEEFGTDARTLLNLLTENQQLRNFIDNPFIAAENKKALIKQILSEASP-----YLRNFLLLLVDKRRIFFLPEILQQYLALLRQLN--QTVLAEVTSAVALTEDQQQAVTEKVLALTKARQVELATKVDSDLIGGVIIKVGSQVIDSSIRGQLRRLSLRLSNS 183
>gi|109648041|ref|ZP_01371944.1| ATP synthase F1, delta subunit [Desulfitobacterium hafniense DCB-2] >gi|109641131|gb|EAT50686.1| ATP synthase F1, delta subunit [Desulfitobacterium hafniense DCB-2] (178 aa)
Score = 140, Expect = 2.3e-07, Identities = 46/175 (26%), Positives = 90/175 (51%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFF-DLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIEN 184
           YA AL+ + ++   +N     +  +++   ++ N E+ H++    IS  EK  ++NKIF  +LS     + ++NFL +L D      +LEI   F +  DE +N +  ++ S   + +   +++    +  TGK VR    +   LIGG+ I  G+ V D ++  K+ +I+ ++ +
  S:    10 YAQALFELAVQ---ENLDGIEAELQELVQCVEQNAEVAHVLYHPHISLSEKKDLMNKIFAGELS-----VTVRNFLNLLIDRRRQNYLLEIARVFARLADEARNIVEAKVASAIPLSETQEQRLHQELARMTGKNVRMVKEVRPELIGGVMIQIGDRVMDGTVAFKLQRIRQSLSH 177
>gi|16804570|ref|NP_466055.1| F0F1 ATP synthase subunit delta [Listeria monocytogenes EGD-e] >gi|153175784|ref|ZP_01931088.1| ATP synthase F1, delta subunit [Listeria monocytogenes FSL N3-165] >gi|167058607|ref|ZP_02280864.1| F0F1 ATP synthase subunit delta [Listeria monocytogenes FSL F2-515] >gi|167405359|ref|ZP_02310116.1| F0F1 ATP synthase subunit delta [Listeria monocytogenes FSL J2-003] >gi|16412020|emb|CAD00610.1| atpH [Listeria monocytogenes] >gi|133729209|gb|EBA30907.1| ATP synthase F1, delta subunit [Listeria monocytogenes FSL N3-165] (179 aa)
Score = 139, Expect = 2.7e-07, Identities = 43/174 (24%), Positives = 95/174 (54%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGK-RVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIE 183
           YANAL+ +    DK    +F+    ++  +LK N + V ++++   + E+K  + + +F  +     N  L++F+++L D +    +  I   + +++++ +      +YS   + ++ L  +  +F+ K  K ++  +N IDKSL+GG+K++ G  +YD S+K K+  ++  I+
  S:    11 YANALFQV--AQDKDLVDVFSEELTELKAALKANKDFVKLLENPTFTTEQKKNLASAVFEKI-----NPTLRDFIYLLIDRSREDYLSVIADVYQKRVNDLRGVADADVYSVVPLSEQELTALSRVFATKMNKTKLNIQNHIDKSLLGGVKVVIGTRIYDDSLKTKLKDMERQIK 178
>gi|153197162|ref|ZP_01941432.1| ATP synthase F1, delta subunit [Listeria monocytogenes 10403S] >gi|127633213|gb|EBA22630.1| ATP synthase F1, delta subunit [Listeria monocytogenes 10403S] (179 aa)
Score = 139, Expect = 3.0e-07, Identities = 43/174 (24%), Positives = 95/174 (54%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGK-RVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIE 183
           YANAL+ +    DK    +F+    ++  +LK N + V ++++   + E+K  + + +F  +     N  L++F+++L D +    +  I   + +++++ +      +YS   + ++ L  +  +F+ K  K ++  +N IDKSL+GG+K++ G  +YD S+K K+  ++  I+
  S:    11 YANALFQV--AQDKDLVDVFSEELTELKAALKANKDFVKLLENPTFTTEQKKNLASAVFEKI-----NPTLRDFIYLLIDRSREDYLSVIADVYQKRVNDLRGVADADVYSVVPLSEQELTALSRVFAAKMNKTKLNIQNHIDKSLLGGVKVVIGTRIYDDSLKTKLKDMERQIK 178
>gi|167015620|ref|ZP_02278153.1| F0F1 ATP synthase subunit delta [Listeria monocytogenes FSL J1-194] (179 aa)
Score = 139, Expect = 3.4e-07, Identities = 43/174 (24%), Positives = 94/174 (54%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGK-RVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIE 183
           YANAL+ +    DK    +F+    ++  +LK N + V ++++   + E+K  + + +F  +     N  L++F+++L D +    +  I   + +++++        +YS   + ++ L  +  +F+ K  K ++  +N IDKSL+GG+K++ G  +YD S+K K+  ++  I+
  S:    11 YANALFQV--AQDKDLVDVFSEELTELKAALKANEDFVKLLENPTFTTEQKKNLASAVFEKI-----NPTLRDFMYLLIDRSREDYLSVIADVYQKRVNDLNGVADADVYSVVPLSEQELTALSRVFATKMNKTKLNIQNHIDKSLLGGVKVVIGTRIYDDSLKTKLKDMERQIK 178
>gi|116873896|ref|YP_850677.1| F0F1 ATP synthase subunit delta [Listeria welshimeri serovar 6b str. SLCC5334] >gi|116742774|emb|CAK21898.1| atpH [Listeria welshimeri serovar 6b str. SLCC5334] (179 aa)
Score = 139, Expect = 3.4e-07, Identities = 43/174 (24%), Positives = 94/174 (54%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGK-RVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIE 183
           YANAL+ +    DK    +F+    ++  +L  N + V ++++   + E+K  + + +F  +     N  L++F+++L D N    +  I   + +++++ +      +YS   + ++ L  +  +F+ K  K ++  +N IDKSL+GG+K++ G  +YD S+K K+  ++  I+
  S:    11 YANALFQV--AQDKDLVDVFSEELTELKAALNANKDFVKLLENPTFTTEQKKNLASAVFEKI-----NPTLRDFIYLLIDRNREDYLSVIADVYQKRVNDLRGVADADVYSVIPLSEQELTALSRVFAAKMNKTKLNIQNHIDKSLLGGVKVVIGTRIYDDSLKTKLKDMERQIK 178
>gi|153168637|ref|ZP_01928460.1| ATP synthase F1, delta subunit [Listeria monocytogenes FSL N1-017] >gi|133726200|gb|EBA27898.1| ATP synthase F1, delta subunit [Listeria monocytogenes FSL N1-017] (179 aa)
Score = 138, Expect = 3.5e-07, Identities = 43/174 (24%), Positives = 94/174 (54%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGK-RVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIE 183
           YANAL+ +    DK    +F+    ++  +LK N + V ++++   + E+K  + + +F  +     N  L++F+++L D +    +  I   + +++++        +YS   + ++ L  +  +F+ K  K ++  +N IDKSL+GG+K++ G  +YD S+K K+  ++  I+
  S:    11 YANALFQV--AQDKDLVDVFSEELTELKAALKANEDFVKLLENPTFTTEQKKNLASAVFEKI-----NPTLRDFIYLLIDRSREDYLSVIADVYQKRVNDLNGVADAEVYSVVPLSEQELTALSRVFATKMNKTKLNIQNHIDKSLLGGVKVVIGTRIYDDSLKTKLKDMERQIK 178
>gi|46908704|ref|YP_015093.1| F0F1 ATP synthase subunit delta [Listeria monocytogenes str. 4b F2365] >gi|47094111|ref|ZP_00231835.1| ATP synthase F1, delta subunit [Listeria monocytogenes str. 4b H7858] >gi|153204118|ref|ZP_01944968.1| ATP synthase F1, delta subunit [Listeria monocytogenes HPB2262] >gi|46881976|gb|AAT05270.1| ATP synthase F1, delta subunit [Listeria monocytogenes str. 4b F2365] >gi|47017518|gb|EAL08327.1| ATP synthase F1, delta subunit [Listeria monocytogenes str. 4b H7858] >gi|133734350|gb|EBA36048.1| ATP synthase F1, delta subunit [Listeria monocytogenes HPB2262] (179 aa)
Score = 138, Expect = 4.4e-07, Identities = 43/174 (24%), Positives = 94/174 (54%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGK-RVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIE 183
           YANAL+ +    DK    +F+    ++  +LK N + V ++++   + E+K  + + +F  +     N  L++F+++L D +    +  I   + +++++        +YS   + ++ L  +  +F+ K  K ++  +N IDKSL+GG+K++ G  +YD S+K K+  ++  I+
  S:    11 YANALFQV--AQDKDLVDVFSEELTELKAALKANEDFVKLLENPTFTTEQKKNLASAVFEKI-----NPTLRDFIYLLIDRSREDYLSVIADVYQKRVNDLNGVADADVYSVVPLSEQELTALSRVFATKMNKTKLNIQNHIDKSLLGGVKVVIGTRIYDDSLKTKLKDMERQIK 178
>gi|89897661|ref|YP_521148.1| F0F1 ATP synthase subunit delta [Desulfitobacterium hafniense Y51] >gi|89337109|dbj|BAE86704.1| ATP synthase F1 delta subunit [Desulfitobacterium hafniense Y51] (178 aa)
Score = 137, Expect = 4.6e-07, Identities = 45/175 (25%), Positives = 89/175 (50%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFF-DLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIEN 184
           YA AL+ + ++   +N     +  +++   ++ N E+ H++    IS  EK  ++NKIF  +LS     + ++NFL +L D      ++EI   F    DE +N +  ++ S   + +   +++    +  TGK VR    +   LIGG+ I  G+ V D ++  K+ +I+ ++ +
  S:    10 YAQALFELAVQ---ENLDGIEAELQELVQCVEQNAEVAHVLYHPHISLSEKKDLMNKIFAGELS-----VTVRNFLNLLIDRRRQNYLMEIARVFAHLADEARNIVEAKVASAIPLSETQEQRLHQELARMTGKNVRMVKEVRPELIGGVMIQIGDRVMDGTVAFKLQRIRQSLSH 177
>gi|75908826|ref|YP_323122.1| F0F1 ATP synthase subunit delta [Anabaena variabilis ATCC 29413] >gi|75702551|gb|ABA22227.1| H+-transporting two-sector ATPase, delta (OSCP) subunit [Anabaena variabilis ATCC 29413] (183 aa)
Score = 137, Expect = 4.9e-07, Identities = 48/176 (27%), Positives = 90/176 (51%)
  Q:    10 YANALYSIWLELDKKNKII---FTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNN---FFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIENN 185
           YA AL SI      K+K +   F + A+ +   L  N ++ + ID+  I+ E K  ++ +I  + S      YL+NFL +L D     F + IL+ +++  ++L+  Q  L     +  + E +     E + ++   ++V     +D  LIGG+ I  G+ V D SI+G++ ++   + N+
  S:    14 YAQALLSI-----AKSKSLTEEFGTDARTLLNLLAENQQLRNFIDNPFIAAENKKALIKQILSEASP-----YLRNFLLLLVDKRRIFFLEEILQQYLALLRQLN--QTVLAEVTSAVALTEDQQQAVKEKVLALTKARQVELATKVDSDLIGGVIIKVGSQVIDSSIRGQLRRLSLRLSNS 183
>gi|119510740|ref|ZP_01629867.1| ATP synthase subunit D [Nodularia spumigena CCY9414] >gi|119464604|gb|EAW45514.1| ATP synthase subunit D [Nodularia spumigena CCY9414] (185 aa)
Score = 137, Expect = 5.7e-07, Identities = 42/157 (26%), Positives = 83/157 (52%)
  Q:    29 FTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNN---FFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIENN 185
           F   A+ +   L  N ++ + I +  I+ E K  ++  I   L +S  N YL+NFL +L D     F + +L+ +++  ++L+  Q  L   I +  + E +    +E + +I   ++V  ++ ID  LIGG+ I  G+ V D S++G++ ++   + +N
  S:    31 FGEDARSLLGLLSENQDLQNFIGNPFITGENKKALIRTI---LGES-GNAYLRNFLLLLVDKRRIVFLEAVLQQYLALLRQLN--QTVLAEVISAVPLSELQQQAVVEKVLAITNARQVEVQSKIDSELIGGVIIKVGSQVIDASLRGQLRRLSLRLTSN 184
>gi|110004063|emb|CAK98402.1| hypothetical atp synthase delta chain protein [Spiroplasma citri] (181 aa)
Score = 135, Expect = 7.9e-07, Identities = 52/180 (28%), Positives = 90/180 (50%)
  Q:     7 IDHYANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIENNK 186
           ID+YA AL  + LE  K +  +  S+     F  + +Y  + ++ +  I KEE+  IL K F    + + +  + N LF+L D   F  +  IF    + ++   +  +  IYS   + KK +  IE   S K G  +   N ID SL+GG++I   +++ D SI G+++ ++    +NK
  S:     8 IDNYAAALMDLALETKKNDHFLEVSNIIVELFKQEPDY--IKLMMNADIPKEERKNILAKPF----QKVIDPLILNALFLLIDREAFCYVRRIFKRLRKLINISYDVQYGNIYSTQPLTKKQITTIETKLSKKFGYHIELVNKIDSSLLGGVRIKIKHEIIDGSIAGQLETMRQKAIHNK 181
>gi|186684956|ref|YP_001868152.1| ATP synthase F1, delta subunit [Nostoc punctiforme PCC 73102] >gi|186467408|gb|ACC83209.1| ATP synthase F1, delta subunit [Nostoc punctiforme PCC 73102] (184 aa)
Score = 135, Expect = 8.6e-07, Identities = 46/176 (26%), Positives = 87/176 (49%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNN---FFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIENN 185
           YA AL SI    +   +  F   A+     L+ + ++ +   +  I  E K  ++ +I  + S    N YL+NFL +L D     F + I + +++  ++L+  Q  L   I +  + E +    I+ + +I   ++V  E  +D  LIGG+ I  G+ V D SI+G++ ++   + N+
  S:    14 YAQALLSIAQSKNLTEE--FGEDARTFLGLLRADKQLHNFFSNPFIQAENKKALIKQILGEGS----NPYLRNFLLILVDKRRIAFLESIFQQYLALLRQLN--QTVLAEVISAVPLTEAQQQAIIQKVIAISNARQVELETKVDSELIGGVIIKVGSQVIDASIRGQLRRLSLRLTNS 184
>gi|164688905|ref|ZP_02212933.1| hypothetical protein CLOBAR_02553 [Clostridium bartlettii DSM 16795] >gi|164602109|gb|EDQ95574.1| hypothetical protein CLOBAR_02553 [Clostridium bartlettii DSM 16795] (179 aa)
Score = 135, Expect = 9.2e-07, Identities = 47/172 (27%), Positives = 93/172 (54%)
  Q:     8 DHYANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           + YA AL+ I  E +K + +   +  K++   +  N ++ +++ S ++SK EK ++++ +F   +  I N  LKNF  +L +      +  I  ++ + L+E  N L   + S   ++ + ++++E   S K  K V  EN +DKS++GG+ +  GN   D +IK ++D +K
  S:     7 NRYAEALFQIGEEENKTDNLY--NELKEVSSLITTNNDLNNVMKSPLVSKNEKIQLIDTLF---AGKIDN-DLKNFFKILVEKGRITSVEAIEATYKELLNEKNNILEGYVISAVPMDNEKIKELETELSKKYNKNVTLENKVDKSVLGGVLVRLGNTEIDGTIKTRLDGLK 172
>gi|16801737|ref|NP_472005.1| F0F1 ATP synthase subunit delta [Listeria innocua Clip11262] >gi|16415212|emb|CAC97902.1| atpH [Listeria innocua] (179 aa)
Score = 134, Expect = 1.0e-06, Identities = 42/174 (24%), Positives = 94/174 (54%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGK-RVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIE 183
           YANAL+ +    DK    +F+    ++  +L  N + V ++++   + E+K  + + +F  +     N  L++F+++L D +    +  I   + +++++ +      +YS   + ++ L  +  +F+ K  K ++  +N IDKSL+GG+K++ G  +YD S+K K+  ++  I+
  S:    11 YANALFQV--AQDKDLVDVFSEELTELKAALNANKDFVKLLENPTFTTEQKKNLASAVFEKI-----NPTLRDFIYLLIDRSREDYLSVIADVYQKRVNDLRGVADADVYSVVPLSEQELTALSRVFAAKMNKTKLNIQNHIDKSLLGGVKVVIGTRIYDDSLKTKLKDMERQIK 178
>gi|196184963|gb|EDX79939.1| ATP synthase F1, delta subunit [Brevundimonas sp. BAL3] (184 aa)
Score = 134, Expect = 1.0e-06, Identities = 41/176 (23%), Positives = 85/176 (48%)
  Q:     8 DHYANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIE 183
           D YA AL+ + LE  + + +   +    +  +   + ++  +  S +IS E++ K L  I    +K+       NFL +L  N+  + +  +   F  +  +H   +   + S   ++ K L  I+   +   GK       +D +++GG+KI  G+ ++D S+K K+DQ+K+ ++
  S:    12 DRYAQALFDLALETGRLDAV--RADLTSLKAAWIESADLRRLATSPVISAEDQGKGLVAI---AAKAKFEQTTANFLGLLAQNHRARDLPHVIAGFEARYAKHAGIVAAEVVSAQALDAKQLAAIKTALNASLGKAPELTTRVDPAILGGLKIKVGSKLFDASLKTKLDQMKFALK 182
>gi|172039400|ref|YP_001805901.1| ATP synthase delta subunit [Cyanothece sp. ATCC 51142] >gi|171700854|gb|ACB53835.1| ATP synthase delta subunit [Cyanothece sp. ATCC 51142] (185 aa)
Score = 134, Expect = 1.3e-06, Identities = 50/169 (29%), Positives = 84/169 (49%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNN---FFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           YA AL S+    D    I      + I   L+ + E+   I S II  E+K  +LN++   L   I + YL+NFL +L D     F + I E +++  +KL      L     S  + E +  + I+ + ++   + V  +  ID  LIGG+ I  G+ V+D S++G++ +I
  S:    14 YAQALMSLAQSRDITRSI--GEDCRSILDILEESAELREFISSPIIKDEDKRGVLNRL---LGNDIHH-YLRNFLMLLVDKRRIVFLQAICEQYLALLRKLT--NTVLAEVTASTELSEGQRRDVIDKIKALTGAESVELKTDIDPDLIGGVIIKVGSQVFDASLRGQLRRI 177
>gi|196164028|ref|ZP_03124559.1| ATP synthase subunit delta [Clostridium difficile QCD-23m63] (181 aa)
Score = 133, Expect = 1.4e-06, Identities = 46/172 (26%), Positives = 94/172 (54%)
  Q:     8 DHYANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           + YA AL+ +  E +    ++F    K +    K + +   ++ S ++SK EK  ++  IF   SK +S+  +KNFL VL D +    + +I +++ + L++  N +     S   + +  ++++E   S K  K V  EN++DK+++GG+ +  GN+  D ++K ++D++K
  S:     7 NRYAEALFQLGEE-ENSTDVLFKELEKVVDMMTKVSKDFYKVLKSPLVSKSEKKNLVEIIF---SKEVSS-NIKNFLKVLVDKDRISYLEDIELAYKELLNKKNNVIAGVAISAIPMSETDIKELEVKLSNKYNKNVTIENVVDKTILGGVLVRIGNEQIDGTVKTRLDKMK 173
>gi|125975088|ref|YP_001038998.1| ATP synthase F1, delta subunit [Clostridium thermocellum ATCC 27405] >gi|196251788|ref|ZP_03150454.1| ATP synthase F1, delta subunit [Clostridium thermocellum DSM 4150] >gi|125715313|gb|ABN53805.1| ATP synthase F1, delta subunit [Clostridium thermocellum ATCC 27405] >gi|196198728|gb|EDX93559.1| ATP synthase F1, delta subunit [Clostridium thermocellum DSM 4150] (188 aa)
Score = 133, Expect = 1.5e-06, Identities = 52/166 (31%), Positives = 85/166 (51%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKR-VRYENIIDKSLIGGMKIMFGNDVYDYSIKGKI 175
           YA AL  +  E +  +K++  ++   +   L+ N E    +    I KE + + + K+F    +      + NFL +L D   F+ I  I   +F+  DE +N L + I S F +E   + +I+  +     K  V+ + IIDKSLIGG+KI  G+ V D SIKG++
  S:    18 YAEALIDVTEEKNSTDKVL--NNLVQVLKLLEENREFYSFLLDPQIQKESRKEAIIKVF----EGRIEQEVVNFLMLLVDKERFENIRGIVEEYFRLADERKNILNMTIISAFPLEDVQINRIKEKYKKLYNKTDVKAKLIIDKSLIGGVKIQIGDKVIDDSIKGRL 178
>gi|47096955|ref|ZP_00234531.1| ATP synthase F1, delta subunit [Listeria monocytogenes str. 1/2a F6854] >gi|153184892|ref|ZP_01935540.1| ATP synthase F1, delta subunit [Listeria monocytogenes J0161] >gi|153192188|ref|ZP_01939233.1| ATP synthase F1, delta subunit [Listeria monocytogenes J2818] >gi|47014665|gb|EAL05622.1| ATP synthase F1, delta subunit [Listeria monocytogenes str. 1/2a F6854] >gi|126942404|gb|EBA20143.1| ATP synthase F1, delta subunit [Listeria monocytogenes J0161] >gi|127764516|gb|EBA25048.1| ATP synthase F1, delta subunit [Listeria monocytogenes J2818] (179 aa)
Score = 132, Expect = 1.9e-06, Identities = 42/174 (24%), Positives = 93/174 (53%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGK-RVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIE 183
           YANAL+ +    DK    +F+    ++  +L  N + V ++++   + E+K  + + +F  +     N  L++F+++L D +    +  I   + +++++        +YS   + ++ L  +  +F+ K  K ++  +N IDKSL+GG+K++ G  +YD S+K K+  ++  I+
  S:    11 YANALFQV--AQDKDLVDVFSEELTELKAALNANKDFVKLLENPTFTTEQKKNLASAVFEKI-----NPTLRDFIYLLIDRSREDYLSVIADVYQKRVNDLNGVADADVYSVVPLSEQELTALSRVFAAKMNKTKLNIQNHIDKSLLGGVKVVIGTRIYDDSLKTKLKDMERQIK 178
>gi|114587|sp|P09220|ATPD_BACP3 ATP synthase delta chain >gi|77459|pir||S01400 H+-transporting two-sector ATPase (EC 3.6.3.14) delta chain - thermophilic bacterium PS-3 >gi|45813|emb|CAA30651.1| unnamed protein product [Bacillus sp. PS3] (179 aa)
Score = 132, Expect = 1.9e-06, Identities = 43/170 (25%), Positives = 86/170 (50%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRI-YSPFVVEKKLLEKIEHLFSIKTGKR-VRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           YA+AL+ I LE  + ++I      + +  +L  N E + ++    +S ++K  ++ + F  +S  + N      L +L + + F  + E+  +  +        +   + YS      + L  +  +F+ K GK+ +  ENIID  LIGG+ +  GN +YD S+ G++++I+
  S:    10 YASALFQIALEQGQLDRI--EEDVRAVRQALAENGEFLSLLSYPKLSLDQKKALIREAFAGVSTPVQNT-----LLLLLERHRFGLVPELAGTVSRPRSTTARGIAKAVAYSGAASTDEELRALSDVFAQKVGKQTLEIENIIDPELIGGVNVRIGNRIYDGSVSGQLERIR 174
>gi|168266764|ref|ZP_02688729.1| atpH [Listeria monocytogenes FSL J2-071] (177 aa)
Score = 132, Expect = 2.0e-06, Identities = 41/166 (24%), Positives = 89/166 (53%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGK-RVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKI 175
           YANAL+ +    DK    +F+    ++  +L  N + V ++++   + E+K  + + +F  +     N  L++F+++L D +    +  I   + +++++        +YS   + ++ L  +  +F+ K  K ++  +N IDKSL+GG+K++ G  +YD S+K K+
  S:    11 YANALFQV--AQDKDLVDVFSEELTELKAALNANKDFVKLLENPTFTTEQKKNLASAVFEKI-----NPTLRDFIYLLIDRSREDYLSVIADVYQKRVNDLNGVADADVYSVVPLSEQELTALSRVFATKMNKTKLNIQNHIDKSLLGGVKVVIGTRIYDDSLKTKL 170
>gi|126701094|ref|YP_001089991.1| ATP synthase subunit delta [Clostridium difficile 630] >gi|145952625|ref|ZP_01801634.1| hypothetical protein CdifQ_04004001 [Clostridium difficile QCD-32g58] >gi|168697760|ref|ZP_02730037.1| ATP synthase subunit delta [Clostridium difficile QCD-37x79] >gi|168714969|ref|ZP_02747246.1| ATP synthase subunit delta [Clostridium difficile QCD-63q42] >gi|168726395|ref|ZP_02758672.1| ATP synthase subunit delta [Clostridium difficile QCD-76w55] >gi|168730159|ref|ZP_02762436.1| ATP synthase subunit delta [Clostridium difficile QCD-97b34] >gi|196124978|ref|ZP_03116727.1| ATP synthase subunit delta [Clostridium difficile ATCC 43255] >gi|196162322|ref|ZP_03122883.1| ATP synthase subunit delta [Clostridium difficile CIP 107932] >gi|115252531|emb|CAJ70374.1| ATP synthase subunit delta [Clostridium difficile 630] (181 aa)
Score = 131, Expect = 2.3e-06, Identities = 46/172 (26%), Positives = 94/172 (54%)
  Q:     8 DHYANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           + YA AL+ +  E +    ++F    K +    K + +   ++ S ++SK EK  ++  IF   SK +S+  +KNFL VL D +    + +I +++ + L++  N +     S   + +  ++++E   S K  K V  EN++DK+++GG+ +  GN+  D ++K ++D++K
  S:     7 NRYAEALFQLGEE-ENSTDVLFKELEKVVDMMTKVSKDFYKVLKSPLVSKSEKKNLVEIIF---SKEVSS-NIKNFLKVLVDKDRISYLEDIELAYKELLNKKNNVIDGVAISAIPMSETDIKELEVKLSNKYNKNVTIENVVDKTILGGVLVRIGNEQIDGTVKTRLDKMK 173
>gi|116619601|ref|YP_821757.1| ATP synthase F1, delta subunit [Solibacter usitatus Ellin6076] >gi|116222763|gb|ABJ81472.1| ATP synthase F1, delta subunit [Solibacter usitatus Ellin6076] (184 aa)
Score = 131, Expect = 2.5e-06, Identities = 41/148 (27%), Positives = 74/148 (50%)
  Q:    39 SLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIENNK 186
           +LK++ E+ + + S  +    K  ++ +I   L   IS I ++NFLFVL D+     + EI  SF   +DE   F    I S   + +     +    +  TGK++R    +D++LIGG     G+ VYD S++G++  ++  +   +
  S:    40 ALKSSVELHNALTSPSVPVGRKRAVVGRISDTLK--ISPI-VRNFLFVLVDHRRIASLTEILHSFELIMDERLGFARAEISSARELTEPQRTALSAQLAQLTGKQIRMRFAVDEALIGGAVARIGSTVYDGSVRGQLQTLERRLSTER 184
>gi|83319489|ref|YP_424076.1| F0F1 ATP synthase subunit delta [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|83283375|gb|ABC01307.1| ATP synthase F1, delta subunit [Mycoplasma capricolum subsp. capricolum ATCC 27343] (181 aa)
Score = 131, Expect = 2.8e-06, Identities = 52/173 (30%), Positives = 88/173 (50%)
  Q:     7 IDHYANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           I++YA AL++I ++    +  I    A     S K+++  + +  SN   K++   I+ K F        +IYL N L +L +N  F     I  + ++KL +++N +   +YS   + K  L  I+   S K  K+V   N ID +LIGG+K+     V+D SIK K++ +K
  S:     8 INNYATALFNIAVKEKLVDDYIIQVDALIQSLSDKDDFNKL-VSFSNKQEKQDAILIIEKTFAPFE---FDIYLINALKILVENQLFINTRMILKALYKKLLDYKNIVLGVVYSTEKLTKTQLSAIKKKISNKVNKKVELVNKIDPTLIGGIKVNVQGKVFDGSIKAKLEALK 176
>gi|149183573|ref|ZP_01861995.1| F0F1 ATP synthase subunit delta [Bacillus sp. SG-1] >gi|148848714|gb|EDL62942.1| F0F1 ATP synthase subunit delta [Bacillus sp. SG-1] (179 aa)
Score = 129, Expect = 4.3e-06, Identities = 44/170 (25%), Positives = 89/170 (52%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKR-VRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           YA AL+ I  E ++   I      + +    + N E+  ++++  IS E+K +IL + F   S ++ N      L +L D +    I  +  +F +  ++ +     ++YS   +++     +   F+ K GK  +R +NI D +L+GG+K+  GN ++D S+KGK+++++
  S:    10 YAIALFEIAKEHNQLESI--EVELRVVRSVFEENKELDVLLETPRISVEKKKEILKEAFSSASPNVMNT-----LMLLVDRHRANAITSVVDAFIELANDERGIAEAKVYSVRPLDEAEKAALSASFAKKVGKSSLRIDNITDTNLLGGLKLRIGNRIFDGSLKGKLERLE 173
>gi|34496124|ref|NP_900339.1| ATP synthase F1, delta subunit [Chromobacterium violaceum ATCC 12472] >gi|34101978|gb|AAQ58345.1| ATP synthase F1, delta subunit [Chromobacterium violaceum ATCC 12472] (178 aa)
Score = 129, Expect = 4.3e-06, Identities = 43/175 (24%), Positives = 85/175 (48%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIEN 184
           YA A+YS+  E  K ++    S A     ++ NN ++  ++ +   + +E    +  +  D+  S  N  +K F+  L +N     + EI   F     + +N +   + S F +  +   ++ +  S K GK VR +   +  LIGG+++  G+DV D S++GK+  +  +++N
  S:    11 YAEAVYSLATEQGKLDQ---WSDALSWLAAMVNNPDLAQVVTNPKHTAQE----VEALMLDVLGSRGNDDVKRFIAALIENARLTLLPEIAAQFELLKAQSENIVDALVESAFALSDEQKAELTNTLSKKYGKAVRLDVRENADLIGGVRVSVGDDVIDASVRGKLQAMAASLKN 178
>gi|56477130|ref|YP_158719.1| F1-ATP synthase, delta subunit [Azoarcus sp. EbN1] >gi|56313173|emb|CAI07818.1| F1-ATP synthase, delta subunit [Azoarcus sp. EbN1] (178 aa)
Score = 127, Expect = 6.8e-06, Identities = 33/121 (27%), Positives = 62/121 (51%)
  Q:    64 LNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIEN 184
           L ++F D++       L+NF+ VL DN   + + EI   F +  +EH+      I S F ++   L  ++     +   R+  +  +D  LIGG++I  G++V D S++GK+  +   ++N
  S:    58 LYQLFIDVAGQGFTPELQNFVRVLVDNERLQMLPEIRDLFVELKNEHEGVQEAEIASAFPLDDATLANLKADLETRFKTRLNTKVSLDPELIGGVRIAIGDEVIDASVRGKLANMAAALKN 178
>gi|167755041|ref|ZP_02427168.1| hypothetical protein CLORAM_00545 [Clostridium ramosum DSM 1402] >gi|167705091|gb|EDS19670.1| hypothetical protein CLORAM_00545 [Clostridium ramosum DSM 1402] (177 aa)
Score = 127, Expect = 7.6e-06, Identities = 46/170 (27%), Positives = 83/170 (48%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           YA +L+ +  E+++     ++     I    +++   V      +I  E K  +L+K F    K   N Y+ NFL +L      + ++EI  +F    +EH   L   +Y+ + +  + ++++E   S K  K +R   + D SLIGG+K+   N V+D SIK K+  +K
  S:     8 YAESLFDLAKEMNQVEA--YSKDIDLIRTVFESDPSFVPFFSHVLIEDEAKCALLDKSF----KGQVNDYVVNFLKLLVRKRRMRYVMEIIEAFKALTNEHFGILEGILYANYDISVQEVKEVEDALSKKENKTIRLRVVNDPSLIGGIKVEINNRVFDGSIKNKVALLK 171
>gi|50364927|ref|YP_053352.1| F0F1 ATP synthase subunit delta [Mesoplasma florum L1] >gi|50363483|gb|AAT75468.1| ATP synthase delta chain [Mesoplasma florum L1] (183 aa)
Score = 126, Expect = 9.1e-06, Identities = 55/184 (29%), Positives = 92/184 (50%)
  Q:     3 EKNHIDHYANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEK-TKILNKIF--FDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIENNK 186
           + N ID++ANAL  I ++ +K  K++    A  +   LKN  E V I+       EEK  KI++  F  F++ + I N +      +L     F    +I      KL E  N  +  ++S   +    +++IE   S K  K V+  N ID  LI G++++  N VYD S++ K+D++K+ +   K
  S:     4 KDNVIDNWANALTKIAVKENKVKKML--EQAHVLIEVLKNKNEFVDILTFKSAHDEEKRIKIIDDTFSQFNIDEDIMNAFK-----ILVHMQAFVNARDILKKLRGKLVELDNMTYGVVWSTEEISAAQIKEIEEKMSKKINKEVKLVNKIDTKLIAGIQVVVHNKVYDGSLRSKLDEMKYQVLKEK 183
>gi|167924982|ref|ZP_02512073.1| F0F1 ATP synthase subunit delta [Mycoplasma mycoides subsp. mycoides LC str. GM12] (181 aa)
Score = 126, Expect = 9.6e-06, Identities = 53/173 (30%), Positives = 88/173 (50%)
  Q:     7 IDHYANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           I++YA AL++I ++    +  I    A  +  SLK+  E   ++  +  +K+EK   +  I    S    +IYL N L +L +N  F     I    ++KL  ++N +   +YS   + K  L  I+   S K  K+V   N ID +LIGG+K+   + V+D SIK K++ +K
  S:     8 INNYATALFNIAVKEKLVDDYIIQVDA--LIKSLKDKDEFNKLV--SFSNKQEKQDAILIIENTFSSFGFDIYLINALKILVENQLFINTRMILKVLYKKLLAYKNIVLGEVYSTEKLTKTQLNAIKKKISNKVNKKVELVNKIDPTLIGGIKVSVEDKVFDGSIKAKLEALK 176
>gi|189426222|ref|YP_001953399.1| ATP synthase F1, delta subunit [Geobacter lovleyi SZ] >gi|189422481|gb|ACD96879.1| ATP synthase F1, delta subunit [Geobacter lovleyi SZ] (180 aa)
Score = 126, Expect = 1.0e-05, Identities = 42/169 (24%), Positives = 81/169 (47%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           YA AL  +  E D  ++  F+   K +      N E+     +   + ++K +I+  +   +++   +  + NFL +L D N    + EI  ++ +  DE    +   I + F ++   +  I+     KTGK+V  +  +D+SLIGG+    G+  YD S+K ++ +I
  S:    10 YAKALVQLGSEKDLIDR--FSQELKVVSGVFAGNAELRAAFGNPAFTADQKKQIMRDL---IARMQCSELVANFLLLLVDKNRVVCLPEIVETYEKLADEQSGVIRPMITTAFALDDSQVNAIKGALEQKTGKKVVPQVKVDQSLIGGVVTQIGDIAYDSSVKTQLARI 173
>gi|149188274|ref|ZP_01866568.1| hypothetical ATP synthase F1, delta subunit [Vibrio shilonii AK1] >gi|148837863|gb|EDL54806.1| hypothetical ATP synthase F1, delta subunit [Vibrio shilonii AK1] (180 aa)
Score = 125, Expect = 1.1e-05, Identities = 33/104 (31%), Positives = 54/104 (51%)
  Q:    79 YLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNI 182
           Y+KNFL V+ +N   K +      FF+   E++  + + +Y+   +E+  L  I++    K GK V  E  ID SL+GG+ I  G  V D SI   + ++  N+
  S:    75 YVKNFLRVMAENKRLKLLATTVELFFEMKAEYEKTMEVLVYAAEPLEQDQLVDIKNALEAKFGKTVTIEQQIDPSLVGGVMIKAGEQVLDGSIYSSLHRLAVNL 178
>gi|119358470|ref|YP_913114.1| F0F1 ATP synthase subunit delta [Chlorobium phaeobacteroides DSM 266] >gi|119355819|gb|ABL66690.1| ATP synthase F1, delta subunit [Chlorobium phaeobacteroides DSM 266] (181 aa)
Score = 125, Expect = 1.2e-05, Identities = 43/170 (25%), Positives = 83/170 (48%)
  Q:    10 YANALYSIWLE---LDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           YA+AL S   E   LD+      T     I   L  + E+VH++ S +I+ ++KT IL ++F D       I+LK    ++        + +I + + + LDE    + + I S   +    ++ +    S  TGK +R +  ++  L+GG+ +  G+ + D S++ ++  +K
  S:    10 YASALLSAAEEGGFLDQA-----TQELAQIKIVLDQSRELVHVLRSPVINADKKTHILQEVFADTVGDKVMIFLK----LIAKKKRSGMLPQIIVEYQKLLDEANGIINVSITSATPMSDDQVKALVAKLSSYTGKTIREKMALNGELLGGVTVKIGDTILDGSVRHQLQLLK 173
>gi|167463132|ref|ZP_02328221.1| F0F1 ATP synthase subunit delta [Paenibacillus larvae subsp. larvae BRL-230010] (183 aa)
Score = 125, Expect = 1.4e-05, Identities = 23/71 (32%), Positives = 47/71 (66%)
  Q:   118 IYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIENNKEV 188
           +++PF +  +  + +   F+  TGK +R E ++D SLIGG+ +  G+ VYD S+KGK+D+++ +++  + +
  S:   113 VHTPFALNPEQEKDLIDYFAKLTGKTIRLETVLDSSLIGGVTVQIGDRVYDGSLKGKLDRLQKSLKQAQSL 183
>gi|42561406|ref|NP_975857.1| F0F1 ATP synthase subunit delta [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|42492904|emb|CAE77499.1| ATP SYNTHASE DELTA CHAIN [Mycoplasma mycoides subsp. mycoides SC str. PG1] (181 aa)
Score = 124, Expect = 1.4e-05, Identities = 52/173 (30%), Positives = 88/173 (50%)
  Q:     7 IDHYANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           I++YA AL++I ++    +  I    A  +  SL +  E   ++  +  +KE+K + +  I    S    +IYL N L +L +N  F     I    ++KL  ++N +   +YS   + K  L  I+   S K  K+V   N ID +LIGG+K+   + V+D SIK K++ +K
  S:     8 INNYATALFNIAVKEKLVDDYIIQVDA--LIKSLADKDEFNKLVTYS--NKEQKKQAILIIENTFSSFGFDIYLINALKILVENQLFINTRMILKVLYKKLLAYKNIVLGEVYSTEKLTKTQLNAIKKKISNKVNKKVELVNKIDPTLIGGIKVSVEDKVFDGSIKAKLEALK 176
>gi|167458488|ref|ZP_02324690.1| ATP synthase F1, delta subunit [Anaeromyxobacter dehalogenans 2CP-1] >gi|167415245|gb|EDR81977.1| ATP synthase F1, delta subunit [Anaeromyxobacter dehalogenans 2CP-1] (179 aa)
Score = 124, Expect = 1.5e-05, Identities = 43/170 (25%), Positives = 81/170 (47%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYE----MVHIIDSNIISKEEKTKILNKIF--FDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           YA AL+S+ +E  +           D    LKN  E    +  ++ + + SKE++  I+ K+     L +  +N+     LF+L D N    +  +  +F    D+H   L  R+ S   ++    + I    S  T  +V  +  +D SL+GG+    G+ VYD S++ +++ ++
  S:    10 YARALFSLAVEQGR------VEPWNDALQVLKNAVEGSPDLRDVLSNPVYSKEQRRAIVEKLASALKLEREPANL-----LFLLGDRNRLAYLAAVVDTFRSLADQHLGRLRARVTSAVPLDASAAQAIADRLSKATNAKVLLDRAVDPSLLGGVIAQVGSLVYDGSVRTQLEDLR 174
>gi|118054094|ref|ZP_01522635.1| ATP synthase F1, delta subunit [Comamonas testosteroni KF-1] >gi|117998516|gb|EAV12679.1| ATP synthase F1, delta subunit [Comamonas testosteroni KF-1] (179 aa)
Score = 123, Expect = 1.9e-05, Identities = 30/111 (27%), Positives = 60/111 (54%)
  Q:    69 FDLSKSISNIYL----KNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           FDL   ++   L    +NFL V+ +N     + E+   F   ++         +YS F +E   L ++      + G+++     +D+SLIGG++++ G++V D S+K +++Q+K
  S:    60 FDLVTGVAKSALPESARNFLHVVLENGRLDVLSEVAAQFRSLVNSKSGSSDAVVYSAFPIEDAALAELGATLQKRFGRKLNLTVKLDESLIGGVRVVVGDEVLDTSVKARLEQMK 174
>gi|78043404|ref|YP_361341.1| ATP synthase F1, delta subunit [Carboxydothermus hydrogenoformans Z-2901] >gi|77995519|gb|ABB14418.1| ATP synthase F1, delta subunit [Carboxydothermus hydrogenoformans Z-2901] (177 aa)
Score = 123, Expect = 1.9e-05, Identities = 46/173 (26%), Positives = 88/173 (50%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNI 182
           YA+AL+ +  E    + I  +   + +  +++   ++  ++D+ ++    K ++L K+F D      N   K+FL +L D      + EI   F +KL E +  + + + S   ++  L + I+   S  TGK+V  +   +  LIGG+ +  GN VYD SIK ++ ++K +I
  S:    10 YASALFELAREKGAIDSI--SHDFEVLEKAIQETPDVKKVLDNPVLIPAAKKELLEKLFPDF-----NPITKSFLKLLVDKRREVYLPEIIALFAEKLREERGEMLVEVESARELKGDLSDLIKEKLSRLTGKKVTMKVRTNPDLIGGIVVRVGNKVYDGSIKNQLYRLKRSI 175
>gi|78224599|ref|YP_386346.1| F0F1 ATP synthase subunit delta [Geobacter metallireducens GS-15] >gi|78195854|gb|ABB33621.1| H+-transporting two-sector ATPase, delta (OSCP) subunit [Geobacter metallireducens GS-15] (180 aa)
Score = 123, Expect = 1.9e-05, Identities = 45/170 (26%), Positives = 81/170 (47%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           YA AL  +  E D  ++  F +        L+ N ++  ++ S     E K +IL  +   LS S +   + NFL VL D      + +I  S+    DE    +   + S F +E   +E ++      TGK+V+    ++ SLIGG+    G+ V+D S++ ++++I+
  S:    10 YAKALVQLGAEEDAVDR--FGAELGQFAALLEGNADIDSVLKSPAYRIEAKREILKDVLAKLSLSGT---VSNFLQVLLDRGRISFLPQIAHSYAAFADELSGVIRPVLTSAFPLEDAQVESMKGALVKATGKKVQLSVQVEPSLIGGVITKIGDKVFDGSVRTQLNRIQ 174
>gi|189347957|ref|YP_001944486.1| ATP synthase F1, delta subunit [Chlorobium limicola DSM 245] >gi|189342104|gb|ACD91507.1| ATP synthase F1, delta subunit [Chlorobium limicola DSM 245] (181 aa)
Score = 123, Expect = 2.3e-05, Identities = 36/150 (24%), Positives = 81/150 (54%)
  Q:    30 TSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           T +   I  +L N+ ++VH++ S +I+ ++KT IL ++F    K I+   +  FL +L       ++ EI   + + LDE    + + I S  ++  +  + + +  +  TGK+VR +  ++++L+GG+ +   + + D S++ ++  +K
  S:    28 TDALNSIKETLANSRDLVHVLRSPLINGDKKTHILEEVF----KEIAGEKVMIFLRLLAHKKRAGQLPEIIGEYQKLLDEKNGVINVSINSAVMLSDEQAKDLVNKLANYTGKKVRAKMKLEEALLGGVTVKIEDTIIDGSVRHQLQMMK 173
>gi|119947326|ref|YP_945006.1| ATP synthase F1, delta subunit [Psychromonas ingrahamii 37] >gi|119865930|gb|ABM05407.1| ATP synthase F1, delta subunit [Psychromonas ingrahamii 37] (177 aa)
Score = 123, Expect = 2.3e-05, Identities = 36/137 (26%), Positives = 74/137 (54%)
  Q:    42 NNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNN---FFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           NN  MV I+ S+  ++E     L ++F ++ +   +   +NF+ ++ +N    F  R+ ++F +     DEH+  + + + S + + KK L+++      +  ++V     IDK+LI GM +  G+ V D S KG++ ++
  S:    40 NNPTMVKILTSDKTAQE-----LAELFLNVCEDQLDENGQNFIKIMAENGRLRFLPRVAQLFAAL---EDEHKKQVDVNVVSAYGLSKKQLDELSKSLEKRLARKVNLHCSIDKTLIAGMVVTVGDLVIDSSAKGQLGRL 171
>gi|118579042|ref|YP_900292.1| F0F1 ATP synthase subunit delta [Pelobacter propionicus DSM 2379] >gi|118579927|ref|YP_901177.1| F0F1 ATP synthase subunit delta [Pelobacter propionicus DSM 2379] >gi|118501752|gb|ABK98234.1| ATP synthase F1, delta subunit [Pelobacter propionicus DSM 2379] >gi|118502637|gb|ABK99119.1| ATP synthase F1, delta subunit [Pelobacter propionicus DSM 2379] (180 aa)
Score = 123, Expect = 2.3e-05, Identities = 35/125 (28%), Positives = 65/125 (52%)
  Q:    55 ISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNN---FFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           +S E K  I+ ++   +     +  + NFL +L D N   FF +I++   ++ Q  DEH   L   I + F ++   L  I      K+ K +  +  +DK+ +GG+ +  G+ VYD S+K ++ +I+
  S:    53 LSHERKKNIMREL---VGSCACSELMGNFLLLLVDKNRVAFFSQIVK---AYGQLADEHVGILRPVITTAFELDAVQLAAIREALEKKSAKTIIPQLTVDKAFLGGVVVQIGDTVYDSSVKTQLKRIQ 174
>gi|33329384|gb|AAQ10087.1| ATP synthase subunit delta [Bacillus sp. TA2.A1] (179 aa)
Score = 123, Expect = 2.4e-05, Identities = 41/177 (23%), Positives = 93/177 (52%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFS---LKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFL--FIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIENNK 186
           YA AL+ +  E ++ +KI      +D+ ++   L+ + ++V  +   ++ KE K +++  +F   ++ +S   L + L +L D      +  I   F +  +E +  +   +   +P + EK+  E +    +  TGK+VR   ++D+ ++GG+ +  G+ +YD +++GK+ + +  I   K
  S:     8 YAKALFEVAKEREELDKI-----EQDLQYTDQVLREHPDLVRFLTHPLVKKETKKELIGTVF---AEQLSPTTL-SLLRLLVDRERENELSGIATYFVRLANEVRGLVDVVVTTATPLLPEKQ--EVLRQQLARMTGKKVRLHFVVDEGVLGGITVKIGDLIYDGTVRGKLSRFERLIATTK 178
>gi|47459047|ref|YP_015909.1| F0F1 ATP synthase subunit delta [Mycoplasma mobile 163K] >gi|47458376|gb|AAT27698.1| ATP synthase delta chain [Mycoplasma mobile 163K] (180 aa)
Score = 122, Expect = 2.4e-05, Identities = 43/143 (30%), Positives = 76/143 (53%)
  Q:    40 LKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNI 182
           +  N ++V ++ S  I  E+K KIL  IF     +   + + NFL ++  NN F  I  I   F     +  N  + +IYS   +++K++  +E  +S K  K+V   N+ID +LI G++I   N +++ SIK  I +++ +I
  S:    37 INENEDLVKLLSSKEIQLEKKLKILENIF----TNHFTVNINNFLKLIITNNLFIYIKSILKIFLDIASKKLNISYGKIYSSKKLDEKIISNLEKFYSDKLSKKVEMLNLIDTTLIKGIRIEIENTIHENSIKNNIKELQKSI 175
>gi|150388190|ref|YP_001318239.1| ATP synthase F1, delta subunit [Alkaliphilus metalliredigens QYMF] >gi|149948052|gb|ABR46580.1| ATP synthase F1, delta subunit [Alkaliphilus metalliredigens QYMF] (180 aa)
Score = 121, Expect = 3.2e-05, Identities = 42/170 (24%), Positives = 89/170 (52%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           YA AL+ +  E+++   +  T     +  +LK + ++  ++ S +I+  EK +IL+ IF    K   +  + NFL +L D +      EI+  +    D  +N +     +   ++   L K++   S+ +GK V+ +N ID ++IGG+ +  G+ + D ++K +++Q++
  S:     9 YAKALFQVAFEMNRYEDV--TEELAFVAENLKQHSDLNELLKSPVITLGEKKEILSTIF----KEQISPEVFNFLRILLDKSRQGDFQEIYEEYKILADAGKNKIEAVAITALPMDNNDLLKLQVNLSMSSGKNVKLKNEIDPTVIGGVLVKMGDKIIDGTVKARLNQMQ 172
>gi|120609072|ref|YP_968750.1| F0F1 ATP synthase subunit delta [Acidovorax avenae subsp. citrulli AAC00-1] >gi|120587536|gb|ABM30976.1| ATP synthase F1, delta subunit [Acidovorax avenae subsp. citrulli AAC00-1] (180 aa)
Score = 121, Expect = 3.5e-05, Identities = 33/129 (25%), Positives = 65/129 (50%)
  Q:    51 DSNIISKEEKTKILNKIFFDLSKSISNIYL----KNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           D  +    +  KI +   FDL   +    L    +NFL VL DN   + + E+   F   ++         ++S F ++   L ++      + G+++     +D+SLIGG+++  G++V D S+K +++Q+K
  S:    43 DPQVRQLADNPKIESGQLFDLIAGVVRAPLSDAARNFLRVLIDNGRLEALPEVAAQFRALVNRQSGSSDAVVHSAFPIDAAALAELGASLEKRFGRKLNLSVQLDESLIGGVRVAVGDEVLDTSVKARLEQMK 175
>gi|125547451|gb|EAY93273.1| hypothetical protein OsI_014506 [Oryza sativa (indica cultivar-group)] (2361 aa)
Score = 121, Expect = 4.0e-05, Identities = 28/107 (26%), Positives = 57/107 (53%)
  Q:    81 KNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIENNKE 187
           +NFL VL DN   + + E+   F   ++         ++S F ++   L ++      + G+++     +D+SLIGG+++  G++V D S+K +++Q+K  +   KE
  S:   412 RNFLRVLIDNGRLEALPEVAAQFRALVNRQSGSSDAVVHSAFPIDAGALAELGASLEKRFGRKLNLSVQLDESLIGGVRVAVGDEVLDTSVKARLEQMKAALVAKKE 518
>gi|153869492|ref|ZP_01999079.1| ATPase, F1 complex, OSCP/delta subunit [Beggiatoa sp. PS] >gi|152074015|gb|EDN70919.1| ATPase, F1 complex, OSCP/delta subunit [Beggiatoa sp. PS] (178 aa)
Score = 120, Expect = 4.3e-05, Identities = 33/130 (25%), Positives = 68/130 (52%)
  Q:    49 IIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           I+   I + + + + L +I FD+     +   KN + +L D +    + +I + + Q   +H+ ++ + I S + V+ +  +++E +   + GK V     +DKSL+GG  I  G+ V D S+KG  +++
  S:    43 IMGKVIANPKVEKETLTRILFDICDEALDEPGKNLVKILVDYHRLPAMPQIALQYEQLKAQHEGYVKVDIASAYPVKPEQQQEMEGILKKRLGKGVDISINVDKSLLGGWLIHAGDQVIDLSVKGHFEKL 172
>gi|30248227|ref|NP_840297.1| ATP synthase, delta (OSCP) subunit [Nitrosomonas europaea ATCC 19718] >gi|30180112|emb|CAD84114.1| ATP synthase, delta (OSCP) subunit [Nitrosomonas europaea ATCC 19718] (178 aa)
Score = 120, Expect = 4.9e-05, Identities = 44/169 (26%), Positives = 84/169 (49%)
  Q:    10 YANALYSIWLELDKKNKIIFT-SSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           YA A++    +L +++  +F+ S   D   S+    ++  +I + +IS  +    L +I F +     N   K  + +L DN     + +I   F Q   +H++ L   + S F ++   LEK+  +   K  ++V+ E  +D  LIGG++I  G+ V D S+ GK++ +
  S:    11 YAEAVF----KLARESGSLFSWSETLDAVNSIVRESQIRELISNPLISSVK----LREIIFSVCGKKLNEDGKRLVSLLIDNQRLLVMPQIHELFEQLKAQHESILEAEVVSAFPLDSGQLEKLVSILEAKFQRKVKAEVSVDSELIGGVRIKIGDQVVDSSVHGKLEAM 172
>gi|193215092|ref|YP_001996291.1| ATP synthase F1, delta subunit [Chloroherpeton thalassium ATCC 35110] >gi|193088569|gb|ACF13844.1| ATP synthase F1, delta subunit [Chloroherpeton thalassium ATCC 35110] (183 aa)
Score = 120, Expect = 5.2e-05, Identities = 36/133 (27%), Positives = 67/133 (50%)
  Q:    50 IDSNIISKEEKTKILNKIFF-DLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNI 182
           I S +I   +K  +L ++F   +S+ ++      FLF+L   N  + + E+   +   LDE    + + I +   ++ K  ++++      T K+VR     DK LIGG+ I  G+ V D SI+ ++  +K N+
  S:    49 IQSPLIQAYKKAALLKEVFGGKVSQQVAT-----FLFLLASKNRAEYLPEVIQEYRALLDEQNGVISVDIKTAVDLDDKQTKQLKDKLEAYTSKKVRVHLATDKQLIGGLTIQIGDTVLDGSIRHQLAMLKNNL 177
>gi|54020003|ref|YP_115567.1| F0F1 ATP synthase subunit delta [Mycoplasma hyopneumoniae 232] >gi|53987176|gb|AAV27377.1| ATP synthase delta chain [Mycoplasma hyopneumoniae 232] (187 aa)
Score = 119, Expect = 5.6e-05, Identities = 39/132 (29%), Positives = 70/132 (53%)
  Q:    40 LKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSI 171
           ++NN  ++ +  S+ I K+EK  I++KIF   S  I  I L NFL V+  NN F    +I + + +  + H +  +  I + F +   +    E + S K GK+V   + I+  LI G++I+  N +++ S+
  S:    39 IQNNQVLILLFKSHFIGKQEKFNIIDKIF---SAKIEKI-LVNFLKVIAKNNLFLYYKQILLKYIKLANSHLSQTWGEIQTAFPISSVMTSSFESILSKKLGKKVHLRHKINSKLISGIRIIVDNQIFENSL 166
>gi|15616319|ref|NP_244624.1| F0F1 ATP synthase subunit delta [Bacillus halodurans C-125] >gi|14916531|sp|Q9K6H2|ATPD_BACHD ATP synthase delta chain >gi|10176381|dbj|BAB07476.1| ATP synthase delta subunit [Bacillus halodurans C-125] (183 aa)
Score = 119, Expect = 5.6e-05, Identities = 48/169 (28%), Positives = 81/169 (47%)
  Q:     8 DHYANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGK-RVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKID 176
           + YA AL+   L  +K     F S  + I    ++  E++  +        +K ++L K F    K   N  + N L VL +      I+ +   F     + Q      +YS   + +   +++  LF+ K GK ++  ENI+D S+IGG+KI  G+ +YD SIKG++D
  S:     8 NRYAVALFE--LAQEKGLHESFVSELELIKAVFQDTPELMQFLTHPKTELTQKRELLEKTF----KGKVNDTIFNTLVVLVERKRIDLIIPVVQKFKSLSYDAQKIAEAFVYSAKPLSEAEKDQLSVLFAKKVGKAKLLIENIVDPSIIGGLKIRIGDRIYDGSIKGQLD 171
>gi|144575259|gb|AAZ53427.2| ATP synthase delta chain [Mycoplasma hyopneumoniae 7448] (187 aa)
Score = 119, Expect = 5.8e-05, Identities = 38/132 (28%), Positives = 70/132 (53%)
  Q:    40 LKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSI 171
           ++NN  ++ +  S+ + K+EK  I++KIF   S  I  I L NFL V+  NN F    +I + + +  + H +  +  I + F +   +    E + S K GK+V   + I+  LI G++I+  N +++ S+
  S:    39 IQNNQVLILLFKSHFVGKQEKFNIIDKIF---SAKIEKI-LVNFLKVIAKNNLFLHYKQILLKYIKLANSHLSQTWGEIETAFPISSVMTSSFESILSKKLGKKVHLRHKINSKLISGIRIIVDNQIFENSL 166
>gi|72080392|ref|YP_287450.1| F0F1 ATP synthase subunit delta [Mycoplasma hyopneumoniae 7448] (185 aa)
Score = 119, Expect = 5.8e-05, Identities = 38/132 (28%), Positives = 70/132 (53%)
  Q:    40 LKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSI 171
           ++NN  ++ +  S+ + K+EK  I++KIF   S  I  I L NFL V+  NN F    +I + + +  + H +  +  I + F +   +    E + S K GK+V   + I+  LI G++I+  N +++ S+
  S:    37 IQNNQVLILLFKSHFVGKQEKFNIIDKIF---SAKIEKI-LVNFLKVIAKNNLFLHYKQILLKYIKLANSHLSQTWGEIETAFPISSVMTSSFESILSKKLGKKVHLRHKINSKLISGIRIIVDNQIFENSL 164
>gi|31544507|ref|NP_853085.1| F0F1 ATP synthase subunit delta [Mycoplasma gallisepticum R] >gi|33860132|sp|P33254|ATPD_MYCGA ATP synthase delta chain >gi|31541352|gb|AAP56653.1| AtpH [Mycoplasma gallisepticum R] (181 aa)
Score = 119, Expect = 5.9e-05, Identities = 47/170 (27%), Positives = 91/170 (53%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFD-LSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           +A AL  +  E DK +  +F  + K ++  +K N +++ +++S ++SK +K +I++ +F D L+++I +     FL V+ DN  F  I  I   FF+ ++E ++ +FI + S   +      ++      K   +V+     D SLI G++I   + + D SI GK+  +K
  S:     8 FARALVDLAHEEDKVH--LFYDNLKVVFDLVKENQDLMSLMNSQVLSKNQKHEIIDVVFKDHLTQTIVD-----FLKVVIDNREFFHIKSIIKKFFRMIEEEEHTIFINVVSAHELNDDQKAQLVEKLHKKFASQVKILYQTDPSLIAGIRIQSNDLLIDNSIDGKLKLLK 171
>gi|186900970|ref|ZP_02973925.1| ATP synthase F1, delta subunit [Cyanothece sp. PCC 7424] >gi|186692092|gb|EDU16713.1| ATP synthase F1, delta subunit [Cyanothece sp. PCC 7424] (184 aa)
Score = 119, Expect = 6.1e-05, Identities = 44/173 (25%), Positives = 88/173 (50%)
  Q:    10 YANALYSIWLELDKKNKII--FTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNN---FFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEK-IEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNI 182
           YA AL S+     + N +   F    + +   L N+ E+   + + +I +E K +IL +I  D +      YL+NFL +L D     F +++ E +++  ++L    N +   + S   +  +  +  I+ + +I   + V  +  I+  LIGG+ I  G+ + D SI+G++ +I  ++
  S:    14 YAQALMSV----SQSNNLTERFGEDIRSLLDLLNNSPELREFLSNPVIREENKKEILQRIMGDQTHP----YLRNFLMLLVDKRRIAFLEQVCEQYLALLRQL---TNTVLAEVVSATELNDEQRQSVIDKVKTISGAQAVELKASINPDLIGGVIIKIGSQILDASIRGQLRRISLSL 181
>gi|118726893|ref|ZP_01575508.1| ATP synthase F1, delta subunit [Clostridium cellulolyticum H10] >gi|118663708|gb|EAV70354.1| ATP synthase F1, delta subunit [Clostridium cellulolyticum H10] (175 aa)
Score = 119, Expect = 6.2e-05, Identities = 39/129 (30%), Positives = 71/129 (55%)
  Q:    50 IDSNIISKEEKTKILNKIFFD-LSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIK-TGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           +++ ++  ++K  ++  +F D LSK++ N+ L     +L   +    I  IF  F Q  +E  N L ++I     +++  LE +   F  K     V    I+D+SLIGG+K++ G+ VYD S+KG+I+ +
  S:    44 LNNPVVKTDKKQALIRSVFTDRLSKNMLNMIL-----LLVSKHRTAEIPGIFNQFIQMANETANVLDMKIIMAAPMDEVQLETLREKFKKKYNAVAVNSTEIVDESLIGGLKVIIGDKVYDGSVKGRIESL 169
>gi|110602254|ref|ZP_01390380.1| ATP synthase F1, delta subunit [Geobacter sp. FRC-32] >gi|110547031|gb|EAT60331.1| ATP synthase F1, delta subunit [Geobacter sp. FRC-32] (180 aa)
Score = 119, Expect = 6.2e-05, Identities = 50/170 (29%), Positives = 84/170 (49%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNN---FFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           YA AL  I  E    +K  F+         L  +  +  +  +     E K +IL +I   L  S +N+   NFL +L D N   F  +I+E F SF    D+    +   + S   +E+  +++I++  +  TGK+V  +  +D SLIGG+    G+ V+D SIK ++ +I+
  S:    10 YAKALVQIGAEEGNVDK--FSGELSQFTGVLAGSTSLTAVFSNPAYGIEAKKEILKEIMTKLGLS-NNV--ANFLQLLLDRNRLPFLPQIVESFNSF---ADDLSGVIRPTLTSGLPLEQSQIDEIKNSLTKATGKKVVLKVEVDPSLIGGVVTKIGDKVFDGSIKTQLAKIQ 174
>gi|99081929|ref|YP_614083.1| ATP synthase F1, delta subunit [Silicibacter sp. TM1040] >gi|99038209|gb|ABF64821.1| ATP synthase F1 delta subunit [Silicibacter sp. TM1040] (217 aa)
Score = 119, Expect = 6.6e-05, Identities = 40/172 (23%), Positives = 86/172 (50%)
  Q:     8 DHYANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKI-----FFD-LSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           D YA A++ I  E +  + +   +S  D+  SL ++ ++  +I S ++S+EE+   ++ +       D L  S++ +  K  LFV         +  +  +   ++ E +  +   + S   + K   EK+    + + GK+V     +D S+IGG+ +  G+ + D SI+ K++ ++
  S:    44 DRYATAIFEIAAESNALDNL--ETSINDLAASLADSEDLRTLITSPLVSREEQAAAISAVADKMGLVDVLRNSLALMAAKRRLFV---------VPALIDALRARIAEARGEVTAEVVSAKALTKTQSEKLAKTLAERVGKKVTINATVDASIIGGLVVKVGSKMIDSSIRSKLNSLQ 210
>gi|110598591|ref|ZP_01386859.1| ATP synthase F1, delta subunit [Chlorobium ferrooxidans DSM 13031] >gi|110339825|gb|EAT58332.1| ATP synthase F1, delta subunit [Chlorobium ferrooxidans DSM 13031] (181 aa)
Score = 119, Expect = 6.6e-05, Identities = 44/170 (25%), Positives = 79/170 (46%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           YA+AL S   E    + I+     K I   L N+ ++VH++ S +I  ++K  IL +IF D      ++    FL ++        + EI   F   LDE Q  L   + S   +    +  +    +  TGK +R +  ++  LIGG+ +  G+ + D S+  +++ +K
  S:    10 YASALLSSAEEGGFLDTIV--EELKQIRDVLNNSRDLVHVLRSPLIQGDKKVHILEEIFRDSVGQKMHL----FLSLIAKKKRAGLLPEIIDEFQVLLDEKQGVLNADVTSAVALSDLQVSDLVSKLTASTGKTIRAKMKVNADLIGGVSVKIGDTILDGSVSHQLEMLK 173
