>gi|26554410|ref|NP_758344.1| transposase [Mycoplasma penetrans HF-2] >gi|26454420|dbj|BAC44748.1| transposase [Mycoplasma penetrans HF-2] (402 aa)
Score = 584, Expect = 4.8e-59, Identities = 122/122 (100%), Positives = 122/122 (100%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI
  S:   281 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 402
>gi|26553458|ref|NP_757392.1| transposase [Mycoplasma penetrans HF-2] >gi|26453464|dbj|BAC43796.1| transposase [Mycoplasma penetrans HF-2] (122 aa)
Score = 530, Expect = 7.7e-53, Identities = 122/122 (100%), Positives = 122/122 (100%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI
  S:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
>gi|57234003|ref|YP_182013.1| ISDet4, transposase [Dehalococcoides ethenogenes 195] >gi|57224451|gb|AAW39508.1| ISDet4, transposase [Dehalococcoides ethenogenes 195] (413 aa)
Score = 302, Expect = 2.1e-26, Identities = 63/122 (51%), Positives = 80/122 (65%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           MKKIY+AP  +     L +F EKW  KY  A KSW ++  EL+TFF++P EIRRLIYTTN IEN NR +R++TK K    S  AL K +YL +++I+E W S V  W  IL QL ILF + I
  S:   287 MKKIYKAPTEEAGRAQLDVFAEKWGKKYPAAIKSWFDHWIELSTFFKYPPEIRRLIYTTNRIENFNRRLRRVTKTKSAYPSDTALLKSLYLAILDITEKWGS-VQGWHSILGQLMILFNDRI 407
>gi|150006150|ref|YP_001300894.1| putative transposase [Bacteroides vulgatus ATCC 8482] >gi|149934574|gb|ABR41272.1| putative transposase [Bacteroides vulgatus ATCC 8482] (124 aa)
Score = 293, Expect = 2.6e-25, Identities = 62/122 (50%), Positives = 81/122 (66%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           MK IY APN +V+   L    +KW  KY YA  SW N  ++LT FFQFP EIR++IYTTNLIEN+N  IRK TK+K    S +A+ K++YL L+ I + W   + NWGLI+ Q  ++FEN I
  S:     1 MKNIYNAPNKEVAAAELDNLEKKWGGKYPYAILSWRNKWDDLTVFFQFPLEIRKIIYTTNLIENLNGKIRKYTKSKLSFPSDDAVKKMVYLSLMEIEKKWTQPIHNWGLIMNQFMLMFENRI 122
>gi|153810306|ref|ZP_01962974.1| hypothetical protein RUMOBE_00687 [Ruminococcus obeum ATCC 29174] >gi|149833485|gb|EDM88566.1| hypothetical protein RUMOBE_00687 [Ruminococcus obeum ATCC 29174] (415 aa)
Score = 291, Expect = 4.8e-25, Identities = 54/122 (44%), Positives = 80/122 (65%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K++Y AP  +V++  L  F EKWS KY    KSW +N   L+T+F++P  +RRLIYTTN IE  NR +RK+TK+K    S ++L K++YL +I+I++ W     +WG I  QL+I FE  +
  S:   291 LKRVYAAPTEEVALAELDSFDEKWSGKYPKIAKSWKDNWANLSTYFKYPEAVRRLIYTTNTIEGFNRQLRKVTKSKTVFPSDDSLLKMLYLAMIDITKKWTGHRQDWGQIHSQLEIFFEERL 412
>gi|150015561|ref|YP_001307815.1| transposase, mutator type [Clostridium beijerinckii NCIMB 8052] >gi|149902026|gb|ABR32859.1| transposase, mutator type [Clostridium beijerinckii NCIMB 8052] (406 aa)
Score = 287, Expect = 1.2e-24, Identities = 55/122 (45%), Positives = 80/122 (65%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K +Y+AP  DV++  L    EKW  KY  A KSW NN +EL+TFF++P EIR++IYTTN +E+ NR +RK+TK+K    +  +L K++YL  I+I++ W   +  W  IL QL I FE  +
  S:   280 LKSVYKAPTEDVALAELDNLEEKWGGKYLIAIKSWRNNWDELSTFFKYPPEIRKIIYTTNAMESYNRQLRKVTKSKSIFPNDESLLKILYLATIDITKKWTQGIKGWAQILAQLSIFFEGRL 401
>gi|47059340|gb|AAT09352.1| truncated putative transposase [Ornithobacterium rhinotracheale] (200 aa)
Score = 287, Expect = 1.4e-24, Identities = 59/122 (48%), Positives = 78/122 (63%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           MK IY APN + +  AL  F EKW  KY YA KSW ++ EELT FF FP EIR++IYTTNLIEN+N  IRK TK K    +  A+ K +YL +   ++ W   + NWGL+L Q  ++F+  +
  S:    77 MKNIYTAPNREAAKLALDDFAEKWEDKYSYAVKSWRDHWEELTVFFDFPLEIRKIIYTTNLIENLNGKIRKYTKNKMSFPTDEAVMKSVYLSIREATKKWSMPIRNWGLVLNQFMLIFDQRL 198
>gi|120435365|ref|YP_861051.1| mutator family transposase [Gramella forsetii KT0803] >gi|120435941|ref|YP_861627.1| mutator family transposase [Gramella forsetii KT0803] >gi|117577515|emb|CAL65984.1| mutator family transposase [Gramella forsetii KT0803] >gi|117578091|emb|CAL66560.1| mutator family transposase [Gramella forsetii KT0803] (398 aa)
Score = 284, Expect = 2.6e-24, Identities = 58/122 (47%), Positives = 77/122 (63%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           MK IY APN   +  AL+ F  +W SKY YA KSW +N E+LT FF+FP EIR++IYTTNLIEN+N  IRK TK K    +  A+ K +YL     ++ W   + NWG+IL Q   ++E  +
  S:   275 MKHIYNAPNQQAAKAALEDFAAQWESKYSYAIKSWRDNWEDLTVFFEFPLEIRKIIYTTNLIENLNGKIRKYTKNKLSFPTDEAVMKSVYLATREATKKWSMPIRNWGIILNQFLTIYEKRV 396
>gi|153852956|ref|ZP_01994393.1| hypothetical protein DORLON_00378 [Dorea longicatena DSM 13814] >gi|153853904|ref|ZP_01995237.1| hypothetical protein DORLON_01228 [Dorea longicatena DSM 13814] >gi|149753286|gb|EDM63217.1| hypothetical protein DORLON_01228 [Dorea longicatena DSM 13814] >gi|149754598|gb|EDM64529.1| hypothetical protein DORLON_00378 [Dorea longicatena DSM 13814] (413 aa)
Score = 272, Expect = 7.5e-23, Identities = 50/122 (40%), Positives = 80/122 (65%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K +Y+A    ++++AL +  E W  KY  +  SW NN  +L+T+F++P EIR+LIYTTN IEN NR +RK+TK+K    + ++L K++YL + +I++ W  +  +WG  L QL I F + I
  S:   286 LKLVYKADTEQLALEALDMLEENWGGKYPSSIASWRNNWPQLSTYFKYPGEIRKLIYTTNSIENFNRQLRKVTKSKTIFPTDDSLFKILYLAMTDITKKWTGKTWDWGQTLDQLCIYFGDRI 407
>gi|14518308|ref|NP_116791.1| putative transposase [Microscilla sp. PRE1] >gi|14484943|gb|AAK62825.1| MS103, putative transposase [Microscilla sp. PRE1] (413 aa)
Score = 272, Expect = 7.6e-23, Identities = 59/122 (48%), Positives = 76/122 (62%)
  Q:     1 MKKIYQAPNFDVSMK-ALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K IYQA   D   K AL    EKW  KY    +SWN+N E L+T+F +   IR+LIYTTN +E  +R +RK+TK+KG  TS  AL KL+YL    I + W S + NWGL +QQL I FE  +
  S:   280 LKPIYQADTRDQPGKPALLELEEKWGKKYPVVIRSWNDNWELLSTYFDYSRPIRKLIYTTNPVEGFHRQVRKVTKSKGAFTSDMALLKLVYLVTRRIEKKWTSPLQNWGLTVQQLAIRFEGRL 402
>gi|29345690|ref|NP_809193.1| transposase for insertion sequence element ISRM3 [Bacteroides thetaiotaomicron VPI-5482] >gi|29347406|ref|NP_810909.1| transposase [Bacteroides thetaiotaomicron VPI-5482] >gi|29348172|ref|NP_811675.1| transposase [Bacteroides thetaiotaomicron VPI-5482] >gi|29337583|gb|AAO75387.1| transposase for insertion sequence element ISRM3 [Bacteroides thetaiotaomicron VPI-5482] >gi|29339306|gb|AAO77103.1| transposase [Bacteroides thetaiotaomicron VPI-5482] >gi|29340075|gb|AAO77869.1| transposase [Bacteroides thetaiotaomicron VPI-5482] (405 aa)
Score = 263, Expect = 7.3e-22, Identities = 52/118 (44%), Positives = 72/118 (61%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           +K +YQAPN D++   L    +KW  KY    +SW  N + L+ +F +   IRRLIYTTN +E  +R +RK+TK KG   +  AL KLIYL ++NIS+ W   + NW L   QL+I F
  S:   280 LKTVYQAPNKDLAELNLDKLQDKWGKKYPVVLESWRRNWDNLSAYFAYDEHIRRLIYTTNAVEGFHRQVRKVTKTKGVFPNDMALMKLIYLAVMNISKKWTQPLQNWALTAGQLRIKF 397
>gi|160871660|ref|ZP_02061792.1| transposase, Mutator family [Rickettsiella grylli] >gi|160871990|ref|ZP_02062122.1| transposase, Mutator family [Rickettsiella grylli] >gi|160872219|ref|ZP_02062351.1| transposase, Mutator family [Rickettsiella grylli] >gi|160872257|ref|ZP_02062389.1| transposase, Mutator family [Rickettsiella grylli] >gi|160872571|ref|ZP_02062703.1| transposase, Mutator family [Rickettsiella grylli] >gi|160872670|ref|ZP_02062802.1| transposase, Mutator family [Rickettsiella grylli] >gi|160872908|ref|ZP_02063040.1| transposase, Mutator family [Rickettsiella grylli] >gi|159120459|gb|EDP45797.1| transposase, Mutator family [Rickettsiella grylli] >gi|159120789|gb|EDP46127.1| transposase, Mutator family [Rickettsiella grylli] >gi|159121018|gb|EDP46356.1| transposase, Mutator family [Rickettsiella grylli] >gi|159121056|gb|EDP46394.1| transposase, Mutator family [Rickettsiella grylli] >gi|159121370|gb|EDP46708.1| transposase, Mutator family [Rickettsiella grylli] >gi|159121469|gb|EDP46807.1| transposase, Mutator family [Rickettsiella grylli] >gi|159121707|gb|EDP47045.1| transposase, Mutator family [Rickettsiella grylli] (406 aa)
Score = 263, Expect = 7.4e-22, Identities = 52/122 (42%), Positives = 73/122 (59%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K +Y+A + D++   L    EKW  KY    KSW    E L+ +F++P E+RR++YTTN++E  +R +RK TK KG  TS NAL KLIY     I E W   + NW LI  QL+I F+  +
  S:   280 LKLVYRASSKDLAEHRLLELDEKWGKKYPAVIKSWQTQWERLSQYFKYPEELRRIVYTTNIVEGFHRQVRKYTKNKGAFTSENALLKLIYCACQKILEKWYQPLHNWALIASQLQIFFDGRL 401
>gi|121535884|ref|ZP_01667682.1| transposase, mutator type [Thermosinus carboxydivorans Nor1] >gi|121305549|gb|EAX46493.1| transposase, mutator type [Thermosinus carboxydivorans Nor1] (408 aa)
Score = 263, Expect = 7.9e-22, Identities = 51/122 (41%), Positives = 76/122 (62%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +KK+Y AP  + +   L+ F EKW  KY    KSW+ N  EL+T+F++P E+R LIYTTN +E  +R +RK TK K    + +A+ K +Y+ +  IS+ W   + NWG+I  QL I FE+ +
  S:   281 LKKVYGAPTLEDAEYRLEEFREKWGRKYPQILKSWDANWAELSTYFKYPQEVRTLIYTTNAVEGFHRMLRKFTKTKTIYPTDDAVRKSVYMSVQEISKKWSMPIRNWGIIFGQLMIFFEDRL 402
>gi|160871725|ref|ZP_02061857.1| transposase, Mutator family [Rickettsiella grylli] >gi|160872321|ref|ZP_02062453.1| transposase, Mutator family [Rickettsiella grylli] >gi|160872379|ref|ZP_02062511.1| transposase, Mutator family [Rickettsiella grylli] >gi|160872641|ref|ZP_02062773.1| transposase, Mutator family [Rickettsiella grylli] >gi|160872704|ref|ZP_02062836.1| transposase, Mutator family [Rickettsiella grylli] >gi|160872855|ref|ZP_02062987.1| transposase, Mutator family [Rickettsiella grylli] >gi|159120524|gb|EDP45862.1| transposase, Mutator family [Rickettsiella grylli] >gi|159121120|gb|EDP46458.1| transposase, Mutator family [Rickettsiella grylli] >gi|159121178|gb|EDP46516.1| transposase, Mutator family [Rickettsiella grylli] >gi|159121440|gb|EDP46778.1| transposase, Mutator family [Rickettsiella grylli] >gi|159121503|gb|EDP46841.1| transposase, Mutator family [Rickettsiella grylli] >gi|159121654|gb|EDP46992.1| transposase, Mutator family [Rickettsiella grylli] (407 aa)
Score = 263, Expect = 8.4e-22, Identities = 53/122 (43%), Positives = 74/122 (60%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K +Y+A + D++   L    EKW  KY    KSW    ++L+ +F++P E+RR+IYTTN+IE  +R +RK TK KG  TS NAL KLIY     I E W   + NW LI  QL+I F+  +
  S:   281 LKLVYRASSKDLAEHHLLELDEKWGKKYPAVIKSWQTQWDKLSQYFKYPEELRRIIYTTNIIEGFHRQVRKYTKNKGAFTSENALLKLIYCACQKILEKWCQPLHNWALIASQLQIFFDGRL 402
>gi|42520146|ref|NP_966061.1| IS256 family transposase [Wolbachia endosymbiont of Drosophila melanogaster] >gi|42409883|gb|AAS13995.1| transposase, IS256 family [Wolbachia endosymbiont of Drosophila melanogaster] (410 aa)
Score = 262, Expect = 1.0e-21, Identities = 51/118 (43%), Positives = 72/118 (61%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           +KKIY+A + +++   L    EKW  KY    KSW NN E L+++F++   +R+LIYTTN IE ++R IRK TK KG  TS NAL K +Y  +  + + W   + NW L + QL I F
  S:   284 LKKIYRASSKEIAENYLLELEEKWGEKYPLVIKSWQNNWENLSSYFKYSGPVRKLIYTTNPIEGLHRQIRKFTKTKGSFTSTNALYKQVYCAIKKVEQKWIMALPNWALTMSQLDIFF 401
>gi|160873087|ref|YP_001557092.1| transposase mutator type [Shewanella baltica OS195] >gi|160877500|ref|YP_001556816.1| transposase mutator type [Shewanella baltica OS195] >gi|160858609|gb|ABX51832.1| transposase mutator type [Shewanella baltica OS195] >gi|160863022|gb|ABX51556.1| transposase mutator type [Shewanella baltica OS195] (400 aa)
Score = 256, Expect = 5.2e-21, Identities = 49/122 (40%), Positives = 72/122 (59%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K +Y+A   +V+  +L    EKW  +Y    KSW N    L+ +F++P  IR+ IYTTN IE V+R  RK+TK KG   + N+L KL+Y  ++N S+ W   + NWG  L QL I F+  +
  S:   273 LKLVYRASTLEVAAASLDDLEEKWGEQYPIVIKSWRNKWVNLSAYFKYPHYIRKAIYTTNAIEAVHRQFRKLTKTKGAFPNENSLLKLLYAGILNASKKWTMPIQNWGPTLSQLAIHFDGRL 394
>gi|167036696|ref|YP_001664274.1| transposase, mutator type [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|167038415|ref|YP_001665993.1| transposase, mutator type [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|166855530|gb|ABY93938.1| transposase, mutator type [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|166857249|gb|ABY95657.1| transposase, mutator type [Thermoanaerobacter pseudethanolicus ATCC 33223] (405 aa)
Score = 254, Expect = 8.6e-21, Identities = 47/117 (40%), Positives = 76/117 (64%)
  Q:     2 KKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           K +YQ+ N +++    +    KW + Y YA KSW NN + L+ F++FP E+R+++YTTN+IE  +R +RK+TK+K    S  AL K++YL  +N+ + W  R  NW ++L QL I++
  S:   281 KAVYQSANEEIARDEFEKLKNKWQNLYPYAIKSWENNWDVLSPFYKFPEEVRKIMYTTNIIEGFHRQLRKVTKSKTIFPSDEALEKMLYLVTMNVLKKWTVRYKNWDIVLNQLIIMY 397
>gi|150389399|ref|YP_001319448.1| transposase, mutator type [Alkaliphilus metalliredigens QYMF] >gi|149949261|gb|ABR47789.1| transposase, mutator type [Alkaliphilus metalliredigens QYMF] (406 aa)
Score = 253, Expect = 1.1e-20, Identities = 50/121 (41%), Positives = 74/121 (61%)
  Q:     2 KKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           K++Y A N     + L     KW  KY YA KSW+ N + L+ FF+FP+E+R+++YTTN+IE ++R  RK+TK K    S  AL K+++L   NI + W     NW ++L QL I FE+ +
  S:   281 KEVYTAVNEKAGHEKLMELENKWGKKYPYAIKSWDANWDVLSPFFKFPSEVRKIMYTTNMIEGLHRQFRKVTKTKSIFPSDQALEKMLFLASQNIMKKWTLSHRNWDIVLNQLMIFFEDRL 401
>gi|78045274|ref|YP_361525.1| transposase mutator family protein [Xanthomonas campestris pv. vesicatoria str. 85-10] >gi|78033778|emb|CAJ19778.1| ISXax1 transposase [Xanthomonas campestris pv. vesicatoria str. 85-10] >gi|87248040|gb|ABD36387.1| putative transposase [Xanthomonas axonopodis pv. phaseoli] (408 aa)
Score = 252, Expect = 1.4e-20, Identities = 49/122 (40%), Positives = 72/122 (59%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K+IY     + + +AL  F  KW ++Y   ++SW  N   L  FF +P EIR++IYTTN IE+VN ++RK+TK +G   S  AL KL YL L NI++ W   + +W   L +  I FE  +
  S:   284 LKRIYACATVEEAEQALTEFEAKWDAQYPPISQSWRRNWSRLIPFFDYPPEIRKVIYTTNAIESVNMSLRKLTKNRGAFPSDEALMKLFYLALRNITKKWTLPIRDWKAALNRFTIQFEGRL 405
>gi|119357032|ref|YP_911676.1| transposase, mutator type [Chlorobium phaeobacteroides DSM 266] >gi|119354381|gb|ABL65252.1| transposase, mutator type [Chlorobium phaeobacteroides DSM 266] (411 aa)
Score = 251, Expect = 1.7e-20, Identities = 45/122 (36%), Positives = 78/122 (63%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K IY +   + +  +L+ F +KW SKY   ++ W+ + E +  FF +P +IR++IYTTN IE++NR++RK+ K KG   +  ++ KL+YL + NI++ W   + +WG ++ QL I FE  +
  S:   288 LKTIYGSNTLEEAELSLQAFGKKWDSKYPTVSQLWHRHWENIVPFFAYPKQIRKVIYTTNAIESLNRSLRKVLKTKGAFPNDESIIKLMYLAMQNIAKKWTLPLRDWGSVINQLSIKFEGRV 409
>gi|29349845|ref|NP_813348.1| transposase [Bacteroides thetaiotaomicron VPI-5482] >gi|29341756|gb|AAO79542.1| transposase [Bacteroides thetaiotaomicron VPI-5482] (404 aa)
Score = 251, Expect = 1.8e-20, Identities = 53/120 (44%), Positives = 72/120 (60%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFEN 120
           +K +YQA N + +   L    EKW  +Y    +SW +N ++L+ +FQ+   IR+LIYTTN +E  +R IRK+TK KG   S  AL KL+YL   NI + W   +ANW  I QQL I F N
  S:   280 LKCVYQAVNKESAENELLKLDEKWGEQYPVVIRSWQDNWDKLSEYFQYTPVIRKLIYTTNTVEGYHRQIRKVTKNKGVFPSDTALEKLVYLAYRNIRKKWTMPLANWATISQQLAIKFGN 399
>gi|118578585|ref|YP_899835.1| transposase, mutator type [Pelobacter propionicus DSM 2379] >gi|118501295|gb|ABK97777.1| transposase, mutator type [Pelobacter propionicus DSM 2379] (266 aa)
Score = 251, Expect = 2.0e-20, Identities = 49/122 (40%), Positives = 73/122 (59%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K IYQAP  +++ K L  F  KW + +    +SW NN E +   F +P EIR+ IYTTN IE++N ++RK+TK +G   S  A+ KL+YL L NI++ W   + +W   L Q  I+F   +
  S:   142 LKAIYQAPTVEMAEKNLDAFAAKWDASHPTIARSWRNNWERIIPLFSYPTEIRKAIYTTNAIESLNMSLRKVTKNRGHFPSDEAMFKLLYLALKNIAKKWTMPIRDWKSALNQFSIMFHGRM 263
>gi|24374871|ref|NP_718914.1| ISSod5, transposase [Shewanella oneidensis MR-1] >gi|24349569|gb|AAN56358.1|AE015773_3 ISSod5, transposase [Shewanella oneidensis MR-1] (401 aa)
Score = 250, Expect = 2.3e-20, Identities = 49/122 (40%), Positives = 69/122 (56%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K +Y+A   + +  AL     KW  KY    KSW N    L+ +F++P  +R  IYTTN +E V+R  RK+TK KGG  + N+L KL+Y  ++  SE W   + NW L L QL I FE  +
  S:   274 LKCVYKAATLNAAEMALDELETKWGDKYPVVIKSWRNKWALLSVYFKYPDYVRTAIYTTNAVEAVHRQFRKLTKTKGGFANENSLLKLLYAGILKASERWTHPIQNWNLTLSQLSIHFEGRL 395
>gi|147678783|ref|YP_001212998.1| transposase and inactivated derivatives [Pelotomaculum thermopropionicum SI] >gi|146274880|dbj|BAF60629.1| transposase and inactivated derivatives [Pelotomaculum thermopropionicum SI] (406 aa)
Score = 250, Expect = 2.5e-20, Identities = 49/122 (40%), Positives = 73/122 (59%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +KK+YQA   + +  A K+F EKW  K+    +SW  N  ELT +F++P EIR+LIYTTN+IE  +R +RK+TK K    + +AL K+IYL  +  S+ W   +  W   + Q  I F + +
  S:   278 LKKVYQALTMEEAELAFKMFKEKWGKKHPVIIRSWEKNWLELTAYFKYPYEIRKLIYTTNIIEGYHRQLRKVTKTKTAYPTDDALKKIIYLATVEASKKWTVPIKEWKSCISQFAIHFSDRL 399
>gi|147677687|ref|YP_001211902.1| transposase and inactivated derivatives [Pelotomaculum thermopropionicum SI] >gi|146273784|dbj|BAF59533.1| transposase and inactivated derivatives [Pelotomaculum thermopropionicum SI] (406 aa)
Score = 250, Expect = 2.5e-20, Identities = 49/122 (40%), Positives = 73/122 (59%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +KK+YQA   + +  A K+F EKW  K+    +SW  N  ELT +F++P EIR+LIYTTN+IE  +R +RK+TK K    + +AL K+IYL  +  S+ W   +  W   + Q  I F + +
  S:   278 LKKVYQALTMEEAELAFKMFKEKWGKKHPVIIRSWEKNWLELTAYFKYPYEIRKLIYTTNIIEGYHRQLRKVTKTKTAYPTDDALKKIIYLATVEASKKWTVPIKEWKSCISQFAIHFSDRL 399
>gi|24375366|ref|NP_719409.1| ISSod5, transposase [Shewanella oneidensis MR-1] >gi|24350190|gb|AAN56853.1|AE015820_6 ISSod5, transposase [Shewanella oneidensis MR-1] (401 aa)
Score = 250, Expect = 2.6e-20, Identities = 49/122 (40%), Positives = 69/122 (56%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K +Y+A   + +  AL     KW  KY    KSW N    L+ +F++P  +R  IYTTN +E V+R  RK+TK KGG  + N+L KL+Y  ++  SE W   + NW L L QL I FE  +
  S:   274 LKCVYKAATLNAAEMALDELETKWGDKYPVVIKSWRNKWALLSVYFKYPDYVRTAIYTTNAVEAVHRQFRKLTKTKGGFANENSLLKLLYAGILKASERWTHPIQNWNLTLSQLSIHFEGRL 395
>gi|24375974|ref|NP_720017.1| ISSod5, transposase [Shewanella oneidensis MR-1] >gi|24350967|gb|AAN57461.1|AE015881_8 ISSod5, transposase [Shewanella oneidensis MR-1] (401 aa)
Score = 250, Expect = 2.6e-20, Identities = 49/122 (40%), Positives = 69/122 (56%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K +Y+A   + +  AL     KW  KY    KSW N    L+ +F++P  +R  IYTTN +E V+R  RK+TK KGG  + N+L KL+Y  ++  SE W   + NW L L QL I FE  +
  S:   274 LKCVYKAATLNAAEMALDELETKWGDKYPVVIKSWRNKWALLSVYFKYPDYVRTAIYTTNAVEAVHRQFRKLTKTKGGFANENSLLKLLYAGILKASERWTHPIQNWNLTLSQLSIHFEGRL 395
>gi|24375766|ref|NP_719809.1| ISSod5, transposase [Shewanella oneidensis MR-1] >gi|24350711|gb|AAN57253.1|AE015861_5 ISSod5, transposase [Shewanella oneidensis MR-1] (401 aa)
Score = 250, Expect = 2.6e-20, Identities = 49/122 (40%), Positives = 69/122 (56%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K +Y+A   + +  AL     KW  KY    KSW N    L+ +F++P  +R  IYTTN +E V+R  RK+TK KGG  + N+L KL+Y  ++  SE W   + NW L L QL I FE  +
  S:   274 LKCVYKAATLNAAEMALDELETKWGDKYPVVIKSWRNKWALLSVYFKYPDYVRTAIYTTNAVEAVHRQFRKLTKTKGGFANENSLLKLLYAGILKASERWTHPIQNWNLTLSQLSIHFEGRL 395
>gi|147677770|ref|YP_001211985.1| transposase and inactivated derivatives [Pelotomaculum thermopropionicum SI] >gi|146273867|dbj|BAF59616.1| transposase and inactivated derivatives [Pelotomaculum thermopropionicum SI] (406 aa)
Score = 249, Expect = 2.9e-20, Identities = 49/122 (40%), Positives = 73/122 (59%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +KK+YQA   + +  A K+F EKW  K+    +SW  N  ELT +F++P EIR+LIYTTN+IE  +R +RK+TK K    + +AL K+IYL  +  S+ W   +  W   + Q  I F + +
  S:   278 LKKVYQALTMEEAELAFKMFKEKWGKKHPVIIRSWEKNWLELTAYFKYPYEIRKLIYTTNIIEGYHRQLRKVTKTKTAYPTDDALKKIIYLATVEASKKWTVPIREWKSCISQFAIHFSDRL 399
>gi|196253908|ref|ZP_03152510.1| transposase mutator type [Clostridium thermocellum DSM 4150] >gi|196196675|gb|EDX91570.1| transposase mutator type [Clostridium thermocellum DSM 4150] (238 aa)
Score = 249, Expect = 3.2e-20, Identities = 47/117 (40%), Positives = 77/117 (65%)
  Q:     2 KKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           K++Y+A N +V+M+      +KW  +Y YA +SW NN + ++ F++FP EIR++IYTTN+IE ++R  RK+TK K    + ++L K++YL  +N+ + W  R  NW  +L QL I +
  S:   114 KEVYRAINEEVAMEKFCEIKDKWGKEYPYAIRSWENNWDVISPFYKFPEEIRKIIYTTNIIEGLHRQFRKVTKTKTMFPNDSSLEKMLYLGSMNVVKKWTQRYKNWDKVLSQLMIEY 230
>gi|126090286|ref|YP_001041741.1| transposase, mutator type [Shewanella baltica OS155] >gi|125999917|gb|ABN63986.1| transposase, mutator type [Shewanella baltica OS155] (389 aa)
Score = 249, Expect = 3.2e-20, Identities = 49/122 (40%), Positives = 69/122 (56%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K +Y+A   + +  AL     KW  KY    KSW N    L+ +F++P  +R  IYTTN +E V+R  RK+TK KGG  + N+L KL+Y  ++  SE W   + NW L L QL I FE  +
  S:   262 LKCVYKAATLNAAEMALDELETKWGDKYPVVIKSWRNKWALLSVYFKYPDYVRTAIYTTNAVEAVHRQFRKLTKTKGGFANENSLLKLLYAGILKASERWTHPIQNWNLTLSQLSIHFEGRL 383
>gi|152983493|ref|YP_001351354.1| transposase mutator family protein [Pseudomonas aeruginosa PA7] >gi|152988458|ref|YP_001348426.1| transposase mutator family protein [Pseudomonas aeruginosa PA7] >gi|45360227|gb|AAS59254.1| putative transposase [Pseudomonas aeruginosa] >gi|45360229|gb|AAS59255.1| putative transposase [Pseudomonas aeruginosa] >gi|150958651|gb|ABR80676.1| transposase, Mutator family [Pseudomonas aeruginosa PA7] >gi|150963616|gb|ABR85641.1| transposase, Mutator family [Pseudomonas aeruginosa PA7] (408 aa)
Score = 249, Expect = 3.6e-20, Identities = 52/122 (42%), Positives = 71/122 (58%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K+IYQ+   D +   L  F  KW   Y    +SW  N   +T FF FP EIR++IYTTN IE+VN ++RKITK +G   S  AL KL YL L NIS+ W   + +W   L +  I +E+ +
  S:   284 LKRIYQSSTADEAELRLGEFEAKWDDDYLPIGQSWRRNWARITPFFDFPPEIRKVIYTTNAIESVNMSLRKITKNRGSFPSDEALLKLFYLALRNISKKWTMPIRDWKAALTRFTISYEDRL 405
>gi|147678728|ref|YP_001212943.1| transposase and inactivated derivatives [Pelotomaculum thermopropionicum SI] >gi|146274825|dbj|BAF60574.1| transposase and inactivated derivatives [Pelotomaculum thermopropionicum SI] (375 aa)
Score = 248, Expect = 4.2e-20, Identities = 50/122 (40%), Positives = 72/122 (59%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +KKIYQA   + +  +   F  KW  K+    +SW NN  ELT +F++P EIRR+IYTTN+IE  +R +RK+TK K    +  AL K+IYL  I  S+ W   + +W   + Q  I FE+ +
  S:   248 LKKIYQALTIEEAEMSFTTFKGKWGKKHPIIVRSWENNWLELTAYFKYPYEIRRMIYTTNIIEGYHRQLRKVTKTKTAYPTDEALVKIIYLATIEASKKWTMSIKDWKNCISQFAIYFEDRL 369
>gi|125972672|ref|YP_001036582.1| transposase, mutator type [Clostridium thermocellum ATCC 27405] >gi|125972877|ref|YP_001036787.1| transposase, mutator type [Clostridium thermocellum ATCC 27405] >gi|125972892|ref|YP_001036802.1| transposase, mutator type [Clostridium thermocellum ATCC 27405] >gi|125973708|ref|YP_001037618.1| transposase, mutator type [Clostridium thermocellum ATCC 27405] >gi|125974378|ref|YP_001038288.1| transposase, mutator type [Clostridium thermocellum ATCC 27405] >gi|125975530|ref|YP_001039440.1| transposase, mutator type [Clostridium thermocellum ATCC 27405] >gi|196252067|ref|ZP_03150730.1| transposase mutator type [Clostridium thermocellum DSM 4150] >gi|196253348|ref|ZP_03151979.1| transposase mutator type [Clostridium thermocellum DSM 4150] >gi|196253372|ref|ZP_03152002.1| transposase mutator type [Clostridium thermocellum DSM 4150] >gi|196253836|ref|ZP_03152442.1| transposase mutator type [Clostridium thermocellum DSM 4150] >gi|196254127|ref|ZP_03152710.1| transposase mutator type [Clostridium thermocellum DSM 4150] >gi|125712897|gb|ABN51389.1| transposase, mutator type [Clostridium thermocellum ATCC 27405] >gi|125713102|gb|ABN51594.1| transposase, mutator type [Clostridium thermocellum ATCC 27405] >gi|125713117|gb|ABN51609.1| transposase, mutator type [Clostridium thermocellum ATCC 27405] >gi|125713933|gb|ABN52425.1| transposase, mutator type [Clostridium thermocellum ATCC 27405] >gi|125714603|gb|ABN53095.1| transposase, mutator type [Clostridium thermocellum ATCC 27405] >gi|125715755|gb|ABN54247.1| transposase, mutator type [Clostridium thermocellum ATCC 27405] >gi|196196455|gb|EDX91369.1| transposase mutator type [Clostridium thermocellum DSM 4150] >gi|196196752|gb|EDX91643.1| transposase mutator type [Clostridium thermocellum DSM 4150] >gi|196197204|gb|EDX92071.1| transposase mutator type [Clostridium thermocellum DSM 4150] >gi|196197224|gb|EDX92090.1| transposase mutator type [Clostridium thermocellum DSM 4150] >gi|196198490|gb|EDX93324.1| transposase mutator type [Clostridium thermocellum DSM 4150] (407 aa)
Score = 247, Expect = 4.9e-20, Identities = 50/122 (40%), Positives = 74/122 (60%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K+IY APN       +   +EKW  KY  A KSW +N + +  FF++  E+R+++YTTN IE++N + R+I K++       +L K IYL  + I+  W  R  NWGLIL QL+I+FE  I
  S:   286 LKRIYTAPNEKAGYDQMLEVSEKWEKKYPAAMKSWKSNWDVICPFFKYSEELRKIMYTTNTIESLNSSYRRINKSRTVFPGDQSLLKSIYLATVKITSKWTMRYKNWGLILGQLQIMFEGRI 407
>gi|125975694|ref|YP_001039604.1| transposase, mutator type [Clostridium thermocellum ATCC 27405] >gi|125715919|gb|ABN54411.1| transposase, mutator type [Clostridium thermocellum ATCC 27405] (407 aa)
Score = 247, Expect = 4.9e-20, Identities = 50/122 (40%), Positives = 74/122 (60%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K+IY APN       +   +EKW  KY  A KSW +N + +  FF++  E+R+++YTTN IE++N + R+I K++       +L K IYL  + I+  W  R  NWGLIL QL+I+FE  I
  S:   286 LKRIYTAPNEKAGYDQMLEVSEKWEKKYPAAMKSWKSNWDVICPFFKYSEELRKIMYTTNTIESLNSSYRRINKSRTVFPGDQSLLKSIYLATVKITSKWTMRYKNWGLILGQLQIMFEGRI 407
>gi|125973486|ref|YP_001037396.1| transposase, mutator type [Clostridium thermocellum ATCC 27405] >gi|125975685|ref|YP_001039595.1| transposase, mutator type [Clostridium thermocellum ATCC 27405] >gi|125713711|gb|ABN52203.1| transposase, mutator type [Clostridium thermocellum ATCC 27405] >gi|125715910|gb|ABN54402.1| transposase, mutator type [Clostridium thermocellum ATCC 27405] (407 aa)
Score = 247, Expect = 5.1e-20, Identities = 50/122 (40%), Positives = 74/122 (60%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K+IY APN       +   +EKW  KY  A KSW +N + +  FF++  E+R+++YTTN IE++N + R+I K++       +L K IYL  + I+  W  R  NWGLIL QL+I+FE  I
  S:   286 LKRIYTAPNEKAGYDQMLEVSEKWEKKYPAAMKSWKSNWDVICPFFKYSEELRKIMYTTNTIESLNSSYRRINKSRTVFPGDQSLLKSIYLATVKITSKWTMRYKNWGLILGQLQIMFEGRI 407
>gi|125974043|ref|YP_001037953.1| transposase, mutator type [Clostridium thermocellum ATCC 27405] >gi|125714268|gb|ABN52760.1| transposase, mutator type [Clostridium thermocellum ATCC 27405] (407 aa)
Score = 247, Expect = 5.4e-20, Identities = 50/122 (40%), Positives = 74/122 (60%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K+IY APN       +   +EKW  KY  A KSW +N + +  FF++  E+R+++YTTN IE++N + R+I K++       +L K IYL  + I+  W  R  NWGLIL QL+I+FE  I
  S:   286 LKRIYTAPNEKAGYDQMLEVSEKWEKKYPAAMKSWKSNWDVICPFFKYSKELRKIMYTTNTIESLNSSYRRINKSRTVFPGDQSLLKSIYLATVKITSKWTMRYKNWGLILGQLQIMFEGRI 407
>gi|125975153|ref|YP_001039063.1| transposase, mutator type [Clostridium thermocellum ATCC 27405] >gi|125715378|gb|ABN53870.1| transposase, mutator type [Clostridium thermocellum ATCC 27405] (407 aa)
Score = 247, Expect = 5.6e-20, Identities = 50/122 (40%), Positives = 74/122 (60%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K+IY APN       +   +EKW  KY  A KSW +N + +  FF++  E+R+++YTTN IE++N + R+I K++       +L K IYL  + I+  W  R  NWGLIL QL+I+FE  I
  S:   286 LKRIYTAPNEKAGYDQMLEVSEKWEKKYPAAMKSWKSNWDVICPFFKYSEELRKIMYTTNTIESLNSSYRRINKSRTVFPGDQSLLKSIYLATVKITSKWTMRYKNWGLILGQLQIMFEGRI 407
>gi|125974403|ref|YP_001038313.1| transposase, mutator type [Clostridium thermocellum ATCC 27405] >gi|125714628|gb|ABN53120.1| transposase, mutator type [Clostridium thermocellum ATCC 27405] (407 aa)
Score = 247, Expect = 5.6e-20, Identities = 50/122 (40%), Positives = 74/122 (60%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K+IY APN       +   +EKW  KY  A KSW +N + +  FF++  E+R+++YTTN IE++N + R+I K++       +L K IYL  + I+  W  R  NWGLIL QL+I+FE  I
  S:   286 LKRIYTAPNEKAGYDQMLEVSEKWEKKYPAAMKSWKSNWDVICPFFKYSEELRKIMYTTNTIESLNSSYRRINKSRTVFPGDQSLLKSIYLATVKITSKWTMRYKNWGLILGQLQIMFEGRI 407
>gi|125973319|ref|YP_001037229.1| transposase, mutator type [Clostridium thermocellum ATCC 27405] >gi|125713544|gb|ABN52036.1| transposase, mutator type [Clostridium thermocellum ATCC 27405] (407 aa)
Score = 247, Expect = 5.9e-20, Identities = 50/122 (40%), Positives = 74/122 (60%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K+IY APN       +   +EKW  KY  A KSW +N + +  FF++  E+R+++YTTN IE++N + R+I K++       +L K IYL  + I+  W  R  NWGLIL QL+I+FE  I
  S:   286 LKRIYTAPNEKAGYDQMLEVSEKWEKKYPAAMKSWKSNWDVICPFFKYSEELRKIMYTTNTIESLNSSYRRINKSRTVFPGDQSLLKSIYLATVKITSKWTMRYKNWGLILGQLQIMFEGRI 407
>gi|196253604|ref|ZP_03152224.1| transposase mutator type [Clostridium thermocellum DSM 4150] >gi|196196978|gb|EDX91855.1| transposase mutator type [Clostridium thermocellum DSM 4150] (407 aa)
Score = 247, Expect = 6.2e-20, Identities = 50/122 (40%), Positives = 74/122 (60%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K+IY APN       +   +EKW  KY  A KSW +N + +  FF++  E+R+++YTTN IE++N + R+I K++       +L K IYL  + I+  W  R  NWGLIL QL+I+FE  I
  S:   286 LKRIYTAPNEKAGYDQMLEVSEKWEKKYPAAMKSWKSNWDVICPFFKYSEELRKIMYTTNTIESLNSSYRRINKSRTVFPGDQSLLKSIYLATVKITSKWTMRYKNWGLILGQLQIMFEGRI 407
>gi|24373965|ref|NP_718008.1| ISSod5, transposase [Shewanella oneidensis MR-1] >gi|24348407|gb|AAN55452.1|AE015682_7 ISSod5, transposase [Shewanella oneidensis MR-1] (401 aa)
Score = 245, Expect = 9.8e-20, Identities = 48/122 (39%), Positives = 68/122 (55%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K +Y+A   + +  AL     KW  KY    KSW N    L+ +F++P  +R  IYTTN +E V+R  RK+ K KGG  + N+L KL+Y  ++  SE W   + NW L L QL I FE  +
  S:   274 LKCVYKAATLNAAEMALDELETKWGDKYPVVIKSWRNKWALLSVYFKYPDYVRTAIYTTNAVEAVHRQFRKLAKTKGGFANENSLLKLLYAGILKASERWTHPIQNWNLTLSQLSIHFEGRL 395
>gi|121593335|ref|YP_985231.1| transposase, mutator type [Acidovorax sp. JS42] >gi|120605415|gb|ABM41155.1| transposase, mutator type [Acidovorax sp. JS42] (408 aa)
Score = 245, Expect = 1.0e-19, Identities = 50/122 (40%), Positives = 71/122 (58%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +++IY A   + +   L  F  +W ++Y    +SW  N   LT FF +P EIR++IYTTN IE+VN  +RK+TK +G   S  ALSKL YL L NIS+ W   + +W   L +  I F + I
  S:   284 LRRIYTAATAEEAELMLAEFEARWDAEYLPIGQSWRRNWSRLTPFFDYPPEIRKVIYTTNAIESVNMGLRKLTKNRGSFPSDEALSKLFYLALRNISQKWTMPIRDWKAALTRFTIQFGDRI 405
>gi|86559598|ref|YP_473419.1| transposase [Clostridium perfringens CPE str. F4969] >gi|86475870|dbj|BAE79046.1| transposase [Clostridium perfringens] (383 aa)
Score = 245, Expect = 1.1e-19, Identities = 51/102 (50%), Positives = 68/102 (66%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKS 102
           +K +Y A N D +++AL    EKW  KY  A KSW NN EEL+TFF++P EIRR+IYTTN IE  NR +RK+TK K    +  AL K++YL  I+I++   S
  S:   280 LKLVYTAVNEDAALQALSSLEEKWGDKYLLAIKSWRNNWEELSTFFKYPPEIRRIIYTTNAIEGYNRQLRKVTKTKTAFPTDEALLKILYLATIDITKKMGS 381
>gi|147678748|ref|YP_001212963.1| hypothetical protein PTH_2413 [Pelotomaculum thermopropionicum SI] >gi|146274845|dbj|BAF60594.1| hypothetical protein [Pelotomaculum thermopropionicum SI] (204 aa)
Score = 244, Expect = 1.1e-19, Identities = 49/122 (40%), Positives = 73/122 (59%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +KK+YQA   + +  A K+F EKW  K+    +SW  N  ELT +F++P EIR+LIYTTN+IE  +R +RK+TK K    + +AL K+IYL  +  S+ W   +  W   + Q  I F + +
  S:    83 LKKVYQALTMEEAELAFKMFKEKWGKKHPVIIRSWEKNWLELTAYFKYPYEIRKLIYTTNIIEGYHRQLRKVTKTKTAYPTDDALKKIIYLATVEASKKWTVPIREWKSCISQFAIHFSDRL 204
>gi|158321645|ref|YP_001514152.1| transposase mutator type [Alkaliphilus oremlandii OhILAs] >gi|158141844|gb|ABW20156.1| transposase mutator type [Alkaliphilus oremlandii OhILAs] (405 aa)
Score = 244, Expect = 1.2e-19, Identities = 48/121 (39%), Positives = 76/121 (62%)
  Q:     2 KKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           K++Y A   + + + L    +KW  KY +A KSW+ N   L++FF+FP EIR ++YTTN IE+++R  RK+TK K   T+  +L K++YL   N+ + W  R  NW  I+ QL IL+++ +
  S:   281 KEVYSAITEESAYEKLMNLQDKWGQKYPFAIKSWDENWLLLSSFFKFPKEIRTIMYTTNAIESLHRQFRKVTKTKSVFTNDQSLEKILYLASQNVMKKWTQRYRNWDSIINQLAILYDDRL 401
>gi|124546166|ref|ZP_01705282.1| transposase, mutator type [Shewanella putrefaciens 200] >gi|124510405|gb|EAY54475.1| transposase, mutator type [Shewanella putrefaciens 200] (302 aa)
Score = 244, Expect = 1.4e-19, Identities = 48/122 (39%), Positives = 68/122 (55%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K +Y+A   + +  AL     KW  KY    KSW N    L+ +F++P  +R  IYTTN +E V+R  R +TK KGG  + N+L KL+Y  ++  SE W   + NW L L QL I FE  +
  S:   175 LKCVYKAATLNAAEMALDELETKWGDKYPVVIKSWRNKWALLSVYFKYPDYVRTAIYTTNAVEAVHRQFRTLTKTKGGFANENSLLKLLYAGILKTSERWTHPIQNWSLTLSQLSIHFEGRL 296
>gi|121594993|ref|YP_986889.1| transposase, mutator type [Acidovorax sp. JS42] >gi|120607073|gb|ABM42813.1| transposase, mutator type [Acidovorax sp. JS42] (408 aa)
Score = 242, Expect = 1.9e-19, Identities = 49/122 (40%), Positives = 72/122 (59%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +++IY A   + +   L  F  +W ++Y    +SW  N   LT FF +P EIR++IYTTN IE+VN ++RK+TK +G   S  AL+KL YL L NIS+ W   + +W   L +  I F + I
  S:   284 LRRIYTAATAEEAELMLAEFEARWDAEYLPIGQSWRRNWSRLTPFFDYPPEIRKVIYTTNAIESVNMSLRKLTKNRGSFPSDEALTKLFYLALRNISQKWTMPIRDWKAALTRFTIQFGDRI 405
>gi|148262327|ref|YP_001229033.1| transposase, mutator type [Geobacter uraniireducens Rf4] >gi|148264923|ref|YP_001231629.1| transposase, mutator type [Geobacter uraniireducens Rf4] >gi|148265724|ref|YP_001232430.1| transposase, mutator type [Geobacter uraniireducens Rf4] >gi|146395827|gb|ABQ24460.1| transposase, mutator type [Geobacter uraniireducens Rf4] >gi|146398423|gb|ABQ27056.1| transposase, mutator type [Geobacter uraniireducens Rf4] >gi|146399224|gb|ABQ27857.1| transposase, mutator type [Geobacter uraniireducens Rf4] (404 aa)
Score = 242, Expect = 2.3e-19, Identities = 46/122 (37%), Positives = 75/122 (61%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K IYQ+   + +   L  F  KW   +    +SW  N E++T FF +PA+IR++IYTTN IE++N ++RK+TK +G   +  A+ KL+YL L NI++ W   + +W   + +  ILFE+ +
  S:   280 LKVIYQSATAEQAEMELTAFEAKWDKTHPTIGQSWRRNWEQITPFFAYPADIRKVIYTTNAIESLNMSLRKVTKNRGSFPNDEAMLKLLYLALKNIAKKWTLPIRDWKAAMNRFSILFEDRM 401
>gi|114565726|ref|YP_752880.1| hypothetical protein Swol_0155 [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|114336661|gb|ABI67509.1| conserved hypothetical protein [Syntrophomonas wolfei subsp. wolfei str. Goettingen] (408 aa)
Score = 241, Expect = 2.7e-19, Identities = 49/118 (41%), Positives = 71/118 (60%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           +KK+YQA   + +  + + F EKW  K+    +SW  N  ELTT+F +P  IRRLIYTTN IE  +R +RK+TK K    + +AL K+IYL + +IS+ W   +  W   + Q+ I F
  S:   282 LKKVYQALTLEEAKFSFEEFKEKWGKKHPIIIRSWEQNWLELTTYFAYPNAIRRLIYTTNTIEGFHRQLRKVTKTKTAYPTDDALRKIIYLAIQDISKKWTMPIREWKQCISQMAIHF 399
>gi|110802712|ref|YP_698367.1| ISCpe3, transposase [Clostridium perfringens SM101] >gi|110803360|ref|YP_697957.1| ISCpe3, transposase [Clostridium perfringens SM101] >gi|110683213|gb|ABG86583.1| ISCpe3, transposase [Clostridium perfringens SM101] >gi|110683861|gb|ABG87231.1| ISCpe3, transposase [Clostridium perfringens SM101] (407 aa)
Score = 241, Expect = 3.0e-19, Identities = 48/122 (39%), Positives = 71/122 (58%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K +Y A   ++++  L +  EKW  KY     SW +N   L+TFF F + IR++IYTTNL+E  NR +RK TK +    +  +L K +YL    + + W S +ANWG IL Q +I+F   I
  S:   280 LKLVYTAETVELALSQLDMLKEKWDYKYANVIDSWYSNWNNLSTFFDFSSGIRKMIYTTNLLEGFNRQLRKFTKIRTVFPTDESLRKSLYLATDQVMKKWTSPIANWGPILLQFEIIFAERI 401
>gi|125975340|ref|YP_001039250.1| transposase, mutator type [Clostridium thermocellum ATCC 27405] >gi|125715565|gb|ABN54057.1| transposase, mutator type [Clostridium thermocellum ATCC 27405] (378 aa)
Score = 240, Expect = 3.1e-19, Identities = 49/122 (40%), Positives = 73/122 (59%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K+IY APN       +   +EKW  KY  A KSW +N + +  FF++  E+R+++YTTN IE++N + R+I K++       +L K IYL  + I+  W  R  NW LIL QL+I+FE  I
  S:   257 LKRIYTAPNEKAGYDQMLEVSEKWEKKYPAAMKSWKSNWDVICPFFKYSEELRKIMYTTNTIESLNSSYRRINKSRTVFPGDQSLLKSIYLATVKITSKWTMRYKNWRLILGQLQIMFEGRI 378
>gi|134299678|ref|YP_001113174.1| transposase, mutator type [Desulfotomaculum reducens MI-1] >gi|134052378|gb|ABO50349.1| transposase, mutator type [Desulfotomaculum reducens MI-1] (403 aa)
Score = 240, Expect = 3.2e-19, Identities = 53/122 (43%), Positives = 74/122 (60%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +KK+YQA   + +  A + F EKW SKY    KSW NN  ELTT+FQ+P  IRR+IYTTN+IE  +R +RK+TK K    S  AL K++YL  ++ S+ W   +  W   + Q  I F + +
  S:   276 LKKVYQALTIEEAEFAFEEFKEKWGSKYPVVIKSWENNWVELTTYFQYPRGIRRMIYTTNVIEGYHRQLRKVTKTKTAYPSDEALVKMLYLATLDASKKWTMPLREWRECISQFLIFFGDRL 397
>gi|24376341|ref|NP_720449.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24345246|gb|AAN53049.1| ISSod4 transposase, TnpA_ISSod4_50 [Shewanella oneidensis MR-1] (400 aa)
Score = 239, Expect = 4.3e-19, Identities = 46/122 (37%), Positives = 69/122 (56%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K +Y+A + + +  AL     KW   Y     SW      L+ +F++P  IR++IYTTN +E V+R  RK+TK KG   + N+L KL+Y  ++N S+ W   + NW L L QL I FE  +
  S:   273 LKPVYRAVSKEAAEMALDELEAKWGDAYPLVINSWRRKWHNLSHYFKYPEHIRKVIYTTNAVEAVHRQFRKLTKTKGAFPNENSLLKLLYAGILNASDKWTMPIHNWSLCLSQLAIYFEGRL 394
>gi|121593520|ref|YP_985416.1| transposase, mutator type [Acidovorax sp. JS42] >gi|121596070|ref|YP_987966.1| transposase, mutator type [Acidovorax sp. JS42] >gi|120605600|gb|ABM41340.1| transposase, mutator type [Acidovorax sp. JS42] >gi|120608150|gb|ABM43890.1| transposase, mutator type [Acidovorax sp. JS42] (408 aa)
Score = 239, Expect = 4.6e-19, Identities = 49/122 (40%), Positives = 70/122 (57%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +++IY A   + +   L  F  +W ++Y    +SW  N   L  FF +P EIR++IYTTN IE+VN  +RK+TK +G   S  ALSKL YL L NIS+ W   + +W   L +  I F + I
  S:   284 LRRIYTAATAEEAELMLAEFEARWDAEYLPIGQSWRRNWSRLIPFFDYPPEIRKVIYTTNAIESVNMGLRKLTKNRGSFPSDEALSKLFYLALRNISQKWTMPIRDWKAALTRFTIQFGDRI 405
>gi|153954700|ref|YP_001395465.1| hypothetical protein CKL_2082 [Clostridium kluyveri DSM 555] >gi|146347558|gb|EDK34094.1| Hypothetical protein CKL_2082 [Clostridium kluyveri DSM 555] (238 aa)
Score = 239, Expect = 5.2e-19, Identities = 50/118 (42%), Positives = 72/118 (61%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           +K +Y A N D +++ L    EKW  KY  A KSW +N + L TFF FP  IR+++YTTN IE++N   RK+TKAK    + ++L K++YL     S+ W     NW +++ QL ILF
  S:   113 LKAVYGAVNEDAALENLMDAKEKWEGKYPNAIKSWEDNWDNLVTFFMFPDYIRKIMYTTNAIESLNSQFRKVTKAKLIFPNDDSLMKMLYLATQRTSKKWTRSYENWDMVVNQLNILF 230
>gi|24371954|ref|NP_715996.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24372612|ref|NP_716654.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24373334|ref|NP_717377.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24375247|ref|NP_719290.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24375743|ref|NP_719786.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24375867|ref|NP_719910.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24376019|ref|NP_720062.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24376055|ref|NP_720098.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24345797|gb|AAN53441.1|AE015483_7 ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24346641|gb|AAN54099.1|AE015547_5 ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24347584|gb|AAN54821.1|AE015620_13 ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24350044|gb|AAN56734.1|AE015809_1 ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24350684|gb|AAN57230.1|AE015858_11 ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24350834|gb|AAN57354.1|AE015872_5 ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24351025|gb|AAN57506.1|AE015887_2 ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24351071|gb|AAN57542.1|AE015890_3 ISSod4, transposase [Shewanella oneidensis MR-1] (400 aa)
Score = 238, Expect = 5.4e-19, Identities = 46/122 (37%), Positives = 69/122 (56%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K +Y+A + + +  AL     KW   Y     SW      L+ +F++P  IR++IYTTN +E V+R  RK+TK KG   + N+L KL+Y  ++N S+ W   + NW L L QL I FE  +
  S:   273 LKPVYRAVSKEAAEMALDELEAKWGDAYPLVINSWRRKWHNLSHYFKYPEHIRKVIYTTNAVEAVHRQFRKLTKTKGAFPNENSLLKLLYAGILNASDKWTMPIHNWSLCLSQLAIYFEGRL 394
>gi|24375104|ref|NP_719147.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24349869|gb|AAN56591.1|AE015797_2 ISSod4, transposase [Shewanella oneidensis MR-1] (400 aa)
Score = 238, Expect = 5.4e-19, Identities = 46/122 (37%), Positives = 69/122 (56%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K +Y+A + + +  AL     KW   Y     SW      L+ +F++P  IR++IYTTN +E V+R  RK+TK KG   + N+L KL+Y  ++N S+ W   + NW L L QL I FE  +
  S:   273 LKPVYRAVSKEAAEMALDELEAKWGDAYPLVINSWRRKWHNLSHYFKYPEHIRKVIYTTNAVEAVHRQFRKLTKTKGAFPNENSLLKLLYAGILNASDKWTMPIHNWSLCLSQLAIYFEGRL 394
>gi|24373845|ref|NP_717888.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24348249|gb|AAN55332.1|AE015670_10 ISSod4, transposase [Shewanella oneidensis MR-1] (400 aa)
Score = 238, Expect = 5.4e-19, Identities = 46/122 (37%), Positives = 69/122 (56%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K +Y+A + + +  AL     KW   Y     SW      L+ +F++P  IR++IYTTN +E V+R  RK+TK KG   + N+L KL+Y  ++N S+ W   + NW L L QL I FE  +
  S:   273 LKPVYRAVSKEAAEMALDELEAKWGDAYPLVINSWRRKWHNLSHYFKYPEHIRKVIYTTNAVEAVHRQFRKLTKTKGAFPNENSLLKLLYAGILNASDKWTMPIHNWSLCLSQLAIYFEGRL 394
>gi|24371974|ref|NP_716016.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24372187|ref|NP_716229.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24372850|ref|NP_716892.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24373014|ref|NP_717056.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24373185|ref|NP_717228.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24373440|ref|NP_717483.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24373638|ref|NP_717681.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24373825|ref|NP_717868.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24373869|ref|NP_717912.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24373891|ref|NP_717934.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24373939|ref|NP_717982.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24374345|ref|NP_718388.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24374349|ref|NP_718392.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24374567|ref|NP_718610.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24374909|ref|NP_718952.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24374953|ref|NP_718996.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24374959|ref|NP_719002.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24375022|ref|NP_719065.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24375026|ref|NP_719069.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24375209|ref|NP_719252.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24375315|ref|NP_719358.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24375347|ref|NP_719390.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24375364|ref|NP_719407.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24375370|ref|NP_719413.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24375432|ref|NP_719475.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24375511|ref|NP_719554.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24375651|ref|NP_719694.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24376179|ref|NP_720223.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24376263|ref|NP_720371.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24376307|ref|NP_720415.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24376352|ref|NP_720460.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24345826|gb|AAN53461.1|AE015486_2 ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24346093|gb|AAN53674.1|AE015506_9 ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24346955|gb|AAN54337.1|AE015570_11 ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24347176|gb|AAN54501.1|AE015588_2 ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24347403|gb|AAN54672.1|AE015608_1 ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24347724|gb|AAN54927.1|AE015631_3 ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24347979|gb|AAN55125.1|AE015649_7 ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24348223|gb|AAN55312.1|AE015668_13 ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24348283|gb|AAN55356.1|AE015673_5 ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24348310|gb|AAN55378.1|AE015675_10 ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24348374|gb|AAN55426.1|AE015680_1 ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24348899|gb|AAN55832.1|AE015720_4 ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24348903|gb|AAN55836.1|AE015720_8 ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24349166|gb|AAN56054.1|AE015740_8 ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24349616|gb|AAN56396.1|AE015776_6 ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24349671|gb|AAN56440.1|AE015780_11 ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24349680|gb|AAN56446.1|AE015781_6 ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24349763|gb|AAN56509.1|AE015788_5 ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24349767|gb|AAN56513.1|AE015788_9 ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24349997|gb|AAN56696.1|AE015805_5 ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24350125|gb|AAN56802.1|AE015815_8 ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24350165|gb|AAN56834.1|AE015818_10 ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24350188|gb|AAN56851.1|AE015820_4 ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24350197|gb|AAN56857.1|AE015821_2 ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24350276|gb|AAN56919.1|AE015826_4 ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24350380|gb|AAN56998.1|AE015834_1 ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24350565|gb|AAN57138.1|AE015849_5 ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24351224|gb|AAN57666.1|AE015902_8 ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24344732|gb|AAN52971.1| ISSod4 transposase, TnpA_ISSod4_46 [Shewanella oneidensis MR-1] >gi|24345199|gb|AAN53015.1| ISSod4 transposase, TnpA_ISSod4_48 [Shewanella oneidensis MR-1] >gi|24345263|gb|AAN53060.1| ISSod4 transposase, TnpA_ISSod4_51 [Shewanella oneidensis MR-1] (400 aa)
Score = 238, Expect = 5.5e-19, Identities = 46/122 (37%), Positives = 69/122 (56%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K +Y+A + + +  AL     KW   Y     SW      L+ +F++P  IR++IYTTN +E V+R  RK+TK KG   + N+L KL+Y  ++N S+ W   + NW L L QL I FE  +
  S:   273 LKPVYRAVSKEAAEMALDELEAKWGDAYPLVINSWRRKWHNLSHYFKYPEHIRKVIYTTNAVEAVHRQFRKLTKTKGAFPNENSLLKLLYAGILNASDKWTMPIHNWSLCLSQLAIYFEGRL 394
>gi|147677055|ref|YP_001211270.1| transposase and inactivated derivatives [Pelotomaculum thermopropionicum SI] >gi|146273152|dbj|BAF58901.1| transposase and inactivated derivatives [Pelotomaculum thermopropionicum SI] (392 aa)
Score = 238, Expect = 6.7e-19, Identities = 46/107 (42%), Positives = 67/107 (62%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANW 107
           +KK+YQA   + +  A K+F EKW  K+    +SW  N  ELT +F++P EIR+LIYTTN+IE  +R +RK+TK K    + +AL K+IYL  +  S+ W   +  W
  S:   278 LKKVYQALTMEEAELAFKMFKEKWGKKHPVIIRSWEKNWLELTAYFKYPYEIRKLIYTTNIIEGYHRQLRKVTKTKTAYPTDDALKKIIYLATVEASKKWTVPIREW 384
>gi|124547650|ref|ZP_01706506.1| transposase, mutator type [Shewanella putrefaciens 200] >gi|124509051|gb|EAY53136.1| transposase, mutator type [Shewanella putrefaciens 200] (400 aa)
Score = 237, Expect = 7.1e-19, Identities = 46/122 (37%), Positives = 69/122 (56%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K +Y+A + + +  AL     KW   Y     SW      L+ +F++P  IR++IYTTN +E V+R  RK+TK KG   + N+L KL+Y  ++N S+ W   + NW L L QL I FE  +
  S:   273 LKPVYRAVSKEAAEMALDELEAKWGDAYPLVINSWRRKWHNLSHYFKYPEHIRKVIYTTNAVEAVHRQFRKLTKTKGAFPNENSLLKLLYAGILNASDKWTMPIHNWSLCLSQLAIYFEGRL 394
>gi|27228664|ref|NP_758714.1| transposase [Pseudomonas resinovorans] >gi|26106252|dbj|BAC41692.1| transposase [Pseudomonas resinovorans] (416 aa)
Score = 237, Expect = 7.4e-19, Identities = 45/122 (36%), Positives = 70/122 (57%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K +Y +   +++ + L  F EKW  +Y     SW  N   +  FF  PAEIR++IYTTN IE++N ++RK+ K +    +  A+SKL YL L NIS+ W   + +W   L +  I FE+ +
  S:   292 LKLVYTSATVELAEQRLTEFEEKWGGQYQSIGLSWRRNWARVIPFFDHPAEIRKVIYTTNAIESINMSLRKVIKTRASFPTDEAVSKLFYLALNNISKKWTMPIRDWKAALNRFSIQFEDRL 413
>gi|125975311|ref|YP_001039221.1| ISDet4, transposase [Clostridium thermocellum ATCC 27405] >gi|125715536|gb|ABN54028.1| ISDet4, transposase [Clostridium thermocellum ATCC 27405] (147 aa)
Score = 236, Expect = 9.1e-19, Identities = 50/122 (40%), Positives = 74/122 (60%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K+IY APN       +   +EKW  KY  A KSW +N + +  FF++  E+R+++YTTN IE++N + R+I K++       +L K IYL  + I+  W  R  NWGLIL QL+I+FE  I
  S:    26 LKRIYTAPNEKAGYDQMLEVSEKWEKKYPAAMKSWKSNWDVICPFFKYSEELRKIMYTTNTIESLNSSYRRINKSRTVFPGDQSLLKSIYLATVKITSKWTMRYKNWGLILGQLQIMFEGRI 147
>gi|170736824|ref|YP_001778084.1| transposase mutator type [Burkholderia cenocepacia MC0-3] >gi|194560443|ref|YP_002095468.1| Transposase, mutator type [Burkholderia cenocepacia PC184] >gi|124875959|gb|EAY65949.1| Transposase, mutator type [Burkholderia cenocepacia PC184] >gi|169819012|gb|ACA93594.1| transposase mutator type [Burkholderia cenocepacia MC0-3] (416 aa)
Score = 235, Expect = 1.5e-18, Identities = 42/120 (35%), Positives = 69/120 (57%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTE-KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFEN 120
           ++ IY AP+ + +   L  F +  W  ++   + +W N  + +  FF FP  +R++IYTTN IEN+N  +RKI K +G   +  A +KLI+L L NI+ +W     +W   + Q  IL+E+
  S:   289 IRPIYTAPSAEAAQAELDAFADGPWGQRFPTVSAAWRNAWDRVIPFFAFPPAVRKIIYTTNAIENINSQLRKIIKTRGHFPTDEAATKLIWLALRNITADWGRAAHDWKTAMNQFAILYED 409
>gi|172060861|ref|YP_001808513.1| transposase mutator type [Burkholderia ambifaria MC40-6] >gi|172065068|ref|YP_001815780.1| transposase mutator type [Burkholderia ambifaria MC40-6] >gi|171993378|gb|ACB64297.1| transposase mutator type [Burkholderia ambifaria MC40-6] >gi|171997310|gb|ACB68227.1| transposase mutator type [Burkholderia ambifaria MC40-6] (416 aa)
Score = 234, Expect = 1.9e-18, Identities = 43/120 (35%), Positives = 70/120 (58%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTE-KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFEN 120
           ++ IY AP+ + +   L  F +  W  K+   + +W N  + +  FF FP  +R++IYTTN IEN+N  +RKI K +G   + +A +KLI+L L NI+ +W     +W   + Q  IL+E+
  S:   289 IRPIYTAPSAEAAQAELDAFADGPWGQKFPPVSTAWRNAWDRVIPFFAFPPGVRKVIYTTNAIENINSQLRKIIKTRGHFPTDDAATKLIWLALRNITADWGRAAHDWKTAMNQFAILYED 409
>gi|73539864|ref|YP_294384.1| transposase [Ralstonia eutropha JMP134] >gi|73540274|ref|YP_294794.1| transposase [Ralstonia eutropha JMP134] >gi|73540344|ref|YP_294864.1| transposase [Ralstonia eutropha JMP134] >gi|73541887|ref|YP_296407.1| transposase [Ralstonia eutropha JMP134] >gi|72117277|gb|AAZ59540.1| Transposase, mutator type [Ralstonia eutropha JMP134] >gi|72117687|gb|AAZ59950.1| Transposase, mutator type [Ralstonia eutropha JMP134] >gi|72117757|gb|AAZ60020.1| Transposase, mutator type [Ralstonia eutropha JMP134] >gi|72119300|gb|AAZ61563.1| Transposase, mutator type [Ralstonia eutropha JMP134] (419 aa)
Score = 233, Expect = 2.2e-18, Identities = 43/119 (36%), Positives = 68/119 (57%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTE-KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFE 119
           +K +Y AP  + ++  L  F + +W  +Y     SW    +++  FF FP  IR+++YTTN IE++N  +RKI K +G   S  A +KL++L L NI+  W S   +W   + Q  IL+E
  S:   292 LKPVYTAPTVEAALAELSAFEQGEWGQRYAPIGASWRRAWDQVIPFFAFPPAIRKIVYTTNAIESINAQLRKIIKTRGHFPSDEAATKLLWLALRNITGKWGSSTHDWKAAMNQFAILYE 411
>gi|148262191|ref|YP_001228897.1| transposase, mutator type [Geobacter uraniireducens Rf4] >gi|148264212|ref|YP_001230918.1| transposase, mutator type [Geobacter uraniireducens Rf4] >gi|148264600|ref|YP_001231306.1| transposase, mutator type [Geobacter uraniireducens Rf4] >gi|148265131|ref|YP_001231837.1| transposase, mutator type [Geobacter uraniireducens Rf4] >gi|148265685|ref|YP_001232391.1| transposase, mutator type [Geobacter uraniireducens Rf4] >gi|148265723|ref|YP_001232429.1| transposase, mutator type [Geobacter uraniireducens Rf4] >gi|148265933|ref|YP_001232639.1| transposase, mutator type [Geobacter uraniireducens Rf4] >gi|148266091|ref|YP_001232797.1| transposase, mutator type [Geobacter uraniireducens Rf4] >gi|146395691|gb|ABQ24324.1| transposase, mutator type [Geobacter uraniireducens Rf4] >gi|146397712|gb|ABQ26345.1| transposase, mutator type [Geobacter uraniireducens Rf4] >gi|146398100|gb|ABQ26733.1| transposase, mutator type [Geobacter uraniireducens Rf4] >gi|146398631|gb|ABQ27264.1| transposase, mutator type [Geobacter uraniireducens Rf4] >gi|146399185|gb|ABQ27818.1| transposase, mutator type [Geobacter uraniireducens Rf4] >gi|146399223|gb|ABQ27856.1| transposase, mutator type [Geobacter uraniireducens Rf4] >gi|146399433|gb|ABQ28066.1| transposase, mutator type [Geobacter uraniireducens Rf4] >gi|146399591|gb|ABQ28224.1| transposase, mutator type [Geobacter uraniireducens Rf4] (404 aa)
Score = 232, Expect = 2.7e-18, Identities = 44/122 (36%), Positives = 74/122 (60%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K IYQ+   + +   L  F  KW   +   ++SW  N  ++  FF +PA+IR++IYTTN IE++N ++RK+TK +G   +  A+ KL+YL L NI++ W   + +W   + +  ILFE+ +
  S:   280 LKVIYQSATAEQAEMELTAFEAKWDKTHPTISQSWRRNWAQVIPFFAYPADIRKVIYTTNAIESLNMSLRKVTKNRGSFPNDEAMFKLLYLALRNIAKKWTLPIRDWKAAMNRFSILFEDRM 401
>gi|110600164|ref|ZP_01388391.1| Transposase, mutator type [Geobacter sp. FRC-32] >gi|110549149|gb|EAT62348.1| Transposase, mutator type [Geobacter sp. FRC-32] (202 aa)
Score = 231, Expect = 3.7e-18, Identities = 48/122 (39%), Positives = 71/122 (58%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K+IYQA     +   L+ F  KWS+ +    KSW  N E +  FF +P EIR+ IYTTN IE++N ++RK+TK +    +  A+ KL+YL L NI + W   + +W   L Q  I+FE  +
  S:    78 LKQIYQAATLQQAEANLEAFETKWSATHPTIGKSWCRNWERIIPFFSYPPEIRKAIYTTNAIESLNMSLRKVTKNRASFPNDEAMLKLLYLALKNIEKKWTMPIRDWKSALNQFTIMFEERM 199
>gi|71733412|ref|YP_276857.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71733651|ref|YP_273104.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71734946|ref|YP_274130.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71735807|ref|YP_276836.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71553965|gb|AAZ33176.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71554204|gb|AAZ33415.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71555499|gb|AAZ34710.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71556360|gb|AAZ35571.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] (419 aa)
Score = 231, Expect = 3.7e-18, Identities = 46/118 (38%), Positives = 68/118 (57%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTE-KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           +K IYQA N DV+ + L  F    W  +Y     +W    + +  FF FPA IR+++YTTN IE++N  +RKI K +G   +  A +KLI+L L NI+ NW     +W + + Q  IL+
  S:   292 LKPIYQAINADVAEQELNAFEAGPWGKQYPTVVAAWRRAWDRVIPFFVFPAGIRKVVYTTNAIESINAQLRKIIKTRGHFPTDEAATKLIWLGLRNITANWGHAAHDWKVAMNQFAILY 410
>gi|91793412|ref|YP_563063.1| transposase, mutator type [Shewanella denitrificans OS217] >gi|91715414|gb|ABE55340.1| transposase, mutator type [Shewanella denitrificans OS217] (400 aa)
Score = 231, Expect = 3.7e-18, Identities = 46/122 (37%), Positives = 68/122 (55%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K +Y+A + + +  AL     KW   Y     SW      L+ +F++P  IR++IYTTN +E V+R  RK+TK KG   + N+L KL+Y  ++N S  W   + NW L L QL I FE  +
  S:   273 LKCVYRAVSKEAAELALDELEAKWGEAYPLVINSWRRKWHNLSHYFKYPEHIRKVIYTTNAVEAVHRQFRKLTKTKGAFPNENSLLKLLYAGILNASNKWTMPIHNWSLCLSQLAIYFEGRL 394
>gi|71733937|ref|YP_276385.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71734237|ref|YP_276112.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71735547|ref|YP_276172.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71738037|ref|YP_274115.1| prophage PSPPH02, ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71554490|gb|AAZ33701.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71554790|gb|AAZ34001.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71556100|gb|AAZ35311.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71558590|gb|AAZ37801.1| prophage PSPPH02, ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] (419 aa)
Score = 231, Expect = 4.1e-18, Identities = 46/118 (38%), Positives = 68/118 (57%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTE-KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           +K IYQA N DV+ + L  F    W  +Y     +W    + +  FF FPA IR+++YTTN IE++N  +RKI K +G   +  A +KLI+L L NI+ NW     +W + + Q  IL+
  S:   292 LKPIYQAINADVAEQELNAFEAGPWGKQYPTVVAAWRRAWDRVIPFFVFPAGIRKVVYTTNAIESINAQLRKIIKTRGHFPTDEAATKLIWLGLRNITANWGHAAHDWKVAMNQFAILY 410
>gi|124549409|ref|ZP_01707650.1| ISSod5, transposase [Shewanella putrefaciens 200] >gi|124507888|gb|EAY51999.1| ISSod5, transposase [Shewanella putrefaciens 200] (149 aa)
Score = 231, Expect = 4.4e-18, Identities = 47/119 (39%), Positives = 66/119 (55%)
  Q:     4 IYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +Y+A   + +  AL     KW  KY    KSW N    L+ +F++P  +R  IYTTN +E V+R  RK+TK KGG  + N+L KL+Y  ++  SE W   + NW   L QL I FE  +
  S:    25 VYKAATLNAAEMALDELETKWGDKYPVVIKSWRNKWALLSVYFKYPDYVRTAIYTTNAVEAVHRQFRKLTKTKGGFANENSLLKLLYAGILKASERWTHPIQNWNFTLSQLSIHFEGRL 143
>gi|71733393|ref|YP_274639.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71733885|ref|YP_275782.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71734015|ref|YP_276478.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71734629|ref|YP_276931.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71734728|ref|YP_274235.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71734743|ref|YP_272642.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71735601|ref|YP_275727.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71735911|ref|YP_273844.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71736124|ref|YP_275488.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71736596|ref|YP_276279.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71736877|ref|YP_274215.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71736940|ref|YP_274737.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71736957|ref|YP_274970.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71737479|ref|YP_275598.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71737662|ref|YP_275160.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71737835|ref|YP_274986.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71737912|ref|YP_274374.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71738077|ref|YP_274517.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71553946|gb|AAZ33157.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71554438|gb|AAZ33649.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71554568|gb|AAZ33779.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71555182|gb|AAZ34393.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71555281|gb|AAZ34492.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71555296|gb|AAZ34507.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71556154|gb|AAZ35365.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71556464|gb|AAZ35675.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71556677|gb|AAZ35888.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71557149|gb|AAZ36360.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71557430|gb|AAZ36641.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71557493|gb|AAZ36704.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71557510|gb|AAZ36721.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71558032|gb|AAZ37243.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71558215|gb|AAZ37426.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71558388|gb|AAZ37599.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71558465|gb|AAZ37676.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71558630|gb|AAZ37841.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] (419 aa)
Score = 231, Expect = 4.4e-18, Identities = 46/118 (38%), Positives = 68/118 (57%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTE-KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           +K IYQA N DV+ + L  F    W  +Y     +W    + +  FF FPA IR+++YTTN IE++N  +RKI K +G   +  A +KLI+L L NI+ NW     +W + + Q  IL+
  S:   292 LKPIYQAINADVAEQELNAFEAGPWGKQYPTVVAAWRRAWDRVIPFFVFPAGIRKVVYTTNAIESINAQLRKIIKTRGHFPTDEAATKLIWLGLRNITANWGHAAHDWKVAMNQFAILY 410
>gi|71725316|ref|YP_272269.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71733232|ref|YP_273594.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71736400|ref|YP_272992.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71737293|ref|YP_276388.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71553785|gb|AAZ32996.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71556953|gb|AAZ36164.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71557846|gb|AAZ37057.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71558906|gb|AAZ38115.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] (419 aa)