>gi|144227443|gb|AAZ44140.2| ATP synthase delta chain [Mycoplasma hyopneumoniae J] (187 aa)
Score = 119, Expect = 7.0e-05, Identities = 39/132 (29%), Positives = 70/132 (53%)
  Q:    40 LKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSI 171
           ++NN  ++ +  S+ I K+EK  I++KIF   S  I  I L NFL V+  NN F    +I + + +  + H +  +  I + F +   +    E + S K GK+V   + I+  LI G++I+  N +++ S+
  S:    39 IQNNQVLILLFKSHFIGKQEKFNIIDKIF---SAKIEKI-LVNFLKVIAKNNLFLYYKQILLKYIKLANSHLSQTWGEIETAFPISSVMTSSFESILSKKLGKKVHLRHKINSKLISGIRIIVDNQIFENSL 166
>gi|71893405|ref|YP_278851.1| F0F1 ATP synthase subunit delta [Mycoplasma hyopneumoniae J] (185 aa)
Score = 119, Expect = 7.0e-05, Identities = 39/132 (29%), Positives = 70/132 (53%)
  Q:    40 LKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSI 171
           ++NN  ++ +  S+ I K+EK  I++KIF   S  I  I L NFL V+  NN F    +I + + +  + H +  +  I + F +   +    E + S K GK+V   + I+  LI G++I+  N +++ S+
  S:    37 IQNNQVLILLFKSHFIGKQEKFNIIDKIF---SAKIEKI-LVNFLKVIAKNNLFLYYKQILLKYIKLANSHLSQTWGEIETAFPISSVMTSSFESILSKKLGKKVHLRHKINSKLISGIRIIVDNQIFENSL 164
>gi|163737808|ref|ZP_02145225.1| ATP synthase F1, delta subunit [Phaeobacter gallaeciensis BS107] >gi|161389334|gb|EDQ13686.1| ATP synthase F1, delta subunit [Phaeobacter gallaeciensis BS107] (186 aa)
Score = 118, Expect = 8.6e-05, Identities = 42/170 (24%), Positives = 88/170 (51%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEK----TKILNKIFFD--LSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           YA A++ I  E    + +   +S  D+  +L ++ ++  +I S ++S++E+    T I  K+  D  LS +++ +  K  LFV         +  +  +   +L E +  +   + S   + K   EK+    + +TGK+V     +D+S+IGG+ +  G+ + D SI+ K++ ++
  S:    15 YATAIFEIAEESKALDSL--ETSINDLSAALADSEDLRDLITSPLVSRQEQGTAITAIAKKMGLDPVLSNALTLMAEKRRLFV---------VPALLDALRVRLAETRGEITADVTSAKALTKTQSEKLAKTLAERTGKKVVINATVDESIIGGLVVKVGSKMIDNSIRSKLNSLQ 179
>gi|163742886|ref|ZP_02150270.1| ATP synthase delta chain [Phaeobacter gallaeciensis 2.10] >gi|161383850|gb|EDQ08235.1| ATP synthase delta chain [Phaeobacter gallaeciensis 2.10] (188 aa)
Score = 118, Expect = 8.6e-05, Identities = 42/170 (24%), Positives = 88/170 (51%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEK----TKILNKIFFD--LSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           YA A++ I  E    + +   +S  D+  +L ++ ++  +I S ++S++E+    T I  K+  D  LS +++ +  K  LFV         +  +  +   +L E +  +   + S   + K   EK+    + +TGK+V     +D+S+IGG+ +  G+ + D SI+ K++ ++
  S:    17 YATAIFEIAEESKALDSL--ETSINDLSAALADSEDLRDLITSPLVSRQEQGTAITAIAKKMGLDPVLSNALTLMAEKRRLFV---------VPALLDALRVRLAETRGEITADVTSAKALTKTQSEKLAKTLAERTGKKVVINATVDESIIGGLVVKVGSKMIDNSIRSKLNSLQ 181
>gi|157694080|ref|YP_001488542.1| F0F1 ATP synthase subunit delta [Bacillus pumilus SAFR-032] >gi|157682838|gb|ABV63982.1| H(+)-transporting two-sector ATPase, F(1) delta subunit [Bacillus pumilus SAFR-032] (181 aa)
Score = 118, Expect = 8.9e-05, Identities = 43/170 (25%), Positives = 82/170 (48%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTG-KRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           YA+AL+ I L     ++        +I   LK + E+   +    I+ ++K  ++ + F  +S  +  ++    L      N F  +   F+    +  +  + +   +YS   +    ++ +  +F+ K G   +R EN+IDK LIGG+KI  GN +YD S+ GK+ +I+
  S:    10 YASALFDIVLASSAVDET--EKELNEIKKVLKADQELNDFLVHPKITADKKKHLIAEAFKGVSTHV--LHTMYLLIDRGRTNIFSEMTSEFVKLANRTKQIDDAI---VYSVKPLSGAEIQSLSEVFAKKAGVTSLRVENVIDKDLIGGVKIRIGNRIYDGSVSGKLSRIE 173
>gi|194689268|gb|ACF78718.1| unknown [Zea mays] (226 aa)
Score = 118, Expect = 9.0e-05, Identities = 42/169 (24%), Positives = 86/169 (50%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKL-DEHQNFLFIRIYSPFVVEKKLLEKIEHLFS---IKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           YANALY+   +    + +    S   +    K + ++  I+++  +S  +K +I+ ++   ++    N  LKNFL  L +NN    +LE  I  F+ L   H+  + + I S   ++ K +++IE   S      GK+++    ++  ++GG+ +  G+   D S+  KI+++
  S:    50 YANALYTASAKTSSLDSV--AKSLSQLGEVFKKDPKLTTILNAPTLSVSDKQQIIKELQ-TVAGGDKNDVLKNFLSTLAENNRLG-LLEGVIDKFETLISAHKGEIELSITSAQELDSKAIQRIEKAVSKSEFSQGKKLKVVTKVNPDVLGGLIVEIGDRTIDLSVSSKINRL 218
>gi|70725930|ref|YP_252844.1| F0F1 ATP synthase subunit delta [Staphylococcus haemolyticus JCSC1435] >gi|68446654|dbj|BAE04238.1| ATP synthase delta chain [Staphylococcus haemolyticus JCSC1435] (179 aa)
Score = 117, Expect = 9.5e-05, Identities = 49/175 (28%), Positives = 85/175 (48%)
  Q:     5 NHIDHYANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIIS-KEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTG-KRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           N  + YA AL+ + ++ D+ +  +      ++  + KN  E +  IDSN      E+ K +  +F D     +N YLKN L +L +N     I  IF  F    +E+ N     + S + +  + L++I+ L   +T   +V     I+  LIGG ++  G  V D S+K  ++QI+
  S:     3 NVANKYAKALFDVAIDKDRLD--LMYDELSEVSEATKNYGEDLRAIDSNPNQPASERRKFVGIVFGD-----ANYYLKNMLMILANNRHLVLINSIFKEFKSLYNEYHNEDSAIVESVYQLSDEELDRIKDLILKQTNLSQVHITTKINPELIGGFRVKVGTTVLDGSVKKDLEQIE 172
>gi|153815542|ref|ZP_01968210.1| hypothetical protein RUMTOR_01778 [Ruminococcus torques ATCC 27756] >gi|145847184|gb|EDK24102.1| hypothetical protein RUMTOR_01778 [Ruminococcus torques ATCC 27756] (175 aa)
Score = 117, Expect = 9.7e-05, Identities = 35/135 (25%), Positives = 71/135 (52%)
  Q:    45 EMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTG-KRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           ++  ++D+  I +E+K ++++K+F           ++NFL ++      + + EIF ++  + DE +  +   ++   +  ++  + +E     K G KR   E   D SLIGG  +  GND YD S KG++D+++
  S:    42 QITDVLDNPTIRQEKKEQVIDKVF--------PREMRNFLKIVCRYRKVRLLGEIFDAYDMRADEEEQIIRAVLFYTALPSEEQKKGMESFLCRKYGAKRAYIEMKKDDSLIGGFILRVGNDEYDRSTKGRLDRLE 169
>gi|26992091|ref|NP_747516.1| F0F1 ATP synthase subunit delta [Pseudomonas putida KT2440] >gi|148550498|ref|YP_001270600.1| F0F1 ATP synthase subunit delta [Pseudomonas putida F1] >gi|167036420|ref|YP_001671651.1| F0F1 ATP synthase subunit delta [Pseudomonas putida GB-1] >gi|24987233|gb|AAN70980.1|AE016742_9 ATP synthase F1, delta subunit [Pseudomonas putida KT2440] >gi|148514556|gb|ABQ81416.1| ATP synthase F1, delta subunit [Pseudomonas putida F1] >gi|166862908|gb|ABZ01316.1| ATP synthase F1, delta subunit [Pseudomonas putida GB-1] (178 aa)
Score = 117, Expect = 9.9e-05, Identities = 32/111 (28%), Positives = 56/111 (50%)
  Q:    68 FFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           F D+     N   +NF+ V  +N+    + EI   F     E +  + + + S F + ++  +K+  + S + G+ VR     D SLIGG+ I  G+ V D S++GKI ++
  S:    62 FIDVCGDKFNAQAQNFIHVAAENDRLLLLPEIAALFDLYKAEQEKSVDVEVTSAFALNQEQQDKLAKVLSARLGQEVRLHASEDASLIGGVVIRAGDLVIDGSVRGKIAKL 172
>gi|168333941|ref|ZP_02692173.1| F0F1-type ATP synthase, delta subunit [Epulopiscium sp. 'N.t. morphotype B'] (180 aa)
Score = 117, Expect = 1.0e-04, Identities = 44/175 (25%), Positives = 87/175 (49%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIEN 184
           YA AL+ +  E  +  +  +   A+ +   L N  + + +++   I  +EK  ++ ++F + + S   + L +        N    IL+ F+    K+D  Q ++   + S   +  + L +I+     +TGK++     ID+SL+GGM I  G+ V D SIKG+++ +K ++ N
  S:     8 YATALFDLASEKGQVGE--YQEEAEGLLEILSNESDFIALLEHPSILLDEKLNLVKEVF-EGNASDDFVGLMHLCVKKGRQNLIIDILQKFVEM-AKVD--QGYVTATVTSSVPLADEKLTQIKSNLENQTGKKIDLSTAIDQSLLGGMIIRVGDKVVDGSIKGQMETLKTSLLN 176
>gi|39995221|ref|NP_951172.1| F0F1 ATP synthase subunit delta [Geobacter sulfurreducens PCA] >gi|39981983|gb|AAR33445.1| ATP synthase F1, delta subunit [Geobacter sulfurreducens PCA] (180 aa)
Score = 117, Expect = 1.2e-04, Identities = 38/140 (27%), Positives = 69/140 (49%)
  Q:    40 LKNNYEMVHIIDSNIISKEEKTKILNKIF--FDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           L  N ++  ++ S     E K +IL  +    +LS ++SN     FL VL D        +I  S+    DE    +   + S F ++   +E ++   +  TGKRV     +D +LIGG+    G+ V+D S++ ++++I+
  S:    38 LDGNADLASVLKSPAYRIEAKREILRDVLAKLNLSGTVSN-----FLQVLLDRGRIGFTPQIAHSYAVFADELSGIVRPVLTSAFPLDDAQVEGMKSALAKATGKRVELSAQVDSALIGGVVTKIGDKVFDGSVRTQLNRIQ 174
>gi|149925405|ref|ZP_01913669.1| ATP synthase F1, delta subunit [Limnobacter sp. MED105] >gi|149825522|gb|EDM84730.1| ATP synthase F1, delta subunit [Limnobacter sp. MED105] (177 aa)
Score = 116, Expect = 1.2e-04, Identities = 30/114 (26%), Positives = 57/114 (50%)
  Q:    66 KIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           K+F +L+K+ +     NFL  L +N     + EI   F +  + H+      I S F +    ++ +      K G ++     +D+SLIGG+ +  G+ + D S++GK++ +K
  S:    59 KVFVELTKTPAEAQAMNFLGALVENGRLLALPEIARQFEELKNSHEGSADAIIASAFPMTDAEVQNVRGALEKKFGSKLNVTVQVDESLIGGVCVTVGDQILDSSVRGKLNAMK 172
>gi|121592739|ref|YP_984635.1| F0F1 ATP synthase subunit delta [Acidovorax sp. JS42] >gi|120604819|gb|ABM40559.1| ATP synthase F1, delta subunit [Acidovorax sp. JS42] (180 aa)
Score = 116, Expect = 1.3e-04, Identities = 26/99 (26%), Positives = 53/99 (53%)
  Q:    81 KNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           KNFL  + DN   + + EI   F   ++         +YS F ++   L  +      + G+++     +D++LIGG++++ G++V D S+K +++Q+K
  S:    77 KNFLRTVIDNGRVQALPEIAAQFRTLVNRSHGTSDAVVYSAFPLDAGALTDVGATLEKRFGRKLNLSVQLDETLIGGVRVVVGDEVLDTSVKARLEQMK 175
>gi|68476283|ref|XP_717791.1| likely mitochondrial ATP synthase subunit Atp5 [Candida albicans SC5314] >gi|68476472|ref|XP_717697.1| likely mitochondrial ATP synthase subunit Atp5 [Candida albicans SC5314] >gi|46439422|gb|EAK98740.1| likely mitochondrial ATP synthase subunit Atp5 [Candida albicans SC5314] >gi|46439523|gb|EAK98840.1| likely mitochondrial ATP synthase subunit Atp5 [Candida albicans SC5314] (205 aa)
Score = 116, Expect = 1.3e-04, Identities = 40/176 (22%), Positives = 85/176 (48%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFS----IKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIENN 185
           YANALYS  ++     +     S + I   +K + ++ + + +  ++K+++  I   +  DLS   +     NFL VL +NN       +F  F    D +   +  ++ S   +E K+L++++        +  GK ++  N ++  ++GG+ +  G+   D SI  K+ ++   + +N
  S:    30 YANALYSATIQQSDMAQTY--KSLEKIENVIKGDPQLKNALTNPSLTKDDRVAIAKSVANDLSLDKTT---ANFLTVLAENNRLGNFSSVFQKFGLLNDAYNGVVEAKVTSAKPLESKILKRLQTSIGKSSFVGEGKTLKLTNQVNPEILGGLVVEVGDRTVDVSIANKVARLNQTLRDN 204
>gi|77166523|ref|YP_345048.1| F0F1 ATP synthase subunit delta [Nitrosococcus oceani ATCC 19707] >gi|76884837|gb|ABA59518.1| H+-transporting two-sector ATPase, delta (OSCP) subunit [Nitrosococcus oceani ATCC 19707] (178 aa)
Score = 116, Expect = 1.3e-04, Identities = 46/169 (27%), Positives = 80/169 (47%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           YANA++   L   +KN   + S   +++  L  + EM  +ID    + E+    L  +F ++         KNF+ +L DN     + E+   F Q   E +  L + I S   + ++ L +I      + G+ V +    D+SL+GG+ I  G+ V D S  GK++Q+
  S:    11 YANAVFE--LAQAQKNYDQW-SRVLNVFADLARDSEMQILIDDPRYTSEQ----LIGLFVEIGGDTVTESAKNFIKILADNRRLSVLPEVAALFEQLRAEIEGTLEVEIISAKPLAEEQLNEIASALKRRLGREVTFSRKTDESLLGGVIIRAGDLVIDGSAIGKLNQL 172
>gi|56697997|ref|YP_168368.1| ATP synthase delta chain [Silicibacter pomeroyi DSS-3] >gi|56679734|gb|AAV96400.1| ATP synthase delta chain [Silicibacter pomeroyi DSS-3] (186 aa)
Score = 116, Expect = 1.3e-04, Identities = 42/170 (24%), Positives = 84/170 (49%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEK----TKILNKIFFD--LSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           YA A+++I    D  +     +   D+  +L  + ++  +I S ++S+ E+    T +  K+  +  L+ ++S +  K  LFVL          ++  +    L E +  +   + S   + K  +EK+    S K GK V     +D+SLIGG+ +  G+ + D SI+ K++ ++
  S:    15 YATAIFAI--AQDNNDLKGLETGINDLTAALGESADLRSLIASPLVSRAEQEAAITAVAKKMKLNPVLANALSLMAQKRRLFVLP---------QLLTALRDALAEARGEVTAEVASAKALTKTQIEKLTKTLSEKVGKSVTINATVDESLIGGLVVKVGSKMIDSSIRSKLNSLQ 179
>gi|16329328|ref|NP_440056.1| F0F1 ATP synthase subunit delta [Synechocystis sp. PCC 6803] >gi|114586|sp|P27180|ATPD_SYNY3 ATP synthase delta chain >gi|47512|emb|CAA41134.1| ATPase subunit delta [Synechocystis sp. PCC 6803] >gi|1651809|dbj|BAA16736.1| ATP synthase d subunit [Synechocystis sp. PCC 6803] (185 aa)
Score = 116, Expect = 1.3e-04, Identities = 39/169 (23%), Positives = 83/169 (49%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNN---FFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKR-VRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           YA AL  I L   +    +F  + + +   L+++ ++  ++ S ++  E+K  +L  +  D      N YL NFL +L D     F + I E +++  ++     N +   + S   +     ++++      TG + V  E  +D  ++GG+ I  G+ V+D S++G++ ++
  S:    14 YAQAL--IGLAQQQNLTEVFGDNLRSLLTLLQDSPDLSAVLSSPVVKDEDKKSVLRSVLGDGG----NGYLLNFLMLLVDKRRIVFLEAICEQYLALLRQF---TNTVLAEVTSALKLTDAQKDQVKERVKQLTGAQAVELETKVDGDILGGIVIKVGSQVFDSSLRGQLRRV 177
>gi|192809059|ref|ZP_03037734.1| ATP synthase F1, delta subunit [Geobacillus sp. Y412MC10] >gi|192801730|gb|EDV78235.1| ATP synthase F1, delta subunit [Geobacillus sp. Y412MC10] (181 aa)
Score = 116, Expect = 1.4e-04, Identities = 19/62 (30%), Positives = 42/62 (67%)
  Q:   118 IYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           +YS + +  +  E++   F     +++R  N++D+SL+GG+K++ G+ +YD SI GK+++++
  S:   113 VYSTYPLSDQEKEQVASEFGQLAHQKIRVTNVVDESLLGGLKVVIGDKLYDGSIAGKLERLE 174
>gi|187603978|ref|ZP_02990189.1| ATP synthase F1, delta subunit [Exiguobacterium sp. AT1b] >gi|187484040|gb|EDU22033.1| ATP synthase F1, delta subunit [Exiguobacterium sp. AT1b] (177 aa)
Score = 116, Expect = 1.4e-04, Identities = 31/140 (22%), Positives = 74/140 (52%)
  Q:    45 EMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIEN 184
           E++ ++ +  +S  E  ++L   F D++  + N  L   + V ND     R L  ++   + +++++      + S + +    L+ +E +F  K GK ++ +N++D+ +IGG+++  G   YD +I+ K+ +++  + N
  S:    42 ELMDLLTNPAVSDSELAQLLKDSFGDMTAIVVNTLL---VMVENDRAAEVRALPRYVR--ELINDYRGIAEGIVTSAYPLSATDLKDVELVFGQKLGKTLQLKNVVDEEVIGGLRVQVGYTTYDDTIETKLTRLERELLN 176
>gi|3913121|sp|O50156|ATPD_STRBO ATP synthase delta chain >gi|2662323|dbj|BAA23752.1| proton-translocating ATPase delta subunit [Streptococcus equinus] (178 aa)
Score = 116, Expect = 1.4e-04, Identities = 49/177 (27%), Positives = 90/177 (50%)
  Q:     7 IDHYANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNN---FFKRILE-IFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIE 183
           ++ YA +L  I +E D   ++    S  +   S+     +   + S ++S++EK K++      L +  S++Y+ NFL V+  N    F K ILE +   F    ++H   +   +      ++++L  +   F +K GK V  ENI D+S++GG  I   N V D SI+ ++ + K N++
  S:     9 VEQYAKSLVEIAIEKDSLAEL---QSETEALLSVFEETNLADFLSSLVVSRDEKVKLVR-----LLQESSSVYMNNFLEVILQNEREAFLKAILEGVQKDFVIATNQHDIVVTTAVALTDEQKERILALVAEKFGVKAGKLV--ENI-DESILGGFVINVNNKVIDTSIRRQLQEFKMNLK 178
>gi|163765119|ref|ZP_02172152.1| ATP synthase F1, delta subunit [Anaeromyxobacter sp. K] >gi|196174716|gb|ACG75689.1| ATP synthase F1, delta subunit [Anaeromyxobacter sp. K] (179 aa)
Score = 116, Expect = 1.4e-04, Identities = 42/170 (24%), Positives = 80/170 (47%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYE----MVHIIDSNIISKEEKTKILNKIF--FDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           YA AL+S+ +E  +           D    LKN  E    +  ++ + + SKE++  I+ K+     L +  +N+     LF+L D N    +  +  +F    D+H   L  R+ S   ++    + I    S  T   V  +  +D +L+GG+    G+ VYD S++ +++ ++
  S:    10 YARALFSLAVEQGR------VEPWNDALQVLKNAVEGSPDLRDVLSNPVYSKEQRRAIVEKLASALKLEREPANL-----LFLLGDRNRLAYLAAVVDTFRSLADQHLGRLRARVTSAVPLDASAAQAIADRLSQATKATVLLDRAVDPALLGGVVAQVGSLVYDGSLRTQLEDLR 174
>gi|170017978|ref|YP_001728897.1| ATP synthase F1, delta subunit [Leuconostoc citreum KM20] >gi|169804835|gb|ACA83453.1| ATP synthase F1, delta subunit [Leuconostoc citreum KM20] (180 aa)
Score = 116, Expect = 1.5e-04, Identities = 44/176 (25%), Positives = 86/176 (48%)
  Q:     4 KNHIDHYANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTG-KRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           K+  D YA A++   L  ++ N          +    +NN   V I+ SN I+ E +  +L  +    S++I     +N + +L  NN    + +I  SF    ++    + +   +   +++  L+K+  +F+ KTG K V   N +D+S+IGG+ +   + + D S++ KI ++K
  S:     6 KDIADQYAKAIFE--LSSEQGNVEDTRKDLDTLKVVFENNPNFVTIVSSNDINSEARDGLLTTLTTGASEAI-----QNLVKLLAYNNRLNLLTQIVTSFEDYYNDAHGIVNVVATTAVALDETRLDKLAAVFASKTGAKHVNLTNNVDESIIGGVILQSQSTLIDGSLQTKIAKMK 175
>gi|67540234|ref|XP_663891.1| hypothetical protein AN6287.2 [Aspergillus nidulans FGSC A4] >gi|40739481|gb|EAA58671.1| hypothetical protein AN6287.2 [Aspergillus nidulans FGSC A4] (227 aa)
Score = 115, Expect = 1.6e-04, Identities = 42/169 (24%), Positives = 84/169 (49%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSA-KDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFS---IKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           YA ALY+      K + +  TS A  ++  +LK + ++  II +  +S  +K  I+ ++         +I LKNFL  L +NN    + ++   F   +  H+  + + I S   ++ K L ++E   S      GK+++  + ++  ++GG+ +  G+   D S+  KI ++
  S:    51 YATALYT---ASAKSSSLDATSKALNNLGAALKADPKLTSIISTPTLSAADKQAIVTELQKVAGADKGDI-LKNFLATLAENNRLGLLNDVVDKFAALMSAHRGEIELSITSAQELDAKTLNRLEKAVSKSEFSQGKKLKVVSKVNPDIVGGLIVEIGDRTIDLSVSSKIAKL 219
>gi|158321583|ref|YP_001514090.1| ATP synthase F1, delta subunit [Alkaliphilus oremlandii OhILAs] >gi|158141782|gb|ABW20094.1| ATP synthase F1, delta subunit [Alkaliphilus oremlandii OhILAs] (180 aa)
Score = 115, Expect = 1.8e-04, Identities = 41/166 (24%), Positives = 83/166 (50%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKI 175
           YA+AL+ +  E  K +K+        I   +++      ++ S +I+ +EK  I++ IF D       + + NFL+++ D      I +I   +   +D  QN +     +   +EK+ L  ++   S  +GK ++ +N +D ++IGG+ +  G+ V D +IK ++
  S:     9 YASALFELAFEEQKHHKV--QEELAFIRSCIEDEPSFFELLKSPLITADEKKDIISNIFRDRV----CMEVLNFLYIIIDKGREAYIKDIVNEYILLVDSVQNKVDAVAITAVPMEKQDLLMLQANLSKSSGKNIQLQNQVDPTIIGGVLVKIGDKVIDGTIKNRL 168
>gi|148266270|ref|YP_001232976.1| F0F1 ATP synthase subunit delta [Geobacter uraniireducens Rf4] >gi|146399770|gb|ABQ28403.1| ATP synthase F1, delta subunit [Geobacter uraniireducens Rf4] (180 aa)
Score = 115, Expect = 2.0e-04, Identities = 46/170 (27%), Positives = 80/170 (47%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           YA AL  I  E  + +K  F S        L  N  +  +  +     E K +IL +I   L+ S S   +  FL +L D +    + +I  S+    D+    +   + S   +E+  +E+I+   +  TGK+V  +  +D SLIGG+    G+ V+D S+K ++ +I+
  S:    10 YAKALVQIGAEEGQVDK--FNSELTQFNTVLAANAGLTSVFSNPAYGIEAKREILKEIIGKLALSES---VAKFLQLLLDRSRLAFLPQITESYGNFADDLSGVVRPTLTSGLPLEESQIEEIKTSLTKTTGKKVMLKVQVDPSLIGGVVTKIGDKVFDGSVKTQLAKIQ 174
>gi|44299|emb|CAA45548.1| adenosinetriphosphatase [Mycoplasma gallisepticum] (181 aa)
Score = 114, Expect = 2.1e-04, Identities = 49/170 (28%), Positives = 96/170 (56%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFD-LSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVV-EKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           +A AL  +  E DK +  +F  + K ++  +K N +++ +++S ++SK +K +I++ +F D L+++I      +FL V+ DN  F  I  I   FF+ +++ ++ +FI + S   + + +  E +E L+  K   +V+     D SLI G++I   + + D SI GK+  +K
  S:     8 FARALVDLAHEEDKVH--LFYDNLKVVFDLVKENQDLMSLMNSQVLSKNQKHEIIDVVFKDHLTQTIV-----DFLKVVIDNREFFHIKSIIKKFFRMIEKEEHTIFINVVSAHELNDDQKAELVEKLYK-KFASQVKILYQTDPSLIAGIRIQSNDLLIDNSIDGKLKLLK 171
>gi|21672859|ref|NP_660924.1| F0F1 ATP synthase subunit delta [Chlorobium tepidum TLS] >gi|21645908|gb|AAM71266.1| ATP synthase F1, delta subunit [Chlorobium tepidum TLS] (181 aa)
Score = 114, Expect = 2.2e-04, Identities = 39/170 (22%), Positives = 87/170 (51%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           YA AL  + +E +   K+  T   + I   L  ++E+V  + S +I+ + K+KIL +IF +     + +++K    +L        +  +   F   +DE    +   + S   +  +  +++ +  S++TGK++R +  +D++LIGG+ +  G+ + D SI  +++ ++
  S:    10 YAVALLEVAVEGNFLEKV--TEDLQKIQEVLSGSHELVLALKSPLINVDLKSKILEEIFRNKVDEKTMVFIK----LLAHKKRAALLAGVISEFNALIDERNGVINADVKSAIKLSDEQAKELVNSLSVRTGKKIRAKMRLDENLIGGVTVKIGDTIIDGSISHQLEMLR 173
>gi|67920482|ref|ZP_00514002.1| H+-transporting two-sector ATPase, delta (OSCP) subunit [Crocosphaera watsonii WH 8501] >gi|67857966|gb|EAM53205.1| H+-transporting two-sector ATPase, delta (OSCP) subunit [Crocosphaera watsonii WH 8501] (184 aa)
Score = 114, Expect = 2.3e-04, Identities = 43/169 (25%), Positives = 80/169 (47%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNN---FFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           YA AL S+    D    +      + I   L  + ++   I S +I  E+K  +LN++  D        YL+NF+ +L D     F + I E +++  +KL      L     S  + + +  + I+ + ++   + V  +   D  LIGG+ I  G+ V+D S++G++ +I
  S:    14 YAQALMSLAQSQDITRSV--GEDCRSILEMLGQSADLQSFISSPVIKDEDKRAVLNQLLGDDIHQ----YLRNFIMLLVDKRRIVFLEAICEQYLALLRKLT--NTVLAEVTASTELSDGQRRDVIDKIKTLTGAESVELKTDNDPELIGGVIIKVGSQVFDASLRGQLRRI 177
>gi|77964178|gb|ABB13423.1| ATP synthase subunit delta [Clostridium paradoxum] (180 aa)
Score = 114, Expect = 2.4e-04, Identities = 45/170 (26%), Positives = 98/170 (57%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           YA+A++ + +EL+K+   +F    K I  + + N +   ++ + I+SK+EK +++  I+    K  +++ + NFL VL D +    I EI   + Q L+E++N +     +   + ++ L+++ +    KT K V+ +N +D +++GG+ +  GN+  D ++K K++++K
  S:     9 YASAIFEVGVELNKEE--MFYEELKIISSNFEENEKFFKMLKTPILSKQEKKELIENIY----KDKASLEIVNFLKVLIDKDRISIIREIVDIYKQLLNENKNEIQAIAITAVPMSEESLKELTYKLCEKTKKNVKVKNQVDPTVLGGVLVKMGNEEIDGTVKTKLEKLK 172
>gi|85080302|ref|XP_956517.1| hypothetical protein NCU01606 [Neurospora crassa OR74A] >gi|27734221|sp|Q9P602|ATPO_NEUCR ATP synthase subunit 5, mitochondrial precursor (ATP synthase chain 5) (Oligomycin sensitivity conferral protein) (OSCP) >gi|16416018|emb|CAB91368.2| probable oligomycin sensitivity conferring protein (ATP5) [Neurospora crassa] >gi|28917584|gb|EAA27281.1| hypothetical protein NCU01606 [Neurospora crassa OR74A] (220 aa)
Score = 114, Expect = 2.4e-04, Identities = 41/169 (24%), Positives = 88/169 (52%)
  Q:    10 YANALYSIWLE---LDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFS----IKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           YA ALY+  ++   L+   K I  SS  ++   L  + ++  I+++  +S  +K+ I+ ++    S  +SN  +KNFL  L +NN    +  +   F + +   +  + + + S   ++ K L ++E   +    + +GK+++  N ++  +IGG+ +  G    D S+  KI ++
  S:    44 YATALYTAAVKTSALEPTAKAI--SSLGNL---LAKDPKLASILETPTLSPADKSAIVAEL--QKSVGVSNETVKNFLATLAENNRLGLLPSVVAKFSELMSAARGEVEMVVTSAQPLDNKTLNRLESAVAKSPYVGSGKKLKVTNKVNADIIGGLVVEIGERTIDLSVSSKIAKM 212
>gi|86136460|ref|ZP_01055039.1| ATP synthase delta chain [Roseobacter sp. MED193] >gi|85827334|gb|EAQ47530.1| ATP synthase delta chain [Roseobacter sp. MED193] (186 aa)
Score = 114, Expect = 2.5e-04, Identities = 38/170 (22%), Positives = 85/170 (50%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFD------LSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           YA A++ I  E    + +   +S  D+  +L ++ ++ ++I S +IS++E+   +  I         L+ ++S +  K  LFV         +  +  +   +L E +  +   + S   + K   EK+    + + GK++     +D+S+IGG+ +  G+ + D SI+ K++ ++
  S:    15 YATAVFEIAEESKALDSL--ETSINDLAAALADSDDLQNLISSPLISRDEQGAAITAIAAKMGLAPVLANTLSLMAQKRRLFV---------VPALITALRDRLSEARGEVTAEVISAKALTKTQSEKLAKTLAERVGKKITINATVDESIIGGLVVKVGSKMVDSSIRSKLNSLQ 179
>gi|89095627|ref|ZP_01168521.1| F0F1 ATP synthase subunit delta [Bacillus sp. NRRL B-14911] >gi|89089373|gb|EAR68480.1| F0F1 ATP synthase subunit delta [Bacillus sp. NRRL B-14911] (178 aa)
Score = 114, Expect = 2.6e-04, Identities = 34/140 (24%), Positives = 76/140 (54%)
  Q:    40 LKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDN--NFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGK-RVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           + NN  +  ++ S  +  +EK  I+   F     S++ + L   + +++ +  + F  + E FIS     ++ +     ++YS   + +    ++   F+ + GK  +R ENI+D  L+GG+K+  GN ++D S++GK+++++
  S:    38 VNNNKGLDAVLKSPKLENDEKKGIIKTAF----ASVNPLVLNTLMLLIDRHREDQFSDLAEEFISL---ANDARGIAEAKVYSVRPLTEAESSELSAAFASRVGKTSLRIENIVDPGLLGGIKLRIGNRIFDGSMRGKLERLE 173
>gi|114330301|ref|YP_746523.1| ATP synthase F1, delta subunit [Nitrosomonas eutropha C91] >gi|114307315|gb|ABI58558.1| ATP synthase F1, delta subunit [Nitrosomonas eutropha C91] (178 aa)
Score = 113, Expect = 2.8e-04, Identities = 40/134 (29%), Positives = 71/134 (52%)
  Q:    45 EMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLND---NNFFKRILEIFIS------------FFQKLD-EHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           EM+ I+ S I   +    I N         I +I L+  +F + D   N   +R++ + I              +++L  +H++ L   I S F +E   LEK+  +  +K   +V+ +  +D  LIGG+KI  G+ V D S+ GK++ +
  S:    30 EMLGIVSSVIQESQVNALIGNP-------QIPSIKLREIVFSICDKELNEDGRRLISLLIENGRLLVLPQISELYEQLKAQHESVLEAEIVSAFPLESYQLEKLISVLEVKFQHKVKAQVSVDSGLIGGVKIEIGDQVIDSSVSGKLEAM 172
>gi|194016379|ref|ZP_03054993.1| ATP synthase F1, delta subunit [Bacillus pumilus ATCC 7061] >gi|194011852|gb|EDW21420.1| ATP synthase F1, delta subunit [Bacillus pumilus ATCC 7061] (181 aa)
Score = 113, Expect = 2.9e-04, Identities = 43/170 (25%), Positives = 81/170 (47%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTG-KRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           YA+AL+ I L     ++        +I   LK + E+   +    I+  +K  ++ + F  +S  +  ++    L      N F  +   F+    +  +  + +   +YS   +    ++ +  +F+ K G   +R EN+IDK LIGG+KI  GN +YD S+ GK+ +I+
  S:    10 YASALFDIVLASSAVDET--EKELNEIKKVLKVDQELNDFLVHPKITANKKKHLIAEAFKGVSTHV--LHTMYLLIDRGRTNIFSEMTSEFVKLANRTKQIDDAI---VYSVKPLSGAEIQSLSEVFAKKAGVTSLRVENVIDKDLIGGVKIRIGNRIYDGSVSGKLSRIE 173
>gi|121603169|ref|YP_980498.1| F0F1 ATP synthase subunit delta [Polaromonas naphthalenivorans CJ2] >gi|120592138|gb|ABM35577.1| ATP synthase F1, delta subunit [Polaromonas naphthalenivorans CJ2] (179 aa)
Score = 113, Expect = 3.0e-04, Identities = 36/170 (21%), Positives = 84/170 (49%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           YA+ALY       + + +  T+   D   ++  N +++   DS  +S ++   ++  +  + +  +     +NFL ++ +N     + EI   F    +         ++S F ++++ L  I  +   + G+++  +  +D SLIGG++ + G++V D S+K +++Q+K
  S:    11 YADALYKA-----QGSDLATTALWVDKLAAVAGNAQLLQFADSPKVSVDQVFDVVAGVASNANDPLPEA-ARNFLRLVIENGRLSALPEIASQFRSLKNAAGGMTDAVVFSAFPMDEQALNDIAAVLEKRFGRKLGIKVELDPSLIGGIRAVVGDEVLDTSVKARLEQMK 174
>gi|53728943|ref|ZP_00134545.2| COG0712: F0F1-type ATP synthase, delta subunit (mitochondrial oligomycin sensitivity protein) [Actinobacillus pleuropneumoniae serovar 1 str. 4074] >gi|126209113|ref|YP_001054338.1| F0F1 ATP synthase subunit delta [Actinobacillus pleuropneumoniae L20] >gi|165977085|ref|YP_001652678.1| F0F1 ATP synthase subunit delta [Actinobacillus pleuropneumoniae serovar 3 str. JL03] >gi|190150980|ref|YP_001969505.1| ATP synthase delta chain [Actinobacillus pleuropneumoniae serovar 7 str. AP76] >gi|126097905|gb|ABN74733.1| ATP synthase delta chain [Actinobacillus pleuropneumoniae L20] >gi|165877186|gb|ABY70234.1| ATP synthase delta chain [Actinobacillus pleuropneumoniae serovar 3 str. JL03] >gi|189916111|gb|ACE62363.1| ATP synthase delta chain [Actinobacillus pleuropneumoniae serovar 7 str. AP76] (177 aa)
Score = 113, Expect = 3.1e-04, Identities = 42/169 (24%), Positives = 84/169 (49%)
  Q:    10 YANALYSIWLE---LDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           YA A +   LE   LDK  +++  S+       +  N ++   I+S++ S +     +++ F  +     + Y +NF+ V+ +N     +  +F +F     EH+    + I+S   + +   +KI      + G++VR  N ID SLI G+ I + + V D S +G+++++
  S:    11 YAKAAFDFALEQGQLDKWQEMLQFSAF------VAENEQVAEYINSSLASGQ-----ISETFIKICGDQLDQYGQNFIRVMAENKRLAVLPMVFDTFVSLRAEHEAVKDVTIFSANELSQAQEDKIAKAMEKRLGQKVRLTNQIDNSLIAGVIIKYDDVVIDGSSRGQLNRL 171
>gi|28872701|ref|NP_795320.1| F0F1 ATP synthase subunit delta [Pseudomonas syringae pv. tomato str. DC3000] >gi|28855957|gb|AAO59015.1| ATP synthase F1, delta subunit [Pseudomonas syringae pv. tomato str. DC3000] (178 aa)
Score = 113, Expect = 3.2e-04, Identities = 29/98 (29%), Positives = 53/98 (54%)
  Q:    81 KNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           +NF+ V+ +N+    + EI   F     E +  + + + S F + ++  +K+  + S + G+ VR     D SLIGG+ I  G+ V D S++GKI ++
  S:    75 QNFIHVVAENDRLPLLPEIAELFDLYKAEQEKSVDVDVTSAFALNQEQQDKLAKVLSARLGREVRLHAAEDASLIGGVVIRAGDLVIDGSVRGKIAKL 172
>gi|66048348|ref|YP_238189.1| F0F1 ATP synthase subunit delta [Pseudomonas syringae pv. syringae B728a] >gi|71737057|ref|YP_277283.1| F0F1 ATP synthase subunit delta [Pseudomonas syringae pv. phaseolicola 1448A] >gi|63259055|gb|AAY40151.1| H+-transporting two-sector ATPase, delta (OSCP) subunit [Pseudomonas syringae pv. syringae B728a] >gi|71557610|gb|AAZ36821.1| ATP synthase F1, delta subunit [Pseudomonas syringae pv. phaseolicola 1448A] (178 aa)
Score = 113, Expect = 3.2e-04, Identities = 29/98 (29%), Positives = 53/98 (54%)
  Q:    81 KNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           +NF+ V+ +N+    + EI   F     E +  + + + S F + ++  +K+  + S + G+ VR     D SLIGG+ I  G+ V D S++GKI ++
  S:    75 QNFIHVVAENDRLPLLPEIAELFDLYKAEQEKSVDVDVTSAFALNQEQQDKLAKVLSARLGREVRLHAAEDASLIGGVVIRAGDLVIDGSVRGKIAKL 172
>gi|148377619|ref|YP_001256495.1| ATP synthase delta subunit [Mycoplasma agalactiae PG2] >gi|148291665|emb|CAL59051.1| ATP synthase delta subunit [Mycoplasma agalactiae PG2] (186 aa)
Score = 113, Expect = 3.3e-04, Identities = 50/181 (27%), Positives = 88/181 (48%)
  Q:     4 KNHIDHYANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIEN 184
           K + D YA ALY   L  ++K+      +    Y  L N+ E+    +S+ I  EEK KI +++   + ++ +     NFL +L   N    +L+    + + ++   N L  ++ S F ++ +   KI      K  K+++    IDKSLI G KI+ GND+ + + K  +++I   I N
  S:     4 KANADGYALALYD--LHKEEKHVSSTYENILSFYELLSNDKEVFSFFNSSKIGLEEKHKIADEL---VQENKNLKTFANFLKLLISKNNSPLLLQALSIYIRLVESELNILRAKLISAFEIDNQTKIKIIEKLENKYNKKIKLTTFIDKSLIFGFKIVIGNDIIEQNAKADLEKISSLINN 179
>gi|171323833|ref|ZP_02912351.1| ATP synthase F1, delta subunit [Geobacillus sp. WCH70] >gi|171090144|gb|EDT36456.1| ATP synthase F1, delta subunit [Geobacillus sp. WCH70] (178 aa)
Score = 112, Expect = 3.6e-04, Identities = 43/170 (25%), Positives = 85/170 (50%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRY-ENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           YA AL+ I  E    +++      + ++     N + + ++    +S E+K  ++ + F  +S       L+N L +L + +    + ++   F   ++E +       YS   + ++    +  +F+ K GK   + ENI+D SLIGG+K+  GN +YD SI GK+++I+
  S:    10 YALALFQIATEKQLLDQL--EEEIRAVWQVFAENDKFLSLLTYPKLSLEKKKALIKETFAAVSSP-----LRNTLLLLLERHRIDIVPQLAEQFIHLVNEARGVAEATAYSARPLTEEEKRALSDVFAKKMGKTTLHIENIVDPSLIGGVKLRIGNRIYDGSISGKLERIQ 173
>gi|79327782|ref|NP_001031875.1| ATP synthase delta chain, mitochondrial, putative / H(+)-transporting two-sector ATPase, delta (OSCP) subunit, putative [Arabidopsis thaliana] (190 aa)
Score = 112, Expect = 3.8e-04, Identities = 31/99 (31%), Positives = 53/99 (53%)
  Q:    81 KNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYS----PFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           KNFL +L +N   K +  I   F Q  + H+  + + + +    P   EK+L E ++ +  I  GK++  E  ID S+ GG+ + F   V D SI+ +  Q++
  S:    78 KNFLSLLAENGKLKNLDAIVKKFMQLTNAHRGDVKVLVTTVIPLPPAEEKELTETLQEI--IGAGKKITVEQKIDPSIYGGLIVEFQQKVLDMSIRTRAQQME 178
>gi|124004916|ref|ZP_01689759.1| ATP synthase F1, delta subunit [Microscilla marina ATCC 23134] >gi|123989594|gb|EAY29140.1| ATP synthase F1, delta subunit [Microscilla marina ATCC 23134] (179 aa)
Score = 112, Expect = 3.8e-04, Identities = 38/139 (27%), Positives = 71/139 (51%)
  Q:    41 KNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           + N +   ++ + II   +K  IL  IF      +S++ +  F  +L   +  + +  I ++F ++ + ++N   + + S   +   L E++    S KTGK ++ E  ID+SLIGGM I   +   D SIK ++ +IK
  S:    40 EENRQFFAVMHNPIIRAHKKLSILKAIF---EGKVSDVMILLFE-ILARRSREEVLYSISVAFREQFNIYKNIQEVYVTSTVTLPDPLKEELRAALSQKTGKTIKIEEEIDESLIGGMVIRISDTQLDNSIKSQLQKIK 174
>gi|160881857|ref|YP_001560825.1| ATP synthase F1, delta subunit [Clostridium phytofermentans ISDg] >gi|160430523|gb|ABX44086.1| ATP synthase F1, delta subunit [Clostridium phytofermentans ISDg] (182 aa)
Score = 112, Expect = 3.9e-04, Identities = 46/173 (26%), Positives = 83/173 (47%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYE--NIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNI 182
           Y  AL+   L L+ ++  I     K +      N E++  ++   I+KEEK   +  IF    K   +  +  FL ++     +  I  IF  F  K+ EH+N     + S   + ++  E+I+    + T K V++E    +D S++GG+ I  G+ V D S+K K++ +  N+
  S:     9 YGEALFD--LALENQSLDIIEEEIKAVKMVFNENTELIKFLNHPKITKEEKVAFVENIF----KGRVSDDVTGFLVIIIKKGRYDEISGIFDYFLAKVREHKNIGVAYVTSAVEISEQEKEQIKDKL-LATTKYVQFEMNYKVDASILGGLIIRIGDRVVDSSLKSKLNTLSKNL 176
>gi|163789296|ref|ZP_02183738.1| uracil phosphoribosyltransferase [Flavobacteriales bacterium ALC-1] >gi|159875511|gb|EDP69573.1| uracil phosphoribosyltransferase [Flavobacteriales bacterium ALC-1] (178 aa)
Score = 112, Expect = 4.0e-04, Identities = 34/141 (24%), Positives = 68/141 (48%)
  Q:    39 SLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           S+ +N ++  ++ S +I   +K  IL ++F     S +N      + +L  N     + ++ + + +  ++ QN     + +   + K L  K+       TG     ENIID+S++GG  +  G+  Y+ SI  K+D++K
  S:    37 SVNDNNDLKEMLQSAVIKSSDKKNILLQVF-----SGANPMFSKLIDLLVKNKRVSILGDVAVKYVELFEKSQNIQVATVTTAVALTKDLETKVLAKVKELTGMEAEVENIIDESILGGFILRVGDIQYNASIANKLDKLK 172
>gi|170724359|ref|YP_001752047.1| ATP synthase F1, delta subunit [Pseudomonas putida W619] >gi|169762362|gb|ACA75678.1| ATP synthase F1, delta subunit [Pseudomonas putida W619] (178 aa)
Score = 112, Expect = 4.0e-04, Identities = 31/111 (27%), Positives = 56/111 (50%)
  Q:    68 FFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           F D+     N   +NF+ V  +N+    + EI   F     E +  + + + S F + ++  +K+  + S + G+ VR     D +LIGG+ I  G+ V D S++GKI ++
  S:    62 FIDVCGDKFNAQAQNFIRVAAENDRLLLLPEIAALFDLYKAEQEKSVDVEVTSAFALNQEQQDKLAKVLSARLGQEVRLHASEDANLIGGVVIRAGDLVIDGSVRGKIAKL 172
>gi|194684373|emb|CAR46015.1| ATP synthase delta chain [Proteus mirabilis HI4320] (177 aa)
Score = 112, Expect = 4.1e-04, Identities = 30/127 (23%), Positives = 64/127 (50%)
  Q:    52 SNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           + ++S    ++ L  IF DL     + + +N + V+ +N+    + E+   F Q     ++ + + + S   + K+ L  I      +  ++V+    IDKS+I GM I  G+ V D S++G+++++
  S:    45 TELLSGSLASEKLADIFIDLCGDQIDEHAQNLIRVMAENDRLSTLPEVLSQFIQLRAVLESTVDVEVTSAIELTKQQLANISAAMEKRLSRKVKLNCKIDKSVIAGMIIRAGDLVIDGSVRGRLERL 171
>gi|117926735|ref|YP_867352.1| ATP synthase F1, delta subunit [Magnetococcus sp. MC-1] >gi|117610491|gb|ABK45946.1| ATP synthase F1, delta subunit [Magnetococcus sp. MC-1] (179 aa)
Score = 112, Expect = 4.3e-04, Identities = 43/179 (24%), Positives = 84/179 (46%)
  Q:     1 MEEKNHIDHYANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           M E      YA AL  +  EL+  + I            L  + EM  ++ S  +SKE + K+++  + + +K   N    NFL +L D +    + ++  +  + +DE    + +++ +P  +   L+ K+E   +  TGK V  E      L+GG+ I  G+ + D S++ ++ ++K
  S:     1 MHESTIAKRYATALAELASELNILDSI--RDELAHFQALLAESPEMHEMMVSPTVSKESQHKLIST-YLEYAKP--NDLTANFLRLLIDKHRMALLNDVATAIVRVVDERAGRIQVKVETPKALTPSLVAKLEKSLADVTGKEVSLEISEKPELLGGLVIRMGSVMLDDSLRTQLHRLK 174
>gi|6320504|ref|NP_010584.1| Subunit 5 of the stator stalk of mitochondrial F1F0 ATP synthase, which is an evolutionarily conserved enzyme complex required for ATP synthesis; homologous to bovine subunit OSCP (oligomycin sensitivity-conferring protein); phosphorylated; Atp5p [Saccharomyces cerevisiae] >gi|114685|sp|P09457|ATPO_YEAST ATP synthase subunit 5, mitochondrial precursor (ATP synthase chain 5) (Oligomycin sensitivity conferral protein) (OSCP) >gi|3404|emb|CAA30917.1| unnamed protein product [Saccharomyces cerevisiae] >gi|172087|gb|AAA34836.1| oligomycin sensitivity conferring protein (OSCP) >gi|849218|gb|AAB64734.1| Atp5p: ATP synthase oligomycin sensitivity conferral protein (Swiss Prot. accession number P09457) [Saccharomyces cerevisiae] >gi|45269355|gb|AAS56058.1| YDR298C [Saccharomyces cerevisiae] >gi|151942270|gb|EDN60626.1| F1F0 ATP synthase subunit 5 [Saccharomyces cerevisiae YJM789] >gi|190404759|gb|EDV08026.1| ATP synthase subunit 5 [Saccharomyces cerevisiae RM11-1a] (212 aa)
Score = 112, Expect = 4.4e-04, Identities = 45/176 (25%), Positives = 89/176 (50%)
  Q:    10 YANALYSIWLELDKKNKIIFTS--SAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFS----IKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIENN 185
           YA ALY    +   KN  I  +  S + +  ++K N ++ H++ +  +S +++  +++ I  +  K++   Y+ N L VL++NN      +I   F    D H   L   + S   ++ K  ++IE   S    +  GK ++ EN++   + GG+ +  G+   D SI  KI ++   +E++
  S:    36 YATALY----QAAAKNSSIDAAFQSLQKVESTVKKNPKLGHLLLNPALSLKDRNSVIDAIV-ETHKNLDG-YVVNLLKVLSENNRLGCFEKIASDFGVLNDAHNGLLKGTVTSAEPLDPKSFKRIEKALSASKLVGQGKSLKLENVVKPEIKGGLIVELGDKTVDLSISTKIQKLNKVLEDS 211
>gi|154687799|ref|YP_001422960.1| F0F1 ATP synthase subunit delta [Bacillus amyloliquefaciens FZB42] >gi|154353650|gb|ABS75729.1| AtpH [Bacillus amyloliquefaciens FZB42] (181 aa)
Score = 112, Expect = 4.4e-04, Identities = 39/170 (22%), Positives = 88/170 (51%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSA-KDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTG-KRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           YA+AL+ I +E  + N+I    +  K+++   +N   +  ++    +S  +K +++ + F  LS+S+ +      +F+L D      + ++   F +  ++ +      +YS   + +  +  +  +F+ K G   +R  N +   LIGG+K+  GN +YD S+ GK+++++
  S:    10 YASALFDIAVETSQINEIEEELTVLKEVF---RNEAGLQEVLSHPKVSAAKKKELIQQSFGALSESVLHT-----IFLLIDRRRSSIVPDLTDEFIKLANQARQTEDAVVYSVKPLSEAEMLSLSQVFAKKAGIASLRIRNEVQTDLIGGIKVRIGNRIYDGSVSGKLERME 173
>gi|14190495|gb|AAK55728.1|AF380647_1 AT5g13450/T22N19_100 [Arabidopsis thaliana] >gi|15809744|gb|AAL06800.1| AT5g13450/T22N19_100 [Arabidopsis thaliana] (238 aa)
Score = 112, Expect = 4.5e-04, Identities = 31/99 (31%), Positives = 53/99 (53%)
  Q:    81 KNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYS----PFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           KNFL +L +N   K +  I   F Q  + H+  + + + +    P   EK+L E ++ +  I  GK++  E  ID S+ GG+ + F   V D SI+ +  Q++
  S:   126 KNFLSLLAENGKLKNLDAIVKKFMQLTNAHRGDVKVLVTTVIPLPPAEEKELTETLQEI--IGAGKKITVEQKIDPSIYGGLIVEFQQKVLDMSIRTRAQQME 226
>gi|15240628|ref|NP_196849.1| ATP synthase delta chain, mitochondrial, putative / H(+)-transporting two-sector ATPase, delta (OSCP) subunit, putative [Arabidopsis thaliana] >gi|22096334|sp|Q96251|ATPO_ARATH ATP synthase subunit O, mitochondrial precursor (Oligomycin sensitivity conferral protein) (OSCP) >gi|7543912|emb|CAB87152.1| delta subunit of mitochondrial F1-ATPase [Arabidopsis thaliana] (238 aa)
Score = 111, Expect = 4.6e-04, Identities = 31/99 (31%), Positives = 53/99 (53%)
  Q:    81 KNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYS----PFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           KNFL +L +N   K +  I   F Q  + H+  + + + +    P   EK+L E ++ +  I  GK++  E  ID S+ GG+ + F   V D SI+ +  Q++
  S:   126 KNFLSLLAENGKLKNLDAIVKKFMQLTNAHRGDVKVLVTTVIPLPPAEEKELTETLQEI--IGAGKKITVEQKIDPSIYGGLIVEFQQKVLDMSIRTRAQQME 226
>gi|171779635|ref|ZP_02920591.1| hypothetical protein STRINF_01472 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gi|171281737|gb|EDT47171.1| hypothetical protein STRINF_01472 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] (178 aa)
Score = 111, Expect = 4.9e-04, Identities = 52/177 (29%), Positives = 90/177 (50%)
  Q:     7 IDHYANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNN---FFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKK--LLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIE 183
           ++ YA +L  I +E D   ++    S  +   S+     +   + S ++S++EK K++      L +  S++Y+ NFL V+  N    F K ILE     F  +  +Q+ + +R       E+K  +L  +   F +K GK V  ENI D+S++GG  I   N V D SI  ++ + K N++
  S:     9 VEQYAKSLVEIAIEKDSLAEL---QSETEALLSVFEETNLADFLSSLVVSRDEKVKLVR-----LLQESSSVYMNNFLEVILQNEREAFLKAILEGVQKDFV-IATNQHDIVVRTAVVLTDEQKDRILALVAEKFGVKAGKLV--ENI-DESILGGFVINVNNKVIDTSIHRQLQEFKMNLK 178
>gi|153007335|ref|YP_001381660.1| F0F1 ATP synthase subunit delta [Anaeromyxobacter sp. Fw109-5] >gi|152030908|gb|ABS28676.1| ATP synthase F1, delta subunit [Anaeromyxobacter sp. Fw109-5] (179 aa)
Score = 111, Expect = 5.5e-04, Identities = 38/170 (22%), Positives = 81/170 (47%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           YA AL+S  L ++K     ++ S + +   ++ + ++  ++ + + S+E++  I+ K+   L          N LF+L D N    +  I  +F    DEH   +  ++ S   ++    + I    S  T   V  +  +D +L+GG+    G+ VYD S++ +++ ++
  S:    10 YAKALFS--LAVEKGRVEPWSESLQSLKEGVEGSPDLREVLSNPVYSREQRRAIVEKLAAALRLESEP---ANLLFLLGDRNRLGYLGAIVDTFRALADEHLGRVRAKVTSAVPLDGSAAQAIADRLSQATQATVLLDREVDPALLGGVVAQVGSLVYDGSLRTQLEDLR 174
>gi|77461950|ref|YP_351457.1| F0F1 ATP synthase subunit delta [Pseudomonas fluorescens PfO-1] >gi|77385953|gb|ABA77466.1| H+-transporting two-sector ATPase, delta (OSCP) subunit [Pseudomonas fluorescens PfO-1] (178 aa)
Score = 110, Expect = 6.0e-04, Identities = 31/111 (27%), Positives = 57/111 (51%)
  Q:    68 FFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           F D+     +   +NF+ V+ +N+    + EI   F     E +  + + + S F + ++  +K+  + S +  + VR +   D SLIGG+ I  G+ V D SI+GKI ++
  S:    62 FIDVCGDKFDAKAQNFINVVAENDRLPLLPEIAALFDLYKAEQEKSVDVEVTSAFALNQEQQDKLAKVLSARLNREVRLQVEEDSSLIGGVVIRAGDLVIDGSIRGKIAKL 172
>gi|104784437|ref|YP_610935.1| F0F1 ATP synthase subunit delta [Pseudomonas entomophila L48] >gi|95113424|emb|CAK18152.1| ATP synthase F1, delta subunit [Pseudomonas entomophila L48] (178 aa)
Score = 110, Expect = 6.3e-04, Identities = 29/98 (29%), Positives = 52/98 (53%)
  Q:    81 KNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           +NF+ V  +N+    + EI   F     E +  + + + S F + ++  +K+  + S + G+ VR     D SLIGG+ I  G+ V D S++GKI ++
  S:    75 QNFIHVAAENDRLLLLPEISALFDLYKAEQEKSVDVEVTSAFALNQEQQDKLAKVLSARLGQEVRLHASEDASLIGGVVIRAGDLVIDGSVRGKIAKL 172
>gi|153833279|ref|ZP_01985946.1| ATP synthase F1, delta subunit [Vibrio harveyi HY01] >gi|148870415|gb|EDL69336.1| ATP synthase F1, delta subunit [Vibrio harveyi HY01] (180 aa)
Score = 110, Expect = 6.4e-04, Identities = 24/106 (22%), Positives = 56/106 (52%)
  Q:    77 NIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNI 182
           N   +NFL ++ +N   K + E+ + F +   +++  + + +     ++++ + +++   + K GK +  E  +D SL+GG+ I  G  VYD S+   + ++  N+
  S:    73 NQNFENFLRIMEENKRLKALSEVNVQFQEMKADYERTMTVTVRVSEPLDEEQMARLKQALTEKYGKAITLETQLDPSLVGGVVITAGQTVYDGSVLTNLSRLATNL 178
>gi|149913693|ref|ZP_01902226.1| hypothetical protein RAZWK3B_10331 [Roseobacter sp. AzwK-3b] >gi|149812813|gb|EDM72642.1| hypothetical protein RAZWK3B_10331 [Roseobacter sp. AzwK-3b] (188 aa)
Score = 110, Expect = 6.7e-04, Identities = 39/172 (22%), Positives = 83/172 (48%)
  Q:     8 DHYANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLD----EHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           + YA A++ I  E     K+   S+  D+  +L  + E+  +I S ++++ ++ K+++ I     K      + N L V+      KR L +     Q L     + +  +   + S   + K   +K+    + + GK V+    +D+SLIGG+ +  G+ + D SI+ +++ ++
  S:    15 ERYATAIFEIAKESKSLPKL--ESNIDDLRAALAESAELRDVISSPVLARADQAKVMDAI---AKKMKLETVMANGLAVMAG----KRRLFVLPQLLQHLSAMIADDKGEVTADVTSAKALTKAQSDKLAKTLTARVGKDVKINATVDESLIGGLVVKVGSKMIDTSIRSRLNSLQ 181
>gi|167648696|ref|YP_001686359.1| ATP synthase F1, delta subunit [Caulobacter sp. K31] >gi|167351126|gb|ABZ73861.1| ATP synthase F1, delta subunit [Caulobacter sp. K31] (196 aa)
Score = 110, Expect = 6.8e-04, Identities = 32/174 (18%), Positives = 83/174 (47%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIE 183
           YA +L+ + +E ++  K+   +  K +   +  + ++  +++S   S E+K K L  +    +K+   +    FL ++  N     ++    +F +   +H+  +   + +   +    L+ +    +   GK       +D S++GG+K+  G+ ++D S++ K+D +K+ ++
  S:    26 YAQSLFELTIENNQLTKV--EADLKSLRAMVAASTDLRRLLESPAFSAEDKAKGLTAV---AAKAGFQLLTAKFLGLVASNGRAGDLMGAITAFVEMSAQHRGVVTAEVVTASALTAAQLKGVSTAVASALGKTPEISTRVDPSILGGIKVRVGSRLFDASLRSKLDSLKFALK 194
>gi|1655482|dbj|BAA13600.1| delta subunit of mitochondrial F1-ATPase [Arabidopsis thaliana] (237 aa)
Score = 110, Expect = 7.0e-04, Identities = 32/99 (32%), Positives = 51/99 (51%)
  Q:    81 KNFLFVLNDNNFFKRILEIFISFFQKLDEHQN---FLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           KNFL +L +N   K +  I   F Q  + H+     +   I  P   EK+L E ++ +  I  GK++  E  ID S+ GG+ + F   V D SI+ +  Q++
  S:   126 KNFLSLLAENGKLKNLDAIVKKFMQLTNAHRGVKVLVTTVIPLPPAEEKELTETLQEI--IGAGKKITVEQKIDPSIYGGLIVEFQQKVLDMSIRTRAQQME 225
>gi|145232277|ref|XP_001399589.1| hypothetical protein An02g04520 [Aspergillus niger] >gi|134056502|emb|CAK37591.1| unnamed protein product [Aspergillus niger] (228 aa)
Score = 110, Expect = 7.1e-04, Identities = 41/169 (24%), Positives = 84/169 (49%)
  Q:    10 YANALYSIWLE---LDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFS---IKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           YA ALY+   +   LD+ +K + +        +LK + +++ I+ +  ++  +K +I+ ++         +I LKNFL  L +NN    +  I   F   +  H+  + + I S   ++ K + ++E   S      GK+++    +D  L+GG+ +  G+   D S+  KI ++
  S:    52 YATALYTASAKSANLDQTSKALASLGQ-----TLKADRKLITILSAPTLTVADKQQIVQELQKVAGADKGDI-LKNFLNTLAENNRLGLLEGICEKFSTLMGAHRGEIELNITSAQELDTKTVNRLEKAVSKSEFSQGKKLKVVTKVDPELVGGLVVEIGDRTIDLSVSSKIAKL 220
>gi|156977321|ref|YP_001448227.1| ATP synthase F1, delta subunit [Vibrio harveyi ATCC BAA-1116] >gi|156528915|gb|ABU74000.1| hypothetical protein VIBHAR_06107 [Vibrio harveyi ATCC BAA-1116] (180 aa)
Score = 109, Expect = 7.8e-04, Identities = 24/106 (22%), Positives = 56/106 (52%)
  Q:    77 NIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNI 182
           N   +NFL ++ +N   K + E+ + F +   +++  + + +     ++++ + +++   + K GK +  E  +D SL+GG+ I  G  VYD S+   + ++  N+