Score = 231, Expect = 4.5e-18, Identities = 46/118 (38%), Positives = 68/118 (57%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTE-KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           +K IYQA N DV+ + L  F    W  +Y     +W    + +  FF FPA IR+++YTTN IE++N  +RKI K +G   +  A +KLI+L L NI+ NW     +W + + Q  IL+
  S:   292 LKPIYQAINADVAEQELNAFEAGPWGKQYPTVVAAWRRAWDRVIPFFVFPAGIRKVVYTTNAIESINAQLRKIIKTRGHFPTDEAATKLIWLGLRNITANWGHAAHDWKVAMNQFAILY 410
>gi|71735405|ref|YP_274647.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71735909|ref|YP_274386.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71555958|gb|AAZ35169.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71556462|gb|AAZ35673.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] (419 aa)
Score = 231, Expect = 4.5e-18, Identities = 46/118 (38%), Positives = 68/118 (57%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTE-KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           +K IYQA N DV+ + L  F    W  +Y     +W    + +  FF FPA IR+++YTTN IE++N  +RKI K +G   +  A +KLI+L L NI+ NW     +W + + Q  IL+
  S:   292 LKPIYQAINADVAEQELNAFEAGPWGKQYPTVVAAWRRAWDRVIPFFVFPAGIRKVVYTTNAIESINAQLRKIIKTRGHFPTDEAATKLIWLGLRNITANWGHAAHDWKVAMNQFAILY 410
>gi|71735230|ref|YP_272359.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71555783|gb|AAZ34994.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] (419 aa)
Score = 230, Expect = 4.5e-18, Identities = 46/118 (38%), Positives = 68/118 (57%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTE-KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           +K IYQA N DV+ + L  F    W  +Y     +W    + +  FF FPA IR+++YTTN IE++N  +RKI K +G   +  A +KLI+L L NI+ NW     +W + + Q  IL+
  S:   292 LKPIYQAINADVAEQELNAFEAGPWGKQYPTVVAAWRRAWDRVIPFFVFPAGIRKVVYTTNAIESINAQLRKIIKTRGHFPTDEAATKLIWLGLRNITANWGHAAHDWKVAMNQFAILY 410
>gi|94309425|ref|YP_582635.1| transposase, mutator type [Ralstonia metallidurans CH34] >gi|94310206|ref|YP_583416.1| transposase, mutator type [Ralstonia metallidurans CH34] >gi|94310445|ref|YP_583655.1| transposase, mutator type [Ralstonia metallidurans CH34] >gi|94311206|ref|YP_584416.1| transposase, mutator type [Ralstonia metallidurans CH34] >gi|6562841|emb|CAB62562.1| unnamed protein product [Cupriavidus necator] >gi|93353277|gb|ABF07366.1| transposase, mutator type [Ralstonia metallidurans CH34] >gi|93354058|gb|ABF08147.1| transposase, mutator type [Ralstonia metallidurans CH34] >gi|93354297|gb|ABF08386.1| transposase, mutator type [Ralstonia metallidurans CH34] >gi|93355058|gb|ABF09147.1| transposase, mutator type [Ralstonia metallidurans CH34] (416 aa)
Score = 230, Expect = 4.6e-18, Identities = 45/120 (37%), Positives = 68/120 (56%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTE-KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFEN 120
           ++ IY AP+ + +   L  F    W  K+   + SW N  + +  FF FP  +RR+IYTTN IEN+N  +RKI K +G   S  A +KLI+L L NI+ +W     +W   + Q  IL+++
  S:   289 IRPIYTAPSAEAAEAELNTFAAGPWGQKFPTVSASWRNAWDRVIPFFAFPPAVRRVIYTTNAIENINSQLRKIIKTRGHFPSDEAATKLIWLALRNITSDWGRAAKDWKDAMNQFAILYQD 409
>gi|71733944|ref|YP_275394.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71554497|gb|AAZ33708.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] (419 aa)
Score = 230, Expect = 4.7e-18, Identities = 46/118 (38%), Positives = 68/118 (57%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTE-KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           +K IYQA N DV+ + L  F    W  +Y     +W    + +  FF FPA IR+++YTTN IE++N  +RKI K +G   +  A +KLI+L L NI+ NW     +W + + Q  IL+
  S:   292 LKPIYQAINADVAEQELNAFEAGPWGKQYPTVVAAWRRAWDRVIPFFVFPAGIRKVVYTTNAIESINAQLRKIIKTRGHFPTDEAATKLIWLGLRNITANWGHAAHDWKVAMNQFAILY 410
>gi|71736568|ref|YP_272917.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71557121|gb|AAZ36332.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] (419 aa)
Score = 230, Expect = 4.9e-18, Identities = 46/118 (38%), Positives = 68/118 (57%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTE-KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           +K IYQA N DV+ + L  F    W  +Y     +W    + +  FF FPA IR+++YTTN IE++N  +RKI K +G   +  A +KLI+L L NI+ NW     +W + + Q  IL+
  S:   292 LKPIYQAINADVAEQELNAFEAGPWGKQYPTVVAAWRRAWDRVIPFFVFPAGIRKVVYTTNAIESINAQLRKIIKTRGHFPTDEAATKLIWLGLRNITANWGHAAHDWKVAMNQFAILY 410
>gi|91793530|ref|YP_563181.1| transposase, mutator type [Shewanella denitrificans OS217] >gi|91715532|gb|ABE55458.1| transposase, mutator type [Shewanella denitrificans OS217] (400 aa)
Score = 230, Expect = 5.1e-18, Identities = 46/122 (37%), Positives = 68/122 (55%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K +Y+A + + +  AL     KW   Y     SW      L+ +F++P  IR++IYTTN +E V+R  RK+TK KG   + N+L KL+Y  ++N S  W   + NW L L QL I FE  +
  S:   273 LKCVYRAVSKEAAELALDELEAKWGEAYPLVINSWRRKWHNLSHYFKYPEHIRKVIYTTNAVEAVHRQFRKLTKTKGAFPNENSLLKLLYAGILNASNKWTMPIHNWSLCLSQLAIYFEGRL 394
>gi|91795065|ref|YP_564716.1| transposase, mutator type [Shewanella denitrificans OS217] >gi|91717067|gb|ABE56993.1| transposase, mutator type [Shewanella denitrificans OS217] (400 aa)
Score = 230, Expect = 5.1e-18, Identities = 46/122 (37%), Positives = 68/122 (55%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K +Y+A + + +  AL     KW   Y     SW      L+ +F++P  IR++IYTTN +E V+R  RK+TK KG   + N+L KL+Y  ++N S  W   + NW L L QL I FE  +
  S:   273 LKCVYRAVSKEAAELALDELEAKWGEAYPLVINSWRRKWHNLSHYFKYPEHIRKVIYTTNAVEAVHRQFRKLTKTKGAFPNENSLLKLLYAGILNASNKWTMPIHNWSLCLSQLAIYFEGRL 394
>gi|91791731|ref|YP_561382.1| transposase, mutator type [Shewanella denitrificans OS217] >gi|91713733|gb|ABE53659.1| transposase, mutator type [Shewanella denitrificans OS217] (400 aa)
Score = 230, Expect = 5.1e-18, Identities = 46/122 (37%), Positives = 68/122 (55%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K +Y+A + + +  AL     KW   Y     SW      L+ +F++P  IR++IYTTN +E V+R  RK+TK KG   + N+L KL+Y  ++N S  W   + NW L L QL I FE  +
  S:   273 LKCVYRAVSKEAAELALDELEAKWGEAYPLVINSWRRKWHNLSHYFKYPEHIRKVIYTTNAVEAVHRQFRKLTKTKGAFPNENSLLKLLYAGILNASNKWTMPIHNWSLCLSQLAIYFEGRL 394
>gi|71735175|ref|YP_276608.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71555728|gb|AAZ34939.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] (419 aa)
Score = 230, Expect = 5.2e-18, Identities = 46/118 (38%), Positives = 68/118 (57%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTE-KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           +K IYQA N DV+ + L  F    W  +Y     +W    + +  FF FPA IR+++YTTN IE++N  +RKI K +G   +  A +KLI+L L NI+ NW     +W + + Q  IL+
  S:   292 LKPIYQAINADVAEQELNAFEAGPWGKQYPTVVAAWRRAWDRVIPFFVFPAGIRKVVYTTNAIESINAQLRKIIKTRGHFPTDEAATKLIWLGLRNITANWGHAAHDWKVAMNQFAILY 410
>gi|122815847|ref|YP_001004113.1| transposase [Yersinia enterocolitica subsp. enterocolitica 8081] >gi|121663721|emb|CAL10090.1| transposase [Yersinia enterocolitica subsp. enterocolitica 8081] (400 aa)
Score = 230, Expect = 5.9e-18, Identities = 51/122 (41%), Positives = 75/122 (61%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K +Y+A + + +  AL    EKW  +Y    +SW    E L+ +F++PA IR++IYTTN IE+V+R  RK+TK KG   + N+L KL+YL L+N  E W   + +W L L QL I FE  +
  S:   273 LKPVYRAVSKEAAETALDELEEKWGQQYPVVLQSWRRKWENLSHYFRYPATIRKVIYTTNAIESVHRQFRKLTKTKGAFPNENSLLKLLYLGLMNAQEKWAMPIQSWNLTLSQLAIYFEGRL 394
>gi|32470336|ref|NP_863558.1| hypothetical protein pYVe8081_p53 [Yersinia enterocolitica] >gi|14579394|gb|AAK69271.1|AF336309_66 unknown [Yersinia enterocolitica] (400 aa)
Score = 230, Expect = 5.9e-18, Identities = 51/122 (41%), Positives = 75/122 (61%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K +Y+A + + +  AL    EKW  +Y    +SW    E L+ +F++PA IR++IYTTN IE+V+R  RK+TK KG   + N+L KL+YL L+N  E W   + +W L L QL I FE  +
  S:   273 LKPVYRAVSKEAAETALDELEEKWGQQYPVVLQSWRRKWENLSHYFRYPATIRKVIYTTNAIESVHRQFRKLTKTKGAFPNENSLLKLLYLGLMNAQEKWAMPIQSWNLTLSQLAIYFEGRL 394
>gi|71725160|ref|YP_272226.1| ISPsy16, transposase, truncated [Pseudomonas syringae pv. phaseolicola 1448A] >gi|55978474|gb|AAV68724.1| putative transposase [Pseudomonas syringae pv. phaseolicola] >gi|71558750|gb|AAZ37960.1| ISPsy16, transposase, truncated [Pseudomonas syringae pv. phaseolicola 1448A] (281 aa)
Score = 229, Expect = 6.7e-18, Identities = 46/118 (38%), Positives = 68/118 (57%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTE-KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           +K IYQA N DV+ + L  F    W  +Y     +W    + +  FF FPA IR+++YTTN IE++N  +RKI K +G   +  A +KLI+L L NI+ NW     +W + + Q  IL+
  S:   154 LKPIYQAINADVAEQELNAFEAGPWGKQYPTVVAAWRRAWDRVIPFFVFPAGIRKVVYTTNAIESINAQLRKIIKTRGHFPTDEAATKLIWLGLRNITANWGHAAHDWKVAMNQFAILY 272
>gi|71734059|ref|YP_276792.1| ISPsy18, transposase, truncated [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71554612|gb|AAZ33823.1| ISPsy18, transposase, truncated [Pseudomonas syringae pv. phaseolicola 1448A] (359 aa)
Score = 228, Expect = 8.1e-18, Identities = 46/118 (38%), Positives = 68/118 (57%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTE-KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           +K IYQA N DV+ + L  F    W  +Y     +W    + +  FF FPA IR+++YTTN IE++N  +RKI K +G   +  A +KLI+L L NI+ NW     +W + + Q  IL+
  S:   232 LKPIYQAINADVAEQELNAFEAGPWGKQYPTVVAAWRRAWDRVIPFFVFPAGIRKVVYTTNAIESINAQLRKIIKTRGHFPTDEAATKLIWLGLRNITANWGHAAHDWKVAMNQFAILY 350
>gi|71736612|ref|YP_273622.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71557165|gb|AAZ36376.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] (419 aa)
Score = 228, Expect = 8.1e-18, Identities = 46/118 (38%), Positives = 67/118 (56%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTE-KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           +K IYQA N DV  + L  F    W  +Y     +W    + +  FF FPA IR+++YTTN IE++N  +RKI K +G   +  A +KLI+L L NI+ NW     +W + + Q  IL+
  S:   292 LKPIYQAINADVVEQELNAFEAGPWGKQYPTVVAAWRRAWDRVIPFFVFPAGIRKVVYTTNAIESINAQLRKIIKTRGHFPTDEAATKLIWLGLRNITANWGHAAHDWKVAMNQFAILY 410
>gi|89893555|ref|YP_517042.1| hypothetical protein DSY0809 [Desulfitobacterium hafniense Y51] >gi|89333003|dbj|BAE82598.1| hypothetical protein [Desulfitobacterium hafniense Y51] (396 aa)
Score = 228, Expect = 8.1e-18, Identities = 47/120 (39%), Positives = 69/120 (57%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFEN 120
           +KKIY A N D +  A + F EKW  KY    +SW+ N  ELTTFF +P +IR LIYTTN +E  +R +RK TK K    + +++ K+++L    I++ W      W +   Q+ I F +
  S:   273 LKKIYGAVNLDDAEYAKEEFREKWDKKYPSILRSWDANWAELTTFFNYPEQIRHLIYTTNAVEAYHRMVRKFTKTKSIFPTDDSIRKVVFLSSREITKKWTQPSRGWPMAYSQIMIFFAD 392
>gi|108807938|ref|YP_651854.1| putative transposase [Yersinia pestis Antiqua] >gi|108779851|gb|ABG13909.1| putative transposase [Yersinia pestis Antiqua] (175 aa)
Score = 228, Expect = 8.5e-18, Identities = 45/122 (36%), Positives = 71/122 (58%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K +YQAP  + ++ AL  F E W  KY   +KSW  + E L TFF +P +IR+ IYTTN IE+VN  IR   K +    + +++ K++YL + + S+ W   + NW L + +  I F + +
  S:    50 LKMVYQAPTEEAALMALDKFAEAWDDKYPQISKSWRTHWENLNTFFGYPPDIRKAIYTTNAIESVNSVIRAAIKKRKVFPTDDSVRKVVYLAIKDASKKWSMPIQNWRLAMSRFIIEFGDRL 171
>gi|71738142|ref|YP_276452.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71558695|gb|AAZ37906.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|115265659|dbj|BAF32920.1| ISPsy18 transposase [Pseudomonas syringae pv. phaseolicola] (419 aa)
Score = 228, Expect = 8.8e-18, Identities = 46/118 (38%), Positives = 67/118 (56%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTE-KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           +K IYQA N DV  + L  F    W  +Y     +W    + +  FF FPA IR+++YTTN IE++N  +RKI K +G   +  A +KLI+L L NI+ NW     +W + + Q  IL+
  S:   292 LKPIYQAINADVVEQELNAFEAGPWGKQYPTVVAAWRRAWDRVIPFFVFPAGIRKVVYTTNAIESINAQLRKIIKTRGHFPTDEAATKLIWLGLRNITANWGHAAHDWKVAMNQFAILY 410
>gi|71734427|ref|YP_276481.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71734976|ref|YP_276211.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71735744|ref|YP_276346.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71737963|ref|YP_273334.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71554980|gb|AAZ34191.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71555529|gb|AAZ34740.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71556297|gb|AAZ35508.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71558516|gb|AAZ37727.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] (419 aa)
Score = 228, Expect = 9.6e-18, Identities = 46/118 (38%), Positives = 67/118 (56%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTE-KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           +K IYQA N DV  + L  F    W  +Y     +W    + +  FF FPA IR+++YTTN IE++N  +RKI K +G   +  A +KLI+L L NI+ NW     +W + + Q  IL+
  S:   292 LKPIYQAINADVVEQELNAFEAGPWGKQYPTVVAAWRRAWDRVIPFFVFPAGIRKVVYTTNAIESINAQLRKIIKTRGHFPTDEAATKLIWLGLRNITANWGHAAHDWKVAMNQFAILY 410
>gi|157827045|ref|YP_001496109.1| transposase [Rickettsia bellii OSU 85-389] >gi|157802349|gb|ABV79072.1| Transposase and inactivated derivative [Rickettsia bellii OSU 85-389] (319 aa)
Score = 227, Expect = 1.1e-17, Identities = 48/122 (39%), Positives = 70/122 (57%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K IYQA N + ++ AL  F +KWS +Y +  KSW NN   L  F Q+P  IRR+IYTTN IE +N  +RK+T  K    + +++ K +YL +  I+  W   + NWG  +    I F+  I
  S:   198 LKLIYQAINEEEALSALADFDKKWSKQYPHIAKSWQNNWHNLVIFLQYPEVIRRIIYTTNAIEGLNSQLRKVTNNKRIFPNDDSVFKTLYLTINYITRKWNMPIQNWGEAMAHFLIKFDQRI 319
>gi|71733357|ref|YP_277022.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71553910|gb|AAZ33121.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] (419 aa)
Score = 227, Expect = 1.2e-17, Identities = 45/118 (38%), Positives = 68/118 (57%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTE-KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           +K IYQA N DV+ + L  F    W  +Y     +W    + +  FF FPA IR+++YTTN IE+++  +RKI K +G   +  A +KLI+L L NI+ NW     +W + + Q  IL+
  S:   292 LKPIYQAINADVAEQELNAFEAGPWGKQYPTVVAAWRRAWDRVIPFFVFPAGIRKVVYTTNTIESIDAQLRKIIKTRGHFPTDEAATKLIWLGLRNITANWGHAAHDWKVAMNQFAILY 410
>gi|108812063|ref|YP_647830.1| transposase [Yersinia pestis Nepal516] >gi|108775711|gb|ABG18230.1| transposase [Yersinia pestis Nepal516] (402 aa)
Score = 226, Expect = 1.3e-17, Identities = 45/122 (36%), Positives = 71/122 (58%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K +YQAP  + ++ AL  F E W  KY   +KSW  + E L TFF +P +IR+ IYTTN IE+VN  IR   K +    + +++ K++YL + + S+ W   + NW L + +  I F + +
  S:   277 LKMVYQAPTEEAALMALDKFAEAWDDKYPQISKSWRTHWENLNTFFGYPPDIRKAIYTTNAIESVNSVIRAAIKKRKVFPTDDSVRKVVYLAIKDASKKWSMPIQNWRLAMSRFIIEFGDRL 398
>gi|108807932|ref|YP_651848.1| putative transposase [Yersinia pestis Antiqua] >gi|108812064|ref|YP_647831.1| transposase [Yersinia pestis Nepal516] >gi|108775712|gb|ABG18231.1| transposase [Yersinia pestis Nepal516] >gi|108779845|gb|ABG13903.1| putative transposase [Yersinia pestis Antiqua] (300 aa)
Score = 226, Expect = 1.3e-17, Identities = 45/122 (36%), Positives = 71/122 (58%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K +YQAP  + ++ AL  F E W  KY   +KSW  + E L TFF +P +IR+ IYTTN IE+VN  IR   K +    + +++ K++YL + + S+ W   + NW L + +  I F + +
  S:   175 LKMVYQAPTEEAALMALDKFAEAWDDKYPQISKSWRTHWENLNTFFGYPPDIRKAIYTTNAIESVNSVIRAAIKKRKVFPTDDSVRKVVYLAIKDASKKWSMPIQNWRLAMSRFIIEFGDRL 296
>gi|45443659|ref|NP_995198.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|45438529|gb|AAS64075.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] (402 aa)
Score = 226, Expect = 1.4e-17, Identities = 45/122 (36%), Positives = 71/122 (58%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K +YQAP  + ++ AL  F E W  KY   +KSW  + E L TFF +P +IR+ IYTTN IE+VN  IR   K +    + +++ K++YL + + S+ W   + NW L + +  I F + +
  S:   277 LKMVYQAPTEEAALMALDKFAEAWDDKYPQISKSWRTHWENLNTFFGYPPDIRKAIYTTNAIESVNSVIRAAIKKRKVFPTDDSVRKVVYLAIKDASKKWSMPIQNWRLAMSRFIIEFGDRL 398
>gi|45442500|ref|NP_994039.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|45437365|gb|AAS62916.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] (402 aa)
Score = 226, Expect = 1.5e-17, Identities = 45/122 (36%), Positives = 71/122 (58%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K +YQAP  + ++ AL  F E W  KY   +KSW  + E L TFF +P +IR+ IYTTN IE+VN  IR   K +    + +++ K++YL + + S+ W   + NW L + +  I F + +
  S:   277 LKMVYQAPTEEAALMALDKFAEAWDDKYPQISKSWRTHWENLNTFFGYPPDIRKAIYTTNAIESVNSVIRAAIKKRKVFPTDDSVRKVVYLAIKDASKKWSMPIQNWRLAMSRFIIEFGDRL 398
>gi|22125930|ref|NP_669353.1| transposase [Yersinia pestis KIM] >gi|45442241|ref|NP_993780.1| putative transposase for IS285 element [Yersinia pestis biovar Microtus str. 91001] >gi|21958869|gb|AAM85604.1|AE013806_8 putative transposase [Yersinia pestis KIM] >gi|45437105|gb|AAS62657.1| putative transposase for IS285 element [Yersinia pestis biovar Microtus str. 91001] (374 aa)
Score = 226, Expect = 1.5e-17, Identities = 45/122 (36%), Positives = 71/122 (58%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K +YQAP  + ++ AL  F E W  KY   +KSW  + E L TFF +P +IR+ IYTTN IE+VN  IR   K +    + +++ K++YL + + S+ W   + NW L + +  I F + +
  S:   249 LKMVYQAPTEEAALMALDKFAEAWDDKYPQISKSWRTHWENLNTFFGYPPDIRKAIYTTNAIESVNSVIRAAIKKRKVFPTDDSVRKVVYLAIKDASKKWSMPIQNWRLAMSRFIIEFGDRL 370
>gi|162418655|ref|YP_001606994.1| IS285, transposase [Yersinia pestis Angola] >gi|162421331|ref|YP_001607453.1| IS285, transposase [Yersinia pestis Angola] >gi|162351470|gb|ABX85418.1| IS285, transposase [Yersinia pestis Angola] >gi|162354146|gb|ABX88094.1| IS285, transposase [Yersinia pestis Angola] (402 aa)
Score = 226, Expect = 1.5e-17, Identities = 45/122 (36%), Positives = 71/122 (58%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K +YQAP  + ++ AL  F E W  KY   +KSW  + E L TFF +P +IR+ IYTTN IE+VN  IR   K +    + +++ K++YL + + S+ W   + NW L + +  I F + +
  S:   277 LKMVYQAPTEEAALMALDKFAEAWDDKYPQISKSWRTHWENLNTFFGYPPDIRKAIYTTNAIESVNSVIRAAIKKRKVFPTDDSVRKVVYLAIKDASKKWSMPIQNWRLAMSRFIIEFGDRL 398
>gi|153947942|ref|YP_001399285.1| IS285, transposase [Yersinia pseudotuberculosis IP 31758] >gi|153949637|ref|YP_001399016.1| IS285, transposase [Yersinia pseudotuberculosis IP 31758] >gi|152959437|gb|ABS46898.1| IS285, transposase [Yersinia pseudotuberculosis IP 31758] >gi|152961132|gb|ABS48593.1| IS285, transposase [Yersinia pseudotuberculosis IP 31758] (402 aa)
Score = 226, Expect = 1.5e-17, Identities = 45/122 (36%), Positives = 71/122 (58%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K +YQAP  + ++ AL  F E W  KY   +KSW  + E L TFF +P +IR+ IYTTN IE+VN  IR   K +    + +++ K++YL + + S+ W   + NW L + +  I F + +
  S:   277 LKMVYQAPTEEAALMALDKFAEAWDDKYPQISKSWRTHWENLNTFFGYPPDIRKAIYTTNAIESVNSVIRAAIKKRKVFPTDDSVRKVVYLAIKDASKKWSMPIQNWRLAMSRFIIEFGDRL 398
>gi|16082872|ref|NP_395426.1| putative transposase [Yersinia pestis CO92] >gi|16120364|ref|NP_403677.1| transposase for the IS285 insertion element [Yersinia pestis CO92] >gi|16121766|ref|NP_405079.1| transposase [Yersinia pestis CO92] >gi|16121832|ref|NP_405145.1| transposase for the IS285 insertion element [Yersinia pestis CO92] >gi|16121852|ref|NP_405165.1| transposase for the IS285 insertion element [Yersinia pestis CO92] >gi|16121857|ref|NP_405170.1| transposase for the IS285 insertion element [Yersinia pestis CO92] >gi|16121889|ref|NP_405202.1| transposase for the IS285 insertion element [Yersinia pestis CO92] >gi|16121986|ref|NP_405299.1| transposase for the IS285 insertion element [Yersinia pestis CO92] >gi|16122230|ref|NP_405543.1| transposase for the IS285 insertion element [Yersinia pestis CO92] >gi|16122342|ref|NP_405655.1| transposase for the IS285 insertion element [Yersinia pestis CO92] >gi|16122371|ref|NP_405684.1| transposase for the IS285 insertion element [Yersinia pestis CO92] >gi|16122402|ref|NP_405715.1| transposase for the IS285 insertion element [Yersinia pestis CO92] >gi|16122424|ref|NP_405737.1| transposase for the IS285 insertion element [Yersinia pestis CO92] >gi|16122668|ref|NP_405981.1| transposase for the IS285 insertion element [Yersinia pestis CO92] >gi|16122788|ref|NP_406101.1| transposase for the IS285 insertion element [Yersinia pestis CO92] >gi|16122864|ref|NP_406177.1| transposase for the IS285 insertion element [Yersinia pestis CO92] >gi|16122987|ref|NP_406300.1| transposase for the IS285 insertion element [Yersinia pestis CO92] >gi|16122998|ref|NP_406311.1| transposase for the IS285 insertion element [Yersinia pestis CO92] >gi|16123054|ref|NP_406367.1| transposase for the IS285 insertion element [Yersinia pestis CO92] >gi|16123126|ref|NP_406439.1| transposase for the IS285 insertion element [Yersinia pestis CO92] >gi|16124008|ref|NP_407321.1| transposase for the IS285 insertion element [Yersinia pestis CO92] >gi|22124269|ref|NP_667692.1| transposase [Yersinia pestis KIM] >gi|22125036|ref|NP_668459.1| transposase [Yersinia pestis KIM] >gi|22125270|ref|NP_668693.1| transposase [Yersinia pestis KIM] >gi|22125439|ref|NP_668862.1| transposase [Yersinia pestis KIM] >gi|22125511|ref|NP_668934.1| transposase [Yersinia pestis KIM] >gi|22125637|ref|NP_669060.1| transposase [Yersinia pestis KIM] >gi|22125642|ref|NP_669065.1| transposase [Yersinia pestis KIM] >gi|22125675|ref|NP_669098.1| transposase [Yersinia pestis KIM] >gi|22125782|ref|NP_669205.1| transposase [Yersinia pestis KIM] >gi|22126039|ref|NP_669462.1| transposase [Yersinia pestis KIM] >gi|22126071|ref|NP_669494.1| transposase [Yersinia pestis KIM] >gi|22126097|ref|NP_669520.1| transposase [Yersinia pestis KIM] >gi|22126208|ref|NP_669631.1| transposase [Yersinia pestis KIM] >gi|22126461|ref|NP_669884.1| transposase [Yersinia pestis KIM] >gi|22126487|ref|NP_669910.1| transposase [Yersinia pestis KIM] >gi|22126554|ref|NP_669977.1| transposase [Yersinia pestis KIM] >gi|31795243|ref|NP_857700.1| transposase [Yersinia pestis KIM] >gi|31795392|ref|NP_857845.1| transposase [Yersinia pestis KIM] >gi|45440804|ref|NP_992343.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|45440984|ref|NP_992523.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|45441208|ref|NP_992747.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|45441514|ref|NP_993053.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|45441563|ref|NP_993102.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|45441611|ref|NP_993150.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|45441623|ref|NP_993162.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|45441639|ref|NP_993178.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|45441740|ref|NP_993279.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|45441794|ref|NP_993333.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|45442024|ref|NP_993563.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|45442057|ref|NP_993596.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|45442223|ref|NP_993762.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|45442348|ref|NP_993887.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|45442525|ref|NP_994064.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|45442619|ref|NP_994158.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|45442719|ref|NP_994258.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|45443233|ref|NP_994772.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|45478710|ref|NP_995566.1| transposase [Yersinia pestis biovar Microtus str. 91001] >gi|51594542|ref|YP_068733.1| putative transposase for IS285 insertion element [Yersinia pseudotuberculosis IP 32953] >gi|51595054|ref|YP_069245.1| putative transposase [Yersinia pseudotuberculosis IP 32953] >gi|51595127|ref|YP_069318.1| putative transposase-like protein [Yersinia pseudotuberculosis IP 32953] >gi|51596422|ref|YP_070613.1| putative transposase [Yersinia pseudotuberculosis IP 32953] >gi|51597611|ref|YP_071802.1| putative transposase [Yersinia pseudotuberculosis IP 32953] >gi|52788138|ref|YP_093966.1| putative transposase [Yersinia pestis] >gi|108793807|ref|YP_636652.1| transposase [Yersinia pestis Nepal516] >gi|108806141|ref|YP_650057.1| transposase for the IS285 insertion element [Yersinia pestis Antiqua] >gi|108806786|ref|YP_650702.1| transposase for the IS285 insertion element [Yersinia pestis Antiqua] >gi|108806853|ref|YP_650769.1| transposase for the IS285 insertion element [Yersinia pestis Antiqua] >gi|108806877|ref|YP_650793.1| transposase for the IS285 insertion element [Yersinia pestis Antiqua] >gi|108807097|ref|YP_651013.1| transposase for the IS285 insertion element [Yersinia pestis Antiqua] >gi|108807366|ref|YP_651282.1| transposase for the IS285 insertion element [Yersinia pestis Antiqua] >gi|108807491|ref|YP_651407.1| transposase for the IS285 insertion element [Yersinia pestis Antiqua] >gi|108807523|ref|YP_651439.1| transposase for the IS285 insertion element [Yersinia pestis Antiqua] >gi|108807548|ref|YP_651464.1| transposase for the IS285 insertion element [Yersinia pestis Antiqua] >gi|108807786|ref|YP_651702.1| transposase for the IS285 insertion element [Yersinia pestis Antiqua] >gi|108807897|ref|YP_651813.1| transposase for the IS285 insertion element [Yersinia pestis Antiqua] >gi|108807941|ref|YP_651857.1| transposase for the IS285 insertion element [Yersinia pestis Antiqua] >gi|108808127|ref|YP_652043.1| transposase for the IS285 insertion element [Yersinia pestis Antiqua] >gi|108808296|ref|YP_652212.1| transposase for the IS285 insertion element [Yersinia pestis Antiqua] >gi|108808376|ref|YP_652292.1| transposase for the IS285 insertion element [Yersinia pestis Antiqua] >gi|108808523|ref|YP_652439.1| transposase for the IS285 insertion element [Yersinia pestis Antiqua] >gi|108808536|ref|YP_652452.1| transposase for the IS285 insertion element [Yersinia pestis Antiqua] >gi|108810254|ref|YP_646021.1| transposase for the IS285 insertion element [Yersinia pestis Nepal516] >gi|108811207|ref|YP_646974.1| transposase for the IS285 insertion element [Yersinia pestis Nepal516] >gi|108811438|ref|YP_647205.1| transposase for the IS285 insertion element [Yersinia pestis Nepal516] >gi|108811631|ref|YP_647398.1| transposase for the IS285 insertion element [Yersinia pestis Nepal516] >gi|108811739|ref|YP_647506.1| transposase for the IS285 insertion element [Yersinia pestis Nepal516] >gi|108811768|ref|YP_647535.1| transposase for the IS285 insertion element [Yersinia pestis Nepal516] >gi|108811799|ref|YP_647566.1| transposase for the IS285 insertion element [Yersinia pestis Nepal516] >gi|108811824|ref|YP_647591.1| transposase for the IS285 insertion element [Yersinia pestis Nepal516] >gi|108811895|ref|YP_647662.1| transposase for the IS285 insertion element [Yersinia pestis Nepal516] >gi|108811933|ref|YP_647700.1| transposase for the IS285 insertion element [Yersinia pestis Nepal516] >gi|108812171|ref|YP_647938.1| transposase for the IS285 insertion element [Yersinia pestis Nepal516] >gi|108812201|ref|YP_647968.1| transposase for the IS285 insertion element [Yersinia pestis Nepal516] >gi|108812206|ref|YP_647973.1| transposase for the IS285 insertion element [Yersinia pestis Nepal516] >gi|108812557|ref|YP_648324.1| transposase for the IS285 insertion element [Yersinia pestis Nepal516] >gi|108812580|ref|YP_648347.1| transposase for the IS285 insertion element [Yersinia pestis Nepal516] >gi|108812646|ref|YP_648413.1| transposase for the IS285 insertion element [Yersinia pestis Nepal516] >gi|108812968|ref|YP_648735.1| transposase for the IS285 insertion element [Yersinia pestis Nepal516] >gi|145597155|ref|YP_001154619.1| transposase [Yersinia pestis Pestoides F] >gi|145597268|ref|YP_001154738.1| transposase [Yersinia pestis Pestoides F] >gi|145597287|ref|YP_001154757.1| transposase [Yersinia pestis Pestoides F] >gi|145597366|ref|YP_001161441.1| transposase for the IS285 insertion element [Yersinia pestis Pestoides F] >gi|145598008|ref|YP_001162084.1| transposase for the IS285 insertion element [Yersinia pestis Pestoides F] >gi|145598237|ref|YP_001162313.1| transposase for the IS285 insertion element [Yersinia pestis Pestoides F] >gi|145598256|ref|YP_001162332.1| transposase for the IS285 insertion element [Yersinia pestis Pestoides F] >gi|145598261|ref|YP_001162337.1| transposase for the IS285 insertion element [Yersinia pestis Pestoides F] >gi|145598430|ref|YP_001162506.1| transposase for the IS285 insertion element [Yersinia pestis Pestoides F] >gi|145598450|ref|YP_001162526.1| transposase for the IS285 insertion element [Yersinia pestis Pestoides F] >gi|145598499|ref|YP_001162575.1| transposase for the IS285 insertion element [Yersinia pestis Pestoides F] >gi|145598701|ref|YP_001162777.1| transposase for the IS285 insertion element [Yersinia pestis Pestoides F] >gi|145599003|ref|YP_001163079.1| transposase for the IS285 insertion element [Yersinia pestis Pestoides F] >gi|145599108|ref|YP_001163184.1| transposase for the IS285 insertion element [Yersinia pestis Pestoides F] >gi|145599144|ref|YP_001163220.1| transposase for the IS285 insertion element [Yersinia pestis Pestoides F] >gi|145599326|ref|YP_001163402.1| transposase for the IS285 insertion element [Yersinia pestis Pestoides F] >gi|145599484|ref|YP_001163560.1| transposase for the IS285 insertion element [Yersinia pestis Pestoides F] >gi|145599762|ref|YP_001163838.1| transposase for the IS285 insertion element [Yersinia pestis Pestoides F] >gi|145599951|ref|YP_001164027.1| transposase for the IS285 insertion element [Yersinia pestis Pestoides F] >gi|145600358|ref|YP_001164434.1| transposase for the IS285 insertion element [Yersinia pestis Pestoides F] >gi|149192809|ref|YP_001294040.1| putative transposase [Yersinia pestis CA88-4125] >gi|149365190|ref|ZP_01887225.1| transposase for the IS285 insertion element [Yersinia pestis CA88-4125] >gi|149365257|ref|ZP_01887292.1| transposase for the IS285 insertion element [Yersinia pestis CA88-4125] >gi|149365267|ref|ZP_01887302.1| transposase for the IS285 insertion element [Yersinia pestis CA88-4125] >gi|149365322|ref|ZP_01887357.1| transposase for the IS285 insertion element [Yersinia pestis CA88-4125] >gi|149365450|ref|ZP_01887485.1| transposase for the IS285 insertion element [Yersinia pestis CA88-4125] >gi|149365524|ref|ZP_01887559.1| transposase for the IS285 insertion element [Yersinia pestis CA88-4125] >gi|149365644|ref|ZP_01887679.1| transposase for the IS285 insertion element [Yersinia pestis CA88-4125] >gi|149365885|ref|ZP_01887920.1| transposase for the IS285 insertion element [Yersinia pestis CA88-4125] >gi|149365907|ref|ZP_01887942.1| transposase