  S:    73 NKNFENFLRIMEENKRLKALSEVNVQFQEMKADYERTMTVTVRVSEPLDEEQMARLKQALTEKYGKAITLETQLDPSLVGGVVITAGQTVYDGSVLTNLSRLATNL 178
>gi|149245916|ref|XP_001527428.1| ATP synthase subunit 5, mitochondrial precursor [Lodderomyces elongisporus NRRL YB-4239] >gi|146449822|gb|EDK44078.1| ATP synthase subunit 5, mitochondrial precursor [Lodderomyces elongisporus NRRL YB-4239] (213 aa)
Score = 109, Expect = 8.7e-04, Identities = 40/176 (22%), Positives = 84/176 (47%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFS----IKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIENN 185
           YAN+LYS  ++    ++    +S K +   +K + ++   + +  +SK+++  I+  +   L    +     NFL VL +NN       IF  F    D H   +   + S   +E K+L++++        +  GK ++  N ++  + GG+ +  G+   D SI  K++++   ++ N
  S:    38 YANSLYSATIQESDMSQTY--NSLKKVEDVIKGDPKLEEALTNPGLSKDDRVAIIKSVNNSLGLDKTT---GNFLLVLAENNRLGNFPSIFKKFGMLNDAHNGIVNATVTSAKPLESKILKRLQTSIGNSSFVGQGKTLKLNNEVNPDIKGGLIVEVGDRTVDVSISNKVNRLNQTLKEN 212
>gi|57282885|emb|CAF74846.1| putative oligomycin sensitivity conferring protein [Silene dioica] >gi|57282889|emb|CAF74848.1| putative oligomycin sensitivity conferring protein [Silene diclinis] (217 aa)
Score = 109, Expect = 9.4e-04, Identities = 46/171 (26%), Positives = 83/171 (48%)
  Q:     9 HYANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYS----PFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           +YA+ALY    +  + NK+   S   D+  + K +           +    ++K L  I  D +K  S++ +KNFL VL +N   + +  I   F +    H+  L   + +    P   EK+L E ++ +     G  V+ E  ID +++GG+ + FG  V+D SI+ +  Q++
  S:    47 NYASALYLAATKAKELNKV--ESELLDLVEATKKSPMFSQFTKDLSVPSVTRSKALKDIC-DQAK-FSDV-MKNFLVVLAENGRLRHVDSIAKRFSELTMAHRGELQATVTTVIPLPPAEEKELKETLQEILG--QGTTVKLEQKIDPNILGGIIVEFGQKVFDMSIRTRARQME 214
>gi|56965612|ref|YP_177346.1| F0F1 ATP synthase subunit delta [Bacillus clausii KSM-K16] >gi|56911858|dbj|BAD66385.1| F0F1-type ATP synthase delta chain [Bacillus clausii KSM-K16] (181 aa)
Score = 109, Expect = 9.9e-04, Identities = 40/179 (22%), Positives = 87/179 (48%)
  Q:     1 MEEKNHIDHYANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIF-FDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKR-VRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           M  K   + YA AL+   L  +K    +F    + +    +   ++  ++    ++ ++K  +L   F   LS ++ N      + +L +   +  I+ +   + Q  D+ +      ++S   +      +I  +F+ K GKR +R  N++D +LIGG+K+  G+ V+D SI+G++ +++
  S:     1 MSNKAVANRYAVALFE--LAEEKGQTDVFERELELVQEVFETTPQLETVLAQPGLAADKKQALLRDAFQAHLSPAVMNT-----INLLMERGRYSEIVGLAGEYKQLNDDKKGIAEATVFSVKALSDSEKNQIAAVFAPKAGKRELRVVNVVDSALIGGLKVRVGDRVFDGSIQGQLKRLE 174
>gi|94501605|ref|ZP_01308122.1| ATP synthase F1, delta subunit [Oceanobacter sp. RED65] >gi|94426288|gb|EAT11279.1| ATP synthase F1, delta subunit [Oceanobacter sp. RED65] (178 aa)
Score = 109, Expect = 1.0e-03, Identities = 35/139 (25%), Positives = 62/139 (44%)
  Q:    40 LKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           + NN +M  ++    +S E++ + L     D+     N   +N + VL +N     +  I   F     E +  + + I S F V     +K+      K  K VR    +D SL+GG  I  G+ V D +++GK+ ++
  S:    38 VANNQDMEAVLSHPGLSGEQQAQTL----IDVCGEKLNEAGQNLVNVLAENKRLALLPHILEQFEHLKAEQERVVDVEITSAFDVTDATKQKLTQALKAKLDKDVRVTTTVDSSLVGGAIIRAGDMVIDGTVRGKLAKL 172
>gi|150015305|ref|YP_001307559.1| F0F1 ATP synthase subunit delta [Clostridium beijerinckii NCIMB 8052] >gi|149901770|gb|ABR32603.1| ATP synthase F1, delta subunit [Clostridium beijerinckii NCIMB 8052] (179 aa)
Score = 109, Expect = 1.0e-03, Identities = 49/170 (28%), Positives = 89/170 (52%)
  Q:    10 YANALYSIWLELDKKNKII-FTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFL--FIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           YA ALY I    +K NK+  +     DI      N E   +I+   I+  +K     ++F DL K   +  L +F+ +L + +   ++ EI     +   E +N +   ++   P + E+  LE+++ +F  K  K + ++  IDKSL+GG+ +  GND+ D +IK K++++K
  S:     9 YALALYEI---AEKNNKVDEYLRDLTDICDIFDENKEFYEVINHPKINTAKK----KQLFTDLFKGKIDEELLSFMMILIEKDRILQLREILDQMEKIDLERRNTIRGIVKTVVPLLDEE--LEQLKAIFEKKYEKNILFDTKIDKSLLGGVYVKVGNDIIDGTIKSKVEEMK 172
>gi|70733502|ref|YP_263277.1| F0F1 ATP synthase subunit delta [Pseudomonas fluorescens Pf-5] >gi|68347801|gb|AAY95407.1| ATP synthase F1, delta subunit [Pseudomonas fluorescens Pf-5] (178 aa)
Score = 108, Expect = 1.0e-03, Identities = 29/95 (30%), Positives = 50/95 (52%)
  Q:    81 KNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKI 175
           +NF+ V  +N+    + EI   F     E +  + + + S F + ++  +K+  + S + G+ VR     D SLIGG+ I  G+ V D SI+GK+
  S:    75 QNFIHVAAENDRLLLLPEISALFDLYKAEQEKSVDVDVTSAFALNQEQQDKLAKVLSARLGREVRLHAAEDASLIGGVVIRAGDLVIDGSIRGKL 169
>gi|146298819|ref|YP_001193410.1| ATP synthase F1, delta subunit [Flavobacterium johnsoniae UW101] >gi|146153237|gb|ABQ04091.1| ATP synthase F1, delta subunit [Flavobacterium johnsoniae UW101] (177 aa)
Score = 108, Expect = 1.1e-03, Identities = 33/151 (21%), Positives = 71/151 (47%)
  Q:    34 KDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIEN 184
           K I  +++ N E+   I +   + E K   L ++F D+     N   K    +L +N  F+ +  I + + +  DE       ++ +   ++  L  K+    +  + K++  EN++D S+IGG  +  G++ Y+ S+  ++  +K  + N
  S:    32 KSIASAIETNTELSTFIQNPTTTVEVKESALLEVFADV-----NGVTKGLFHLLFENKRFEILDAIAVEYNKLFDESNGVEVAKVTTAIPMDAALEAKVLAKVATLSDKKITIENVVDPSIIGGFILRIGDNQYNASVANRLQVLKRELSN 177
>gi|121607473|ref|YP_995280.1| F0F1 ATP synthase subunit delta [Verminephrobacter eiseniae EF01-2] >gi|121552113|gb|ABM56262.1| ATP synthase F1, delta subunit [Verminephrobacter eiseniae EF01-2] (183 aa)
Score = 108, Expect = 1.1e-03, Identities = 26/125 (20%), Positives = 61/125 (48%)
  Q:    55 ISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           ++ ++   +  ++  D +++       NFL  +  N     + ++   F   L+    F    +YS F ++   L ++      + G+++      D SLIGG++++ G++V D S+K +++Q+K
  S:    54 VTADQVFALFTQVLKDAARAALPEMAGNFLRTVIANGRINVLTQVAQQFRALLNRRNGFSDAVVYSAFPMDSAALSEVGAALQKRFGRKLNLAVQQDPSLIGGIRVVVGDEVLDSSVKARLEQMK 178
>gi|114567891|ref|YP_755045.1| ATP synthase F1 delta subunit [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|114338826|gb|ABI69674.1| ATP synthase F1 delta subunit [Syntrophomonas wolfei subsp. wolfei str. Goettingen] (182 aa)
Score = 108, Expect = 1.2e-03, Identities = 45/186 (24%), Positives = 84/186 (45%)
  Q:     1 MEEKNHIDHYANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIENNK 186
           M  K+    YA A +SI  E  K +++      + +   ++    +       +I  + K ++ NK+F      +S + L NFL ++ D      I  I   +    DE +N     + +   V +  ++ +E   S KTGK V+    +D  LIGG+KI  G+ + D ++  K++ +K  ++  K
  S:     1 MLNKSVARRYAEAFFSIARETGKVDEL--QQELEKLVSIIETTENLPEYFAHLLIPAKAKKEVANKLF---GGQVSQLTL-NFLNMIIDKRRETYIGLISEEYRDMADELRNITKAELTAAAPVSEADMKNLEQNLSAKTGKTVQLSLKVDPGLIGGLKIRIGDQIVDATVAKKLEMLKEQLKQAK 180
>gi|119720766|gb|ABL97953.1| hydrogen-transporting ATP synthase [Brassica rapa] (244 aa)
Score = 108, Expect = 1.2e-03, Identities = 32/99 (32%), Positives = 52/99 (52%)
  Q:    81 KNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYS----PFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           KNFL +L +N   K +  I   F Q    H+  + + + +    P   EK+L E ++ +  I  GK+V  E  ID S+ GG+ + F   V D SI+ +  Q++
  S:   132 KNFLSLLAENGKLKNLDVIVKKFMQLTTAHRGDVKVLVTTVMPLPPAEEKELKETLQEI--IGEGKKVTVEQKIDPSIYGGLIVEFQQKVLDMSIRTRAQQME 232
>gi|154251915|ref|YP_001412739.1| ATP synthase F1, delta subunit [Parvibaculum lavamentivorans DS-1] >gi|154155865|gb|ABS63082.1| ATP synthase F1, delta subunit [Parvibaculum lavamentivorans DS-1] (194 aa)
Score = 108, Expect = 1.2e-03, Identities = 31/140 (22%), Positives = 70/140 (50%)
  Q:    40 LKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           L  + ++V ++ S I S E++TK    +   L K+  +  +KNF+ ++  N     + ++  ++   L   +  +   + S   ++   +E ++      TG+ VR    +D SL+GG+ +  G+ + D S++ K++ +K
  S:    51 LNESSDLVRLVRSPIFSAEDQTKAFGAV---LEKAGISGLVKNFIGLVIRNRRLFGLSDMIGAYTTLLARKRGEMTADVVSAHPLQAAQVESLKAALKSATGRDVRINTKVDASLLGGLIVTVGSRMVDSSLRTKLNSLK 187
>gi|23464959|ref|NP_695562.1| F0F1 ATP synthase subunit delta [Bifidobacterium longum NCC2705] >gi|189439989|ref|YP_001955070.1| F0F1-type ATP synthase delta subunit [Bifidobacterium longum DJO10A] >gi|23325556|gb|AAN24198.1| ATP synthase delta chain [Bifidobacterium longum NCC2705] >gi|189428424|gb|ACD98572.1| F0F1-type ATP synthase delta subunit [Bifidobacterium longum DJO10A] (278 aa)
Score = 108, Expect = 1.3e-03, Identities = 18/90 (20%), Positives = 49/90 (54%)
  Q:    94 KRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIE 183
           +R LE       K   H     + + +   ++K+ ++++  ++S K G++V   +++D +++GGM+I  G++V D ++  ++  +   ++
  S:   183 RRYLETIQWLINKFSRHMGESMVTVTTATPLKKEQIKRLVEVYSAKVGRQVHINSVVDPTVLGGMRIQVGDEVTDNTVVAQLQNLHRKVQ 272
>gi|23336545|ref|ZP_00121757.1| COG0712: F0F1-type ATP synthase, delta subunit (mitochondrial oligomycin sensitivity protein) [Bifidobacterium longum DJO10A] (280 aa)
Score = 108, Expect = 1.3e-03, Identities = 18/90 (20%), Positives = 49/90 (54%)
  Q:    94 KRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIE 183
           +R LE       K   H     + + +   ++K+ ++++  ++S K G++V   +++D +++GGM+I  G++V D ++  ++  +   ++
  S:   185 RRYLETIQWLINKFSRHMGESMVTVTTATPLKKEQIKRLVEVYSAKVGRQVHINSVVDPTVLGGMRIQVGDEVTDNTVVAQLQNLHRKVQ 274
>gi|88801716|ref|ZP_01117244.1| ATP synthase subunit D [Polaribacter irgensii 23-P] >gi|88782374|gb|EAR13551.1| ATP synthase subunit D [Polaribacter irgensii 23-P] (185 aa)
Score = 108, Expect = 1.3e-03, Identities = 47/188 (25%), Positives = 94/188 (50%)
  Q:     1 MEEKNHIDHYANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFV-----VEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIENNKEV 188
           M++      YA A+ +  L  D+K++I        I  +++ N ++  ++ S I+   +K  +LN +F      ++N+ L   LF L   N    +L      +  + +H   + + + +  V     VEK +LEKI  L    TGK+   EN+++ +++GG  +  G+  YD SI   +++++   +N++ V
  S:     1 MKDARAAIRYAKAILN--LAKDEKSEIAVNDDMSLISATIEENRDLAVMLKSPIVKASDKINVLNALF---EGKVNNVTLG--LFHLLRENKRIAMLNSIAKKYTLIFDHLMHMQVAMVTTAVALTEEVEKLVLEKIISL----TGKKANIENVVNPAILGGFILRVGDVQYDASISNHLNELRREFDNSQYV 182
>gi|196193459|gb|EDX88418.1| ATP synthase F1, delta subunit [Alcanivorax sp. DG881] (178 aa)
Score = 107, Expect = 1.4e-03, Identities = 26/99 (26%), Positives = 50/99 (50%)
  Q:    80 LKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           ++NF+  L  N     +  I   F + L E Q F  + + S F ++    +K+      + G  V     +D+SLIGG+ +  G+ V D S++G+++++
  S:    74 VRNFVAQLTQNKRLPLLPIILQLFHELLAEQQQFTDVEMISAFELDDAATDKLVAALKKRLGTEVNVTTSVDQSLIGGVLVRAGDTVIDGSVRGRLNRL 172
>gi|57282895|emb|CAF75208.1| putative oligomycin sensitivity conferring protein [Silene vulgaris] (217 aa)
Score = 107, Expect = 1.4e-03, Identities = 48/171 (28%), Positives = 81/171 (47%)
  Q:     9 HYANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEH----QNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           +YA+ALY    +  + N++   S   D+  + K +           +    +TK L  I  D +K  S+I +KNFL VL +N   + +  I   F Q    H    Q  +   I  P   EK+L E ++ +     G  V+ E  ID +++GG+ + F   V+D SI+ +  Q++
  S:    47 NYASALYLAATKAKQLNQV--ESELLDLVEATKKSPAFSQFTKDLSVPANIRTKALKDIC-DHAK-FSDI-MKNFLVVLAENGRLRHVDSIAKRFSQLTMAHRGEVQATVTTVIPLPPAEEKELKETLQEILG--QGTTVKLEQKIDPNILGGIIVEFSQKVFDMSIRTRARQME 214
>gi|177664417|ref|ZP_02940219.1| ATP synthase F1, delta subunit [Cyanothece sp. PCC 8801] >gi|196244743|ref|ZP_03143469.1| ATP synthase F1, delta subunit [Cyanothece sp. PCC 8802] >gi|172076253|gb|EDT61665.1| ATP synthase F1, delta subunit [Cyanothece sp. PCC 8801] >gi|196207487|gb|EDY02280.1| ATP synthase F1, delta subunit [Cyanothece sp. PCC 8802] (185 aa)
Score = 107, Expect = 1.4e-03, Identities = 39/173 (22%), Positives = 83/173 (47%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNN---FFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKR-VRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNI 182
           YA AL S+    +   +  F    + +   L+ + ++  +I S +I + +K  +L ++  D +      YL NF+ +L D     F + I + +++  +KL    N +   + S   +  +    +       TG + V  +  +D  LIGG+ I  G+ V+D S++G++ ++  ++
  S:    14 YAQALMSVAQAHNLTEQ--FGDDCRSLIAILEESRDLQGLILSPVIKETDKKAVLRRMMGDRTSP----YLLNFIMLLVDKRRIIFLEEICQQYLTLLRKL---TNTVLAEVTSAKELSDRQCRAVTDKIKDLTGAQGVEIKTSVDPDLIGGVTIKVGSQVFDASLRGQLRRVSLSL 181
>gi|148975561|ref|ZP_01812432.1| hypothetical ATP synthase F1, delta subunit [Vibrionales bacterium SWAT-3] >gi|145964989|gb|EDK30240.1| hypothetical ATP synthase F1, delta subunit [Vibrionales bacterium SWAT-3] (183 aa)
Score = 107, Expect = 1.4e-03, Identities = 32/129 (24%), Positives = 63/129 (48%)
  Q:    50 IDSNIISKE----EKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           I   IIS E    ++T+ L  +   + + + + ++ N + VL +N     + ++F  F +  DEH+  + + + S   +    +  +      K  ++V  E +ID SL+GG+ I  G  V D S+   I ++
  S:    44 IADQIISAEGASAQQTEQLANLIIHVCQGLVDEHVINLIRVLAENGRLSVVKDLFSLFSELKDEHERVIPVTVTSSECLTSGQVTSLTAALEKKLERQVELEQVIDDSLVGGIVIKAGETVIDGSLNTSISRL 176
>gi|52082216|ref|YP_081007.1| F0F1 ATP synthase subunit delta [Bacillus licheniformis ATCC 14580] >gi|52787607|ref|YP_093436.1| F0F1 ATP synthase subunit delta [Bacillus licheniformis ATCC 14580] >gi|52005427|gb|AAU25369.1| ATP synthase (subunit delta) [Bacillus licheniformis ATCC 14580] >gi|52350109|gb|AAU42743.1| AtpH [Bacillus licheniformis DSM 13] (184 aa)
Score = 107, Expect = 1.5e-03, Identities = 45/178 (25%), Positives = 90/178 (50%)
  Q:    10 YANALYSIWLELDKKNKIIFT-SSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGK-RVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNI--ENNKE 187
           YA AL+ I LE    N+I    +  K I+   K   ++  ++    +  E+K +IL   F  +S ++ +      L++L D +    + ++   + +  +  +      +YS   + ++ +     +F+ + G   +R  N ++  LIGG+KI  GN +YD S++GK+D+I+  +  EN K+
  S:    10 YAAALFDIALESKLVNEIEEELTVVKKIFIEHK---DLNAVLGHPKVPAEKKKQILKDSFGSVSTAVLHT-----LYLLVDRSRTSIVPDLADEYVKMANRFRGTEDAIVYSVKPLSEEEISSFSQVFAKEAGAASLRVRNEVNPDLIGGVKIRIGNRIYDGSVRGKLDRIERQLAGENRKK 183
>gi|159045477|ref|YP_001534271.1| ATP synthase F1, delta subunit [Dinoroseobacter shibae DFL 12] >gi|157913237|gb|ABV94670.1| ATP synthase F1, delta subunit [Dinoroseobacter shibae DFL 12] (186 aa)
Score = 107, Expect = 1.6e-03, Identities = 43/172 (25%), Positives = 83/172 (48%)
  Q:     8 DHYANALYSIWLELDKKNKIIFTSSAKDIY-FSLKNNYEMVHIIDSNIISKEEKTKILNKIF--FDLSKSISN----IYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           D YA A++ +  E   +N I    +  D+   +LK + E   +I S + S++E+   +  I    +L+  +SN    +  K  LFVL          ++  S    + E +  +   + S   + K  L+++  + S    K V+    +D SLIGG+ +  G+ + D SI+ K++ ++
  S:    13 DRYATAIFELAKE---ENNIGALEAGADLLDAALKESAEFRDLISSPVYSRDEQAGAIGAIAKKLELAPMLSNALALMASKRRLFVLP---------QLVASLRALIAEEKGEMTADVISAQPLSKANLDELTKVLSASADKTVKVNATVDNSLIGGLVVKMGSKMIDTSIRAKLNALQ 179
>gi|88804490|ref|ZP_01120010.1| ATP synthase subunit D [Robiginitalea biformata HTCC2501] >gi|88785369|gb|EAR16538.1| ATP synthase subunit D [Robiginitalea biformata HTCC2501] (178 aa)
Score = 107, Expect = 1.6e-03, Identities = 42/179 (23%), Positives = 80/179 (44%)
  Q:     1 MEEKNHIDHYANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDE--HQNFLFIRIYSPFV--VEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           M E      YA A+  + LE  K   +      + +  +L  +  +  ++ S ++   +K   L  IF D SK    ++      +L +N     + E+   +  + +E   Q+   +    P    +EKK+L +++ +    TGK V  E  +D  LIGG  +  G+  Y+ S+  K++ +K
  S:     1 MSEARAASRYAKAVLDLALEQKKAGDV--EKDMQQLLDTLSGSDSLWEVLTSPVLKGTDKASALGAIFGDASKLTVQLF-----GLLAENKRIGMLDEVARQYIARYEEIKGQDVAHVTTAVPLTQALEKKVLGQLQAI----TGKDVTLEQTVDPELIGGFVLRVGDLEYNASLAHKLENLK 172
>gi|116618948|ref|YP_819319.1| F0F1-type ATP synthase, delta subunit [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|116097795|gb|ABJ62946.1| F0F1-type ATP synthase, delta subunit [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (180 aa)
Score = 107, Expect = 1.6e-03, Identities = 38/176 (21%), Positives = 89/176 (50%)
  Q:     4 KNHIDHYANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTG-KRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           K+  + YA A++ +  E D  ++++  +  + I   L  N   + I  S  ++   +  +L  +  + + S+     KN + +L  NN    +  +   F  + +E    + ++  +   ++   L+K+  +F+ KTG ++V  EN++D+S++GG+ +   + + D S++ KI ++K
  S:     6 KDIANQYAKAIFELAGEQDNVDEVL--TDLRTIKTVLDENQNFITIASSADVAIASRDDLLKTLTGNSTDSV-----KNLVKLLQVNNRLNILSIVVDEFVSQYNEVNGIVDVQATTAVALDDGRLDKLASVFASKTGAQQVNIENVVDESILGGVILQSQSTLIDGSLQTKIAKMK 175
>gi|94971361|ref|YP_593409.1| ATP synthase F1, delta subunit [Acidobacteria bacterium Ellin345] >gi|94553411|gb|ABF43335.1| ATP synthase F1, delta subunit [Acidobacteria bacterium Ellin345] (179 aa)
Score = 107, Expect = 1.6e-03, Identities = 45/170 (26%), Positives = 82/170 (48%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNI---------------YLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           YANAL  + L     N++  T++ +D+               +NI+S   +++ L K++ + S +++                  ++NF+ VL D+     +  I   F  +L+    F    + S   +  +  + IE   +   GK VR     + +L+GG  I  G+ VYD SIKG++ +IK
  S:     8 YANALADVVLS----NRLDVTTAVRDL---------------NNIVSMTIESEDLRKVWENPSIAVAQKRAILDGLVGMVGTPRIIRNFVAVLIDHQRVPLLPRIARQFELELNHRMGFADAEVTSVHELSAQDRQMIEQQIAKVVGKSVRARYKTNATLLGGAIIRVGSTVYDGSIKGQLAKIK 173
>gi|57282883|emb|CAF74845.1| putative oligomycin sensitivity conferring protein [Silene latifolia] (217 aa)
Score = 107, Expect = 1.6e-03, Identities = 47/171 (27%), Positives = 83/171 (48%)
  Q:     9 HYANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFL----FIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           +YA+ALY    +  + NK+   S   D+  + K +           +  + ++K L  I  D +K  S++ +KNFL VL +N   + +  I   F +    H+  L       I  P   EK+L E ++ +     G  V+ E  ID +++GG+ + FG  V+D SI+ +  Q++
  S:    47 NYASALYLAATKAKQLNKV--ESELLDLVEATKKSPTFFQFTKDLSVPSDIRSKALKDIC-DQAK-FSDV-MKNFLVVLAENGRLRHVDSIAKRFSELTMAHRGELQATATTVIPLPPAEEKELKETLQEILG--QGITVKLEQKIDPNILGGIIVEFGQKVFDMSIRTRARQME 214
>gi|114578|sp|P17675|ATPD_BACME ATP synthase delta chain >gi|142558|gb|AAA82523.1| ATP synthase delta subunit (181 aa)
Score = 107, Expect = 1.6e-03, Identities = 36/134 (26%), Positives = 71/134 (52%)
  Q:    45 EMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYS--PFVVEKKLLEKIEHLFSIKTGKR-VRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           E++ ++    I+ E K + +++ F +LS ++ +  L     +L + +  + + E+   +    +E +      +YS  P   ++K    I   F+ K GK  +   NI+DK++IGG+K+  GN +YD SI  K++ I
  S:    43 ELMDVLTHPKITIERKKQFVSEAFAELSPTVQHTVL-----LLLERHRIQIVSEMVKEYRFLANEVRGVADATVYSVKPLSADEK--RAISQSFASKVGKHTLNISNIVDKTVIGGVKLRIGNRIYDGSISSKLETI 172
>gi|46447305|ref|YP_008670.1| putative H+-transporting two-sector ATPase (delta chain, atpH) [Candidatus Protochlamydia amoebophila UWE25] >gi|46400946|emb|CAF24395.1| putative H+-transporting two-sector ATPase (delta chain, atpH) [Candidatus Protochlamydia amoebophila UWE25] (181 aa)
Score = 107, Expect = 1.7e-03, Identities = 34/125 (27%), Positives = 65/125 (52%)
  Q:    55 ISKEEKTKILNKIFFD-LSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           +S   K  IL ++F D L ++I N     FLFVL + N FK I++I   + +   +    L +R+ +   V     EK+         K V  +N+++  ++GGM ++  + ++D S+K ++ ++K
  S:    53 LSTLTKKSILQRLFKDRLDETILN-----FLFVLIEKNRFKYIVDIRKEYHRLAKKRLGILEVRLLTAVSVSDIPQEKVRIKLQKTYQKEVEIQNVVNPDIVGGMILIMDHQIFDNSVKKRLAKLK 173
>gi|57282881|emb|CAF74844.1| putative oligomycin sensitivity conferring protein [Silene latifolia] (217 aa)
Score = 107, Expect = 1.7e-03, Identities = 46/171 (26%), Positives = 83/171 (48%)
  Q:     9 HYANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYS----PFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           +YA+ALY    +  + NK+   S   D+  + K +           +    ++K L  I  D +K  S++ +KNFL VL +N   + +  I   F +    H+  L   + +    P   EK+L E ++ +     G  V+ E  ID +++GG+ + FG  V+D SI+ +  Q++
  S:    47 NYASALYLAATKAKELNKV--ESELLDLVEATKKSPMFSQFTKDLSVPSVTRSKALKDIC-DQAK-FSDV-MKNFLVVLAENGRLRHVDSIAKRFSELTMAHRGELQATVTTVIPLPPTEEKELKETLQEILG--QGITVKLEQKIDPNILGGIIVEFGQKVFDMSIRTRARQME 214
>gi|90961573|ref|YP_535489.1| ATP synthase delta chain [Lactobacillus salivarius UCC118] >gi|90820767|gb|ABD99406.1| ATP synthase delta chain [Lactobacillus salivarius UCC118] (180 aa)
Score = 107, Expect = 1.7e-03, Identities = 48/179 (26%), Positives = 90/179 (50%)
  Q:     1 MEEKNHIDHYANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTG-KRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           ++ +  +  Y  AL+ +  E+  +NK  F S  ++    L+N  ++   + SN IS E K KI+  +  D SK ++N+     L +L D      +  I   F +  DE +  +   + +   ++++  +K+   F+   G K+V  + I+D  +IGG+ +   + +YD SIK KI +IK
  S:     3 LDNETIVHRYGKALFELAEEMKIRNK--FHSELQEYKKVLQNEPQLKVFMSSNQISPEAKLKIMEILKKDSSKLMTNL-----LDMLYDYGRITSLEGIIDEFDRLNDEFEKTVRASVITAIELDEERKQKLASSFANVVGAKKVIIDPIVDPGIIGGVILKSESYIYDGSIKTKIARIK 175
>gi|163814612|ref|ZP_02206001.1| hypothetical protein COPEUT_00763 [Coprococcus eutactus ATCC 27759] >gi|158450247|gb|EDP27242.1| hypothetical protein COPEUT_00763 [Coprococcus eutactus ATCC 27759] (171 aa)
Score = 107, Expect = 1.7e-03, Identities = 39/137 (28%), Positives = 63/137 (45%)
  Q:    43 NYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTG-KRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           N E+   + S ++   EK K+++++F        +  L NF+  L DN+ F  I +IF  + +   E Q+ L   +Y       K    IE     + G K V+   +  K LIGG  I  G+  YD SI G+   ++
  S:    32 NLELADALASPVVEHAEKRKVIDRVF----DRFGSKELVNFMKTLCDNDGFDMINDIFDEYEKYAREQQDILSATLYYVTPPTDKQKAGIEDFLMKEYGSKAVQLSMVEKKELIGGFVIRTGDREYDRSILGRYKSLR 165
>gi|110835590|ref|YP_694449.1| ATP synthase, delta subunit [Alcanivorax borkumensis SK2] >gi|110648701|emb|CAL18177.1| ATP synthase, delta subunit [Alcanivorax borkumensis SK2] (178 aa)
Score = 107, Expect = 1.7e-03, Identities = 26/98 (26%), Positives = 49/98 (50%)
  Q:    81 KNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           +NF+  L  N     +  I   F + L E Q F  + + S F ++    +K+      + G  V     +D+SLIGG+ +  G+ V D S++G+++++
  S:    75 RNFVAQLTQNKRLPLLPIILQLFHELLAEQQQFTDVEMISAFELDDAATDKLVAALKKRLGTEVNVTTSVDQSLIGGVLVRAGDTVIDGSVRGRLNRL 172
>gi|14715603|gb|AAK72440.1|AF283808_5 ATP synthase delta subunit [Clostridium pasteurianum] (179 aa)
Score = 106, Expect = 1.7e-03, Identities = 47/170 (27%), Positives = 83/170 (48%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           YA ALY+I    +K  + I  +  K I   +KNN ++  II +  IS  +K +I   IF D      ++ L +FL +L +     ++  I +   +   ++ N +   + +   +       +     IK  K +    +IDKS+IGG+ +  G+DV D +IK KI+++K
  S:     9 YAVALYNIASAENKVEEYI--ADLKQINDLIKNNEDLNQIISNPKISTTKKREIFTSIFEDKI----DLKLFSFLIILIEKKRIDQLTGIILQIEKVDLDNHNQVVAEVKTVVPLNNSERTALIDKLQIKYNKSIILREVIDKSIIGGVYVRVGDDVIDGTIKNKIEEMK 172
>gi|114777380|ref|ZP_01452377.1| ATP synthase F1, delta subunit [Mariprofundus ferrooxydans PV-1] >gi|114552162|gb|EAU54664.1| ATP synthase F1, delta subunit [Mariprofundus ferrooxydans PV-1] (173 aa)
Score = 106, Expect = 1.8e-03, Identities = 30/125 (24%), Positives = 62/125 (49%)
  Q:    55 ISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           I+ E K  IL+K+   LS  +  +     L +L   N  + + EI     Q + + ++ +   + S   +  K    I    + ++G++VR E  +D SL+GG+ +  G+   DYS++ +++ ++
  S:    49 IAAEVKIAILDKVCGGLSAELGRL-----LTLLGSKNKLELLPEINAMVEQLIRDSESEISAVVTSAVKLTAKTQSDITAALTKQSGRKVRLETALDASLLGGIVVHIGDRQIDYSVRSRLESMR 168
>gi|160895866|ref|YP_001561448.1| F0F1 ATP synthase subunit delta [Delftia acidovorans SPH-1] >gi|160361450|gb|ABX33063.1| ATP synthase F1, delta subunit [Delftia acidovorans SPH-1] (179 aa)
Score = 106, Expect = 1.8e-03, Identities = 28/118 (23%), Positives = 62/118 (52%)
  Q:    62 KILNKIFFDLSKSISNIYL----KNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           K+ ++  FD+   ++   L    +NFL V+ +N   + + E+   F   ++         + S F ++   L  +      + G+++      D+SLIGG++++ G++V D S+K +++Q+K
  S:    53 KVTDEQLFDVISGVAGSALPDAARNFLRVIIENGRLQALPEVAAQFRSLVNRAGGSSDAVVQSAFPIDAAALAALGTSLEKRFGRKLNLSVQQDQSLIGGIRVVVGDEVLDTSVKARLEQMK 174
>gi|83815762|ref|YP_445048.1| ATP synthase F1, delta subunit [Salinibacter ruber DSM 13855] >gi|83757156|gb|ABC45269.1| ATP synthase F1, delta subunit [Salinibacter ruber DSM 13855] (190 aa)
Score = 106, Expect = 1.8e-03, Identities = 40/175 (22%), Positives = 83/175 (47%)
  Q:     1 MEEKNHIDHYANALYSIWLELDKKNKII--FTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLF---IRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKI 175
           M ++     YA ALY    E    N ++       + +  SL +N  +V + +S +I +++K  I+ ++  D  + ++  +L+  L +  D    + + E  +  +Q L + Q  +    + +  P   E +    +  +   KTGK +R     D  LIGG+ +  G+ V+D S++ ++
  S:     1 MSQRTVTRRYAAALY----EEANANGVLEAVDEDVRMLLESLDSNRPLVRVFESPVIPQDKKDSIVRELLGDRVEDLTVRFLR--LLIRKDR---ETMTEAILDQYQTLRDEQRGIVDAEVTVARPLADETR--TTLVGVLEEKTGKEIRLHLHEDADLIGGLVVRIGDRVFDASVRSQL 169
>gi|23507248|gb|AAN38067.1| oligomycin sensitivity conferring protein [Silene latifolia] (230 aa)
Score = 106, Expect = 1.8e-03, Identities = 47/171 (27%), Positives = 83/171 (48%)
  Q:     9 HYANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFL----FIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           +YA+ALY    +  + NK+   S   D+  + K +           +  + ++K L  I  D +K  S++ +KNFL VL +N   + +  I   F +    H+  L       I  P   EK+L E ++ +     G  V+ E  ID +++GG+ + FG  V+D SI+ +  Q++
  S:    54 NYASALYLAATKAKQLNKV--ESELLDLVEATKKSPTFFQFTKDLSVPSDIRSKALKDIC-DQAK-FSDV-MKNFLVVLAENGRLRHVDSIAKRFSELTMAHRGELQATATTVIPLPPAEEKELKETLQEILG--QGITVKLEQKIDPNILGGIIVEFGQKVFDMSIRTRARQME 221
>gi|16127680|ref|NP_422244.1| ATP synthase F1, delta subunit [Caulobacter crescentus CB15] >gi|13425168|gb|AAK25412.1| ATP synthase F1, delta subunit [Caulobacter crescentus CB15] (184 aa)
Score = 106, Expect = 1.8e-03, Identities = 36/174 (20%), Positives = 80/174 (45%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIE 183
           YA +L+ + +E     K+   +  K +   + ++ ++  +I S   S E+K K L  +     K+        FL ++  N     +L    +F +   +H+  +   + S   +    L+ ++   +   GK       +D SL+GG+K+  G+ ++D S++ K+D +K+ ++
  S:    14 YAQSLFELTIENGSLQKV--EADLKSLKAMVADSADLRRLIASPAFSAEDKGKGLTAV---AKKAGFQPLTTKFLGLVAANGRTGDLLGAISAFVELSAKHRGVVTAEVVSAAALSPAQLKGVQTALAQALGKTPEVSTRVDPSLLGGLKVRVGSRLFDASLRSKLDSLKFALK 182
>gi|88705414|ref|ZP_01103125.1| ATP synthase delta chain [gamma proteobacterium KT 71] >gi|88700504|gb|EAQ97612.1| ATP synthase delta chain [Congregibacter litoralis KT71] (178 aa)
Score = 106, Expect = 1.8e-03, Identities = 28/104 (26%), Positives = 51/104 (49%)
  Q:    81 KNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIEN 184
           K FL VL +N     +  I   F Q   + +  + + + SPF V   + ++I      +  + V     ID SL+GG+ I  G+ V D S++G+++++   + N
  S:    75 KRFLHVLAENRRLGLVPNILELFAQLKAQREQSVDVEMVSPFEVPDTVRDRIAQALGKRLEREVVVSTSIDSSLLGGVLIRAGDLVIDGSVRGRLNKLAEALTN 178
>gi|95929974|ref|ZP_01312714.1| ATP synthase F1, delta subunit [Desulfuromonas acetoxidans DSM 684] >gi|95133943|gb|EAT15602.1| ATP synthase F1, delta subunit [Desulfuromonas acetoxidans DSM 684] (180 aa)
Score = 106, Expect = 1.8e-03, Identities = 40/170 (23%), Positives = 83/170 (48%)
  Q:    10 YANALYSIWLELDKKNKII--FTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIF--FDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           YA AL    +EL  + K++  + +   ++   L     +  +++S  +  ++KT I+  I    +LS+ I     K F+ +L   +  + + +I   +    DE    L   + S   + K   + I+     ++GK++  +  +D +L+GG+K   G  V+D SIK ++ +I+
  S:    10 YATAL----VELATEQKLVEQYGAELGEVSAVLAREDALRLLMESPTLDVDKKTAIMADIVNKMELSEGI-----KKFVGLLTVKDRIQYVGQIHTDYTAYADEISGVLRASVTSATKLTKAQADNIQKGLEAQSGKKIDLQTKVDSTLLGGLKAEVGGKVFDGSIKTQLQRIE 174
>gi|116629876|ref|YP_815048.1| F0F1 ATP synthase subunit delta [Lactobacillus gasseri ATCC 33323] >gi|116095458|gb|ABJ60610.1| F0F1-type ATP synthase, delta subunit [Lactobacillus gasseri ATCC 33323] (182 aa)
Score = 106, Expect = 1.8e-03, Identities = 38/146 (26%), Positives = 70/146 (47%)
  Q:    41 KNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTG-KRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIENNK 186
           K N +M+ ++   II K +K +     F        +   KNFL  L +   F  + EI  +F    DE +N       S   +++  L +I   ++ K G K++   N +D S++GG+ +  G+ + D SI+ ++ QI+  +  N+
  S:    41 KENPDMLRLLSDPIIRKNQKEE-----FLSSFSGEFSSETKNFLEFLLEYGRFNALTEIIKAFDALYDEDKNIASGTAVSAINLDEDELNRISQAYAKKYGFKKLILTNEVDSSILGGIILKVGDRIIDGSIRTRLQQIREQLIENR 182
>gi|193213683|ref|YP_001999636.1| ATP synthase F1, delta subunit [Chlorobaculum parvum NCIB 8327] >gi|193087160|gb|ACF12436.1| ATP synthase F1, delta subunit [Chlorobaculum parvum NCIB 8327] (181 aa)
Score = 106, Expect = 1.9e-03, Identities = 42/170 (24%), Positives = 84/170 (49%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           YA AL  + +E +  + +  T     I   L  + E++  + S +I+ + K++IL +IF       + I++K  L      N    ++  F S    LDE    +   + S   +  +  +++ +  SI+TGK++R +  +D+ LIGG+ +  G+ + D SI+ ++  +K
  S:    10 YALALLEVAIEANFLDTV--TEDLLKIQEVLSGSRELLLALRSPLINVDLKSRILEEIFGKEVGEKTMIFIK-LLAHKKRANLLPTVITEFSSL---LDERNGVINADVKSAVKLSDEQAKELVNGLSIRTGKKIRAKMSLDEKLIGGVTVKIGDTILDGSIQHQLQLLK 173
>gi|57282887|emb|CAF74847.1| putative oligomycin sensitivity conferring protein [Silene dioica] (217 aa)
Score = 106, Expect = 1.9e-03, Identities = 47/171 (27%), Positives = 83/171 (48%)
  Q:     9 HYANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFL----FIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           +YA+ALY    +  + NK+   S   D+  + K +           +  + ++K L  I  D +K  S++ +KNFL VL +N   + +  I   F +    H+  L       I  P   EK+L E ++ +     G  V+ E  ID +++GG+ + FG  V+D SI+ +  Q++
  S:    47 NYASALYLAATKAKQLNKV--ESELLDLVEATKKSPTFFQFTKDLSVPSDIRSKALKDIC-DQAK-FSDV-MKNFLVVLAENGRLRHVGGIAKRFSELTMAHRGELQATATTVIPLPPAEEKELKETLQEILG--QGITVKLEQKIDPNILGGIIVEFGQKVFDMSIRTRARQME 214
>gi|190346428|gb|EDK38512.2| hypothetical protein PGUG_02610 [Pichia guilliermondii ATCC 6260] (205 aa)
Score = 106, Expect = 2.0e-03, Identities = 41/169 (24%), Positives = 84/169 (49%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMV-------HIIDSNIISKEEKTKILNKIF--FDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFS----IKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           YA ALY   +E          SS +  Y +L    +++         +++  +S +++  +++ I     L K+++N     FL VL+DNN       I+  F Q  D  Q  +   I S   ++ K+L++++   +    +  GK ++  N ++  ++GG+ +  G+   D SI  K+ ++
  S:    30 YATALYRASVE---------DSSVEKSYQALTKVNDLIETDAKVNQFLNNPALSSDDRKVVIDTIASSLKLDKTVTN-----FLTVLSDNNRLSEFKSIYTKFGQLNDAEQGIVEATITSAKPLDSKILKRLQTAITKSSFVGDGKTLKVANEVNPEILGGLVVEVGDKTVDLSISSKVAKL 197
>gi|126662882|ref|ZP_01733881.1| ATPase, delta subunit (H(+)-transporting two-sector ATPase) [Flavobacteria bacterium BAL38] >gi|126626261|gb|EAZ96950.1| ATPase, delta subunit (H(+)-transporting two-sector ATPase) [Flavobacteria bacterium BAL38] (177 aa)
Score = 106, Expect = 2.0e-03, Identities = 35/154 (22%), Positives = 70/154 (45%)
  Q:    31 SSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIEN 184
           S    I  ++K++ E+   + S I+  E K   LN+IF    K    ++    L V   N  F+ + ++ + F    DE       ++ + F +  +L  K+    +  + K +  +NI+D ++IGG  +  G+  Y+ S+  ++  +K    N
  S:    29 SDMTSIVNAIKDSAELKDFLQSPIVKGEIKFSSLNEIFASAQKETKGLF--QLLLV---NKRFELLNDVALQFNALYDELNGIEIAKVTTAFPITPELEAKVLAKIASFSNKNITIQNIVDPAIIGGFILRMGDKQYNASVASRLQNLKREFSN 177
>gi|120556782|ref|YP_961133.1| ATP synthase F1, delta subunit [Marinobacter aquaeolei VT8] >gi|120326631|gb|ABM20946.1| ATP synthase F1, delta subunit [Marinobacter aquaeolei VT8] (178 aa)
Score = 106, Expect = 2.0e-03, Identities = 28/99 (28%), Positives = 52/99 (52%)
  Q:    80 LKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           L+NFL +L +N     + EI   F     + +  + + I + F +     +K+    S K  ++V  E  +D+SLIGG+ +  G+ V D S++GK+ ++
  S:    74 LRNFLLILAENKRLALLPEISALFRLYRADLEKSVHLTIDTAFDLSADEQQKLIDALSKKLERKVELETTVDQSLIGGVIVRTGDLVIDASVRGKLARM 172
>gi|160902214|ref|YP_001567795.1| ATP synthase F1, delta subunit [Petrotoga mobilis SJ95] >gi|160359858|gb|ABX31472.1| ATP synthase F1, delta subunit [Petrotoga mobilis SJ95] (190 aa)
Score = 106, Expect = 2.0e-03, Identities = 28/110 (25%), Positives = 59/110 (53%)
  Q:    70 DLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           D+S+    I+++ FL VL D      I  +    +Q+  E +  + +R+  P  V   ++ +++     KTG++++     ++ LIGG+++  G+  +DYS+KG +  I+
  S:    68 DVSEFDDTIFVQ-FLEVLADKRRQNLIPFMSHILYQESLEREKVVEVRLVLPNEVSNTIINQVKQAIQNKTGRKIKLRTQFNEDLIGGLQLYIGDKFFDYSVKGFLQDIQ 176
>gi|23507246|gb|AAN38066.1| oligomycin sensitivity conferring protein [Silene latifolia] (230 aa)
Score = 106, Expect = 2.1e-03, Identities = 46/171 (26%), Positives = 83/171 (48%)
  Q:     9 HYANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYS----PFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           +YA+ALY    +  + NK+   S   D+  + K +           +    ++K L  I  D +K  S++ +KNFL VL +N   + +  I   F +    H+  L   + +    P   EK+L E ++ +     G  V+ E  ID +++GG+ + FG  V+D SI+ +  Q++
  S:    54 NYASALYLAATKAKELNKV--ESELLDLVEATKKSPMFSQFTKDLSVPSVTRSKALKDIC-DQAK-FSDV-MKNFLVVLAENGRLRHVDSIAKRFSELTMAHRGELQATVTTVIPLPPTEEKELKETLQEILG--QGITVKLEQKIDPNILGGIIVEFGQKVFDMSIRTRARQME 221
>gi|115469200|ref|NP_001058199.1| Os06g0646500 [Oryza sativa (japonica cultivar-group)] >gi|51535416|dbj|BAD37315.1| putative ATP synthase delta chain [Oryza sativa Japonica Group] >gi|51535638|dbj|BAD37612.1| putative ATP synthase delta chain [Oryza sativa Japonica Group] >gi|113596239|dbj|BAF20113.1| Os06g0646500 [Oryza sativa (japonica cultivar-group)] >gi|125556268|gb|EAZ01874.1| hypothetical protein OsI_023106 [Oryza sativa (indica cultivar-group)] >gi|125598035|gb|EAZ37815.1| hypothetical protein OsJ_021298 [Oryza sativa (japonica cultivar-group)] (225 aa)
Score = 106, Expect = 2.2e-03, Identities = 45/171 (26%), Positives = 83/171 (48%)
  Q:     9 HYANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKR--VRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           +YA+AL+    + +  +K+   +  +D+  + K +      I    + KE + K + +IF +     S++  KNFL VL DN   K I  I   F      H+  + + + +   + +K  ++++       GK   +  E  ID S++GG+ I FG  V+D SIK +  Q++
  S:    49 NYASALFLTAAKANLLDKV--ETEIRDVVEASKKSPLFSQFIKDLSVPKETRVKAITEIFAE--AGFSDV-TKNFLAVLADNGRLKHIDRIAERFVDLTMAHKGEVKVLVRTVIPLPEKEEKELKETLQDILGKNKTILIEQKIDYSIMGGLVIQFGQKVFDMSIKTRAKQME 216
>gi|91786235|ref|YP_547187.1| F0F1 ATP synthase subunit delta [Polaromonas sp. JS666] >gi|91695460|gb|ABE42289.1| ATP synthase F1, delta subunit [Polaromonas sp. JS666] (176 aa)
Score = 106, Expect = 2.2e-03, Identities = 25/99 (25%), Positives = 51/99 (51%)
  Q:    81 KNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           KNFL  + +N     + EI   F    +         +YS F +E   L  +      + G+++ +   ++ +LIGG++++ G++V D S+K +++Q+K
  S:    73 KNFLRTVIENGRISVLPEIAAQFRVLKNAQSGSSDATVYSAFPLEGPALADLAATLEKRFGRKLNFAVELEPALIGGVRVVVGDEVLDTSVKARLEQMK 171
>gi|147679150|ref|YP_001213365.1| F0F1 ATP synthase subunit delta [Pelotomaculum thermopropionicum SI] >gi|146275247|dbj|BAF60996.1| F0F1-type ATP synthase, delta subunit [Pelotomaculum thermopropionicum SI] (187 aa)
Score = 105, Expect = 2.3e-03, Identities = 35/140 (25%), Positives = 68/140 (48%)
  Q:    40 LKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           ++ N ++  ++    I+ EEK  +L K+F      IS++   NFL +L D        EI   F +  +  +N +  ++ S   +  +    +  +    TGK+V+    +D SLIGG+ +  G+ + D S+K ++  +K
  S:    45 IRENSDLQKLLYHPRITAEEKKDLLQKLF---KGKISDV-TANFLALLVDRRRETFFGEIVAEFVKLANAGRNIITAQVTSAVELNDQEKGDLNRILVRLTGKKVKTSYAVDPSLIGGVVVRMGDKIIDGSLKTRLASLK 180
>gi|14916962|sp|P22479|ATPD_BACPF ATP synthase delta chain >gi|12061043|gb|AAG48360.1|AF330160_7 ATP synthase delta subunit [Bacillus pseudofirmus] (182 aa)
Score = 105, Expect = 2.3e-03, Identities = 33/135 (24%), Positives = 72/135 (53%)
  Q:    45 EMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGK-RVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           E + ++    ++ E+K   +   F D   S+S   L   L ++ +N   + ++++  SF +   E Q+     +YS   +  +   +I  +F+ K  K ++   N+++K L+GG+KI  G+ +YD S+K ++D+++
  S:    43 EFLQLLSHPKVTTEKKRAFIENSFKD---SLSETSLHTLLLLV-ENKRIESLVDMIDSFKEMSYEAQDMAEAVVYSAKPLTSEEQAQIAVIFAKKVNKAKLLVTNVVNKDLLGGLKIRIGDRIYDGSVKSQLDRLE 174
>gi|169848066|ref|XP_001830741.1| hypothetical protein CC1G_03278 [Coprinopsis cinerea okayama7#130] >gi|116508215|gb|EAU91110.1| hypothetical protein CC1G_03278 [Coprinopsis cinerea okayama7#130] (212 aa)
Score = 105, Expect = 2.4e-03, Identities = 33/140 (23%), Positives = 69/140 (49%)
  Q:    39 SLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYL----KNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLF----SIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           ++K   E+   I +  +S +E+ K LN +   +  S     L    KN L +L++N        +   F + L EH+  L + + S   + K  L ++E       + +  K ++  N ++ S++GG+ + FG+   D S+  ++ ++
  S:    57 AIKTQPEVSSFITNPTLSLQERQKGLNTLLVKVEGSGKKEQLTDVTKNLLALLSENGRLAETEGVIEGFNELLAEHKGELTVTVTSAAPLPKDTLTRLESTLKQSQTAQKAKVLKITNKVNPSVLGGLIVDFGDKTVDLSVSSRVTKL 204
>gi|119896448|ref|YP_931661.1| putative ATP synthase delta chain [Azoarcus sp. BH72] >gi|119668861|emb|CAL92774.1| putative ATP synthase delta chain [Azoarcus sp. BH72] (177 aa)
Score = 105, Expect = 2.4e-03, Identities = 31/104 (29%), Positives = 53/104 (50%)
  Q:    81 KNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIEN 184
           +NF+ VL DN   + + EI   F    +EH+  L   I S F ++   L  ++     +   R+     ID  LIGG++I  G++V D S++GK+  +   ++N
  S:    74 QNFVRVLVDNERLQVLPEIRDLFVALKNEHEGVLEAEIASAFPLDDAALAALKADLEARFQARLNVTVSIDPELIGGVRIAVGDEVIDASVRGKLANMAAALKN 177
>gi|160893776|ref|ZP_02074560.1| hypothetical protein CLOL250_01330 [Clostridium sp. L2-50] >gi|156864761|gb|EDO58192.1| hypothetical protein CLOL250_01330 [Clostridium sp. L2-50] (169 aa)
Score = 105, Expect = 2.4e-03, Identities = 44/144 (30%), Positives = 75/144 (52%)
  Q:    35 DIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIY---SPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDK--SLIGGMKIMFGNDVYDYSIKGKIDQI 178
           D+   ++ N E+   +   ++S+E+K++I++KIF D SK+        FL VL +N+ F +  EI   +   + +  + L   +Y    P   +KK +E     F  K  K    E  ++K  SLIGG  I  GN  YD+S+ G+  ++
  S:    24 DMEAVVRENPELQEALTCPVVSREKKSEIIDKIF-DGSKTTVK-----FLKVLCNNSDFDQFFEICREYRVLIKKKADVLLATLYYVTPPTEAQKKGIED----FLKKKYKTSDVELTLEKNDSLIGGFIIKVGNKEYDWSLAGRCKRL 162
>gi|416681|sp|P32980|ATPD_TOBAC ATP synthase delta chain, chloroplast precursor >gi|19787|emb|CAA45153.1| chloroplast ATP synthase (delta subunit) [Nicotiana tabacum] (248 aa)
Score = 105, Expect = 2.4e-03, Identities = 47/174 (27%), Positives = 87/174 (50%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAK-DIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTG-KRVRYENIIDKSLIGGMKIMFGND---VYDYSIKGKIDQIKWNIE 183
           YANAL  I     K N  +  ++A  +    + ++  + +   S I+ +E+K +++++I   +S S    ++ NFL +L D    + I EI   F +  +   +     + S   +E + L +I       TG K VR + +ID+SL+ G  I +GN    + D S+K +++ I   +E
  S:    69 YANALADI----AKSNGTLEQTTADLEKIEKISDDEAVFNFFVSPIVGEEKKRELVDEI---VSSSSIQPHVANFLNILVDMKRVELIKEIVKEFEKVYNTLTDTELAVVTSVVKLESQHLAQIAKGVQRLTGSKNVRIKTVIDESLVAGFTIRYGNSGSKLIDMSVKKQLEDIAAQLE 240
>gi|145588212|ref|YP_001154809.1| ATP synthase F1, delta subunit [Polynucleobacter sp. QLW-P1DMWA-1] >gi|145046618|gb|ABP33245.1| ATP synthase F1, delta subunit [Polynucleobacter sp. QLW-P1DMWA-1] (178 aa)
Score = 105, Expect = 2.4e-03, Identities = 33/116 (28%), Positives = 63/116 (54%)
  Q:    64 LNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKT---GKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           L+K+   + K+  +  + +FL ++N N+    + EI   F    ++ +    + I S F +E   L  +  L S+K    GK +R    +D +LIGG++I  G++V D S+K ++ Q++
  S:    57 LSKLLSGMVKTKLDGKVASFLNLINQNHRLAAVPEIAHQFEAMKNKSEGAAEVSITSAFPLEGSALNDL--LSSLKKRFGGKELRPTIQVDPTLIGGVRIQVGDEVMDSSVKAQLAQMQ 173
>gi|42518862|ref|NP_964792.1| F0F1 ATP synthase subunit delta [Lactobacillus johnsonii NCC 533] >gi|41583148|gb|AAS08758.1| ATP synthase delta chain [Lactobacillus johnsonii NCC 533] (182 aa)
Score = 105, Expect = 2.4e-03, Identities = 38/146 (26%), Positives = 70/146 (47%)
  Q:    41 KNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTG-KRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIENNK 186
           K N +M+ ++   II K +K + L+      S        KNFL  L +   F+ +  I  +F    DE++N       S   + +  L +I   ++ K G K +   N +D S++GG+ +  G+ + D SI+ ++ QI+  +  N+
  S:    41 KENPDMLRLLSDPIIRKNQKEEFLSSFSDKFSSET-----KNFLDFLLEYRRFESLTAIIEAFNTLYDEYKNIASGTAVSAIKLNEDELSRISQAYAKKYGFKELILTNKVDPSILGGIILKVGDRIIDGSIRTRLQQIREQLIENR 182
>gi|28378941|ref|NP_785833.1| F0F1 ATP synthase subunit delta [Lactobacillus plantarum WCFS1] >gi|28271778|emb|CAD64684.1| H(+)-transporting two-sector ATPase, delta subunit [Lactobacillus plantarum WCFS1] (181 aa)
Score = 105, Expect = 2.5e-03, Identities = 35/176 (19%), Positives = 84/176 (47%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTG-KRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIENN 185
           Y+ AL+ + +E D+     F +  K +     +N ++  ++  +++  ++K   L+ +    S+     Y+KNF+ +L D      ++ I  +F  + DE +  +   + S   +  +  + I   F+ + G  +V     +D+++IGG+ +   N  +D S+  ++  ++  + NN
  S:    12 YSKALFELAVEKDQTEA--FLAELKQLRQVFVDNPQLAEVLSGSLLPVDQKQTTLSTLTDHASE-----YIKNFIQMLYDYGRMSNLVGIVDAFEARFDESRKIVHAEVTSAVKLSDEQADAIAKAFAKRVGANQVVLSRKVDEAIIGGVIVKSNNQTFDGSVALQLTNLRRALINN 181
>gi|166367756|ref|YP_001660029.1| F0F1 ATP synthase subunit delta [Microcystis aeruginosa NIES-843] >gi|166090129|dbj|BAG04837.1| ATP synthase CF1 delta chain [Microcystis aeruginosa NIES-843] (182 aa)
Score = 105, Expect = 2.5e-03, Identities = 42/173 (24%), Positives = 88/173 (50%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDN---NFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVV---EKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNI 182
           YA AL S+     +   I      K +   L+N  ++   I + +I +E K  +L+++      S +N YL NF+ +L D     F + + + +++  + L    N +   + S   +   +K+++  I+ + ++     V  +  +D SLIGG+ I  G+ V+D SI+G++ ++  ++
  S:    14 YAQALLSVAQSSGQLEAI--GGEIKSLLELLENAPDLRAFIGNPVIKEEAKKAVLSQVM----GSSANPYLTNFMMLLVDKRRIQFLEPVCQQYLTLARVL---TNTVLAEVSSATELNDSQKQIV--IDKVKTLTGANVVELKTKVDGSLIGGVVIKVGSQVFDASIRGQLQRLSLSL 181
>gi|57282891|emb|CAF74849.1| putative oligomycin sensitivity conferring protein [Silene diclinis] (217 aa)
Score = 105, Expect = 2.6e-03, Identities = 47/171 (27%), Positives = 82/171 (47%)
  Q:     9 HYANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEH----QNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           +YA+ALY    +  + NK+   S   D+  + K +           +  + ++K L  I  D +K  S++ +KNFL VL +N   + +  I   F +    H    Q      I  P   EK+L E ++ +     G  V+ E  ID +++GG+ + FG  V+D SI+ +  Q++
  S:    47 NYASALYLAATKAKQLNKV--ESELLDLVEATKKSPTFFQFTKDLSVPSDIRSKALMDIC-DQAK-FSDV-MKNFLVVLAENGRLRHVGGIAKRFSELTMAHRGELQAIATTVIPLPPAEEKELKETLQEILG--QGITVKLEQKIDPNILGGIIVEFGQKVFDMSIRTRARQME 214
>gi|71001782|ref|XP_755572.1| ATP synthase oligomycin sensitivity conferral protein [Aspergillus fumigatus Af293] >gi|66853210|gb|EAL93534.1| ATP synthase oligomycin sensitivity conferral protein, putative [Aspergillus fumigatus Af293] >gi|159129632|gb|EDP54746.1| ATP synthase oligomycin sensitivity conferral protein, putative [Aspergillus fumigatus A1163] (227 aa)
Score = 105, Expect = 2.6e-03, Identities = 40/169 (23%), Positives = 86/169 (50%)
  Q:    10 YANALYSIWLE---LDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFS---IKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           YA ALY+   +   LD+ +K + +S A+    + K + ++  II +  +S  +K +I+ ++         +I +KNFL  L +NN    +  I   F   +  H+  + + I S   ++ K + ++E   S   +  GK+++    ++  ++GG+ +  G+   D S+  K+ ++
  S:    51 YATALYTASAKSSALDQTSKAL-SSLAQ----TFKADRKLTSIIAAPTLSASDKQQIIQELQKIAGNDKGDI-IKNFLQTLAENNRLGLLEGICQKFETLMGAHRGEMEVTITSAQELDNKTINRLEKAVSKHELSQGKKLKIVTKVNPEIVGGLVVEIGDRTIDLSVSSKLAKL 219
>gi|119481333|ref|XP_001260695.1| ATP synthase oligomycin sensitivity conferral protein, putative [Neosartorya fischeri NRRL 181] >gi|119408849|gb|EAW18798.1| ATP synthase oligomycin sensitivity conferral protein, putative [Neosartorya fischeri NRRL 181] (227 aa)
Score = 105, Expect = 2.7e-03, Identities = 40/169 (23%), Positives = 86/169 (50%)
  Q:    10 YANALYSIWLE---LDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFS---IKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           YA ALY+   +   LD+ +K + +S A+    + K + ++  II +  ++  +K +I+ ++         +I +KNFL  L +NN    +  I   F   +  H+  + + I S   ++ K + ++E   S   +  GK+++    ++  ++GG+ +  G+   D S+  KI ++
  S:    51 YATALYTASAKTSALDQTSKAL-SSLAQ----TFKTDRKLTGIIAAPTLTASDKQQIIQELQKIAGNDKGDI-IKNFLQTLAENNRLGLLEGICEKFETLMGAHRGEMEVTITSAQELDNKTINRLEKAVSKHELSQGKKLKVVTKVNPDIVGGLVVEIGDRTIDLSVSSKIAKL 219
>gi|193811143|emb|CAQ41871.1| mitochondrial ATP synthase delta subunit,putative [Plasmodium knowlesi strain H] (247 aa)
Score = 105, Expect = 2.7e-03, Identities = 57/173 (32%), Positives = 95/173 (54%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNY----EMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDN---NFFKRILEIF-ISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNI 182
           Y+ ALY++     KKNK I   S+ DI F +KNN+      ++ + +  I  +EK   L       + + S I   NFL  L D+   NF ++I+E F +   ++  E + F++         ++K+ E I  LF +K   +   E  IDKS++GG+ +  GN V+D+S K KI++I+ N+
  S:    75 YSLALYNV----GKKNKKINEISS-DILF-IKNNFLKDKTFLNFLQTPNIENKEKLNFLKTECKKYNNNFSPI-TSNFLESLFDSKRINFLQKIIEEFELLLMKERKEIKCFVYTAKEINNTEKQKIQESI--LFKLKNELKPLIEYKIDKSILGGLVLQIGNQVFDFSAKYKIEKIRSNL 246
>gi|169774739|ref|XP_001821837.1| hypothetical protein [Aspergillus oryzae RIB40] >gi|83769700|dbj|BAE59835.1| unnamed protein product [Aspergillus oryzae] (226 aa)
Score = 105, Expect = 2.7e-03, Identities = 38/151 (25%), Positives = 79/151 (52%)
  Q:    28 IFTSSAKDIYFS------------LKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFS---IKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           +FT+SAK                 LK + ++  +I +  ++  +K++I+ ++   L+    +I +KNFL  L +NN    +  +   F   +  H+  + + I S   ++KK L ++E   S      GK+++    ++  L+GG+ +  G+   D S+  KI ++
  S:    55 LFTASAKSANLEQTSKALSALGEVLKADRKLTGLISAPTLTASDKSQIVQELQ-KLTGDKGDI-VKNFLETLAENNRLGLLEGVCEKFATLMGAHRGEIDLNITSAQELDKKTLNRLEKAVSQSHFSQGKKLKVVTKVNPDLVGGLVVEIGDRTIDLSVSSKIAKL 218
>gi|149375661|ref|ZP_01893430.1| ATP synthase delta chain [Marinobacter algicola DG893] >gi|149360063|gb|EDM48518.1| ATP synthase delta chain [Marinobacter algicola DG893] (178 aa)
Score = 105, Expect = 2.9e-03, Identities = 27/99 (27%), Positives = 51/99 (51%)
  Q:    80 LKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           ++NFL +L  N     + EI   F     + +  + I + S + +  +  +K+    S K  ++V     +DKSLIGG+ +  G+ V D S++GK+ ++
  S:    74 VRNFLMILAANRRLSLLPEIAALFNTYRADFERTVDIEVTSAYELTDEQQQKLAQALSTKLERQVSLAASMDKSLIGGVIVRTGDMVIDASVRGKLTKL 172
>gi|170787926|gb|EDT28970.1| ATP synthase F1, delta subunit [Oligotropha carboxidovorans OM5] (186 aa)
Score = 105, Expect = 2.9e-03, Identities = 43/170 (25%), Positives = 81/170 (47%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFS--LKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           YA AL+    EL +  K I    A    F+  L +N ++V ++ S + + +E+ K L+ +   L+K+       NFL VL  N     + ++  +F   + + +      +     +  K L+ ++      TGK V     +D S+IGG+ +  G+ + D S++ K++ IK
  S:    15 YATALF----ELARDQKSIDAVRADVDKFAALLADNPDLVRLVRSPVFTAQEQGKALDAV---LTKAGITGITANFLKVLTANRRLFAVNDVIRAFRALVAKFRGEATADVTVAEPLNDKNLDALKASLKSVTGKDVDLNVKVDPSIIGGLIVKLGSRMVDSSLRTKLNSIK 179
>gi|154488035|ref|ZP_02029152.1| hypothetical protein BIFADO_01604 [Bifidobacterium adolescentis L2-32] >gi|154083508|gb|EDN82553.1| hypothetical protein BIFADO_01604 [Bifidobacterium adolescentis L2-32] (275 aa)
Score = 104, Expect = 3.0e-03, Identities = 19/90 (21%), Positives = 48/90 (53%)
  Q:    94 KRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIE 183
           +R L+       K   H     + + +   + K+ ++K+  ++S KTG  V   +++D +++GGM+I  G++V D ++  ++  ++  ++
  S:   183 RRYLQTIQWLINKFSRHMGESMVTVTTATPLSKEQVKKLVAIYSAKTGHPVHINSVVDPTVLGGMRIQVGDEVTDNTVVAQLQHLQRTVK 272
>gi|119026448|ref|YP_910293.1| F0F1 ATP synthase subunit delta [Bifidobacterium adolescentis ATCC 15703] >gi|118766032|dbj|BAF40211.1| ATP synthase delta chain [Bifidobacterium adolescentis ATCC 15703] (275 aa)
Score = 104, Expect = 3.0e-03, Identities = 19/90 (21%), Positives = 48/90 (53%)
  Q:    94 KRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIE 183
           +R L+       K   H     + + +   + K+ ++K+  ++S KTG  V   +++D +++GGM+I  G++V D ++  ++  ++  ++
  S:   183 RRYLQTIQWLINKFSRHMGESMVTVTTATPLSKEQVKKLVAIYSAKTGHPVHINSVVDPTVLGGMRIQVGDEVTDNTVVAQLQHLQRTVK 272
>gi|45593087|gb|AAS68131.1| ATP synthase delta subunit [Bifidobacterium animalis] (277 aa)
Score = 104, Expect = 3.1e-03, Identities = 19/90 (21%), Positives = 48/90 (53%)
  Q:    94 KRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIE 183
           +R LE       K   H     + + +   +  +  +K+  +++ KTG+ V   +++D +++GGM+I  G++V D ++  +++ +K  ++
  S:   183 RRYLESVQWLINKFSRHMGESMVTVTTATPLSDEQSDKLARIYTKKTGRAVHIHSVVDPTVMGGMRIQVGDEVTDNTVVAQLENLKRKVK 272
>gi|156056026|ref|XP_001593937.1| hypothetical protein SS1G_05365 [Sclerotinia sclerotiorum 1980] >gi|154703149|gb|EDO02888.1| hypothetical protein SS1G_05365 [Sclerotinia sclerotiorum 1980] (225 aa)
Score = 104, Expect = 3.1e-03, Identities = 33/169 (19%), Positives = 83/169 (49%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFS----IKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           YA+ALY+   +    + +    S + ++   + + ++  I+ +  +S E+K++I+ ++            +KNFL  L +NN    +  +   F + +   +  + + + S   ++ K L ++E   S    +  GK+++  N ++  ++GG+ +  G+   D S+  +I ++
  S:    47 YASALYTAAAKTSTLDSV--ARSLQSLHAIFQKDAKLATIMQAPTLSVEDKSQIIQELQKHTGGQDKGDTVKNFLETLAENNRLSLLKGVCEKFGELMGAARGEIELVVTSASQLDSKTLNRLESAVSKSQYVGQGKKLKVTNKVNPDVLGGLIVEIGDRTIDLSVSSRIAKM 217
>gi|45593077|gb|AAS68122.1| ATP synthase delta subunit [Bifidobacterium breve] (278 aa)
Score = 104, Expect = 3.1e-03, Identities = 18/90 (20%), Positives = 50/90 (55%)
  Q:    94 KRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIE 183
           +R LE      +K   H     I + +   ++++ ++++  ++S K G++V   +++D +++GGM+I  G++V D ++  ++  +   ++
  S:   183 RRYLETIQWLIKKFSRHMGQSMITVTTAAPLKEEQIKRLIDVYSAKVGRQVHINSVVDPTVLGGMRIQVGDEVTDNTVVAQLQNLHRRVQ 272
>gi|75674627|ref|YP_317048.1| F0F1 ATP synthase subunit delta [Nitrobacter winogradskyi Nb-255] >gi|74419497|gb|ABA03696.1| H+-transporting two-sector ATPase, delta (OSCP) subunit [Nitrobacter winogradskyi Nb-255] (207 aa)
Score = 104, Expect = 3.1e-03, Identities = 43/170 (25%), Positives = 80/170 (47%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFS--LKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           YA AL+    EL +++K I    A    F   L  + E+V ++ S + S + ++K L  +   LSK+       NFL VL  N     + ++  +F   + + +      +     +  K L+ ++      TGK +     +D S+IGG+ +  G+ + D S++ K++ IK
  S:    36 YATALF----ELAREDKSIDAVKADLDKFDAMLAESPELVRLVRSPVFSADTQSKALAAV---LSKAGIGGTTANFLKVLAANRRLFAVADVIRAFRALVAKFKGEATAEVTVAEKLNDKNLDALKAALKSVTGKDITLNVKVDPSIIGGLVVKLGSRMVDTSLRTKLNSIK 200
>gi|114682|sp|P22778|ATPO_IPOBA ATP synthase subunit O, mitochondrial precursor (Oligomycin sensitivity conferral protein) (OSCP) >gi|168270|gb|AAA33388.1| F-1-ATPase delta subunit precursor (EC 3.6.1.3) (244 aa)
Score = 104, Expect = 3.1e-03, Identities = 29/99 (29%), Positives = 53/99 (53%)
  Q:    81 KNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYS----PFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           +NFL +L +N   K I  I   F +    H+  +   + +    P   EK+L   ++ +  +  GK V+ E  ID +++GG+ + FG  V+D SI+ +  Q++
  S:   135 QNFLLILAENGRLKHIDRIVKRFKELTMAHRGEVKATVTTVIPLPADEEKELKATLQEM--VGQGKSVQIEQKIDPTILGGLVVEFGQKVFDMSIRTRARQME 235
>gi|4774163|dbj|BAA77508.1| F1-ATP synthase delta subunit [Ipomoea batatas] (244 aa)
Score = 104, Expect = 3.2e-03, Identities = 29/99 (29%), Positives = 53/99 (53%)
  Q:    81 KNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYS----PFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           +NFL +L +N   K I  I   F +    H+  +   + +    P   EK+L   ++ +  +  GK V+ E  ID +++GG+ + FG  V+D SI+ +  Q++
  S:   135 QNFLLILAENGRLKHIDRIVKRFKELTMAHRGEVKATVTTVIALPADEEKELKATLQEM--VGQGKSVQIEQKIDPTILGGLVVEFGQKVFDMSIRTRARQME 235
>gi|89889661|ref|ZP_01201172.1| ATP synthase delta chain [Flavobacteria bacterium BBFL7] >gi|89517934|gb|EAS20590.1| ATP synthase delta chain [Flavobacteria bacterium BBFL7] (178 aa)
Score = 104, Expect = 3.3e-03, Identities = 42/170 (24%), Positives = 81/170 (47%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDN--NFFKRILEIFISFFQKLDEHQ-NFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           YA A+ S  L +DKK         K I  +L  N E+   + S +I  E+K   L ++F    K    I + +F  ++++   +    +   +I  F+ +++ +   +   +     +E+K+L K + L     GK +  E  ID+S++GG  +  G+   + S+  K+ Q+K
  S:    10 YAKAILS--LAIDKKEADAVNEEMKSILVTLNGNKELRDFMSSPLIKSEQKRGALRQVF----KDAGAITMGSFDLLVDNKRADVLMDVATKYILLFEDMNKREIATVTTAVEITAELEQKVLAKAKEL----AGKEITLEKNIDESILGGFILRVGDQEINASVANKLGQLK 172
>gi|5902612|gb|AAD55576.1|AF110794_1 ATP synthase-delta chain [Volvox carteri f. nagariensis] (219 aa)
Score = 104, Expect = 3.5e-03, Identities = 44/178 (24%), Positives = 85/178 (47%)
  Q:     1 MEEKNHI-DHYANALYSIWLELDKKNKIIFTSSAKDIYFSL-KNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQ-----NFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           M  K+ + + YA AL  +    D+K K+    +  D   SL K N ++  +I + I+  ++K  +L KI  +       +   N L   +  +    I E F   + ++ + Q     + + +     F++ KKL E       +   K ++ + +ID SLI G  + +G+   D SI+G+I+++
  S:    32 MARKSEVSESYAKALVEL---ADEKGKLEAVHADVDAVSSLMKENKKLSDLIMNPIVDADKKRAVLAKIAKEAGFQQYTVNFLNLLVEKDRLSLVPEICECFEDLYCQMTDTQVATLRSAVKLEQEQQFLIAKKLQE-------LTGSKNIKLKPVIDSSLIAGFVVEYGSSQIDLSIRGQIERV 206
>gi|159486703|ref|XP_001701377.1| chloroplast ATP synthase delta chain [Chlamydomonas reinhardtii] >gi|2493039|sp|Q42687|ATPD_CHLRE ATP synthase delta chain, chloroplast precursor >gi|1134976|gb|AAB51365.1| chloroplast ATP synthase subunit delta precursor >gi|158271679|gb|EDO97493.1| chloroplast ATP synthase delta chain [Chlamydomonas reinhardtii] (219 aa)
Score = 104, Expect = 3.7e-03, Identities = 43/178 (24%), Positives = 84/178 (47%)
  Q:     1 MEEKNHI-DHYANALYSIWLELDKKNKIIFTSSAKDIYFSL-KNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQ-----NFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           M  KN + + YA AL  +    D+K K+    +  D    L K N ++  +I + ++  ++K  +L KI  +       I   N L   +  +    I E F   + ++ + Q     + + +     F++ KKL E       +   K ++ + +ID SLI G  + +G+   D S++G+I+++
  S:    32 MARKNEVSESYAKALVEL---ADEKGKLEAVHADVDAVAGLMKENAKLSALIMNPVVESDKKRAVLAKIAKEAGFQQYTINWLNLLVEKDRLSLVPEICECFEDLYCQMTDTQVATLRSAVKLEQEQQFLIAKKLQE-------LTGSKNIKLKPVIDSSLIAGFVVEYGSSQIDLSVRGQIERV 206
>gi|196179695|gb|EDX74689.1| ATP synthase F1, delta subunit [Microcoleus chthonoplastes PCC 7420] (185 aa)
Score = 104, Expect = 3.7e-03, Identities = 42/172 (24%), Positives = 81/172 (47%)
  Q:     7 IDHYANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKI-EHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           ++ YA AL S+  E +  +K  F      +  +LK + E+   +D+ II  E+K  +L +I    S    + Y+ NFL +L +      + EI   +   L E +  +   + S   +     + + + + S+   + V  +  ID  L+GG+ I   + V D S++G++ +I
  S:    11 VEPYAEALMSVAQEHNLVDK--FGEDVAALLDTLKESEELQQFLDNPIIKAEDKKAVLQQI----SGDQIHPYMVNFLKILVERRRILFMGEICKQYQALLRELKQTVLAEVVSAVELNDDQKQAVRQKVLSMTNAQDVELDTQIDADLLGGVIIKVESQVVDASLRGQLRRI 177
>gi|67459661|ref|YP_247285.1| F0F1 ATP synthase subunit delta [Rickettsia felis URRWXCal2] >gi|75535943|sp|Q4UK15|ATPD_RICFE ATP synthase delta chain >gi|67005194|gb|AAY62120.1| ATP synthase delta chain [Rickettsia felis URRWXCal2] (184 aa)
Score = 104, Expect = 3.7e-03, Identities = 45/178 (25%), Positives = 94/178 (52%)
  Q:     1 MEEKNHIDHYANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           M + N I++YA AL++  +  + ++KI    +A  I   + +N+++   + S I++K++K  ++N +   +  +  N  + NFL +L  N+    +  I  ++   L E +N   +++ S   ++ K  E I+     +  ++      ID ++IGG+ I + + + DYSIKG +D+I
  S:     1 MNKDNLIENYAVALFNNAMVDNIQDKIFEEITA--INRIIIDNFDIREFLFSPIVNKDDKINVVNSL---VKNTKFNKIVNNFLLLLVKNSRTAILSNIVDAYNTLLYESKNIKIVQVISANKLQPKEQEWIKSRIEKELNQKTEILFDIDSTIIGGIIIKYDSMLQDYSIKGSLDKI 173
>gi|90023609|ref|YP_529436.1| F0F1 ATP synthase subunit delta [Saccharophagus degradans 2-40] >gi|89953209|gb|ABD83224.1| ATP synthase F1, delta subunit [Saccharophagus degradans 2-40] (178 aa)
Score = 104, Expect = 3.7e-03, Identities = 26/98 (26%), Positives = 49/98 (50%)
  Q:    81 KNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           +NF+ VL DN     + EI + F       +  L + + + F ++    +K+    S K  + V     +DK+L+GG  I  G+ V D S++G++ ++
  S:    75 QNFIHVLADNRRLALLPEISVLFDLYKANQEKSLDVTVETAFEIDAATEKKLVEALSKKLDREVTLSTAVDKALLGGALIRAGDTVIDGSVRGRLAKL 172
>gi|183602785|ref|ZP_02964148.1| ATP synthase delta chain [Bifidobacterium animalis subsp. lactis HN019] >gi|183218023|gb|EDT88671.1| ATP synthase delta chain [Bifidobacterium animalis subsp. lactis HN019] (270 aa)
Score = 104, Expect = 3.8e-03, Identities = 19/90 (21%), Positives = 48/90 (53%)
  Q:    94 KRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIE 183
           +R LE       K   H     + + +   +  +  +K+  +++ KTG+ V   +++D +++GGM+I  G++V D ++  +++ +K  ++
  S:   176 RRYLESVQWLINKFSRHMGESMVTVTTATPLSDEQSDKLARIYTKKTGRPVHIHSVVDPTVMGGMRIQVGDEVTDNTVVAQLENLKRKVK 265
>gi|196257289|ref|ZP_03155825.1| ATP synthase F1, delta subunit [Cyanothece sp. PCC 7822] >gi|196200889|gb|EDX95708.1| ATP synthase F1, delta subunit [Cyanothece sp. PCC 7822] (185 aa)
Score = 103, Expect = 4.3e-03, Identities = 41/173 (23%), Positives = 85/173 (49%)
  Q:    10 YANALYSIWLELDKKNKII--FTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNN---FFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNI 182
           YA AL S+     + N +   F    + +   L N+ E+   + + +  +  K +IL +I  + +      YL+NF+ +L D     F K + E +++  ++L      L   I +  + + +    IE + S+   + V  +  ++  LIGG+ I  G+ ++D SI+G++ +I  ++
  S:    14 YAQALMSV----SQSNNLTERFGEEIRSLLELLDNSPELQEFLSNPVFGESSKKEILARILGEGTHP----YLQNFVKLLVDKRRIVFLKAVGEQYLALLRQLT--NTVLAEAISATELNDDQRQAVIEKVKSLTGAQSVELKTSVNPDLIGGVIIKVGSQIFDASIRGQLRRISLSL 181
>gi|51244683|ref|YP_064567.1| F0F1 ATP synthase subunit delta [Desulfotalea psychrophila LSv54] >gi|50875720|emb|CAG35560.1| probable ATP synthase, delta subunit (AtpD) [Desulfotalea psychrophila LSv54] (181 aa)
Score = 103, Expect = 4.3e-03, Identities = 34/118 (28%), Positives = 60/118 (50%)
  Q:    66 KIFFDLSKSIS-NIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIE 183
           K+   + KS+  +  + NFL +L +    + + EI   F   +D+ QN     + S   + ++L  KI+      TGK+V     +D S+IGG+    G+ V D SIK ++  +K +I+
  S:    60 KVMVGIVKSMDIDAVMSNFLNLLVEKKRAEILPEIAEEFQAMVDDAQNLSHGSVISAVELSEELQGKIQQTLEKLTGKKVELTTSVDPSIIGGIVAKVGDLVLDGSIKTQLAGLKESIK 178
>gi|119190337|ref|XP_001245775.1| hypothetical protein CIMG_05216 [Coccidioides immitis RS] >gi|90304561|gb|EAS34192.1| hypothetical protein CIMG_05216 [Coccidioides immitis RS] (227 aa)
Score = 103, Expect = 4.3e-03, Identities = 37/169 (21%), Positives = 90/169 (53%)
  Q:    10 YANALYSIWLE---LDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFS---IKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           YANALY+   +   L++ +K +  +S  +++   K + ++  I+++  +S+ +K +I+ ++      +     LKNFL  L +NN    +  +   F   +  ++  + + I S   +++K L+++E+  +      GK+++    I+  ++GG+ +  G+   D S+  K+ ++
  S:    50 YANALYTASAKTSSLEQTSKAL--ASLGEVF---KKDAKLTSILNAPTLSQADKAQIIAELQKVAGGAGKGDILKNFLNTLAENNRLGLLQGVCEKFATLMGAYRGEIELIITSAQKLDQKTLQRLENAVAKSEYSQGKKLKVVTKINSDVVGGLIVEIGDRTIDLSVSSKMAKL 219
>gi|86160766|ref|YP_467551.1| F0F1 ATP synthase subunit delta [Anaeromyxobacter dehalogenans 2CP-C] >gi|85777277|gb|ABC84114.1| ATP synthase F1, delta subunit [Anaeromyxobacter dehalogenans 2CP-C] (193 aa)
Score = 103, Expect = 4.3e-03, Identities = 42/170 (24%), Positives = 81/170 (47%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYE----MVHIIDSNIISKEEKTKILNKIF--FDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           YA AL+S+ +E  +           D    LKN  E    +  ++ + + SKE++  I+ K+     L +  +N+     LF+L D N    +  +  +F    D+H   L  R+ S   ++ +  + I    S  T   V  +  +D +L+GG+    G+ VYD S++ +++ ++
  S:    24 YARALFSLAVEQGR------VEPWNDALQVLKNAVEGSPDLRDVLSNPVYSKEQRRAIVEKLASALKLEREPANL-----LFLLGDRNRLAYLPAVVDTFRALADQHLGRLRARVTSAVPLDAQAAQAIADRLSQATKATVLLDRAVDPALLGGVVAQVGSLVYDGSLRTQLEDLR 188
>gi|116490720|ref|YP_810264.1| F0F1-type ATP synthase, delta subunit [Oenococcus oeni PSU-1] >gi|118586239|ref|ZP_01543699.1| ATP synthase, delta subunit [Oenococcus oeni ATCC BAA-1163] >gi|116091445|gb|ABJ56599.1| F0F1-type ATP synthase, delta subunit [Oenococcus oeni PSU-1] >gi|118433323|gb|EAV40029.1| ATP synthase, delta subunit [Oenococcus oeni ATCC BAA-1163] (183 aa)
Score = 103, Expect = 4.3e-03, Identities = 44/181 (24%), Positives = 82/181 (45%)
  Q:     3 EKNHIDHYANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTG-KRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIE 183
           E   I++YA AL    +E+  K      S  + I    + N E+   +D   +S +++   +      L K  S    KNFL  L DN  F  + EI  +  Q++    N   +   +   +  +  +++  +   K G + V  +N++D ++I G+ +  G+   D SIK K+ Q+  +I+
  S:     5 ENRVINNYAEAL----MEVSGKQTAKVLSELQVIELVFERNKELAQTLDDVSVSSQQQEAFIGI----LGKGCSTT-TKNFLETLADNRHFSLLEEIVENLDQRVSASNNHSLVIAKTAIPITAEQSKRLSKIAQKKFGYQHVEVKNVVDPNVIAGVILTAGSKTIDGSIKNKLVQLNNHIK 177
>gi|162447839|ref|YP_001620971.1| F-type H+-transporting ATPase delta chain [Acholeplasma laidlawii PG-8A] >gi|161985946|gb|ABX81595.1| F-type H+-transporting ATPase delta chain [Acholeplasma laidlawii PG-8A] (171 aa)
Score = 103, Expect = 4.4e-03, Identities = 42/173 (24%), Positives = 86/173 (49%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNY-EMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKI-EHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNI 182
           Y++AL+ + L+ D    II      + + SL  +Y + + ++DS +I    K K+L ++       I +    NFL +L  ++  +   +I+  +  K   +Q   ++++YS   + KK L ++ E +     G  + +   ID +LI G+K+ +     + S+K  +D ++ NI
  S:     6 YSDALFKLALKEDAIESII---EQFETFVSLARDYPDWIVLLDSPMIRNRVKNKMLTEL------GIFDALFMNFLMLLVRHHQVRLYEDIYEQWIAKSRLNQKIAYVQLYSAKPLSKKRLNQLKEEIQDYLPGLEIEFNQHIDPTLIEGVKMTYQGRSIERSLKKALDDMRTNI 171
>gi|13508340|ref|NP_110290.1| F0F1 ATP synthase subunit delta [Mycoplasma pneumoniae M129] >gi|2493035|sp|Q50328|ATPD_MYCPN ATP synthase delta chain >gi|1209763|gb|AAC43656.1| ATP synthase delta chain >gi|1673909|gb|AAB95889.1| ATP synthase delta chain [Mycoplasma pneumoniae M129] (178 aa)
Score = 103, Expect = 4.7e-03, Identities = 37/166 (22%), Positives = 87/166 (52%)
  Q:    20 ELDKKNKIIFTSSAKDIYFSLKNNYE---MVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIENN 185
           E +KK K ++  S    +  L  N++   +  ++++  ++K+EK K+++K+F        ++++ +FL  +    +F  + +    FF  ++  ++  FIRI + F +    L++I      K   ++ Y+  IDKSLI G++I     +++ +I+ ++ ++    + N
  S:    16 EEEKKVKKVYDQSHD--FLKLARNFKDGSLAALLNAYTLTKKEKLKLIDKLF---KNHFCDLFV-DFLKTIVLKGYFNLVEQALKYFFDCVENEKHVQFIRIITAFELSAPQLKRIVAAMEKKLNSKIVYKTEIDKSLISGIRIESSAQLFEKNIRDQLSRLMEQFKGN 178
>gi|149173278|ref|ZP_01851909.1| probable ATP synthase delta chain [Planctomyces maris DSM 8797] >gi|148848084|gb|EDL62416.1| probable ATP synthase delta chain [Planctomyces maris DSM 8797] (217 aa)
Score = 103, Expect = 4.8e-03, Identities = 31/137 (22%), Positives = 65/137 (47%)
  Q:    48 HIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIEN 184
            I+ S+ ++K+E+  +++++    +  +    L NFL VL  ++  +   +I        D       + + S F +  + L  I+   S   G     +  ID+S+IGG+ I   + VYD S++ ++ Q++  + N
  S:    66 QILTSHSLNKDERLNLIDRVIAPHASEL----LTNFLRVLARHDRLELFEQIMSQIITMRDTESGKKMVLVRSAFELTDETLSSIKQRLSDTLGFSPVLQTSIDQSVIGGLVIQVDDTVYDGSLRTRLKQLRGRLSN 198
>gi|82701441|ref|YP_411007.1| ATP synthase F1, delta subunit [Nitrosospira multiformis ATCC 25196] >gi|82409506|gb|ABB73615.1| ATP synthase F1, delta subunit [Nitrosospira multiformis ATCC 25196] (178 aa)
Score = 103, Expect = 4.8e-03, Identities = 26/118 (22%), Positives = 60/118 (50%)
  Q:    61 TKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           ++ L ++F  +  +  N   +NF+ +L +N   + + E+   + Q    H+  L  ++ S F +    L+ +      K  +++  +  +D  LIGG+ +  G++V D S++GK++ +
  S:    55 SRKLGELFLSVCGNRLNEEGRNFILLLAENGRLEILPEVNELYEQLKTRHEGVLDAKVISAFAMSDAQLKDLVTDLEAKFKRKIEAKVSVDADLIGGVIVEIGDEVLDASVRGKLEAM 172
>gi|149200616|ref|ZP_01877620.1| ATP synthase delta subunit [Lentisphaera araneosa HTCC2155] >gi|149136290|gb|EDM24739.1| ATP synthase delta subunit [Lentisphaera araneosa HTCC2155] (179 aa)
Score = 103, Expect = 5.0e-03, Identities = 32/140 (22%), Positives = 68/140 (48%)
  Q:    45 EMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIEN 184
           E+   + S +++++++ ++L  +F     + +     +F+  LN  +    + E+   F    +E  N   + I S   + +  ++ IE     K  K ++    +D SL+GG KI  G+ V D+SI  +++ +K +I N
  S:    43 ELTTFLSSPLVAQDKRLELLKSLFEGKIGATA----MSFVTFLNQKDRTPVLAEVCEYFEVFCNEAANVQLVTITSAQELSETQVKAIEVKLEAKLNKTIKASTELDASLLGGFKIAIGDQVIDHSITAQLNSLKQSIVN 178
>gi|126739849|ref|ZP_01755540.1| ATP synthase delta chain [Roseobacter sp. SK209-2-6] >gi|126719081|gb|EBA15792.1| ATP synthase delta chain [Roseobacter sp. SK209-2-6] (186 aa)
Score = 103, Expect = 5.0e-03, Identities = 39/170 (22%), Positives = 84/170 (49%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEK----TKILNKIFFD--LSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           YA A++ I  E    + +   SS  D+  +L ++ +  ++I S ++S+E++      +  K+  +  L+ ++S +  K  LFV         +  +  +   +L E +  +   + S   + K   EK+    + + GK V     +D S+IGG+ +  G+ + D SI+ K++ ++
  S:    15 YATAVFEIAEESKALDSL--ESSINDLAAALADSEDFQNLISSPLVSREDQEAAIAAVAKKMGLEPVLANTLSLMAQKRRLFV---------VPALVEALRARLAEARGEVTAEVISAKALTKTQSEKLAKTLAERVGKTVTINATVDASIIGGLVVKVGSKMIDSSIRSKLNSLQ 179
>gi|124522168|ref|ZP_01696877.1| ATP synthase F1, delta subunit [Bacillus coagulans 36D1] >gi|124496267|gb|EAY43875.1| ATP synthase F1, delta subunit [Bacillus coagulans 36D1] (178 aa)
Score = 103, Expect = 5.0e-03, Identities = 22/78 (28%), Positives = 47/78 (60%)
  Q:   102 SFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGK-RVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           +F +++++ +      +YS   +     + I  +F+ K GK  +  ENI+D  L+ G+KI  GN ++D S++GK+++++
  S:    95 AFIERVNDERGIADALVYSARPLSADESKAISEVFAKKVGKLSLNIENIVDDGLLAGLKIRIGNSIFDSSLRGKLERLE 173
>gi|153206220|ref|ZP_01945483.1| ATP synthase F1, delta subunit [Coxiella burnetii 'MSU Goat Q177'] >gi|154706716|ref|YP_001423605.1| ATP synthase F1, delta subunit [Coxiella burnetii Dugway 5J108-111] >gi|165918733|ref|ZP_02218819.1| ATP synthase F1, delta subunit [Coxiella burnetii RSA 334] >gi|120577350|gb|EAX33974.1| ATP synthase F1, delta subunit [Coxiella burnetii 'MSU Goat Q177'] >gi|154356002|gb|ABS77464.1| ATP synthase F1, delta subunit [Coxiella burnetii Dugway 5J108-111] >gi|165917561|gb|EDR36165.1| ATP synthase F1, delta subunit [Coxiella burnetii RSA 334] (185 aa)
Score = 103, Expect = 5.0e-03, Identities = 47/156 (30%), Positives = 82/156 (52%)
  Q:    28 IFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSI---SNIYLKN----FLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIE 183
           +FT+ +K I    KN      II+     KE KT     + FDL ++I   S   LK+    FL +L D      + +I + + Q L+++Q+ +   +   F +  +  ++I+     +    V+ + I D+SL+GG+ I  GN V D SIKGK+ ++  N++
  S:    31 VFTAFSKII----KNKEVARQIINPKFSDKEIKT-----LLFDLIQTIEPESTKQLKDKIDHFLQLLIDEKRLMILPDIALVYQQLLNKYQDIIEASVTYVFPLNDEHRQQIQKQLEKRFNAEVKLKMIKDESLLGGVIIRAGNWVMDGSIKGKLTRLAENLK 184
>gi|168026822|ref|XP_001765930.1| predicted protein [Physcomitrella patens subsp. patens] >gi|162682836|gb|EDQ69251.1| predicted protein [Physcomitrella patens subsp. patens] (211 aa)
Score = 103, Expect = 5.0e-03, Identities = 26/99 (26%), Positives = 55/99 (55%)
  Q:    81 KNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLF--SIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           KNF+ +L +N     + +IF  + + L+ H+  + + + +   + +  LE+I+     +++ G+ V     +D+S+IGG+ +  G+   D SI  KI Q++
  S:   104 KNFMNLLAENGRLNWVPKIFKCYNELLNAHKGKVEVYVTTAMELSETDLEEIKKAMKGNVEKGQNVEITQRVDRSIIGGIVVAIGDKHIDLSIARKITQME 204
>gi|92116154|ref|YP_575883.1| F0F1 ATP synthase subunit delta [Nitrobacter hamburgensis X14] >gi|91799048|gb|ABE61423.1| ATP synthase F1, delta subunit [Nitrobacter hamburgensis X14] (207 aa)
Score = 103, Expect = 5.0e-03, Identities = 42/170 (24%), Positives = 77/170 (45%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFS--LKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           YA AL+    EL +++K I    A    F   L ++ E+  ++ S + S + + K L  +   L K+        FL VL  N     + E+  +F   +   +  +   +     + KK L+ +       TGK +     +D S+IGG+ +  G+ + D S++ K++ IK
  S:    36 YATALF----ELAREDKSIDAVKADLDRFDAMLADSPELARLVRSPVFSADTQAKALAAV---LDKAGFGGTTAKFLKVLTANRRLFAVTEVIRAFRALVARFKGEVTAEVTVAETLNKKNLDALTTALKSVTGKDITLNVKVDPSIIGGLVVKLGSRMVDSSLRTKLNSIK 200
>gi|183597134|ref|ZP_02958627.1| hypothetical protein PROSTU_00373 [Providencia stuartii ATCC 25827] >gi|188023444|gb|EDU61484.1| hypothetical protein PROSTU_00373 [Providencia stuartii ATCC 25827] (177 aa)
Score = 102, Expect = 5.1e-03, Identities = 26/115 (22%), Positives = 59/115 (51%)
  Q:    64 LNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           L K F  +     + +++N + ++ +N     + E+   F Q  D  ++ + + + S   + ++ L KI      +  ++V+    IDKS+I G+ I  G+ V D S++G+++++
  S:    57 LAKTFISVCGDEIDEHVQNLIRIMAENGRLSTLPEVLAQFIQLRDTLESTIEVDVISANELNEQQLAKISAAMEKRLSRKVKLNCKIDKSVIAGVIIRAGDLVIDGSVRGRLERL 171
>gi|146417827|ref|XP_001484881.1| hypothetical protein PGUG_02610 [Pichia guilliermondii ATCC 6260] (205 aa)
Score = 102, Expect = 5.1e-03, Identities = 41/169 (24%), Positives = 84/169 (49%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMV-------HIIDSNIISKEEKTKILNKIF--FDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFS----IKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           YA ALY   +E          SS +  Y +L    +++         +++  +S +++  +++ I     L K+++N     FL VL+DNN       I+  F Q  D  Q  +   I S   ++ K+L++++   +    +  GK ++  N ++  ++GG+ +  G+   D SI  K+ ++
  S:    30 YATALYRASVE---------DSSVEKSYQALTKVNDLIETDAKVNQFLNNPALSSDDRKVVIDTIASSLKLDKTVTN-----FLTVLSDNNRLSEFKSIYTKFGQLNDAEQGIVEATITSAKPLDSKILKRLQTAITKSSFVGDGKTLKVANEVNPEILGGLVVEVGDKTVDLSISLKVAKL 197
>gi|168037006|ref|XP_001770996.1| predicted protein [Physcomitrella patens subsp. patens] >gi|162677684|gb|EDQ64151.1| predicted protein [Physcomitrella patens subsp. patens] (230 aa)
Score = 102, Expect = 5.2e-03, Identities = 34/125 (27%), Positives = 63/125 (50%)
  Q:    55 ISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFS--IKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           +SK  + K + +IF       SN+  KNFL VL +N    ++  I   + + L  H+  +   + +   +    LE I++     +K G+ ++ E  +D+S+IGG+ +   +   D SI  KI Q++
  S:   100 VSKTMRMKAMEEIFG--QTKFSNV-TKNFLAVLAENGRLAQLQRISGCYSELLHAHRGEVQALVTAALQLSPAELEDIKNALKGYLKPGQTLKVEQKVDRSIIGGIVVDIQDKHIDLSIDTKIKQME 223
>gi|159027206|emb|CAO89300.1| atpH [Microcystis aeruginosa PCC 7806] (182 aa)
Score = 102, Expect = 5.4e-03, Identities = 41/173 (23%), Positives = 88/173 (50%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDN---NFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVV---EKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNI 182
           YA AL S+     +   I      K +   L+N  ++   I + +I +E K  +L+++      + +N YL NF+ +L D     F + + + +++  + L    N +   + S   +   +K+++  I+ + ++     V  +  +D SLIGG+ I  G+ V+D SI+G++ ++  ++
  S:    14 YAQALLSVAQSSGQLEAI--GGEIKSLLELLENAPDLRAFIGNPVIKEEAKKAVLSQVM----GTSANPYLTNFMMLLVDKRRIQFLEPVCQQYLTLSRVL---TNTVLAEVSSATELNDSQKQIV--IDKVKTLTGANVVELKTKVDGSLIGGVVIKVGSQVFDASIRGQLQRLSLSL 181
>gi|33151289|ref|NP_872642.1| F0F1 ATP synthase subunit delta [Haemophilus ducreyi 35000HP] >gi|33147509|gb|AAP95031.1| ATP synthase delta chain [Haemophilus ducreyi 35000HP] (177 aa)
Score = 102, Expect = 5.4e-03, Identities = 41/169 (24%), Positives = 83/169 (49%)
  Q:    10 YANALYSIWLE---LDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           YA A +   LE   LDK  +++  S+       +  N ++V  I S++ S +     +++IF  +     + Y +NF+ V+ +N     + E+F  F     E++    + + S   + +   EKI      + G++VR    ID +L+ G+ I + + V D S +G+++++
  S:    11 YAKAAFDFALEQGQLDKWQEMLQFSAL------VAENEQVVEYITSSLASGQ-----ISEIFLQICDDQLDQYGQNFIRVMAENKRLAILPEVFNRFNALRAEYEAIKKVIVVSATELSQAQEEKIAKAMEKRLGQKVRLTTEIDSTLLTGIIIKYDDIVIDGSSRGQLNRL 171
>gi|169188271|ref|ZP_02848417.1| ATP synthase F1, delta subunit [Paenibacillus sp. JDR-2] >gi|169004920|gb|EDS51775.1| ATP synthase F1, delta subunit [Paenibacillus sp. JDR-2] (179 aa)
Score = 102, Expect = 5.7e-03, Identities = 40/170 (23%), Positives = 81/170 (47%)
  Q:    10 YANALYSIWLELDKKNKIIFTS--SAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           YA AL+    EL  +  I+  +    K I   LKN+ +    ++   I  E+K  +L   F D    +S + L     +L      + I +++ ++ +   E        +Y+   +    L ++E  F   +GK++  E I+   L+GG+++  G+ +YD S+ GK+++++
  S:    11 YAKALF----ELANEQSIVSETEDQLKLIVQGLKNDADARKFLELPSIEPEKKIAVLKGAFGD---HVSALVLHTLELILVRGRQ-ELISDVYDAYTKIAGEALGQAHAVVYTAHSLSASELAEVEVSFGKLSGKKIVAEQIVKPDLLGGVQVRIGDRLYDGSLSGKLERLQ 174
>gi|37524075|ref|NP_927419.1| F0F1 ATP synthase subunit delta [Photorhabdus luminescens subsp. laumondii TTO1] >gi|36783498|emb|CAE12338.1| ATP synthase delta chain [Photorhabdus luminescens subsp. laumondii TTO1] (177 aa)
Score = 102, Expect = 5.7e-03, Identities = 28/125 (22%), Positives = 62/125 (49%)
  Q:    54 IISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           ++S    ++ L   F  +     + + +NF+ V+ +N     + E+   F Q     ++ + + + S   + ++ L KI      +  ++V+    IDKS+I G+ +  G+ V D SI+G++D++
  S:    47 LLSGSLASETLANTFIAICGEQVDEHAQNFIRVMAENGRLLALPEVLQQFIQLRASLESTVDVEVISATELREQQLAKISVAMEKRLSRKVKLNCKIDKSVIAGVVVRAGDLVIDGSIRGRLDRL 171
>gi|157964952|ref|YP_001499776.1| F0F1 ATP synthase subunit delta [Rickettsia massiliae MTU5] >gi|157844728|gb|ABV85229.1| ATP synthase delta chain [Rickettsia massiliae MTU5] (187 aa)
Score = 102, Expect = 5.9e-03, Identities = 46/178 (25%), Positives = 94/178 (52%)
  Q:     1 MEEKNHIDHYANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           M + N I++YA AL++  +  + ++KI        I   + +N+++   + S I++K +K   +N +  ++   IS I ++NFL +L  N+    +  I  ++   L E +N   +++ S   ++ K  E I+ L   +  ++      ID ++IGG+ I + + + DYSIKG +++I
  S:     4 MNKGNLIENYAVALFNNAMVDNIQDKIF--EEITSINRIITDNFDIREFLFSPIVNKNDKINAVNLLAKNIK--ISTI-VQNFLLLLVKNSRTASLSNIVDAYNTLLYESKNIKIVQVISANKLQPKEQEWIKSLIEKELNQKTEILFDIDSTIIGGIVIKYDSMLQDYSIKGSLEKI 176
>gi|85704179|ref|ZP_01035282.1| ATP synthase delta chain [Roseovarius sp. 217] >gi|85671499|gb|EAQ26357.1| ATP synthase delta chain [Roseovarius sp. 217] (218 aa)
Score = 102, Expect = 5.9e-03, Identities = 37/170 (21%), Positives = 82/170 (48%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILN------KIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           YA A++ +  E     K+   S+  D+  +L ++ ++  +I S ++S++ +   ++      K+  +L   ++ +  K  LFVL          ++       + E +  +   + S   + K   +K+      + GK V+    +D+SLIGG+ +  G+ + D SI+ K+D ++
  S:    47 YATAIFELVREAKSVAKL--ESNLNDLAQALTDSDDLRAMISSPVLSRDVQGAAMSAVAAKMKLLPELQNGLALMAQKRRLFVLP---------QLIAQLNAMIAEDKGEVSADVISAKALTKAQADKLAKTLKDRVGKDVKINATVDESLIGGLVVKMGSKMIDTSIRSKLDSLQ 211
>gi|154503955|ref|ZP_02041015.1| hypothetical protein RUMGNA_01781 [Ruminococcus gnavus ATCC 29149] >gi|153795382|gb|EDN77802.1| hypothetical protein RUMGNA_01781 [Ruminococcus gnavus ATCC 29149] (162 aa)
Score = 102, Expect = 5.9e-03, Identities = 32/124 (25%), Positives = 60/124 (48%)
  Q:    55 ISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIK-TGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           I  ++K ++++K+F           ++NFL V         I EIF ++ +  DE    L   +    +   + L+ +E     K    + R E   D +L+GG  +  G+D YD+S+KG++D++
  S:    39 IPAQKKERVIDKVFPQ--------EMRNFLKVACKYERMDLIPEIFAAYDRYCDEQDRILSAVLTCVELPSDEQLKNMEAFLCKKYEASKARIEIQTDSTLLGGFVLRTGSDEYDWSLKGRLDRL 155
>gi|167628985|ref|YP_001679484.1| F0F1 ATP synthase subunit delta [Heliobacterium modesticaldum Ice1] >gi|167591725|gb|ABZ83473.1| ATP synthase f1, delta subunit [Heliobacterium modesticaldum Ice1] (185 aa)
Score = 102, Expect = 6.1e-03, Identities = 24/99 (24%), Positives = 49/99 (49%)
  Q:    81 KNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           + F+ ++ D        +IF  F +  ++ +N    R+ S   +  + +E++    +  TGK +     +D  LIGG+ + FG+ + D S+ GKI  ++
  S:    75 RAFILLVIDRRRESYFADIFREFVRLANKVRNIEEARVTSAVELAPEQVERLRSQLAAATGKAIVLRMAVDPDLIGGLVVAFGDRIIDGSVAGKIRDLR 173
>gi|166033113|ref|ZP_02235942.1| hypothetical protein DORFOR_02835 [Dorea formicigenerans ATCC 27755] >gi|166027470|gb|EDR46227.1| hypothetical protein DORFOR_02835 [Dorea formicigenerans ATCC 27755] (178 aa)
Score = 102, Expect = 6.1e-03, Identities = 45/170 (26%), Positives = 84/170 (49%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGK-RVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           YA  LY   LE+ K +        K+I+  +   YE   ++ + +I+ + K  ++ +IF    K I N     FL V  +N     + +IF S+ +  +E Q  +   +      +++  EK++     K  K +V  E   D SL+GG  +  G+D YD+SI+G++++++
  S:    19 YARVLYE--LEIPKAD----IEKTKEIFCQVPEVYE---VLLNPVITAKNKYSVIEQIF---PKPICN-----FLKVTCENQRMGMLWDIFESYDKYCEEQQQVMTATLICVDEPDEEQAEKMKTFIMDKYHKSKVNLEVEKDPSLLGGFILRAGSDEYDWSIRGRMNRLE 172
>gi|84500103|ref|ZP_00998369.1| ATP synthase delta chain [Oceanicola batsensis HTCC2597] >gi|84392037|gb|EAQ04305.1| ATP synthase delta chain [Oceanicola batsensis HTCC2597] (188 aa)
Score = 102, Expect = 6.1e-03, Identities = 40/170 (23%), Positives = 80/170 (47%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDE----HQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           YA A++ I    D  +     S   D+  +L ++ ++  +I S + S+E + K ++ +     K      LKN L ++ +    KR L +      +L E     +  +   + S   + K    ++  + S + GK V+    +D+SLIGG+ +  G+ + D S+K K+  ++
  S:    17 YATAIFEI--SRDNNDVSALESGVDDLSAALDDSADLRDLIHSPVYSREAQGKAISAL---ADKMGLPQVLKNSLGLMAE----KRRLFVLPQLVAQLRELIATEKGEVTAEVVSAKALTKTQETRLSKVLSAQAGKEVKLNTSVDESLIGGLIVKVGSKMIDTSVKSKLASLQ 181
>gi|29655226|ref|NP_820918.1| ATP synthase F1, delta subunit [Coxiella burnetii RSA 493] >gi|161829858|ref|YP_001597758.1| ATP synthase F1, delta subunit [Coxiella burnetii RSA 331] >gi|29542498|gb|AAO91432.1| ATP synthase F1, delta subunit [Coxiella burnetii RSA 493] >gi|161761725|gb|ABX77367.1| ATP synthase F1, delta subunit [Coxiella burnetii RSA 331] (185 aa)
Score = 102, Expect = 6.2e-03, Identities = 47/156 (30%), Positives = 81/156 (51%)
  Q:    28 IFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSI---SNIYLKN----FLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIE 183
           +FT+ +K I    KN      II+     KE KT     + FDL ++I   S   LK+    FL +L D      + +I + + Q L+++Q  +   +   F +  +  ++I+     +    V+ + I D+SL+GG+ I  GN V D SIKGK+ ++  N++
  S:    31 VFTAFSKII----KNKEVARQIINPKFSDKEIKT-----LLFDLIQTIEPESTKQLKDKIDHFLQLLIDEKRLMILPDIALVYQQLLNKYQGIIEASVTYVFPLNDEHRQQIQKQLEKRFNAEVKLKMIKDESLLGGVIIRAGNWVMDGSIKGKLTRLAENLK 184
>gi|167856124|ref|ZP_02478865.1| F0F1 ATP synthase subunit alpha [Haemophilus parasuis 29755] >gi|167852765|gb|EDS24038.1| F0F1 ATP synthase subunit alpha [Haemophilus parasuis 29755] (177 aa)
Score = 102, Expect = 6.2e-03, Identities = 43/169 (25%), Positives = 81/169 (47%)
  Q:    10 YANALYSIWLE---LDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           YA A +   LE   LDK  +++  S+       +  N ++ H I S+       T++++  F  +     + Y +NF+ V+ +N     +  +F SF Q   E+++   + + S   + K   +KI +    K    VR    ID SLI G+ I + + V D S +G+++++
  S:    11 YAKAAFDFALEQGQLDKWQEMLQFSAL------VAENEDVQHFIHSS----SAATQVVDT-FIAICGDQLDQYGQNFIRVMAENKRLSALPSVFASFNQIRAEYESVKDVFVTSATPLTKAQEDKIANAMKQKLNSEVRITTSIDASLIAGVIIRYDDVVIDGSSRGQLNRL 171
>gi|189183874|ref|YP_001937659.1| ATP synthase delta chain [Orientia tsutsugamushi str. Ikeda] >gi|189180645|dbj|BAG40425.1| ATP synthase delta chain [Orientia tsutsugamushi str. Ikeda] (181 aa)
Score = 102, Expect = 6.3e-03, Identities = 29/104 (27%), Positives = 55/104 (52%)
  Q:    82 NFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIENN 185
           NFL +L  NN    +  I I+F  ++  +Q      + +     K  ++ I+ +F  K  +++   NI+DKS++GG+ + + +  YD S+ G I++ K  I+ N
  S:    77 NFLKLLQKNNRLTYLSHIIIAFDAQVRNYQGVTLGYLITTIKWSKAAIKDIKAIFERKLNRKLIISNIVDKSIVGGIILRYDDYEYDLSMLGAINRFKSRIKLN 180
>gi|157826260|ref|YP_001493980.1| F0F1 ATP synthase subunit delta [Rickettsia akari str. Hartford] >gi|157800218|gb|ABV75472.1| F0F1 ATP synthase subunit delta [Rickettsia akari str. Hartford] (184 aa)
Score = 101, Expect = 6.9e-03, Identities = 45/178 (25%), Positives = 92/178 (51%)
  Q:     1 MEEKNHIDHYANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           M + N I +YA AL++  +  + ++KI    +A  I   + +N+++   + S I++K +K   +N +  ++  S     ++NFL +L  N+    +  I  ++   L E +N   +R+ S   ++ K  E I+     +  ++      ID ++IGG+ I + + + DYSIKG +++I
  S:     1 MNKDNLIKNYAVALFNNAVVDNIQDKIFEEITA--INRIITDNFDIREFLFSPIVNKNDKVNAVNSLAKNIKMST---IVQNFLLLLVKNSRTAILSNIVDTYNALLYESKNIKIVRVISANKLQPKEQEWIKSRIEKELNQKTEILFDIDSTIIGGIVIKYDSMLQDYSIKGSLEKI 173
>gi|1168587|sp|Q07300|ATPD_SORBI ATP synthase delta chain, chloroplast precursor >gi|311231|emb|CAA46803.1| H(+)-transporting ATP synthase [Sorghum bicolor] (247 aa)
Score = 101, Expect = 7.1e-03, Identities = 48/176 (27%), Positives = 86/176 (48%)
  Q:     8 DHYANALYSIWLE----------LDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSIS-NIYLKNFLFVLNDNNFFKRIL-EIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKI-EHLFSIKTGKRVRYENIIDKSLIGGMKIMFGND---VYDYSIKGKIDQIKWNIE 183
           D YA+AL  + +E          L+K  KI    +  + +             D+  + +EEKT ++++I    +KS     ++ NF+ V+ DN F   IL EI + F    +         + S   +E + L +I +H+  +   K VR +  +D  LI G  + +G D   + D S++ +I++I    E
  S:    66 DSYASALSEVAVENGTLEQTVSDLEKLQKIFADETVAEFF-------------DNPTVPREEKTALIDEI----AKSYELQPHVVNFINVVVDN-FRATILPEIVVEFENIFNSLTGTEVATVTSVVQLESQDLAQIAQHVQKMTGAKNVRLKTQLDPELIAGFTVQYGRDGSSLIDMSVRKQIEEITSEFE 239
>gi|168037751|ref|XP_001771366.1| predicted protein [Physcomitrella patens subsp. patens] >gi|162677284|gb|EDQ63756.1| predicted protein [Physcomitrella patens subsp. patens] (227 aa)
Score = 101, Expect = 7.2e-03, Identities = 40/139 (28%), Positives = 68/139 (48%)
  Q:    40 LKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKI-EHLFSIKTGKRVRYENIIDKSLIGGMKIMFGND---VYDYSIKGKIDQI 178
           L  N  +   + S +I  ++K  IL  +  D     S++ L NFL +L D      I E+   F    +E  +     + S   +EK  L  I + + S+   K VR +N++D +LI G  + +G D     D S+KG++D++
  S:    75 LMTNETLYDFLVSPVIDGDKKKSILKTVAED--AKFSDVTL-NFLNLLVDKKRIDLIKEVTKEFEVIYNELTDTQVATVISAVKIEKPQLALIAKKIQSLCGAKNVRIKNVLDPTLIAGFIVQYGKDGSRYIDMSVKGQLDKL 214
>gi|126696980|ref|YP_001091866.1| F0F1 ATP synthase subunit delta [Prochlorococcus marinus str. MIT 9301] >gi|126544023|gb|ABO18265.1| ATP synthase, delta (OSCP) subunit [Prochlorococcus marinus str. MIT 9301] (180 aa)
Score = 101, Expect = 7.4e-03, Identities = 47/169 (27%), Positives = 80/169 (47%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVV---EKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           YA AL  +  E  +  +++  S  K +   + N+ E+   + S I+  + K KI+N+IF   SK + N  L NFL +L D      +  I   F +   E+ N     + S   +   +K L+ K   + +I   +++     ID SLIGG     G+ V D S+  +I ++
  S:    11 YAEALLQVVNENSQTEEMV--SEVKQLLELINNSPELEKALSSPILETDAKKKIINEIF---SKKV-NSSLLNFLKLLADRQRIGILTSILDRFLEIYRENSNIALATVTSAVELTDEQKGLITK--KIINIAGTEKLELVTKIDPSLIGGFVASVGSKVIDASLASQIRKL 174
>gi|88797170|ref|ZP_01112760.1| H+-transporting two-sector ATPase, delta (OSCP) subunit [Reinekea sp. MED297] >gi|88780039|gb|EAR11224.1| H+-transporting two-sector ATPase, delta (OSCP) subunit [Reinekea sp. MED297] (178 aa)
Score = 101, Expect = 7.4e-03, Identities = 41/169 (24%), Positives = 73/169 (43%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           YA A +S  ++      I   S+A      +     +  +I S  +S  +K K +     D++    N    N L VL +N+ F  + EI   F     EH+    + + S F +     + +    + K  + V     +D +LIGG+ I  G+ V D S++GK+ ++
  S:    11 YAKAAFSAAVD---SGDIATWSTALQTLAVISKAESVAELIASPSVSALDKAKTIA----DIAGDDCNEGASNLLVVLAENDRFALLSEISSQFELLRSEHEKSADVVVTSAFELSDAQQKALTEKLTAKLSREVSMTVKVDSALIGGVIIKAGDLVIDGSVRGKLSKL 172
>gi|169351554|ref|ZP_02868492.1| hypothetical protein CLOSPI_02334 [Clostridium spiroforme DSM 1552] >gi|169291776|gb|EDS73909.1| hypothetical protein CLOSPI_02334 [Clostridium spiroforme DSM 1552] (177 aa)
Score = 101, Expect = 7.7e-03, Identities = 35/140 (25%), Positives = 67/140 (47%)
  Q:    40 LKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
             N  E +      +I  E K  ++++ F    K   NIY+ NFL +L      + + EI   F +  +++       +Y+ + + ++ L+++E        K V+   + D +LIGG+K+   N V+D +IK K+  +K
  S:    36 FSNEPEFLTFFSHVLIDDEVKCNLIDQSF----KGTVNIYIVNFLKLLIKKRRIRYLQEIIKEFKKLCNDYFGIEEGILYTSYDISQESLKQVEQAIGKVENKLVKLNVVKDPTLIGGIKVEVNNRVFDGTIKNKVSLLK 171
>gi|20807127|ref|NP_622298.1| F0F1-type ATP synthase delta subunit (mitochondrial oligomycin sensitivity protein) [Thermoanaerobacter tengcongensis MB4] >gi|20515622|gb|AAM23902.1| F0F1-type ATP synthase delta subunit (mitochondrial oligomycin sensitivity protein) [Thermoanaerobacter tengcongensis MB4] (177 aa)
Score = 101, Expect = 8.0e-03, Identities = 43/173 (24%), Positives = 85/173 (49%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVH------IIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNI 182
           YA+AL+ +  + D+          K+ Y  LK   E++       I  +  I K +K K + ++    SK I N          +  N  K IL  F + ++    + N + +++ S + +++++L  +      K  K+V    ++DK ++GG+K++ GN V D SIK +++ +  N+
  S:     9 YASALFDVAKKEDR---------VKEYYEELKKAVEILQTEAVWKIFVNKSIDKTKKMKFVEEVLEGFSKEIVNFV--KVAISKHRENLIKEILNEFEALYKA---YFNMIDVKVISAYPLKEEVLNLVREKLEKKYNKKVNLIPVVDKEILGGLKLVIGNTVIDGSIKARLEALLKNM 173
>gi|118411030|ref|YP_874425.1| ATP synthase CF1 delta chain [Phaeodactylum tricornutum] >gi|116739777|gb|ABK20648.1| ATP synthase CF1 delta chain [Phaeodactylum tricornutum] (187 aa)
Score = 101, Expect = 8.0e-03, Identities = 42/179 (23%), Positives = 90/179 (50%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPF---VVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIENNKEV 188
           YA AL+   +E +  ++I  T+  +++   LK N E+   +D+ ++SK  K +IL K    L   +++  LK FL +L +      +  +   + + + E  +   I + + F     +K +L  ++ L  +   + +R    +D +LIGG  I   + V D++IK ++ ++  +++   E+
  S:    14 YARALFDFSVEKNIMHQI--TADFQNLEIFLKENTELTEYLDNPVVSKNAKCEILAKT---LQAQLNDETLK-FLMILVERGRISLLTSVITIYLELVYETASIKTIEVSTAFEFTTSQKTIL--VQKLKELMNAREIRLMITVDPNLIGGFLIKTQSKVIDFTIKNQLQKLAKHLDTVLEI 187
>gi|50421995|ref|XP_459558.1| hypothetical protein DEHA0E06237g [Debaryomyces hansenii CBS767] >gi|49655226|emb|CAG87785.1| unnamed protein product [Debaryomyces hansenii CBS767] (205 aa)
Score = 101, Expect = 8.1e-03, Identities = 36/169 (21%), Positives = 85/169 (50%)
  Q:    10 YANALYSIWLELDKKNKII-FTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIF--FDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFS----IKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           YANALYS  ++     K   F  +  ++   ++N+ ++   + +  ++K++++ ++  +     L K+ +N     FL VL + N       ++  F    D HQ  +  ++ S   ++ K+L++++        +  GK ++  N ++  ++GG+ +  G+   D S+  KI ++
  S:    30 YANALYSASVQDSSVEKTFQFLGTINEL---VENDSQVRDFLHNPALTKDDRSAVIKALSSGLKLDKTTTN-----FLNVLAEYNRLSHFQNVYKEFATLNDAHQGLVEAKVTSVKPLDSKILKRLQASIGKSSFVGEGKTLKLTNDVNPDIVGGLIVEVGDRTVDLSVSAKIAKL 197
>gi|94263075|ref|ZP_01286894.1| H+-transporting two-sector ATPase, delta (OSCP) subunit [delta proteobacterium MLMS-1] >gi|93456618|gb|EAT06726.1| H+-transporting two-sector ATPase, delta (OSCP) subunit [delta proteobacterium MLMS-1] (181 aa)
Score = 101, Expect = 8.2e-03, Identities = 35/174 (20%), Positives = 88/174 (50%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSI-SNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIE 183
           YA AL+++  E    +   +  S  ++     ++ E+   + + +  ++ + K++      L+K++ +   + NF  +L D      + ++  ++ + +D  +N L   + +   ++++L  K++      TGK+V + + +D ++IGGM    G+ V D SI+ ++  +K +I+
  S:    10 YAKALFAVGKE--DGSYAAYAESLSELAELFSSSREVADALTNPLYPEDVRLKVMES----LAKALKAPTVMINFFKLLADKRRVAILPDVAQAYREMVDRDRNLLRGTLVTAGEIDQELSAKVKATMEKITGKQVEFSSQVDPAIIGGMVAKVGDLVLDGSIRSQLTGLKESIK 178
>gi|171462850|ref|YP_001796963.1| ATP synthase F1, delta subunit [Polynucleobacter necessarius STIR1] >gi|171192388|gb|ACB43349.1| ATP synthase F1, delta subunit [Polynucleobacter necessarius STIR1] (178 aa)
Score = 101, Expect = 8.4e-03, Identities = 33/116 (28%), Positives = 63/116 (54%)
  Q:    64 LNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKT---GKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           L+K+   + K+  +  + +FL ++N N+    + EI   F    ++ +    + I S F +E   L  +  L S+K    GK +R    +D +LIGG++I  G++V D S+K ++ Q++
  S:    57 LSKLLSGMVKTKLDPKVASFLNLVNQNHRLVAVPEIAHQFEAMKNKSEGAAEVNITSAFPLEGSALNDL--LSSLKKRFGGKELRPTIQVDPTLIGGVRIQVGDEVMDSSVKVQLAQMQ 173
>gi|83719601|ref|YP_443803.1| F0F1 ATP synthase subunit delta [Burkholderia thailandensis E264] >gi|167582837|ref|ZP_02375711.1| F0F1 ATP synthase subunit delta [Burkholderia thailandensis TXDOH] >gi|167620977|ref|ZP_02389608.1| F0F1 ATP synthase subunit delta [Burkholderia thailandensis Bt4] >gi|83653426|gb|ABC37489.1| ATP synthase F1, delta subunit [Burkholderia thailandensis E264] (179 aa)
Score = 100, Expect = 8.7e-03, Identities = 25/95 (26%), Positives = 51/95 (53%)
  Q:    81 KNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKI 175
           KNF+ +L DN+    + EI + F    +  +    ++I S F +E   L ++      K  ++++    +D SLIGG+++  G++V D S++ ++
  S:    76 KNFVQMLVDNHRIALLPEIAVQFEALKNAREGAADVQIVSAFPLEGAQLAELVTSLERKFKRKLKPAVEVDSSLIGGVRVTVGDEVLDTSVRARL 170