for the IS285 insertion element [Yersinia pestis CA88-4125] >gi|149365938|ref|ZP_01887973.1| transposase for the IS285 insertion element [Yersinia pestis CA88-4125] >gi|149365968|ref|ZP_01888003.1| transposase for the IS285 insertion element [Yersinia pestis CA88-4125] >gi|149366081|ref|ZP_01888116.1| transposase for the IS285 insertion element [Yersinia pestis CA88-4125] >gi|149366319|ref|ZP_01888353.1| transposase for the IS285 insertion element [Yersinia pestis CA88-4125] >gi|149366414|ref|ZP_01888448.1| transposase [Yersinia pestis CA88-4125] >gi|149366480|ref|ZP_01888514.1| transposase for the IS285 insertion element [Yersinia pestis CA88-4125] >gi|149366500|ref|ZP_01888534.1| transposase for the IS285 insertion element [Yersinia pestis CA88-4125] >gi|149366505|ref|ZP_01888539.1| transposase for the IS285 insertion element [Yersinia pestis CA88-4125] >gi|149366537|ref|ZP_01888571.1| transposase for the IS285 insertion element [Yersinia pestis CA88-4125] >gi|150260925|ref|ZP_01917653.1| transposase for the IS285 insertion element [Yersinia pestis CA88-4125] >gi|153997071|ref|ZP_02022204.1| transposase for the IS285 insertion element [Yersinia pestis CA88-4125] >gi|162417845|ref|YP_001604621.1| IS256 family transposase [Yersinia pestis Angola] >gi|162418218|ref|YP_001605010.1| IS285, transposase [Yersinia pestis Angola] >gi|162418255|ref|YP_001607206.1| IS285, transposase [Yersinia pestis Angola] >gi|162418320|ref|YP_001606767.1| IS285, transposase [Yersinia pestis Angola] >gi|162418742|ref|YP_001606376.1| IS285, transposase [Yersinia pestis Angola] >gi|162418970|ref|YP_001606759.1| IS285, transposase [Yersinia pestis Angola] >gi|162419053|ref|YP_001606599.1| IS285, transposase [Yersinia pestis Angola] >gi|162419073|ref|YP_001605450.1| IS285, transposase [Yersinia pestis Angola] >gi|162419145|ref|YP_001607838.1| IS285, transposase [Yersinia pestis Angola] >gi|162419473|ref|YP_001607281.1| IS285, transposase [Yersinia pestis Angola] >gi|162419595|ref|YP_001605786.1| IS285, transposase [Yersinia pestis Angola] >gi|162419784|ref|YP_001607249.1| IS285, transposase [Yersinia pestis Angola] >gi|162419904|ref|YP_001604831.1| IS285, transposase [Yersinia pestis Angola] >gi|162419905|ref|YP_001606200.1| IS285, transposase [Yersinia pestis Angola] >gi|162419940|ref|YP_001605467.1| IS285, transposase [Yersinia pestis Angola] >gi|162419950|ref|YP_001607090.1| IS285, transposase [Yersinia pestis Angola] >gi|162420006|ref|YP_001606796.1| IS285, transposase [Yersinia pestis Angola] >gi|162420022|ref|YP_001604658.1| IS285, transposase [Yersinia pestis Angola] >gi|162420149|ref|YP_001606639.1| IS285, transposase [Yersinia pestis Angola] >gi|162420289|ref|YP_001606410.1| IS285, transposase [Yersinia pestis Angola] >gi|162420295|ref|YP_001608375.1| IS285, transposase [Yersinia pestis Angola] >gi|162420474|ref|YP_001605006.1| IS285, transposase [Yersinia pestis Angola] >gi|162420528|ref|YP_001605155.1| IS285, transposase [Yersinia pestis Angola] >gi|162420567|ref|YP_001604811.1| IS285, transposase [Yersinia pestis Angola] >gi|162420644|ref|YP_001608406.1| IS285, transposase [Yersinia pestis Angola] >gi|162420732|ref|YP_001607046.1| IS285, transposase [Yersinia pestis Angola] >gi|162420753|ref|YP_001606400.1| IS285, transposase [Yersinia pestis Angola] >gi|162420928|ref|YP_001607375.1| IS285, transposase [Yersinia pestis Angola] >gi|162420987|ref|YP_001606963.1| IS285, transposase [Yersinia pestis Angola] >gi|162421021|ref|YP_001607092.1| IS285, transposase [Yersinia pestis Angola] >gi|162421318|ref|YP_001606621.1| IS285, transposase [Yersinia pestis Angola] >gi|162421351|ref|YP_001604774.1| IS285, transposase [Yersinia pestis Angola] >gi|162421653|ref|YP_001605201.1| IS285, transposase [Yersinia pestis Angola] >gi|165924353|ref|ZP_02220185.1| IS285, transposase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165924569|ref|ZP_02220401.1| IS285, transposase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165924704|ref|ZP_02220536.1| IS285, transposase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165925166|ref|ZP_02220998.1| IS285, transposase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165925197|ref|ZP_02221029.1| IS285, transposase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165925330|ref|ZP_02221162.1| IS285, transposase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165925404|ref|ZP_02221236.1| IS285, transposase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165925470|ref|ZP_02221302.1| IS285, transposase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165925480|ref|ZP_02221312.1| IS285, transposase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165925624|ref|ZP_02221456.1| IS285, transposase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165925945|ref|ZP_02221777.1| IS285, transposase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165926206|ref|ZP_02222038.1| IS285, transposase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165926334|ref|ZP_02222166.1| IS285, transposase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165926382|ref|ZP_02222214.1| IS285, transposase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165926829|ref|ZP_02222661.1| IS285, transposase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165927437|ref|ZP_02223269.1| IS285, transposase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165927455|ref|ZP_02223287.1| IS285, transposase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165927682|ref|ZP_02223514.1| IS285, transposase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165927708|ref|ZP_02223540.1| IS285, transposase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165937019|ref|ZP_02225584.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165937062|ref|ZP_02225627.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165937094|ref|ZP_02225659.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165937713|ref|ZP_02226275.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165938204|ref|ZP_02226763.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165938247|ref|ZP_02226806.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165938366|ref|ZP_02226924.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165938505|ref|ZP_02227062.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165938507|ref|ZP_02227064.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165938819|ref|ZP_02227373.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165939226|ref|ZP_02227776.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165939340|ref|ZP_02227888.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165939381|ref|ZP_02227929.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165939445|ref|ZP_02227992.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165939497|ref|ZP_02228043.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165939560|ref|ZP_02228105.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165939658|ref|ZP_02228202.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165939665|ref|ZP_02228208.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165939934|ref|ZP_02228472.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165940166|ref|ZP_02228698.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165940174|ref|ZP_02228706.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|166008053|ref|ZP_02228951.1| IS285, transposase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166008228|ref|ZP_02229126.1| IS285, transposase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166008236|ref|ZP_02229134.1| IS285, transposase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166008321|ref|ZP_02229219.1| IS285, transposase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166008416|ref|ZP_02229314.1| IS285, transposase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166008522|ref|ZP_02229420.1| IS285, transposase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166008562|ref|ZP_02229460.1| IS285, transposase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166008591|ref|ZP_02229489.1| IS285, transposase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166009091|ref|ZP_02229989.1| IS285, transposase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166009108|ref|ZP_02230006.1| IS285, transposase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166009256|ref|ZP_02230154.1| IS285, transposase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166009259|ref|ZP_02230157.1| IS285, transposase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166009271|ref|ZP_02230169.1| IS285, transposase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166009375|ref|ZP_02230273.1| IS285, transposase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166009459|ref|ZP_02230357.1| IS285, transposase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166011432|ref|ZP_02232330.1| IS285, transposase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166011777|ref|ZP_02232675.1| IS285, transposase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166011820|ref|ZP_02232718.1| IS285, transposase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166012175|ref|ZP_02233073.1| IS285, transposase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166210434|ref|ZP_02236469.1| IS285, transposase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166210456|ref|ZP_02236491.1| IS285, transposase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166210505|ref|ZP_02236540.1| IS285, transposase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166210538|ref|ZP_02236573.1| IS285, transposase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166210624|ref|ZP_02236659.1| IS285, transposase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166210964|ref|ZP_02236999.1| IS285, transposase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166210972|ref|ZP_02237007.1| IS285, transposase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166211062|ref|ZP_02237097.1| IS285, transposase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166211279|ref|ZP_02237314.1| IS285, transposase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166211329|ref|ZP_02237364.1| IS285, transposase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166211565|ref|ZP_02237600.1| IS285, transposase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166211744|ref|ZP_02237779.1| IS285, transposase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166212261|ref|ZP_02238296.1| IS285, transposase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166213580|ref|ZP_02239615.1| IS285, transposase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166213602|ref|ZP_02239637.1| IS285, transposase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166214486|ref|ZP_02240521.1| IS285, transposase [Yersinia pestis biovar Antiqua str. B42003004] >gi|167398436|ref|ZP_02303960.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167398590|ref|ZP_02304114.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167398753|ref|ZP_02304277.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167399169|ref|ZP_02304693.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167399392|ref|ZP_02304916.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167400244|ref|ZP_02305757.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167400245|ref|ZP_02305758.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167400267|ref|ZP_02305780.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167400316|ref|ZP_02305829.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167400771|ref|ZP_02306277.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167400859|ref|ZP_02306365.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167400877|ref|ZP_02306383.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167401429|ref|ZP_02306926.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167401455|ref|ZP_02306952.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167401799|ref|ZP_02307290.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167402042|ref|ZP_02307521.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167402384|ref|ZP_02307847.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167402399|ref|ZP_02307862.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167419209|ref|ZP_02310962.1| IS285, transposase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167420297|ref|ZP_02312050.1| IS285, transposase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167420352|ref|ZP_02312105.1| IS285, transposase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167420370|ref|ZP_02312123.1| IS285, transposase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167420392|ref|ZP_02312145.1| IS285, transposase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167420443|ref|ZP_02312196.1| IS285, transposase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167421094|ref|ZP_02312847.1| IS285, transposase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167421358|ref|ZP_02313111.1| IS285, transposase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167421388|ref|ZP_02313141.1| IS285, transposase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167421398|ref|ZP_02313151.1| IS285, transposase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167421728|ref|ZP_02313481.1| IS285, transposase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167421738|ref|ZP_02313491.1| IS285, transposase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167421783|ref|ZP_02313536.1| IS285, transposase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167421790|ref|ZP_02313543.1| IS285, transposase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167421850|ref|ZP_02313603.1| IS285, transposase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167422268|ref|ZP_02314021.1| IS285, transposase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167422540|ref|ZP_02314293.1| IS285, transposase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167422595|ref|ZP_02314348.1| IS285, transposase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167423089|ref|ZP_02314842.1| IS285, transposase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167423856|ref|ZP_02315609.1| IS285, transposase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167424198|ref|ZP_02315951.1| IS285, transposase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167424247|ref|ZP_02316000.1| IS285, transposase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167424392|ref|ZP_02316145.1| IS285, transposase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167424665|ref|ZP_02316418.1| IS285, transposase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167424771|ref|ZP_02316524.1| IS285, transposase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167424790|ref|ZP_02316543.1| IS285, transposase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167424935|ref|ZP_02316688.1| IS285, transposase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167425898|ref|ZP_02317651.1| IS285, transposase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167426565|ref|ZP_02318318.1| IS285, transposase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167426913|ref|ZP_02318666.1| IS285, transposase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167427001|ref|ZP_02318754.1| IS285, transposase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167427021|ref|ZP_02318774.1| IS285, transposase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167427140|ref|ZP_02318893.1| IS285, transposase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167466849|ref|ZP_02331553.1| IS285, transposase [Yersinia pestis FV-1] >gi|167468202|ref|ZP_02332906.1| IS285, transposase [Yersinia pestis FV-1] >gi|167468728|ref|ZP_02333432.1| IS285, transposase [Yersinia pestis FV-1] >gi|167468946|ref|ZP_02333650.1| IS285, transposase [Yersinia pestis FV-1] >gi|167468962|ref|ZP_02333666.1| IS285, transposase [Yersinia pestis FV-1] >gi|167470020|ref|ZP_02334724.1| IS285, transposase [Yersinia pestis FV-1] >gi|167470598|ref|ZP_02335302.1| IS285, transposase [Yersinia pestis FV-1] >gi|167470668|ref|ZP_02335372.1| IS285, transposase [Yersinia pestis FV-1] >gi|170022678|ref|YP_001719183.1| transposase mutator type [Yersinia pseudotuberculosis YPIII] >gi|186893541|ref|YP_001870653.1| transposase mutator type [Yersinia pseudotuberculosis PB1/+] >gi|186894859|ref|YP_001871971.1| transposase mutator type [Yersinia pseudotuberculosis PB1/+] >gi|186895101|ref|YP_001872213.1| transposase mutator type [Yersinia pseudotuberculosis PB1/+] >gi|186895880|ref|YP_001872992.1| transposase mutator type [Yersinia pseudotuberculosis PB1/+] >gi|186897561|ref|YP_001874672.1| transposase mutator type [Yersinia pseudotuberculosis PB1/+] >gi|21957038|gb|AAM83943.1|AE013636_1 putative transposase [Yersinia pestis KIM] >gi|21957885|gb|AAM84710.1|AE013716_1 putative transposase [Yersinia pestis KIM] >gi|21958142|gb|AAM84944.1|AE013739_10 putative transposase [Yersinia pestis KIM] >gi|21958329|gb|AAM85113.1|AE013757_5 putative transposase [Yersinia pestis KIM] >gi|21958408|gb|AAM85185.1|AE013764_9 putative transposase [Yersinia pestis KIM] >gi|21958547|gb|AAM85311.1|AE013777_10 putative transposase [Yersinia pestis KIM] >gi|21958553|gb|AAM85316.1|AE013778_2 putative transposase [Yersinia pestis KIM] >gi|21958588|gb|AAM85349.1|AE013780_13 putative transposase [Yersinia pestis KIM] >gi|21958707|gb|AAM85456.1|AE013792_4 putative transposase [Yersinia pestis KIM] >gi|21958990|gb|AAM85713.1|AE013818_7 putative transposase [Yersinia pestis KIM] >gi|21959026|gb|AAM85745.1|AE013822_4 putative transposase [Yersinia pestis KIM] >gi|21959054|gb|AAM85771.1|AE013824_13 putative transposase [Yersinia pestis KIM] >gi|21959175|gb|AAM85882.1|AE013834_7 putative transposase [Yersinia pestis KIM] >gi|21959454|gb|AAM86135.1|AE013860_1 putative transposase [Yersinia pestis KIM] >gi|21959482|gb|AAM86161.1|AE013862_6 putative transposase [Yersinia pestis KIM] >gi|21959557|gb|AAM86228.1|AE013870_3 putative transposase [Yersinia pestis KIM] >gi|2996347|gb|AAC13227.1| transposase [Yersinia pestis KIM] >gi|3883062|gb|AAC82722.1| transposase [Yersinia pestis KIM] >gi|5834763|emb|CAB55262.1| putative transposase [Yersinia pestis CO92] >gi|45357363|gb|AAS58757.1| transposase [Yersinia pestis biovar Microtus str. 91001] >gi|45435662|gb|AAS61220.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|45435843|gb|AAS61400.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|45436068|gb|AAS61624.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|45436375|gb|AAS61930.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|45436424|gb|AAS61979.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|45436472|gb|AAS62027.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|45436484|gb|AAS62039.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|45436501|gb|AAS62055.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|45436602|gb|AAS62156.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|45436656|gb|AAS62210.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|45436887|gb|AAS62440.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|45436920|gb|AAS62473.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|45437087|gb|AAS62639.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|45437212|gb|AAS62764.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|45437390|gb|AAS62941.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|45437484|gb|AAS63035.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|45437585|gb|AAS63135.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|45438101|gb|AAS63649.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|51587824|emb|CAH19426.1| putative transposase for IS285 insertion element [Yersinia pseudotuberculosis IP 32953] >gi|51588336|emb|CAH19944.1| putative transposase [Yersinia pseudotuberculosis IP 32953] >gi|51588409|emb|CAH20017.1| putative transposase-like protein [Yersinia pseudotuberculosis IP 32953] >gi|51589704|emb|CAH21334.1| putative transposase [Yersinia pseudotuberculosis IP 32953] >gi|51590893|emb|CAH22549.1| Putative transposase [Yersinia pseudotuberculosis IP 32953] >gi|52538067|emb|CAG27492.1| putative transposase [Yersinia pestis] >gi|108773902|gb|ABG16421.1| transposase for the IS285 insertion element [Yersinia pestis Nepal516] >gi|108774855|gb|ABG17374.1| transposase for the IS285 insertion element [Yersinia pestis Nepal516] >gi|108775086|gb|ABG17605.1| transposase for the IS285 insertion element [Yersinia pestis Nepal516] >gi|108775279|gb|ABG17798.1| transposase for the IS285 insertion element [Yersinia pestis Nepal516] >gi|108775387|gb|ABG17906.1| transposase for the IS285 insertion element [Yersinia pestis Nepal516] >gi|108775416|gb|ABG17935.1| transposase for the IS285 insertion element [Yersinia pestis Nepal516] >gi|108775447|gb|ABG17966.1| transposase for the IS285 insertion element [Yersinia pestis Nepal516] >gi|108775472|gb|ABG17991.1| transposase for the IS285 insertion element [Yersinia pestis Nepal516] >gi|108775543|gb|ABG18062.1| transposase for the IS285 insertion element [Yersinia pestis Nepal516] >gi|108775581|gb|ABG18100.1| transposase for the IS285 insertion element [Yersinia pestis Nepal516] >gi|108775819|gb|ABG18338.1| transposase for the IS285 insertion element [Yersinia pestis Nepal516] >gi|108775849|gb|ABG18368.1| transposase for the IS285 insertion element [Yersinia pestis Nepal516] >gi|108775854|gb|ABG18373.1| transposase for the IS285 insertion element [Yersinia pestis Nepal516] >gi|108776205|gb|ABG18724.1| transposase for the IS285 insertion element [Yersinia pestis Nepal516] >gi|108776228|gb|ABG18747.1| transposase for the IS285 insertion element [Yersinia pestis Nepal516] >gi|108776294|gb|ABG18813.1| transposase for the IS285 insertion element [Yersinia pestis Nepal516] >gi|108776616|gb|ABG19135.1| transposase for the IS285 insertion element [Yersinia pestis Nepal516] >gi|108777871|gb|ABG20389.1| transposase [Yersinia pestis Nepal516] >gi|108778054|gb|ABG12112.1| transposase for the IS285 insertion element [Yersinia pestis Antiqua] >gi|108778699|gb|ABG12757.1| transposase for the IS285 insertion element [Yersinia pestis Antiqua] >gi|108778766|gb|ABG12824.1| transposase for the IS285 insertion element [Yersinia pestis Antiqua] >gi|108778790|gb|ABG12848.1| transposase for the IS285 insertion element [Yersinia pestis Antiqua] >gi|108779010|gb|ABG13068.1| transposase for the IS285 insertion element [Yersinia pestis Antiqua] >gi|108779279|gb|ABG13337.1| transposase for the IS285 insertion element [Yersinia pestis Antiqua] >gi|108779404|gb|ABG13462.1| transposase for the IS285 insertion element [Yersinia pestis Antiqua] >gi|108779436|gb|ABG13494.1| transposase for the IS285 insertion element [Yersinia pestis Antiqua] >gi|108779461|gb|ABG13519.1| transposase for the IS285 insertion element [Yersinia pestis Antiqua] >gi|108779699|gb|ABG13757.1| transposase for the IS285 insertion element [Yersinia pestis Antiqua] >gi|108779810|gb|ABG13868.1| transposase for the IS285 insertion element [Yersinia pestis Antiqua] >gi|108779854|gb|ABG13912.1| transposase for the IS285 insertion element [Yersinia pestis Antiqua] >gi|108780040|gb|ABG14098.1| transposase for the IS285 insertion element [Yersinia pestis Antiqua] >gi|108780209|gb|ABG14267.1| transposase for the IS285 insertion element [Yersinia pestis Antiqua] >gi|108780289|gb|ABG14347.1| transposase for the IS285 insertion element [Yersinia pestis Antiqua] >gi|108780436|gb|ABG14494.1| transposase for the IS285 insertion element [Yersinia pestis Antiqua] >gi|108780449|gb|ABG14507.1| transposase for the IS285 insertion element [Yersinia pestis Antiqua] >gi|115345843|emb|CAL18701.1| transposase for the IS285 insertion element [Yersinia pestis CO92] >gi|115347245|emb|CAL20139.1| transposase [Yersinia pestis CO92] >gi|115347311|emb|CAL20207.1| transposase for the IS285 insertion element [Yersinia pestis CO92] >gi|115347331|emb|CAL20228.1| transposase for the IS285 insertion element [Yersinia pestis CO92] >gi|115347336|emb|CAL20234.1| transposase for the IS285 insertion element [Yersinia pestis CO92] >gi|115347368|emb|CAL20266.1| transposase for the IS285 insertion element [Yersinia pestis CO92] >gi|115347465|emb|CAL20370.1| transposase for the IS285 insertion element [Yersinia pestis CO92] >gi|115347709|emb|CAL20624.1| transposase for the IS285 insertion element [Yersinia pestis CO92] >gi|115347821|emb|CAL20740.1| transposase for the IS285 insertion element [Yersinia pestis CO92] >gi|115347850|emb|CAL20770.1| transposase for the IS285 insertion element [Yersinia pestis CO92] >gi|115347881|emb|CAL20802.1| transposase for the IS285 insertion element [Yersinia pestis CO92] >gi|115347903|emb|CAL20824.1| transposase for the IS285 insertion element [Yersinia pestis CO92] >gi|115348147|emb|CAL21075.1| transposase for the IS285 insertion element [Yersinia pestis CO92] >gi|115348267|emb|CAL21196.1| transposase for the IS285 insertion element [Yersinia pestis CO92] >gi|115348343|emb|CAL21276.1| transposase for the IS285 insertion element [Yersinia pestis CO92] >gi|115348466|emb|CAL21402.1| transposase for the IS285 insertion element [Yersinia pestis CO92] >gi|115348477|emb|CAL21414.1| transposase for the IS285 insertion element [Yersinia pestis CO92] >gi|115348533|emb|CAL21473.1| transposase for the IS285 insertion element [Yersinia pestis CO92] >gi|115348605|emb|CAL21549.1| transposase for the IS285 insertion element [Yersinia pestis CO92] >gi|115349487|emb|CAL22461.1| transposase for the IS285 insertion element [Yersinia pestis CO92] >gi|145209062|gb|ABP38469.1| transposase for the IS285 insertion element [Yersinia pestis Pestoides F] >gi|145209704|gb|ABP39111.1| transposase for the IS285 insertion element [Yersinia pestis Pestoides F] >gi|145209933|gb|ABP39340.1| transposase for the IS285 insertion element [Yersinia pestis Pestoides F] >gi|145209952|gb|ABP39359.1| transposase for the IS285 insertion element [Yersinia pestis Pestoides F] >gi|145209957|gb|ABP39364.1| transposase for the IS285 insertion element [Yersinia pestis Pestoides F] >gi|145210126|gb|ABP39533.1| transposase for the IS285 insertion element [Yersinia pestis Pestoides F] >gi|145210146|gb|ABP39553.1| transposase for the IS285 insertion element [Yersinia pestis Pestoides F] >gi|145210195|gb|ABP39602.1| transposase for the IS285 insertion element [Yersinia pestis Pestoides F] >gi|145210397|gb|ABP39804.1| transposase for the IS285 insertion element [Yersinia pestis Pestoides F] >gi|145210699|gb|ABP40106.1| transposase for the IS285 insertion element [Yersinia pestis Pestoides F] >gi|145210804|gb|ABP40211.1| transposase for the IS285 insertion element [Yersinia pestis Pestoides F] >gi|145210840|gb|ABP40247.1| transposase for the IS285 insertion element [Yersinia pestis Pestoides F] >gi|145211022|gb|ABP40429.1| transposase for the IS285 insertion element [Yersinia pestis Pestoides F] >gi|145211180|gb|ABP40587.1| transposase for the IS285 insertion element [Yersinia pestis Pestoides F] >gi|145211458|gb|ABP40865.1| transposase for the IS285 insertion element [Yersinia pestis Pestoides F] >gi|145211647|gb|ABP41054.1| transposase for the IS285 insertion element [Yersinia pestis Pestoides F] >gi|145212054|gb|ABP41461.1| transposase for the IS285 insertion element [Yersinia pestis Pestoides F] >gi|145212923|gb|ABP42329.1| transposase [Yersinia pestis Pestoides F] >gi|145213036|gb|ABP42441.1| transposase [Yersinia pestis Pestoides F] >gi|145213055|gb|ABP42460.1| transposase [Yersinia pestis Pestoides F] >gi|148872467|gb|ABR14956.1| putative transposase [Yersinia pestis CA88-4125] >gi|149289377|gb|EDM39455.1| transposase for the IS285 insertion element [Yersinia pestis CA88-4125] >gi|149290333|gb|EDM40410.1| transposase for the IS285 insertion element [Yersinia pestis CA88-4125] >gi|149290693|gb|EDM40768.1| transposase for the IS285 insertion element [Yersinia pestis CA88-4125] >gi|149290788|gb|EDM40863.1| transposase [Yersinia pestis CA88-4125] >gi|149290854|gb|EDM40929.1| transposase for the IS285 insertion element [Yersinia pestis CA88-4125] >gi|149290874|gb|EDM40949.1| transposase for the IS285 insertion element [Yersinia pestis CA88-4125] >gi|149290879|gb|EDM40954.1| transposase for the IS285 insertion element [Yersinia pestis CA88-4125] >gi|149290911|gb|EDM40986.1| transposase for the IS285 insertion element [Yersinia pestis CA88-4125] >gi|149291603|gb|EDM41677.1| transposase for the IS285 insertion element [Yersinia pestis CA88-4125] >gi|149291670|gb|EDM41744.1| transposase for the IS285 insertion element [Yersinia pestis CA88-4125] >gi|149291680|gb|EDM41754.1| transposase for the IS285 insertion element [Yersinia pestis CA88-4125] >gi|149291735|gb|EDM41809.1| transposase for the IS285 insertion element [Yersinia pestis CA88-4125] >gi|149291863|gb|EDM41937.1| transposase for the IS285 insertion element [Yersinia pestis CA88-4125] >gi|149291937|gb|EDM42011.1| transposase for the IS285 insertion element [Yersinia pestis CA88-4125] >gi|149292057|gb|EDM42131.1| transposase for the IS285 insertion element [Yersinia pestis CA88-4125] >gi|149292298|gb|EDM42372.1| transposase for the IS285 insertion element [Yersinia pestis CA88-4125] >gi|149292320|gb|EDM42394.1| transposase for the IS285 insertion element [Yersinia pestis CA88-4125] >gi|149292351|gb|EDM42425.1| transposase for the IS285 insertion element [Yersinia pestis CA88-4125] >gi|149292381|gb|EDM42455.1| transposase for the IS285 insertion element [Yersinia pestis CA88-4125] >gi|149292494|gb|EDM42568.1| transposase for the IS285 insertion element [Yersinia pestis CA88-4125] >gi|162350817|gb|ABX84766.1| transposase, IS256 family [Yersinia pestis Angola] >gi|162351033|gb|ABX84981.1| IS285, transposase [Yersinia pestis Angola] >gi|162351070|gb|ABX85018.1| IS285, transposase [Yersinia pestis Angola] >gi|162351135|gb|ABX85083.1| IS285, transposase [Yersinia pestis Angola] >gi|162351557|gb|ABX85505.1| IS285, transposase [Yersinia pestis Angola] >gi|162351785|gb|ABX85733.1| IS285, transposase [Yersinia pestis Angola] >gi|162351868|gb|ABX85816.1| IS285, transposase [Yersinia pestis Angola] >gi|162351888|gb|ABX85836.1| IS285, transposase [Yersinia pestis Angola] >gi|162351960|gb|ABX85908.1| IS285, transposase [Yersinia pestis Angola] >gi|162352288|gb|ABX86236.1| IS285, transposase [Yersinia pestis Angola] >gi|162352410|gb|ABX86358.1| IS285, transposase [Yersinia pestis Angola] >gi|162352599|gb|ABX86547.1| IS285, transposase [Yersinia pestis Angola] >gi|162352719|gb|ABX86667.1| IS285, transposase [Yersinia pestis Angola] >gi|162352720|gb|ABX86668.1| IS285, transposase [Yersinia pestis Angola] >gi|162352755|gb|ABX86703.1| IS285, transposase [Yersinia pestis Angola] >gi|162352765|gb|ABX86713.1| IS285, transposase [Yersinia pestis Angola] >gi|162352821|gb|ABX86769.1| IS285, transposase [Yersinia pestis Angola] >gi|162352837|gb|ABX86785.1| IS285, transposase [Yersinia pestis Angola] >gi|162352964|gb|ABX86912.1| IS285, transposase [Yersinia pestis Angola] >gi|162353104|gb|ABX87052.1| IS285, transposase [Yersinia pestis Angola] >gi|162353110|gb|ABX87058.1| IS285, transposase [Yersinia pestis Angola] >gi|162353289|gb|ABX87237.1| IS285, transposase [Yersinia pestis Angola] >gi|162353343|gb|ABX87291.1| IS285, transposase [Yersinia pestis Angola] >gi|162353382|gb|ABX87330.1| IS285, transposase [Yersinia pestis Angola] >gi|162353459|gb|ABX87407.1| IS285, transposase [Yersinia pestis Angola] >gi|162353547|gb|ABX87495.1| IS285, transposase [Yersinia pestis Angola] >gi|162353568|gb|ABX87516.1| IS285, transposase [Yersinia pestis Angola] >gi|162353743|gb|ABX87691.1| IS285, transposase [Yersinia pestis Angola] >gi|162353802|gb|ABX87750.1| IS285, transposase [Yersinia pestis Angola] >gi|162353836|gb|ABX87784.1| IS285, transposase [Yersinia pestis Angola] >gi|162354133|gb|ABX88081.1| IS285, transposase [Yersinia pestis Angola] >gi|162354166|gb|ABX88114.1| IS285, transposase [Yersinia pestis Angola] >gi|162354468|gb|ABX88416.1| IS285, transposase [Yersinia pestis Angola] >gi|165911912|gb|EDR30557.