>gi|53724013|ref|YP_104459.1| F0F1 ATP synthase subunit delta [Burkholderia mallei ATCC 23344] >gi|124384608|ref|YP_001027570.1| F0F1 ATP synthase subunit delta [Burkholderia mallei NCTC 10229] >gi|126441070|ref|YP_001060964.1| F0F1 ATP synthase subunit delta [Burkholderia pseudomallei 668] >gi|126447991|ref|YP_001082532.1| F0F1 ATP synthase subunit delta [Burkholderia mallei NCTC 10247] >gi|126451679|ref|YP_001068264.1| F0F1 ATP synthase subunit delta [Burkholderia pseudomallei 1106a] >gi|134281554|ref|ZP_01768262.1| ATP synthase F1, delta subunit [Burkholderia pseudomallei 305] >gi|161359681|ref|ZP_02105548.1| F0F1 ATP synthase subunit delta [Burkholderia pseudomallei 1106b] >gi|167721825|ref|ZP_02405061.1| F0F1 ATP synthase subunit delta [Burkholderia pseudomallei DM98] >gi|167904853|ref|ZP_02492058.1| F0F1 ATP synthase subunit delta [Burkholderia pseudomallei NCTC 13177] >gi|167913131|ref|ZP_02500222.1| F0F1 ATP synthase subunit delta [Burkholderia pseudomallei 112] >gi|194316844|ref|YP_002012826.1| ATP synthase F1, delta subunit [Burkholderia mallei ATCC 10399] >gi|194512635|ref|YP_002025159.1| ATP synthase F1, delta subunit [Burkholderia pseudomallei Pasteur 52237] >gi|194523418|ref|YP_002058950.1| ATP synthase F1, delta subunit [Burkholderia mallei FMH] >gi|194528404|ref|YP_002063926.1| ATP synthase F1, delta subunit [Burkholderia mallei JHU] >gi|194576167|ref|YP_002111050.1| ATP synthase F1, delta subunit [Burkholderia mallei 2002721280] >gi|52427436|gb|AAU48029.1| ATP synthase F1, delta subunit [Burkholderia mallei ATCC 23344] >gi|124292628|gb|ABN01897.1| ATP synthase F1, delta subunit [Burkholderia mallei NCTC 10229] >gi|126220563|gb|ABN84069.1| ATP synthase F1, delta subunit [Burkholderia pseudomallei 668] >gi|126225321|gb|ABN88861.1| ATP synthase F1, delta subunit [Burkholderia pseudomallei 1106a] >gi|126240861|gb|ABO03954.1| ATP synthase F1, delta subunit [Burkholderia mallei NCTC 10247] >gi|134247221|gb|EBA47307.1| ATP synthase F1, delta subunit [Burkholderia pseudomallei 305] >gi|147747428|gb|EDK54504.1| ATP synthase F1, delta subunit [Burkholderia mallei FMH] >gi|147752414|gb|EDK59480.1| ATP synthase F1, delta subunit [Burkholderia mallei JHU] >gi|148026488|gb|EDK84573.1| ATP synthase F1, delta subunit [Burkholderia mallei 2002721280] >gi|157934176|gb|EDO89846.1| ATP synthase F1, delta subunit [Burkholderia pseudomallei Pasteur 52237] >gi|160695999|gb|EDP85969.1| ATP synthase F1, delta subunit [Burkholderia mallei ATCC 10399] (179 aa)
Score = 100, Expect = 8.7e-03, Identities = 25/95 (26%), Positives = 51/95 (53%)
  Q:    81 KNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKI 175
           KNF+ +L DN+    + EI + F    +  +    ++I S F +E   L ++      K  ++++    +D SLIGG+++  G++V D S++ ++
  S:    76 KNFVQMLVDNHRIALLPEIAVQFEALKNAREGAADVQIVSAFPLEGAQLAELVTSLERKFKRKLKPAVEVDSSLIGGVRVTVGDEVLDTSVRARL 170
>gi|67643088|ref|ZP_00441837.1| COG0712: F0F1-type ATP synthase, delta subunit (mitochondrial oligomycin sensitivity protein) [Burkholderia mallei GB8 horse 4] (162 aa)
Score = 100, Expect = 8.7e-03, Identities = 25/95 (26%), Positives = 51/95 (53%)
  Q:    81 KNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKI 175
           KNF+ +L DN+    + EI + F    +  +    ++I S F +E   L ++      K  ++++    +D SLIGG+++  G++V D S++ ++
  S:    59 KNFVQMLVDNHRIALLPEIAVQFEALKNAREGAADVQIVSAFPLEGAQLAELVTSLERKFKRKLKPAVEVDSSLIGGVRVTVGDEVLDTSVRARL 153
>gi|171742080|ref|ZP_02917887.1| hypothetical protein BIFDEN_01185 [Bifidobacterium dentium ATCC 27678] >gi|171277694|gb|EDT45355.1| hypothetical protein BIFDEN_01185 [Bifidobacterium dentium ATCC 27678] (275 aa)
Score = 100, Expect = 9.2e-03, Identities = 19/90 (21%), Positives = 48/90 (53%)
  Q:    94 KRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIE 183
           +R L+       KL  H     + + +   +  + ++K+  ++S KTG  V   +++D +++GGM+I  G++V D ++  ++  ++  ++
  S:   183 RRYLQTIQWLINKLSRHMGESMVTVTTAKPLTDEQVDKLVAVYSAKTGHPVHINSVVDPTVMGGMRIQVGDEVTDNTVVAQLQHLQRTVK 272
>gi|58266712|ref|XP_570512.1| hypothetical protein [Cryptococcus neoformans var. neoformans JEC21] >gi|134110870|ref|XP_775899.1| hypothetical protein CNBD3070 [Cryptococcus neoformans var. neoformans B-3501A] >gi|50258565|gb|EAL21252.1| hypothetical protein CNBD3070 [Cryptococcus neoformans var. neoformans B-3501A] >gi|57226745|gb|AAW43205.1| conserved hypothetical protein [Cryptococcus neoformans var. neoformans JEC21] (208 aa)
Score = 100, Expect = 9.2e-03, Identities = 36/162 (22%), Positives = 79/162 (48%)
  Q:    16 SIWLELDKKNKIIFTSSAKDIYF---SLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLF---SIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQ 177
           S +L   KK+     + AKD+      ++++ ++   I +  +S  E+   L+ +      S ++  L N L VL++N       ++F  F   +  ++  L + + S   ++ K L +++       I  GK ++  N ++ S++GG+ + FG+   D S   K+++
  S:    36 STYLAALKKSPKELEALAKDVEAFDRKIRDDAKVAAFIQNPTLSASERAAALSSVV----PSGASPILSNLLSVLSENGRLSSAPKVFADFHSLMAAYRGELEVVVTSAEPLDSKSLSRLDKALKGTEIAQGKTLKVVNRVNASVLGGLLVDFGDKTIDLSASSKVNR 199
>gi|170077358|ref|YP_001733996.1| ATP synthase F1, delta subunit [Synechococcus sp. PCC 7002] >gi|169885027|gb|ACA98740.1| ATP synthase F1, delta subunit [Synechococcus sp. PCC 7002] (185 aa)
Score = 100, Expect = 9.3e-03, Identities = 42/176 (23%), Positives = 88/176 (50%)
  Q:     7 IDHYANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNN---FFKRILEIFISFFQKLDEHQNFLFIRIYS--PFVVEKK--LLEKIEHLFSIKTGKRVRYENI-IDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNI 182
           ++ YA AL ++  E +K     F  + + +    + + E    + + ++  E+K  +L  +         + Y  NFLF+L D     F + I + F++  +KL+   N +   + S  P   +++  + ++++ +    TG      NI  D  LIGG+ I  G+ V+D S++G++ +I  ++
  S:    11 VEPYAGALMTLAQETNKVEA--FAENCRALLSLFQESAEFRSFVMNPLVKAEDKKGVLQGV----CGQDVDTYFLNFLFLLVDRRRIVFLEGICQEFVALQRKLN---NIVLADVTSAQPLTTDQEAAIADQVKQM----TGANAVELNISTDADLIGGVVIKVGSKVFDASLRGQLRRISMDL 181
>gi|194337848|ref|YP_002019642.1| ATP synthase F1, delta subunit [Pelodictyon phaeoclathratiforme BU-1] >gi|194310325|gb|ACF45025.1| ATP synthase F1, delta subunit [Pelodictyon phaeoclathratiforme BU-1] (178 aa)
Score = 100, Expect = 9.3e-03, Identities = 43/170 (25%), Positives = 82/170 (48%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFV--LNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           YA+AL S   E +  N+I+       I   L+++ ++V+ + S ++  + K  IL +IF D      ++  K FLF+  +        + EI   F   LDE +  + + I S   +  +   ++    +  TGK +R    I++  IGG+ +  G+ +YD SI  ++  ++
  S:    10 YASALLSAAEEGNFLNQIV--DELHVIKEVLEHSRDLVYALRSPLVKGDRKIHILEEIFKD------SVGEKMFLFLRLVAHKKRAGLLPEIIDEFQILLDEKRGVINVDITSATALSDEQTAELVTKLAAFTGKEIRPRMAINEQFIGGVAVKIGDTIYDGSISHQLQMLR 173
>gi|113869576|ref|YP_728065.1| F0F1 ATP synthase subunit delta [Ralstonia eutropha H16] >gi|113528352|emb|CAJ94697.1| Membrane-bound ATP synthase, F1 sector,delta-subunit [Ralstonia eutropha H16] (180 aa)
Score = 100, Expect = 9.7e-03, Identities = 29/112 (25%), Positives = 54/112 (48%)
  Q:    64 LNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKI 175
           L ++F  + KS  N   + F+ +L DN     + EI   F    +  +    + I S F +E   L  +      K G+++  +  +D SLIGG+ +  G++V D S++ ++
  S:    60 LAELFLSVLKSPLNDEARRFVKLLVDNGRLTVMPEIAEQFHVLKNAREGSSDVEITSAFPLEGSQLNDLVAALERKFGRKLYAQVAVDPSLIGGVSVKVGDEVLDTSVRSRL 171
>gi|148284340|ref|YP_001248430.1| H(+)-transporting two-sector ATPase F(1) delta subunit [Orientia tsutsugamushi str. Boryong] >gi|146739779|emb|CAM79645.1| H(+)-transporting two-sector ATPase F(1) delta subunit [Orientia tsutsugamushi Boryong] (181 aa)
Score = 100, Expect = 9.9e-03, Identities = 29/104 (27%), Positives = 56/104 (53%)
  Q:    82 NFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIENN 185
           NFL +L  NN    +  I I+F  ++  +Q      + +     K  +++I+ +F  K  +++   NI+DKS++GG+ + + +  YD S+ G I++ K  I+ N
  S:    77 NFLKLLQKNNRLTYLSHIIIAFDAQVRNYQGVTLGYLITTKKWSKSAIKEIKDIFERKLNRKLIISNIVDKSIVGGIILRYEDYEYDLSMLGAINRFKSRIKLN 180
>gi|124265387|ref|YP_001019391.1| F0F1 ATP synthase subunit delta [Methylibium petroleiphilum PM1] >gi|124258162|gb|ABM93156.1| putative ATP synthase delta chain protein [Methylibium petroleiphilum PM1] (177 aa)
Score = 100, Expect = 1.0e-02, Identities = 27/121 (22%), Positives = 58/121 (47%)
  Q:    59 EKTKILNKIFFDLSKSISNIYL----KNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           +  K+  +  FDL   ++   L    +N L  + +N     + E+   F   ++         +YS F +E   L  +      + G+R+     ++  LIGG++++ G++V D S+K +++ +K
  S:    48 DSPKVAAQQVFDLVAGVTKQTLVPGVQNLLRAMIENGRLSALPEVAAQFHALVNASSGVSDAIVYSAFPIEPAALADLVATLEKRFGRRLSATVQLEPELIGGVRVVVGDEVLDTSVKARLEHMK 172
>gi|83649676|ref|YP_438111.1| F0F1 ATP synthase subunit delta [Hahella chejuensis KCTC 2396] >gi|83637719|gb|ABC33686.1| ATP synthase F1, delta subunit [Hahella chejuensis KCTC 2396] (178 aa)
Score = 100, Expect = 1.0e-02, Identities = 29/113 (25%), Positives = 55/113 (48%)
  Q:    66 KIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           + F D+ +   N    NF+ VL +NN    + EI   F Q   + +  + + I S F +  +   K+      K  + V   + ++K LIGG+ +  G+ V D S++G++ ++
  S:    60 QTFLDVCEGKLNEAGANFVRVLAENNRLVLLPEIAALFEQLKAQQEATIEVTIESAFEMNDEQENKLAQALQKKLSRNVNLRSQLNKELIGGIVVRAGDLVIDASVRGRLAKL 172
>gi|73543031|ref|YP_297551.1| F0F1 ATP synthase subunit delta [Ralstonia eutropha JMP134] >gi|72120444|gb|AAZ62707.1| H+-transporting two-sector ATPase, delta (OSCP) subunit [Ralstonia eutropha JMP134] (179 aa)
Score = 100, Expect = 1.1e-02, Identities = 27/112 (24%), Positives = 55/112 (49%)
  Q:    64 LNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKI 175
           L  +F  + KS  N   + F+ +L +NN    + E+   F    +  +    + I S F ++ + L  +      K G+++  +  +D SLIGG+ +  G++V D S++ ++
  S:    58 LGDLFLSVVKSPVNDEARRFVKLLVENNRLTVMPEVAEQFHALKNAREGSSDVEITSAFPLDGQPLNDLVAALERKFGRKLYAKVAVDPSLIGGVSVKVGDEVLDTSVRARL 169
>gi|156845325|ref|XP_001645554.1| hypothetical protein Kpol_1004p74 [Vanderwaltozyma polyspora DSM 70294] >gi|156116218|gb|EDO17696.1| hypothetical protein Kpol_1004p74 [Vanderwaltozyma polyspora DSM 70294] (207 aa)
Score = 100, Expect = 1.1e-02, Identities = 41/169 (24%), Positives = 83/169 (49%)
  Q:    10 YANALY---SIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFS----IKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           YA AL+   S    +D  NK     S   +  +L+ + ++  I+ +  +S  E+  ++N++    S+S  +  + NFL VL +NN    + ++   F    D +   +   + S   ++ K  +++E   +    +  GK ++ +NII   + GG+ +  G+   D SI  KI ++
  S:    31 YATALFTAASRETSIDSANK-----SLTKLRETLQVDPKLNEILGNPALSSGERKVVVNELI--KSESGLDATVSNFLKVLAENNRLDLLPKVTSQFSVLADAYNGLIQATVTSSQPLDNKSFKRVEKALTQSELVGQGKTLKLKNIIKPDIQGGLIVEIGDKTVDLSIASKIQKL 199
>gi|179398824|gb|ACB86607.1| putative oligomycin sensitivity protein [Silene conica] (220 aa)
Score = 100, Expect = 1.1e-02, Identities = 28/100 (28%), Positives = 52/100 (52%)
  Q:    80 LKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYS----PFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           +KNFL +L  N   + +  I   F +    H+  +   + +    P   EK+L E ++ +     G  V+ E  ID S++GG+ + F  +V+D SI+ +  Q++
  S:   116 MKNFLVLLAKNGRLRNMDSIAKRFSELTMAHRGEVHATVTTVIPLPPAEEKELKETLQEILG--KGTTVKLEQKIDPSIMGGLIVEFSQEVFDMSIRKRAKQME 217
>gi|50305405|ref|XP_452662.1| ATPO_KLULA [Kluyveromyces lactis] >gi|52788224|sp|O74190|ATPO_KLULA ATP synthase subunit 5, mitochondrial precursor (ATP synthase chain 5) (Oligomycin sensitivity conferral protein) (OSCP) >gi|49641795|emb|CAH01513.1| ATPO_KLULA [Kluyveromyces lactis NRRL Y-1140] (206 aa)
Score = 99, Expect = 1.1e-02, Identities = 35/148 (23%), Positives = 79/148 (53%)
  Q:    31 SSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSIS-NIYLKNFLFVLNDNNFFKRILEIFISFFQKL-DEHQNFLFIRIYSPFVVEKKLLEKIEHLFS----IKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           SS   +  ++  + ++  I+++  +S E++  +++     LSK I+ +  ++N L VL +NN    +LE   S F KL D +   +   + +   ++ KL +++E   +    +  GK ++ EN++   + GG+ +   +   D SI  +I+++
  S:    50 SSLNALKETVAKDTKLTSILENPALSAEDRNIVVDT----LSKKINLDQSVQNLLKVLAENNRLS-LLEHVTSQFSKLTDAYHGLVQATVTTAQPLDSKLFKRVEKALAASSLVGKGKSLKLENVVKPEIQGGLIVEVSDRTVDLSIASRINKL 198
>gi|170694317|ref|ZP_02885471.1| ATP synthase F1, delta subunit [Burkholderia graminis C4D1M] >gi|170140740|gb|EDT08914.1| ATP synthase F1, delta subunit [Burkholderia graminis C4D1M] (179 aa)
Score = 99, Expect = 1.1e-02, Identities = 26/103 (25%), Positives = 53/103 (51%)
  Q:    77 NIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           N   KN + +L DN+  + + EI + F +  +  +    + I S F +E   L  +      K  ++++    ID SLIGG+++  G++V D S++ ++  ++
  S:    72 NAQAKNLVQMLVDNHRLQLLPEIAVQFEELKNAREGAADVLIVSAFPLEGAQLNDLVASLERKFKRKLKPTVEIDSSLIGGVRVTVGDEVLDTSVRARLASMQ 174
>gi|163745697|ref|ZP_02153057.1| ATP synthase F1, delta subunit [Oceanibulbus indolifex HEL-45] >gi|161382515|gb|EDQ06924.1| ATP synthase F1, delta subunit [Oceanibulbus indolifex HEL-45] (188 aa)
Score = 99, Expect = 1.1e-02, Identities = 39/172 (22%), Positives = 89/172 (51%)
  Q:     8 DHYANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFD---LSKSISN----IYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           + YA A+Y +  E ++ + I    +A +   +L ++ +   +I S + +++++ + + K+  D   L+K+++N    +  K  LFVL           +  +  + + E +  +   + S   + K   +K+    +  TGK+V     +D+SLIGG+ +  G+ + D SI+ K++ ++
  S:    15 ERYATAVYDLAREANQVDAIEGDLTALEA--ALNDSDDFRRLISSPLYTRDQQAQAI-KVLADKMGLTKTMANTLALMAQKRRLFVLP---------ALVKALRETIAEAKGEITADVVSAKALTKTQSDKLTKSLNASTGKKVSLHATVDESLIGGLVVKVGSKMIDTSIRSKLNSLQ 181
>gi|121715818|ref|XP_001275518.1| ATP synthase oligomycin sensitivity conferral protein, putative [Aspergillus clavatus NRRL 1] >gi|119403675|gb|EAW14092.1| ATP synthase oligomycin sensitivity conferral protein, putative [Aspergillus clavatus NRRL 1] (227 aa)
Score = 99, Expect = 1.2e-02, Identities = 38/169 (22%), Positives = 84/169 (49%)
  Q:    10 YANALYSIWLE---LDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHL---FSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           YA ALY+   +   LD  +K + + +      + K + ++  +I +  +S  +K +I+ ++   ++ S     LKNFL  L +NN    + +I   F   +  H+  + + I S   ++ K L ++E     + +  G++ +    ++  ++GG+ +  G+   D S+  KI ++
  S:    51 YATALYTASAKSAALDSTSKALASLAQ-----TFKADPKLTDLIAAPTLSVSDKQQIIQELQ-KVAGSDKGDILKNFLQTLAENNRLGLLEDICEKFETLMSAHRGEVEVTITSAQELDNKTLNRLEKAVGKYELGQGQKPKVVTKVNPDILGGLVVEIGDRTIDLSVSSKIAKL 219
>gi|121999211|ref|YP_001003998.1| F0F1 ATP synthase subunit delta [Halorhodospira halophila SL1] >gi|121590616|gb|ABM63196.1| ATP synthase F1, delta subunit [Halorhodospira halophila SL1] (178 aa)
Score = 99, Expect = 1.2e-02, Identities = 25/98 (25%), Positives = 49/98 (50%)
  Q:    81 KNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           +NF+ +L  N   +   E+   + +   E +  + + + S   +E    E++      + G+ VR +  +D+SLIGG  I  G+   D S+KGK+ ++
  S:    75 ENFVRLLASNRRLQYAPEVARVYEELRAEAEGIVDVEVLSATQLEDAQQERLAEALRKRLGREVRLQTRVDESLIGGAMIRAGDTTIDGSVKGKLARL 172
>gi|153093202|gb|EDN74213.1| H(+)-transporting two-sector ATPase, F(1) delta subunit [Mannheimia haemolytica PHL213] (177 aa)
Score = 99, Expect = 1.2e-02, Identities = 37/169 (21%), Positives = 83/169 (49%)
  Q:    10 YANALYSIWLE---LDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           YA A +   LE   L++  +++  S+A      + N+ ++   ++S++ S +     +++ F  +     + Y +NF+ V+ DN     +  +  +F +   E ++   + + S   +      KI +    + G +VR  + ID SLI G+ I + + V D S +G+++++
  S:    11 YAKAAFDFALEQGQLEQWQQMLTFSAA------VANDEQVASFLNSSLASGQ-----ISETFIKICGEQLDQYGQNFIRVMADNKRLAVLPAVLNAFLELRAEQESIKDVEVVSADKLTDAQEAKIANAMEKRLGTKVRITSSIDSSLIAGVIIRYDDVVIDGSSRGQLNRL 171
>gi|153885486|ref|ZP_02006643.1| ATP synthase F1, delta subunit [Ralstonia pickettii 12D] >gi|151578386|gb|EDN42785.1| ATP synthase F1, delta subunit [Ralstonia pickettii 12D] (178 aa)
Score = 99, Expect = 1.2e-02, Identities = 29/113 (25%), Positives = 54/113 (47%)
  Q:    67 IFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           IF    KS  +   K  + +L  N     + EI   F    +  +    + I S F +E   L ++      K GK+++    +D SLIGG+++  G++V D S++ ++ Q++
  S:    60 IFLSALKSPVSHEAKELVGLLVANKRLSLLPEIAAQFHVLRNASEGAADVEITSAFPLEGAPLTELVATLERKFGKKLQAHVSVDPSLIGGVRVQIGDEVLDTSVRARLTQMQ 172
>gi|86145159|ref|ZP_01063490.1| hypothetical ATP synthase F1, delta subunit [Vibrio sp. MED222] >gi|85836736|gb|EAQ54856.1| hypothetical ATP synthase F1, delta subunit [Vibrio sp. MED222] (183 aa)
Score = 99, Expect = 1.2e-02, Identities = 40/178 (22%), Positives = 81/178 (45%)
  Q:     1 MEEKNHIDH-YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           M +  +I H YA A +   L    +NK+    S   I  ++     +   I S      ++++ L  +   + + + + ++ N + VL +N     I ++F  F    DEH+  + + + S  ++ +  +  +      K  ++V  E +ID SL+GG+ I  G  V D S+   I+++
  S:     1 MSDYTNIAHPYAKASFDFAL---GENKLQEWHSMLSILVTVAEEETIAKQISSAEGVHTQQSEELVNLIIHVCQGLVDDHVINLIKVLAENGRLAVIRDLFNLFSDLKDEHERVIPVTVTSSELLTQDQVTSLTAALEKKLERQVEMEQVIDDSLVGGIVIKAGETVIDGSLNTSINRL 176
>gi|78188051|ref|YP_378389.1| F0F1 ATP synthase subunit delta [Chlorobium chlorochromatii CaD3] >gi|78170250|gb|ABB27346.1| H+-transporting two-sector ATPase, delta (OSCP) subunit [Chlorobium chlorochromatii CaD3] (179 aa)
Score = 99, Expect = 1.3e-02, Identities = 38/170 (22%), Positives = 83/170 (48%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           YANAL S+  E +  +K +   +A  I   L ++ ++VH + S +IS ++K  I+ ++F    K   +  +  FL ++   N    +  I   F   LDE +  + + I S   +  +   ++    +  +GK+VR    +++ LI G  +   + + D +++ ++ +++
  S:    10 YANALLSVVEESNTIDKTLDEMNA--ISEVLHHSRDLVHALKSPLISYDKKIHIVEEVF----KGRVSETVMFFLKLVGKKNRLGHLPHIVDEFKNLLDEDRGIINVDITSAVELSDEQANELVATIANMSGKQVRATLTVNEELIAGAAVKIADTIIDGTVRHQLSKLR 173
>gi|83746951|ref|ZP_00943997.1| ATP synthase delta chain [Ralstonia solanacearum UW551] >gi|83726371|gb|EAP73503.1| ATP synthase delta chain [Ralstonia solanacearum UW551] (178 aa)
Score = 99, Expect = 1.3e-02, Identities = 29/113 (25%), Positives = 54/113 (47%)
  Q:    67 IFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           IF    KS  +   K  + +L  N     + EI   F    +  +    + I S F +E   L ++      K GK+++    +D SLIGG+++  G++V D S++ ++ Q++
  S:    60 IFLSALKSPVSHEAKELVGLLVANKRLSLLPEIAAQFHVLRNASEGAADVEITSAFPLEGAPLTELVATLERKFGKKLQPHVTVDPSLIGGVRVQVGDEVLDTSVRARLTQMQ 172
>gi|126131682|ref|XP_001382366.1| F1F0-ATPase subunit [Pichia stipitis CBS 6054] >gi|126094191|gb|ABN64337.1| F1F0-ATPase subunit [Pichia stipitis CBS 6054] (205 aa)
Score = 99, Expect = 1.3e-02, Identities = 42/174 (24%), Positives = 88/174 (50%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKL----DEHQNFLFIRIYSPFVVEKKLLEKIEHLFS----IKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIE 183
           YANALYS  ++ D   +  F S  K I   ++++ ++   + +  ++K ++  ++  I   L    +     NFL VL  NN     L IF S ++K     D H   +  ++ S   ++ K+L++++   S    +  GK ++  N ++  ++GG+ +  G    D S++ K+ ++   ++
  S:    30 YANALYSASVQ-DSSVEASFQSLTK-INNLIQSDSKVAEFLANPAVNKADRDSVVKVIESTLKLDKTT---GNFLSVLAQNNR----LTIFKSIYEKFSLLNDAHNGLVEAKVTSAKPLDSKILKRLQTSISKSALVGEGKTLKLTNNVNPEILGGLVVEVGEQTVDLSVQSKVSKLNQTLK 202
>gi|85713715|ref|ZP_01044705.1| H+-transporting two-sector ATPase, delta (OSCP) subunit [Nitrobacter sp. Nb-311A] >gi|85699619|gb|EAQ37486.1| H+-transporting two-sector ATPase, delta (OSCP) subunit [Nitrobacter sp. Nb-311A] (191 aa)
Score = 99, Expect = 1.3e-02, Identities = 42/170 (24%), Positives = 78/170 (45%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFS--LKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           YA AL+    EL ++ K I    A    F   L ++ E+V ++ S + S + + K L  +   L+K+       NFL VL  N     + ++  +F   +   +      +     +  K L+ ++      TGK +     +D S+IGG+ +  G+ + D S++ K++ IK
  S:    20 YATALF----ELAREEKSIDAVRADLDKFDAMLADSPELVRLVRSPVFSADTQGKALAAV---LNKAGIGGTTANFLKVLATNRRLFAVADVIRAFRALVARFKGEAAAEVTVAETLNDKNLDALKTALKSVTGKDITLNVKVDPSIIGGLVVKLGSRMVDTSLRTKLNSIK 184
>gi|399081|sp|Q02849|ATPD_ANTSP ATP synthase delta chain, chloroplast >gi|14176|emb|CAA44983.1| atpD [Antithamnion sp.] (183 aa)
Score = 99, Expect = 1.3e-02, Identities = 43/176 (24%), Positives = 86/176 (48%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPF-VVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIENN 185
           YA+AL  + L  +  +K   +S    I   +  + ++   + + ++    K  +LN++F D    +S+  +K FL VL D      +  I   +F  + + ++ +   + +   + E++ +  I  +  +  GK V+    ID++LIGG  +  G+ V D S+ GK+ QI + +E N
  S:    13 YADALLELSLLNNAMDKA--SSDLSMILEVISKSADLKLFLSNPLVEDNLKKNVLNQLFKD---KVSDFIVK-FLMVLVDRRRISMLHLIIDKYFSLVYKTESTILTEVITAIDLTEEQEIALINKIKVMTKGKNVKLITTIDQTLIGGFIVRIGSKVIDASLSGKLKQIAFYLETN 183
>gi|16080737|ref|NP_391565.1| F0F1 ATP synthase subunit delta [Bacillus subtilis subsp. subtilis str. 168] >gi|584811|sp|P37811|ATPD_BACSU ATP synthase delta chain >gi|433988|emb|CAA82257.1| ATP synthase subunit delta [Bacillus subtilis] >gi|2636209|emb|CAB15701.1| ATP synthase (subunit delta) [Bacillus subtilis subsp. subtilis str. 168] (181 aa)
Score = 99, Expect = 1.4e-02, Identities = 39/170 (22%), Positives = 80/170 (47%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTG-KRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           YA+AL+ I  E  + N++        +    +N   +  +++   +   +K +++   F  LS+S+ N      +F+L D +    + E+   F +  +  +      +YS   +    +  +  +F+ K G   +R  N +   LIGG+K+  GN +YD S+ GK+ +I+
  S:    10 YASALFDIANESAQLNQV--EEELIVVKQVFQNEKALNDVLNHPKVPAAKKKELIQNAFGSLSQSVLNT-----IFLLIDRHRAAIVPELTDEFIKLANVARQTEDAIVYSVKPLTDAEMLPLSQVFAKKAGVASLRIRNEVQTDLIGGIKVRIGNRIYDGSVSGKLQRIE 173
>gi|187930580|ref|YP_001901067.1| ATP synthase F1, delta subunit [Ralstonia pickettii 12J] >gi|187727470|gb|ACD28635.1| ATP synthase F1, delta subunit [Ralstonia pickettii 12J] (178 aa)
Score = 99, Expect = 1.4e-02, Identities = 29/113 (25%), Positives = 54/113 (47%)
  Q:    67 IFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           IF    KS  +   K  + +L  N     + EI   F    +  +    + I S F +E   L ++      K GK+++    +D SLIGG+++  G++V D S++ ++ Q++
  S:    60 IFLSALKSPVSHEAKELVGLLVANKRLTLLPEIAAQFHVLRNASEGAADVEITSAFPLEGAPLTELVATLERKFGKKLQAHVSVDPSLIGGVRVQIGDEVLDTSVRARLTQMQ 172
>gi|89092250|ref|ZP_01165204.1| ATP synthase F1, delta subunit [Oceanospirillum sp. MED92] >gi|89083338|gb|EAR62556.1| ATP synthase F1, delta subunit [Oceanospirillum sp. MED92] (177 aa)
Score = 99, Expect = 1.4e-02, Identities = 26/98 (26%), Positives = 50/98 (51%)
  Q:    81 KNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           KNFL +L +N     + EI   F +   + +  L I + + F ++ +  EK+      K G+ V   + +DKS++GG  I   + V D S++ ++ ++
  S:    74 KNFLRLLAENKRLAILPEINTQFAKLKADQEKSLDIEVTTAFELQDEQQEKLAQALKTKLGREVILSSQVDKSILGGAVIRTDDLVIDGSVRARLAKL 171
>gi|187925866|ref|YP_001897508.1| ATP synthase F1, delta subunit [Burkholderia phytofirmans PsJN] >gi|187717060|gb|ACD18284.1| ATP synthase F1, delta subunit [Burkholderia phytofirmans PsJN] (179 aa)
Score = 99, Expect = 1.5e-02, Identities = 26/103 (25%), Positives = 53/103 (51%)
  Q:    77 NIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           N   KN + +L DN+  + + EI + F +  +  +    + I S F +E   L  +      K  ++++    ID SLIGG+++  G++V D S++ ++  ++
  S:    72 NAQAKNLVQMLVDNHRLQLLPEIAVQFEELKNAREGAADVLIVSAFPLEGAQLNDLVASLERKFKRKLKPTVEIDPSLIGGVRVTVGDEVLDTSVRARLASMQ 174
>gi|83952822|ref|ZP_00961552.1| ATP synthase delta chain [Roseovarius nubinhibens ISM] >gi|83835957|gb|EAP75256.1| ATP synthase delta chain [Roseovarius nubinhibens ISM] (186 aa)
Score = 98, Expect = 1.5e-02, Identities = 33/141 (23%), Positives = 70/141 (49%)
  Q:    39 SLKNNYEMVHIIDSNIISKEEKTKILN------KIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           +L+ + ++  +I S +IS+ E+   +       K+  +LS+ ++ +  K  LF L          ++  S    L EH+  +   + S   + K   +K+        GK V+    +D+SLIGG+ +  G+ + D SI+ +++ ++
  S:    42 ALETSADLRAMIASPVISRAEQGAAIAALAKKMKLPAELSQGLALMAEKRRLFTLP---------QLVKSLRAMLAEHKGEVTAEVTSAKALTKTQADKLAKTLKSSVGKDVKINATVDESLIGGLVVKMGSKMIDTSIRSRLNSLQ 179
>gi|84385788|ref|ZP_00988818.1| hypothetical ATP synthase F1, delta subunit [Vibrio splendidus 12B01] >gi|84379104|gb|EAP95957.1| hypothetical ATP synthase F1, delta subunit [Vibrio splendidus 12B01] (183 aa)
Score = 98, Expect = 1.5e-02, Identities = 40/178 (22%), Positives = 80/178 (44%)
  Q:     1 MEEKNHIDH-YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           M +  +I H YA A +   L    +NK+    S   I  ++     +   I S      ++++ L  +   + + + + ++ N + VL +N     I ++F  F    DEH+  + + + S  ++ +  +  +      K  ++V  E +ID SL+GG+ I  G  V D S+   I ++
  S:     1 MSDYTNIAHPYAKASFDFAL---GENKLQEWHSMLSILVTVAEEETIAKQISSAEGVHTQQSEELVNLIIHVCQGLVDDHVINLIKVLAENGRLAVIRDLFNLFSDLKDEHERVIPVTVTSSELLTQDQVTSLTAALEKKLERQVEMEQVIDDSLVGGIVIKAGETVIDGSLNTSISRL 176
>gi|15600750|ref|NP_254244.1| F0F1 ATP synthase subunit delta [Pseudomonas aeruginosa PAO1] >gi|116053708|ref|YP_794035.1| F0F1 ATP synthase subunit delta [Pseudomonas aeruginosa UCBPP-PA14] >gi|152985958|ref|YP_001351670.1| F0F1 ATP synthase subunit delta [Pseudomonas aeruginosa PA7] >gi|194548752|ref|YP_002083780.1| ATP synthase delta chain [Pseudomonas aeruginosa C3719] >gi|81621971|sp|Q9HT17|ATPD_PSEAE ATP synthase delta chain >gi|9951897|gb|AAG08942.1|AE004967_13 ATP synthase delta chain [Pseudomonas aeruginosa PAO1] >gi|115588929|gb|ABJ14944.1| ATP synthase delta chain [Pseudomonas aeruginosa UCBPP-PA14] >gi|126169698|gb|EAZ55209.1| ATP synthase delta chain [Pseudomonas aeruginosa C3719] >gi|150961116|gb|ABR83141.1| ATP synthase F1, delta subunit [Pseudomonas aeruginosa PA7] (178 aa)
Score = 98, Expect = 1.5e-02, Identities = 26/98 (26%), Positives = 50/98 (51%)
  Q:    81 KNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           +NF+  + +N   + +  I   + Q   E +  + + + S F + K+  +K+    S +  + VR     D SLIGG+ I  G+ V D S++GK+ ++
  S:    75 QNFVRTVAENKRLELLPTIAEMYEQLKAEQEKSVEVEVTSAFTLSKEQQDKLAKALSARLSREVRLHASEDASLIGGVIIRAGDLVIDGSVRGKLAKL 172
>gi|170782292|ref|YP_001710625.1| ATP synthase delta chain [Clavibacter michiganensis subsp. sepedonicus] >gi|169156861|emb|CAQ02029.1| ATP synthase delta chain [Clavibacter michiganensis subsp. sepedonicus] (263 aa)
Score = 98, Expect = 1.5e-02, Identities = 16/64 (25%), Positives = 37/64 (57%)
  Q:   116 IRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           + + SP   E+   E++    S +  +R+    ++D+ L+GG+++  G+DV D S+  +I+ ++
  S:   198 VSVASPLSPEQS--ERLAQALSRRYSRRIELNQVVDRDLVGGLRVQIGDDVIDGSVATRINDLR 259
>gi|148272346|ref|YP_001221907.1| F0F1 ATP synthase subunit delta [Clavibacter michiganensis subsp. michiganensis NCPPB 382] >gi|147830276|emb|CAN01210.1| ATP synthase delta chain [Clavibacter michiganensis subsp. michiganensis NCPPB 382] (263 aa)
Score = 98, Expect = 1.5e-02, Identities = 16/64 (25%), Positives = 37/64 (57%)
  Q:   116 IRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           + + SP   E+   E++    S +  +R+    ++D+ L+GG+++  G+DV D S+  +I+ ++
  S:   198 VSVASPLSPEQS--ERLAQALSRRYSRRIELNQVVDRDLVGGLRVQIGDDVIDGSVATRINDLR 259
>gi|170092525|ref|XP_001877484.1| predicted protein [Laccaria bicolor S238N-H82] >gi|164647343|gb|EDR11587.1| predicted protein [Laccaria bicolor S238N-H82] (213 aa)
Score = 98, Expect = 1.5e-02, Identities = 31/140 (22%), Positives = 73/140 (52%)
  Q:    39 SLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLS------KSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLF----SIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           S+K   E+   + +  +S +E+ K L  +F  L       + +S I  KN L VL++N        +   F + + +++  L + + S   + K +L ++E       + +  K ++  N ++ +++GG+ + FG+   D S++ ++ ++
  S:    57 SIKTRPEVDGFVHNPTLSLQERKKGLESLFSKLEGTGPKKEQVSEI-TKNLLSVLSENGRLGETQAVIEGFNELVSQYKGELTVTVTSATPLTKDVLTRLETTLKQSQTAQAAKVLKITNKVNPAVLGGLIVDFGDKTIDLSVQSRVTKL 205
>gi|171689348|ref|XP_001909614.1| unnamed protein product [Podospora anserina] >gi|170944636|emb|CAP70747.1| unnamed protein product [Podospora anserina] (225 aa)
Score = 98, Expect = 1.6e-02, Identities = 39/169 (23%), Positives = 86/169 (50%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKN----NYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFS----IKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           YA ALY+  ++           +AK +  SL N    + ++V I+++  +S  +K+ I++++    S  +S   +KN L  L +NN    +  +   F + +   +  + + + S   ++ K L ++E   S    +  GK+++ +N ++  +IGG+ +  G    D S+  K+ ++
  S:    49 YATALYTAAVKTSS-----LEPTAKGVT-SLANLLAKDPKLVGILEAPTLSAADKSAIVSEL--TKSAGVSGETVKNLLAALAENNRLGLLPGVCAKFGELMSAARGEVEMVVTSAQPLDNKTLNRLESAVSKSSYVGEGKKLKVKNQVNPDIIGGLIVEVGERTIDLSVSAKLAKM 217
>gi|80096|pir||S17723 H+-transporting two-sector ATPase (EC 3.6.3.14) delta chain - Bacillus firmus (182 aa)
Score = 98, Expect = 1.6e-02, Identities = 32/135 (23%), Positives = 71/135 (52%)
  Q:    45 EMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGK-RVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           E + ++    ++ E+K   +   F D   S+S   L   L ++ +N   + ++++  SF +   E Q+     +YS   +  +   +I  +F+ K  K ++   N+++K L+GG+KI  G+ +YD  +K ++D+++
  S:    43 EFLQLLSHPKVTTEKKRAFIENSFKD---SLSETSLHTLLLLV-ENKRIESLVDMIDSFKEMSYEAQDMAEAVVYSAKPLTSEEQAQIAVIFAKKVNKAKLLVINVVNKDLLGGLKIRIGDRIYDGRVKSQLDRLE 174
>gi|149202400|ref|ZP_01879373.1| ATP synthase F1, delta subunit [Roseovarius sp. TM1035] >gi|149144498|gb|EDM32529.1| ATP synthase F1, delta subunit [Roseovarius sp. TM1035] (218 aa)
Score = 98, Expect = 1.6e-02, Identities = 37/170 (21%), Positives = 82/170 (48%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILN------KIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           YA A++ +  E     K+   S+  D+  +L ++ ++  +I S ++S++ +   ++      K+  +L   ++ +  K  LFVL          ++       + E +  +   + S   + K   +K+      + GK V+    +D+SLIGG+ +  G+ + D SI+ K+D ++
  S:    47 YATAIFELVREAKGLAKL--ESNLTDLAQALNDSDDLRAMIASPVLSRDVQGAAMSAVAAKMKLLPELQNGLALMGQKRRLFVLP---------QLITQLNAMIAEDKGEVSADVTSAKALTKAQSDKLAKALKARVGKDVKINATVDESLIGGLVVKMGSKMIDTSIRSKLDSLQ 211
>gi|115926312|ref|XP_001178536.1| PREDICTED: similar to LOC446923 protein [Strongylocentrotus purpuratus] (209 aa)
Score = 98, Expect = 1.6e-02, Identities = 36/166 (21%), Positives = 83/166 (50%)
  Q:    10 YANALYSIWLE---LDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFS--IKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKI 175
           YA ALYS   +   LD+ +K +   S + +   +K +  +   + +  I+K+ K  +++ +      + S +   NF  +L +N    ++ EIF+++ + +  H+  +  ++ +   ++    ++++      IK G+ ++    +D +LIGGM +  G+   D S   K+
  S:    36 YATALYSAASKQKTLDQVDKDM--GSVQSL---MKQSAVLSDFMKNPTINKKAKISVISDVLKGEKMADSTV---NFFGMLAENGRLNKVKEIFVAWTKIMAAHKGEIICKVTTAKTLDASQQKQVQEALKAFIKKGESLQLNLTVDPTLIGGMIVEVGDKYVDMSTASKV 198
>gi|187933038|ref|YP_001884708.1| ATP synthase F1, delta subunit [Clostridium botulinum B str. Eklund 17B] >gi|188590336|ref|YP_001919895.1| ATP synthase F1, delta subunit [Clostridium botulinum E3 str. Alaska E43] >gi|187721191|gb|ACD22412.1| ATP synthase F1, delta subunit [Clostridium botulinum B str. Eklund 17B] >gi|188500617|gb|ACD53753.1| ATP synthase F1, delta subunit [Clostridium botulinum E3 str. Alaska E43] (179 aa)
Score = 98, Expect = 1.6e-02, Identities = 47/170 (27%), Positives = 89/170 (52%)
  Q:    10 YANALYSIWLELDKKNKII-FTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLD-EHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           YA ALY +    +KK K+  +    ++I   ++NN+E   +I    IS ++K K    IF    K   +  L +FL +L + +    + E  ++  +K+D E +N L   I +   +     + +  +F  K  K + +E  +D++L+GG+ +  G+DV D ++K KI+++K
  S:     9 YALALYQV---AEKKGKVDEYLQDLREICELIENNHEFYEVIKHPQISTKKKKKTFISIF----KDKIDEELLSFLLILIEKDRILYLREK-LNEMEKIDLERKNTLKGIIKTAIPLLSNEFDNLRDIFQKKYDKNILFETEVDRNLLGGVYVRVGHDVIDDTVKSKIEEMK 172
>gi|90415391|ref|ZP_01223325.1| ATP synthase subunit D [marine gamma proteobacterium HTCC2207] >gi|90332714|gb|EAS47884.1| ATP synthase subunit D [marine gamma proteobacterium HTCC2207] (178 aa)
Score = 98, Expect = 1.7e-02, Identities = 34/140 (24%), Positives = 72/140 (51%)
  Q:    39 SLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLD----EHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           S+     +V ++ S  ++ E++ + L +I  D      N   KNFL +L++N    R L++     Q+ D      +  + + + +   ++ +  +K+    S K  ++V  +  +DK+L+GG  I  G+ V D SI+G++ ++
  S:    37 SVAQQSNVVRLLASPSVTAEQQAQALIEICGD----ALNDQGKNFLTILSEN----RRLQLLPDISQQFDVLKANREKAVDVEVTAAHELDAEQQQKLSDALSTKLERKVNMQVRLDKNLLGGAVIRAGDTVIDGSIRGRLAKL 172
>gi|170098|gb|AAA34024.1| ATP synthase delta subunit precursor >gi|226262|prf||1503275A ATP synthase delta (257 aa)
Score = 98, Expect = 1.7e-02, Identities = 39/130 (30%), Positives = 68/130 (52%)
  Q:    54 IISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDN---NFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTG-KRVRYENIIDKSLIGGMKIMFGND---VYDYSIKGKIDQIKWNIE 183
           +IS + K  +L++I   ++ S    +  NF+ +L D+   N  K IL  F   F K+   +  +   + S   +E   L +I       TG K VR + +ID SL+ G  I +GN+   + D S+K ++++I   +E
  S:   119 VISIDNKRSVLDEI---ITTSGLQPHTANFINILIDSERINLVKEILNEFEDVFNKITGTEVAV---VTSVVKLENDHLAQIAKGVQKITGAKNVRIKTVIDPSLVAGFTIRYGNEGSKLVDMSVKKQLEEIAAQLE 249
>gi|126736543|ref|ZP_01752283.1| ATP synthase F1, delta subunit [Roseobacter sp. CCS2] >gi|126713856|gb|EBA10727.1| ATP synthase F1, delta subunit [Roseobacter sp. CCS2] (186 aa)
Score = 98, Expect = 1.8e-02, Identities = 40/170 (23%), Positives = 80/170 (47%)
  Q:    10 YANALYSIWLELDKKNKII--FTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIF--FDLSKSISNIYL----KNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           YA A++    EL ++ K I    S    +  ++  + ++  ++ S + S+EE++  +  I     LS + SN+      K  LFVL          ++       L E +  +   + +   + K   EK+      + GK V  +  +D+S+IGG+ +  G+ + D SI  K++ ++
  S:    15 YATAVF----ELAREGKAIKALESDVATLEAAMAESADLRTLLTSPLYSREEQSGAITAIAKKMKLSDTTSNVLALLASKRRLFVLP---------QLLAVLQDMLAEERGEVTAEVTTAKALTKAQTEKLSKTLKAQVGKSVTIKETVDESIIGGLIVKVGSKMIDTSIASKLNALQ 179
>gi|167748911|ref|ZP_02421038.1| hypothetical protein ANACAC_03685 [Anaerostipes caccae DSM 14662] >gi|167651533|gb|EDR95662.1| hypothetical protein ANACAC_03685 [Anaerostipes caccae DSM 14662] (167 aa)
Score = 98, Expect = 1.8e-02, Identities = 38/135 (28%), Positives = 68/135 (50%)
  Q:    45 EMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISF---FQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKR-VRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           E V  + S +++K+EK  ++ ++     +S        F  V+ DN     I EIF S+    Q+ ++    +F  +  P   + + +E I+++   K  K  V  +   D SLIGG  +  G+DVYD S+K  I +++
  S:    34 EFVKALASPVVTKKEKHAVIERVIPGPVQS--------FFKVVTDNGEADSIFEIFASYDELVQRKNKVVKAVFAYVTKP---DDRKIEDIKNMICRKYHKTGVNLQLKEDPSLIGGFILTVGDDVYDRSVKASITKLQ 161
>gi|168042585|ref|XP_001773768.1| predicted protein [Physcomitrella patens subsp. patens] >gi|162674883|gb|EDQ61385.1| predicted protein [Physcomitrella patens subsp. patens] (224 aa)
Score = 98, Expect = 1.9e-02, Identities = 32/125 (25%), Positives = 63/125 (50%)
  Q:    55 ISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFS--IKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           +SK  + K + +IF    ++  +   KNFL VL +N    ++  I   + + L  H+  +   + +   +    LE I++     +K G+ ++ E  +D+S+IGG+ +   +   D SI  KI Q++
  S:    94 VSKTMRMKAMEEIF---GQTKFSDVTKNFLAVLAENGRLSQLQRISGCYSELLHAHRGEVQALVTAALELSPAELEDIKNALRGYLKPGQTLKVEQKVDRSIIGGIVVDIQDKHIDLSIDTKIKQME 217
>gi|71891798|ref|YP_277527.1| ATP synthase, F1 sector, delta-subunit [Candidatus Blochmannia pennsylvanicus str. BPEN] >gi|71795904|gb|AAZ40655.1| ATP synthase, F1 sector, delta-subunit [Candidatus Blochmannia pennsylvanicus str. BPEN] (181 aa)
Score = 97, Expect = 1.9e-02, Identities = 40/166 (24%), Positives = 78/166 (46%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKI 175
           YA A++ I +E    NK     S  D++  +  N  +V  +    +  +  + I   I  D  K   + + KN ++++ +NN    +  +F  F      + + + I I S + ++   L+KI  + + +  K V   + +DK ++ G+ I  G+ V D SI+G+I
  S:    11 YAQAIFDIAVEQKNINK---WKSVLDLFSEISLN-RLVQSLFFRCLEPKRLSDIFIAICEDYQKKQVDTFSKNIIYIMAENNRLLLLPIVFKEFTYLCSIYVHTVEIEIISAWPLKYNQLKKITDIMAKRLSKTVNPVHKVDKDILAGVIIRIGDTVIDGSIRGRI 172
>gi|108804477|ref|YP_644414.1| ATP synthase F1, delta subunit [Rubrobacter xylanophilus DSM 9941] >gi|108765720|gb|ABG04602.1| ATP synthase F1, delta subunit [Rubrobacter xylanophilus DSM 9941] (179 aa)
Score = 97, Expect = 2.0e-02, Identities = 34/173 (19%), Positives = 84/173 (48%)
  Q:     7 IDHYANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKI-EHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           +  YA AL+    E D+  +++     ++   +L+ + E+        I + EK + +      L++ +S +   NFL VL DN   + + ++   + + +++H   + + + +   +  ++ E+I E +  +  G+ V     +D  ++GG    F + + D SI+G+++ ++
  S:     4 VSTYAEALFGAAREKDELERVL--DDLREFCRALRESEELALFFYGEQIPEREKRRAIEA----LTEGMSPL-TTNFLKVLCDNRREEILEDVLRRYEEMVEDHLGRIEVEVVTATELSGEMQERIRERIARVLGGREVILRTSVDPEILGGAVFRFKDRLVDSSIRGRLEGLR 170
>gi|23100433|ref|NP_693900.1| F0F1 ATP synthase subunit delta [Oceanobacillus iheyensis HTE831] >gi|22778666|dbj|BAC14934.1| H(+)-transporting ATP synthase delta chain [Oceanobacillus iheyensis HTE831] (181 aa)
Score = 97, Expect = 2.0e-02, Identities = 39/173 (22%), Positives = 83/173 (47%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKR-VRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNI 182
           YA+AL+ +  E +  ++++  +   ++     N+ ++   +    I  E+K + L  +F      + N      L +L D +    I  I       +++ +      +YS   +     E+++  F+ + GKR V+  N++D  ++GGMKI  GN +YD ++  K+++I  +I
  S:    10 YADALFQLGREKNSLDQLV--ADFLEVRQIFTNDQKLNVFLKHPKIDNEKKKQFLADVFKGADPVVINT-----LKLLVDRHRTSTIPSIVDHLVALVNDTKGIADATVYSIRELNTDEKEQLQTSFAKRLGKRSVQITNVVDPKILGGMKIRVGNTIYDGTVSNKLNRISRSI 176
>gi|15828740|ref|NP_326100.1| ATP synthase delta chain [Mycoplasma pulmonis UAB CTIP] >gi|17366625|sp|Q98QU2|ATPD_MYCPU ATP synthase delta chain >gi|14089682|emb|CAC13442.1| ATP SYNTHASE DELTA CHAIN [Mycoplasma pulmonis] (179 aa)
Score = 97, Expect = 2.1e-02, Identities = 51/183 (27%), Positives = 87/183 (47%)
  Q:     1 MEEKNHIDHYANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIE 183
           M + +++   A AL  I  E  +K + +F +    I      N E+V  + S  I  E K K + +IF DL + +    + NFL +  ++N  K +  IF+     +++  N     IY+   +  K L +IE   S+   K V+  N+IDK LI G +I  G+     ++   IDQ+  +I+
  S:     1 MIDNHYVQSSAKALSQIAFE--EKKEKLFLNQLFIIKNIFSYNPEVVEYLASGSIKLENKKKFIEEIF-DLIEPL----ILNFLLMAVEDNKIKYLDNIFLKAILTINKKLNIENGIIYTTLKLSDKKLLEIEKKLSVFLKKEVKLLNLIDKELISGYEIQVGDFKQRNNVASWIDQMALSIK 176
>gi|3273480|gb|AAC64903.1| oligomycin sensitivity conferring protein [Kluyveromyces lactis] (206 aa)
Score = 97, Expect = 2.2e-02, Identities = 35/148 (23%), Positives = 79/148 (53%)
  Q:    31 SSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSIS-NIYLKNFLFVLNDNNFFKRILEIFISFFQKL-DEHQNFLFIRIYSPFVVEKKLLEKIEHLFS----IKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           SS   +  ++  + ++  I+++  +S E++  +++     LSK I+ +  ++N L VL +NN    +LE   S F KL D +   +   + +   ++ KL +++E   +    +  GK ++ EN++   + GG+ +   +   D SI  +I+++
  S:    50 SSLNALKETVVKDTKLTSILENPALSAEDRNIVVDT----LSKKINLDQSVQNLLKVLAENNRLS-LLEHVTSQFSKLTDAYHGLVQATVTTAQPLDSKLFKRVEKALAASSLVGKGKSLKLENVVKPEIQGGLIVEVSDRTVDLSIASRINKL 198
>gi|32476314|ref|NP_869308.1| ATP synthase delta chain [Rhodopirellula baltica SH 1] >gi|32446859|emb|CAD78765.1| probable ATP synthase delta chain [Rhodopirellula baltica SH 1] (227 aa)
Score = 97, Expect = 2.2e-02, Identities = 30/140 (21%), Positives = 65/140 (46%)
  Q:    39 SLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           +L +N ++     S  I  +EK ++++++F       S+  L   + V+        ++ +  +     DE    +   + +   + ++L  ++    S + GK VR    +D  LIGGM I  G+ V+D S+  ++D++
  S:    69 ALLHNPKLQLAFQSPQIDADEKCRVVDRLF----GGNSHPTLIKLMKVMAKRGRLGYLVAVRDAAVDLFDEAAGRVVAEVRTAVPMTEQLRGEVTQQLSSRFGKTVRLRESVDTELIGGMVIRVGDTVFDSSVASRLDKL 204
>gi|27904518|ref|NP_777644.1| ATP synthase delta chain [Buchnera aphidicola str. Bp (Baizongia pistaciae)] >gi|38372226|sp|Q89B42|ATPD_BUCBP ATP synthase delta chain >gi|27903915|gb|AAO26749.1| ATP synthase delta chain [Buchnera aphidicola str. Bp (Baizongia pistaciae)] (178 aa)
Score = 97, Expect = 2.2e-02, Identities = 31/129 (24%), Positives = 67/129 (51%)
  Q:    50 IDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           I  N+ISK   ++ +  +F DL  +  N Y  N + +L +N     + +++  F    + +Q  + I + S   + ++ + KI  +   +  K++    +ID+S+IGG+ I F + V + SI  +++++
  S:    44 IIKNLISKAYFSQHVISLFIDLCCNKVNQYGINLIKILAENKRLMLLEKLYKEFINLCELYQGVVNITVISAHKLNEEYISKINIMLKKRFFKKINVTYVIDESIIGGLIIKFCDTVINASIHSRLEKL 172
>gi|134300984|ref|YP_001114480.1| F0F1 ATP synthase subunit delta [Desulfotomaculum reducens MI-1] >gi|134053684|gb|ABO51655.1| ATP synthase F1, delta subunit [Desulfotomaculum reducens MI-1] (181 aa)
Score = 97, Expect = 2.2e-02, Identities = 45/170 (26%), Positives = 78/170 (45%)
  Q:    10 YANALYSIWLELDKKNKI-IFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           YA ALY I  E   KN +       K +  +++   E+  ++    +   EK  +L  +F D    +S+  L NFL ++ D      I  I   F    +E +  +   + +   +++K  +++  + S   GK V     +D SLIGG+ +  G+ V D SIK ++  IK
  S:    10 YAQALYEIAQE---KNALEAMEQELKGVAEAIEGTRELQKVLYHPQVLPGEKKNLLKALFTD---KVSDETL-NFLGLVVDKRRENYIAGIAAEFSVLANEARGKVAAEVTTAIEIDEKQKQELVKVASRMAGKEVEPTFGVDPSLIGGVVVRIGSKVIDGSIKTRLATIK 173
>gi|12045264|ref|NP_073075.1| F0F1 ATP synthase subunit delta [Mycoplasma genitalium G37] >gi|66880522|ref|ZP_00405503.1| COG0712: F0F1-type ATP synthase, delta subunit (mitochondrial oligomycin sensitivity protein) [Mycoplasma genitalium G-37] >gi|1352035|sp|P47642|ATPD_MYCGE ATP synthase delta chain >gi|3844994|gb|AAC71630.1| ATP synthase F1, delta subunit [Mycoplasma genitalium G37] >gi|166078726|gb|ABY79344.1| ATP synthase F1, delta subunit [synthetic Mycoplasma genitalium JCVI-1.0] (176 aa)
Score = 97, Expect = 2.3e-02, Identities = 29/130 (22%), Positives = 72/130 (55%)
  Q:    49 IIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           +++S  ++K +K ++++K+F         +++ +FL V+    +F  + +    FF  ++  ++  FI+I + F +  K L KI  +   +   +V Y+  ID+SLI G++I   + +++ +++ ++ +I
  S:    46 LLNSYTLTKPDKIRLVDKLF---KNHFCQVFV-DFLKVIILKGYFTLVEQAIKYFFDNVESQKHIQFIKIITAFELSSKQLNKIIAIMEKRFKTKVVYKTEIDRSLISGIRIESSSHLFEKNVRDELKRI 171
>gi|46579191|ref|YP_009999.1| F0F1 ATP synthase subunit delta [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] >gi|120603235|ref|YP_967635.1| F0F1 ATP synthase subunit delta [Desulfovibrio vulgaris subsp. vulgaris DP4] >gi|46448604|gb|AAS95258.1| ATP synthase, F1 delta subunit [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] >gi|120563464|gb|ABM29208.1| ATP synthase F1, delta subunit [Desulfovibrio vulgaris subsp. vulgaris DP4] (183 aa)
Score = 97, Expect = 2.3e-02, Identities = 32/174 (18%), Positives = 82/174 (47%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIE 183
           YA AL+++  +    +   F +    +  +L+   E+V +  + + + +EK  ++ K+   L    +   ++NF  +L D      I +I   +   LD  +  +   + +   +     +K++     + G+++     +DK+++GG+ +  G+ + D S++ ++  +K NI+
  S:    10 YARALFALGKKSGLSDLETFGNDLAALAGTLETAPELVRMFRNPVFTPDEKRNVIAKLLDKLKVCPT---VRNFCLLLADRERLAFIQDIQAYYGILLDAEKGVIRGELVTAIELANAKRDKVKAQLEAQAGRKLELGFSVDKNILGGVVLKVGDRILDASLRAQLGILKDNIK 180
>gi|91975036|ref|YP_567695.1| F0F1 ATP synthase subunit delta [Rhodopseudomonas palustris BisB5] >gi|91681492|gb|ABE37794.1| ATP synthase F1, delta subunit [Rhodopseudomonas palustris BisB5] (186 aa)
Score = 97, Expect = 2.3e-02, Identities = 45/170 (26%), Positives = 80/170 (47%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFS--LKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKS-ISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           YA AL+    EL +  K+I    A    FS  L  + E++ ++ S +   E +TK L  +   L K+ I+ I   NFL +L  N     + ++  ++   +   +      +     +  K LE ++      TGK V     +D ++IGG+ +  G+ + D SI+ K++ IK
  S:    15 YATALF----ELARDEKVIDAVKADLDKFSAMLVESPELLRLVRSPVFGAEAQTKALGAV---LDKAGIAGIS-ANFLKLLAANRRLFVVADVIGAYRALVARFKGEATADVTVAETLSDKNLEALKLALKSVTGKDVTLNINVDPAIIGGLVVKLGSRMVDSSIRTKLNSIK 179
>gi|168004832|ref|XP_001755115.1| predicted protein [Physcomitrella patens subsp. patens] >gi|162693708|gb|EDQ80059.1| predicted protein [Physcomitrella patens subsp. patens] (180 aa)
Score = 97, Expect = 2.4e-02, Identities = 37/139 (26%), Positives = 68/139 (48%)
  Q:    40 LKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKI-EHLFSIKTGKRVRYENIIDKSLIGGMKIMFGND---VYDYSIKGKIDQI 178
           L NN  + + + S II  ++K  I+  +  D   S   +   N L      +  + + + F + + +L + Q      + S   +EK  L  I + + S+   K VR +N++D SLI G  + +G D     D S+KG++D++
  S:    33 LLNNDTLYNFLVSPIIDGDKKKSIIKTVAEDAEFSAVTLSFLNLLVDKKRIDIVREVTKEFEAIYNELTDTQ---VANVISAVKIEKPQLALIAKKIQSLCGAKNVRIKNVVDPSLIAGFIVQYGKDGSRYIDMSVKGQLDKL 172
>gi|163792317|ref|ZP_02186294.1| H+-transporting two-sector ATPase, delta (OSCP) subunit [alpha proteobacterium BAL199] >gi|159182022|gb|EDP66531.1| H+-transporting two-sector ATPase, delta (OSCP) subunit [alpha proteobacterium BAL199] (183 aa)
Score = 97, Expect = 2.4e-02, Identities = 36/170 (21%), Positives = 81/170 (47%)
  Q:    10 YANALYSIWLELDKKNKII--FTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           YA ALY    EL  + K +    S    +   L ++ E + +I S +++++E++K    +   ++K+ ++     FL VL  N     + ++  ++  +L   +  +   + S   +    +E +        G++V     +D SLIGG+ +  G+ + D S++ K+ +++
  S:    12 YALALY----ELADEGKALDDVASDLTAVRQLLSDSPEFLRLIRSPVLTRDEQSK---GVLAVMNKAGAHALTAKFLGVLATNRRLFALPQMIEAYLSELARRRGEVAAEVTSAVSLSDPEIESVTEALRKVVGQKVSVALTVDPSLIGGLIVRVGSRMIDSSLRTKLQRLQ 176
>gi|17548037|ref|NP_521439.1| F0F1 ATP synthase subunit delta [Ralstonia solanacearum GMI1000] >gi|17430343|emb|CAD17108.1| probable atp synthase delta chain protein [Ralstonia solanacearum] (178 aa)
Score = 97, Expect = 2.5e-02, Identities = 29/113 (25%), Positives = 53/113 (46%)
  Q:    67 IFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           IF    KS  +   K  + +L  N     + EI   F    +  +    + I S F +E   L  +      K GK+++    +D SLIGG+++  G++V D S++ ++ Q++