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165911920|gb|EDR30565.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165912153|gb|EDR30792.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165912355|gb|EDR30989.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165912455|gb|EDR31088.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165912476|gb|EDR31108.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165912546|gb|EDR31177.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165912633|gb|EDR31263.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165912681|gb|EDR31310.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165912722|gb|EDR31351.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165912826|gb|EDR31453.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165913182|gb|EDR31805.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165913620|gb|EDR32240.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165913622|gb|EDR32242.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165913744|gb|EDR32363.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165913865|gb|EDR32483.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165913908|gb|EDR32526.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165914463|gb|EDR33078.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165914882|gb|EDR33494.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165914925|gb|EDR33537.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165914957|gb|EDR33569.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165920296|gb|EDR37573.1| IS285, transposase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165920322|gb|EDR37599.1| IS285, transposase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165920510|gb|EDR37787.1| IS285, transposase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165920703|gb|EDR37951.1| IS285, transposase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165921180|gb|EDR38404.1| IS285, transposase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165921603|gb|EDR38800.1| IS285, transposase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165921858|gb|EDR39055.1| IS285, transposase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165922066|gb|EDR39243.1| IS285, transposase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165922149|gb|EDR39326.1| IS285, transposase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165922579|gb|EDR39730.1| IS285, transposase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165922589|gb|EDR39740.1| IS285, transposase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165922733|gb|EDR39884.1| IS285, transposase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165922773|gb|EDR39924.1| IS285, transposase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165922804|gb|EDR39955.1| IS285, transposase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165922937|gb|EDR40088.1| IS285, transposase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165923011|gb|EDR40162.1| IS285, transposase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165923413|gb|EDR40545.1| IS285, transposase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165923629|gb|EDR40761.1| IS285, transposase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165923764|gb|EDR40896.1| IS285, transposase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165988909|gb|EDR41210.1| IS285, transposase [Yersinia pestis biovar Antiqua str. E1979001] >gi|165989285|gb|EDR41586.1| IS285, transposase [Yersinia pestis biovar Antiqua str. E1979001] >gi|165989384|gb|EDR41685.1| IS285, transposase [Yersinia pestis biovar Antiqua str. E1979001] >gi|165989578|gb|EDR41879.1| IS285, transposase [Yersinia pestis biovar Antiqua str. E1979001] >gi|165991381|gb|EDR43682.1| IS285, transposase [Yersinia pestis biovar Antiqua str. E1979001] >gi|165991646|gb|EDR43947.1| IS285, transposase [Yersinia pestis biovar Antiqua str. E1979001] >gi|165991663|gb|EDR43964.1| IS285, transposase [Yersinia pestis biovar Antiqua str. E1979001] >gi|165991811|gb|EDR44112.1| IS285, transposase [Yersinia pestis biovar Antiqua str. E1979001] >gi|165991814|gb|EDR44115.1| IS285, transposase [Yersinia pestis biovar Antiqua str. E1979001] >gi|165991826|gb|EDR44127.1| IS285, transposase [Yersinia pestis biovar Antiqua str. E1979001] >gi|165991930|gb|EDR44231.1| IS285, transposase [Yersinia pestis biovar Antiqua str. E1979001] >gi|165992435|gb|EDR44736.1| IS285, transposase [Yersinia pestis biovar Antiqua str. E1979001] >gi|165992610|gb|EDR44911.1| IS285, transposase [Yersinia pestis biovar Antiqua str. E1979001] >gi|165992618|gb|EDR44919.1| IS285, transposase [Yersinia pestis biovar Antiqua str. E1979001] >gi|165992703|gb|EDR45004.1| IS285, transposase [Yersinia pestis biovar Antiqua str. E1979001] >gi|165992798|gb|EDR45099.1| IS285, transposase [Yersinia pestis biovar Antiqua str. E1979001] >gi|165992904|gb|EDR45205.1| IS285, transposase [Yersinia pestis biovar Antiqua str. E1979001] >gi|165992944|gb|EDR45245.1| IS285, transposase [Yersinia pestis biovar Antiqua str. E1979001] >gi|165992973|gb|EDR45274.1| IS285, transposase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166204334|gb|EDR48814.1| IS285, transposase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166205253|gb|EDR49733.1| IS285, transposase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166205275|gb|EDR49755.1| IS285, transposase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166206192|gb|EDR50672.1| IS285, transposase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166207050|gb|EDR51530.1| IS285, transposase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166207100|gb|EDR51580.1| IS285, transposase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166207336|gb|EDR51816.1| IS285, transposase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166207515|gb|EDR51995.1| IS285, transposase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166207614|gb|EDR52094.1| IS285, transposase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166207636|gb|EDR52116.1| IS285, transposase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166207685|gb|EDR52165.1| IS285, transposase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166207718|gb|EDR52198.1| IS285, transposase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166207804|gb|EDR52284.1| IS285, transposase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166208144|gb|EDR52624.1| IS285, transposase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166208152|gb|EDR52632.1| IS285, transposase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166208242|gb|EDR52722.1| IS285, transposase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166958442|gb|EDR55463.1| IS285, transposase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|166958554|gb|EDR55575.1| IS285, transposase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|166958774|gb|EDR55795.1| IS285, transposase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|166960213|gb|EDR56234.1| IS285, transposase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|166960223|gb|EDR56244.1| IS285, transposase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|166960268|gb|EDR56289.1| IS285, transposase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|166960275|gb|EDR56296.1| IS285, transposase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|166960335|gb|EDR56356.1| IS285, transposase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|166960847|gb|EDR56868.1| IS285, transposase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|166960877|gb|EDR56898.1| IS285, transposase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|166960887|gb|EDR56908.1| IS285, transposase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|166961223|gb|EDR57244.1| IS285, transposase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|166961992|gb|EDR58013.1| IS285, transposase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|166962047|gb|EDR58068.1| IS285, transposase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|166962065|gb|EDR58086.1| IS285, transposase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|166962087|gb|EDR58108.1| IS285, transposase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|166962138|gb|EDR58159.1| IS285, transposase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|166963203|gb|EDR59224.1| IS285, transposase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167048217|gb|EDR59625.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167048232|gb|EDR59640.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167048516|gb|EDR59924.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167048904|gb|EDR60312.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167049125|gb|EDR60533.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167049151|gb|EDR60559.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167049624|gb|EDR61032.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167049712|gb|EDR61120.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167049730|gb|EDR61138.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167050193|gb|EDR61601.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167050194|gb|EDR61602.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167050216|gb|EDR61624.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167050265|gb|EDR61673.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167050940|gb|EDR62348.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167051094|gb|EDR62502.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167051257|gb|EDR62665.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167051673|gb|EDR63081.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167051896|gb|EDR63304.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167053865|gb|EDR63697.1| IS285, transposase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167053980|gb|EDR63808.1| IS285, transposase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167054000|gb|EDR63828.1| IS285, transposase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167054080|gb|EDR63907.1| IS285, transposase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167054441|gb|EDR64253.1| IS285, transposase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167055046|gb|EDR64845.1| IS285, transposase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167056122|gb|EDR65900.1| IS285, transposase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167056274|gb|EDR66043.1| IS285, transposase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167056547|gb|EDR66316.1| IS285, transposase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167056653|gb|EDR66422.1| IS285, transposase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167056672|gb|EDR66441.1| IS285, transposase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167056705|gb|EDR66468.1| IS285, transposase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167057047|gb|EDR66810.1| IS285, transposase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167057096|gb|EDR66859.1| IS285, transposase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167057259|gb|EDR67005.1| IS285, transposase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|169749212|gb|ACA66730.1| transposase mutator type [Yersinia pseudotuberculosis YPIII] >gi|186696567|gb|ACC87196.1| transposase mutator type [Yersinia pseudotuberculosis PB1/+] >gi|186697885|gb|ACC88514.1| transposase mutator type [Yersinia pseudotuberculosis PB1/+] >gi|186698127|gb|ACC88756.1| transposase mutator type [Yersinia pseudotuberculosis PB1/+] >gi|186698906|gb|ACC89535.1| transposase mutator type [Yersinia pseudotuberculosis PB1/+] >gi|186700587|gb|ACC91215.1| transposase mutator type [Yersinia pseudotuberculosis PB1/+] (402 aa)
Score = 226, Expect = 1.5e-17, Identities = 45/122 (36%), Positives = 71/122 (58%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K +YQAP  + ++ AL  F E W  KY   +KSW  + E L TFF +P +IR+ IYTTN IE+VN  IR   K +    + +++ K++YL + + S+ W   + NW L + +  I F + +
  S:   277 LKMVYQAPTEEAALMALDKFAEAWDDKYPQISKSWRTHWENLNTFFGYPPDIRKAIYTTNAIESVNSVIRAAIKKRKVFPTDDSVRKVVYLAIKDASKKWSMPIQNWRLAMSRFIIEFGDRL 398
>gi|22127688|ref|NP_671111.1| transposase [Yersinia pestis KIM] >gi|108809522|ref|YP_653438.1| putative transposase [Yersinia pestis Antiqua] >gi|108810404|ref|YP_646171.1| transposase [Yersinia pestis Nepal516] >gi|166213676|ref|ZP_02239711.1| IS285, transposase [Yersinia pestis biovar Antiqua str. B42003004] >gi|167402110|ref|ZP_02307587.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167427030|ref|ZP_02318783.1| IS285, transposase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|21960805|gb|AAM87362.1|AE013984_8 putative transposase [Yersinia pestis KIM] >gi|108774052|gb|ABG16571.1| transposase [Yersinia pestis Nepal516] >gi|108781435|gb|ABG15493.1| putative transposase [Yersinia pestis Antiqua] >gi|166205078|gb|EDR49558.1| IS285, transposase [Yersinia pestis biovar Antiqua str. B42003004] >gi|167048485|gb|EDR59893.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167053957|gb|EDR63788.1| IS285, transposase [Yersinia pestis biovar Mediaevalis str. K1973002] (402 aa)
Score = 226, Expect = 1.5e-17, Identities = 45/122 (36%), Positives = 71/122 (58%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K +YQAP  + ++ AL  F E W  KY   +KSW  + E L TFF +P +IR+ IYTTN IE+VN  IR   K +    + +++ K++YL + + S+ W   + NW L + +  I F + +
  S:   277 LKMVYQAPTEEAALMALDKFAEAWDDKYPQISKSWRTHWENLNTFFGYPPDIRKAIYTTNAIESVNSVIRAAIKKRKVFPTDDSVRKVVYLAIKDASKKWSMPIQNWRLAMSRFIIEFGDRL 398
>gi|166212623|ref|ZP_02238658.1| transposase, Mutator family [Yersinia pestis biovar Antiqua str. B42003004] >gi|166206554|gb|EDR51034.1| transposase, Mutator family [Yersinia pestis biovar Antiqua str. B42003004] (272 aa)
Score = 226, Expect = 1.5e-17, Identities = 45/122 (36%), Positives = 71/122 (58%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K +YQAP  + ++ AL  F E W  KY   +KSW  + E L TFF +P +IR+ IYTTN IE+VN  IR   K +    + +++ K++YL + + S+ W   + NW L + +  I F + +
  S:   147 LKMVYQAPTEEAALMALDKFAEAWDDKYPQISKSWRTHWENLNTFFGYPPDIRKAIYTTNAIESVNSVIRAAIKKRKVFPTDDSVRKVVYLAIKDASKKWSMPIQNWRLAMSRFIIEFGDRL 268
>gi|49658889|emb|CAF28515.1| is285 transposase [Yersinia pseudotuberculosis] (402 aa)
Score = 226, Expect = 1.6e-17, Identities = 45/122 (36%), Positives = 71/122 (58%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K +YQAP  + ++ AL  F E W  KY   +KSW  + E L TFF +P +IR+ IYTTN IE+VN  IR   K +    + +++ K++YL + + S+ W   + NW L + +  I F + +
  S:   277 LKMVYQAPTEEAALMALDKFAEAWDDKYPQISKSWRTHWENLNTFFGYPPDIRKAIYTTNAIESVNSVIRAAIKKRKVFPTDDSVRKVVYLAIKDASKKWSMPIQNWRLAMSRFIIEFGDRL 398
>gi|71734517|ref|YP_273759.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71555070|gb|AAZ34281.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] (419 aa)
Score = 226, Expect = 1.6e-17, Identities = 45/118 (38%), Positives = 67/118 (56%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTE-KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           +K IYQA N DV+ + L  F    W  +Y     +W    + +  FF FPA IR+++Y TN IE++N  +RKI K +G   +  A +KLI+L L NI+ NW     +W + + Q  IL+
  S:   292 LKPIYQAINADVAEQELNAFEAGPWGKQYPTVVAAWRRAWDRVIPFFVFPAGIRKVVYMTNAIESINAQLRKIIKTRGHFPTDEAATKLIWLGLRNITANWGHAAHDWKVAMNQFAILY 410
>gi|115759367|ref|XP_001184078.1| PREDICTED: similar to transposase, Mutator family [Strongylocentrotus purpuratus] >gi|115947402|ref|XP_001193370.1| PREDICTED: similar to transposase, Mutator family [Strongylocentrotus purpuratus] (394 aa)
Score = 226, Expect = 1.7e-17, Identities = 46/122 (37%), Positives = 73/122 (59%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K IYQA   + ++K+L IF ++W+ +Y    +SW  N E + T F +PAEIR  IYTTN IE++N  IR  TK +   +S +++ K+IYL   N ++ W   + NW L +    I F++ +
  S:   269 LKAIYQASTEENALKSLDIFCDQWNHQYPKIGESWRANWENIRTIFSYPAEIRHAIYTTNAIESLNSVIRHSTKKRKIFSSDDSVKKVIYLATSNAAKKWTMPIQNWRLAMNWFTIQFDDRL 390
>gi|108793603|ref|YP_636759.1| transposase [Yersinia pestis Antiqua] >gi|167402259|ref|ZP_02307730.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|108782150|gb|ABG16207.1| transposase [Yersinia pestis Antiqua] >gi|167048361|gb|EDR59769.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] (402 aa)
Score = 226, Expect = 1.7e-17, Identities = 45/122 (36%), Positives = 71/122 (58%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K +YQAP  + ++ AL  F E W  KY   +KSW  + E L TFF +P +IR+ IYTTN IE+VN  IR   K +    + +++ K++YL + + S+ W   + NW L + +  I F + +
  S:   277 LKMVYQAPTEEAALMALDKFAEAWDDKYPQISKSWRTHWENLNTFFGYPPDIRKAIYTTNAIESVNSVIRAAIKKRKVFPTDDSVRKVVYLAIKDASKKWSMPIQNWRLAMSRFIIEFGDRL 398
>gi|71736031|ref|YP_273698.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71556584|gb|AAZ35795.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] (419 aa)
Score = 226, Expect = 1.7e-17, Identities = 45/118 (38%), Positives = 67/118 (56%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTE-KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           +K IYQA N DV+ + L  F    W  +Y     +W    + +  FF FPA IR+++Y TN IE++N  +RKI K +G   +  A +KLI+L L NI+ NW     +W + + Q  IL+
  S:   292 LKPIYQAINADVAEQELNAFEAGPWGKQYPTVVAAWRRAWDRVIPFFVFPAGIRKVVYMTNAIESINAQLRKIIKTRGHFPTDEAATKLIWLGLRNITANWGHAAHDWKVAMNQFAILY 410
>gi|45439877|ref|NP_991416.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|145601132|ref|YP_001165208.1| transposase for the IS285 insertion element [Yersinia pestis Pestoides F] >gi|45434732|gb|AAS60293.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|145212828|gb|ABP42235.1| transposase for the IS285 insertion element [Yersinia pestis Pestoides F] (402 aa)
Score = 225, Expect = 1.8e-17, Identities = 45/122 (36%), Positives = 71/122 (58%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K +YQAP  + ++ AL  F E W  KY   +KSW  + E L TFF +P +IR+ IYTTN IE+VN  IR   K +    + +++ K++YL + + S+ W   + NW L + +  I F + +
  S:   277 LKMVYQAPTEEAALMALDKFAEAWDDKYPQISKSWRTHWENLNTFFGYPPDIRKAIYTTNAIESVNSVIRAAIKKRKVFPTDDSVRKVVYLAIKDASKKWSMPIQNWRLAMSRFIIEFGDRL 398
>gi|71737692|ref|YP_277275.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71558245|gb|AAZ37456.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] (419 aa)
Score = 225, Expect = 1.8e-17, Identities = 45/118 (38%), Positives = 67/118 (56%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTE-KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           +K IYQA N DV+ + L  F    W  +Y     +W    + +  FF FPA IR+++Y TN IE++N  +RKI K +G   +  A +KLI+L L NI+ NW     +W + + Q  IL+
  S:   292 LKPIYQAINADVAEQELNAFEAGPWGKQYPTVVAAWRRAWDRVIPFFVFPAGIRKVVYMTNAIESINAQLRKIIKTRGHFPTDEAATKLIWLGLRNITANWGHAAHDWKVAMNQFAILY 410
>gi|71737316|ref|YP_272430.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71557869|gb|AAZ37080.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] (419 aa)
Score = 225, Expect = 2.0e-17, Identities = 45/118 (38%), Positives = 67/118 (56%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTE-KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           +K IYQA N DV+ + L  F    W  +Y     +W    + +  FF FPA IR+++Y TN IE++N  +RKI K +G   +  A +KLI+L L NI+ NW     +W + + Q  IL+
  S:   292 LKPIYQAINADVAEQELNAFEAGPWGKQYPTVVAAWRRAWDRVIPFFVFPAGIRKVVYMTNAIESINAQLRKIIKTRGHFPTDEAATKLIWLGLRNITANWGHAAHDWKVAMNQFAILY 410
>gi|28373056|ref|NP_783715.1| transposase [Yersinia enterocolitica] >gi|28302123|gb|AAO39032.1| transposase [Yersinia enterocolitica] (400 aa)
Score = 225, Expect = 2.0e-17, Identities = 52/122 (42%), Positives = 75/122 (61%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K +Y+A +   +  AL    EKW  +Y    +SW    E L+ +F++PA IR++IYTTN IE+V+R  RK+TK KG   + N+L KL+YLRL+N  E W   + +W L L QL I FE  +
  S:   273 LKPVYRAVSKVAAETALDELEEKWGQQYPVVLQSWRRKWENLSHYFRYPATIRKVIYTTNAIESVHRQFRKLTKTKGAFPNENSLLKLLYLRLMNAQEKWAMPIQSWNLTLSQLAIYFEGRL 394
>gi|108812325|ref|YP_648092.1| transposase [Yersinia pestis Nepal516] >gi|108775973|gb|ABG18492.1| transposase [Yersinia pestis Nepal516] (220 aa)
Score = 225, Expect = 2.1e-17, Identities = 45/122 (36%), Positives = 71/122 (58%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K +YQAP  + ++ AL  F E W  KY   +KSW  + E L TFF +P +IR+ IYTTN IE+VN  IR   K +    + +++ K++YL + + S+ W   + NW L + +  I F + +
  S:    95 LKMVYQAPTEEAALMALDKFAEAWDDKYPQISKSWRTHWENLNTFFGYPPDIRKAIYTTNAIESVNSVIRAAIKKRKVFPTDDSVRKVVYLAIKDASKKWSMPIQNWRLAMSRFIIEFGDRL 216
>gi|71733459|ref|YP_272361.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71554012|gb|AAZ33223.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] (419 aa)
Score = 225, Expect = 2.1e-17, Identities = 45/118 (38%), Positives = 67/118 (56%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTE-KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           +K IYQA N DV+ + L  F    W  +Y     +W    + +  FF FPA IR+++Y TN IE++N  +RKI K +G   +  A +KLI+L L NI+ NW     +W + + Q  IL+
  S:   292 LKPIYQAINADVAEQELNAFEAGPWGKQYPTVVAAWRRAWDRVIPFFVFPAGIRKVVYMTNAIESINAQLRKIIKTRGHFPTDEAATKLIWLGLRNITANWGHAAHDWKVAMNQFAILY 410
>gi|108811156|ref|YP_646923.1| transposase [Yersinia pestis Nepal516] >gi|108774804|gb|ABG17323.1| transposase [Yersinia pestis Nepal516] (203 aa)
Score = 224, Expect = 2.4e-17, Identities = 45/122 (36%), Positives = 71/122 (58%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K +YQAP  + ++ AL  F E W  KY   +KSW  + E L TFF +P +IR+ IYTTN IE+VN  IR   K +    + +++ K++YL + + S+ W   + NW L + +  I F + +
  S:    78 LKMVYQAPTEEAALMALDKFAEAWDDKYPQISKSWRTHWENLNTFFGYPPDIRKAIYTTNAIESVNSVIRAAIKKRKVFPTDDSVRKVVYLAIKDASKKWSMPIQNWRLAMSRFIIEFGDRL 199
>gi|149913235|ref|ZP_01901769.1| transposase, mutator type [Roseobacter sp. AzwK-3b] >gi|149813641|gb|EDM73467.1| transposase, mutator type [Roseobacter sp. AzwK-3b] (404 aa)
Score = 224, Expect = 2.7e-17, Identities = 46/118 (38%), Positives = 67/118 (56%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           +++IY AP  D++   L  F EKW+ KY     +W    +E+  FF F   IR++IYTTN IE++NR IRK  K +G   S  A +KLIYL + N  ++ ++ V  W     Q  I+F
  S:   282 LRRIYSAPTADMAETELDAFEEKWAGKYASIAPAWRRAWQEVIPFFGFDPAIRKIIYTTNAIESLNRVIRKSIKTRGSFPSDEAATKLIYLAIRNFEKDGRN-VREWFAARNQFAIMF 398
>gi|170722481|ref|YP_001750169.1| transposase mutator type [Pseudomonas putida W619] >gi|169760484|gb|ACA73800.1| transposase mutator type [Pseudomonas putida W619] (415 aa)
Score = 223, Expect = 2.9e-17, Identities = 46/118 (38%), Positives = 68/118 (57%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTE-KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           +K IYQA N + + +AL  F    W  +Y     +W    + +  FF FP  IR++IYTTN IE++N  +RKI K +G   + +A +KLI+L L NI+ NW S   +W   + Q  IL+
  S:   288 LKPIYQAINAEAAEQALDEFENGPWGKQYPTVVAAWRRAWDRVIPFFVFPPAIRKVIYTTNAIESINAQLRKIIKTRGHFPNDDAATKLIWLGLRNITANWGSAAHDWKSAMNQFAILY 406
>gi|24372299|ref|NP_716341.1| transposase mutator family protein [Shewanella oneidensis MR-1] >gi|24346232|gb|AAN53786.1|AE015516_8 transposase, mutator family [Shewanella oneidensis MR-1] (403 aa)
Score = 223, Expect = 3.1e-17, Identities = 42/122 (34%), Positives = 72/122 (59%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K IY A     +  AL+ F + W  ++   +KSW  N   L+ FF +P EIR++IYTTN IE++N ++R++TK +    S +A+ KL+YL L  I++ W   + +W   + Q  I++ + +
  S:   280 LKTIYGAATLQQAELALEQFAKTWDKQHPSISKSWRENWTRLSVFFDYPPEIRKVIYTTNAIESLNASLRQVTKTRRSFPSDDAVLKLLYLALHQIAKKWTMPLRDWKPAMTQFMIMYSDRV 401
>gi|148653847|ref|YP_001280940.1| transposase, mutator type [Psychrobacter sp. PRwf-1] >gi|148572931|gb|ABQ94990.1| transposase, mutator type [Psychrobacter sp. PRwf-1] (399 aa)
Score = 223, Expect = 3.3e-17, Identities = 43/118 (36%), Positives = 67/118 (56%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           +K +Y+A N + +  AL      W  +Y    KSW +    L+ +F++P  +R+ IYTTN +E V+R  RK+TK KG   +  +L KL+Y+ ++N S  W   + NWG  + QL I F
  S:   272 LKPVYKAVNKESAELALDDLEAVWGDQYPAVIKSWRDKWHLLSAYFKYPEAVRKPIYTTNAVEAVHRQFRKLTKTKGAFPNETSLLKLLYVGMLNASAKWTMPIRNWGQTMMQLSIYF 389
>gi|71735212|ref|YP_274306.1| ISPsy18, transposase, truncated [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71555765|gb|AAZ34976.1| ISPsy18, transposase, truncated [Pseudomonas syringae pv. phaseolicola 1448A] (224 aa)
Score = 223, Expect = 3.4e-17, Identities = 46/118 (38%), Positives = 68/118 (57%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTE-KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           +K IYQA N DV+ + L  F    W  +Y     +W    + +  FF FPA IR+++YTTN IE++N  +RKI K +G   +  A +KLI+L L NI+ NW     +W + + Q  IL+
  S:    97 LKPIYQAINADVAEQELNAFEAGPWGKQYPTVVAAWRRAWDRVIPFFVFPAGIRKVVYTTNAIESINAQLRKIIKTRGHFPTDEAATKLIWLGLRNITANWGHAAHDWKVAMNQFAILY 215
>gi|148973898|ref|ZP_01811431.1| transposase [Vibrionales bacterium SWAT-3] >gi|148974912|ref|ZP_01811892.1| transposase [Vibrionales bacterium SWAT-3] >gi|148974952|ref|ZP_01811932.1| transposase [Vibrionales bacterium SWAT-3] >gi|148975360|ref|ZP_01812284.1| transposase [Vibrionales bacterium SWAT-3] >gi|148976908|ref|ZP_01813563.1| transposase [Vibrionales bacterium SWAT-3] >gi|148977124|ref|ZP_01813764.1| transposase [Vibrionales bacterium SWAT-3] >gi|148977307|ref|ZP_01813921.1| transposase [Vibrionales bacterium SWAT-3] >gi|148977653|ref|ZP_01814229.1| transposase [Vibrionales bacterium SWAT-3] >gi|148977973|ref|ZP_01814525.1| transposase [Vibrionales bacterium SWAT-3] >gi|148978028|ref|ZP_01814575.1| transposase [Vibrionales bacterium SWAT-3] >gi|145962712|gb|EDK27986.1| transposase [Vibrionales bacterium SWAT-3] >gi|145962793|gb|EDK28066.1| transposase [Vibrionales bacterium SWAT-3] >gi|145963168|gb|EDK28436.1| transposase [Vibrionales bacterium SWAT-3] >gi|145963420|gb|EDK28684.1| transposase [Vibrionales bacterium SWAT-3] >gi|145963593|gb|EDK28855.1| transposase [Vibrionales bacterium SWAT-3] >gi|145963782|gb|EDK29042.1| transposase [Vibrionales bacterium SWAT-3] >gi|145965284|gb|EDK30534.1| transposase [Vibrionales bacterium SWAT-3] >gi|145965421|gb|EDK30670.1| transposase [Vibrionales bacterium SWAT-3] >gi|145965461|gb|EDK30710.1| transposase [Vibrionales bacterium SWAT-3] >gi|145965595|gb|EDK30843.1| transposase [Vibrionales bacterium SWAT-3] (402 aa)
Score = 222, Expect = 4.2e-17, Identities = 45/122 (36%), Positives = 72/122 (59%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +KKIYQ+   D ++ AL+ F++KW  KY   ++SW  +   L T F +P +IRR IYTTN IE++N  IRK  K +    +  +  K+I+L + + S+ W   + NW   L +  I+FE+ +
  S:   277 LKKIYQSKTEDEALLALEQFSDKWDDKYPQISRSWTAHWANLNTLFNYPEDIRRAIYTTNAIESLNSVIRKAIKKRKLFPTDESARKVIFLAIQDASKRWTMPIRNWRQALNRFMIMFEDRL 398
>gi|148975911|ref|ZP_01812700.1| transposase [Vibrionales bacterium SWAT-3] >gi|148976674|ref|ZP_01813361.1| transposase [Vibrionales bacterium SWAT-3] >gi|148979122|ref|ZP_01815330.1| transposase [Vibrionales bacterium SWAT-3] >gi|148980639|ref|ZP_01816143.1| transposase [Vibrionales bacterium SWAT-3] >gi|145961138|gb|EDK26455.1| transposase [Vibrionales bacterium SWAT-3] >gi|145961988|gb|EDK27277.1| transposase [Vibrionales bacterium SWAT-3] >gi|145964025|gb|EDK29283.1| transposase [Vibrionales bacterium SWAT-3] >gi|145964656|gb|EDK29909.1| transposase [Vibrionales bacterium SWAT-3] (402 aa)
Score = 222, Expect = 4.2e-17, Identities = 45/122 (36%), Positives = 72/122 (59%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +KKIYQ+   D ++ AL+ F++KW  KY   ++SW  +   L T F +P +IRR IYTTN IE++N  IRK  K +    +  +  K+I+L + + S+ W   + NW   L +  I+FE+ +
  S:   277 LKKIYQSKTEDEALLALEQFSDKWDDKYPQISRSWTAHWANLNTLFNYPEDIRRAIYTTNAIESLNSVIRKAIKKRKLFPTDESARKVIFLAIQDASKRWTMPIRNWRQALNRFMIMFEDRL 398
>gi|148977614|ref|ZP_01814190.1| transposase [Vibrionales bacterium SWAT-3] >gi|145963129|gb|EDK28397.1| transposase [Vibrionales bacterium SWAT-3] (401 aa)
Score = 222, Expect = 4.6e-17, Identities = 45/122 (36%), Positives = 72/122 (59%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +KKIYQ+   D ++ AL+ F++KW  KY   ++SW  +   L T F +P +IRR IYTTN IE++N  IRK  K +    +  +  K+I+L + + S+ W   + NW   L +  I+FE+ +
  S:   276 LKKIYQSKTEDEALLALEQFSDKWDDKYPQISRSWTAHWANLNTLFNYPEDIRRAIYTTNAIESLNSVIRKAIKKRKLFPTDESARKVIFLAIQDASKRWTMPIRNWRQALNRFMIMFEDRL 397
>gi|148978541|ref|ZP_01814993.1| transposase [Vibrionales bacterium SWAT-3] >gi|145962330|gb|EDK27611.1| transposase [Vibrionales bacterium SWAT-3] (402 aa)
Score = 222, Expect = 4.6e-17, Identities = 45/122 (36%), Positives = 72/122 (59%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +KKIYQ+   D ++ AL+ F++KW  KY   ++SW  +   L T F +P +IRR IYTTN IE++N  IRK  K +    +  +  K+I+L + + S+ W   + NW   L +  I+FE+ +
  S:   277 LKKIYQSKTEDEALLALEQFSDKWDDKYPQISRSWTAHWANLNTLFNYPEDIRRAIYTTNAIESLNSVIRKAIKKRKLFPTDESARKVIFLAIQDASKRWTMPIRNWRQALNRFMIMFEDRL 398
>gi|148974978|ref|ZP_01811958.1| transposase [Vibrionales bacterium SWAT-3] >gi|145965487|gb|EDK30736.1| transposase [Vibrionales bacterium SWAT-3] (347 aa)
Score = 222, Expect = 4.6e-17, Identities = 45/122 (36%), Positives = 72/122 (59%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +KKIYQ+   D ++ AL+ F++KW  KY   ++SW  +   L T F +P +IRR IYTTN IE++N  IRK  K +    +  +  K+I+L + + S+ W   + NW   L +  I+FE+ +
  S:   222 LKKIYQSKTEDEALLALEQFSDKWDDKYPQISRSWTAHWANLNTLFNYPEDIRRAIYTTNAIESLNSVIRKAIKKRKLFPTDESARKVIFLAIQDASKRWTMPIRNWRQALNRFMIMFEDRL 343
>gi|71736120|ref|YP_277145.1| ISPsy18, transposase, truncated [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71556673|gb|AAZ35884.1| ISPsy18, transposase, truncated [Pseudomonas syringae pv. phaseolicola 1448A] (295 aa)
Score = 221, Expect = 6.2e-17, Identities = 45/118 (38%), Positives = 67/118 (56%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTE-KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           +K IYQA N DV+ + L  F    W  +Y     +W    + +  FF FPA IR+++Y TN IE++N  +RKI K +G   +  A +KLI+L L NI+ NW     +W + + Q  IL+
  S:   168 LKPIYQAINADVAEQELNAFEAGPWGKQYPTVVAAWRRAWDRVIPFFVFPAGIRKVVYMTNAIESINAQLRKIIKTRGHFPTDEAATKLIWLGLRNITANWGHAAHDWKVAMNQFAILY 286
>gi|107022256|ref|YP_620583.1| transposase, mutator type [Burkholderia cenocepacia AU 1054] >gi|107026954|ref|YP_624465.1| transposase, mutator type [Burkholderia cenocepacia AU 1054] >gi|116689201|ref|YP_834824.1| transposase, mutator type [Burkholderia cenocepacia HI2424] >gi|116691849|ref|YP_837382.1| transposase, mutator type [Burkholderia cenocepacia HI2424] >gi|105892445|gb|ABF75610.1| transposase, mutator type [Burkholderia cenocepacia AU 1054] >gi|105896328|gb|ABF79492.1| transposase, mutator type [Burkholderia cenocepacia AU 1054] >gi|116647290|gb|ABK07931.1| transposase, mutator type [Burkholderia cenocepacia HI2424] >gi|116649849|gb|ABK10489.1| transposase, mutator type [Burkholderia cenocepacia HI2424] (416 aa)
Score = 221, Expect = 6.3e-17, Identities = 46/120 (38%), Positives = 69/120 (57%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTE-KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFEN 120
           +K IY AP+ + +   L  F +  W  K+   + +W N  + +  FF FP  +R++IYTTN IEN+N  +RKI K +G   S  A +KLI+L L NI+ NW S   +W   + Q  IL+ +
  S:   289 IKPIYAAPSAEAAQAELDAFADGPWGQKFPTVSSAWRNAWDRVIPFFAFPPGVRKIIYTTNAIENINSQLRKIIKTRGHFPSDEAATKLIWLALRNITANWGSAAHDWKTAMNQFAILYAD 409
>gi|26246249|ref|NP_752288.1| transposase [Escherichia coli CFT073] >gi|26106647|gb|AAN78832.1|AE016756_15 Putative Transposase within prophage [Escherichia coli CFT073] (374 aa)
Score = 220, Expect = 6.5e-17, Identities = 44/122 (36%), Positives = 71/122 (58%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K +YQAP  + ++ AL  F   W  KY   +KSW  + E L TFF +P +IR+ IYTTN IE++N  IR+  K +    + +++ K+IYL + + S+ W   + NW L + +  I F + +
  S:   249 LKAVYQAPTEEAALMALDKFAGVWDEKYPQISKSWRTHWENLNTFFGYPPDIRKAIYTTNAIESLNSVIRQAIKKRKVFPTDDSVRKVIYLAIQSASKKWSMPIQNWRLAMSRFIIEFGDRL 370
>gi|71725144|ref|YP_272140.1| ISPsy18, transposase, truncated [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71558734|gb|AAZ37944.1| ISPsy18, transposase, truncated [Pseudomonas syringae pv. phaseolicola 1448A] (202 aa)
Score = 220, Expect = 6.6e-17, Identities = 46/118 (38%), Positives = 68/118 (57%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTE-KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           +K IYQA N DV+ + L  F    W  +Y     +W    + +  FF FPA IR+++YTTN IE++N  +RKI K +G   +  A +KLI+L L NI+ NW     +W + + Q  IL+
  S:    75 LKPIYQAINADVAEQELNAFEAGPWGKQYPTVVAAWRRAWDRVIPFFVFPAGIRKVVYTTNAIESINAQLRKIIKTRGHFPTDEAATKLIWLGLRNITANWGHAAHDWKVAMNQFAILY 193
>gi|16519908|ref|NP_444028.1| Y4pO [Rhizobium sp. NGR234] >gi|2501307|sp|P55620|Y4PO_RHISN Probable transposase for insertion sequence element ISRM3-like >gi|2182585|gb|AAB91825.1| Y4pO [Rhizobium sp. NGR234] (400 aa)
Score = 220, Expect = 7.8e-17, Identities = 44/118 (37%), Positives = 66/118 (55%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEK-WSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           ++ IY+A + +  +KAL+ F E  W  KY   ++SW  N E +  FF FP  +RR+IYTTN IE +N  +R+  +++G      A  KL+YL L N +E WK     W     Q  ++F
  S:   276 LRAIYRARDAEAGLKALEAFEEGYWGQKYPAISQSWRRNWEHVVPFFAFPEGVRRIIYTTNAIEALNSKLRRAVRSRGHFPGDEAAMKLLYLVLNNAAEQWKRAPREWVEAKTQFAVIF 394
>gi|20145841|emb|CAD29300.1| putative transposase [Pseudomonas syringae pv. glycinea] (171 aa)
Score = 220, Expect = 8.3e-17, Identities = 46/118 (38%), Positives = 68/118 (57%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTE-KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           +K IYQA N DV+ + L  F    W  +Y     +W    + +  FF FPA IR+++YTTN IE++N  +RKI K +G   +  A +KLI+L L NI+ NW     +W + + Q  IL+
  S:    44 LKPIYQAINADVAEQELNAFEAGPWGKQYPTVVAAWRRAWDRVIPFFVFPAGIRKVVYTTNAIESINAQLRKIIKTRGHFPTDEAATKLIWLGLRNITANWGHAAHDWKVAMNQFAILY 162
>gi|31790976|ref|NP_857611.1| hypothetical protein pEJ30_p02 [Erwinia sp. Ejp 556] >gi|31580582|gb|AAP51293.1| TnpA [Erwinia sp. Ejp 556] (402 aa)
Score = 219, Expect = 9.3e-17, Identities = 44/122 (36%), Positives = 71/122 (58%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K +YQAP  + ++ AL  F   W  KY   +KSW  + + L TFF +PA+IR+ IYTTN IE++N  IR   K +    + +++ K+IYL + + S+ W   + NW L + +  I F + +
  S:   277 LKTVYQAPTEEAALMALDKFAGIWDEKYPQISKSWRTHWKNLNTFFGYPADIRKAIYTTNAIESLNSVIRAAIKKRKVFPTDDSVRKVIYLAIKDASKKWSMPIQNWRLAMSRFIIEFGDRL 398
>gi|29345433|ref|NP_808936.1| transposase [Bacteroides thetaiotaomicron VPI-5482] >gi|29337325|gb|AAO75130.1| transposase [Bacteroides thetaiotaomicron VPI-5482] (121 aa)
Score = 219, Expect = 9.6e-17, Identities = 50/99 (50%), Positives = 62/99 (62%)
  Q:    20 FTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
             EKW  KY    KSW +N E+LT +FQF ++IRR+IYTTN IE  +R IRK+TK KG   +   L KL+YL   NI + W   +ANW  I QQL I F
  S:    16 LNEKWEEKYPIVIKSWQDNWEKLTEYFQFTSDIRRMIYTTNTIEGYHRQIRKVTKNKGVFPNDTTLEKLVYLAYRNIRKKWTMPLANWEAITQQLAIKF 114
>gi|108811601|ref|YP_647368.1| transposase [Yersinia pestis Nepal516] >gi|108775249|gb|ABG17768.1| transposase [Yersinia pestis Nepal516] (146 aa)
Score = 219, Expect = 9.9e-17, Identities = 45/122 (36%), Positives = 71/122 (58%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K +YQAP  + ++ AL  F E W  KY   +KSW  + E L TFF +P +IR+ IYTTN IE+VN  IR   K +    + +++ K++YL + + S+ W   + NW L + +  I F + +
  S:    21 LKMVYQAPTEEAALMALDKFAEAWDDKYPQISKSWRTHWENLNTFFGYPPDIRKAIYTTNAIESVNSVIRAAIKKRKVFPTDDSVRKVVYLAIKDASKKWSMPIQNWRLAMSRFIIEFGDRL 142
>gi|150378034|ref|YP_001314629.1| transposase mutator type [Sinorhizobium medicae WSM419] >gi|150032581|gb|ABR64696.1| transposase mutator type [Sinorhizobium medicae WSM419] (400 aa)
Score = 219, Expect = 1.1e-16, Identities = 44/118 (37%), Positives = 65/118 (55%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEK-WSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           ++ IY+A + +  +KAL+ F E  W  KY    +SW  N E +  FF FP  +RR+IYTTN IE +N  +R+  +++G      A  KL+YL L N +E WK     W     Q  ++F
  S:   276 LRAIYRARDAEAGLKALEAFEEGYWGQKYPAIAQSWRRNWEHVVPFFAFPEGVRRIIYTTNAIEALNSKLRRAVRSRGHFPGDEAAMKLLYLVLNNAAEQWKRAPREWVEAKTQFAVIF 394
>gi|15963917|ref|NP_384270.1| transposase ISRM3 [Sinorhizobium meliloti 1021] >gi|15965775|ref|NP_386128.1| transposase ISRM3 [Sinorhizobium meliloti 1021] >gi|15966732|ref|NP_387085.1| transposase ISRM3 [Sinorhizobium meliloti 1021] >gi|16262658|ref|NP_435451.1| TRm3 transposase [Sinorhizobium meliloti 1021] >gi|16262693|ref|NP_435486.1| TRm3 transposase [Sinorhizobium meliloti 1021] >gi|16262808|ref|NP_435601.1| TRm3 transposase [Sinorhizobium meliloti 1021] >gi|16263195|ref|NP_435988.1| TRm3 transposase [Sinorhizobium meliloti 1021] >gi|136132|sp|P80011|TRA3_RHIME Transposase for insertion sequence element ISRM3 >gi|149112|gb|AAA98142.1| transposase [Sinorhizobium meliloti] >gi|14523278|gb|AAK64863.1| TRm3 transposase [Sinorhizobium meliloti 1021] >gi|14523317|gb|AAK64898.1| TRm3 transposase [Sinorhizobium meliloti 1021] >gi|14523442|gb|AAK65013.1| TRm3 transposase [Sinorhizobium meliloti 1021] >gi|14523863|gb|AAK65400.1| TRm3 transposase [Sinorhizobium meliloti 1021] >gi|15073092|emb|CAC41551.1| Transposase for insertion sequence element ISRm3 [Sinorhizobium meliloti 1021] >gi|15075044|emb|CAC46601.1| Transposase for insertion sequence element ISRm3 [Sinorhizobium meliloti 1021] >gi|15076004|emb|CAC47558.1| Transposase for insertion sequence element ISRm3 [Sinorhizobium meliloti 1021] (400 aa)
Score = 218, Expect = 1.2e-16, Identities = 44/118 (37%), Positives = 65/118 (55%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEK-WSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           ++ IY+A + +  +KAL+ F E  W  KY    +SW  N E +  FF FP  +RR+IYTTN IE +N  +R+  +++G      A  KL+YL L N +E WK     W     Q  ++F
  S:   276 LRAIYRARDAEAGLKALEAFEEGYWGQKYPAIAQSWRRNWEHVVPFFAFPEGVRRIIYTTNAIEALNSKLRRAVRSRGHFPGDEAAMKLLYLVLNNAAEQWKRAPREWVEAKTQFAVIF 394
>gi|46323|emb|CAA45248.1| transposase [Sinorhizobium meliloti] (400 aa)
Score = 218, Expect = 1.2e-16, Identities = 44/118 (37%), Positives = 65/118 (55%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEK-WSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           ++ IY+A + +  +KAL+ F E  W  KY    +SW  N E +  FF FP  +RR+IYTTN IE +N  +R+  +++G      A  KL+YL L N +E WK     W     Q  ++F
  S:   276 LRAIYRARDAEAGLKALEAFEEGYWGQKYPAIAQSWRRNWEHVVPFFAFPEGVRRIIYTTNAIEALNSKLRRAVRSRGHFPGDEAAMKLLYLVLNNAAEQWKRAPREWVEAKTQFAVIF 394
>gi|90309326|gb|ABD93710.1| TnpA [Edwardsiella ictaluri] >gi|162404915|gb|ABX88888.1| transposase [Edwardsiella ictaluri] (413 aa)
Score = 217, Expect = 1.6e-16, Identities = 42/122 (34%), Positives = 69/122 (56%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K IYQAP  D    AL+ F   W ++Y   ++SW  N   L TFF +PA+IR++IYTTN IE++N  IR   K +    +  A+ K+++L +   S+ W   + +W + + +  I F + +
  S:   288 LKAIYQAPTEDAGQHALEAFASAWDNRYPQISRSWQTNWANLATFFAYPADIRKVIYTTNAIESLNSVIRHAIKKRKVFPTDEAVKKVVWLAIQAASQKWTMPLRDWRMAMSRFIIEFGDRL 409
>gi|71733218|ref|YP_275646.1| ISPsy18, transposase, truncated [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71553771|gb|AAZ32982.1| ISPsy18, transposase, truncated [Pseudomonas syringae pv. phaseolicola 1448A] (227 aa)
Score = 217, Expect = 1.7e-16, Identities = 45/118 (38%), Positives = 67/118 (56%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTE-KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           +K IYQA N DV+ + L  F    W  +Y     +W    + +  FF FPA IR+++Y TN IE++N  +RKI K +G   +  A +KLI+L L NI+ NW     +W + + Q  IL+
  S:   100 LKPIYQAINADVAEQELNAFEAGPWGKQYPTVVAAWRRAWDRVIPFFVFPAGIRKVVYMTNAIESINAQLRKIIKTRGHFPTDEAATKLIWLGLRNITANWGHAAHDWKVAMNQFAILY 218
>gi|93005785|ref|YP_580222.1| transposase, mutator type [Psychrobacter cryohalolentis K5] >gi|92393463|gb|ABE74738.1| transposase, mutator type [Psychrobacter cryohalolentis K5] (259 aa)
Score = 217, Expect = 1.8e-16, Identities = 46/122 (37%), Positives = 67/122 (54%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K IY A   +++   L+ F E W  KY +  KSW NN E LT FF +P +IR++IYTTN IE++N  IR     +    S  A  K++YL     S+ W   + NW   L +  I+F++ I
  S:   133 LKAIYGADTIEIAEANLEHFDEVWGDKYPHVIKSWRNNWEGLTVFFGYPKDIRKVIYTTNAIESLNSVIRTAVNKRKVFPSDQAAFKVVYLATQQASKKWSMPIRNWTSALNRFMIMFDDRI 254
>gi|71065104|ref|YP_263831.1| transposase mutator family protein [Psychrobacter arcticus 273-4] >gi|71038089|gb|AAZ18397.1| transposase, mutator family [Psychrobacter arcticus 273-4] (402 aa)
Score = 217, Expect = 1.9e-16, Identities = 45/122 (36%), Positives = 65/122 (53%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K IY A   +++   L+ F E W   Y +  KSW NN E LT FF +P +IR+ IYTTN IE++N  IR     +    S  A  K++YL     S+ W   + NW   L +  I+F++ I
  S:   278 LKAIYGADTIELAQANLEHFDETWGKNYPHVVKSWRNNWEGLTVFFNYPKDIRKAIYTTNAIESLNSVIRTAVNKRKVFPSDQAAFKVVYLATQQASKKWSMPIRNWTSALNRFMIMFDDRI 399
>gi|71065445|ref|YP_264172.1| transposase mutator family protein [Psychrobacter arcticus 273-4] >gi|71066537|ref|YP_265264.1| transposase mutator family protein [Psychrobacter arcticus 273-4] >gi|71038430|gb|AAZ18738.1| transposase, mutator family [Psychrobacter arcticus 273-4] >gi|71039522|gb|AAZ19830.1| transposase, mutator family [Psychrobacter arcticus 273-4] (404 aa)
Score = 216, Expect = 2.0e-16, Identities = 45/122 (36%), Positives = 65/122 (53%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K IY A   +++   L+ F E W   Y +  KSW NN E LT FF +P +IR+ IYTTN IE++N  IR     +    S  A  K++YL     S+ W   + NW   L +  I+F++ I
  S:   278 LKAIYGADTIELAQANLEHFDETWGKNYPHVVKSWRNNWEGLTVFFNYPKDIRKAIYTTNAIESLNSVIRTAVNKRKVFPSDQAAFKVVYLATQQASKKWSMPIRNWTSALNRFMIMFDDRI 399
>gi|187925389|ref|YP_001897031.1| transposase mutator type [Burkholderia phytofirmans PsJN] >gi|187716583|gb|ACD17807.1| transposase mutator type [Burkholderia phytofirmans PsJN] (425 aa)
Score = 216, Expect = 2.2e-16, Identities = 47/118 (39%), Positives = 67/118 (56%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTE-KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           ++ IY A N   + +AL+ F E +W +KY    +SW    E +T FF FP EIRR+IYTTN IE++N  +RKI K +G   +  A  KL++L L N+         +W   + Q  ILF
  S:   298 LRPIYTAANELAARQALEAFAEGQWGTKYPTIVQSWRRAWENVTPFFVFPPEIRRVIYTTNAIESLNMQLRKIIKTRGHFPNDEAAIKLLWLALRNVLAKSVRTTFDWKSAMNQFAILF 416
>gi|153815093|ref|ZP_01967761.1| hypothetical protein RUMTOR_01317 [Ruminococcus torques ATCC 27756] >gi|153815651|ref|ZP_01968319.1| hypothetical protein RUMTOR_01887 [Ruminococcus torques ATCC 27756] >gi|145847082|gb|EDK24000.1| hypothetical protein RUMTOR_01887 [Ruminococcus torques ATCC 27756] >gi|145847661|gb|EDK24579.1| hypothetical protein RUMTOR_01317 [Ruminococcus torques ATCC 27756] (425 aa)
Score = 216, Expect = 2.2e-16, Identities = 41/122 (33%), Positives = 71/122 (58%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K IYQA +   ++ AL    EKW++KY  + K W +N + ++  F+F A +R++IYTTN IE++N   RK+ + +    S  AL K +YL     ++ W + + NW  +  +L I++E  +
  S:   302 LKTIYQAADEKKALAALDRVMEKWTAKYPNSMKRWKDNWDAISPIFKFSAAVRKVIYTTNAIESLNSTYRKLNRQRSVFPSDTALLKALYLATFEATKKWTATIRNWAQVYGELSIMYEGRL 423
>gi|93005758|ref|YP_580195.1| transposase, mutator type [Psychrobacter cryohalolentis K5] >gi|92393436|gb|ABE74711.1| transposase, mutator type [Psychrobacter cryohalolentis K5] (259 aa)
Score = 215, Expect = 2.6e-16, Identities = 45/122 (36%), Positives = 67/122 (54%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K IY A   +++   L+ F E W  +Y +  KSW NN E LT FF +P +IR++IYTTN IE++N  IR     +    S  A  K++YL     S+ W   + NW   L +  I+F++ I
  S:   133 LKAIYGADTIEIAEANLEHFDETWGKEYPHVVKSWRNNWEGLTVFFGYPKDIRKVIYTTNAIESLNSVIRTAVNKRKVFPSDQAAFKVVYLATQQASKKWSMPIRNWTSALNRFMIMFDDRI 254
>gi|193070420|ref|ZP_03051361.1| IS1414, transposase [Escherichia coli E110019] >gi|192956239|gb|EDV86701.1| IS1414, transposase [Escherichia coli E110019] (402 aa)
Score = 215, Expect = 2.7e-16, Identities = 41/122 (33%), Positives = 71/122 (58%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K IYQAP  +   +AL+ F   W S+Y   ++SW  N   L TFF +PA+IR++IYTTN IE++N  IR   K +    + +++ K+++L +   S+ W   + +W + + +  I F + +
  S:   277 LKAIYQAPTEEAGQQALEAFASAWDSRYPQISRSWQANWTNLATFFAYPADIRKVIYTTNAIESLNSVIRPAIKKRKVFPTDDSVKKVVWLAIQAASQKWTMPLRDWRMAMSRFIIEFGDRL 398
>gi|187924835|ref|YP_001896477.1| transposase mutator type [Burkholderia phytofirmans PsJN] >gi|187716029|gb|ACD17253.1| transposase mutator type [Burkholderia phytofirmans PsJN] (425 aa)
Score = 215, Expect = 3.2e-16, Identities = 47/118 (39%), Positives = 67/118 (56%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTE-KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           ++ IY A N   + +AL+ F E +W +KY    +SW    E +T FF FP EIRR+IYTTN IE++N  +RKI K +G   +  A  KL++L L N+         +W   + Q  ILF
  S:   298 LRPIYTAVNELAARQALEAFAEGQWGTKYPTIVQSWRRAWENVTPFFVFPPEIRRVIYTTNAIESLNMQLRKIIKTRGHFPNDEAAIKLLWLALRNVLAKSVRTTFDWKSAMNQFAILF 416
>gi|187922787|ref|YP_001894429.1| transposase mutator type [Burkholderia phytofirmans PsJN] >gi|187923569|ref|YP_001895211.1| transposase mutator type [Burkholderia phytofirmans PsJN] >gi|187713981|gb|ACD15205.1| transposase mutator type [Burkholderia phytofirmans PsJN] >gi|187714763|gb|ACD15987.1| transposase mutator type [Burkholderia phytofirmans PsJN] (425 aa)
Score = 214, Expect = 3.4e-16, Identities = 47/118 (39%), Positives = 67/118 (56%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTE-KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           ++ IY A N   + +AL+ F E +W +KY    +SW    E +T FF FP EIRR+IYTTN IE++N  +RKI K +G   +  A  KL++L L N+         +W   + Q  ILF
  S:   298 LRPIYTAVNELAARQALEAFAEGQWGTKYPTIVQSWRRAWENVTPFFVFPPEIRRVIYTTNAIESLNMQLRKIIKTRGHFPNDEAAIKLLWLALRNVLAKSVRTTFDWKSAMNQFAILF 416
>gi|187924286|ref|YP_001895928.1| transposase mutator type [Burkholderia phytofirmans PsJN] >gi|187715480|gb|ACD16704.1| transposase mutator type [Burkholderia phytofirmans PsJN] (425 aa)
Score = 214, Expect = 3.5e-16, Identities = 47/118 (39%), Positives = 67/118 (56%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTE-KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           ++ IY A N   + +AL+ F E +W +KY    +SW    E +T FF FP EIRR+IYTTN IE++N  +RKI K +G   +  A  KL++L L N+         +W   + Q  ILF
  S:   298 LRPIYTAVNELAARQALEAFAEGQWGTKYPTIVQSWRRAWENVTPFFVFPPEIRRVIYTTNAIESLNMQLRKIIKTRGHFPNDEAAIKLLWLALRNVLAKSVRTTFDWKSAMNQFAILF 416
>gi|84687369|ref|ZP_01015248.1| Transposase, mutator family protein [Rhodobacterales bacterium HTCC2654] >gi|84664666|gb|EAQ11151.1| Transposase, mutator family protein [Rhodobacterales bacterium HTCC2654] (404 aa)
Score = 214, Expect = 3.7e-16, Identities = 44/118 (37%), Positives = 65/118 (55%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           ++ IY+AP    + + L  F EKW  KY     +W     E+T F+ F A IR++IYTTN +E++NR +RK  K KG   +  A +KLI+L + N  +  +  V  W     QL I+F
  S:   282 LRPIYEAPTAGEAERQLDTFEEKWGGKYPSIAPAWRRAWAEVTPFYAFSAAIRKIIYTTNAVESLNRVLRKTLKTKGSFPTEEAATKLIFLAIRNFEKGGRG-VREWVAARNQLAIMF 398
>gi|148551055|ref|YP_001260485.1| transposase, mutator type [Sphingomonas wittichii RW1] >gi|148503466|gb|ABQ71718.1| transposase, mutator type [Sphingomonas wittichii RW1] (407 aa)
Score = 213, Expect = 4.9e-16, Identities = 44/118 (37%), Positives = 65/118 (55%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTE-KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           +K+IY+A + D + KAL  F    W  +Y    +SW     E+  FF FP E+RR+IYTTN IE +N  +R+  +A+G   S  A +KL+YL L    + WK     W +   Q  ++F
  S:   279 LKEIYRATDADAAEKALTAFEAGPWGQRYPAIGQSWRRAWGEVIPFFAFPDEVRRIIYTTNAIEALNSKLRRAVRARGHFPSDEAATKLLYLILNRSEKEWKMPPREWTMAKAQFAVIF 397
>gi|138894303|ref|YP_001124756.1| transposase [Geobacillus thermodenitrificans NG80-2] >gi|138894437|ref|YP_001124890.1| transposase [Geobacillus thermodenitrificans NG80-2] >gi|134265816|gb|ABO66011.1| Transposase (04) [Geobacillus thermodenitrificans NG80-2] >gi|134265950|gb|ABO66145.1| Transposase (04) [Geobacillus thermodenitrificans NG80-2] (389 aa)
Score = 213, Expect = 5.2e-16, Identities = 40/103 (38%), Positives = 64/103 (62%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSR 103
           +K IY++PN +++++  + F  KWS KY  A +SW N ++ L TF  +P+ IR +IYTTN IE   + IRK  K    ++S+ A  K++YL + + +E W  R
  S:   266 LKLIYRSPNKEIALEMFQQFQSKWSHKYPRAVQSWANELDVLLTFMDYPSSIRSVIYTTNAIERTIKEIRKRLKPMNSLSSLEAAEKVVYLTIQDFNEKWAGR 368
>gi|138895217|ref|YP_001125670.1| transposase [Geobacillus thermodenitrificans NG80-2] >gi|134266730|gb|ABO66925.1| Transposase (04) [Geobacillus thermodenitrificans NG80-2] (389 aa)
Score = 213, Expect = 5.2e-16, Identities = 40/103 (38%), Positives = 64/103 (62%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSR 103
           +K IY++PN +++++  + F  KWS KY  A +SW N ++ L TF  +P+ IR +IYTTN IE   + IRK  K    ++S+ A  K++YL + + +E W  R
  S:   266 LKLIYRSPNKEIALEMFQQFQSKWSHKYPRAVQSWANELDVLLTFMDYPSSIRSVIYTTNAIERTIKEIRKRLKPMNSLSSLEAAEKVVYLTIQDFNEKWAGR 368
>gi|149912433|ref|ZP_01900967.1| transposase, mutator type [Roseobacter sp. AzwK-3b] >gi|149812839|gb|EDM72665.1| transposase, mutator type [Roseobacter sp. AzwK-3b] (240 aa)
Score = 212, Expect = 6.0e-16, Identities = 45/118 (38%), Positives = 67/118 (56%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           +++IY AP  D++   L  F EKW+ KY     +W    +E+  FF F   IR++IYTTN IE++NR IRK  K +G   +  A +KLIYL + N  ++ ++ V  W     Q  I+F
  S:   118 LRRIYSAPTADMAETELDAFEEKWAGKYASIAPAWRRAWQEVIPFFGFDPAIRKIIYTTNAIESLNRVIRKSIKTRGSFPTDEAATKLIYLAIRNFEKDGRN-VREWFAARNQFAIMF 234
>gi|16262980|ref|NP_435773.1| TRm3 putative transposase [Sinorhizobium meliloti 1021] >gi|14523630|gb|AAK65185.1| TRm3 transposase fragment [Sinorhizobium meliloti 1021] (262 aa)
Score = 212, Expect = 6.3e-16, Identities = 44/118 (37%), Positives = 65/118 (55%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEK-WSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           ++ IY+A + +  +KAL+ F E  W  KY    +SW  N E +  FF FP  +RR+IYTTN IE +N  +R+  +++G      A  KL+YL L N +E WK     W     Q  ++F
  S:   138 LRAIYRARDAEAGLKALEAFEEGYWGQKYPAIAQSWRRNWEHVVPFFAFPEGVRRIIYTTNAIEALNSKLRRAVRSRGHFPGDEAAMKLLYLVLNNAAEQWKRAPREWVEAKTQFAVIF 256
>gi|82775610|ref|YP_401957.1| transposase [Shigella dysenteriae Sd197] >gi|81239758|gb|ABB60468.1| Putative Transposase within prophage [Shigella dysenteriae Sd197] (220 aa)
Score = 212, Expect = 6.4e-16, Identities = 43/122 (35%), Positives = 70/122 (57%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K +YQAP  + ++  L  F   W  KY   +KSW  + E L TFF +P +IR+ IYTTN IE++N  IR+  K +    + +++ K+IYL + + S+ W   + NW L + +  I F + +
  S:    95 LKAVYQAPTEEAALMTLDKFAGVWDEKYPQISKSWRTHWENLNTFFGYPPDIRKAIYTTNAIESLNSVIRQAIKKRKVFPTDDSVRKVIYLAIQSASKKWSMPIQNWRLAMSRFIIEFGDRL 216
>gi|50512913|gb|AAT77725.1| putative transposase [Edwardsiella ictaluri] (162 aa)
Score = 210, Expect = 9.5e-16, Identities = 42/122 (34%), Positives = 69/122 (56%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K IYQAP  D    AL+ F   W ++Y   ++SW  N   L TFF +PA+IR++IYTTN IE++N  IR   K +    +  A+ K+++L +   S+ W   + +W + + +  I F + +
  S:    37 LKAIYQAPTEDAGQHALEAFASAWDNRYPQISRSWQTNWANLATFFAYPADIRKVIYTTNAIESLNSVIRHAIKKRKVFPTDEAVKKVVWLAIQAASQKWTMPLRDWRMAMSRFIIEFGDRL 158
>gi|10567527|gb|AAG18473.1|AF143819_2 transposase-like protein; TnpA [Escherichia coli] (402 aa)
Score = 210, Expect = 9.8e-16, Identities = 40/122 (32%), Positives = 70/122 (57%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K IYQAP  +   +AL+ F   W S+Y   ++SW  N   L TFF +P +IR++IYTTN IE++N  IR   K +    + +++ K+++L + + S  W   + +W + + +  I F + +
  S:   277 LKAIYQAPTEEAGQQALEAFAAAWDSRYPQISRSWQANWPNLATFFAYPTDIRKVIYTTNAIESLNSVIRHAIKKRKVFPTDDSVKKVVWLAIQSASRKWTMPLKDWRMAMSRFIIEFGDRL 398
>gi|33334431|gb|AAQ12271.1| transposase; TnpA [primary endosymbiont of Sitophilus zeamais] (397 aa)
Score = 210, Expect = 1.1e-15, Identities = 40/118 (33%), Positives = 69/118 (58%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           +K IYQAP  +  ++AL+ F+  W  +Y   ++SW  N   L TFF +P +IR++IYTTN IE++N  IR   K +    + +A+ K+++L +   S+ W   + +W + + +  I F
  S:   277 LKAIYQAPTEEAGLQALEAFSSAWDIRYPQISRSWQANWANLATFFAYPTDIRKVIYTTNAIESLNSVIRHAIKKRKVFPTDDAVKKVVWLAIQAASQKWTMPLRDWRIAMSRFIIEF 394
>gi|153810304|ref|ZP_01962972.1| hypothetical protein RUMOBE_00685 [Ruminococcus obeum ATCC 29174] >gi|149833483|gb|EDM88564.1| hypothetical protein RUMOBE_00685 [Ruminococcus obeum ATCC 29174] (186 aa)
Score = 209, Expect = 1.3e-15, Identities = 42/122 (34%), Positives = 70/122 (57%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K IYQA +   ++ AL+  TEKW+ KY  + K W +N + ++  F+F   +R +IYTTN IE++N   RK+ + +    S  AL K +YL     ++ W S + NW  +  +L I++E  +
  S:    63 LKTIYQATDEKKALAALERVTEKWTPKYPNSMKRWKDNWDSISPIFKFSTTVRTVIYTTNAIESLNSTYRKLNRQRSVFPSDTALLKALYLATFEATKKWTSTIRNWAQVYGELSIMYEGRL 184
>gi|84060940|ref|YP_444152.1| putative transposase [Escherichia coli] >gi|76782008|gb|ABA54778.1| putative transposase [Escherichia coli] (259 aa)
Score = 209, Expect = 1.4e-15, Identities = 40/122 (32%), Positives = 71/122 (58%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K IYQAP  +   +AL+ F   W S+Y   ++SW  N   L TFF +P +IR++IYTTN IE++N  IR   K +    + +++ K+++L + + S+ W   + +W + + +  I F + +
  S:   134 LKAIYQAPTEEAGQQALEAFAAAWDSRYPQISRSWQANWPNLATFFAYPTDIRKVIYTTNAIESLNSVIRHAIKKRKVFPTDDSVKKVVWLAIQSASQKWTMPLKDWRMAMSRFIIEFGDRL 255
>gi|15801523|ref|NP_287540.1| putative transposase within CP-933O; partial [Escherichia coli O157:H7 EDL933] >gi|12515028|gb|AAG56152.1|AE005345_14 putative transposase within CP-933O; partial [Escherichia coli O157:H7 EDL933] (293 aa)
Score = 209, Expect = 1.5e-15, Identities = 40/122 (32%), Positives = 70/122 (57%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K IYQAP  +   +AL+ F   W S+Y   ++SW  N   L  FF +PA+IR++IYTTN IE++N  IR   K +    + +++ K+++L +   S+ W   + +W + + +  I F + +
  S:   168 LKAIYQAPTEEAGQQALEAFASAWDSRYPQISRSWQANWTNLAMFFAYPADIRKVIYTTNAIESLNSVIRHAIKKRKVFPTDDSVKKVVWLAIQAASQKWTMPLRDWRMAMSRFIIEFGDRL 289
>gi|15831475|ref|NP_310248.1| putative transposase [Escherichia coli O157:H7 str. Sakai] >gi|168712690|ref|ZP_02744967.1| putative transposase within CP-933O; partial [Escherichia coli O157:H7 str. EC4045] >gi|168721826|ref|ZP_02754103.1| putative transposase within CP-933O; partial [Escherichia coli O157:H7 str. EC4206] >gi|168739132|ref|ZP_02771409.1| putative transposase within CP-933O; partial [Escherichia coli O157:H7 str. EC4115] >gi|168751521|ref|ZP_02776543.1| transposase, Mutator family [Escherichia coli O157:H7 str. EC4113] >gi|168758043|ref|ZP_02783050.1| transposase, Mutator family [Escherichia coli O157:H7 str. EC4401] >gi|168764926|ref|ZP_02789933.1| transposase, Mutator family [Escherichia coli O157:H7 str. EC4501] >gi|168771751|ref|ZP_02796758.1| transposase, Mutator family [Escherichia coli O157:H7 str. EC4486] >gi|168774156|ref|ZP_02799163.1| transposase, Mutator family [Escherichia coli O157:H7 str. EC4196] >gi|168781588|ref|ZP_02806595.1| transposase, Mutator family [Escherichia coli O157:H7 str. EC4076] >gi|168796443|ref|ZP_02821450.1| putative transposase within CP-933O; partial [Escherichia coli O157:H7 str. EC4042] >gi|168802177|ref|ZP_02827184.1| transposase, Mutator family [Escherichia coli O157:H7 str. EC508] >gi|195940374|ref|ZP_03085756.1| putative transposase [Escherichia coli O157:H7 str. EC4024] >gi|13361687|dbj|BAB35644.1| putative transposase [Escherichia coli O157:H7 str. Sakai] >gi|187770130|gb|EDU33974.1| transposase, Mutator family [Escherichia coli O157:H7 str. EC4196] >gi|188014476|gb|EDU52598.1| transposase, Mutator family [Escherichia coli O157:H7 str. EC4113] >gi|189000897|gb|EDU69883.1| transposase, Mutator family [Escherichia coli O157:H7 str. EC4076] >gi|189355097|gb|EDU73516.1| transposase, Mutator family [Escherichia coli O157:H7 str. EC4401] >gi|189359563|gb|EDU77982.1| transposase, Mutator family [Escherichia coli O157:H7 str. EC4486] >gi|189365168|gb|EDU83584.1| transposase, Mutator family [Escherichia coli O157:H7 str. EC4501] >gi|189375791|gb|EDU94207.1| transposase, Mutator family [Escherichia coli O157:H7 str. EC508] (289 aa)
Score = 208, Expect = 1.6e-15, Identities = 40/122 (32%), Positives = 70/122 (57%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K IYQAP  +   +AL+ F   W S+Y   ++SW  N   L  FF +PA+IR++IYTTN IE++N  IR   K +    + +++ K+++L +   S+ W   + +W + + +  I F + +
  S:   164 LKAIYQAPTEEAGQQALEAFASAWDSRYPQISRSWQANWTNLAMFFAYPADIRKVIYTTNAIESLNSVIRHAIKKRKVFPTDDSVKKVVWLAIQAASQKWTMPLRDWRMAMSRFIIEFGDRL 285
>gi|83943408|ref|ZP_00955867.1| TRm3 transposase [Sulfitobacter sp. EE-36] >gi|83845640|gb|EAP83518.1| TRm3 transposase [Sulfitobacter sp. EE-36] (172 aa)
Score = 208, Expect = 1.9e-15, Identities = 46/120 (38%), Positives = 65/120 (54%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEK-WSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFEN 120
           +K IY A + + +  AL  F +   + +Y     SW     E+  F  +P E+RRLIYTTN IE +N  IR+  + +G   S +A +KLIYL L   S  WK  V  W  +  QL I+FE+
  S:    47 LKAIYTAVDVEAAELALAEFEDSDLARQYPAIAPSWRRAWNEVIPFLDYPPEVRRLIYTTNSIEALNSKIRRAVRTRGHFPSDDAAAKLIYLALNATSTEWKRSVREWHAVRSQLAIMFED 167
>gi|29376391|ref|NP_815545.1| IS256 family transposase [Enterococcus faecalis V583] >gi|29343854|gb|AAO81615.1| transposase, IS256 family [Enterococcus faecalis V583] (430 aa)
Score = 208, Expect = 1.9e-15, Identities = 44/116 (37%), Positives = 67/116 (57%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWK-SRVANWGLILQQLKI 116
           MKK Y A + + +  A   F  +WS  Y  A   W  N   +   F + + IR+++YTTN +E+V+ + RK+TK KG  ++ NAL KL+YLR   +   W   R+ NW ++L+QL I
  S:   285 MKKFYGASSLNAAHAAFGSFQNRWS-HYSGAVDVWKRNFAHVEQLFDYGSAIRKIMYTTNAVESVHSSFRKVTK-KGAFSNENALLKLLYLRTKELHAKWSGGRIQNWAMVLKQLMI 399
>gi|69244022|ref|ZP_00602600.1| Transposase, mutator type [Enterococcus faecium DO] >gi|68196748|gb|EAN11173.1| Transposase, mutator type [Enterococcus faecium DO] (441 aa)
Score = 208, Expect = 2.0e-15, Identities = 44/116 (37%), Positives = 66/116 (56%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWK-SRVANWGLILQQLKI 116
           MKK Y A + + +  A   F  +WS  Y  A   W  N   +   F + + IR+++YTTN +E+V+ + RK+TK KG  ++ NAL KL+YLR   +   W   R+ NW ++L QL I
  S:   296 MKKFYGASSLNAAHAAFDSFQNRWS-HYSGAVDVWKRNFAHVEQLFDYGSAIRKIMYTTNAVESVHSSFRKVTK-KGAFSNENALLKLLYLRTKELHAKWSGGRIQNWAMVLNQLMI 410
>gi|56419412|ref|YP_146730.1| transposase of IS654-like element [Geobacillus kaustophilus HTA426] >gi|56379254|dbj|BAD75162.1| transposase of IS654-like element [Geobacillus kaustophilus HTA426] (389 aa)
Score = 207, Expect = 2.3e-15, Identities = 39/103 (37%), Positives = 63/103 (61%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSR 103
           +K IY++PN +++++  + F  KWS KY    +SW N ++ L TF  +P+ IR +IYTTN IE   + IRK  K    ++S+ A  K++YL + + +E W  R
  S:   266 LKLIYRSPNKEIALEMFQQFQSKWSHKYPREVQSWANELDVLLTFMDYPSSIRSVIYTTNAIERTIKEIRKRLKPMNSLSSLEAAEKVVYLTIQDFNEKWAGR 368
>gi|56418880|ref|YP_146198.1| transposase of IS654-like element [Geobacillus kaustophilus HTA426] >gi|196249630|ref|ZP_03148327.1| transposase mutator type [Geobacillus sp. G11MC16] >gi|56378722|dbj|BAD74630.1| transposase of IS654-like element [Geobacillus kaustophilus HTA426] >gi|196210924|gb|EDY05686.1| transposase mutator type [Geobacillus sp. G11MC16] (389 aa)
Score = 207, Expect = 2.3e-15, Identities = 39/103 (37%), Positives = 63/103 (61%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSR 103
           +K IY++PN +++++  + F  KWS KY    +SW N ++ L TF  +P+ IR +IYTTN IE   + IRK  K    ++S+ A  K++YL + + +E W  R
  S:   266 LKLIYRSPNKEIALEMFQQFQSKWSHKYPREVQSWANELDVLLTFMDYPSSIRSVIYTTNAIERTIKEIRKRLKPMNSLSSLEAAEKVVYLTIQDFNEKWAGR 368
>gi|138895602|ref|YP_001126055.1| transposase [Geobacillus thermodenitrificans NG80-2] >gi|134267115|gb|ABO67310.1| Transposase (04) [Geobacillus thermodenitrificans NG80-2] (389 aa)
Score = 207, Expect = 2.5e-15, Identities = 39/103 (37%), Positives = 63/103 (61%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSR 103
           +K IY++PN +++++  + F  KWS KY    +SW N ++ L TF  +P+ IR +IYTTN IE   + IRK  K    ++S+ A  K++YL + + +E W  R
  S:   266 LKLIYRSPNKEIALEMFQQFQSKWSHKYPREVQSWANELDVLLTFMDYPSSIRSVIYTTNAIERTIKEIRKRLKPMNSLSSLEAAEKVVYLTIQDFNEKWAGR 368