  S:    60 IFLSALKSPVSHEAKELVGLLVANKRLSLLPEIAAQFHVLRNASEGAADVEITSAFPLEGAPLTDLVATLERKFGKKLQPHVTVDPSLIGGVRVQVGDEVLDTSVRARLAQMQ 172
>gi|150026487|ref|YP_001297313.1| ATP synthase delta subunit [Flavobacterium psychrophilum JIP02/86] >gi|149773028|emb|CAL44512.1| ATP synthase delta subunit [Flavobacterium psychrophilum JIP02/86] (177 aa)
Score = 97, Expect = 2.5e-02, Identities = 38/175 (21%), Positives = 80/175 (45%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIEN 184
           YA A+  I    +  N++  ++    I  ++ +N E+   I +  I  E K   L ++F +     +N   K+   +L +N  F+ +  I   + +  DE       ++ +   ++  L  K++   +  + K+V  EN +D S+IGG  +  G+  Y+ S+  ++  +K  + N
  S:    10 YAKAIIEIATSKNAANEV--SNDMFLIATTINSNSELDTFIQNPTIKVEAKENALLEVFAN-----TNEVTKSLFHLLFENKRFEILGAIASEYNKLFDEINGIQVAKVTTAIAMDANLEAKVKAKIATFSDKKVTIENTVDASIIGGFILRIGDKQYNASVANRLQVLKRELSN 177
>gi|81428738|ref|YP_395738.1| F0F1 ATP synthase subunit delta [Lactobacillus sakei subsp. sakei 23K] >gi|78610380|emb|CAI55430.1| H(+)-transporting two-sector ATPase (ATP synthase), delta subunit [Lactobacillus sakei subsp. sakei 23K] (180 aa)
Score = 97, Expect = 2.5e-02, Identities = 39/170 (22%), Positives = 80/170 (47%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTG-KRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           YA AL+S+  +  +   I     A +  F+  +N ++  ++    +S  ++  +L  +  D S       +++FL ++ D      +  I  ++    D+H+     ++ S   ++   L KI   F+ + G   V  E+++D  +IGG+ +   + V D S+K  +DQIK
  S:    12 YAKALFSLAEQEQQFESIHDEIQALETIFN--DNPKLGTVLTDTTLSGLKQRNLLESLSNDFST-----LMQHFLSLVFDYQRMAEMPYIIAAYEDLYDQHKGIAHAKVTSAVALDDDQLAKISQSFAKREGLNEVLIESVVDPDIIGGIVLESNHKVIDGSVKHGLDQIK 175
>gi|114584|sp|P11402|ATPD_SPIOL ATP synthase delta chain, chloroplast precursor >gi|21240|emb|CAA43634.1| unnamed protein product [Spinacia oleracea] (257 aa)
Score = 96, Expect = 2.5e-02, Identities = 39/130 (30%), Positives = 68/130 (52%)
  Q:    54 IISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDN---NFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTG-KRVRYENIIDKSLIGGMKIMFGND---VYDYSIKGKIDQIKWNIE 183
           +IS + K  +L++I   ++ S    +  NF+ +L D+   N  K IL  F   F K+   +  +   + S   +E   L +I       TG K VR + +ID SL+ G  I +GN+   + D S+K ++++I   +E
  S:   119 VISIDNKRSVLDEI---ITTSGLQPHTANFINILIDSERINLVKEILNEFEDVFNKITGTEVAV---VTSVVKLENDHLAQIAKGVQKITGAKNVRIKTVIDPSLVAGFTIRYGNEGSKLVDMSVKKQLEEIAAQLE 249
>gi|49081644|gb|AAT50222.1| PA5557 [synthetic construct] (179 aa)
Score = 96, Expect = 2.6e-02, Identities = 26/98 (26%), Positives = 50/98 (51%)
  Q:    81 KNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           +NF+  + +N   + +  I   + Q   E +  + + + S F + K+  +K+    S +  + VR     D SLIGG+ I  G+ V D S++GK+ ++
  S:    75 QNFVRTVAENKRLELLPTIAEMYEQLKAEQEKSVEVEVTSAFTLGKEQQDKLAKALSARLSREVRLHASEDASLIGGVIIRAGDLVIDGSVRGKLAKL 172
>gi|154310373|ref|XP_001554518.1| hypothetical protein BC1G_07106 [Botryotinia fuckeliana B05.10] >gi|150851438|gb|EDN26631.1| hypothetical protein BC1G_07106 [Botryotinia fuckeliana B05.10] (226 aa)
Score = 96, Expect = 2.7e-02, Identities = 31/169 (18%), Positives = 82/169 (48%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFS----IKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           YA+ALY+   +    + +    S + ++   + + ++  I+ +  +S  +K++I+ ++            +KNFL  L +NN    +  +   F + +   +  + + + S   ++ K L ++E   +    +  GK+++  N ++  ++GG+ +  G+   D S+  +I ++
  S:    48 YASALYTAASKTSTLDSV--ARSLQSLHNVFQKDAKLATIMQAPTLSAADKSQIIQELQKHTGGQDKGDTVKNFLETLAENNRLALLKGVCEKFGELMGAARGEIELTVTSASQLDSKTLNRLESAVAKSQYVGQGKKLKVTNKVNPDVLGGLIVEIGDRTIDLSVSNRIAKM 218
>gi|148245077|ref|YP_001219771.1| F0F1-type ATP synthase delta subunit [Candidatus Vesicomyosocius okutanii HA] >gi|146326904|dbj|BAF62047.1| F0F1-type ATP synthase delta subunit [Candidatus Vesicomyosocius okutanii HA] (183 aa)
Score = 96, Expect = 2.7e-02, Identities = 41/169 (24%), Positives = 76/169 (44%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           YANA++ +     + N  +      D+   L  + +M  +I S  I +++K   +  +   +     + +   F+ VL DNN    +  I   F   ++   N     I S + + K   E+I      +  K V  + ++DK L+GG+ I  G+ V D SIK ++D++
  S:    10 YANAIFEL---AQQDNSHLQWKMVLDVGAYLLLDKKMRRLIASPNILEQDKLSTIKALLMSILNRELDAHEAMFISVLLDNNRIGILPSIATLFESLINITNNIKIFTIISSYQLSKSEKEQIVSDLMNQYNKTVSIDIVVDKDLVGGVIIKDGDKVIDISIKARVDEL 175
>gi|121601599|ref|YP_994637.1| F0F1 ATP synthase subunit delta [Burkholderia mallei SAVP1] >gi|167001253|ref|ZP_02267052.1| F0F1 ATP synthase subunit delta [Burkholderia mallei PRL-20] >gi|121230409|gb|ABM52927.1| ATP synthase F1, delta subunit [Burkholderia mallei SAVP1] (179 aa)
Score = 96, Expect = 2.7e-02, Identities = 25/95 (26%), Positives = 50/95 (52%)
  Q:    81 KNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKI 175
           KNF+ +L DN+      EI + F    +  +    ++I S F +E   L ++      K  ++++    +D SLIGG+++  G++V D S++ ++
  S:    76 KNFVQMLVDNHRIALSPEIAVQFEALKNAREGAADVQIVSAFPLEGAQLAELVTSLERKFKRKLKPAVEVDSSLIGGVRVTVGDEVLDTSVRARL 170
>gi|52630929|gb|AAU84928.1| ATP synthase oligomycin sensitivity conferral protein [Toxoptera citricida] (208 aa)
Score = 96, Expect = 2.8e-02, Identities = 49/168 (29%), Positives = 81/168 (48%)
  Q:    10 YANALYSI-----WLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFL--FIRIYSPF-VVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQ 177
           YA AL+S       LE  +K+ I F ++       LK++  +   +D+ I  +  K   L      L+ S  +    NFL +L +N   +++  I  SF   +  H+  L   +    P    E++ L+K    FS K G+ ++ E  +D SLIGGM +  G+   D S+  KI +
  S:    35 YATALFSAGSKQNQLESIEKDLIKFQTA-------LKSDKVLKEFVDNPINKRSLKASTLQLAAKKLALSPPS---SNFLSILAENGRLQKLNSIINSFKVIMAAHRGDLPCIVTTAKPLDSAEQQELKKTLQAFS-KKGETIKLELKVDPSLIGGMIVSIGDKYVDMSVATKIKK 199
>gi|168215819|ref|ZP_02641444.1| ATP synthase F1, delta subunit [Clostridium perfringens NCTC 8239] >gi|182382410|gb|EDT79889.1| ATP synthase F1, delta subunit [Clostridium perfringens NCTC 8239] (179 aa)
Score = 96, Expect = 2.9e-02, Identities = 45/170 (26%), Positives = 78/170 (45%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           YA ALY +  E +K  +  + +  ++I   +  N E+  II    IS   K K    IF    +   +  L +FL VL + +    + E      +   E  N L   + S   + +  + ++      K  K++  +  IDKS+IGG+ +  G+DV D ++K ++D IK
  S:     9 YALALYEVAEEKNKVEE--YLNDLREICDIIYGNNELYEIIKHPQISTVRKKKTFRNIF----EGKIDDELLSFLMVLIEKDRILYLREKLKEMEKIHLERNNTLLAEVKSVVPLTEDEVTRLVAKLENKYSKKILLKQEIDKSIIGGLYVRVGDDVIDGTVKSRLDDIK 172
>gi|74272629|gb|ABA01110.1| chloroplast ATP synthase delta subunit [Chlamydomonas incerta] (220 aa)
Score = 96, Expect = 2.9e-02, Identities = 43/178 (24%), Positives = 82/178 (46%)
  Q:     1 MEEKNHI-DHYANALYSIWLELDKKNKIIFTSSAKDIYFSL-KNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQ-----NFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           M  KN + + YA AL  +    D+K K+    +  D    L K N ++  +I + ++  ++K  +L KI  +       I   N L   +       I E F   + +L + Q     + + +     F++ KKL E       +   K ++ + +ID SLI G  + +G+   D S++ +I+++
  S:    33 MARKNEVSESYAKALVEL---ADEKGKLEAVHADVDSVAGLMKENAKLSALIMNPVVDADKKRAVLAKIAKEAGFQQYTINFLNLLVEKDRLALVPEICECFEDLYCQLTDTQVATLRSAVKLEQEQQFLIAKKLQE-------LTGSKNIKLKPVIDSSLIAGFVVEYGSSQIDLSVRTQIERV 207
>gi|51473972|ref|YP_067729.1| F0F1 ATP synthase subunit delta [Rickettsia typhi str. Wilmington] >gi|81610750|sp|Q68VU5|ATPD_RICTY ATP synthase delta chain >gi|51460284|gb|AAU04247.1| H(+)-transporting two-sector ATPase F(1) delta subunit; ATP synthase.; Chloroplast ATPase.; F(0)F(1)-ATPase.; F(1)-ATPase.; H(+)-transporting ATP synthase.; H(+)-transporting ATPase.; Mitochondrial ATPase. [Rickettsia typhi str. Wilmington] (183 aa)
Score = 96, Expect = 2.9e-02, Identities = 46/186 (24%), Positives = 96/186 (51%)
  Q:     1 MEEKNHIDHYANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIENNK 186
           M + N I +YA AL++  L LD     IF      +   +++++++   + S I++K +K  ++N +   +  +  N  + NFL +L  N+    +  I  ++ + L E +N   +++ S   ++ +  E I++    +  ++      ID ++IGG+ I + N + DYSIKG +++I   ++N K
  S:     1 MNKDNLIQNYAVALFNNAL-LDNIQVTIFEEITL-LNRIIEDSFDIKEFLISPIVNKIDKINVINSL---IKNTKLNKIVNNFLLLLIKNSRTHILSNIVEAYNKLLYESRNIKIVQVISSNQLQPREQEWIQYRIEKELQQKTALFFDIDNTIIGGIVIKYDNVLRDYSIKGSLEKIAKCLKNVK 181
>gi|134294235|ref|YP_001117970.1| F0F1 ATP synthase subunit delta [Burkholderia vietnamiensis G4] >gi|134137392|gb|ABO53135.1| ATP synthase F1, delta subunit [Burkholderia vietnamiensis G4] (179 aa)
Score = 96, Expect = 2.9e-02, Identities = 26/99 (26%), Positives = 51/99 (51%)
  Q:    81 KNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           KNF+ +L DN+    + EI   F    +E +      I S F +E   L+ +      K  ++++    +D SLIGG+++  G++V D S++ ++  ++
  S:    76 KNFVQMLVDNHRIALLPEIAEQFEALKNEREGAADAEIVSAFPLEGAELDSLVSGLERKFKRKLKPTVEVDSSLIGGVRVTVGDEVLDTSVRARLASMQ 174
>gi|171060199|ref|YP_001792548.1| ATP synthase F1, delta subunit [Leptothrix cholodnii SP-6] >gi|170777644|gb|ACB35783.1| ATP synthase F1, delta subunit [Leptothrix cholodnii SP-6] (177 aa)
Score = 96, Expect = 2.9e-02, Identities = 35/170 (20%), Positives = 78/170 (45%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYL----KNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           YA ALY +  + D    +   S+   +      N E+     S  +S E+         +D+  + + + L    ++FL  + DN     +  I + F   ++         I+S + +E   L ++      + G+++     ++  LIGG++++ G++V D S+K +++++K
  S:    11 YAEALYQVARQGDVAVWVEQVSALAQV----AENAELRQFAGSPKVSAEQ--------VYDVVAAAAGVSLSTGVQHFLRTVIDNGRLAVLPAIAVQFNALVNAASGVADAAIFSAYPIEPAQLAEVVAALEQRFGRKLSVNVTLEPELIGGIRVVVGDEVLDTSVKARLERMK 172
>gi|107104659|ref|ZP_01368577.1| hypothetical protein PaerPA_01005738 [Pseudomonas aeruginosa PACS2] (178 aa)
Score = 96, Expect = 3.0e-02, Identities = 25/98 (25%), Positives = 50/98 (51%)
  Q:    81 KNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           +NF+  + +N   + +  I   + Q   E +  + + + S F + ++  +K+    S +  + VR     D SLIGG+ I  G+ V D S++GK+ ++
  S:    75 QNFVRTVAENKRLELLPTIAEMYEQLKAEQEKSVEVEVTSAFTLSREQQDKLAKALSARLSREVRLHASEDASLIGGVIIRAGDLVIDGSVRGKLAKL 172
>gi|187479687|ref|YP_787712.1| ATP synthase delta chain [Bordetella avium 197N] >gi|115424274|emb|CAJ50827.1| ATP synthase delta chain [Bordetella avium 197N] (179 aa)
Score = 96, Expect = 3.1e-02, Identities = 27/114 (23%), Positives = 57/114 (50%)
  Q:    66 KIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           ++F  L KS      +NF+ +L  N+    +  I   F    + ++      I S F +    ++++     +K G +++ +  ID SLIGG+++  G+ V D S+K ++ +++
  S:    61 QVFTSLIKSPLPQAARNFIDLLVQNDRLLLLPIIATQFVDLKNRYEGTAQAEITSAFELSDAQVKELIAALEVKFGLKLKPQVTIDPSLIGGVRVAVGDQVLDTSVKAQLARLR 174
>gi|191163786|ref|ZP_03025658.1| ATP synthase F1, delta subunit [Geobacter sp. M21] >gi|190995231|gb|EDV70687.1| ATP synthase F1, delta subunit [Geobacter sp. M21] (180 aa)
Score = 96, Expect = 3.1e-02, Identities = 33/122 (27%), Positives = 60/122 (49%)
  Q:    58 EEKTKILNKIF--FDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           E K +++ ++     LS  ISN+     L +L +      + EI  S+    DE    +   + S   +E   +E+I    +  TGK+V  +  +D SLIGG+    G  V+D S++ ++ +I+
  S:    56 ESKREVMKELVAKLQLSPMISNL-----LMLLLERGRISVLPEISQSYGAFADELSGVIRPTLSSGLPLEAGQIEEIRSALAKSTGKKVELKVEVDPSLIGGVVTKIGGKVFDGSVRTQLARIQ 174
>gi|126725126|ref|ZP_01740969.1| ATP synthase F1, delta subunit [Rhodobacterales bacterium HTCC2150] >gi|126706290|gb|EBA05380.1| ATP synthase F1, delta subunit [Rhodobacterales bacterium HTCC2150] (186 aa)
Score = 96, Expect = 3.1e-02, Identities = 39/170 (22%), Positives = 81/170 (47%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKI--FFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           YA A++ +  E  KK K +  +    +  +L ++ +   +I+S I+S+EE++  ++ I     LS +++N      L ++ +N     +  +  S    + E +  +   + +   + K   EK+        GK V     +D+S+IGG+ I  G+ + D SI  K+  ++
  S:    15 YATAVFELANE-GKKLKAL-EADVDALTAALSDSTDFAALINSPILSREEQSNSISAIGAKMKLSDTVANT-----LTLMANNRRLFVLPALLTSLRDLIAEEKGEVTAEVTAAKALTKAQQEKLAKSLKASVGKTVNINLAVDESIIGGLIIKVGSKMIDTSIASKLSNLQ 179
>gi|88711567|ref|ZP_01105655.1| ATP synthase subunit D [Flavobacteriales bacterium HTCC2170] >gi|88710508|gb|EAR02740.1| ATP synthase subunit D [Flavobacteriales bacterium HTCC2170] (179 aa)
Score = 95, Expect = 3.3e-02, Identities = 46/185 (24%), Positives = 87/185 (47%)
  Q:     1 MEEKNHIDHYANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEH---QNFLFIRIYSPFV--VEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIENN 185
           M++      YA A+  I   +D K         + +  ++ ++ E+  ++ S II  E+K   L+KIF       S+   +  + +L DN     + E+ + +   L+E    Q+   +    P    +EKK+L ++  +    TG  V  EN ID+++IGG  +  G+  +D S+  K+  +K    N+
  S:     1 MKDTRAAIRYAKAILDI--AVDNKATDAIEKDMRSVVSTISDSKELKDLLSSPIIKGEDKKVALSKIF-----KGSHAITEGMIKLLVDNKRVGMLNEVALKYI-ILNEQLKGQDVAVVTTAVPLTKDLEKKILGQVNKI----TGNEVTIENKIDENIIGGFVLRVGDLQFDASVANKLSSLKREFTNS 178
>gi|91785736|ref|YP_560942.1| F0F1 ATP synthase subunit delta [Burkholderia xenovorans LB400] >gi|91689690|gb|ABE32890.1| ATP synthase F1, delta subunit [Burkholderia xenovorans LB400] (179 aa)
Score = 95, Expect = 3.4e-02, Identities = 25/103 (24%), Positives = 52/103 (50%)
  Q:    77 NIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           N   KN + +L DN+    + EI + F +  +  +    + I S F +E   L  +      K  ++++    +D SLIGG+++  G++V D S++ ++  ++
  S:    72 NAQAKNLVQMLVDNHRLPLLPEIAVQFEELKNAREGAADVLIVSAFPLEGAQLNDLVASLERKFKRKLKPTVEVDSSLIGGVRVTVGDEVLDTSVRARLASMQ 174
>gi|91204907|ref|YP_537262.1| F0F1 ATP synthase subunit delta [Rickettsia bellii RML369-C] >gi|157827766|ref|YP_001496830.1| F0F1 ATP synthase subunit delta [Rickettsia bellii OSU 85-389] >gi|123084599|sp|Q1RKE1|ATPD_RICBR ATP synthase delta chain >gi|91068451|gb|ABE04173.1| ATP synthase delta chain [Rickettsia bellii RML369-C] >gi|157803070|gb|ABV79793.1| F0F1 ATP synthase subunit delta [Rickettsia bellii OSU 85-389] (189 aa)
Score = 95, Expect = 3.4e-02, Identities = 34/139 (24%), Positives = 77/139 (55%)
  Q:    40 LKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           +++N E+  ++ S I++K +K  ++N +  ++   IS I ++NFL +L  N+    + +I  ++ + L E +N   +++ S   ++    E ++     +  +  +    ID +++GG+ I + + + DYSIKG +D+I
  S:    38 IEDNIEVKELLSSPIVNKVDKIGVINSLVKNIK--ISKI-MQNFLLLLIKNSRTSILADIANTYSKLLYESKNIKIVQVISANKLKPTEQEWVKTNIEKELKQETKINFEIDPTIMGGIVIKYDSILQDYSIKGSLDKI 173
>gi|89898930|ref|YP_521401.1| F0F1 ATP synthase subunit delta [Rhodoferax ferrireducens T118] >gi|89343667|gb|ABD67870.1| ATP synthase F1, delta subunit [Rhodoferax ferrireducens T118] (176 aa)
Score = 95, Expect = 3.5e-02, Identities = 22/99 (22%), Positives = 48/99 (48%)
  Q:    81 KNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           +NFL  + +N     + EI   F    +         +YS F ++   L ++      +  +++     +   LIGG++++ G++V D S+K +++Q+K
  S:    73 QNFLRTVIENGRLSALPEIAAQFRVMKNAQSGSSDAVVYSAFAIDSTALAELAATLEQRFARKLNVSVQLQPELIGGIRVVVGDEVLDSSVKARLEQMK 171
>gi|78064762|ref|YP_367531.1| F0F1 ATP synthase subunit delta [Burkholderia sp. 383] >gi|77965507|gb|ABB06887.1| H+-transporting two-sector ATPase, delta (OSCP) subunit [Burkholderia sp. 383] (179 aa)
Score = 95, Expect = 3.5e-02, Identities = 26/99 (26%), Positives = 50/99 (50%)
  Q:    81 KNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           KNF+ +L DN+    + EI   F    +E +      I S F +    LE +      K  ++++    +D SLIGG+++  G++V D S++ ++  ++
  S:    76 KNFVQMLVDNHRIALLPEIAEQFEALKNEREGAADAEIVSAFPLNGADLESLVSGLERKFKRKLKPTVAVDSSLIGGVRVTVGDEVLDTSVRARLASMQ 174
>gi|123444376|ref|YP_001008341.1| F0F1 ATP synthase subunit delta [Yersinia enterocolitica subsp. enterocolitica 8081] >gi|122091337|emb|CAL14223.1| ATP synthase delta subunit protein [Yersinia enterocolitica subsp. enterocolitica 8081] (177 aa)
Score = 95, Expect = 3.5e-02, Identities = 23/98 (23%), Positives = 52/98 (53%)
  Q:    81 KNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           +NF+ V+ +N     + E+ + F Q     ++ + + + S   +  + L KI      +  ++V+    IDKS++ G+ I  G+ V D S++G+++++
  S:    74 QNFIRVMAENGRLLVLPEVLLQFIQLRASLESTVDVEVSSASPLNDEQLAKIAAAMEKRLSRKVKLNCKIDKSVMAGVVIRAGDMVIDGSVRGRLERL 171
>gi|94312428|ref|YP_585638.1| F0F1 ATP synthase subunit delta [Ralstonia metallidurans CH34] >gi|93356280|gb|ABF10369.1| ATP synthase F1, delta subunit [Ralstonia metallidurans CH34] (180 aa)
Score = 95, Expect = 3.6e-02, Identities = 26/112 (23%), Positives = 55/112 (49%)
  Q:    64 LNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKI 175
           L ++F  + KS  N   + F+ +L +N+    + EI   F    +  +    + I S F ++     ++      K G+++  +  +D SLIGG+ +  G++V D S++ ++
  S:    60 LEEVFLSVLKSPVNDEARRFVKLLVENSRLTALPEIAEQFHALKNAREGSSDVEITSAFPLDASQTNELVAALERKFGRKLYAKVAVDPSLIGGVSVKVGDEVLDTSVRSRL 171
>gi|58337087|ref|YP_193672.1| F0F1 ATP synthase subunit delta [Lactobacillus acidophilus NCFM] >gi|6652830|gb|AAF22495.1|AF098522_5 F1F0-ATPase subunit delta [Lactobacillus acidophilus] >gi|58254404|gb|AAV42641.1| ATP synthase delta subunit [Lactobacillus acidophilus NCFM] (182 aa)
Score = 95, Expect = 3.7e-02, Identities = 35/140 (25%), Positives = 66/140 (47%)
  Q:    43 NYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTG-KRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNI 182
           N + + ++   I+S ++K  IL  +  D S  +     + FL +L + N F  +++I   F    D           +   ++   LE++   F+ K     VR EN +D S++GG+ +   + V D S+K K+ +I+  I
  S:    43 NPKFISVLSDPILSSKDKKSILTAVEKDFSDEV-----QGFLNLLLEYNRFADLIDIIDQFSLLYDNENKIASGTATTAVKLDDDQLERLSESFAKKYDLNAVRLENKVDPSILGGVILQVKDRVIDGSVKNKLKKIRAQI 178
>gi|194335032|ref|YP_002016892.1| ATP synthase F1, delta subunit [Prosthecochloris aestuarii DSM 271] >gi|194312850|gb|ACF47245.1| ATP synthase F1, delta subunit [Prosthecochloris aestuarii DSM 271] (180 aa)
Score = 95, Expect = 3.9e-02, Identities = 26/144 (18%), Positives = 74/144 (51%)
  Q:    36 IYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           I  ++ +++++V ++ S +I  + K K L  +F  +    + +++ + +      +   +++E + +     DE    + + + S   +E +   ++ +  +  TGK+VR    +D+ L+GG+ +  G+ + D S++ ++D ++
  S:    34 ISATIADSHDLVVMLKSPLIKGDTKAKALKAVFHGMLNEKTLLFI-DLICRKKRADHLPQMVEEYKAL---RDERSGLINVDVNSAVKLEDEQARELINSLATYTGKKVRARLALDEKLLGGVTVKIGDTIIDGSVRHQLDMLR 173
>gi|126728275|ref|ZP_01744091.1| ATP synthase delta chain [Sagittula stellata E-37] >gi|126711240|gb|EBA10290.1| ATP synthase delta chain [Sagittula stellata E-37] (187 aa)
Score = 95, Expect = 3.9e-02, Identities = 37/172 (21%), Positives = 82/172 (47%)
  Q:     8 DHYANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIF--FDLSKSISNIY----LKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           + YA A++ I  E    N      +  D+  +L ++ ++  ++ + + ++EE+   ++ +    D+  ++ N+      K  LFV+      KR+ E+       + EH   +   + S   +  +    +      K GK V+    +D+SLIGG+ +  G+ + D SI+ K++ ++
  S:    14 ERYATAVFEIVKE--NNNLPALEKNLNDLTAALDDSADLRELLVNPVYTREEQGNAISAVADAMDMIPAVKNVLGLMAQKRRLFVVP--AMVKRLREM-------IAEHNGEVTAEVTSAMALTDEQSASLAATLKEKVGKDVKISTTVDESLIGGLIVKVGSKMIDTSIRSKLNSLQ 180
>gi|114769419|ref|ZP_01447045.1| ATPase, delta (OSCP) subunit [alpha proteobacterium HTCC2255] >gi|114550336|gb|EAU53217.1| ATPase, delta (OSCP) subunit [alpha proteobacterium HTCC2255] (186 aa)
Score = 95, Expect = 3.9e-02, Identities = 35/170 (20%), Positives = 79/170 (46%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           YA AL+ +  E DK   I       D+  +L NN  +  + +S + S++E   ++N +    +K   +  + N L ++      + +  +  +   K+ + +  +   + +   +  + ++++        GK V  +  ID+SLIGG+ +  G+ + D SI+ K+  ++
  S:    15 YATALFDLAKEADKLPAIEADLDTLDV--ALTNNESLRDLFNSPVYSRDE---LMNSVIALSAKMKLSSIVSNTLGLMAQKRRLQVVPMLIDAVRTKISDEKGEVTAEVTAAQKLSSEQIKELSETLKSSVGKNVNIKATIDESLIGGLIVKVGSKMIDSSIRSKLSNLQ 179
>gi|167344641|ref|ZP_02290482.1| F0F1 ATP synthase subunit delta [Listeria monocytogenes FSL J1-208] (92 aa)
Score = 95, Expect = 3.9e-02, Identities = 22/58 (37%), Positives = 38/58 (65%)
  Q:   118 IYSPFVVEKKLLEKIEHLFSIKTGK-RVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKI 175
           +YS   + ++ L  +  +F+ K  K ++  +N IDKSL+GG+K++ G  +YD S+K KI
  S:    27 VYSVVPLSEQELTALSRVFAAKMNKTKLNIQNHIDKSLLGGVKVVIGTRIYDDSLKTKI 85
>gi|78356035|ref|YP_387484.1| F0F1 ATP synthase subunit delta [Desulfovibrio desulfuricans subsp. desulfuricans str. G20] >gi|78218440|gb|ABB37789.1| ATP synthase F1, delta subunit [Desulfovibrio desulfuricans G20] (183 aa)
Score = 95, Expect = 4.0e-02, Identities = 34/174 (19%), Positives = 79/174 (45%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIE 183
           YA AL++I  +        F S    +  +++ +  +  +  + + S EEK  +L K+   L  + +   + NF  +L D      + +I   +   LD  +  +   + +   + K   + ++     + G+++     +DK ++GG+ +  G+ V D S++ ++  +K NI+
  S:    10 YARALFAIGQKQGLAELDAFGSELSAVAKAVEESPALARLFRNPLFSIEEKRAVLAKL---LQAAGAGQTVSNFCNLLADKGRLADLPDINAFYSLLLDAEKGIIRGELVTAIKLAKAKRDAVKEQLEKQAGQKIELNFSVDKDILGGVVLKVGDRVLDASLRAQLGILKDNIK 180
>gi|71909720|ref|YP_287307.1| H+-transporting two-sector ATPase, delta (OSCP) subunit [Dechloromonas aromatica RCB] >gi|71849341|gb|AAZ48837.1| H+-transporting two-sector ATPase, delta (OSCP) subunit [Dechloromonas aromatica RCB] (178 aa)
Score = 95, Expect = 4.1e-02, Identities = 30/105 (28%), Positives = 58/105 (55%)
  Q:    80 LKNFLFVLNDNNFFKRILEI--FISFFQKLDEHQNFLFIRIYSPFVVE----KKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIEN 184
           L NF+ +L++N+    + EI      +++ +E        I S F ++    K L+ ++E +F  K    V     +D +LIGG+K++ G+ + D S++GK+D +   + N
  S:    74 LSNFIQLLSNNDRLGLLPEIAGLYETYKRAEEGTKQ--ADIVSAFPIDDNQVKALIPQLEAVFKTKLEAAVS----VDPTLIGGIKVIVGDQMLDASVRGKLDAMATALNN 178
>gi|163854644|ref|YP_001628942.1| F0F1 ATP synthase subunit delta [Bordetella petrii DSM 12804] >gi|163258372|emb|CAP40671.1| ATP synthase delta chain [Bordetella petrii] (179 aa)
Score = 95, Expect = 4.2e-02, Identities = 31/114 (27%), Positives = 59/114 (51%)
  Q:    66 KIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVE----KKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           ++F  L K+     ++NF+ +L  N+    +  I   F    + H+      I S F +     K+L+E +E  F +K    V     +DKSLIGG+++  G+ V D S++ ++ +++
  S:    61 ELFTGLVKTQLPQAVRNFIELLVANDRLLLLPVIAKQFVALKNRHEGTAQAEITSAFELSDAQVKELIEALETKFGLKLKPSV----TVDKSLIGGVRVAVGDQVLDTSVQAQLARLR 174
>gi|86131155|ref|ZP_01049754.1| ATP synthase, delta (OSCP) subunit [Cellulophaga sp. MED134] >gi|85818566|gb|EAQ39726.1| ATP synthase, delta (OSCP) subunit [Dokdonia donghaensis MED134] (178 aa)
Score = 94, Expect = 4.3e-02, Identities = 47/176 (26%), Positives = 89/176 (50%)
  Q:    10 YANALYSIWLELDKKNKII--FTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDN---NFFKRILEIFISFFQKLD--EHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGK-RVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIENN 185
           YA A+    L+L K N  +    +  K +  +++ + E+ + ++S +I  ++K  +L ++F D +K    +     + VL DN   N    + + FI+ + K +  E          +P  +E K+L K++ L    TG   V   N ID+S+IGG  +  G+  Y+ SI  ++ ++K    N+
  S:     8 YAKAV----LDLAKDNGSVEAVLNDMKSVKATIEGSKELRNALNSPVIKADDKRAVLRQVFTDGTKETLGL-----VDVLVDNSRANLLGGVADSFIAEYNKSNKIESATVTTAVALTP-ELETKVLAKVKEL----TGSTNVTLTNEIDESIIGGFVLRVGDTQYNASIASQLGKLKREFSNS 177
>gi|116204663|ref|XP_001228142.1| hypothetical protein CHGG_10215 [Chaetomium globosum CBS 148.51] >gi|88176343|gb|EAQ83811.1| hypothetical protein CHGG_10215 [Chaetomium globosum CBS 148.51] (219 aa)
Score = 94, Expect = 4.3e-02, Identities = 26/139 (18%), Positives = 72/139 (51%)
  Q:    40 LKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFS----IKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           ++ + ++V I+ +  +S  +K+ ++ ++  +   S   +  KNFL  L +NN    +  +   F + +   +  + + + S   ++ + L ++E   S    +  GK+++ +N ++  ++GG+ +  G+   D S+  K+ ++
  S:    71 IQKDAKLVTILQAPTLSAADKSAVVAELQKNAGASGETV--KNFLATLAENNRLALLPGVCTKFSELMSAARGEVEMVVTSAQPLDNRTLSRLEAAVSKSSYVGAGKKLKVKNTVNPDIVGGLVVEVGDRTIDLSVSSKLAKM 211
>gi|121534924|ref|ZP_01666743.1| ATP synthase F1, delta subunit [Thermosinus carboxydivorans Nor1] >gi|121306523|gb|EAX47446.1| ATP synthase F1, delta subunit [Thermosinus carboxydivorans Nor1] (188 aa)
Score = 94, Expect = 4.6e-02, Identities = 27/125 (21%), Positives = 59/125 (47%)
  Q:    55 ISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           +  E K   + K+F     S    Y++NFL +L D      +  I   F Q  ++ +N +  ++ +   +  +  + +    S  TG+ V  +  +D S++GG+ +  G+ + D S+  +++ +K
  S:    53 VPAEAKKDTIRKVF----GSELTEYVRNFLLLLVDKRRETALRAIVHEFIQLANQARNIVEAQVTTARPLSPEAQQALAAKLSAVTGRNVALKTAVDDSILGGVVVKIGDKLIDGSVARQLNSLK 173
>gi|194569809|ref|YP_002104811.1| ATP synthase F1, delta subunit [Burkholderia pseudomallei 406e] >gi|157808552|gb|EDO85722.1| ATP synthase F1, delta subunit [Burkholderia pseudomallei 406e] (149 aa)
Score = 94, Expect = 4.7e-02, Identities = 25/95 (26%), Positives = 50/95 (52%)
  Q:    81 KNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKI 175
           KNF+ +L DN+    + EI   F    +  +    ++I S F +E   L ++      K  ++++    +D SLIGG+++  G++V D S++ ++
  S:    46 KNFVQMLVDNHRIALLPEIAEQFEALKNAREGAADVQIVSAFPLEGAQLAELVTSLERKFKRKLKPAVEVDSSLIGGVRVTVGDEVLDTSVRARL 140
>gi|53721006|ref|YP_109992.1| F0F1 ATP synthase subunit delta [Burkholderia pseudomallei K96243] >gi|76810890|ref|YP_331598.1| F0F1 ATP synthase subunit delta [Burkholderia pseudomallei 1710b] >gi|161371883|ref|ZP_02111446.1| F0F1 ATP synthase subunit delta [Burkholderia pseudomallei 1710a] >gi|167740797|ref|ZP_02413571.1| F0F1 ATP synthase subunit delta [Burkholderia pseudomallei 14] >gi|167818012|ref|ZP_02449692.1| F0F1 ATP synthase subunit delta [Burkholderia pseudomallei 91] >gi|167826375|ref|ZP_02457846.1| F0F1 ATP synthase subunit delta [Burkholderia pseudomallei 9] >gi|167847894|ref|ZP_02473402.1| F0F1 ATP synthase subunit delta [Burkholderia pseudomallei B7210] >gi|167896451|ref|ZP_02483853.1| F0F1 ATP synthase subunit delta [Burkholderia pseudomallei 7894] >gi|167921068|ref|ZP_02508159.1| F0F1 ATP synthase subunit delta [Burkholderia pseudomallei BCC215] >gi|194502146|ref|YP_002031724.1| ATP synthase F1, delta subunit [Burkholderia pseudomallei 1655] >gi|194518025|ref|YP_002053677.1| ATP synthase F1, delta subunit [Burkholderia pseudomallei S13] >gi|52211420|emb|CAH37411.1| ATP synthase delta chain [Burkholderia pseudomallei K96243] >gi|76580343|gb|ABA49818.1| ATP synthase F1, delta subunit [Burkholderia pseudomallei 1710b] >gi|169651348|gb|EDS84041.1| ATP synthase F1, delta subunit [Burkholderia pseudomallei S13] >gi|184214558|gb|EDU11601.1| ATP synthase F1, delta subunit [Burkholderia pseudomallei 1655] (179 aa)
Score = 94, Expect = 4.7e-02, Identities = 25/95 (26%), Positives = 50/95 (52%)
  Q:    81 KNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKI 175
           KNF+ +L DN+    + EI   F    +  +    ++I S F +E   L ++      K  ++++    +D SLIGG+++  G++V D S++ ++
  S:    76 KNFVQMLVDNHRIALLPEIAEQFEALKNAREGAADVQIVSAFPLEGAQLAELVTSLERKFKRKLKPAVEVDSSLIGGVRVTVGDEVLDTSVRARL 170
>gi|46105344|ref|XP_380476.1| hypothetical protein FG00300.1 [Gibberella zeae PH-1] (226 aa)
Score = 94, Expect = 4.8e-02, Identities = 33/169 (19%), Positives = 83/169 (49%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSL----KNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFS----IKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           YA+ALY+  ++           +A D    L    + + ++V ++ +  ++  +K  I++++   ++     +  KNFL  L +NN    I  +   F   +   +  + + + S   ++K+ L ++E   +    +  GK+++  N ++  ++GG+ +  G+   D S+  +I ++
  S:    50 YASALYTAAVKTSS------VDAAADALLKLGALIEKDPKLVAVLKTPTLADADKKAIVDELVKQINTKDETV--KNFLATLAENNRLGLIPGVVDKFSTIISAARGEVELTVTSAQALDKRTLSRLETAVAKSSYVGQGKKLKVTNEVNPDIVGGLVVEVGDRTIDLSVSSRIAKM 218
>gi|194561960|ref|YP_002096983.1| ATP synthase subunit D [Burkholderia dolosa AUO158] >gi|124893584|gb|EAY67464.1| ATP synthase subunit D [Burkholderia dolosa AUO158] (179 aa)
Score = 94, Expect = 4.9e-02, Identities = 25/99 (25%), Positives = 51/99 (51%)
  Q:    81 KNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           KNF+ +L DN+    + EI   F    +E +      I S F ++   L+ +      K  ++++    +D SLIGG+++  G++V D S++ ++  ++
  S:    76 KNFVQMLVDNHRIALLPEIAEQFEALKNEREGAADAEIVSAFPLDGADLDSLVASLERKFKRKLKPTVAVDSSLIGGVRVTVGDEVLDTSVRARLASMQ 174
>gi|34581169|ref|ZP_00142649.1| ATP synthase delta chain [Rickettsia sibirica 246] >gi|28262554|gb|EAA26058.1| ATP synthase delta chain [Rickettsia sibirica 246] (184 aa)
Score = 94, Expect = 4.9e-02, Identities = 44/179 (24%), Positives = 90/179 (50%)
  Q:     1 MEEKNHIDHYANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           M + N I +YA AL +  +  + ++KI        I   + +N+++   + S I++K +K   +N +  ++  S     ++NFL +L  N+    +  I  ++   L E +N   +++ S   ++ K  E I+     +  ++      ID ++IGG+ I + + + DYSIKG +++IK
  S:     1 MNKGNLIKNYAVALLNNAMVDNIQDKIF--EEITSINRIITDNFDIREFLFSPIVNKNDKINAVNSLAKNIKIST---IVQNFLLLLVKNSRTAILSNIVDAYNTLLYESKNIKIVQVISANKLQPKEQEWIKSRIEKELNQKTEILFDIDNTIIGGIVIKYDSMLQDYSIKGSLEKIK 174
>gi|168002028|ref|XP_001753716.1| predicted protein [Physcomitrella patens subsp. patens] >gi|162695123|gb|EDQ81468.1| predicted protein [Physcomitrella patens subsp. patens] (180 aa)
Score = 94, Expect = 5.1e-02, Identities = 38/139 (27%), Positives = 64/139 (46%)
  Q:    40 LKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKI-EHLFSIKTGKRVRYENIIDKSLIGGMKIMFGND---VYDYSIKGKIDQI 178
           L  N  +   + S +I  ++K  IL  +  D   S   I   N L         + + + F + F  L + Q      + S   +EK  L  I + + S+   K VR +N++D SLI G  + +G D     D S+KG++D++
  S:    33 LLTNETLYDFLVSPVIDGDKKKSILKTVAEDAKFSDVTISFLNLLVDKKRIELIREVTKEFEAIFNDLTDTQ---MANVISAVKIEKPQLALIAKKIQSLCGAKNVRIKNVVDPSLIAGFIVQYGKDGSRYIDMSVKGQLDRL 172
>gi|168205573|ref|ZP_02631578.1| ATP synthase F1, delta subunit [Clostridium perfringens E str. JGS1987] >gi|169344187|ref|ZP_02865169.1| ATP synthase F1, delta subunit [Clostridium perfringens C str. JGS1495] >gi|169297645|gb|EDS79745.1| ATP synthase F1, delta subunit [Clostridium perfringens C str. JGS1495] >gi|170662888|gb|EDT15571.1| ATP synthase F1, delta subunit [Clostridium perfringens E str. JGS1987] (179 aa)
Score = 94, Expect = 5.1e-02, Identities = 44/170 (25%), Positives = 78/170 (45%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           YA ALY +  E +K  +  + +  ++I   +  N E+  II    IS   K K    IF    +   +  L +FL VL + +    + E      +   E  N L   + S   + +  + ++      K  K++  +  IDKS+IGG+ +  G+DV D ++K ++D +K
  S:     9 YALALYEVAEEKNKVEE--YLNDLREICDIIYGNNELYEIIKHPQISTVRKKKTFRNIF----EGKIDDELLSFLMVLIEKDRILYLREKLKEMEKIHLERNNTLLAEVKSVIPLTEDEVTRLVAKLENKYSKKILLKQEIDKSIIGGLYVRVGDDVIDGTVKSRLDDMK 172
>gi|156102673|ref|XP_001617029.1| ATP synthase delta chain, mitochondrial, putative [Plasmodium vivax SaI-1] >gi|148805903|gb|EDL47302.1| ATP synthase delta chain, mitochondrial, putative [Plasmodium vivax] (244 aa)
Score = 94, Expect = 5.2e-02, Identities = 52/170 (30%), Positives = 85/170 (50%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNY----EMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEH--LFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           Y+ ALY++     KKNK I      DI F +KNN+      ++ + +  I   EK   L       + + S I   NFL  L D+   K + +I   F   L + +  +   +Y+   +     +KI+   LF +K   +   E  IDKS++GG+ +  GN V+D+S K KI++I+
  S:    72 YSLALYNV----GKKNKKI-NEITSDILF-IKNNFLKDKSFLNFLHTPNIESREKLNFLKTECKKYNNNFSPI-TSNFLESLFDSKRIKFLQKIIEEFELLLMKERKEIKCVVYTAKEINNNEKQKIQESILFKLKNELKPLIEYKIDKSILGGLVLQIGNQVFDFSAKYKIEKIR 240
>gi|18311172|ref|NP_563106.1| F0F1 ATP synthase subunit delta [Clostridium perfringens str. 13] >gi|110799264|ref|YP_696869.1| F0F1 ATP synthase subunit delta [Clostridium perfringens ATCC 13124] >gi|168210120|ref|ZP_02635745.1| ATP synthase F1, delta subunit [Clostridium perfringens B str. ATCC 3626] >gi|168213706|ref|ZP_02639331.1| ATP synthase F1, delta subunit [Clostridium perfringens CPE str. F4969] >gi|182623978|ref|ZP_02951766.1| ATP synthase F1, delta subunit [Clostridium perfringens D str. JGS1721] >gi|18145855|dbj|BAB81896.1| ATP synthase delta subunit [Clostridium perfringens str. 13] >gi|110673911|gb|ABG82898.1| ATP synthase F1, delta subunit [Clostridium perfringens ATCC 13124] >gi|170711804|gb|EDT23986.1| ATP synthase F1, delta subunit [Clostridium perfringens B str. ATCC 3626] >gi|170714811|gb|EDT26993.1| ATP synthase F1, delta subunit [Clostridium perfringens CPE str. F4969] >gi|177910871|gb|EDT73225.1| ATP synthase F1, delta subunit [Clostridium perfringens D str. JGS1721] (179 aa)
Score = 94, Expect = 5.3e-02, Identities = 44/170 (25%), Positives = 78/170 (45%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           YA ALY +  E +K  +  + +  ++I   +  N E+  II    IS   K K    IF    +   +  L +FL VL + +    + E      +   E  N L   + S   + +  + ++      K  K++  +  IDKS+IGG+ +  G+DV D ++K ++D +K
  S:     9 YALALYEVAEEKNKVEE--YLNDLREICDIIYGNNELYEIIKHPQISTVRKKKTFRNIF----EGKIDDELLSFLMVLIEKDRILYLREKLKEMEKIHLERNNTLLAEVKSVVPLTEDEVTRLVAKLENKYSKKILLKQEIDKSIIGGLYVRVGDDVIDGTVKSRLDDMK 172
>gi|197089674|gb|ACH40945.1| ATP synthase F1, delta subunit [Geobacter bemidjiensis Bem] (180 aa)
Score = 93, Expect = 5.8e-02, Identities = 32/122 (26%), Positives = 60/122 (49%)
  Q:    58 EEKTKILNKIF--FDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           E K +++ ++     LS  ISN+     L +L +      + +I  S+    DE    +   + S   +E   +E+I    +  TGK+V  +  +D SLIGG+    G  V+D S++ ++ +I+
  S:    56 ESKREVMKELVAKLQLSPMISNL-----LMLLLERGRISVLPQISESYGAFADELSGVIRPTLSSGLPLEASQIEEIRSALAKSTGKKVELKVEVDPSLIGGVVTKIGGKVFDGSVRTQLARIQ 174
>gi|145621086|ref|ZP_01777086.1| ATP synthase F1, delta subunit [Geobacter bemidjiensis Bem] >gi|144942618|gb|EDJ77743.1| ATP synthase F1, delta subunit [Geobacter bemidjiensis Bem] (181 aa)
Score = 93, Expect = 5.8e-02, Identities = 32/122 (26%), Positives = 60/122 (49%)
  Q:    58 EEKTKILNKIF--FDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           E K +++ ++     LS  ISN+     L +L +      + +I  S+    DE    +   + S   +E   +E+I    +  TGK+V  +  +D SLIGG+    G  V+D S++ ++ +I+
  S:    57 ESKREVMKELVAKLQLSPMISNL-----LMLLLERGRISVLPQISESYGAFADELSGVIRPTLSSGLPLEASQIEEIRSALAKSTGKKVELKVEVDPSLIGGVVTKIGGKVFDGSVRTQLARIQ 175
>gi|51891226|ref|YP_073917.1| ATP synthase delta subunit [Symbiobacterium thermophilum IAM 14863] >gi|51854915|dbj|BAD39073.1| ATP synthase delta subunit [Symbiobacterium thermophilum IAM 14863] (186 aa)
Score = 93, Expect = 5.9e-02, Identities = 37/169 (21%), Positives = 79/169 (46%)
  Q:    10 YANALYSIWLE---LDKKNK---IIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           YA AL+ +  E   LD+ N+   ++ +    D Y            ++   IS  +K K+L  +   L   +S + L +FL+V+        +  ++ +F    +E    + + + S   + ++    +E   + K GKRV+    +   LIGG+ +  G+ + D S++ ++ ++
  S:    10 YARALFELAQEKGLLDQVNRELELVVSMYETDSYLRA--------FMNDQRISPSQKRKVLASV---LEGKVSPLVL-HFLYVVVQKRREPHLPSMYRAFQDLANEAMGVVEVEVRSAVPLAEETARNLEAKLTTKLGKRVKLRTQVAPELIGGLAVRVGDTLMDGSVRTRLRRM 172
>gi|157829070|ref|YP_001495312.1| F0F1 ATP synthase subunit delta [Rickettsia rickettsii str. 'Sheila Smith'] >gi|165933796|ref|YP_001650585.1| F0F1 ATP synthase subunit delta [Rickettsia rickettsii str. Iowa] >gi|157801551|gb|ABV76804.1| F0F1 ATP synthase subunit delta [Rickettsia rickettsii str. 'Sheila Smith'] >gi|165908883|gb|ABY73179.1| ATP synthase delta chain [Rickettsia rickettsii str. Iowa] (184 aa)
Score = 93, Expect = 6.0e-02, Identities = 43/178 (24%), Positives = 90/178 (50%)
  Q:     1 MEEKNHIDHYANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           M + N I +YA AL++  +  + ++KI        I   + +N+++   + S I++K +K   +N +  ++  S     ++NFL +L  N+    +  I  ++   L E +N   +++ S   ++ K  E I+     +  ++      ID ++IGG+ I + + + DYSIKG +++I
  S:     1 MNKGNLIKNYAVALFNNAIVDNIQDKIF--EEITSINRIITDNFDIREFLFSPIVNKNDKINAVNSLAKNIKIST---IVQNFLLLLVKNSRTAILSNIVDAYNTLLYESKNIKIVQVISANKLQPKEQEWIKSRIEKELNQKTEILFDIDNTIIGGIVIKYDSMLQDYSIKGSLEKI 173
>gi|115350150|ref|YP_771989.1| F0F1 ATP synthase subunit delta [Burkholderia ambifaria AMMD] >gi|171315829|ref|ZP_02905060.1| ATP synthase F1, delta subunit [Burkholderia ambifaria MEX-5] >gi|172059169|ref|YP_001806821.1| ATP synthase F1, delta subunit [Burkholderia ambifaria MC40-6] >gi|115280138|gb|ABI85655.1| ATP synthase F1, delta subunit [Burkholderia ambifaria AMMD] >gi|171099018|gb|EDT43803.1| ATP synthase F1, delta subunit [Burkholderia ambifaria MEX-5] >gi|171991686|gb|ACB62605.1| ATP synthase F1, delta subunit [Burkholderia ambifaria MC40-6] (179 aa)
Score = 93, Expect = 6.1e-02, Identities = 26/99 (26%), Positives = 50/99 (50%)
  Q:    81 KNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           KNF+ +L DN+    + EI   F    +E +      I S F +    LE +      K  ++++    +D SLIGG+++  G++V D S++ ++  ++
  S:    76 KNFVQMLVDNHRIALLPEIAEQFEALKNEREGAADAEIVSAFPLNGADLESLVSGLERKFKRKLKPTVEVDSSLIGGVRVTVGDEVLDTSVRARLASMQ 174
>gi|126667605|ref|ZP_01738574.1| F0F1 ATP synthase subunit delta [Marinobacter sp. ELB17] >gi|126627874|gb|EAZ98502.1| F0F1 ATP synthase subunit delta [Marinobacter sp. ELB17] (118 aa)
Score = 93, Expect = 6.3e-02, Identities = 28/99 (28%), Positives = 49/99 (49%)
  Q:    80 LKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           ++NF  VL +N     + EI   F       +  + I + + F +  +   K+    S K  ++V     +DKSLIGG+ I  G+ V D S++GK+ ++
  S:    14 VRNFFAVLAENGRLVLLTEIAALFDTYWANLKRTVDIEVTAAFELTDEQQNKLAQALSKKLERQVSLVASLDKSLIGGVIIRTGDMVIDASVRGKLTKL 112
>gi|56461722|ref|YP_157003.1| F0F1-type ATP synthase, delta subunit [Idiomarina loihiensis L2TR] >gi|56180732|gb|AAV83454.1| F0F1-type ATP synthase, delta subunit [Idiomarina loihiensis L2TR] (177 aa)
Score = 93, Expect = 6.3e-02, Identities = 26/104 (25%), Positives = 54/104 (51%)
  Q:    81 KNFLFVLNDNNFFKRILEIFISFFQKLD-EHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIEN 184
           KNF+ VL +N     +L      +Q L  EH   + + + S   + K     +      +  ++++    +DKS+IGG+ I  G+ V D +++GK+D++ + +++
  S:    74 KNFVKVLAENERLP-VLPAVSELYQTLRAEHDKEVTVDVKSAVKLLKAQQTALIKALEKRLQRKIKLNCSVDKSIIGGLVIEAGDTVIDGTLRGKLDRLAYALQS 177
>gi|73662087|ref|YP_300868.1| F0F1 ATP synthase subunit delta [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|72494602|dbj|BAE17923.1| F0F1-type ATP synthase delta subunit [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (179 aa)
Score = 93, Expect = 6.6e-02, Identities = 33/104 (31%), Positives = 55/104 (52%)
  Q:    76 SNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTG-KRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           +N YL+N L +L  N     I EI+I+F    +E  N  +  I S + + ++ L  IE +   +T   ++   N I+  LIGG+++  G  V D SIK  + Q++
  S:    68 TNQYLQNMLTILASNRHLGHIHEIYIAFETLYNEEHNQDYAVIESVYQLSEEELSSIEEIIKARTKLSKIMITNKINPELIGGIRVKVGTKVMDASIKNDLAQLE 172
>gi|77973803|ref|ZP_00829348.1| COG0712: F0F1-type ATP synthase, delta subunit (mitochondrial oligomycin sensitivity protein) [Yersinia frederiksenii ATCC 33641] (177 aa)
Score = 93, Expect = 6.6e-02, Identities = 23/98 (23%), Positives = 51/98 (52%)
  Q:    81 KNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           +NF+ V+ +N     + E+   F Q     ++ + + + S   +  + L KI      +  ++V+    IDKS++ G+ I  G+ V D S++G+++++
  S:    74 QNFIRVMAENGRLLVLPEVLQQFIQLRASLESTVDVEVSSASALNDEQLAKIAAAMEKRLSRKVKLNCKIDKSVMAGVVIRAGDMVIDGSVRGRLERL 171
>gi|123966864|ref|YP_001011945.1| F0F1 ATP synthase subunit delta [Prochlorococcus marinus str. MIT 9515] >gi|123201230|gb|ABM72838.1| ATP synthase, delta (OSCP) subunit [Prochlorococcus marinus str. MIT 9515] (180 aa)
Score = 93, Expect = 7.0e-02, Identities = 44/169 (26%), Positives = 77/169 (45%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVV---EKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           YA AL  +  E D+  +++  +  K +   + +  E+   + S ++  E K KI+ +IF D   S     L NFL +L D      +  I   F +   E+ N     + S   +   +K L+ K   + +I   +++     ID SLIGG     G+ V D S+  +I ++
  S:    11 YAEALLQVVNENDQTEEMV--NEVKQLLTLINDAPELEKTLSSPVLETETKRKIIIEIFSDRINS----SLLNFLKLLADRQRIGIVTSILNRFLEIHRENSNIALATVTSAVELTDDQKGLITK--KIINIAGTEKLELVTKIDPSLIGGFVASVGSKVIDASLASQIRKL 174
>gi|110803409|ref|YP_699465.1| F0F1 ATP synthase subunit delta [Clostridium perfringens SM101] >gi|110683910|gb|ABG87280.1| ATP synthase F1, delta subunit [Clostridium perfringens SM101] (179 aa)
Score = 93, Expect = 7.0e-02, Identities = 47/170 (27%), Positives = 85/170 (50%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYS--PFVVEK--KLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           YA ALY +  E +K  +  + +  ++I   +  N E+  +I    IS   K K    IF    +   +  L +FL VL + +    + E      +   E  N L   + S  P   ++  +L+EK+E+ +S    K++  +  ID+S+IGG+ +  G+DV D ++K ++D +K
  S:     9 YALALYEVAEEKNKVEE--YLNDLREICEIIYGNNELYEVIKHPQISTVRKKKTFRNIF----EGKIDDELLSFLMVLIEKDRILYLREKLKEMEKIHLERNNTLLAEVKSVVPLTEDEVTRLVEKLENKYS----KKILLKQEIDRSIIGGLYVRVGDDVIDGTVKSRLDDMK 172
>gi|116780989|gb|ABK21914.1| unknown [Picea sitchensis] (252 aa)
Score = 93, Expect = 7.1e-02, Identities = 44/171 (25%), Positives = 88/171 (51%)
  Q:     9 HYANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYS--PFVVE-----KKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           +YA+ALY   ++ +  +++   S  K +  ++ N+      I    + ++ + K + +IF +   S S+I  KNFL V  +    +++  I  +F +    H+  +   + +  P   E     K++L KI     +  GK V++E  ID S++GG+ I F +  +D SIK +  +++
  S:    73 NYASALYVSAVKANMLDRV--ESELKTLMEAVNNSPNFRIFIKDLSVPRDTRLKAVREIFEE--SSFSDI-TKNFLAVAAELGRLRQLESIVKAFMRLTLAHKGEVHAVVTTVIPLPAEEEKDLKQVLGKI-----LGPGKTVKFEEKIDPSILGGLIIDFEDKRFDISIKTRAAKME 240
>gi|154281809|ref|XP_001541717.1| ATP synthase subunit 5, mitochondrial precursor [Ajellomyces capsulatus NAm1] >gi|150411896|gb|EDN07284.1| ATP synthase subunit 5, mitochondrial precursor [Ajellomyces capsulatus NAm1] (226 aa)
Score = 93, Expect = 7.1e-02, Identities = 36/169 (21%), Positives = 79/169 (46%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSA-KDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           YANALY   +   K + +  TS A   +   LK + ++  ++ +  ++  +K++I+ ++         +  L NFL  L +NN    +  +   F   +  H   + + I S   ++ K L+++E   +     + +   +I+  ++GG+ +  G+   D S+  KI ++
  S:    52 YANALY---IASAKTSNLEQTSKALATLGEVLKTDVKLPGMLSAPTLTAADKSQIIQELQRVAGGPGKDNILNNFLSTLAENNRLGVLQGVCEKFAALMSAHNGEIELVITSAQKLDTKTLQRLEAAVAKSEYSQGKKLKVINPDIVGGLVVELGDRTIDLSVSSKIAKL 218
>gi|33594183|ref|NP_881827.1| F0F1 ATP synthase subunit delta [Bordetella pertussis Tohama I] >gi|33598629|ref|NP_886272.1| F0F1 ATP synthase subunit delta [Bordetella parapertussis 12822] >gi|33603580|ref|NP_891140.1| F0F1 ATP synthase subunit delta [Bordetella bronchiseptica RB50] >gi|33564258|emb|CAE43550.1| ATP synthase delta chain [Bordetella pertussis Tohama I] >gi|33574758|emb|CAE39417.1| ATP synthase delta chain [Bordetella parapertussis] >gi|33577705|emb|CAE34970.1| ATP synthase delta chain [Bordetella bronchiseptica RB50] (179 aa)
Score = 93, Expect = 7.1e-02, Identities = 26/115 (22%), Positives = 57/115 (49%)
  Q:    65 NKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           +++F  L KS      +NF+ +L  N+    +  I   F    + H+      I S F +    ++++     +K G +++    +D+ LIGG+++  G+ V D S+K ++ +++
  S:    60 SEVFTGLIKSQLPQAARNFIELLVKNDRLLLLPVIATQFVALKNRHEGTAQAEITSAFELSDAQVKELIAALELKFGLKLKPHVSVDQELIGGVRVAVGDQVLDTSVKAQLARLR 174
>gi|157804176|ref|YP_001492725.1| F0F1 ATP synthase subunit delta [Rickettsia canadensis str. McKiel] >gi|157785439|gb|ABV73940.1| F0F1 ATP synthase subunit delta [Rickettsia canadensis str. McKiel] (214 aa)
Score = 93, Expect = 7.2e-02, Identities = 49/178 (27%), Positives = 89/178 (50%)
  Q:     1 MEEKNHIDHYANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKL-DEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           M + N I +Y  AL++  +  + ++K+        I   + +N ++   + S I++K +K K +N +      +  N  + NFL +L   NF   IL   IS F KL  E +N   +++ S   ++ K  E I+     +  ++      ID ++IGG+ I + + + DYSIKG +D+I
  S:    31 MNKNNLIGNYTIALFNNAMVDNIQDKVF--EEITSINSIITDNVDIREFLFSPIVNKNDKIKAINSL---AKNTKINTIVYNFLLLL-IKNFRMTILSDIISVFNKLLCESKNIKIVQVISANKLKPKEQEWIKSHIEKELNQKTEILFDIDSNIIGGIVIKYDSMLQDYSIKGSLDKI 203
>gi|163803600|ref|ZP_02197466.1| F0F1 ATP synthase subunit delta [Vibrio campbellii AND4] >gi|159172594|gb|EDP57452.1| F0F1 ATP synthase subunit delta [Vibrio campbellii AND4] (177 aa)
Score = 92, Expect = 7.4e-02, Identities = 24/115 (20%), Positives = 59/115 (51%)
  Q:    64 LNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           + +IF  +     + + +N + V+ +N     + ++   FF    EH+  + + + S   +  + L KI     ++  ++V+    +D++L+GG+ I  G+ V D S +G+++++
  S:    57 MAEIFVAVCGEQVDAHGQNLIKVMAENGRLSALPDVCEQFFLLKKEHEKEIDVEVISASELSDEQLAKIGSKLEVRLERKVKLNCSVDETLLGGVIIRAGDLVIDDSARGRLNRL 171
>gi|16124232|ref|NP_407545.1| F0F1 ATP synthase subunit delta [Yersinia pestis CO92] >gi|22128006|ref|NP_671429.1| F0F1 ATP synthase subunit delta [Yersinia pestis KIM] >gi|45443754|ref|NP_995293.1| F0F1 ATP synthase subunit delta [Yersinia pestis biovar Microtus str. 91001] >gi|51598254|ref|YP_072445.1| F0F1 ATP synthase subunit delta [Yersinia pseudotuberculosis IP 32953] >gi|108810159|ref|YP_654075.1| F0F1 ATP synthase subunit delta [Yersinia pestis Antiqua] >gi|108814141|ref|YP_649908.1| F0F1 ATP synthase subunit delta [Yersinia pestis Nepal516] >gi|145601149|ref|YP_001165225.1| F0F1 ATP synthase subunit delta [Yersinia pestis Pestoides F] >gi|150260942|ref|ZP_01917670.1| ATP synthase delta subunit protein [Yersinia pestis CA88-4125] >gi|153949432|ref|YP_001403121.1| F0F1 ATP synthase subunit delta [Yersinia pseudotuberculosis IP 31758] >gi|162420685|ref|YP_001608475.1| F0F1 ATP synthase subunit delta [Yersinia pestis Angola] >gi|165926102|ref|ZP_02221934.1| ATP synthase F1, delta subunit [Yersinia pestis biovar Orientalis str. F1991016] >gi|165939965|ref|ZP_02228502.1| ATP synthase F1, delta subunit [Yersinia pestis biovar Orientalis str. IP275] >gi|166009622|ref|ZP_02230520.1| ATP synthase F1, delta subunit [Yersinia pestis biovar Antiqua str. E1979001] >gi|166213376|ref|ZP_02239411.1| ATP synthase F1, delta subunit [Yersinia pestis biovar Antiqua str. B42003004] >gi|167401536|ref|ZP_02307030.1| ATP synthase F1, delta subunit [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167422831|ref|ZP_02314584.1| ATP synthase F1, delta subunit [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167425484|ref|ZP_02317237.1| ATP synthase F1, delta subunit [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|170026427|ref|YP_001722932.1| ATP synthase F1, delta subunit [Yersinia pseudotuberculosis YPIII] >gi|186897465|ref|YP_001874577.1| ATP synthase F1, delta subunit [Yersinia pseudotuberculosis PB1/+] >gi|21961154|gb|AAM87680.1|AE014015_5 membrane-bound ATP synthase, F1 sector, delta-subunit [Yersinia pestis KIM] >gi|45438624|gb|AAS64170.1| ATP synthase delta subunit protein [Yersinia pestis biovar Microtus str. 91001] >gi|51591536|emb|CAH23208.1| ATP synthase delta subunit protein [Yersinia pseudotuberculosis IP 32953] >gi|108777789|gb|ABG20308.1| ATP synthase delta subunit protein [Yersinia pestis Nepal516] >gi|108782072|gb|ABG16130.1| ATP synthase delta subunit protein [Yersinia pestis Antiqua] >gi|115349711|emb|CAL22692.1| ATP synthase delta subunit protein [Yersinia pestis CO92] >gi|145212845|gb|ABP42252.1| ATP synthase delta subunit protein [Yersinia pestis Pestoides F] >gi|149290350|gb|EDM40427.1| ATP synthase delta subunit protein [Yersinia pestis CA88-4125] >gi|152960927|gb|ABS48388.1| ATP synthase F1, delta subunit [Yersinia pseudotuberculosis IP 31758] >gi|162353500|gb|ABX87448.1| ATP synthase F1, delta subunit [Yersinia pestis Angola] >gi|165912091|gb|EDR30731.1| ATP synthase F1, delta subunit [Yersinia pestis biovar Orientalis str. IP275] >gi|165921962|gb|EDR39139.1| ATP synthase F1, delta subunit [Yersinia pestis biovar Orientalis str. F1991016] >gi|165991544|gb|EDR43845.1| ATP synthase F1, delta subunit [Yersinia pestis biovar Antiqua str. E1979001] >gi|166205674|gb|EDR50154.1| ATP synthase F1, delta subunit [Yersinia pestis biovar Antiqua str. B42003004] >gi|166958223|gb|EDR55244.1| ATP synthase F1, delta subunit [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167048918|gb|EDR60326.1| ATP synthase F1, delta subunit [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167055498|gb|EDR65291.1| ATP synthase F1, delta subunit [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|169752961|gb|ACA70479.1| ATP synthase F1, delta subunit [Yersinia pseudotuberculosis YPIII] >gi|186700491|gb|ACC91120.1| ATP synthase F1, delta subunit [Yersinia pseudotuberculosis PB1/+] (177 aa)
Score = 92, Expect = 7.4e-02, Identities = 23/98 (23%), Positives = 51/98 (52%)
  Q:    81 KNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           +NF+ V+ +N     + E+   F Q     ++ + + + S   +  + L KI      +  ++V+    IDKS++ G+ I  G+ V D S++G+++++
  S:    74 QNFIRVMAENGRLLVLPEVLQQFIQLRASLESTVDVEVSSARALNDEQLAKIAAAMEKRLSRKVKLNCKIDKSVMAGVVIRAGDMVIDGSVRGRLERL 171
>gi|119475223|ref|ZP_01615576.1| H+-transporting two-sector ATPase, delta (OSCP) subunit [marine gamma proteobacterium HTCC2143] >gi|119451426|gb|EAW32659.1| H+-transporting two-sector ATPase, delta (OSCP) subunit [marine gamma proteobacterium HTCC2143] (178 aa)
Score = 92, Expect = 7.6e-02, Identities = 32/140 (22%), Positives = 71/140 (50%)
  Q:    45 EMVH-IIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIEN 184
           E +H I+ S  ++ +++ K     F D+     +  ++NF+ VL +N     + EI   F Q     +  + + + + F ++  + +K+    S K  + V  +  ID +L+GG+ I   + V D SI+G++ ++  ++++
  S:    42 EKIHKILSSPSLTSDQQAKQ----FIDVCGDELSDGVRNFVEVLAENKRISLLPEIVGLFEQFKSNREKSVDVNVTTVFELDNDVQQKLSTSLSRKLDRDVNLQTTIDTTLLGGVVIRAADIVIDGSIRGRLAKLAESMQS 178
>gi|84702329|ref|ZP_01016904.1| ATP synthase F1, delta subunit [Parvularcula bermudensis HTCC2503] >gi|84691575|gb|EAQ17415.1| ATP synthase F1, delta subunit [Parvularcula bermudensis HTCC2503] (182 aa)
Score = 92, Expect = 7.8e-02, Identities = 38/176 (21%), Positives = 86/176 (48%)
  Q:     8 DHYANALYSIWLE---LDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEH----LFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIE 183
           + Y+ AL+ + LE   LD   + + +        +L N+ ++  +I S +   + K   L  +   L ++ ++  + NF  +L+ N     +  I  +F ++L +H+     R+ +  +  K L ++ E           GK V     +D SL+GG+ +  G+ + D S++ K+++++  ++
  S:    10 ERYSEALFDLALENGELDAVERDLLSLEK-----ALANSEDLRRLIKSPVFDNDTKQAGLVAV---LERAAASRTVLNFARLLSANGRASALPGIIAAFNRRLAKHRG----RVAAEAISAKPLTDEQERDLRSRLEAAVGKTVELSTQVDPSLLGGLIVKVGSRMIDSSLRTKLNRLQQTLK 180
>gi|59802444|ref|YP_209156.1| F0F1 ATP synthase subunit delta [Neisseria gonorrhoeae FA 1090] >gi|121635593|ref|YP_975838.1| F0F1 ATP synthase subunit delta [Neisseria meningitidis FAM18] >gi|59719339|gb|AAW90744.1| putative ATP synthase delta chain [Neisseria gonorrhoeae FA 1090] >gi|120867299|emb|CAM11070.1| ATP synthase delta chain [Neisseria meningitidis FAM18] (177 aa)
Score = 92, Expect = 8.0e-02, Identities = 40/175 (22%), Positives = 77/175 (44%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIEN 184
           YA AL+ +  E   KN+I       +   ++    ++  +ID    +  EK  IL     DL   + +  LKNF+ VL        + E++  +        +     IYS + +  K + ++  + + +    ++    I+  LIGG+K+  G+ V D S++GK+  +   + N
  S:    11 YAKALFGLAQE---KNQIESWLGGLEKLAAVVQEGKVASLIDRPETNASEKADIL----IDLV-GLKDKELKNFVIVLAGQKRLSILPEVYAQYQDLTLSFNHIKSAVIYSAYPLTDKQVGELAQMLNKRFDSELKISVEIEPELIGGIKVEVGDQVLDLSVQGKLSALYTTMTN 177
>gi|2493036|sp|P72244|ATPD_RHOCA ATP synthase delta chain >gi|1524321|emb|CAA67907.1| FoF1 ATP synthase [Rhodobacter capsulatus] (186 aa)
Score = 92, Expect = 8.2e-02, Identities = 34/170 (20%), Positives = 75/170 (44%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           YA A++   L  + K     ++    +  +L  + E+  +I S + ++EE+   +  +   +  S     L N L ++        + ++       + E +  +   + S   +     EK+    + +TGK V+    +D+SLIGGM +  G+ + D ++K K+  ++
  S:    15 YATAIFD--LAQEAKGIDALSADVDALTAALAGSAELRDLISSPVYTREEQGDAIAAVAAKMGLSAP---LANGLKLMATKRRLFALPQLLKGLAAAIAEAKGEMTADVTSATALSAAQAEKLAATLAKQTGKTVKLNVAVDESLIGGMIVKLGSRMIDTTVKAKLASLQ 179
>gi|15233985|ref|NP_192703.1| ATP synthase delta chain, chloroplast, putative / H(+)-transporting two-sector ATPase, delta (OSCP) subunit, putative [Arabidopsis thaliana] >gi|7267660|emb|CAB78088.1| H+-transporting ATP synthase-like protein [Arabidopsis thaliana] >gi|7321084|emb|CAB82132.1| H+-transporting ATP synthase-like protein [Arabidopsis thaliana] >gi|17473800|gb|AAL38334.1| H+-transporting ATP synthase-like protein [Arabidopsis thaliana] >gi|21386985|gb|AAM47896.1| H+-transporting ATP synthase-like protein [Arabidopsis thaliana] >gi|21593484|gb|AAM65451.1| H+-transporting ATP synthase-like protein [Arabidopsis thaliana] >gi|21689783|gb|AAM67535.1| putative H+-transporting ATP synthase [Arabidopsis thaliana] (234 aa)
Score = 92, Expect = 8.3e-02, Identities = 41/129 (31%), Positives = 66/129 (51%)
  Q:    55 ISKEEKTKILNKIFFDLSKSIS-NIYLKNFLFVLNDNNFFKRILEIFISF---FQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTG-KRVRYENIIDKSLIGGMKIMF---GNDVYDYSIKGKIDQIKWNIE 183
           I+ E+K ++++    D+ KS S   +  NFL VL D N    + EI   F   + KL + Q      + S   +E   L +I       TG K VR + +ID SL+ G  I +   G+ + D S+K +++ I   +E
  S:    97 ITVEKKRQVID----DIVKSSSLQSHTSNFLNVLVDANRINIVTEIVKEFELVYNKLTDTQ---LAEVRSVVKLEAPQLAQIAKQVQKLTGAKNVRVKTVIDASLVAGFTIRYGESGSKLIDMSVKKQLEDIASQLE 226
>gi|18491181|gb|AAL69493.1| putative H+-transporting ATP synthase [Arabidopsis thaliana] (250 aa)
Score = 92, Expect = 8.3e-02, Identities = 41/129 (31%), Positives = 66/129 (51%)
  Q:    55 ISKEEKTKILNKIFFDLSKSIS-NIYLKNFLFVLNDNNFFKRILEIFISF---FQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTG-KRVRYENIIDKSLIGGMKIMF---GNDVYDYSIKGKIDQIKWNIE 183
           I+ E+K ++++    D+ KS S   +  NFL VL D N    + EI   F   + KL + Q      + S   +E   L +I       TG K VR + +ID SL+ G  I +   G+ + D S+K +++ I   +E
  S:   113 ITVEKKRQVID----DIVKSSSLQSHTSNFLNVLVDANRINIVTEIVKEFELVYNKLTDTQ---LAEVRSVVKLEAPQLAQIAKQVQKLTGAKNVRVKTVIDASLVAGFTIRYGESGSKLIDMSVKKQLEDIASQLE 242
>gi|167472354|ref|ZP_02337058.1| ATP synthase delta chain [Rickettsia africae ESF-5] (184 aa)
Score = 92, Expect = 8.4e-02, Identities = 44/179 (24%), Positives = 90/179 (50%)
  Q:     1 MEEKNHIDHYANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           M + N I +YA AL +  +  + ++KI        I   + +N+++   + S I++K +K   +N +  ++  S     ++NFL +L  N+    +  I  ++   L E +N   +++ S   ++ K  E I+     +  ++      ID ++IGG+ I + + + DYSIKG +++IK
  S:     1 MNKGNLIKNYAVALLNNAMVDNIQDKIF--EEITSINRIITDNFDIREFLFSPIVNKNDKINAVNLLAKNIKIST---IVQNFLLLLVKNSRTAILSNIVNAYNTLLYESKNIKIVQVISANKLQPKEQEWIKSRIEKELNQKTEILFDIDNTIIGGIVIKYDSMLQDYSIKGSLEKIK 174
>gi|161523283|ref|YP_001578295.1| F0F1 ATP synthase subunit delta [Burkholderia multivorans ATCC 17616] >gi|189351944|ref|YP_001947572.1| F-type H+-transporting ATPase delta chain [Burkholderia multivorans ATCC 17616] >gi|160340712|gb|ABX13798.1| ATP synthase F1, delta subunit [Burkholderia multivorans ATCC 17616] >gi|189335966|dbj|BAG45036.1| F-type H+-transporting ATPase delta chain [Burkholderia multivorans ATCC 17616] (179 aa)
Score = 92, Expect = 8.5e-02, Identities = 25/99 (25%), Positives = 51/99 (51%)
  Q:    81 KNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           KNF+ +L DN+    + EI   F    +E +      I S F ++   L+ +      K  ++++    +D SLIGG+++  G++V D S++ ++  ++
  S:    76 KNFVQMLVDNHRIALLPEIAEQFEALKNEREGAADAEIVSAFPLDGADLDSLVASLERKFKRKLKPTVEVDSSLIGGVRVTVGDEVLDTSVRARLASMQ 174
>gi|189501404|ref|YP_001960874.1| ATP synthase F1, delta subunit [Chlorobium phaeobacteroides BS1] >gi|189496845|gb|ACE05393.1| ATP synthase F1, delta subunit [Chlorobium phaeobacteroides BS1] (180 aa)
Score = 92, Expect = 8.7e-02, Identities = 30/135 (22%), Positives = 71/135 (52%)
  Q:    45 EMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLF--VLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           +++ ++ S +++ + K +IL ++F   + ++S    K  LF  +L        + ++   F    DE    + + + S   +  +   K+ +  S+ TGK+VR    +D+ LIGG+K+  G+ + D ++  +++++K
  S:    43 DLLTMLRSPVVNGDLKARILKEVF---NGAVSG---KTMLFFELLCRKKRAGLLADVIEEFSALRDERGGVVNVDVTSAVKLNDEQSRKLINGLSVYTGKKVRARLSLDEHLIGGVKVQIGDTILDNTVVHQLERLK 173
>gi|77977933|ref|ZP_00833370.1| COG0712: F0F1-type ATP synthase, delta subunit (mitochondrial oligomycin sensitivity protein) [Yersinia intermedia ATCC 29909] (177 aa)
Score = 92, Expect = 9.2e-02, Identities = 23/98 (23%), Positives = 52/98 (53%)
  Q:    81 KNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           +NF+ V+ +N     + E+   F Q     ++ + + + S   ++ + L KI      +  ++V+    IDKS++ G+ I  G+ V D S++G+++++
  S:    74 QNFIRVMAENGRLLVLPEVLQQFIQLRASLESTVDVEVSSASPLKDEQLAKIAAAMEKRLSRKVKLNCKIDKSVMAGVVIRAGDMVIDGSVRGRLERL 171
>gi|193216469|ref|YP_001999711.1| ATP synthase delta subunit [Mycoplasma arthritidis 158L3-1] >gi|193001792|gb|ACF07007.1| ATP synthase delta subunit [Mycoplasma arthritidis 158L3-1] (179 aa)
Score = 91, Expect = 9.7e-02, Identities = 36/143 (25%), Positives = 76/143 (53%)
  Q:    40 LKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNI 182
           LK N   + I++S  +  + K + +++ F     S +NI+L NF+ +       K +++I + F +  ++  N  +  I++   +++  +++ E   S K   +V  +N ID SLI G+KI   + V + SI G ++++K ++
  S:    39 LKRNKRYLEILNSYNVDLDVKFQKIDEAF-----SGNNIHLINFIKLAAKAAVAKFLIQILVRFVEISNQKLNVKYGTIFTTIALDEVKVKEFESKISKKLNAKVILKNEIDPSLIAGIKIKIDDYVVENSISGYLNELKKSV 176
>gi|113955351|ref|YP_731511.1| F0F1 ATP synthase subunit delta [Synechococcus sp. CC9311] >gi|113882702|gb|ABI47660.1| ATP synthase F1, delta subunit [Synechococcus sp. CC9311] (182 aa)
Score = 91, Expect = 1.0e-01, Identities = 39/169 (23%), Positives = 79/169 (46%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLF--IRIYSPFVVEKK--LLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           YA+AL  +     +  ++   +  KD+  + +++  +   + S ++  E K K L  +   LS+ ++   L N L VL D      +  + + + +   E +N     +R   P   E++  L  K++   S+     V  +  +D SLIGG  +  G+ V D S+ G++ ++
  S:    11 YADALLQVTDVRQESEEV--ANQCKDLLSAWESSEPLRDAMTSPVLEPEAKKKALTSL---LSEQVTP-SLMNLLKVLADRQRLPALEAVLLRYLELYRESRNIALAHVRAAQPLTEEQQAALTTKVQ---SMAGTNAVEIDLKVDPSLIGGFVVNLGSQVIDASLSGQVRRL 174
>gi|2493038|sp|Q40610|ATPD_OCHNE ATP synthase delta chain, chloroplast >gi|1430914|emb|CAA67539.1| subunit delta of ATPase [Ochrosphaera neapolitana] (179 aa)
Score = 91, Expect = 1.0e-01, Identities = 44/171 (25%), Positives = 86/171 (50%)
  Q:     8 DHYANALYSIWLELDKKNKII--FTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNN---FFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTG-KRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           D YA AL    LEL   NK +   T+    +   L N+ ++   + + +I++E K  +L  +   L + IS++ L NFL +L +     F  +I + F+    K D  +     ++ S   +  +  +++     + TG K+++    ++  LIGG  +  G+ + D SI+G++ +I
  S:     8 DAYAEAL----LELANSNKSLKETTNDMNIVSQFLANSSDLKKFLGNPLITRERKKNVLKDV---LGEQISSVSL-NFLMLLVNRGRVAFLDKIAQKFLELSYKQDAIE---IAKVTSSVALSAQQQKELAGKLKLITGAKKIKLALRVEPKLIGGFTVEIGSKLIDTSIRGQLKKI 173
>gi|49218|emb|CAA49874.1| ATP synthase (delta); H(+)-transporting ATP synthase [Synechococcus sp.] (185 aa)
Score = 91, Expect = 1.0e-01, Identities = 38/172 (22%), Positives = 81/172 (47%)
  Q:     7 IDHYANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDN---NFFKRILEIFISFFQKLDEHQNFLFIRIYSPF-VVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           ++ YA AL S+    +  ++  F   +  I   L  + E+   + + +I+ + K  +L ++  D        Y  NFL +L D    N    I + + +  +KL   +N +   + S   + E++    +E + ++     V     ID  L+GG+ I  G+ ++D S++G++ ++
  S:    11 VEPYAEALLSLAQSHNLADQ--FQQDSGLILDLLAASAELQEFLANPLINPDAKKNVLRQLTVDKVHG----YFLNFLMLLVDRRRINLLAAICQQYRALLRKL---RNIVLAEVISAVELTEQQRHAVVEKVKTMTGAADVELAIAIDPELLGGVVIKVGSQIFDASLRGQLRRL 177
>gi|461572|sp|Q05374|ATPD_SYNP1 ATP synthase delta chain (184 aa)
Score = 91, Expect = 1.0e-01, Identities = 38/172 (22%), Positives = 81/172 (47%)
  Q:     7 IDHYANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDN---NFFKRILEIFISFFQKLDEHQNFLFIRIYSPF-VVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           ++ YA AL S+    +  ++  F   +  I   L  + E+   + + +I+ + K  +L ++  D        Y  NFL +L D    N    I + + +  +KL   +N +   + S   + E++    +E + ++     V     ID  L+GG+ I  G+ ++D S++G++ ++
  S:    10 VEPYAEALLSLAQSHNLADQ--FQQDSGLILDLLAASAELQEFLANPLINPDAKKNVLRQLTVDKVHG----YFLNFLMLLVDRRRINLLAAICQQYRALLRKL---RNIVLAEVISAVELTEQQRHAVVEKVKTMTGAADVELAIAIDPELLGGVVIKVGSQIFDASLRGQLRRL 176
>gi|83854835|ref|ZP_00948365.1| ATP synthase delta chain [Sulfitobacter sp. NAS-14.1] >gi|83941358|ref|ZP_00953820.1| ATP synthase delta chain [Sulfitobacter sp. EE-36] >gi|83842678|gb|EAP81845.1| ATP synthase delta chain [Sulfitobacter sp. NAS-14.1] >gi|83847178|gb|EAP85053.1| ATP synthase delta chain [Sulfitobacter sp. EE-36] (188 aa)
Score = 91, Expect = 1.0e-01, Identities = 41/170 (24%), Positives = 80/170 (47%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIF--FDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDE----HQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           YA A+Y +  E     +I        +  +L  + +   +I+S I ++E++   ++ I    DLS+++++         L  N   KR L +     Q L +     +  +   + S   + K   EK+    +  TGK+V     +D SLIGG+ +  G+ + D SI+ K++ ++
  S:    17 YATAVYELAQEAKALPQI--EKDLDALQAALAESEDFRDLINSPIYTREQQAASISAIAKKMDLSQTLAST------LELMAN---KRRLFVLPQLVQNLRDIIAVEKGEVTADVISAKALTKAQSEKLSKSLAATTGKKVTLNATVDDSLIGGLIVKVGSKMIDTSIRAKLNSLQ 181
>gi|110680696|ref|YP_683703.1| ATP synthase F1, delta subunit [Roseobacter denitrificans OCh 114] >gi|109456812|gb|ABG33017.1| ATP synthase F1, delta subunit [Roseobacter denitrificans OCh 114] (186 aa)
Score = 91, Expect = 1.0e-01, Identities = 35/170 (20%), Positives = 76/170 (44%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           YA A+Y I    D K+          +  +L  + +   +I S I ++EE+   ++ +   +  S +   + N L ++        + ++  +  + + E +  +   + S   + K   +K+       TGK V     +D+SLIGG+ +  G+ + D SI+ K++ ++
  S:    15 YATAVYDI--AKDSKSVKTLEDDINVLQGALAESADFGALIMSPIYTREEQEAAISALAAKMGLSAT---MANTLSLMAQKRRLFVVPQLLSTLREIIAEDKGEVTADVVSAKALTKTQADKLAKTLKASTGKTVTLNASVDESLIGGLVVKVGSRMIDTSIRSKLNSLQ 179
>gi|32490754|ref|NP_871008.1| hypothetical protein WGLp005 [Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis] >gi|25165960|dbj|BAC24151.1| atpH [Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis] (176 aa)
Score = 91, Expect = 1.0e-01, Identities = 35/108 (32%), Positives = 54/108 (50%)
  Q:    68 FFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKI 175
            F+  K+  ++Y  NF+ ++ +NN      EI   F    ++  N   I I S + ++KK+L KIE        K ++    IDKS+IGG  I   N + D SIK K+
  S:    62 LFESIKNNFDVYFNNFVKIIIENNRLIIFPEILNQFINLKNDQNNIENITIISKYKLDKKILNKIEKKIKSLIFKEIKINIKIDKSIIGGYIIKSKNFLIDNSIKNKL 169
>gi|170759969|ref|YP_001785482.1| ATP synthase F1, delta subunit [Clostridium botulinum A3 str. Loch Maree] >gi|169406958|gb|ACA55369.1| ATP synthase F1, delta subunit [Clostridium botulinum A3 str. Loch Maree] (179 aa)
Score = 91, Expect = 1.1e-01, Identities = 43/170 (25%), Positives = 80/170 (47%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           YA ALY +  E +K ++  +    K++   +KN+ ++  I+    IS   K +I  +IF    K   +  + +FL VL +      + E      +   E  N +   + +   + K+  E++      K  K++  E  IDKS+IGG+ +  G+DV D ++  ++  IK
  S:     9 YALALYEVAEENNKVDE--YLRDLKEVVNIIKNSEDICKILKHPEISTSRKKEIFTEIF----KDKVDDKILSFLLVLIEKERILYLEEKLKEMEKIYLEKNNMILANVKTVIPLLKEEREELIEKLGNKYNKKIILEEEIDKSIIGGVYVRVGDDVLDGTLSTRLKDIK 172
>gi|15893161|ref|NP_360875.1| F0F1 ATP synthase subunit delta [Rickettsia conorii str. Malish 7] >gi|22001521|sp|Q92G85|ATPD_RICCN ATP synthase delta chain >gi|15620372|gb|AAL03776.1| ATP synthase delta chain [EC:3.6.1.34] [Rickettsia conorii str. Malish 7] (184 aa)
Score = 91, Expect = 1.1e-01, Identities = 44/179 (24%), Positives = 89/179 (49%)
  Q:     1 MEEKNHIDHYANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           M + N I +YA AL +  +  + ++KI        I   + +N+++   + S I++K +K   +N +  ++  S     ++NFL +L  N+    +  I  ++   L E +N   +++ S   ++ K  E I+     +  +       ID ++IGG+ I + + + DYSIKG +++IK
  S:     1 MNKGNLIKNYAVALLNNAMVDNIQDKIF--EEITSINRIITDNFDIREFLFSPIVNKNDKINAVNSLAKNIKIST---IVQNFLLLLVKNSRTAILSNIVDAYNTLLYESKNIKIVQVISANKLQPKEQEWIKSRIEKELNQTTEILFDIDNTIIGGIIIKYDSMLQDYSIKGSLEKIK 174
>gi|15616635|ref|NP_239847.1| F0F1 ATP synthase subunit delta [Buchnera aphidicola str. APS (Acyrthosiphon pisum)] >gi|11131209|sp|P57121|ATPD_BUCAI ATP synthase delta chain >gi|25529194|pir||E84930 H+-transporting two-sector ATPase (EC 3.6.3.14) delta chain [imported] - Buchnera sp. (strain APS) >gi|10038698|dbj|BAB12733.1| ATP synthase delta chain [Buchnera aphidicola str. APS (Acyrthosiphon pisum)] (177 aa)
Score = 91, Expect = 1.1e-01, Identities = 29/126 (23%), Positives = 63/126 (50%)
  Q:    53 NIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           N +S     K L+ IF  +  +I +   KN + +L++N  F  +  IF  F +    ++N + +++ S F +++ L+ KI  +      K+ +    +D +++ GM +   N ++D S +  + Q+
  S:    46 NFLSGSISPKYLSLIFITIGTNIIDENAKNLIKLLSENQRFNILNNIFERFVKLEACYKNIIIVQLKSAFSLKENLINKIRKVLERFFLKKTKIIYKVDPNILNGMIVKVNNTIFDLSAQNHLKQL 171
>gi|167587931|ref|ZP_02380319.1| F0F1 ATP synthase subunit delta [Burkholderia ubonensis Bu] (179 aa)
Score = 91, Expect = 1.1e-01, Identities = 25/99 (25%), Positives = 50/99 (50%)
  Q:    81 KNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           KNF+ +L DN+    + EI + F    +  +      I S F +    LE +      K  ++++    +D SLIGG+++  G++V D S++ ++  ++
  S:    76 KNFVQMLVDNHRIALLPEIAVQFDALKNAREGAADATIVSAFPLNGTDLEGLVASLERKFKRKLKPTVEVDSSLIGGVRVTVGDEVLDSSVRARLASMQ 174
>gi|19076005|ref|NP_588505.1| F0-ATPase delta subunit [Schizosaccharomyces pombe] >gi|27734219|sp|O74479|ATPO_SCHPO ATP synthase subunit 5, mitochondrial precursor (ATP synthase chain 5) (Oligomycin sensitivity conferral protein) (OSCP) >gi|7160223|emb|CAA20129.2| F0-ATPase delta subunit [Schizosaccharomyces pombe] (216 aa)
Score = 91, Expect = 1.2e-01, Identities = 39/169 (23%), Positives = 85/169 (50%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISN-IYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIE-HLFSIKTGK-RVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           YA++LY+  ++  K + +    +   +   L+   E    I S  +++E+K  +++     L++   N   LKNF  VL DN+    +  I   F   +   +  + ++I S   ++ K+L ++E  +   K GK ++   N +  S+IGG+ +  G+++ D S+  +++ +
  S:    43 YASSLYTAAVKESKLDNV--EKALNKLSGVLQQRPEFEQYISSPWLTREDKKILVSS----LTQMTGNEPLLKNFYNVLLDNHRLYLLTRIQKQFSTLMRAKRGEIEVKITSATPLDSKILSRLESRIAKSKYGKGKLLVSNKVTPSIIGGLIVEIGDNILDVSVGSRLNNL 208
>gi|86747394|ref|YP_483890.1| F0F1 ATP synthase subunit delta [Rhodopseudomonas palustris HaA2] >gi|86570422|gb|ABD04979.1| ATP synthase F1, delta subunit [Rhodopseudomonas palustris HaA2] (186 aa)
Score = 91, Expect = 1.2e-01, Identities = 39/170 (22%), Positives = 78/170 (45%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFS--LKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           YA AL+    EL +  K++   +A    F   L ++ +++ ++ S +   E + K L  +   L K+       NFL +L  N     + ++  ++   + + +      +     +  K LE ++      TGK V     +D ++IGG+ +  G+ + D SI+ K++ IK
  S:    15 YATALF----ELARDEKVVDAVTADLDKFKAMLADSPDLLRLVRSPVFGAEAQAKALGAV---LDKAGITGISANFLKLLAANRRLFVVADVIRAYRALVAKFKGEATADVTVAETLGDKNLEALKAALKAVTGKDVTLNINVDPAIIGGLVVKLGSRMVDSSIRTKLNSIK 179
>gi|311237|emb|CAA46804.1| H(+)-transporting ATP synthase [Zea mays] (185 aa)
Score = 91, Expect = 1.2e-01, Identities = 40/176 (22%), Positives = 81/176 (46%)
  Q:     8 DHYANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKI-EHLFSIKTGKRVRYENIIDKSLIGGMKIMFGND---VYDYSIKGKIDQIKWNIE 183
           + YA+AL  + +E     + +      +  FS   +  +    D+  + +EEK +++ +I      S    ++ NFL V+ DN     + +I + F    +         + S   +E + L +I +H+  +   K VR +  +D +LI G  + +G D   + D S++ +I++I    E
  S:     4 ESYASALSEVAVENGTLEQTVSDLEKLEKIFS---DEAVAEFFDNPTVPREEKAELIGEI---AKSSELQPHVVNFLNVVVDNFRASIVPQIVVEFENVYNSLTGTEVATVTSVVQLESQDLAQIAQHVQKMTGAKNVRLKTQLDPALIAGFTVQYGRDGSNLIDMSVRKQIEEIASEFE 177
>gi|77961819|ref|ZP_00825649.1| COG0712: F0F1-type ATP synthase, delta subunit (mitochondrial oligomycin sensitivity protein) [Yersinia mollaretii ATCC 43969] (177 aa)
Score = 91, Expect = 1.2e-01, Identities = 23/98 (23%), Positives = 51/98 (52%)
  Q:    81 KNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           +NF+ V+ +N     + E+   F Q     ++ + + + S   +  + L KI      +  ++V+    IDKS++ G+ I  G+ V D S++G+++++
  S:    74 QNFIRVMAENGRLLVLPEVLQQFIQLRASLESTVDVEVSSASPLNDEQLAKIAAAMEKRLSRKVKLNCKIDKSVMAGVVIRAGDMVIDGSVRGRLERL 171
>gi|114582|sp|P05437|ATPD_RHOBL ATP synthase delta chain >gi|581488|emb|CAA77312.1| ATPase delta subunit [Rhodobacter blasticus] (186 aa)
Score = 90, Expect = 1.3e-01, Identities = 37/172 (21%), Positives = 81/172 (47%)
  Q:     8 DHYANALYSIWLELDKKNKIIFT-----SSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           + YA AL+    EL K+   + T      + KD+   L  + ++  +I S +IS+ ++ K +  I   +  S     + N L ++++      + ++  +    + E +  +   + +   +     +K+      K GK V+    +D+SLIGG+ +  G+ + D S+K K+  ++
  S:    13 ERYATALF----ELSKETGALKTLETDIDALKDV---LAGSPDLGAMIASPVISRGDQAKAVAAIAGKMGLSP---LMTNTLALMSEKRRLFALPQVLSALAGLIAEEKGEVTAEVTAATKLSAAQAKKLAETLKAKVGKTVKLNTTVDESLIGGLIVKLGSTMIDTSVKSKLASLQ 179
>gi|15677767|ref|NP_274931.1| F0F1 ATP synthase subunit delta [Neisseria meningitidis MC58] >gi|7227195|gb|AAF42266.1| ATP synthase F1, delta subunit [Neisseria meningitidis MC58] (177 aa)
Score = 90, Expect = 1.3e-01, Identities = 40/175 (22%), Positives = 77/175 (44%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIEN 184
           YA AL+ +  E   KN+I       +   ++    ++  +ID    +  EK  IL     DL   + +  LKNF+ VL        + E++  +        +     IYS + +  K + ++  + + +    ++    I+  LIGG+K+  G+ V D S++GK+  +   + N
  S:    11 YAKALFGLAQE---KNQIESWLGGLEKLAAVVQEGKVASLIDRPETNASEKADIL----IDLV-GLKDKELKNFVIVLAGQKRLSILPEVYAQYQDLTLSFNHIKSAVIYSAYPLTDKQVGELVQMLNKRFDSELKISVEIEPELIGGIKVEVGDQVLDLSVQGKLSALYTTMTN 177
>gi|183220212|ref|YP_001838208.1| ATP synthase F1, delta subunit [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] >gi|189910330|ref|YP_001961885.1| Delta subunit of the H(+)-transporting two- sector ATPase, F1 sector [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] >gi|167775006|gb|ABZ93307.1| Delta subunit of the H(+)-transporting two- sector ATPase, F1 sector [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] >gi|167778634|gb|ABZ96932.1| ATP synthase F1, delta subunit [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] (187 aa)
Score = 90, Expect = 1.3e-01, Identities = 28/96 (29%), Positives = 49/96 (51%)
  Q:    80 LKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKI 175
           + NF+ ++   N F  + +I   +   +D  +N   +RI S   + K+ +++I    S K G+ VR     D +LIGG KI   + + D SI+ K+
  S:    74 VANFITLVVRKNRFLYLKDILEDYRSGVDRLKNRSSLRIVSKDSLGKEAVDQITKSISSKFGREVRVTEHTDLNLIGGFKIYIDDFLIDASIRAKL 169
>gi|39942144|ref|XP_360609.1| hypothetical protein MGG_03152 [Magnaporthe grisea 70-15] >gi|145015870|gb|EDK00360.1| hypothetical protein MGG_03152 [Magnaporthe grisea 70-15] (230 aa)
Score = 90, Expect = 1.3e-01, Identities = 26/132 (19%), Positives = 70/132 (53%)
  Q:    40 LKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFS----IKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSI 171
           +K + ++  I+ +  ++  +K+ I+ ++  + S   S+  +KN L VL +NN    + E+   F + +   +  + + + S   ++ + L ++E   +    +  GK+++  N +++ ++GG+ +  G+   D S+
  S:    80 VKKDPKLATILGAPTLTASDKSAIVAEL--EKSSGSSSAAVKNLLEVLAENNRLGLLPEVCSKFGELMSAARGEVEMTVTSAQPLDNRTLSRLETAVAKSSYVGAGKKLKVTNQVNRDIVGGLVVEVGDRTIDLSV 213
>gi|195977924|ref|YP_002123168.1| ATP synthase delta chain AtpH [Streptococcus equi subsp. zooepidemicus str. MGCS10565] >gi|195974629|gb|ACG62155.1| ATP synthase delta chain AtpH [Streptococcus equi subsp. zooepidemicus str. MGCS10565] (178 aa)
Score = 90, Expect = 1.3e-01, Identities = 42/182 (23%), Positives = 83/182 (45%)
  Q:     2 EEKNHIDHYANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFS----IKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIE 183
           +E+  I+ YA +L  +  E D    +     A    F   N   +   + S  + + +K +++ ++  D     + IYL NFL V+  N     + ++ +    +L    N   + + S   + ++  +++  + S    +KTG+ +     +D SLIGG  I   N V D SI+ ++   K N++
  S:     4 KEQALIEQYAKSLVQVCQERDTLEALQADVLAILEVFKATN---LAKTLSSLAVPRAKKLELVRQLQGD-----NIIYLNNFLEVMLQNEREAYLYQVLLRVLSELASVSNQYDVTVTSAVPLSEEQKQRVRTVVSKRLAVKTGRLIEK---VDPSLIGGFMISVNNKVIDTSIRRQLQAFKMNLK 178
>gi|78187937|ref|YP_375980.1| F0F1 ATP synthase subunit delta [Pelodictyon luteolum DSM 273] >gi|78167839|gb|ABB24937.1| H+-transporting two-sector ATPase, delta (OSCP) subunit [Pelodictyon luteolum DSM 273] (181 aa)
Score = 90, Expect = 1.3e-01, Identities = 33/150 (22%), Positives = 70/150 (46%)
  Q:    30 TSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           T+  + I  +L  + ++V ++ S +I+ + KT IL +IF    +      +  FL ++        +  I   F   LDE    +   + S   +  +  +++ +  +  TGK VR    +D  +IGG+ +  G+ + D SI+ ++  ++
  S:    28 TAEMEMIGETLAGSRDLVRVLASPLINGDRKTHILEEIF----RGRVGERMMRFLSLIARKKRAGILRGIASEFKVLLDEKNGVVNADVTSATELSGEQAKELVNGLAAYTGKHVRARMTLDPEMIGGVSVQIGDTILDGSIRHQLQVLR 173
>gi|45184759|ref|NP_982477.1| AAL065Cp [Ashbya gossypii ATCC 10895] >gi|52782729|sp|Q75EZ3|ATPO_ASHGO ATP synthase subunit 5, mitochondrial precursor (ATP synthase chain 5) (Oligomycin sensitivity conferral protein) (OSCP) >gi|44980105|gb|AAS50301.1| AAL065Cp [Ashbya gossypii ATCC 10895] (207 aa)
Score = 90, Expect = 1.3e-01, Identities = 23/99 (23%), Positives = 48/99 (48%)
  Q:    80 LKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFS----IKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           ++N + VL +NN    +  +   F +  D H   +   + +   +E KL  ++E   +    I  GK ++ EN++   + GG+ +   +   D SI  +I ++
  S:    97 VQNLMQVLAENNRLNLLQGVAGEFTKLTDAHNGLVQATVTTAQPLEGKLFRRVEKALAQSSFIGAGKTLKLENVVKPEIQGGLIVEVADRTVDLSIASRISKL 199
>gi|116785961|gb|ABK23923.1| unknown [Picea sitchensis] >gi|116791738|gb|ABK26090.1| unknown [Picea sitchensis] (256 aa)
Score = 90, Expect = 1.4e-01, Identities = 29/101 (28%), Positives = 54/101 (53%)
  Q:    82 NFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKI-EHLFSIKTGKRVRYENIIDKSLIGGMKIMF---GNDVYDYSIKGKIDQIKWNI 182
           NFL++L DN     I +I   F    ++  +     + S   +E + L +I + + S+   K VR + +ID SLI G  I +   G+++ D S+K +++++   I
  S:   143 NFLYLLIDNKRMDLIGDIVKEFELAYNKLTDIQLAVVTSVVNLENRHLAEIAKKVQSLTGAKNVRLKTVIDPSLIAGFTIRYGPTGSNIIDMSVKTELEKLASQI 247
>gi|77958189|ref|ZP_00822227.1| COG0712: F0F1-type ATP synthase, delta subunit (mitochondrial oligomycin sensitivity protein) [Yersinia bercovieri ATCC 43970] (177 aa)
Score = 90, Expect = 1.4e-01, Identities = 23/98 (23%), Positives = 51/98 (52%)
  Q:    81 KNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           +NF+ V+ +N     + E+   F Q     ++ + + + S   +  + L KI      +  ++V+    IDKS++ G+ I  G+ V D S++G+++++
  S:    74 QNFIRVMAENGRLLVLPEVLEQFIQLRASLESTVDVEVSSASPLNDEQLAKIAAAMEKRLSRKVKLNCKIDKSVMAGVVIRAGDMVIDGSVRGRLERL 171
>gi|57238813|ref|YP_179949.1| ATP synthase delta chain [Ehrlichia ruminantium str. Welgevonden] >gi|58578742|ref|YP_196954.1| ATP synthase delta chain [Ehrlichia ruminantium str. Welgevonden] >gi|58616802|ref|YP_196001.1| ATP synthase delta chain [Ehrlichia ruminantium str. Gardel] >gi|57160892|emb|CAH57797.1| putative ATP synthase delta chain [Ehrlichia ruminantium str. Welgevonden] >gi|58416414|emb|CAI27527.1| ATP synthase delta chain [Ehrlichia ruminantium str. Gardel] >gi|58417368|emb|CAI26572.1| ATP synthase delta chain [Ehrlichia ruminantium str. Welgevonden] (189 aa)
Score = 90, Expect = 1.4e-01, Identities = 27/100 (27%), Positives = 49/100 (49%)
  Q:    80 LKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           L  F+ V+  NN    +L+IF +F + + +H   + I + S   +  +  + I +    K GK V   N +D S++GG  I  G D+ D S+   +  ++
  S:    75 LSRFILVVVTNNRGNMLLQIFNTFLEYVRKHNKEVSISVTSCSKLTTQEKQGICNALLEKYGKVVSITNTVDPSILGGFIIRVGFDIIDVSLNSYLQSLQ 174
>gi|161869276|ref|YP_001598443.1| F0F1 ATP synthase subunit delta [Neisseria meningitidis 053442] >gi|161594829|gb|ABX72489.1| ATP synthase delta chain [Neisseria meningitidis 053442] (177 aa)
Score = 90, Expect = 1.4e-01, Identities = 32/140 (22%), Positives = 63/140 (45%)
  Q:    45 EMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIEN 184
           ++  +ID    +  EK  IL     DL   + +  LKNF+ VL        + E++  +        +     IYS + +  K + ++  + + +    ++    I+  LIGG+K+  G+ V D S++GK+  +   + N
  S:    43 KVASLIDRPETNASEKADIL----IDLV-GLKDKELKNFVIVLAGQKRLSILPEVYAQYQDLTLSFNHIKSAVIYSAYPLTDKQVGELAQMLNKRFDSELKISVEIEPELIGGIKVEVGDQVLDLSVRGKLSALYTTMTN 177
>gi|156936115|ref|YP_001440031.1| F0F1 ATP synthase subunit delta [Enterobacter sakazakii ATCC BAA-894] >gi|156534369|gb|ABU79195.1| hypothetical protein ESA_04009 [Enterobacter sakazakii ATCC BAA-894] (177 aa)
Score = 90, Expect = 1.5e-01, Identities = 22/98 (22%), Positives = 50/98 (51%)
  Q:    81 KNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           +N + V+ +N   K + ++   F Q     +  + + + S   +  + L KI      +  ++V+    IDKS++ G+ I  G+ V D S++G+++++
  S:    74 QNLIRVMAENGRLKVLPDVLEQFIQLRAALEATVEVEVTSASALSDEQLAKISAAMEKRLSRKVKLNCKIDKSVMAGVIIRSGDTVIDGSVRGRLERL 171
>gi|154484978|ref|ZP_02027426.1| hypothetical protein EUBVEN_02696 [Eubacterium ventriosum ATCC 27560] >gi|149733931|gb|EDM50050.1| hypothetical protein EUBVEN_02696 [Eubacterium ventriosum ATCC 27560] (167 aa)
Score = 90, Expect = 1.5e-01, Identities = 37/130 (28%), Positives = 68/130 (52%)
  Q:    50 IDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDK-SLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           ++S IISK EK  I+ K+F    K I     +NFL V+ D+     I EI  ++++K +E  N L   +       +  L +I++  + K  K      ++++  LIGG  +  G+   D SI+G++++++
  S:    39 LESPIISKNEKYSIIEKVF---PKEI-----ENFLKVVCDHEKMSYIDEIIEAYYKKYNEANNILTATLSYVVEPNENQLSQIKNYLAKKYNKETVELTMVEQPELIGGFVLKVGDIEEDNSIRGRLNRLE 161
>gi|94986844|ref|YP_594777.1| F0F1 ATP synthase subunit delta [Lawsonia intracellularis PHE/MN1-00] >gi|94731093|emb|CAJ54456.1| F1F0-ATPase delta subunit [Lawsonia intracellularis PHE/MN1-00] (188 aa)
Score = 90, Expect = 1.5e-01, Identities = 35/177 (19%), Positives = 85/177 (48%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIF--FDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIENNK 186
           YA AL+ +  E       ++ ++   I   L  + E+ + + + I +  EK  +L K+    D ++ I     KNF  +L +      + +I  SF   LD  +N +  ++ +   +++K   ++      +T +++     ++  ++GG+ +  G+ V+D S++ +++ I+  I+  +
  S:    10 YAQALFDLGKEQSLHEVELYDTALSQIEELLMTSNELTYFLHAPIFTIYEKQGVLLKLLELIDAAQPI-----KNFCLLLAEKERLPLLTQIINSFKVLLDNAKNIVHGQLITAITLDEKKQSELLISLEKQTNRKLELLFQVNPDILGGIVLHIGDKVFDASLRTQLECIRNTIKKGE 183
>gi|168177486|ref|ZP_02612150.1| ATP synthase F1, delta subunit [Clostridium botulinum NCTC 2916] >gi|182671086|gb|EDT83060.1| ATP synthase F1, delta subunit [Clostridium botulinum NCTC 2916] (179 aa)
Score = 90, Expect = 1.5e-01, Identities = 44/170 (25%), Positives = 82/170 (48%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           YA ALY +  E +K ++  +    K++   +KN+ ++  I+    I+   K +I  ++F D    + N  L +FL VL + +    + E      +   E  N +   I +   + K+  E++      K  K++  E  IDKS+IGG+ +  G+DV D ++  ++  IK
  S:     9 YALALYEVAEENNKVDE--YLRDLKEVVNIIKNSEDICKILKHPEINTSRKKEIFTELFKD---KVDNKIL-SFLLVLIEKDRILYLEEKLKEMEKIYLEKNNMILANIKTVIPLLKEEREELIEKLGNKYNKKIILEEEIDKSIIGGVYVRVGDDVLDGTLSTRLKDIK 172
>gi|71894423|ref|YP_278531.1| ATP synthase delta chain [Mycoplasma synoviae 53] >gi|71851211|gb|AAZ43820.1| ATP synthase delta chain [Mycoplasma synoviae 53] (183 aa)
Score = 90, Expect = 1.6e-01, Identities = 31/129 (24%), Positives = 68/129 (52%)
  Q:    40 LKNNYEMVHIIDSNIISKEEKTKILNKIF----FDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYD 168
           ++ N +++  + ++ I+ E++ +++++IF     D+  SI    ++N +FVL          +I + F +  +      F ++ + + +    LEKI+   + KT K V     +D+ L+ G KI+F N +Y+
  S:    38 IEKNPQLITFLKNDEIALEKRFELIDEIFGSLEVDVKNSIKVALVRNMIFVLR---------KIIVDFLKITNYELGIKFAKVITAYPLSDSELEKIQKKLNEKTKKIVEISTEVDEKLLSGYKIIFSNQLYE 161
>gi|22297977|ref|NP_681224.1| F0F1 ATP synthase subunit delta [Thermosynechococcus elongatus BP-1] >gi|22294155|dbj|BAC07986.1| H+-transporting ATP synthase delta chain [Thermosynechococcus elongatus BP-1] (185 aa)
Score = 90, Expect = 1.6e-01, Identities = 41/172 (23%), Positives = 82/172 (47%)
  Q:     7 IDHYANALYSIWLELDKKNKII--FTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDN---NFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVV----EKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           ++ YA AL    L L + + +I  F    + +   + ++ E+   + + +I  E K  +L ++  D        Y  NFL +L D    NF   I E + +  +KL   +N     + S   +     + ++EK++   ++     V      D  LIGG+ I  G+ ++D S++G++ ++
  S:    11 VEPYAEAL----LSLAQTHNLIDQFQQDTQLMVELVASSGELQQFLANPLIKPEAKKNVLRQLTVDKVHG----YFLNFLMLLVDRRRINFLSSICEHYRALVRKL---RNVALAEVTSAVELNDDQRRAVVEKVK---TMTGAADVELVTACDPELIGGVVIKVGSQIFDASLRGQLRRL 177
>gi|107024494|ref|YP_622821.1| F0F1 ATP synthase subunit delta [Burkholderia cenocepacia AU 1054] >gi|116688127|ref|YP_833750.1| F0F1 ATP synthase subunit delta [Burkholderia cenocepacia HI2424] >gi|170731474|ref|YP_001763421.1| ATP synthase F1, delta subunit [Burkholderia cenocepacia MC0-3] >gi|194557680|ref|YP_002092706.1| F0F1-type ATP synthase, delta subunit [Burkholderia cenocepacia PC184] >gi|105894683|gb|ABF77848.1| ATP synthase F1, delta subunit [Burkholderia cenocepacia AU 1054] >gi|116646216|gb|ABK06857.1| ATP synthase F1, delta subunit [Burkholderia cenocepacia HI2424] >gi|124871471|gb|EAY63187.1| F0F1-type ATP synthase, delta subunit [Burkholderia cenocepacia PC184] >gi|169814716|gb|ACA89299.1| ATP synthase F1, delta subunit [Burkholderia cenocepacia MC0-3] (179 aa)
Score = 89, Expect = 1.6e-01, Identities = 25/99 (25%), Positives = 50/99 (50%)
  Q:    81 KNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           KNF+ +L DN+    + EI   F    +E +      I S F +    L+ +      K  ++++    +D SLIGG+++  G++V D S++ ++  ++
  S:    76 KNFVQMLVDNHRIALLPEIAEQFEALKNEREGAADAEIVSAFPLNGADLDSLVSGLERKFKRKLKPTVEVDSSLIGGVRVTVGDEVLDTSVRARLASMQ 174
>gi|188535586|ref|YP_001909383.1| ATP synthase, F1 complex, delta subunit [Erwinia tasmaniensis] >gi|188030628|emb|CAO98524.1| ATP synthase, F1 complex, delta subunit [Erwinia tasmaniensis] (177 aa)
Score = 89, Expect = 1.7e-01, Identities = 22/98 (22%), Positives = 47/98 (47%)
  Q:    81 KNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           +N + V+ +N     +  +   F Q    H     + + S   +  + L KI      +  ++V+    IDKS++ G+ I  G+ V D S++G+++++
  S:    74 QNLIKVMAENGRLPTLTAVLEQFIQLRAAHDATAEVEVISSTTLSDEQLTKISAAMEKRLSRKVKLNCKIDKSVMAGVIIRAGDMVIDGSVRGRLERL 171
>gi|156972759|ref|YP_001443666.1| F0F1 ATP synthase subunit delta [Vibrio harveyi ATCC BAA-1116] >gi|156524353|gb|ABU69439.1| hypothetical protein VIBHAR_00424 [Vibrio harveyi ATCC BAA-1116] (177 aa)
Score = 89, Expect = 1.7e-01, Identities = 24/115 (20%), Positives = 58/115 (50%)
  Q:    64 LNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           L +IF  +     + + +N + V+ +N     + ++   FF    EH+  + + + S   +  + L  I     ++  ++V+    +D++L+GG+ I  G+ V D S +G+++++
  S:    57 LAEIFVAVCGEQVDAHGQNLIKVMAENGRLTALPDVCEQFFLLKKEHEKEIDVEVISASELSDEQLANIGSKLEVRLERKVKLNCSVDETLLGGVIIRAGDLVIDNSARGRLNRL 171
>gi|157746455|ref|XP_001668323.1| Hypothetical protein CBG12309 [Caenorhabditis briggsae AF16] >gi|187029449|emb|CAP31305.1| C. briggsae CBR-ATP-3 protein [Caenorhabditis briggsae] (207 aa)
Score = 89, Expect = 1.7e-01, Identities = 40/170 (23%), Positives = 81/170 (47%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVH-IIDSNIISKEEKTKI-LNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSI--KTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           YA ALYS   + +K ++I  +S   ++    K+N +    ++D  + + ++KT I        LSK   N     FL +L +N    ++  +  SF   +  H+  LF+++ S   +     + +    S   K+G+++     +  S++GG+ +  G+   D SI  ++ + K
  S:    34 YAAALYSAGHKQNKLDQI--SSDLNNVRAVYKDNKKFQEFVLDPTLKALKKKTAIEAVSTKLGLSKETGN-----FLGLLAENGRLNKLESVVSSFESIMRAHRGELFVQVTSAEELSSSNQKALSDALSKIGKSGQKLTVTYAVKPSILGGLVVTIGDKYVDLSIASRVKKYK 200
>gi|29377096|ref|NP_816250.1| F0F1 ATP synthase subunit delta [Enterococcus faecalis V583] >gi|29344562|gb|AAO82320.1| ATP synthase F1, delta subunit [Enterococcus faecalis V583] (180 aa)
Score = 89, Expect = 1.7e-01, Identities = 43/170 (25%), Positives = 84/170 (49%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVH-------IIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYE-----NIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           Y  AL+ + +E   KN+      A+ IY  L    E+ H       I+  + +   EK  I+ K+    S+      ++NFL V+ +      +L +   + ++ DEHQ  +   + +   + K+  + +E     K  + + YE     N+ID S++GG+ I   + V D SI+ +++ ++
  S:    12 YGKALFELAVE---KNQ------AEAIYQELLTLREVYHQVPGIGDILSDDRLEPYEKDSIMEKLVTGFSE-----MMQNFLRVVYEYRRMYDLLLMIDEYERRYDEHQGLILGSVTTAIPLSKEQHQAMEE----KAAQLLGYEQAHLVNLIDPSIVGGVVIEANHQVIDGSIRKQLEHMQ 175
>gi|169624796|ref|XP_001805803.1| hypothetical protein SNOG_15659 [Phaeosphaeria nodorum SN15] >gi|111055914|gb|EAT77034.1| hypothetical protein SNOG_15659 [Phaeosphaeria nodorum SN15] (231 aa)
Score = 89, Expect = 1.8e-01, Identities = 33/169 (19%), Positives = 82/169 (48%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSL-KNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFS----IKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           YA+ALY+      K N +  T+ + +   +L K + ++V ++ +  +S  +K +I+ ++  +L        +KNFL  L  NN    +  +   F   +  H+  + + + S   ++ + L ++E        +  G++++  + ++  + GG+ +   +   D S+  K+ ++
  S:    53 YASALYT---AASKTNALDPTAKSLESLSALFKKDPKLVEVLGAPTLSVSDKQQIVQELQKNLGSQDKEGIVKNFLQTLAQNNRLGVLAGVVDKFGVLMGAHRGEVELTVTSATALDNRTLSRLEAAIHKSEYVANGQKLKVVSKVNPEIRGGLIVEIADRTIDLSVSAKMAKM 223
>gi|39933256|ref|NP_945532.1| F0F1 ATP synthase subunit delta [Rhodopseudomonas palustris CGA009] >gi|167367432|ref|ZP_02301574.1| ATP synthase F1, delta subunit [Rhodopseudomonas palustris TIE-1] >gi|192288607|ref|YP_001989212.1| ATP synthase F1, delta subunit [Rhodopseudomonas palustris TIE-1] >gi|39652881|emb|CAE25623.1| putative H+-transporting ATP synthase delta chain. [Rhodopseudomonas palustris CGA009] >gi|192282356|gb|ACE98736.1| ATP synthase F1, delta subunit [Rhodopseudomonas palustris TIE-1] (186 aa)
Score = 89, Expect = 1.8e-01, Identities = 39/170 (22%), Positives = 76/170 (44%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           YA AL+   L  D+K+    T+        L  + ++V ++ S + + E + K L  +   L K+       NFL VL  N     + ++  ++   + + +      +     +  K LE ++      TGK V     +D ++IGG+ +  G+ + D S++ K++ IK
  S:    15 YATALFE--LARDEKSIDAVTADLDKFSAMLAGSPDLVRLVRSPVFASEVQGKALAAV---LDKAGITGISANFLKVLAANRRLFVVADVIRAYRALVAKFKGEATADVTVAEKLSDKNLEALKAALKSVTGKDVALNINVDPAIIGGLVVKLGSRMVDSSLRTKLNSIK 179
>gi|163762346|ref|ZP_02169411.1| modification methylase, HemK family [Bacillus selenitireducens MLS10] >gi|160357085|gb|EDP83733.1| modification methylase, HemK family [Bacillus selenitireducens MLS10] (184 aa)
Score = 89, Expect = 1.8e-01, Identities = 16/50 (32%), Positives = 33/50 (66%)
  Q:   130 EKIEHLFSIKTGK-RVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           E +   F+ + GK R+   N++D+ LIGG+++  G+ VYD ++  ++ +I+
  S:   124 EAVAETFAKRAGKARLMITNVVDEDLIGGLRVQIGDTVYDGTVANQLARIE 174
>gi|186477776|ref|YP_001859246.1| ATP synthase F1, delta subunit [Burkholderia phymatum STM815] >gi|184194235|gb|ACC72200.1| ATP synthase F1, delta subunit [Burkholderia phymatum STM815] (179 aa)
Score = 89, Expect = 1.8e-01, Identities = 25/103 (24%), Positives = 51/103 (49%)
  Q:    77 NIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           N   KN + +L DN+    + EI   F +  +  +      I S F +E   L+ +      K  ++++    +D SLIGG+++  G++V D S++ ++  ++
  S:    72 NAQAKNLVQMLVDNHRLPLLPEIATQFEELKNAREGAADALIVSAFPLEGAQLDGLVASLERKFKRKLKPTVQVDSSLIGGVRVTVGDEVLDTSVRARLASMQ 174
>gi|15793514|ref|NP_283336.1| F0F1 ATP synthase subunit delta [Neisseria meningitidis Z2491] >gi|121051500|emb|CAM07793.1| ATP synthase delta chain [Neisseria meningitidis Z2491] (177 aa)
Score = 89, Expect = 1.8e-01, Identities = 32/140 (22%), Positives = 63/140 (45%)
  Q:    45 EMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIEN 184
           ++  +ID    +  EK  IL     DL   + +  LKNF+ VL        + E++  +        +     IYS + +  K + ++  + + +    ++    I+  LIGG+K+  G+ V D S++GK+  +   + N
  S:    43 KVASLIDRPETNASEKADIL----IDLV-GLKDKELKNFVIVLAGQKRLSILPEVYAQYQDLTLSFNHIKSAVIYSAYPLTDKQVGELAQMLNKRFDSELKISVEIEPELIGGIKVEVGDQVLDLSVQGKLSALYTTMTN 177
>gi|157350761|emb|CAO40852.1| unnamed protein product [Vitis vinifera] (251 aa)
Score = 89, Expect = 2.0e-01, Identities = 42/171 (24%), Positives = 77/171 (45%)
  Q:     9 HYANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFL--FIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           +YA+ALY   ++ +  + +   S   D   + K +      + +  +S+  + K L  I    S++  +   KNFL VL +    + +  I   F      H+  +   +    P   E++   K      I  GK+V+ E  ID S++GG+ + F   V+D SIK +  Q++
  S:    72 NYASALYIAAVKANALDTV--ESEILDFLEASKRSDNFSQFMKNLSVSRGVRVKALTAI---CSETKFSDVTKNFLVVLAETGRLRNLESIAKKFLDLTMAHKGEVRAVVTTVIPLPTEEEKELKETLQDIIGHGKKVKLEQKIDPSILGGLVVEFSQKVFDMSIKTRSQQME 239
>gi|145220541|ref|YP_001131250.1| F0F1 ATP synthase subunit delta [Prosthecochloris vibrioformis DSM 265] >gi|145206705|gb|ABP37748.1| ATP synthase F1, delta subunit [Prosthecochloris vibrioformis DSM 265] (181 aa)
Score = 89, Expect = 2.1e-01, Identities = 31/141 (21%), Positives = 68/141 (48%)
  Q:    39 SLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           +L  + ++   + S +I+ + KT +L +IF   ++++ +  +  FL ++        +  I   F   LDE    +   + S   +     + +       TGK+VR    ID+SLIGG+ +  G+ ++D S++ ++  ++
  S:    37 TLAASRDLQRALASPLINADRKTHLLEEIF---AEAVGDKMML-FLRLIAHKKRAGILGGITQEFAALLDEKNGIVNAAVTSATELSDSQQKALSRSLEGYTGKKVRSAMKIDESLIGGLSVKIGDTIFDGSVRHQLQLLR 173
>gi|83592559|ref|YP_426311.1| F0F1 ATP synthase subunit delta [Rhodospirillum rubrum ATCC 11170] >gi|114583|sp|P05438|ATPD_RHORU ATP synthase delta chain >gi|581524|emb|CAA26337.1| unnamed protein product [Rhodospirillum rubrum] >gi|83575473|gb|ABC22024.1| H+-transporting two-sector ATPase, delta (OSCP) subunit [Rhodospirillum rubrum ATCC 11170] (186 aa)
Score = 89, Expect = 2.1e-01, Identities = 33/172 (19%), Positives = 81/172 (47%)
  Q:     8 DHYANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           + YA ALY +  +    +++  ++  + +   L  + ++  +I S +I ++++ K L  +     K+  +  ++NFL V+   +    +  +  +F ++L   +  +  RI S   +       +    +  TG  V  +  +D +L+GGM +  G+ + D S+  K+ +++