>gi|148979275|ref|ZP_01815429.1| transposase for the IS285 insertion element [Vibrionales bacterium SWAT-3] >gi|145961923|gb|EDK27214.1| transposase for the IS285 insertion element [Vibrionales bacterium SWAT-3] (130 aa)
Score = 207, Expect = 2.6e-15, Identities = 45/122 (36%), Positives = 72/122 (59%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +KKIYQ+   D ++ AL+ F++KW  KY   ++SW  +   L T F +P +IRR IYTTN IE++N  IRK  K +    +  +  K+I+L + + S+ W   + NW   L +  I+FE+ +
  S:     5 LKKIYQSKTEDEALLALEQFSDKWDDKYPQISRSWTAHWANLNTLFNYPEDIRRAIYTTNAIESLNSVIRKAIKKRKLFPTDESARKVIFLAIQDASKRWTMPIRNWRQALNRFMIMFEDRL 126
>gi|194437962|ref|ZP_03070056.1| IS1414, transposase [Escherichia coli 101-1] >gi|194423183|gb|EDX39176.1| IS1414, transposase [Escherichia coli 101-1] (398 aa)
Score = 207, Expect = 2.7e-15, Identities = 41/122 (33%), Positives = 69/122 (56%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K IYQAP  +   +AL+ F   W S+Y   ++SW  N   L TFF +P +IR++IYTTN IE++N  IR   K +    + +A+ K+ +L + + S  W   + +W + + +  I F + +
  S:   273 LKAIYQAPTEEAGQQALEAFAAAWDSRYPQISRSWQANWPNLATFFAYPTDIRKVIYTTNAIESLNSVIRHAIKKRKVFPTDDAVKKVGWLAIQSASRKWTMPLRDWRMAMSRFIIEFGDRL 394
>gi|152988382|ref|YP_001349878.1| transposase mutator family protein [Pseudomonas aeruginosa PA7] >gi|150963540|gb|ABR85565.1| transposase, Mutator family [Pseudomonas aeruginosa PA7] (416 aa)
Score = 206, Expect = 3.5e-15, Identities = 39/97 (40%), Positives = 54/97 (55%)
  Q:    24 WSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFEN 120
           W  K+     +W N  + +  FF F  EIR++IYTTN IENVN  +RKI K +G   +  A SKLI+L L NI+  W     +W   + Q  IL+ +
  S:   313 WGQKFPTVCAAWRNAWDRVIPFFAFAPEIRKVIYTTNAIENVNSQLRKIIKTRGHFPTDEAASKLIWLALRNITAKWSRSAHDWKQAMNQFAILYAD 409
>gi|138893996|ref|YP_001124449.1| transposase [Geobacillus thermodenitrificans NG80-2] >gi|134265509|gb|ABO65704.1| Transposase (04) [Geobacillus thermodenitrificans NG80-2] (388 aa)
Score = 206, Expect = 3.5e-15, Identities = 41/103 (39%), Positives = 62/103 (60%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSR 103
           +K IY+APN +++++  + F  KWSSKY    +SW N ++ L TF   P+ IR +IYTTN IE   + IRK  K    + S+ A  K++YL + + +E W  R
  S:   265 LKLIYRAPNKEMALQMFQQFESKWSSKYPREVQSWANELDVLLTFMDDPSSIRSVIYTTNAIERTIKEIRKRLKPMNSLNSLEAAEKIVYLTIQDFNEKWAGR 367
>gi|194549736|ref|YP_002084764.1| Transposase, mutator type [Pseudomonas aeruginosa C3719] >gi|126170682|gb|EAZ56193.1| Transposase, mutator type [Pseudomonas aeruginosa C3719] (418 aa)
Score = 206, Expect = 3.5e-15, Identities = 39/97 (40%), Positives = 54/97 (55%)
  Q:    24 WSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFEN 120
           W  K+     +W N  + +  FF F  EIR++IYTTN IENVN  +RKI K +G   +  A SKLI+L L NI+  W     +W   + Q  IL+ +
  S:   315 WGQKFPTVCAAWRNAWDRVIPFFAFAPEIRKVIYTTNAIENVNSQLRKIIKTRGHFPTDEAASKLIWLALRNITAKWSRSAHDWKQAMNQFAILYAD 411
>gi|93006190|ref|YP_580627.1| transposase, mutator type [Psychrobacter cryohalolentis K5] >gi|92393868|gb|ABE75143.1| transposase, mutator type [Psychrobacter cryohalolentis K5] (268 aa)
Score = 205, Expect = 3.7e-15, Identities = 44/122 (36%), Positives = 64/122 (52%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K IY A   +++   L+ F   W  KY +  KSW NN E L  FF +P +IR+ IYTTN IE++N  IR     +    S  A  K++YL     S+ W   + NW   L +  I+F++ I
  S:   142 LKAIYGADTHEIAEANLESFDATWGDKYPHVVKSWRNNWEGLKVFFGYPKDIRKAIYTTNAIESLNSVIRTAVNKRKVFLSDQAAFKVVYLATQQASKKWSMPIRNWTSALNRFMIMFDDRI 263
>gi|145299917|ref|YP_001142758.1| IS256 family transposase [Aeromonas salmonicida subsp. salmonicida A449] >gi|142852689|gb|ABO91010.1| IS256-family transposase [Aeromonas salmonicida subsp. salmonicida A449] (404 aa)
Score = 205, Expect = 3.7e-15, Identities = 42/122 (34%), Positives = 68/122 (55%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K+IYQ+     + +AL  F E+W S+Y    +SW NN + L T F +P  IR++IYTTN IE++N  +RK TK +    +  +  K+ +L +   S+ W   + NW   L +  I F + +
  S:   279 LKQIYQSATEREAQQALATFGERWDSQYPQIARSWQNNWDNLITLFDYPPAIRKVIYTTNAIESLNSVLRKATKQRKLFPTDESALKVAFLAIQQASKKWTMPIQNWKPALNRFIIEFGDRL 400
>gi|149280595|ref|ZP_01886710.1| Transposase, mutator family protein [Pedobacter sp. BAL39] >gi|149228640|gb|EDM34044.1| Transposase, mutator family protein [Pedobacter sp. BAL39] (92 aa)
Score = 205, Expect = 3.8e-15, Identities = 43/87 (49%), Positives = 59/87 (67%)
  Q:    34 SWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFEN 120
           SW  N +ELT++F+FP EIR++IYTTN+IE++N  IRK TKAK       A  K +YL ++NI + W   V +WG I+ Q  I+FEN
  S:     2 SWEKNWDELTSYFEFPLEIRKIIYTTNVIESLNSGIRKFTKAKNLFPDDQAALKAVYLSVMNIQKKWTMPVRDWGKIINQFSIIFEN 88
>gi|84624537|ref|YP_451909.1| IS1113 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|188575834|ref|YP_001912763.1| transposase, Mutator family [Xanthomonas oryzae pv. oryzae PXO99A] >gi|84368477|dbj|BAE69635.1| IS1113 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|188520286|gb|ACD58231.1| transposase, Mutator family [Xanthomonas oryzae pv. oryzae PXO99A] (261 aa)
Score = 205, Expect = 4.0e-15, Identities = 41/103 (39%), Positives = 58/103 (56%)
  Q:    20 FTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           F E+W   Y    +SW  N   L  FF +P +IR++IYT N IE+V+  +R++TK +G   S  AL KL+ L L NIS+ W   + +W   L +  I FE  I
  S:   156 FQERWDDAYAPIGQSWRRNWPCLVPFFDYPPQIRKVIYTANAIESVHYGLRRLTKHRGAFPSDEALIKLLSLALRNISKRWTLPIRDWKAALNRFTIQFEERI 258
>gi|83718803|ref|YP_441062.1| transposase [Burkholderia thailandensis E264] >gi|83652628|gb|ABC36691.1| transposase [Burkholderia thailandensis E264] (639 aa)
Score = 205, Expect = 4.1e-15, Identities = 38/96 (39%), Positives = 55/96 (57%)
  Q:    23 KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           +W  K+      W    E++  FF +P E+RR++YTTN IE+++  +RKI K +G   S  A SKL+YL L NI ++WK     W   + Q  ILF
  S:   535 EWGRKFPTVAAMWQRQWEQVIPFFAYPPEVRRIVYTTNAIESMHMQLRKIVKNRGHFPSDEAASKLLYLALRNIEKDWKMPPITWRQAVNQFAILF 630
>gi|47174902|gb|AAT12436.1| TnpA [Salmonella enterica] (402 aa)
Score = 205, Expect = 4.4e-15, Identities = 39/122 (31%), Positives = 70/122 (57%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K IYQAP  +   +AL+ F   W S+Y   ++SW  N   L TFF +P +IR++I TTN IE++N  IR   K +    + +++ K+++L + + S+ W   + +W + + +  I F + +
  S:   277 LKAIYQAPTEEAGQQALEAFAAAWDSRYPQISRSWQANWPNLATFFAYPTDIRKVIXTTNAIESLNSVIRHAIKKRKVFPTDDSVKKVVWLAIQSASQKWTMPLKDWRMAMSRFIIEFGDRL 398
>gi|17544971|ref|NP_518373.1| ISRSO7-transposase protein [Ralstonia solanacearum GMI1000] >gi|17548699|ref|NP_522039.1| ISRSO7-transposase protein [Ralstonia solanacearum GMI1000] >gi|17427261|emb|CAD13780.1| isrso7-transposase protein [Ralstonia solanacearum] >gi|17430947|emb|CAD17629.1| isrso7-transposase protein [Ralstonia solanacearum] (416 aa)
Score = 204, Expect = 4.9e-15, Identities = 41/118 (34%), Positives = 65/118 (55%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTE-KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           ++ IY A + + +   L  F +  W  +Y     +W N  + +  FF FP  +R++IYTTN IEN+N  +RKI K +G   + +A +KLI+L L NI+  W     +W   + Q  IL+
  S:   289 IRPIYTAASAEAAQAELDAFADGPWGQRYPTVCAAWRNAWDRVIPFFAFPPAVRKVIYTTNAIENINAQLRKIIKTRGHFPTDDAATKLIWLALRNITAGWSRAAHDWKQAMNQFAILY 407
>gi|114762674|ref|ZP_01442108.1| TRm3 transposase [Roseovarius sp. HTCC2601] >gi|114766511|ref|ZP_01445469.1| TRm3 transposase [Roseovarius sp. HTCC2601] >gi|114766531|ref|ZP_01445488.1| TRm3 transposase [Roseovarius sp. HTCC2601] >gi|114541221|gb|EAU44272.1| TRm3 transposase [Roseovarius sp. HTCC2601] >gi|114541278|gb|EAU44328.1| TRm3 transposase [Roseovarius sp. HTCC2601] >gi|114544584|gb|EAU47590.1| TRm3 transposase [Roseovarius sp. HTCC2601] (407 aa)
Score = 203, Expect = 6.2e-15, Identities = 45/120 (37%), Positives = 65/120 (54%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEK-WSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFEN 120
           +K +Y A +   +  AL  F E   +++Y     SW     E+  F  +P E+RRLIYTTN +E +N  IR+  + +G   S  A +KLIYL L   S+ WK  V  W  +  QL I+FE+
  S:   282 LKAVYSAVDAAAAEAALTDFEESDLAARYPAIAPSWRRAWTEVIPFLDYPPEVRRLIYTTNAVEALNSKIRRAVRTRGHFPSDEAAAKLIYLALNATSQEWKRSVREWHAVKSQLAIMFED 402
>gi|83746024|ref|ZP_00943079.1| Transposase [Ralstonia solanacearum UW551] >gi|83727207|gb|EAP74330.1| Transposase [Ralstonia solanacearum UW551] (141 aa)
Score = 202, Expect = 8.6e-15, Identities = 40/120 (33%), Positives = 64/120 (53%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTE-KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFEN 120
           ++ IY AP+ + +   L  F +  W  +Y     +W N  + +  FF FP  +R++I TTN IEN+N  +RKI K +G   +  A +K I+L L NI+  W     +W   + Q  IL+ +
  S:    14 IRPIYTAPSAEAAQAELDAFADGPWGQRYPTVCAAWRNAWDRVIPFFAFPPAVRKVICTTNAIENINAQLRKIIKTRGHFPTDEAATKFIWLALRNITAGWSRVAHDWKQAMNQFAILYAD 134
>gi|134294566|ref|YP_001118301.1| transposase, mutator type [Burkholderia vietnamiensis G4] >gi|134137723|gb|ABO53466.1| transposase, mutator type [Burkholderia vietnamiensis G4] (424 aa)
Score = 202, Expect = 9.6e-15, Identities = 43/118 (36%), Positives = 66/118 (55%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTE-KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           ++ IY A + + + +AL+ F +  W +KY    +SW    E +  FF FP EIRR++YTTN IE++N  +RKI K +G   +  A  KL++L L N+         +W   + Q  ILF
  S:   297 LRPIYAAASEEAARQALQDFADGPWGAKYPTIVQSWQRAWEHVIPFFVFPPEIRRVVYTTNAIESLNMQLRKIIKTRGHFPNDEAAIKLLWLALRNVLAKTVRAAFDWKSAMNQFAILF 415
>gi|134293690|ref|YP_001117426.1| transposase, mutator type [Burkholderia vietnamiensis G4] >gi|134136847|gb|ABO57961.1| transposase, mutator type [Burkholderia vietnamiensis G4] (426 aa)
Score = 202, Expect = 9.9e-15, Identities = 43/118 (36%), Positives = 66/118 (55%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTE-KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           ++ IY A + + + +AL+ F +  W +KY    +SW    E +  FF FP EIRR++YTTN IE++N  +RKI K +G   +  A  KL++L L N+         +W   + Q  ILF
  S:   299 LRPIYAAASEEAARQALQDFADGPWGAKYPTIVQSWRRAWEHVIPFFVFPPEIRRVVYTTNAIESLNMQLRKIIKTRGHFPNDEAAIKLLWLALRNVLAKTVRAAFDWKSAMNQFAILF 417
>gi|134295927|ref|YP_001119662.1| transposase, mutator type [Burkholderia vietnamiensis G4] >gi|134139084|gb|ABO54827.1| transposase, mutator type [Burkholderia vietnamiensis G4] (426 aa)
Score = 202, Expect = 9.9e-15, Identities = 43/118 (36%), Positives = 66/118 (55%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTE-KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           ++ IY A + + + +AL+ F +  W +KY    +SW    E +  FF FP EIRR++YTTN IE++N  +RKI K +G   +  A  KL++L L N+         +W   + Q  ILF
  S:   299 LRPIYAAASEEAARQALQDFADGPWGAKYPTIVQSWRRAWEHVIPFFVFPPEIRRVVYTTNAIESLNMQLRKIIKTRGHFPNDEAAIKLLWLALRNVLAKTVRAAFDWKSAMNQFAILF 417
>gi|134295209|ref|YP_001118944.1| transposase, mutator type [Burkholderia vietnamiensis G4] >gi|134295312|ref|YP_001119047.1| transposase, mutator type [Burkholderia vietnamiensis G4] >gi|134138366|gb|ABO54109.1| transposase, mutator type [Burkholderia vietnamiensis G4] >gi|134138469|gb|ABO54212.1| transposase, mutator type [Burkholderia vietnamiensis G4] (426 aa)
Score = 202, Expect = 1.0e-14, Identities = 43/118 (36%), Positives = 66/118 (55%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTE-KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           ++ IY A + + + +AL+ F +  W +KY    +SW    E +  FF FP EIRR++YTTN IE++N  +RKI K +G   +  A  KL++L L N+         +W   + Q  ILF
  S:   299 LRPIYAAASEEAARQALQDFADGPWGAKYPTIVQSWRRAWEHVIPFFVFPPEIRRVVYTTNAIESLNMQLRKIIKTRGHFPNDEAAIKLLWLALRNVLAKTVRAAFDWKSAMNQFAILF 417
>gi|134292442|ref|YP_001116178.1| transposase, mutator type [Burkholderia vietnamiensis G4] >gi|134135599|gb|ABO56713.1| transposase, mutator type [Burkholderia vietnamiensis G4] (424 aa)
Score = 201, Expect = 1.1e-14, Identities = 43/118 (36%), Positives = 66/118 (55%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTE-KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           ++ IY A + + + +AL+ F +  W +KY    +SW    E +  FF FP EIRR++YTTN IE++N  +RKI K +G   +  A  KL++L L N+         +W   + Q  ILF
  S:   297 LRPIYAAASEEAARQALQDFADGPWGAKYPTIVQSWRRAWEHVIPFFVFPPEIRRVVYTTNAIESLNMQLRKIIKTRGHFPNDEAAIKLLWLALRNVLAKTVRAAFDWKSAMNQFAILF 415
>gi|194564815|ref|YP_002099837.1| Transposase [Burkholderia dolosa AUO158] >gi|124898475|gb|EAY70318.1| Transposase [Burkholderia dolosa AUO158] (426 aa)
Score = 201, Expect = 1.3e-14, Identities = 42/118 (35%), Positives = 66/118 (55%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTE-KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           ++ IY A + + + +AL+ F +  W +KY    +SW    E +  F+ FP EIRR++YTTN IE++N  +RKI K +G   +  A  KL++L L N+         +W   + Q  ILF
  S:   299 LRPIYAAASEEAARQALQDFADGPWGAKYPTIVQSWQRAWEHVVPFYVFPPEIRRVVYTTNAIESLNMQLRKIIKTRGHFPNDEAAIKLLWLALRNVLAKTVQSAFDWKSAMNQFAILF 417
>gi|194565593|ref|YP_002100615.1| Transposase [Burkholderia dolosa AUO158] >gi|194566345|ref|YP_002101366.1| Transposase [Burkholderia dolosa AUO158] >gi|124899253|gb|EAY71096.1| Transposase [Burkholderia dolosa AUO158] >gi|124901097|gb|EAY71847.1| Transposase [Burkholderia dolosa AUO158] (426 aa)
Score = 201, Expect = 1.3e-14, Identities = 42/118 (35%), Positives = 66/118 (55%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTE-KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           ++ IY A + + + +AL+ F +  W +KY    +SW    E +  F+ FP EIRR++YTTN IE++N  +RKI K +G   +  A  KL++L L N+         +W   + Q  ILF
  S:   299 LRPIYAAASEEAARQALQDFADGPWGAKYPTIVQSWQRAWEHVVPFYVFPPEIRRVVYTTNAIESLNMQLRKIIKTRGHFPNDEAAIKLLWLALRNVLAKTVQSAFDWKSAMNQFAILF 417
>gi|170734626|ref|YP_001773740.1| transposase mutator type [Burkholderia cenocepacia MC0-3] >gi|170735276|ref|YP_001774390.1| transposase mutator type [Burkholderia cenocepacia MC0-3] >gi|170735573|ref|YP_001776833.1| transposase mutator type [Burkholderia cenocepacia MC0-3] >gi|194557185|ref|YP_002092211.1| Transposase [Burkholderia cenocepacia PC184] >gi|194558134|ref|YP_002093160.1| Transposase [Burkholderia cenocepacia PC184] >gi|124870976|gb|EAY62692.1| Transposase [Burkholderia cenocepacia PC184] >gi|124871925|gb|EAY63641.1| Transposase [Burkholderia cenocepacia PC184] >gi|169817761|gb|ACA92343.1| transposase mutator type [Burkholderia cenocepacia MC0-3] >gi|169820664|gb|ACA95245.1| transposase mutator type [Burkholderia cenocepacia MC0-3] >gi|169821314|gb|ACA95895.1| transposase mutator type [Burkholderia cenocepacia MC0-3] (426 aa)
Score = 200, Expect = 1.4e-14, Identities = 43/118 (36%), Positives = 65/118 (55%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTE-KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           ++ IY A + + + +AL+ F +  W  KY    +SW    E +  FF FP EIRR++YTTN IE++N  +RKI K +G   +  A  KL++L L N+         +W   + Q  ILF
  S:   299 LRPIYAAASEEAARQALQDFADGPWGEKYPTIVQSWQRAWEHVIPFFVFPPEIRRVVYTTNAIESLNMQLRKIIKTRGHFPNDEAAIKLLWLALRNVLAKTVRAAFDWKSAMNQFAILF 417
>gi|194556843|ref|YP_002091869.1| Transposase [Burkholderia cenocepacia PC184] >gi|124870634|gb|EAY62350.1| Transposase [Burkholderia cenocepacia PC184] (426 aa)
Score = 200, Expect = 1.4e-14, Identities = 43/118 (36%), Positives = 65/118 (55%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTE-KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           ++ IY A + + + +AL+ F +  W  KY    +SW    E +  FF FP EIRR++YTTN IE++N  +RKI K +G   +  A  KL++L L N+         +W   + Q  ILF
  S:   299 LRPIYAAASEEAARQALQDFADGPWGEKYPTIVQSWQRAWEHVIPFFVFPPEIRRVVYTTNAIESLNMQLRKIIKTRGHFPNDEAAIKLLWLALRNVLAKTVRAAFDWKSAMNQFAILF 417
>gi|58582651|ref|YP_201667.1| putative transposase [Xanthomonas oryzae pv. oryzae KACC10331] >gi|58427245|gb|AAW76282.1| putative transposase [Xanthomonas oryzae pv. oryzae KACC10331] (261 aa)
Score = 200, Expect = 1.4e-14, Identities = 41/103 (39%), Positives = 57/103 (55%)
  Q:    20 FTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           F E+W   Y    +SW  N   L  FF  P +IR++IYT N IE+V+  +R++TK +G   S  AL KL+ L L NIS+ W   + +W   L +  I FE  I
  S:   156 FQERWDDAYAPIGQSWRRNWPCLVPFFDCPPQIRKVIYTANAIESVHYGLRRLTKHRGAFPSDEALIKLLSLALRNISKRWTLPIRDWKAALNRFTIQFEERI 258
>gi|134292775|ref|YP_001116511.1| transposase, mutator type [Burkholderia vietnamiensis G4] >gi|134135932|gb|ABO57046.1| transposase, mutator type [Burkholderia vietnamiensis G4] (389 aa)
Score = 200, Expect = 1.4e-14, Identities = 43/118 (36%), Positives = 66/118 (55%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTE-KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           ++ IY A + + + +AL+ F +  W +KY    +SW    E +  FF FP EIRR++YTTN IE++N  +RKI K +G   +  A  KL++L L N+         +W   + Q  ILF
  S:   262 LRPIYAAASEEAARQALQDFADGPWGAKYPTIVQSWRRAWEHVIPFFVFPPEIRRVVYTTNAIESLNMQLRKIIKTRGHFPNDEAAIKLLWLALRNVLAKTVRAAFDWKSAMNQFAILF 380
>gi|83721043|ref|YP_443633.1| transposase mutator family protein [Burkholderia thailandensis E264] >gi|83654868|gb|ABC38931.1| transposase, Mutator family [Burkholderia thailandensis E264] (422 aa)
Score = 200, Expect = 1.4e-14, Identities = 38/96 (39%), Positives = 55/96 (57%)
  Q:    23 KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           +W  K+      W    E++  FF +P E+RR++YTTN IE+++  +RKI K +G   S  A SKL+YL L NI ++WK     W   + Q  ILF
  S:   318 EWGRKFPTVAAMWQRQWEQVIPFFAYPPEVRRIVYTTNAIESMHMQLRKIVKNRGHFPSDEAASKLLYLALRNIEKDWKMPPITWRQAVNQFAILF 413
>gi|83716872|ref|YP_439279.1| transposase mutator family protein [Burkholderia thailandensis E264] >gi|83650697|gb|ABC34761.1| transposase, Mutator family [Burkholderia thailandensis E264] (422 aa)
Score = 200, Expect = 1.5e-14, Identities = 38/96 (39%), Positives = 55/96 (57%)
  Q:    23 KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           +W  K+      W    E++  FF +P E+RR++YTTN IE+++  +RKI K +G   S  A SKL+YL L NI ++WK     W   + Q  ILF
  S:   318 EWGRKFPTVAAMWQRQWEQVIPFFAYPPEVRRIVYTTNAIESMHMQLRKIVKNRGHFPSDEAASKLLYLALRNIEKDWKMPPITWRQAVNQFAILF 413
>gi|83718984|ref|YP_443738.1| transposase mutator family protein [Burkholderia thailandensis E264] >gi|83652809|gb|ABC36872.1| transposase, Mutator family [Burkholderia thailandensis E264] (422 aa)
Score = 200, Expect = 1.5e-14, Identities = 38/96 (39%), Positives = 55/96 (57%)
  Q:    23 KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           +W  K+      W    E++  FF +P E+RR++YTTN IE+++  +RKI K +G   S  A SKL+YL L NI ++WK     W   + Q  ILF
  S:   318 EWGRKFPTVAAMWQRQWEQVIPFFAYPPEVRRIVYTTNAIESMHMQLRKIVKNRGHFPSDEAASKLLYLALRNIEKDWKMPPITWRQAVNQFAILF 413
>gi|83719149|ref|YP_443404.1| transposase mutator family protein [Burkholderia thailandensis E264] >gi|83652974|gb|ABC37037.1| transposase, Mutator family [Burkholderia thailandensis E264] (422 aa)
Score = 200, Expect = 1.5e-14, Identities = 38/96 (39%), Positives = 55/96 (57%)
  Q:    23 KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           +W  K+      W    E++  FF +P E+RR++YTTN IE+++  +RKI K +G   S  A SKL+YL L NI ++WK     W   + Q  ILF
  S:   318 EWGRKFPTVAAMWQRQWEQVIPFFAYPPEVRRIVYTTNAIESMHMQLRKIVKNRGHFPSDEAASKLLYLALRNIEKDWKMPPITWRQAVNQFAILF 413
>gi|194562032|ref|YP_002097055.1| Transposase [Burkholderia dolosa AUO158] >gi|124893656|gb|EAY67536.1| Transposase [Burkholderia dolosa AUO158] (426 aa)
Score = 200, Expect = 1.6e-14, Identities = 42/118 (35%), Positives = 66/118 (55%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTE-KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           ++ IY A + + + +AL+ F +  W +KY    +SW    E +  F+ FP EIRR++YTTN IE++N  +RKI K +G   +  A  KL++L L N+         +W   + Q  ILF
  S:   299 LRPIYAAASEEAARQALQDFADGPWGAKYPTIVQSWQRAWEHVVPFYVFPPEIRRVVYTTNAIESLNMQLRKIIKTRGHFPNDEAAIKLLWLALRNVLAKTVRSAFDWKSAMNQFAILF 417
>gi|194564709|ref|YP_002099731.1| Transposase [Burkholderia dolosa AUO158] >gi|124898369|gb|EAY70212.1| Transposase [Burkholderia dolosa AUO158] (426 aa)
Score = 200, Expect = 1.6e-14, Identities = 42/118 (35%), Positives = 66/118 (55%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTE-KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           ++ IY A + + + +AL+ F +  W +KY    +SW    E +  F+ FP EIRR++YTTN IE++N  +RKI K +G   +  A  KL++L L N+         +W   + Q  ILF
  S:   299 LRPIYAAASEEAARQALQDFADGPWGAKYPTIVQSWQRAWEHVVPFYVFPPEIRRVVYTTNAIESLNMQLRKIIKTRGHFPNDEAAIKLLWLALRNVLAKTVRSAFDWKSAMNQFAILF 417
>gi|83716088|ref|YP_439723.1| transposase mutator family protein [Burkholderia thailandensis E264] >gi|83649913|gb|ABC33977.1| transposase, Mutator family [Burkholderia thailandensis E264] (422 aa)
Score = 200, Expect = 1.7e-14, Identities = 38/96 (39%), Positives = 55/96 (57%)
  Q:    23 KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           +W  K+      W    E++  FF +P E+RR++YTTN IE+++  +RKI K +G   S  A SKL+YL L NI ++WK     W   + Q  ILF
  S:   318 EWGRKFPTVAAMWQRQWEQVIPFFAYPPEVRRIVYTTNAIESMHMQLRKIVKNRGHFPSDEAASKLLYLALRNIEKDWKMPPITWRQAVNQFAILF 413
>gi|118443604|ref|YP_877034.1| transposase mutator family protein [Clostridium novyi NT] >gi|118134060|gb|ABK61104.1| transposase, Mutator family [Clostridium novyi NT] (384 aa)
Score = 200, Expect = 1.7e-14, Identities = 41/97 (42%), Positives = 58/97 (59%)
  Q:     4 IYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENW 100
           IY+A   ++++  L    EKW SKYG    SW NN + L+TFF+F  EIR++IYTTN +E  N  IRK TK +    +  +L K +YL  + I + W
  S:   287 IYKATTEELALLELDNLKEKWGSKYGIVIDSWYNNWDNLSTFFEFSPEIRKMIYTTNALEGFNIQIRKFTKTRTVFPTDESLKKSLYLATMEIMKKW 383
>gi|83717124|ref|YP_438473.1| transposase mutator family protein [Burkholderia thailandensis E264] >gi|83650949|gb|ABC35013.1| transposase, Mutator family [Burkholderia thailandensis E264] (422 aa)
Score = 200, Expect = 1.7e-14, Identities = 38/96 (39%), Positives = 55/96 (57%)
  Q:    23 KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           +W  K+      W    E++  FF +P E+RR++YTTN IE+++  +RKI K +G   S  A SKL+YL L NI ++WK     W   + Q  ILF
  S:   318 EWGRKFPTVAAMWQRQWEQVIPFFAYPPEVRRIVYTTNAIESMHMQLRKIVKNRGHFPSDEAASKLLYLALRNIEKDWKMPPITWRQAVNQFAILF 413
>gi|83717189|ref|YP_438824.1| transposase mutator family protein [Burkholderia thailandensis E264] >gi|83651014|gb|ABC35078.1| transposase, Mutator family [Burkholderia thailandensis E264] (290 aa)
Score = 200, Expect = 1.7e-14, Identities = 38/96 (39%), Positives = 55/96 (57%)
  Q:    23 KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           +W  K+      W    E++  FF +P E+RR++YTTN IE+++  +RKI K +G   S  A SKL+YL L NI ++WK     W   + Q  ILF
  S:   186 EWGRKFPTVAAMWQRQWEQVIPFFAYPPEVRRIVYTTNAIESMHMQLRKIVKNRGHFPSDEAASKLLYLALRNIEKDWKMPPITWRQAVNQFAILF 281
>gi|47174907|gb|AAT12440.1| TnpA [Salmonella enterica] (162 aa)
Score = 199, Expect = 2.2e-14, Identities = 39/122 (31%), Positives = 70/122 (57%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K IYQAP  +   +AL+ F   W S+Y   ++SW  N   L TFF +P +IR++I TTN IE++N  IR   K +    + +++ K+++L + + S+ W   + +W + + +  I F + +
  S:    37 LKAIYQAPTEEAGQQALEAFAAAWDSRYPQISRSWQANWPNLATFFAYPTDIRKVIXTTNAIESLNSVIRHAIKKRKVFPTDDSVKKVVWLAIQSASQKWTMPLKDWRMAMSRFIIEFGDRL 158
>gi|56419111|ref|YP_146429.1| transposase of IS654-like element [Geobacillus kaustophilus HTA426] >gi|56378953|dbj|BAD74861.1| transposase of IS654-like element [Geobacillus kaustophilus HTA426] (193 aa)
Score = 198, Expect = 2.4e-14, Identities = 39/103 (37%), Positives = 63/103 (61%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSR 103
           +K IY++PN +++++  + F  KWS KY    +SW N ++ L TF  +P+ IR +IYTTN IE   + IRK  K    ++S+ A  K++YL + + +E W  R
  S:    70 LKLIYRSPNKEIALEMFQQFQSKWSHKYPREVQSWANELDVLLTFMDYPSSIRSVIYTTNAIERTIKEIRKRLKPMNSLSSLEAAEKVVYLTIQDFNEKWAGR 172
>gi|172064614|ref|YP_001812264.1| transposase mutator type [Burkholderia ambifaria MC40-6] >gi|171998099|gb|ACB69015.1| transposase mutator type [Burkholderia ambifaria MC40-6] (295 aa)
Score = 198, Expect = 2.5e-14, Identities = 43/118 (36%), Positives = 66/118 (55%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTE-KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           ++ IY A + + + +AL+ F +  W +KY    +SW    E +  FF FP EIRR++YTTN IE++N  +RKI K +G   +  A  KL++L L N+         +W   + Q  ILF
  S:   168 LRPIYAAASEEAARQALQDFADGPWGAKYPTIVQSWQRAWEHVIPFFVFPPEIRRVVYTTNAIESLNMQLRKIIKTRGHFPNDEAAIKLLWLALRNVLAKTVRAAFDWKSAMNQFAILF 286
>gi|194563858|ref|YP_002098881.1| Transposase [Burkholderia dolosa AUO158] >gi|124895482|gb|EAY69362.1| Transposase [Burkholderia dolosa AUO158] (389 aa)
Score = 198, Expect = 2.5e-14, Identities = 42/118 (35%), Positives = 66/118 (55%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTE-KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           ++ IY A + + + +AL+ F +  W +KY    +SW    E +  F+ FP EIRR++YTTN IE++N  +RKI K +G   +  A  KL++L L N+         +W   + Q  ILF
  S:   262 LRPIYAAASEEAARQALQDFADGPWGAKYPTIVQSWQRAWEHVVPFYVFPPEIRRVVYTTNAIESLNMQLRKIIKTRGHFPNDEAAIKLLWLALRNVLAKTVRSAFDWKSAMNQFAILF 380
>gi|83719319|ref|YP_442869.1| transposase mutator family protein [Burkholderia thailandensis E264] >gi|83653144|gb|ABC37207.1| transposase, Mutator family [Burkholderia thailandensis E264] (422 aa)
Score = 198, Expect = 2.6e-14, Identities = 38/96 (39%), Positives = 55/96 (57%)
  Q:    23 KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           +W  K+      W    E++  FF +P E+RR++YTTN IE+++  +RKI K +G   S  A SKL+YL L NI ++WK     W   + Q  ILF
  S:   318 EWGRKFPTVAAMWQRQWEQVIPFFAYPPEVRRIVYTTNAIESMHMQLRKIVKNRGHFPSDEADSKLLYLALRNIEKDWKMPPITWRQAVNQFAILF 413
>gi|77973488|ref|ZP_00829035.1| COG3328: Transposase and inactivated derivatives [Yersinia frederiksenii ATCC 33641] (402 aa)
Score = 198, Expect = 2.6e-14, Identities = 39/122 (31%), Positives = 69/122 (56%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K IYQA   +   +AL+ F+  W S Y   ++SW  N   L TFF +P +IR++IYTTN IE++N  IR   K +    + +++ K+++L +   S+ W   + +W + + +  I F + +
  S:   277 LKAIYQAATEEAGSQALEAFSSAWDSCYPQISRSWQTNWANLATFFAYPTDIRKVIYTTNAIESLNSVIRHAIKKRKVFPTDDSVKKVVWLAIQAASQKWTMPLRDWRMAMSRFIIEFGDRL 398
>gi|148262189|ref|YP_001228895.1| transposase, mutator type [Geobacter uraniireducens Rf4] >gi|146395689|gb|ABQ24322.1| transposase, mutator type [Geobacter uraniireducens Rf4] (393 aa)
Score = 197, Expect = 3.5e-14, Identities = 39/104 (37%), Positives = 64/104 (61%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRV 104
           +K IYQ+   + +   L  F  KW   +   ++SW  N  ++  FF +PA+IR++IYTTN IE++N ++RK+TK +G   +  A+ KL+YL L NI++    R+
  S:   280 LKVIYQSATAEQAEMELTAFEAKWDKTHPTISQSWRRNWAQVIPFFAYPADIRKVIYTTNAIESLNMSLRKVTKNRGSFPNDEAMFKLLYLALRNIAKKALQRI 383
>gi|89098876|ref|ZP_01171757.1| transposase (04) [Bacillus sp. NRRL B-14911] >gi|89086552|gb|EAR65672.1| transposase (04) [Bacillus sp. NRRL B-14911] (198 aa)
Score = 197, Expect = 3.7e-14, Identities = 41/119 (34%), Positives = 67/119 (56%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSR-VANWGLILQQLKILFE 119
           +K++Y +  F+ + K LK   EKW   Y     SW  ++  L TF  +P EI++ IYTTNLIE  N+ +RK  K    + ++ A  K+IYL  I+ ++ W  R +  +GL  + +  +F+
  S:    73 LKRVYTSSTFEEAEKVLKEIKEKWKKTYSRELASWEEDLPVLLTFLHYPEEIQKYIYTTNLIERTNKEVRKRLKTMNSLPNIEAAEKIIYLTSIDYNDRWARRKLGGFGLAYETILNMFD 192
>gi|24210994|ref|NP_710165.1| putative transposase [Aeromonas salmonicida subsp. salmonicida] >gi|145301391|ref|YP_001144230.1| IS256 family transposase [Aeromonas salmonicida subsp. salmonicida A449] >gi|145301427|ref|YP_001144266.1| IS256 family transposase [Aeromonas salmonicida subsp. salmonicida A449] >gi|145301471|ref|YP_001144310.1| IS256 family transposase [Aeromonas salmonicida subsp. salmonicida A449] >gi|23897238|emb|CAD48423.1| putative transposase [Aeromonas salmonicida subsp. salmonicida] >gi|142856273|gb|ABO92482.1| IS256-family transposase [Aeromonas salmonicida subsp. salmonicida A449] >gi|142856309|gb|ABO92518.1| IS256-family transposase [Aeromonas salmonicida subsp. salmonicida A449] >gi|142856353|gb|ABO92562.1| IS256-family transposase [Aeromonas salmonicida subsp. salmonicida A449] (404 aa)
Score = 197, Expect = 3.8e-14, Identities = 41/122 (33%), Positives = 67/122 (54%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K+IYQ+     + +AL  F E+W S+Y    +SW NN + L T F +P  I ++IYTTN IE++N  +RK TK +    +  +  K+ +L +   S+ W   + NW   L +  I F + +
  S:   279 LKQIYQSATEREAQQALATFGERWDSQYPQIARSWQNNWDNLITLFDYPPAIWKVIYTTNAIESLNSVLRKATKQRKLFPTDESALKVAFLAIQQASKKWTMPIQNWKPALNRFIIEFGDRL 400
>gi|124549148|ref|ZP_01707534.1| Transposase and inactivated derivatives-like [Shewanella putrefaciens 200] >gi|124508047|gb|EAY52153.1| Transposase and inactivated derivatives-like [Shewanella putrefaciens 200] (144 aa)
Score = 195, Expect = 5.5e-14, Identities = 39/97 (40%), Positives = 56/97 (57%)
  Q:     4 IYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENW 100
           +Y+A   + +  AL     KW  KY    KSW N    L+ +F++P  +R  IYTTN +E V+R  RK+TK KGG  + N+L KL+Y  ++  SE W
  S:    25 VYKAATLNAAEMALDELETKWGDKYPVVIKSWRNKWALLSVYFKYPDYVRTTIYTTNAVEAVHRQFRKLTKTKGGFANENSLLKLLYAGILKASERW 121
>gi|27228690|ref|NP_758733.1| transposase [Erwinia pyrifoliae] >gi|26245284|gb|AAN04528.1| transposase [Erwinia pyrifoliae] (403 aa)
Score = 195, Expect = 6.4e-14, Identities = 41/122 (33%), Positives = 67/122 (54%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K +YQAP  + ++ AL  F   W  KY   +KSW  + E + TFF +PA+IR+  YT N IE+ N  IR   K +    + +++ K+IYL + + S+ W   + N  L + +  I F + +
  S:   278 LKTVYQAPTEEAALMALDKFAGIWDEKYPQISKSWRAHWENINTFFGYPADIRKAXYTXNAIESXNSVIRAAIKKRKVFPTDDSVRKVIYLAIEDASKKWNMPIQNXRLAISRFIIEFGDRL 399
>gi|194563807|ref|YP_002098830.1| Transposase [Burkholderia dolosa AUO158] >gi|124895431|gb|EAY69311.1| Transposase [Burkholderia dolosa AUO158] (290 aa)
Score = 195, Expect = 6.4e-14, Identities = 42/118 (35%), Positives = 66/118 (55%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTE-KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           ++ IY A + + + +AL+ F +  W +KY    +SW    E +  F+ FP EIRR++YTTN IE++N  +RKI K +G   +  A  KL++L L N+         +W   + Q  ILF
  S:   163 LRPIYAAASEEAARQALQDFADGPWGAKYPTIVQSWQRAWEHVVPFYVFPPEIRRVVYTTNAIESLNMQLRKIIKTRGHFPNDEAAIKLLWLALRNVLAKTVQSAFDWKSAMNQFAILF 281
>gi|148976488|ref|ZP_01813184.1| transposase [Vibrionales bacterium SWAT-3] >gi|145964064|gb|EDK29321.1| transposase [Vibrionales bacterium SWAT-3] (382 aa)
Score = 195, Expect = 6.6e-14, Identities = 40/106 (37%), Positives = 63/106 (59%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVAN 106
           +KKIYQ+   D ++ AL+ F++KW  KY   ++SW  +   L T F +P +IRR IYTTN IE++N  IRK  K +    +  +  K+I+L + + S+ W   + N
  S:   277 LKKIYQSKTEDEALLALEQFSDKWDDKYPQISRSWTAHWANLNTLFNYPEDIRRAIYTTNAIESLNSVIRKAIKKRKLFPTDESARKVIFLAIQDASKRWTMPIRN 382