  S:    13 ERYATALYELAEDRGALDQV--SADLRSLKAMLDESGDLRRVIASPVIGRDDQRKALTAL---AEKAGFHEIVRNFLGVVAAKHRSFAVPGMIGAFLERLAARRGEVTARIVSATALTSAQKSALTTALNKATGNTVTIDASVDPALLGGMVVRVGSRMVDSSLSTKLKRLQ 179
>gi|194291169|ref|YP_002007076.1| membrane-bound ATP synthase, F1 sector, delta-subunit [Cupriavidus taiwanensis] >gi|193225004|emb|CAQ71015.1| membrane-bound ATP synthase, F1 sector, delta-subunit [Cupriavidus taiwanensis] (181 aa)
Score = 88, Expect = 2.1e-01, Identities = 26/112 (23%), Positives = 54/112 (48%)
  Q:    64 LNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKI 175
           L ++F  + KS  +   + F+ +L +N     + +I   F    +  +    + I S F +E   L  +      K G+++  +  +D SLIGG+ +  G++V D S++ ++
  S:    60 LAELFLSVLKSPVSDEARRFVQLLVENGRLTVMPDIAEQFHALKNAREGSSDVEITSAFPLEDGQLNDLVAALERKFGRKLYAQVAVDPSLIGGVSVKVGDEVLDTSVRARL 171
>gi|158520617|ref|YP_001528487.1| F0F1 ATP synthase subunit delta [Desulfococcus oleovorans Hxd3] >gi|158509443|gb|ABW66410.1| ATP synthase F1, delta subunit [Desulfococcus oleovorans Hxd3] (183 aa)
Score = 88, Expect = 2.1e-01, Identities = 33/131 (25%), Positives = 65/131 (49%)
  Q:    58 EEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIENNKEV 188
           E + K+L+ +   L  S+    +++FL +L +    + +  I   +   +DE +  +   + S   +   ++EKI    S  TGK+V  +   D +LIGG+    G+ V D SIK ++  +K +++  + V
  S:    56 EARRKVLDMVIEKLGVSV---MMRSFLALLFEKRRIQHVRGINEVYQNLVDELKGIVRADVVSAGELSDDVVEKIRASLSKMTGKQVIVDIAQDPTLIGGIVTKVGDMVLDGSIKTQLSNMKESLKKGERV 183
>gi|153834306|ref|ZP_01986973.1| ATP synthase F1, delta subunit [Vibrio harveyi HY01] >gi|148869314|gb|EDL68328.1| ATP synthase F1, delta subunit [Vibrio harveyi HY01] (177 aa)
Score = 88, Expect = 2.1e-01, Identities = 24/127 (18%), Positives = 62/127 (48%)
  Q:    52 SNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           S +++       + +IF  +     + + +N + V+ +N     + ++   FF    EH+  + + + S   +  + L  I     ++  ++V+    +D++L+GG+ I  G+ V D S +G+++++
  S:    45 SELLTGSVSADKMAEIFVAVCGEQVDTHGQNLIKVMAENGRLTALPDVCEQFFLLKKEHEKEIDVEVISASELSDEQLANIGSKLEVRLERKVKLNCSVDETLLGGVIIRAGDLVIDDSARGRLNRL 171
>gi|167838427|ref|ZP_02465286.1| F0F1 ATP synthase subunit delta [Burkholderia thailandensis MSMB43] (179 aa)
Score = 88, Expect = 2.2e-01, Identities = 28/95 (29%), Positives = 50/95 (52%)
  Q:    81 KNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVE----KKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKI 175
           KNF+ +L +N+    + EI   F +  +  +      I S F +E     +L+E +E  F  K    V     +D SLIGG+++  G++V D S++ ++
  S:    76 KNFVGMLVENHRIALLPEISAQFDELKNAREGAADALIVSAFPLEGAQLTELVENLERRFKRKLKPTVE----VDASLIGGVRVTVGDEVLDTSVRARL 170
>gi|89053537|ref|YP_508988.1| ATP synthase F1, delta subunit [Jannaschia sp. CCS1] >gi|88863086|gb|ABD53963.1| ATP synthase F1 delta subunit [Jannaschia sp. CCS1] (186 aa)
Score = 88, Expect = 2.2e-01, Identities = 16/75 (21%), Positives = 42/75 (56%)
  Q:   105 QKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           +++ +H+  +   + S   + K  L+K+      + GK V  +  +D+++IGG+ +  G+ + D S++ K++ ++
  S:   105 ERIADHKGEVTAEVTSAKALTKTQLDKLTKSLKAQVGKTVTVKETVDENIIGGLIVKIGSKMIDTSVRSKLNALQ 179
>gi|148378159|ref|YP_001252700.1| ATP synthase F1, delta subunit [Clostridium botulinum A str. ATCC 3502] >gi|153931774|ref|YP_001382560.1| F0F1 ATP synthase subunit delta [Clostridium botulinum A str. ATCC 19397] >gi|153937337|ref|YP_001386112.1| F0F1 ATP synthase subunit delta [Clostridium botulinum A str. Hall] >gi|148287643|emb|CAL81708.1| ATP synthase subunit delta [Clostridium botulinum A str. ATCC 3502] >gi|152927818|gb|ABS33318.1| ATP synthase F1, delta subunit [Clostridium botulinum A str. ATCC 19397] >gi|152933251|gb|ABS38750.1| ATP synthase F1, delta subunit [Clostridium botulinum A str. Hall] (179 aa)
Score = 88, Expect = 2.3e-01, Identities = 42/170 (24%), Positives = 81/170 (47%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           YA ALY +  E +K ++  +    K++   +KN+ ++  I+    I+   K +I  ++F    K   +  + +FL VL + +    + E      +   E  N +   I +   + K+  E++      K  K++  E  IDKS+IGG+ +  G+DV D ++  ++  IK
  S:     9 YALALYEVAEENNKVDE--YLRDLKEVVNIIKNSEDICKILKHPEINTSRKKEIFTELF----KDKVDDKILSFLLVLIEKDRILYLEEKLKEMEKIYLEKNNMILANIKTVIPLLKEEREELIEKLGNKYNKKIILEEEIDKSIIGGVYVRVGDDVLDGTLSTRLKDIK 172
>gi|157144371|ref|YP_001451689.1| F0F1 ATP synthase subunit delta [Citrobacter koseri ATCC BAA-895] >gi|157081576|gb|ABV11254.1| hypothetical protein CKO_00075 [Citrobacter koseri ATCC BAA-895] (177 aa)
Score = 88, Expect = 2.4e-01, Identities = 21/98 (21%), Positives = 50/98 (51%)
  Q:    81 KNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           +N + V+ +NN    + ++   F       ++   + + S   + ++ L KI      +  ++V+    IDKS++ G+ I  G+ V D S++G+++++
  S:    74 QNLIRVMAENNRLNALPDVLEQFIHLRAASESTSEVEVTSATALSEEQLAKISAAMEKRLSRKVKLNCKIDKSVMAGVIIRAGDMVIDGSVRGRLERL 171
>gi|115608260|ref|XP_792250.2| PREDICTED: similar to CG4307-PA [Strongylocentrotus purpuratus] (146 aa)
Score = 88, Expect = 2.4e-01, Identities = 26/136 (19%), Positives = 67/136 (49%)
  Q:    40 LKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFS--IKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKI 175
           +K +  +   + +  I+K+ K  +++ +      + S +   NF  +L +N    ++ EIF+++ + +  H+  +  ++ +   ++    ++++      IK G+ ++    +D +LIGGM +  G+   D S   K+
  S:     1 MKQSAVLSDFMKNPTINKKAKISVISDVLKGEKMADSTV---NFFGMLAENGRLNKVKEIFVAWTKIMAAHKGEIICKVTTAKTLDASQQKQVQEALKAFIKKGESLQLNLTVDPTLIGGMIVEVGDKYVDMSTASKV 135
>gi|191638158|ref|YP_001987324.1| H(+)-transporting two-sector ATPase (ATP synthase), delta subunit [Lactobacillus casei] >gi|190712460|emb|CAQ66466.1| H(+)-transporting two-sector ATPase (ATP synthase), delta subunit [Lactobacillus casei BL23] (181 aa)
Score = 88, Expect = 2.4e-01, Identities = 28/140 (20%), Positives = 63/140 (45%)
  Q:    40 LKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTG-KRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
             +N  ++ I D+  I+  +K  ++  +  D S  ++N+     L +      F  +  I  +F Q  DE    +   + +   +     + +    + + G K  + + ++D S+IGG++I     V D ++K + D++K
  S:    40 FNDNPTILTIFDNARITAADKDALMTTLTKDASPLVANL-----LKLTQQYGRFGALPAIISAFNQAYDEEAGIIAATVTTAVALSADQADALRSTIAARFGMKSTQLDQVVDPSVIGGVRIQARGSVIDGTVKHRFDKMK 175
>gi|163754724|ref|ZP_02161846.1| hypothetical protein KAOT1_17553 [Kordia algicida OT-1] >gi|161325665|gb|EDP96992.1| hypothetical protein KAOT1_17553 [Kordia algicida OT-1] (178 aa)
Score = 88, Expect = 2.4e-01, Identities = 42/153 (27%), Positives = 77/153 (50%)
  Q:    33 AKD---IYFSLKNNYEMVHIIDSNIISKEEKTKILNKIF---FDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFV--VEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIENN 185
           AKD   I  +++N+ ++  +++S I+  E K   L +IF     +S+ + ++ + N    L DN     I   + + F +L   Q  + +    P    +  K+L K++ L    T   V  EN ID+S+IGG  +  G+  Y+ SI  +++ +K     N
  S:    28 AKDMDGIVKTVENSKDLRLMLNSPIVKSETKKAALLEIFTGMHSVSEGVIDMLMANKRIDLLDN-----IAVQYCNLFDQLQGKQTAV-VTTAVPLTDGLRSKVLAKVKDL----TNNEVTIENKIDESIIGGFILRVGDLQYNASIANQLNTLKRTFSQN 178
>gi|116494659|ref|YP_806393.1| F0F1-type ATP synthase, delta subunit [Lactobacillus casei ATCC 334] >gi|116104809|gb|ABJ69951.1| F0F1-type ATP synthase, delta subunit [Lactobacillus casei ATCC 334] (181 aa)
Score = 88, Expect = 2.4e-01, Identities = 28/140 (20%), Positives = 63/140 (45%)
  Q:    40 LKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTG-KRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
             +N  ++ I D+  I+  +K  ++  +  D S  ++N+     L +      F  +  I  +F Q  DE    +   + +   +     + +    + + G K  + + ++D S+IGG++I     V D ++K + D++K
  S:    40 FNDNPTILTIFDNARITAADKDALMTTLTKDASPLVANL-----LKLTQQYGRFGALPAIISAFNQAYDEEAGIIAATVTTAVALSADQADALRSTIAARFGMKSTQLDQVVDPSVIGGVRIQARGSVIDGTVKHRFDKMK 175
>gi|167768299|ref|ZP_02440352.1| hypothetical protein CLOSS21_02855 [Clostridium sp. SS2/1] >gi|167709823|gb|EDS20402.1| hypothetical protein CLOSS21_02855 [Clostridium sp. SS2/1] (162 aa)
Score = 88, Expect = 2.5e-01, Identities = 39/140 (27%), Positives = 72/140 (51%)
  Q:    40 LKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNN---FFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKI-EHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           L  N E++  +++  I+K+EK  ++ K+F D         +K+FL V+ DN+    F   +E +    +K D+     F  +  P   + + LE+I ++L       +V      +K LIGG  +  G+ VYD S+ GK+ +++
  S:    24 LHENEELLSALENPTITKKEKENVVEKLFPD--------DIKSFLKVVCDNDDIACFDEAVEYYDELKRKTDKIIKAEFDYVTMP---KDEQLERIKQYLMKQYQADKVELTLKEEKDLIGGFVLKVGDHVYDNSLSGKMRKLQ 156
>gi|149369283|ref|ZP_01889135.1| ATP synthase subunit D [unidentified eubacterium SCB49] >gi|149356710|gb|EDM45265.1| ATP synthase subunit D [unidentified eubacterium SCB49] (178 aa)
Score = 88, Expect = 2.5e-01, Identities = 38/146 (26%), Positives = 75/146 (51%)
  Q:    34 KDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIF---FDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPF----VVEKKLLEKIEHLFSIKTGK-RVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           K +  ++  + E+ +++ S II  E+K + L+KIF    D++KS+ +I        L  N     +  +  S+    +E +      + +       +EK++L K++ +    TG   +  EN ID+S+IGG  +  G+  Y+ SI  ++  +K
  S:    30 KSVGTTIAGSKELRNVLQSPIIKGEDKKQALHKIFEGNSDVTKSLIDI--------LTANKRIDLLGGVATSYINLYNERKGVKVAHVTTAVPLSEALEKEVLAKVKQM----TGSDNISIENKIDESIIGGFILRVGDVQYNASIANQLGNLK 171
>gi|192362048|ref|YP_001984263.1| ATP synthase F1, delta subunit [Cellvibrio japonicus Ueda107] >gi|190688213|gb|ACE85891.1| ATP synthase F1, delta subunit [Cellvibrio japonicus Ueda107] (178 aa)
Score = 88, Expect = 2.6e-01, Identities = 23/98 (23%), Positives = 49/98 (50%)
  Q:    81 KNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           +NF+  L  N     +  I   F +   + +  + + + + + +   L+ K+    S K  + V   + I+KSL+GG+ I  G+ V D S++G++ ++
  S:    75 QNFIRTLASNKRLALLPYIKELFARMKAQQEKTIDVEVTAAYELPVDLINKLAQALSAKLDRNVSVHSSINKSLLGGVVIHTGDTVIDGSVRGRLAKL 172
>gi|33862008|ref|NP_893569.1| F0F1 ATP synthase subunit delta [Prochlorococcus marinus subsp. pastoris str. CCMP1986] >gi|33640376|emb|CAE19911.1| ATP synthase, delta (OSCP) subunit [Prochlorococcus marinus subsp. pastoris str. CCMP1986] (180 aa)
Score = 88, Expect = 2.7e-01, Identities = 43/169 (25%), Positives = 79/169 (46%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVV---EKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           YA AL  +  E D+  +++     K +   + ++ ++   + S ++  + K KI+ +IF   S+ I N  L NFL +L D      +  I   F +   E+ N     + S   +   +K L+ K   + +I   +++     ID SLIGG     G+ V D S+  +I ++
  S:    11 YAEALLQVVSENDQTEEMV--KEVKQLLSLINDSPDLEKTLSSPVLETDTKKKIIIEIF---SEKI-NSSLLNFLKLLADRQRIGIVTSILDRFLEIYRENSNIALATVTSAVELTDDQKGLITK--KIINIAGTEKLELVTKIDPSLIGGFVASVGSKVIDASLASQIRKL 174
>gi|11467681|ref|NP_050733.1| ATP synthase CF1 delta subunit [Guillardia theta] >gi|5915727|sp|O78476|ATPD_GUITH ATP synthase delta chain, chloroplast >gi|3603006|gb|AAC35667.1| ATP synthase CF1 subunit d [Guillardia theta] (185 aa)
Score = 88, Expect = 2.7e-01, Identities = 17/47 (36%), Positives = 32/47 (68%)
  Q:   132 IEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           +E L S+ + ++++    +DK+LIGG K+  G+ V D SI+G++ Q+
  S:   130 VEKLKSMTSTEQIKLNITVDKTLIGGFKVQIGSKVIDTSIQGQLRQL 176
>gi|94676559|ref|YP_588613.1| ATP synthase F1, delta subunit [Baumannia cicadellinicola str. Hc (Homalodisca coagulata)] >gi|94219709|gb|ABF13868.1| ATP synthase F1, delta subunit [Baumannia cicadellinicola str. Hc (Homalodisca coagulata)] (177 aa)
Score = 87, Expect = 2.8e-01, Identities = 31/139 (22%), Positives = 69/139 (49%)
  Q:    40 LKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           L +N  +  ++ S +I+    TKI + IF  +  +  + Y +NF+ ++  N     + +I   F Q   ++ + + + + +   +    + +I      +  ++V+   IID S+I GM I  G+ V D S+ G+++++
  S:    37 LNSNPYIAKLLSSTVITN---TKIAD-IFIAVCGNKLDNYGRNFIRIMAYNRRLLLLPDILKIFLQLCKKNSSTIEVEVITVSALTNNQIAQITQAMRQRLSQKVKLNCIIDLSIIAGMIIRIGDIVIDSSMLGRLERL 171
>gi|169832277|ref|YP_001718259.1| ATP synthase F1, delta subunit [Candidatus Desulforudis audaxviator MP104C] >gi|169639121|gb|ACA60627.1| ATP synthase F1, delta subunit [Candidatus Desulforudis audaxviator MP104C] (182 aa)
Score = 87, Expect = 2.8e-01, Identities = 45/177 (25%), Positives = 89/177 (50%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSA-KDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNN---FFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIE--HLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIENNK 186
           YA AL+ +  +    N+I  T +  +     L  + ++  ++ +  +  E K +I+ + F    K +S   L NFL ++ D     + K I + FI+     +E +N +   + S   +E  ++ K+    + S  TGK +R    +D  +IGG+ +  G+ + D SIK +++++K +I   K
  S:    10 YAQALFDVARD---NNRIAETENELRGFMRLLDESRDLQQVLYNPQVPVELKKEIVREAF---GKELSGTTL-NFLCLVLDRRREVYLKGIADHFIAL---ANETRNIIEAEVTS--ALELSVVHKVNLMQVLSRMTGKELRIRYQVDPDIIGGLVVRLGDRIIDGSIKRQLERLKDSIRETK 180
>gi|170755127|ref|YP_001779781.1| ATP synthase F1, delta subunit [Clostridium botulinum B1 str. Okra] >gi|169120339|gb|ACA44175.1| ATP synthase F1, delta subunit [Clostridium botulinum B1 str. Okra] (179 aa)
Score = 87, Expect = 2.9e-01, Identities = 41/170 (24%), Positives = 81/170 (47%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           YA ALY +  E +K ++  +    K++   +KN+ ++  I+    I+   K +I  ++F    K   +  + +FL VL + +    + E      +   E  N +   + +   + K+  E++      K  K++  E  IDKS+IGG+ +  G+DV D ++  ++  IK
  S:     9 YALALYEVAEENNKVDE--YLRDLKEVVNIIKNSEDICKILKHPEINTSRKKEIFTELF----KDKVDDKILSFLLVLIEKDRILYLEEKLKEMEKIYLEKNNMILANVKTVIPLLKEEREELIEKLGNKYNKKIILEEEIDKSIIGGVYVRVGDDVLDGTLSTRLKDIK 172
>gi|145628863|ref|ZP_01784663.1| F0F1 ATP synthase subunit delta [Haemophilus influenzae 22.1-21] >gi|148825239|ref|YP_001289992.1| F0F1 ATP synthase subunit delta [Haemophilus influenzae PittEE] >gi|144979333|gb|EDJ89019.1| F0F1 ATP synthase subunit delta [Haemophilus influenzae 22.1-21] >gi|148715399|gb|ABQ97609.1| F0F1 ATP synthase subunit delta [Haemophilus influenzae PittEE] (177 aa)
Score = 87, Expect = 3.0e-01, Identities = 23/100 (23%), Positives = 48/100 (48%)
  Q:    79 YLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           Y +N + ++ +N     I  +F  F   ++EHQ    + + S   +    +EKI      +  ++V+    +D +LI G+ I   + V D S +G++ ++
  S:    72 YGQNLIRLMAENKRLSAIPAVFEEFKHHVEEHQAIAEVEVTSAQPLNATQIEKIAAAMEKRLARKVKLNCNVDNALIAGVIIRTEDFVIDGSSRGQLTRL 171
>gi|91777095|ref|YP_546851.1| ATP synthase F1, delta subunit [Methylobacillus flagellatus KT] >gi|91711082|gb|ABE51010.1| ATP synthase F1, delta subunit [Methylobacillus flagellatus KT] (178 aa)
Score = 87, Expect = 3.0e-01, Identities = 15/45 (33%), Positives = 30/45 (66%)
  Q:   139 KTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIE 183
           K GK+V     +D  +IGG+KI+ G+ V D S++G++ ++ + ++
  S:   133 KFGKKVEASVKVDPEIIGGIKIVVGDTVIDASVRGQLQELAYTLK 177
>gi|194100108|ref|YP_002003248.1| AtpH [Neisseria gonorrhoeae NCCP11945] >gi|193935398|gb|ACF31222.1| AtpH [Neisseria gonorrhoeae NCCP11945] (163 aa)
Score = 87, Expect = 3.1e-01, Identities = 32/136 (23%), Positives = 61/136 (44%)
  Q:    49 IIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIEN 184
           +ID    +  EK  IL     DL   + +  LKNF+ VL        + E++  +        +     IYS + +  K + ++  + + +    ++    I+  LIGG+K+  G+ V D S++GK+  +   + N
  S:    33 LIDRPETNASEKADIL----IDLV-GLKDKELKNFVIVLAGQKRLSILPEVYAQYQDLTLSFNHIKSAVIYSAYPLTDKQVGELAQMLNKRFDSELKISVEIEPELIGGIKVEVGDQVLDLSVQGKLSALYTTMTN 163
>gi|118411111|ref|YP_874505.1| ATP synthase CF1 delta chain [Thalassiosira pseudonana] >gi|116739858|gb|ABK20728.1| ATP synthase CF1 delta chain [Thalassiosira pseudonana] (187 aa)
Score = 87, Expect = 3.1e-01, Identities = 40/179 (22%), Positives = 84/179 (46%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYS--PFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIENNKEV 188
           YA ALY   +E +  +++  T+  +++   L     ++  + + I++  +K  +L K      KS  N     FL VL   +    +  I  ++ + + +  +   I + +  PF   +KL   I+ L  +   + +R    +D SLIGG  I   + V D++IK +++ +  +++   E+
  S:    14 YARALYDFSVEQNIMHQV--TADFQNLDVFLAEVPTLMEYLGNPIVTATQKEALLTKTL----KSQLNAETFKFLMVLVKRDRINLLPTIITTYLELVYKTASVKMIEVSTAFPFTTLQKL-NLIKKLKELTNAREIRLVVTVDSSLIGGFLIKTNSKVIDFTIKNQLENLAKHLDGVLEI 187
>gi|170699471|ref|ZP_02890514.1| ATP synthase F1, delta subunit [Burkholderia ambifaria IOP40-10] >gi|170135620|gb|EDT03905.1| ATP synthase F1, delta subunit [Burkholderia ambifaria IOP40-10] (179 aa)
Score = 87, Expect = 3.2e-01, Identities = 25/99 (25%), Positives = 49/99 (49%)
  Q:    81 KNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           KN + +L DN+    + EI   F    +E +      I S F +    LE +      K  ++++    +D SLIGG+++  G++V D S++ ++  ++
  S:    76 KNLVQMLVDNHRIALLPEIAEQFEALKNEREGAADAEIVSAFPLNGADLESLVSGLERKFKRKLKPTVEVDSSLIGGVRVTVGDEVLDTSVRARLASMQ 174
>gi|167571763|ref|ZP_02364637.1| F0F1 ATP synthase subunit delta [Burkholderia oklahomensis C6786] (179 aa)
Score = 87, Expect = 3.2e-01, Identities = 27/95 (28%), Positives = 50/95 (52%)
  Q:    81 KNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVE----KKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKI 175
           KNF+ +L +N+    + EI   F +  +  +      I S F +E     +L+E +E  F  K    +     +D SLIGG+++  G++V D S++ ++
  S:    76 KNFVGMLVENHRIALLPEISAQFDELKNAREGAADALIVSAFPLEGAQLAELVENLERRFKRKLKPTIE----VDASLIGGVRVTVGDEVLDTSVRARL 170
>gi|167564621|ref|ZP_02357537.1| F0F1 ATP synthase subunit delta [Burkholderia oklahomensis EO147] (179 aa)
Score = 87, Expect = 3.2e-01, Identities = 27/95 (28%), Positives = 50/95 (52%)
  Q:    81 KNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVE----KKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKI 175
           KNF+ +L +N+    + EI   F +  +  +      I S F +E     +L+E +E  F  K    +     +D SLIGG+++  G++V D S++ ++
  S:    76 KNFVGMLVENHRIALLPEISAQFDELKNAREGAADALIVSAFPLEGAQLAELVENLERRFKRKLKPTIE----VDASLIGGVRVTVGDEVLDTSVRARL 170
>gi|170766754|ref|ZP_02901207.1| ATP synthase F1, delta subunit [Escherichia albertii TW07627] >gi|170124192|gb|EDS93123.1| ATP synthase F1, delta subunit [Escherichia albertii TW07627] (177 aa)
Score = 87, Expect = 3.2e-01, Identities = 22/98 (22%), Positives = 49/98 (50%)
  Q:    81 KNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           +N + V+ +N   K + E+   F       +    + + S   + ++ L KI      +  ++V+    IDKS++ G+ I  G+ V D S++G+++++
  S:    74 QNLIRVMAENGRLKVLPEVLEQFIHLRAASEATAEVDVISAAALSEQQLAKISAAMEKRLSRKVKLNCKIDKSVMAGVIIRAGDMVIDGSVRGRLERL 171
>gi|24215480|ref|NP_712961.1| F0F1 ATP synthase subunit delta [Leptospira interrogans serovar Lai str. 56601] >gi|45657123|ref|YP_001209.1| F0F1 ATP synthase subunit delta [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] >gi|24196611|gb|AAN49979.1|AE011443_8 ATP synthase F1, delta subunit [Leptospira interrogans serovar Lai str. 56601] >gi|45600361|gb|AAS69846.1| ATP synthase delta chain [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] (186 aa)
Score = 87, Expect = 3.2e-01, Identities = 40/128 (31%), Positives = 62/128 (48%)
  Q:    52 SNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           S  +S EEK K+L K   +L   IS+I L NFL VL +      + EI   F  +LD+ +  +  ++ S   +E     K+  + S K       E   DKSL+GG  + F +   + SI  ++ +IK
  S:    47 SPTVSNEEKEKVLIK---NLRGKISDITL-NFLGVLLNRGRIIHLPEIQKQFTVELDKKKGRVRAQVRSYPSLEPAQAAKLGSILSEKFKSEFILEVSEDKSLLGGFVVQFNDLKIEKSIASQLGEIK 170
>gi|168182237|ref|ZP_02616901.1| ATP synthase F1, delta subunit [Clostridium botulinum Bf] >gi|182674544|gb|EDT86505.1| ATP synthase F1, delta subunit [Clostridium botulinum Bf] (179 aa)
Score = 87, Expect = 3.3e-01, Identities = 41/170 (24%), Positives = 81/170 (47%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           YA ALY +  E +K ++  +    K++   +KN+ ++  I+    I+   K +I  ++F    K   +  + +FL VL + +    + E      +   E  N +   + +   + K+  E++      K  K++  E  IDKS+IGG+ +  G+DV D ++  ++  IK
  S:     9 YALALYEVAEENNKVDE--YLKDLKEVVNIIKNSEDICKILKHPEINTSRKKEIFTELF----KDKVDDKILSFLLVLIEKDRILYLEEKLKEMEKIYLEKNNMILANVKTVIPLLKEEREELIEKLGNKYNKKIILEEEIDKSIIGGVYVRVGDDVLDGTLSTRLKDIK 172
>gi|91226235|ref|ZP_01261075.1| F0F1 ATP synthase subunit delta [Vibrio alginolyticus 12G01] >gi|91189246|gb|EAS75525.1| F0F1 ATP synthase subunit delta [Vibrio alginolyticus 12G01] (177 aa)
Score = 87, Expect = 3.4e-01, Identities = 24/115 (20%), Positives = 57/115 (49%)
  Q:    64 LNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           + +IF  +     + + +N L V+ +N     + ++   FF    EH+  + + + S   +  + L  I      +  ++V+    +D++L+GG+ I  G+ V D S +G+++++
  S:    57 MAEIFVAVCGEQVDAHGQNLLKVMAENGRLAALPDVCKEFFTLKKEHEKEIDVEVISATELSDEQLANIGSKLEKRLERKVKLNCSVDETLLGGVIIRAGDLVIDDSARGRLNRL 171
>gi|121282043|gb|ABM53597.1| putative ATP synthase delta chain [uncultured bacterium CBNPD1 BAC clone 2089] (174 aa)
Score = 87, Expect = 3.5e-01, Identities = 15/40 (37%), Positives = 28/40 (70%)
  Q:   140 TGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           TGK V  + ++D S++GG+    G++V D S++ ++DQ+K
  S:   132 TGKAVNLKVVVDPSVLGGLIATVGDEVIDGSVRTRLDQVK 171
>gi|152965235|ref|YP_001361019.1| ATP synthase F1, delta subunit [Kineococcus radiotolerans SRS30216] >gi|151359752|gb|ABS02755.1| ATP synthase F1, delta subunit [Kineococcus radiotolerans SRS30216] (276 aa)
Score = 87, Expect = 3.5e-01, Identities = 22/86 (25%), Positives = 43/86 (50%)
  Q:    94 KRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           +R+LE ++    K  E    L   + S   +     E++    S + G+ +R    +D  L+GG+++  G+DV D SI  ++D+ +
  S:   189 ERLLEEWVEVVAKRREQ---LVAHVVSATPLTDAQRERLAATLSRQYGRAIRVNLDVDPHLVGGLRVSVGDDVIDGSISTRLDEAR 271
>gi|169182327|ref|ZP_02842844.1| ATP synthase F1, delta subunit [Thauera sp. MZ1T] >gi|169010466|gb|EDS57231.1| ATP synthase F1, delta subunit [Thauera sp. MZ1T] (177 aa)
Score = 87, Expect = 3.5e-01, Identities = 28/104 (26%), Positives = 52/104 (50%)
  Q:    81 KNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIEN 184
           +NF+ VL ++   + + EI   F    +EH+     +I S F ++   L  ++     +    V     ID  LIGG++I  G++V D S++GK+  +   ++N
  S:    74 QNFVRVLVESERLQVLPEIRDLFVALKNEHEGVREAQIASAFPLDDAALAALKADLEARFKAAVNVSVSIDPELIGGVRIAVGDEVIDASVRGKLANMAAALKN 177
>gi|161505607|ref|YP_001572719.1| F0F1 ATP synthase subunit delta [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] >gi|160866954|gb|ABX23577.1| hypothetical protein SARI_03783 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] (177 aa)
Score = 87, Expect = 3.5e-01, Identities = 21/98 (21%), Positives = 49/98 (50%)
  Q:    81 KNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           +N + V+ +NN    + ++   F       +    + + S   + ++ L KI      +  ++V+    IDKS++ G+ I  G+ V D S++G+++++
  S:    74 QNLIRVMAENNRLNALPDVLEQFIHLRAASEATSEVEVTSATALSEEQLSKISAAMEKRLSRKVKLNCKIDKSVMAGVIIRAGDMVIDGSVRGRLERL 171
>gi|16762458|ref|NP_458075.1| F0F1 ATP synthase subunit delta [Salmonella enterica subsp. enterica serovar Typhi str. CT18] >gi|16767152|ref|NP_462767.1| F0F1 ATP synthase subunit delta [Salmonella typhimurium LT2] >gi|29143946|ref|NP_807288.1| F0F1 ATP synthase subunit delta [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] >gi|56415736|ref|YP_152811.1| F0F1 ATP synthase subunit delta [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|62182350|ref|YP_218767.1| F0F1 ATP synthase subunit delta [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|161616988|ref|YP_001590953.1| F0F1 ATP synthase subunit delta [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|167560498|ref|ZP_02353501.1| hypothetical protein Sententeri_27052 [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853] >gi|167994872|ref|ZP_02575962.1| hypothetical protein Sententer_01000051_0100025722 [Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701] >gi|168224037|ref|ZP_02649269.1| hypothetical protein Senterenterica_26870 [Salmonella enterica subsp. enterica serovar Agona str. SL483] >gi|168229023|ref|ZP_02654254.1| hypothetical protein Sententeric_24860 [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433] >gi|168234376|ref|ZP_02659434.1| hypothetical protein Sententerica_25577 [Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191] >gi|168239812|ref|ZP_02664870.1| hypothetical protein Senteenterica_26790 [Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480] >gi|168245305|ref|ZP_02670237.1| hypothetical protein Senterienterica_26921 [Salmonella enterica subsp. enterica serovar Heidelberg str. SL486] >gi|168263236|ref|ZP_02685209.1| hypothetical protein Salmentericaenterica_19288 [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] >gi|168464797|ref|ZP_02698689.1| ATP synthase F1, delta subunit [Salmonella enterica subsp. enterica serovar Newport str. SL317] >gi|168478090|ref|ZP_02707113.1| hypothetical protein Salmoentericaenterica_25866 [Salmonella enterica subsp. enterica serovar Virchow str. SL491] >gi|168823195|ref|ZP_02835195.1| hypothetical protein Salentericaenterica_27682 [Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537] >gi|194445487|ref|YP_002043114.1| ATP synthase F1, delta subunit [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194450955|ref|YP_002047897.1| ATP synthase F1, delta subunit [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194468999|ref|ZP_03074983.1| ATP synthase F1, delta subunit [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|194735849|ref|YP_002116809.1| ATP synthase F1, delta subunit [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|25290484|pir||AC0954 ATP synthase delta chain [imported] - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) >gi|16422442|gb|AAL22726.1| membrane-bound ATP synthase, F1 sector, delta-subunit [Salmonella typhimurium LT2] >gi|16504763|emb|CAD03127.1| ATP synthase delta subunit [Salmonella enterica subsp. enterica serovar Typhi] >gi|29139582|gb|AAO71148.1| ATP synthase delta subunit [Salmonella enterica subsp. enterica serovar Typhi Ty2] >gi|56129993|gb|AAV79499.1| ATP synthase delta subunit [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|62129983|gb|AAX67686.1| membrane-bound ATP synthase, F1 sector, delta-subunit [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|161366352|gb|ABX70120.1| hypothetical protein SPAB_04809 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|194404150|gb|ACF64372.1| ATP synthase F1, delta subunit [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194409259|gb|ACF69478.1| ATP synthase F1, delta subunit [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194455363|gb|EDX44202.1| ATP synthase F1, delta subunit [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|194711351|gb|ACF90572.1| ATP synthase F1, delta subunit [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|195632282|gb|EDX50766.1| ATP synthase F1, delta subunit [Salmonella enterica subsp. enterica serovar Newport str. SL317] (177 aa)
Score = 87, Expect = 3.5e-01, Identities = 21/98 (21%), Positives = 49/98 (50%)
  Q:    81 KNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           +N + V+ +NN    + ++   F       +    + + S   + ++ L KI      +  ++V+    IDKS++ G+ I  G+ V D S++G+++++
  S:    74 QNLIRVMAENNRLNALPDVLEQFIHLRAASEATSEVEVTSATALSEEQLSKISAAMEKRLSRKVKLNCKIDKSVMAGVIIRAGDMVIDGSVRGRLERL 171
>gi|114322019|ref|YP_743702.1| F0F1 ATP synthase subunit delta [Alkalilimnicola ehrlichei MLHE-1] >gi|114228413|gb|ABI58212.1| ATP synthase F1, delta subunit [Alkalilimnicola ehrlichei MLHE-1] (179 aa)
Score = 86, Expect = 3.6e-01, Identities = 25/98 (25%), Positives = 49/98 (50%)
  Q:    81 KNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           KN + +L DN     + EI   +     E +  + +++ S   + K+  ++I      + G++VR     D++LIGG  I  G+   D S++GK+ ++
  S:    76 KNLVQLLADNGRLGLLPEIAALYEHLRAEAEGVVDVQVTSASKLTKEQQDQIAGALKKRLGRKVRLHCRTDEALIGGALIQAGDLTIDGSVRGKLARL 173
>gi|146309623|ref|YP_001190088.1| ATP synthase F1, delta subunit [Pseudomonas mendocina ymp] >gi|145577824|gb|ABP87356.1| ATP synthase F1, delta subunit [Pseudomonas mendocina ymp] (178 aa)
Score = 86, Expect = 3.9e-01, Identities = 31/124 (25%), Positives = 62/124 (50%)
  Q:    55 ISKEEKTKILNKI---FFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           ++ E+K  +L +I     D S S       NFL  L  N+    +  +   F     E +  L + + S F +  + L+ +    S +  + V+ + +++ +LIGG+ I  G+ V D S++GK++++
  S:    53 LTDEQKVNVLAQICAGHIDASFS-------NFLRSLGSNDRLSLLPVVREQFAVLKAEAERALDVEVESAFELNAEQLQTLAAALSKRLDRTVQPKPVVNPALIGGVVIRAGDLVIDGSVRGKLNKL 172
>gi|78779929|ref|YP_398041.1| F0F1 ATP synthase subunit delta [Prochlorococcus marinus str. MIT 9312] >gi|78713428|gb|ABB50605.1| ATP synthase F1, delta subunit [Prochlorococcus marinus str. MIT 9312] (180 aa)
Score = 86, Expect = 4.1e-01, Identities = 44/169 (26%), Positives = 77/169 (45%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVV---EKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           YA AL  +  E  +  +++  S  K +   L ++ E+   + S I+  E K KI+ +IF     +  N  L NFL +L D      +  I   F +   E+ N     + S   +   +K L+   + + +I   +++     ID SLIGG     G+ V D S+  +I ++
  S:    11 YAEALLQVVNENLQTEEMV--SEVKQLLELLNDSPELEKALSSPILETEAKKKIIIEIF----SNKVNSSLLNFLKLLADRQRIGILTSILNRFLEIYRENSNIALATVTSAVELTDEQKGLI--TQKIVNIAGTQKLELVTKIDPSLIGGFVASVGSKVIDASLASQIRKL 174
>gi|71984710|ref|NP_001021420.1| ATP synthase subunit family member (atp-3) [Caenorhabditis elegans] >gi|1703605|gb|AAB37654.1| Atp synthase subunit protein 3, isoform a [Caenorhabditis elegans] (207 aa)
Score = 86, Expect = 4.2e-01, Identities = 38/170 (22%), Positives = 81/170 (47%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVH-IIDSNIISKEEKTKILN-KIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSI--KTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           YA ALYS   + +K ++I  ++   ++    K+N +    ++D  + + ++KT I        L+K   N     FL +L +N    ++  +  SF   +  H+  LF+++ S   +     + +    S   K+G+++     +  S++GG+ +  G+   D SI  ++ + K
  S:    34 YAAALYSAGHKQNKLDQI--STDLNNVRSVYKDNKKFQEFVLDPTLKANKKKTAIEAISTKLGLTKETGN-----FLGLLAENGRLNKLESVVSSFESIMRAHRGELFVQVTSAEELSSSNQKALSDALSKIGKSGQKLTVTYAVKPSILGGLVVTIGDKYVDLSIASRVKKYK 200
>gi|146284505|ref|YP_001174658.1| ATP synthase delta chain [Pseudomonas stutzeri A1501] >gi|145572710|gb|ABP81816.1| ATP synthase delta chain [Pseudomonas stutzeri A1501] (178 aa)
Score = 86, Expect = 4.2e-01, Identities = 25/134 (18%), Positives = 64/134 (47%)
  Q:    45 EMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           E+  +++   ++ E K + L ++  D +        +N++  L +N+    +  ++  +     + +  L   + + F +    L+ +    S +  + V  + +++ +LIGG+ I  G+ V D S++GK+ Q+
  S:    43 EVAALLNDPRLTSESKVQALVRVLGDDADEA----FRNYVQTLGENDRLSVLPTVWELYEDIKAQAEKTLEAEVETAFELSNAQLQTLAAALSKRLDRTVNLQQVVNPALIGGVLIRAGDVVVDGSVRGKLSQL 172
>gi|16272429|ref|NP_438642.1| F0F1 ATP synthase subunit delta [Haemophilus influenzae Rd KW20] >gi|42629936|ref|ZP_00155481.1| COG0712: F0F1-type ATP synthase, delta subunit (mitochondrial oligomycin sensitivity protein) [Haemophilus influenzae R2846] >gi|53733290|ref|ZP_00156315.2| COG0712: F0F1-type ATP synthase, delta subunit (mitochondrial oligomycin sensitivity protein) [Haemophilus influenzae R2866] >gi|68249084|ref|YP_248196.1| F0F1 ATP synthase subunit delta [Haemophilus influenzae 86-028NP] >gi|145632749|ref|ZP_01788483.1| F0F1 ATP synthase subunit delta [Haemophilus influenzae 3655] >gi|145634520|ref|ZP_01790229.1| F0F1 ATP synthase subunit delta [Haemophilus influenzae PittAA] >gi|145636250|ref|ZP_01791919.1| F0F1 ATP synthase subunit delta [Haemophilus influenzae PittHH] >gi|145638602|ref|ZP_01794211.1| F0F1 ATP synthase subunit delta [Haemophilus influenzae PittII] >gi|145640457|ref|ZP_01796041.1| F0F1 ATP synthase subunit delta [Haemophilus influenzae R3021] >gi|148827678|ref|YP_001292431.1| F0F1 ATP synthase subunit delta [Haemophilus influenzae PittGG] >gi|1168586|sp|P43717|ATPD_HAEIN ATP synthase delta chain >gi|1573460|gb|AAC22140.1| ATP synthase F1, subunit delta (atpH) [Haemophilus influenzae Rd KW20] >gi|68057283|gb|AAX87536.1| ATP synthase delta chain [Haemophilus influenzae 86-028NP] >gi|144986944|gb|EDJ93496.1| F0F1 ATP synthase subunit delta [Haemophilus influenzae 3655] >gi|145268065|gb|EDK08060.1| F0F1 ATP synthase subunit delta [Haemophilus influenzae PittAA] >gi|145270415|gb|EDK10349.1| F0F1 ATP synthase subunit delta [Haemophilus influenzae PittHH] >gi|145272197|gb|EDK12105.1| F0F1 ATP synthase subunit delta [Haemophilus influenzae PittII] >gi|145275043|gb|EDK14905.1| F0F1 ATP synthase subunit delta [Haemophilus influenzae 22.4-21] >gi|148718920|gb|ABR00048.1| F0F1 ATP synthase subunit delta [Haemophilus influenzae PittGG] (177 aa)
Score = 86, Expect = 4.2e-01, Identities = 22/100 (22%), Positives = 48/100 (48%)
  Q:    79 YLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           Y +N + ++ +N     I  +F  F   ++EHQ    + + S   +    +EKI      +  ++V+    +D +LI G+ +   + V D S +G++ ++
  S:    72 YGQNLIRLMAENKRLSAIPAVFEEFKHHVEEHQAIAEVEVTSAQPLNATQIEKIAAAMEKRLARKVKLNCNVDNALIAGVIVRTEDFVIDGSSRGQLTRL 171
>gi|196018139|ref|XP_002118744.1| hypothetical protein TRIADDRAFT_34654 [Trichoplax adhaerens] >gi|190578318|gb|EDV18771.1| hypothetical protein TRIADDRAFT_34654 [Trichoplax adhaerens] (182 aa)
Score = 86, Expect = 4.3e-01, Identities = 37/140 (26%), Positives = 75/140 (53%)
  Q:    40 LKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKI-EHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           +K N  +  ++ +  + K+ K+   N IF ++   +SN+ LKNF+ +L        + +I   F   +D H   + ++I     +++   +KI E L+     K+++++ I DKS++GGM I  G+ + D S+  K+ +I+
  S:    39 IKQNKSVQKLLFNKYVPKKVKSVFFNTIFNEIK--VSNL-LKNFIMILIQRKRLYLLDKIEKCFKDMIDSHNGIIKLKIKLANELDQDSNDKIKEKLYKYLGYKKIKFDFIYDKSILGGMLIEKGSQMLDLSLLAKLKKIE 176
>gi|91070174|gb|ABE11095.1| ATP synthase delta (OSCP) subunit [uncultured Prochlorococcus marinus clone HF10-11D6] (180 aa)
Score = 86, Expect = 4.4e-01, Identities = 43/169 (25%), Positives = 77/169 (45%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVV---EKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           YA AL  +  E  +  +++  S  K +   + ++ E+   + S I+  + K KI+ +IF     +  N  L NFL +L D      +  I   F +   E+ N     + S   +   +K L+ K   + +I   +++     ID SLIGG     G+ V D S+  +I ++
  S:    11 YAEALLQVVNENSQTEEMV--SEVKQLLELINDSPELEKALSSPILETDAKKKIIIEIF----SNKVNSSLLNFLKLLADRQRIGILTSILDRFLEIYRENSNIALATVTSAVELTDEQKGLITK--KIINIAGTEKLELVTKIDPSLIGGFVASVGSKVIDASLASQIRKL 174
>gi|163732298|ref|ZP_02139744.1| ATP synthase F1, delta subunit [Roseobacter litoralis Och 149] >gi|161394596|gb|EDQ18919.1| ATP synthase F1, delta subunit [Roseobacter litoralis Och 149] (188 aa)
Score = 86, Expect = 4.5e-01, Identities = 38/170 (22%), Positives = 79/170 (46%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEK----TKILNKIFFD--LSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           YA A+Y I    D K+          +  +L  + +   ++ S I ++EE+    T + +K+     ++ ++S +  K  LFV         + ++  +    + E +  +   + S   + K   +K+       TGK V     +D+SLIGG+ +  G+ + D SI+ K++ ++
  S:    17 YATAVYDI--AKDSKSVKSLEDDINVLQSALSESADFGALLSSPIYTREEQEAAITALASKMGLSTTMASTLSLMAQKRRLFV---------VPQLLSTLRAIIAEDKGEVTADVVSAKALTKTQADKLAKTLKASTGKTVTLNASVDESLIGGLVVKVGSRMIDTSIRSKLNSLQ 181
>gi|15604636|ref|NP_221154.1| F0F1 ATP synthase subunit delta [Rickettsia prowazekii str. Madrid E] >gi|6225072|sp|Q9ZCF2|ATPD_RICPR ATP synthase delta chain >gi|3861331|emb|CAA15230.1| ATP SYNTHASE DELTA CHAIN (atpH) [Rickettsia prowazekii] (183 aa)
Score = 86, Expect = 4.5e-01, Identities = 45/186 (24%), Positives = 91/186 (48%)
  Q:     1 MEEKNHIDHYANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIENNK 186
           M + N I +YA AL++  L  + + KI        +   +++++E+   + S +++K +K  + N +   +  +  N  + NFL +L  N+    +  I   + + L E +N   + + S   ++ K  E I+     +   +      ID ++IGG+ I + N + DYSIKG +++I   ++N K
  S:     1 MNKDNLIQNYAVALFNNALLDNIQVKI--CEEITLLNSIIEDSFEIKKFLFSPLVNKIDKINVFNSL---VKTTNFNKIVNNFLLLLIKNSRTHILSNIVEVYNKLLYESRNIKIVHVISTNELQPKEQEWIQSRIEKELQHKTELFFDIDNTIIGGIVIKYDNVLRDYSIKGSLEKIAKCLKNVK 181
>gi|145630336|ref|ZP_01786117.1| F0F1 ATP synthase subunit delta [Haemophilus influenzae 22.4-21] >gi|144984071|gb|EDJ91508.1| F0F1 ATP synthase subunit delta [Haemophilus influenzae R3021] (177 aa)
Score = 86, Expect = 4.6e-01, Identities = 22/100 (22%), Positives = 48/100 (48%)
  Q:    79 YLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           Y +N + ++ +N     I  +F  F   ++EHQ    + + S   +    +EKI      +  ++V+    +D +LI G+ +   + V D S +G++ ++
  S:    72 YGQNLIRLMAENKRLSAIPAVFEEFKHHVEEHQAIAEVEVTSAQPLNATQIEKIAAAMEKRLARKVKLNCNVDNALIAGVIVRTEDFVIDGSSRGQLTRL 171
>gi|90578415|ref|ZP_01234226.1| hypothetical ATP synthase F1, delta subunit [Vibrio angustum S14] >gi|90441501|gb|EAS66681.1| hypothetical ATP synthase F1, delta subunit [Vibrio angustum S14] (182 aa)
Score = 86, Expect = 4.7e-01, Identities = 28/126 (22%), Positives = 64/126 (50%)
  Q:    58 EEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYS--PFVVEKK--LLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIE 183
           E  +     +F  + + + + + +N + V+ +N     I ++   F +  ++H+  +   + +  P   E+K  L++ ++     K  + V  +  ID+SL+GGM I  G  V D S+K  I+++  +++
  S:    56 EHDSTAFTDMFLGVCEGLLDEHGQNLIRVMAENGRLNVIAQVAELFHELKEDHERMVTATVTTTEPLTDEQKANLIQALQK----KLNRSVELDCHIDESLVGGMLIKAGEMVIDGSLKSSINRLATSLQ 181
>gi|90421701|ref|YP_530071.1| F0F1 ATP synthase subunit delta [Rhodopseudomonas palustris BisB18] >gi|90103715|gb|ABD85752.1| ATP synthase F1, delta subunit [Rhodopseudomonas palustris BisB18] (203 aa)
Score = 86, Expect = 4.7e-01, Identities = 39/170 (22%), Positives = 77/170 (45%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFS--LKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           YA AL+    EL +  K +    A    F   L ++ E+  ++ S + S E ++K L  +   L K+        FL VL  N     + ++  ++   + + +      +     + +K L+ ++      TGK V     +D ++IGG+ +  G+ + D S++ K++ IK
  S:    32 YATALF----ELARDEKAVDAVKADLDRFKAMLADSPELTRLVRSPVFSAETQSKALAAV---LDKAGFAGTTAKFLKVLTANRRLFTVTDVIRAYGALVAKFKGEATADVTVAEPLSEKNLDALKTALKSVTGKDVALNVNVDPAIIGGLVVKLGSRMVDSSLRTKLNSIK 196
>gi|86141103|ref|ZP_01059662.1| ATP synthase d subunit [Flavobacterium sp. MED217] >gi|85833045|gb|EAQ51494.1| ATP synthase d subunit [Leeuwenhoekiella blandensis MED217] (179 aa)
Score = 86, Expect = 4.7e-01, Identities = 35/158 (22%), Positives = 73/158 (46%)
  Q:    22 DKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPF----VVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           +K  + +   + K I  +L  + E+  ++ S +I  E+K   L  +F D   S   + L + L     +    ++ + ++S +   +E +  +  ++ +       +E K+L K++ L        V  E  ID SLIGG  +  G+  YD S+  ++  ++
  S:    19 EKGTEEVVFGNMKSIDATLNASKELRSVLKSPVIKPEDKRASLKAVFADYDPS--TLSLIDLLVDKKRSALLGQVAQSYVSLY---NESKGIVVAQVTTAVELDASLEAKILAKVKEL---TNSSEVTLEQHIDPSLIGGFILRVGDVQYDASVANQLVSVQ 172
>gi|28899846|ref|NP_799451.1| F0F1 ATP synthase subunit delta [Vibrio parahaemolyticus RIMD 2210633] >gi|28808098|dbj|BAC61335.1| ATP synthase F1, delta subunit [Vibrio parahaemolyticus RIMD 2210633] (177 aa)
Score = 85, Expect = 4.7e-01, Identities = 24/115 (20%), Positives = 57/115 (49%)
  Q:    64 LNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           + +IF  +     + + +N L V+ +N     + ++   FF    EH+  + + + S   +  + L  I      +  ++V+    +D++L+GG+ I  G+ V D S +G+++++
  S:    57 MAEIFVAVCGEQVDAHGQNLLKVMAENGRLAALPDVCEQFFILKKEHEKEIDVEVISASELSDEQLANIGSKLEARLERKVKLNCSVDETLLGGVIIRAGDLVIDDSARGRLNRL 171
>gi|126653444|ref|ZP_01725540.1| F0F1 ATP synthase subunit delta [Bacillus sp. B14905] >gi|126589800|gb|EAZ83933.1| F0F1 ATP synthase subunit delta [Bacillus sp. B14905] (178 aa)
Score = 85, Expect = 5.1e-01, Identities = 18/48 (37%), Positives = 31/48 (64%)
  Q:   132 IEHLFSIKTGKR-VRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           I   F+   GK+ +   N ID SL+GG+++  GN +YD S+  K++++K
  S:   125 ISTTFAKLVGKQSLNITNEIDPSLLGGIRVQIGNHIYDSSVANKLERLK 173
>gi|13473459|ref|NP_105026.1| F0F1 ATP synthase subunit delta [Mesorhizobium loti MAFF303099] >gi|14024208|dbj|BAB50812.1| ATP synthetase delta [Mesorhizobium loti MAFF303099] (186 aa)
Score = 85, Expect = 5.1e-01, Identities = 39/172 (22%), Positives = 75/172 (43%)
  Q:     8 DHYANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           + YA +L+ + L+ +   K+   S        L  + ++  +I+S + S EE+ K +  I       I+ +   NFL V+  N     +  +  +F Q   EH+      + S   +      +++       GK V     +D SL+GG+ +  G+   D S+K K++ +K
  S:    13 ERYAGSLFELALQANSVAKV--ESDLNSFEAMLAGSSDLTRLINSPVFSGEEQAKAIAAI--ADKAGITGL-TGNFLRVVARNRRLFAVPGMIKAFRQIAAEHRGETAAEVTSAHELTAAQQTELKAALKSVAGKDVAISVTVDPSLLGGLVVKIGSRQIDTSLKTKLNSLK 179
>gi|55820564|ref|YP_139006.1| F0F1 ATP synthase subunit delta [Streptococcus thermophilus LMG 18311] >gi|116627373|ref|YP_819992.1| F0F1 ATP synthase subunit delta [Streptococcus thermophilus LMD-9] >gi|55736549|gb|AAV60191.1| H+-translocating ATPase delta subunit [Streptococcus thermophilus LMG 18311] >gi|116100650|gb|ABJ65796.1| F0F1-type ATP synthase, delta subunit [Streptococcus thermophilus LMD-9] (178 aa)
Score = 85, Expect = 5.1e-01, Identities = 48/177 (27%), Positives = 80/177 (45%)
  Q:     7 IDHYANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDN---NFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKK--LLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIKWNIE 183
           ++ YA +L  +  E D  + I      + I            +   N+ S+ +K  +    FF  S S+   Y+ NFL V++ N   N    +L++ +  F + D   + + +   SP   E+K  LL  +   F IKT + V     ID+ LIGG  I   N   D SI+ ++   K N++
  S:     9 VEQYARSLVEVAFEQDAVSTI--QEEVRQILTVFAETNLKTFLSQVNVTSEAKKESL---SFFQESCSV---YMNNFLEVISLNDRANILYDVLKLVLELFDQEDNTYD-VTVTSASPLSEEQKTRLLTIVSQKFEIKTRRLVEK---IDEELIGGFVIKAKNKFVDTSIRSQLQAFKMNLK 178
>gi|123969186|ref|YP_001010044.1| F0F1 ATP synthase subunit delta [Prochlorococcus marinus str. AS9601] >gi|123199296|gb|ABM70937.1| ATP synthase, delta (OSCP) subunit [Prochlorococcus marinus str. AS9601] (180 aa)
Score = 85, Expect = 5.2e-01, Identities = 43/169 (25%), Positives = 77/169 (45%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVV---EKKLLEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           YA AL  +  E  +  +++  S  K +   + ++ E+   + S I+  + K KI+ +IF     +  N  L NFL +L D      +  I   F +   E+ N     + S   +   +K L+ K   + +I   +++     ID SLIGG     G+ V D S+  +I ++
  S:    11 YAEALLQVVNENSQTEEMV--SEVKQLLELVNDSPELEKALSSPILETDAKKKIIIEIF----SNKVNSSLLNFLKLLADRQRIGILTSILDRFLEIYRENSNIALATVTSAVELTDEQKGLITK--KIINIAGTEKLELVTKIDPSLIGGFVASVGSKVIDASLASQIRKL 174
>gi|69247778|ref|ZP_00604483.1| H+-transporting two-sector ATPase, delta (OSCP) subunit [Enterococcus faecium DO] >gi|68194707|gb|EAN09189.1| H+-transporting two-sector ATPase, delta (OSCP) subunit [Enterococcus faecium DO] (180 aa)
Score = 85, Expect = 5.4e-01, Identities = 42/152 (27%), Positives = 82/152 (53%)
  Q:    28 IFTSSAKDIY---FSLKNNYEMV----HIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYS--PFVVEKKL-LEKIEHLFSIKTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           I ++ A++IY    SL+  YE V    +++    +   EK +I++K+      S  +  +KNFL V+   N    +L +   + ++ DEHQ  L   + +  P   E+++ LEK  ++      + V  + I+D S+IGG  +   + V D SI+ +++ ++
  S:    21 IDSNQAEEIYQDLVSLRQIYEQVPGLGNMLSDVRLEPHEKREIMDKLV-----SGYDGIVKNFLEVVYAYNRMDDLLFMIEEYERRYDEHQGLLLGSVTTAVPLSDEQRIQLEK--NVAKTMNYQSVELKQIVDSSIIGGAIVEANHRVIDGSIRTQLENMR 175
>gi|71984717|ref|NP_001021421.1| ATP synthase subunit family member (atp-3) [Caenorhabditis elegans] >gi|38638821|gb|AAR25649.1| Atp synthase subunit protein 3, isoform b [Caenorhabditis elegans] (228 aa)
Score = 85, Expect = 5.4e-01, Identities = 38/170 (22%), Positives = 81/170 (47%)
  Q:    10 YANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVH-IIDSNIISKEEKTKILN-KIFFDLSKSISNIYLKNFLFVLNDNNFFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSI--KTGKRVRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQIK 179
           YA ALYS   + +K ++I  ++   ++    K+N +    ++D  + + ++KT I        L+K   N     FL +L +N    ++  +  SF   +  H+  LF+++ S   +     + +    S   K+G+++     +  S++GG+ +  G+   D SI  ++ + K
  S:    55 YAAALYSAGHKQNKLDQI--STDLNNVRSVYKDNKKFQEFVLDPTLKANKKKTAIEAISTKLGLTKETGN-----FLGLLAENGRLNKLESVVSSFESIMRAHRGELFVQVTSAEELSSSNQKALSDALSKIGKSGQKLTVTYAVKPSILGGLVVTIGDKYVDLSIASRVKKYK 221
>gi|56751187|ref|YP_171888.1| F0F1 ATP synthase subunit delta [Synechococcus elongatus PCC 6301] >gi|81299146|ref|YP_399354.1| F0F1 ATP synthase subunit delta [Synechococcus elongatus PCC 7942] >gi|114585|sp|P08448|ATPD_SYNP6 ATP synthase delta chain >gi|48016|emb|CAA28927.1| unnamed protein product [Synechococcus elongatus PCC 6301] >gi|56686146|dbj|BAD79368.1| ATP synthase d subunit [Synechococcus elongatus PCC 6301] >gi|81168027|gb|ABB56367.1| ATP synthase F1, delta subunit [Synechococcus elongatus PCC 7942] (180 aa)
Score = 85, Expect = 5.4e-01, Identities = 40/171 (23%), Positives = 83/171 (48%)
  Q:     8 DHYANALYSIWLELDKKNKIIFTSSAKDIYFSLKNNYEMVHIIDSNIISKEEKTKILNKIFFDLSKSISNIYLKNFLFVLNDNN--FFKRILEIFISFFQKLDEHQNFLFIRIYSPFVVEKKLLEKIEHLFSIKTGKR-VRYENIIDKSLIGGMKIMFGNDVYDYSIKGKIDQI 178
           D YA AL +I  E   +++  F   A     +L  + ++ H++++  +   +K  +LN++F     S+  + L     +++ N   F   I + + +  +KL   +N +   + S   + +  ++ I       TG   V  E+ +D  L+GG+ I  G+ V D S++G++ +I
  S:     9 DPYAEALMAIAREQGLEDR--FGEDAALFRSTLAASADLRHLLENPTLFSSQKKAVLNQVF---GSSVHPLVLNFLNLLVDRNRIAFLDGIADRYQALLRKL---RNVVRADVSSAVPLTEAQVQVITEKVKQLTGAAGVEIESQVDADLLGGVIIKVGSQVLDASLRGQLKRI 174