>gi|83855151|ref|ZP_00948681.1| TRm3 transposase [Sulfitobacter sp. NAS-14.1] >gi|83954230|ref|ZP_00962950.1| TRm3 transposase [Sulfitobacter sp. NAS-14.1] >gi|83955838|ref|ZP_00964380.1| TRm3 transposase [Sulfitobacter sp. NAS-14.1] >gi|83956074|ref|ZP_00964556.1| TRm3 transposase [Sulfitobacter sp. NAS-14.1] >gi|83956084|ref|ZP_00964566.1| TRm3 transposase [Sulfitobacter sp. NAS-14.1] >gi|83839640|gb|EAP78819.1| TRm3 transposase [Sulfitobacter sp. NAS-14.1] >gi|83839650|gb|EAP78829.1| TRm3 transposase [Sulfitobacter sp. NAS-14.1] >gi|83839843|gb|EAP79020.1| TRm3 transposase [Sulfitobacter sp. NAS-14.1] >gi|83841267|gb|EAP80437.1| TRm3 transposase [Sulfitobacter sp. NAS-14.1] >gi|83842994|gb|EAP82161.1| TRm3 transposase [Sulfitobacter sp. NAS-14.1] (407 aa)
Score = 194, Expect = 7.0e-14, Identities = 39/95 (41%), Positives = 51/95 (53%)
  Q:    25 SSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFE 119
           + +Y     SW     E+  F  +P E+RRLIYTTN IE +N  IR+  + +G   S  A +KLIYL L   S  WK  V  W  +  QL I+FE
  S:   307 AKRYPAIAPSWRRAWNEVIPFLDYPPEVRRLIYTTNAIEALNSKIRRAVRTRGHFPSDEAAAKLIYLALNATSAEWKRSVREWHRVKSQLAIMFE 401
>gi|134047197|ref|YP_001102022.1| transposase InsF [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|133905116|gb|ABO41131.1| transposase InsF [Salmonella enterica subsp. enterica serovar Newport str. SL254] (411 aa)
Score = 194, Expect = 7.8e-14, Identities = 35/97 (36%), Positives = 54/97 (55%)
  Q:    24 WSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFEN 120
           W  ++     +W      +  FF FP ++RR+IYTTN IE+V+  +RKI K +G   S  A +KLI+L L NI+  W     +W   + Q  I++E+
  S:   309 WGERFPTVVAAWRRAWTRVVPFFAFPPDVRRVIYTTNAIESVHARLRKIIKTRGHFPSDEAATKLIWLALRNITAEWSRASQHWKAAMNQFAIIYED 405
>gi|51594371|ref|YP_068562.1| putative transposase [Yersinia pseudotuberculosis IP 32953] >gi|186893357|ref|YP_001870469.1| transposase mutator type [Yersinia pseudotuberculosis PB1/+] >gi|51587653|emb|CAH19252.1| putative transposase [Yersinia pseudotuberculosis IP 32953] >gi|186696383|gb|ACC87012.1| transposase mutator type [Yersinia pseudotuberculosis PB1/+] (395 aa)
Score = 194, Expect = 7.9e-14, Identities = 39/98 (39%), Positives = 60/98 (61%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISE 98
           +K +YQAP  + ++ AL  F E W  KY   +KSW  + E L TFF +P +IR+ IYTTN IE+VN  IR   K +    + +++ K++YL + + S+
  S:   277 LKMVYQAPTEEAALMALDKFAEAWDDKYPQISKSWRTHWENLNTFFGYPPDIRKAIYTTNAIESVNSVIRAAIKKRKVFPTDDSVRKVVYLAIKDASK 374
>gi|89897353|ref|YP_520840.1| hypothetical protein DSY4607 [Desulfitobacterium hafniense Y51] >gi|89336801|dbj|BAE86396.1| hypothetical protein [Desulfitobacterium hafniense Y51] (105 aa)
Score = 194, Expect = 8.3e-14, Identities = 42/90 (46%), Positives = 57/90 (63%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIY 90
           +KK+YQA   + +        EKW  K+    KSW NN  ELTTFF +P+EIRR+IYTTNLIE  +R +RK+TK K    + +AL K+ +
  S:    16 LKKVYQALTLEEAEYNFLELKEKWGKKHPIVIKSWENNWLELTTFFAYPSEIRRVIYTTNLIEGYHRQLRKVTKTKTAYPTDDALRKICH 105
>gi|83720506|ref|YP_442276.1| transposase mutator family protein [Burkholderia thailandensis E264] >gi|83654331|gb|ABC38394.1| transposase, Mutator family [Burkholderia thailandensis E264] (226 aa)
Score = 193, Expect = 9.9e-14, Identities = 38/96 (39%), Positives = 55/96 (57%)
  Q:    23 KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           +W  K+      W    E++  FF +P E+RR++YTTN IE+++  +RKI K +G   S  A SKL+YL L NI ++WK     W   + Q  ILF
  S:   122 EWGRKFPTVAAMWQRQWEQVIPFFAYPPEVRRIVYTTNAIESMHMQLRKIVKNRGHFPSDEAASKLLYLALRNIEKDWKMPPITWRQAVNQFAILF 217
>gi|194562031|ref|YP_002097054.1| Transposase [Burkholderia dolosa AUO158] >gi|124893655|gb|EAY67535.1| Transposase [Burkholderia dolosa AUO158] (175 aa)
Score = 193, Expect = 1.0e-13, Identities = 42/118 (35%), Positives = 66/118 (55%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTE-KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           ++ IY A + + + +AL+ F +  W +KY    +SW    E +  F+ FP EIRR++YTTN IE++N  +RKI K +G   +  A  KL++L L N+         +W   + Q  ILF
  S:    48 LRPIYAAASEEAARQALQDFADGPWGAKYPTIVQSWQRAWEHVVPFYVFPPEIRRVVYTTNAIESLNMQLRKIIKTRGHFPNDEAAIKLLWLALRNVLAKTVQSAFDWKSAMNQFAILF 166
>gi|138997039|dbj|BAF52671.1| transposase [Bacillus subtilis subsp. natto] (415 aa)
Score = 193, Expect = 1.1e-13, Identities = 38/116 (32%), Positives = 66/116 (56%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWK-SRVANWGLILQQLKI 116
           +KK+Y AP+      A + F ++WS+ Y  A   W  N   +   F +   IR+++YTTN +E+++ + RK+TK KG     NAL K+++LR   + + W   R+  W +++ QL +
  S:   288 LKKVYGAPSLKACHSAFESFEKQWST-YPGAVDVWKRNFSHVEQLFDYGGNIRKIMYTTNAVESIHSSFRKVTK-KGAFPHENALLKILFLRTKELEKKWDGGRIQQWAMVMNQLLV 402
>gi|34497771|ref|NP_901986.1| transposase protein [Chromobacterium violaceum ATCC 12472] >gi|34103627|gb|AAQ59988.1| probable transposase protein [Chromobacterium violaceum ATCC 12472] (263 aa)
Score = 192, Expect = 1.2e-13, Identities = 46/118 (38%), Positives = 64/118 (54%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTE-KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           +K IYQA   D +   L  F E  W  K       W    E++  FF +P+E+R++IYTTN IE+++  +RKI K +G   S  A SKL+YL L NI ++W+     W     Q  ILF
  S:   127 LKPIYQAATADAAAALLDEFAEGDWGRKLPTVPAMWRRQWEQVVPFFAYPSEVRKIIYTTNAIESMHMQLRKIVKNRGHFPSDEAASKLLYLALRNIEKDWRMPPITWKQAANQFAILF 245
>gi|90417629|ref|ZP_01225541.1| transposase [Aurantimonas sp. SI85-9A1] >gi|90418007|ref|ZP_01225919.1| transposase, mutator family [Aurantimonas sp. SI85-9A1] >gi|90418095|ref|ZP_01226007.1| transposase [Aurantimonas sp. SI85-9A1] >gi|90337301|gb|EAS50952.1| transposase [Aurantimonas sp. SI85-9A1] >gi|90337679|gb|EAS51330.1| transposase, mutator family [Aurantimonas sp. SI85-9A1] >gi|90337767|gb|EAS51418.1| transposase [Aurantimonas sp. SI85-9A1] (413 aa)
Score = 192, Expect = 1.3e-13, Identities = 41/118 (34%), Positives = 65/118 (55%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTE-KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           +K IY+A +   + KAL  F E +W  +Y    +SW     E+  F+ FP E+RR++YTTN IE +N  +R+  +A+G   + +A  KL++L L    + WK     W +   Q  IL+
  S:   286 LKDIYRAADAVAAEKALTAFEEGEWGHRYAAIGQSWRRAWAEVVPFYGFPEEVRRMVYTTNAIEALNSKLRRAVRARGHFPTDDAAMKLLFLVLNQSEKEWKMPPREWAMAKAQFAILY 404
>gi|83719172|ref|YP_442868.1| transposase mutator family protein [Burkholderia thailandensis E264] >gi|83652997|gb|ABC37060.1| transposase, Mutator family [Burkholderia thailandensis E264] (182 aa)
Score = 192, Expect = 1.4e-13, Identities = 38/96 (39%), Positives = 55/96 (57%)
  Q:    23 KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           +W  K+      W    E++  FF +P E+RR++YTTN IE+++  +RKI K +G   S  A SKL+YL L NI ++WK     W   + Q  ILF
  S:    78 EWGRKFPTVAAMWQRQWEQVIPFFAYPPEVRRIVYTTNAIESMHMQLRKIVKNRGHFPSDEADSKLLYLALRNIEKDWKMPPITWRQAVNQFAILF 173
>gi|83956454|ref|ZP_00964875.1| TRm3 transposase [Sulfitobacter sp. NAS-14.1] >gi|83839339|gb|EAP78526.1| TRm3 transposase [Sulfitobacter sp. NAS-14.1] (263 aa)
Score = 192, Expect = 1.5e-13, Identities = 39/95 (41%), Positives = 51/95 (53%)
  Q:    25 SSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFE 119
           + +Y     SW     E+  F  +P E+RRLIYTTN IE +N  IR+  + +G   S  A +KLIYL L   S  WK  V  W  +  QL I+FE
  S:   163 AKRYPAIAPSWRRAWNEVIPFLDYPPEVRRLIYTTNAIEALNSKIRRAVRTRGHFPSDEAAAKLIYLALNATSAEWKRSVREWHRVKSQLAIMFE 257
>gi|15613253|ref|NP_241556.1| transposase (04) [Bacillus halodurans C-125] >gi|10173304|dbj|BAB04409.1| transposase (04) [Bacillus halodurans C-125] (292 aa)
Score = 191, Expect = 1.5e-13, Identities = 39/118 (33%), Positives = 67/118 (56%)
  Q:     2 KKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKS-RVANWGLILQQLKILFE 119
           K IYQA  ++ +    K F E W  +Y     +W  +++ L TF  +P+ IR +IYTTN+IE   + I+K TK    + +  A  K++YL+ I+ +E W + R+  +G   + L+ +F+
  S:   168 KPIYQANTYEEAKNRFKEFKENWQKRYPKVVATWEKDLDVLLTFLSYPSTIRPMIYTTNIIERTMKEIKKRTKTMNSLPNEKAAEKIVYLQAIDYNERWATRRLRGFGEAYEALQEMFK 286
>gi|5822825|dbj|BAA83968.1| transposase-like [Bacillus halodurans] (240 aa)
Score = 191, Expect = 1.5e-13, Identities = 39/118 (33%), Positives = 67/118 (56%)
  Q:     2 KKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKS-RVANWGLILQQLKILFE 119
           K IYQA  ++ +    K F E W  +Y     +W  +++ L TF  +P+ IR +IYTTN+IE   + I+K TK    + +  A  K++YL+ I+ +E W + R+  +G   + L+ +F+
  S:   116 KPIYQANTYEEAKNRFKEFKENWQKRYPKVVATWEKDLDVLLTFLSYPSTIRPMIYTTNIIERTMKEIKKRTKTMNSLPNEKAAEKIVYLQAIDYNERWATRRLRGFGEAYEALQEMFK 234
>gi|90418145|ref|ZP_01226057.1| transposase, mutator family [Aurantimonas sp. SI85-9A1] >gi|90337817|gb|EAS51468.1| transposase, mutator family [Aurantimonas sp. SI85-9A1] (406 aa)
Score = 191, Expect = 1.6e-13, Identities = 41/118 (34%), Positives = 65/118 (55%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTE-KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           +K IY+A +   + KAL  F E +W  +Y    +SW     E+  F+ FP E+RR++YTTN IE +N  +R+  +A+G   + +A  KL++L L    + WK     W +   Q  IL+
  S:   279 LKDIYRAADAVAAEKALTAFEEGEWGHRYAAIGQSWRRAWAEVVPFYGFPEEVRRMVYTTNAIEALNSKLRRAVRARGHFPTDDAAMKLLFLVLNQSEKEWKMPPREWAMAKAQFAILY 397
>gi|116662217|ref|YP_829272.1| transposase, mutator type [Arthrobacter sp. FB24] >gi|116612969|gb|ABK05691.1| transposase, mutator type [Arthrobacter sp. FB24] (430 aa)
Score = 191, Expect = 1.8e-13, Identities = 45/120 (37%), Positives = 66/120 (55%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYL--RLINISENWKSRVA-NWGLILQQLKILFEN 120
           +K IY APN + +  AL+   E+W  KYG   + W N  EEL  F  +  EIRR+I +TN IE++N   R+  KA+G + +  A  K +YL  R ++ +   K+R A  W   L    I F +
  S:   300 VKPIYTAPNAEAARTALEELAERWGRKYGAIVRLWENAWEELIPFLDYDVEIRRVICSTNAIESLNARYRRAVKARGHLPTEQAALKCLYLVTRSLDPTGAGKTRWAVRWKPALNAFAITFSD 422
>gi|47076563|dbj|BAD18189.1| transposase of IS654 [Bacillus halodurans] (390 aa)
Score = 190, Expect = 2.0e-13, Identities = 39/118 (33%), Positives = 67/118 (56%)
  Q:     2 KKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKS-RVANWGLILQQLKILFE 119
           K IYQA  ++ +    K F E W  +Y     +W  +++ L TF  +P+ IR +IYTTN+IE   + I+K TK    + +  A  K++YL+ I+ +E W + R+  +G   + L+ +F+
  S:   266 KPIYQANTYEEAKNRFKEFKENWQKRYPKVVATWEKDLDVLLTFLSYPSTIRPMIYTTNIIERTMKEIKKRTKTMNSLPNEKAAEKIVYLQAIDYNERWATRRLRGFGEAYEALQEMFK 384
>gi|47076577|dbj|BAD18196.1| transposase of IS654 [Bacillus halodurans] (390 aa)
Score = 190, Expect = 2.0e-13, Identities = 39/118 (33%), Positives = 67/118 (56%)
  Q:     2 KKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKS-RVANWGLILQQLKILFE 119
           K IYQA  ++ +    K F E W  +Y     +W  +++ L TF  +P+ IR +IYTTN+IE   + I+K TK    + +  A  K++YL+ I+ +E W + R+  +G   + L+ +F+
  S:   266 KPIYQANTYEEAKNRFKEFKENWQKRYPKVVATWEKDLDVLLTFLSYPSTIRPMIYTTNIIERTMKEIKKRTKTMNSLPNEKAAEKIVYLQAIDYNERWATRRLRGFGEAYEALQEMFK 384
>gi|15612874|ref|NP_241177.1| transposase (04) [Bacillus halodurans C-125] >gi|15612919|ref|NP_241222.1| transposase (04) [Bacillus halodurans C-125] >gi|15612950|ref|NP_241253.1| transposase (04) [Bacillus halodurans C-125] >gi|15613478|ref|NP_241781.1| transposase (04) [Bacillus halodurans C-125] >gi|15614656|ref|NP_242959.1| transposase (04) [Bacillus halodurans C-125] >gi|15615527|ref|NP_243831.1| transposase (04) [Bacillus halodurans C-125] >gi|15616020|ref|NP_244325.1| transposase (04) [Bacillus halodurans C-125] >gi|15616226|ref|NP_244531.1| transposase (04) [Bacillus halodurans C-125] >gi|10172924|dbj|BAB04030.1| transposase (04) [Bacillus halodurans C-125] >gi|10172969|dbj|BAB04075.1| transposase (04) [Bacillus halodurans C-125] >gi|10173000|dbj|BAB04106.1| transposase (04) [Bacillus halodurans C-125] >gi|10173530|dbj|BAB04634.1| transposase (04) [Bacillus halodurans C-125] >gi|10174712|dbj|BAB05812.1| transposase (04) [Bacillus halodurans C-125] >gi|10175587|dbj|BAB06684.1| transposase (04) [Bacillus halodurans C-125] >gi|10176081|dbj|BAB07177.1| transposase (04) [Bacillus halodurans C-125] >gi|10176288|dbj|BAB07383.1| transposase (04) [Bacillus halodurans C-125] >gi|47076567|dbj|BAD18191.1| transposase of IS654 [Bacillus halodurans] >gi|47076569|dbj|BAD18192.1| transposase of IS654 [Bacillus halodurans] >gi|47076573|dbj|BAD18194.1| transposase of IS654 [Bacillus halodurans] >gi|47076575|dbj|BAD18195.1| transposase of IS654 [Bacillus halodurans] (390 aa)
Score = 190, Expect = 2.2e-13, Identities = 39/118 (33%), Positives = 67/118 (56%)
  Q:     2 KKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKS-RVANWGLILQQLKILFE 119
           K IYQA  ++ +    K F E W  +Y     +W  +++ L TF  +P+ IR +IYTTN+IE   + I+K TK    + +  A  K++YL+ I+ +E W + R+  +G   + L+ +F+
  S:   266 KPIYQANTYEEAKNRFKEFKENWQKRYPKVVATWEKDLDVLLTFLSYPSTIRPMIYTTNIIERTMKEIKKRTKTMNSLPNEKAAEKIVYLQAIDYNERWATRRLRGFGEAYEALQEMFK 384
>gi|134294370|ref|YP_001118105.1| transposase, mutator type [Burkholderia vietnamiensis G4] >gi|134137527|gb|ABO53270.1| transposase, mutator type [Burkholderia vietnamiensis G4] (422 aa)
Score = 190, Expect = 2.4e-13, Identities = 42/109 (38%), Positives = 67/109 (61%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTE-KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINI-------SENWKSRVANWGL 109
           ++ IY A + + + +AL+ F +  W +KY    +SW    E +  FF FP EIRR++YTTN IE++N  +RKI K +G   +  A  KL++L L N+       + +WKS +   G+
  S:   299 LRPIYAAASEEAARQALQDFADGPWGAKYPTIVQSWRRAWEHVIPFFVFPPEIRRVVYTTNAIESLNMQLRKIIKTRGHFPNDEAAIKLLWLALRNVLAKTVRAAFDWKSAMNQGGV 415
>gi|170734248|ref|YP_001766195.1| transposase mutator type [Burkholderia cenocepacia MC0-3] >gi|169817490|gb|ACA92073.1| transposase mutator type [Burkholderia cenocepacia MC0-3] (415 aa)
Score = 190, Expect = 2.5e-13, Identities = 38/96 (39%), Positives = 58/96 (60%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTE-KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINI 96
           ++ IY A + D + +AL+ F +  W  KY    +SW    E +  F+ FP EIRR++YTTN IE++N  +RKI K +G   +  A  KL++L L N+
  S:   299 LRPIYAAASEDAARQALQDFADGPWGEKYPTIVQSWQRAWEHVVPFYVFPPEIRRVVYTTNAIESLNMQLRKIIKTRGHFPNDEAAIKLLWLALRNV 395
>gi|114775608|ref|ZP_01451176.1| putative transposase [Mariprofundus ferrooxydans PV-1] >gi|114778621|ref|ZP_01453437.1| putative transposase [Mariprofundus ferrooxydans PV-1] >gi|114778792|ref|ZP_01453599.1| putative transposase [Mariprofundus ferrooxydans PV-1] >gi|114550923|gb|EAU53487.1| putative transposase [Mariprofundus ferrooxydans PV-1] >gi|114551086|gb|EAU53647.1| putative transposase [Mariprofundus ferrooxydans PV-1] >gi|114553719|gb|EAU56100.1| putative transposase [Mariprofundus ferrooxydans PV-1] (406 aa)
Score = 189, Expect = 2.7e-13, Identities = 39/122 (31%), Positives = 67/122 (54%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +++IYQ+   + + + L IF EKW  KY   +  W  +   L T F++P EIR++IYTTN IE++N  IRK  K +    +  A  K+++L +   ++ W   + +W   L +  I F + +
  S:   281 LRRIYQSVTVEEAERELDIFAEKWDGKYPSISIMWRRHWPNLITIFEYPDEIRKVIYTTNAIESLNSVIRKAIKNRKVFPNDQAAMKVVWLAIEAAAKKWTMPIRDWKAALNRFMIEFPDRM 402
>gi|84624620|ref|YP_451992.1| IS1113 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|84368560|dbj|BAE69718.1| IS1113 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] (394 aa)
Score = 189, Expect = 2.7e-13, Identities = 39/121 (32%), Positives = 71/121 (58%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENE 121
           +K+IYQ+   + +   L+    +W  KY    + W  N + +  FFQF  +IR++IYTTN IE++N  +RK+T+ +    + ++  K ++L +   S+NW+S + +W L LQ  +++F  E
  S:   268 LKRIYQSATAEEAAAELEALDTQWGDKYRAVVRLWRGNWDNIIPFFQFVPQIRKVIYTTNAIESLNMVMRKLTRNRRIFPNDDSALKSLFLAVREASKNWRS-IHHWKLALQSFQVMFGEE 387
>gi|5832446|emb|CAB54902.1| YPCD1.25 [Yersinia pestis CO92] (105 aa)
Score = 189, Expect = 2.8e-13, Identities = 40/99 (40%), Positives = 58/99 (58%)
  Q:    24 WSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           W  +Y    +SW      L+ +F++P  IR++IY TN IE+V+R  RK+TK KG   + N+L K +YL L+N  E W   + +W L L QL I FE  +
  S:     1 WGQQYPVVLQSWRKKWANLSCYFRYPTTIRKVIYMTNAIESVHRLFRKLTKTKGIFPNENSLLKSLYLGLMNAQERWTMPIQSWNLALSQLAIYFEGRL 99
>gi|47076695|dbj|BAD18260.1| transposase of IS654 [Bacillus alcalophilus] (390 aa)
Score = 188, Expect = 3.8e-13, Identities = 38/118 (32%), Positives = 67/118 (56%)
  Q:     2 KKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKS-RVANWGLILQQLKILFE 119
           K IYQA  ++ +    K F E W  +Y     +W  +++ L TF  +P+ IR +IYTTN+IE   + I+K T+    + +  A  K++YL+ I+ +E W + R+  +G   + L+ +F+
  S:   266 KPIYQANTYEEAKNRFKEFKENWQKRYPKVVATWEKDLDVLLTFLSYPSTIRPMIYTTNIIERTMKEIKKRTRTMNSLPNEKAAEKIVYLQAIDYNERWATRRLRGFGEAYEALQEMFK 384
>gi|134096660|ref|YP_001102321.1| transposase for IS3508i [Saccharopolyspora erythraea NRRL 2338] >gi|134098340|ref|YP_001104001.1| transposase for IS3508i [Saccharopolyspora erythraea NRRL 2338] >gi|133909283|emb|CAL99395.1| transposase for IS3508i [Saccharopolyspora erythraea NRRL 2338] >gi|133910963|emb|CAM01076.1| transposase for IS3508i [Saccharopolyspora erythraea NRRL 2338] (459 aa)
Score = 188, Expect = 4.2e-13, Identities = 39/98 (39%), Positives = 58/98 (59%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEK-WSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISE 98
           +K IY AP    +  AL  F E     KY  A ++W N  E    F +FP E+R++IYTTN IE++N  +RKI K +G   S +A+ KL++L + +I +
  S:   309 LKPIYTAPTAQAAETALLEFAESDLGRKYPAAVRTWENAWERFIPFLEFPPEVRKIIYTTNSIESLNYQLRKIIKNRGHFPSDDAVIKLLWLAIRDIED 407
>gi|134101596|ref|YP_001107257.1| transposase for IS3508i [Saccharopolyspora erythraea NRRL 2338] >gi|133914219|emb|CAM04332.1| transposase for IS3508i [Saccharopolyspora erythraea NRRL 2338] (459 aa)
Score = 188, Expect = 4.2e-13, Identities = 39/98 (39%), Positives = 58/98 (59%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEK-WSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISE 98
           +K IY AP    +  AL  F E     KY  A ++W N  E    F +FP E+R++IYTTN IE++N  +RKI K +G   S +A+ KL++L + +I +
  S:   309 LKPIYTAPTAQAAETALLEFAESDLGRKYPAAVRTWENAWERFIPFLEFPPEVRKIIYTTNSIESLNYQLRKIIKNRGHFPSDDAVIKLLWLAIRDIED 407
>gi|134098200|ref|YP_001103861.1| transposase [Saccharopolyspora erythraea NRRL 2338] >gi|133910823|emb|CAM00936.1| Transposase, mutator type [Saccharopolyspora erythraea NRRL 2338] (459 aa)
Score = 188, Expect = 4.2e-13, Identities = 39/98 (39%), Positives = 58/98 (59%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEK-WSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISE 98
           +K IY AP    +  AL  F E     KY  A ++W N  E    F +FP E+R++IYTTN IE++N  +RKI K +G   S +A+ KL++L + +I +
  S:   309 LKPIYTAPTAQAAETALLEFAESDLGRKYPAAVRTWENAWERFIPFLEFPPEVRKIIYTTNSIESLNYQLRKIIKNRGHFPSDDAVIKLLWLAIRDIED 407
>gi|118462670|ref|YP_881435.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118463114|ref|YP_882436.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118464275|ref|YP_882160.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118466417|ref|YP_882162.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118163957|gb|ABK64854.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118164401|gb|ABK65298.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118165562|gb|ABK66459.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118167704|gb|ABK68601.1| transposase, Mutator family protein [Mycobacterium avium 104] (424 aa)
Score = 188, Expect = 4.2e-13, Identities = 39/98 (39%), Positives = 58/98 (59%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISE 98
           ++ IY A     +  AL+ F  +W +K   A   W+ +  E   F  FP EIR++IYTTN IE++N  +RK+TKA+G   S  A  KL+YL + NI++
  S:   297 LRPIYTAATEQAAAVALEQFRTEWKAKSPGAVAVWDRSWAEFVPFLAFPVEIRKIIYTTNAIESLNYQLRKVTKARGSFPSDAAAMKLLYLAIRNINQ 394
>gi|134098898|ref|YP_001104559.1| transposase for IS3508i [Saccharopolyspora erythraea NRRL 2338] >gi|133911521|emb|CAM01634.1| transposase for IS3508i [Saccharopolyspora erythraea NRRL 2338] (459 aa)
Score = 187, Expect = 5.1e-13, Identities = 39/98 (39%), Positives = 57/98 (58%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEK-WSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISE 98
           +K IY AP    +  AL  F E     KY  A ++W N  E    F  FP E+R++IYTTN IE++N  +RKI K +G   S +A+ KL++L + +I +
  S:   309 LKPIYTAPTVQAAETALLEFAESDLGRKYPAAVRTWENAWERFIPFLSFPPEVRKIIYTTNSIESLNYQLRKIIKNRGHFPSDDAVIKLLWLAIRDIED 407
>gi|67459847|ref|YP_247470.1| transposase [Rickettsia felis URRWXCal2] >gi|67459892|ref|YP_247514.1| transposase [Rickettsia felis URRWXCal2] >gi|67005380|gb|AAY62305.1| Transposase [Rickettsia felis URRWXCal2] >gi|67005425|gb|AAY62349.1| Transposase [Rickettsia felis URRWXCal2] (230 aa)
Score = 186, Expect = 6.8e-13, Identities = 44/122 (36%), Positives = 67/122 (54%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +K IY A     ++ AL+ F  KWS +Y    KSW  + + L     +P EIR++IYTTN +E+VN  +RK+TK K    + NA+ K +YL +  +++ W   + NW   +    I FE  I
  S:   110 LKPIYTANTEKEALSALEAFESKWSKQYPQIAKSWYIHWDNLM-ILGYPEEIRKIIYTTNAVESVNSQLRKVTKNKRLFPNDNAVFKSLYLAIDYMTKKWSMPIPNWNAAMAHFLIKFEERI 230
>gi|92115742|ref|YP_575471.1| transposase, mutator type [Nitrobacter hamburgensis X14] >gi|92118496|ref|YP_578225.1| transposase, mutator type [Nitrobacter hamburgensis X14] >gi|91798636|gb|ABE61011.1| transposase, mutator type [Nitrobacter hamburgensis X14] >gi|91801390|gb|ABE63765.1| transposase, mutator type [Nitrobacter hamburgensis X14] (407 aa)
Score = 186, Expect = 7.1e-13, Identities = 43/118 (36%), Positives = 65/118 (55%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTE-KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           +K IY+A + D + KAL  F    W  +Y    +SW     E+  FF FP E+RR++YTTN IE +N  +R+  +A+G   S +A +KL+YL L    + WK     W +   Q  ++F
  S:   279 LKDIYRAVDADAAEKALAAFEAGPWGQRYPAIGQSWRRAWGEVIPFFAFPDEVRRIVYTTNSIEALNSKLRRAVRARGHFPSDDAATKLLYLILNRSEKEWKMPPREWTMAKAQFAVIF 397
>gi|116255016|ref|YP_770851.1| putative transposase-like protein [Rhizobium leguminosarum bv. viciae 3841] >gi|115259664|emb|CAK11649.1| putative transposase-like protein [Rhizobium leguminosarum bv. viciae 3841] (382 aa)
Score = 184, Expect = 1.1e-12, Identities = 41/120 (34%), Positives = 60/120 (50%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEK-WSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFEN 120
           +K IY A +   +  AL  F    W  K+    + W    +E+  FF FP ++RR+IYTTN IE +N  +R+   A+G   S  A +KL+YL L    + WK     W +   Q  IL  +
  S:   255 LKSIYGAIDDKAAEAALTTFENGFWGRKFPAIAQIWRRAWQEVIPFFAFPKDVRRIIYTTNAIEALNSKLRRAVPARGHFPSDEAATKLLYLVLNRSEKEWKMPPREWTMAKSQFAILLAD 375
>gi|148244112|ref|YP_001220348.1| transposase, mutator type [Acidiphilium cryptum JF-5] >gi|146400675|gb|ABQ29206.1| transposase, mutator type [Acidiphilium cryptum JF-5] (375 aa)
Score = 183, Expect = 1.4e-12, Identities = 35/95 (36%), Positives = 52/95 (54%)
  Q:    24 WSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           W  KY    +SW    +E+  FF FP E+RR+IYTTN IE +N  +R+  +A+G   S  A +KL+YL L    ++W      W +   Q  ++F
  S:   271 WGQKYPAIGQSWRRVWQEVIPFFSFPGEVRRIIYTTNAIEALNSKLRRAIRARGHFPSDEAAAKLLYLILNRSEKDWVMPPREWAMAKAQFALIF 365
>gi|22126308|ref|NP_669731.1| transposase [Yersinia pestis KIM] >gi|108807257|ref|YP_651173.1| putative transposase [Yersinia pestis Antiqua] >gi|108812401|ref|YP_648168.1| transposase [Yersinia pestis Nepal516] >gi|145598534|ref|YP_001162610.1| transposase [Yersinia pestis Pestoides F] >gi|167467990|ref|ZP_02332694.1| transposase [Yersinia pestis FV-1] >gi|170024516|ref|YP_001721021.1| transposase [Yersinia pseudotuberculosis YPIII] >gi|21959287|gb|AAM85982.1|AE013846_13 putative transposase [Yersinia pestis KIM] >gi|108776049|gb|ABG18568.1| transposase [Yersinia pestis Nepal516] >gi|108779170|gb|ABG13228.1| putative transposase [Yersinia pestis Antiqua] >gi|145210230|gb|ABP39637.1| transposase [Yersinia pestis Pestoides F] >gi|169751050|gb|ACA68568.1| transposase [Yersinia pseudotuberculosis YPIII] (112 aa)
Score = 183, Expect = 1.4e-12, Identities = 39/107 (36%), Positives = 61/107 (57%)
  Q:    16 ALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           AL  F E W  KY   +K W  + E L TFF +P +IR+ IYTTN IE++N  IR+  K +    + +++ K+IYL + ++S+ W   + NW L +    I F + +
  S:     2 ALDKFAEAWDDKYPKISKIWRTHWENLNTFFGYPPDIRKAIYTTNAIESLNSVIRQAIKKRKVFPTDDSVRKVIYLAIRDVSKKWSMPIQNWRLAMSCFIIEFGDRL 108
>gi|84624248|ref|YP_451620.1| IS1113 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|84368188|dbj|BAE69346.1| IS1113 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] (394 aa)
Score = 183, Expect = 1.6e-12, Identities = 38/121 (31%), Positives = 70/121 (57%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENE 121
           +K+IYQ+   + +   L+    +W  KY    + W  N + +  FFQF  +IR++IYTTN IE++N  +RK+T+ +    + ++  K ++L +   S+NW+S + +W   LQ  +++F  E
  S:   268 LKRIYQSATAEEAAAELEALDTQWGDKYRAVVRLWRGNWDNIIPFFQFVPQIRKVIYTTNAIESLNMVMRKLTRNRRIFPNDDSALKSLFLAVREASKNWRS-IHHWKPALQSFQVMFGEE 387
>gi|84622372|ref|YP_449744.1| IS1113 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|27762619|gb|AAO20849.1| putative IS1113 transposase [Xanthomonas oryzae pv. oryzae] >gi|84366312|dbj|BAE67470.1| IS1113 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] (394 aa)
Score = 182, Expect = 1.7e-12, Identities = 38/121 (31%), Positives = 70/121 (57%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENE 121
           +K+IYQ+   + +   L+    +W  KY    + W  N + +  FFQF  +IR++IYTTN IE++N  +RK+T+ +    + ++  K ++L +   S+NW+S + +W   LQ  +++F  E
  S:   268 LKRIYQSATAEEAAAELEALDTQWGDKYRAVVRLWRGNWDNIIPFFQFVPQIRKVIYTTNAIESLNMVMRKLTRNRRIFPNDDSALKSLFLAVREASKNWRS-IHHWKPALQSFQVMFGEE 387
>gi|122879047|ref|YP_199426.6| IS1113 transposase [Xanthomonas oryzae pv. oryzae KACC10331] (401 aa)
Score = 182, Expect = 1.7e-12, Identities = 38/121 (31%), Positives = 70/121 (57%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENE 121
           +K+IYQ+   + +   L+    +W  KY    + W  N + +  FFQF  +IR++IYTTN IE++N  +RK+T+ +    + ++  K ++L +   S+NW+S + +W   LQ  +++F  E
  S:   275 LKRIYQSATAEEAAAELEALDTQWGDKYRAVVRLWRGNWDNIIPFFQFVPQIRKVIYTTNAIESLNMVMRKLTRNRRIFPNDDSALKSLFLAVREASKNWRS-IHHWKPALQSFQVMFGEE 394
>gi|58425004|gb|AAW74041.1| putative IS1113 transposase [Xanthomonas oryzae pv. oryzae KACC10331] (414 aa)
Score = 182, Expect = 1.7e-12, Identities = 38/121 (31%), Positives = 70/121 (57%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENE 121
           +K+IYQ+   + +   L+    +W  KY    + W  N + +  FFQF  +IR++IYTTN IE++N  +RK+T+ +    + ++  K ++L +   S+NW+S + +W   LQ  +++F  E
  S:   288 LKRIYQSATAEEAAAELEALDTQWGDKYRAVVRLWRGNWDNIIPFFQFVPQIRKVIYTTNAIESLNMVMRKLTRNRRIFPNDDSALKSLFLAVREASKNWRS-IHHWKPALQSFQVMFGEE 407
>gi|148244114|ref|YP_001220350.1| transposase, mutator type [Acidiphilium cryptum JF-5] >gi|146400677|gb|ABQ29208.1| transposase, mutator type [Acidiphilium cryptum JF-5] (407 aa)
Score = 182, Expect = 1.8e-12, Identities = 35/95 (36%), Positives = 51/95 (53%)
  Q:    24 WSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           W  KY    +SW    +E+  FF FP E+RR+IYTTN IE +N  +R+  +A+G   S  A +KL+YL L    + W      W +   Q  ++F
  S:   303 WGQKYPAIGQSWRRVWQEVIPFFSFPGEVRRIIYTTNAIEALNSKLRRAIRARGHFPSDEAAAKLLYLILNRSEKEWVMPPREWAMAKAQFALIF 397
>gi|153953195|ref|YP_001393960.1| transposase [Clostridium kluyveri DSM 555] >gi|146346076|gb|EDK32612.1| Transposase [Clostridium kluyveri DSM 555] (268 aa)
Score = 182, Expect = 1.9e-12, Identities = 35/106 (33%), Positives = 61/106 (57%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVAN 106
           +K IYQAP+ ++  + +++  EKW  KY     SW+ N + ++  F+F  ++R++IYTTN IE++N   R++   +    S  AL K +YL     ++ W S + N
  S:   163 LKTIYQAPSEEIGHRNMEVVAEKWQDKYPGTMNSWSKNWDAISPIFKFSTDVRKVIYTTNAIESLNSTYRRLNSQRSVFPSDTALLKALYLATFEATKKWTSVLRN 268
>gi|120403640|ref|YP_953469.1| transposase, mutator type [Mycobacterium vanbaalenii PYR-1] >gi|120404397|ref|YP_954226.1| transposase, mutator type [Mycobacterium vanbaalenii PYR-1] >gi|119956458|gb|ABM13463.1| transposase, mutator type [Mycobacterium vanbaalenii PYR-1] >gi|119957215|gb|ABM14220.1| transposase, mutator type [Mycobacterium vanbaalenii PYR-1] (451 aa)
Score = 181, Expect = 2.4e-12, Identities = 47/122 (38%), Positives = 71/122 (58%)
  Q:     1 MKKIYQAPNFDVSMKALKIFT-EKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINI-----SENWKSR-----------------VANWGLILQQLKILFENEI 122
           +K IY APN + +   L  FT  +   K    T+ +    E+   F  FP E+RR+IYTTN IE++N  +RK+TK +G   +  A  KL++L + NI     +E  K R                 V NW   L+QL +++ + I
  S:   303 LKPIYTAPNAEAARAELDAFTASELGKKNPTVTRVFERAWEQFIPFLAFPPELRRVIYTTNSIESLNYQLRKVTKTRGQFPNDAAAVKLLWLAICNIEDKRAAERAKERKQKRCRTAPGRLVEGQVVTNWKKALEQLVLVYPDRI 447
>gi|78065468|ref|YP_368237.1| transposase and inactivated derivatives-like [Burkholderia sp. 383] >gi|77966213|gb|ABB07593.1| transposase and inactivated derivatives-like [Burkholderia sp. 383] (171 aa)
Score = 180, Expect = 2.9e-12, Identities = 36/96 (37%), Positives = 54/96 (56%)
  Q:    23 KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           +W  K+      W    E++  FF +P E+RR++YTTN IE+++  +RKI K +G   S  A SKL++L L  I ++WK     W   + Q  ILF
  S:    67 EWGRKFPTVAAMWQRQWEQVIPFFAYPPEVRRIVYTTNAIESMHMQLRKIVKNRGHFPSDEAASKLLFLALRIIEKDWKMPPITWRQAVNQFAILF 162
>gi|19717573|gb|AAL96208.1|AF482989_1 putative transposase [Xanthomonas oryzae pv. oryzae] (394 aa)
Score = 180, Expect = 3.5e-12, Identities = 37/118 (31%), Positives = 69/118 (58%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           +K+IYQ+   + +   L+    +W  KY    + W  N + +  FFQF  +IR++IYTTN IE++N  +RK+T+ +    + ++  K ++L +   S+NW+S + +W   LQ  +++F
  S:   268 LKRIYQSATAEEAAAELEALDTQWGDKYRAVVRLWRGNWDNIIPFFQFVPQIRKVIYTTNAIESLNMVMRKLTRNRRIFPNDDSALKSLFLAVREASKNWRS-IHHWKPALQSFQVMF 384
>gi|37519902|ref|NP_923279.1| putative transposase [Gloeobacter violaceus PCC 7421] >gi|35210894|dbj|BAC88274.1| glr0333 [Gloeobacter violaceus PCC 7421] (405 aa)
Score = 180, Expect = 3.5e-12, Identities = 37/122 (30%), Positives = 64/122 (52%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           ++ IY A   D +   L++  EKW   Y    + W  N   +   F+F  +IR++IYTTN IE++N  IRK+++    + +  ++ K++YL + N  + W   +  W   L +L I FE  +
  S:   282 LRSIYSAATEDEAELHLELLREKWDKPYPSVGRMWRENWSRVIPIFRFGEDIRKVIYTTNAIESLNMTIRKVSRNHRIMPNDESVMKMVYLAIQNQMKKWTMPIRAWRPALNRLMIEFEGRL 403
>gi|82913654|ref|XP_728730.1| transposase [Plasmodium yoelii yoelii str. 17XNL] >gi|23485229|gb|EAA20295.1| transposase, Mutator family [Plasmodium yoelii yoelii] (411 aa)
Score = 180, Expect = 3.5e-12, Identities = 39/116 (33%), Positives = 62/116 (53%)
  Q:     1 MKKIYQAPNFD---VSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKI 116
           +K IY AP+ +   V + AL+     W  K+     +W    + +  FF F   +RR+IYTTN IE+++  +RKI K +G   +  A +KL++L L NI+ +W      W   + Q  I
  S:   294 LKPIYTAPSAEAAAVELDALE--AGPWGQKFPTVVATWRRAWDRVIPFFAFSPAVRRVIYTTNAIESLHSQLRKIIKTRGHFPNDEAATKLLWLALRNITADWGRAAREWKDAMNQFAI 410
>gi|58424420|gb|AAW73457.1| putative IS1113 transposase [Xanthomonas oryzae pv. oryzae KACC10331] (339 aa)
Score = 180, Expect = 3.6e-12, Identities = 38/121 (31%), Positives = 70/121 (57%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENE 121
           +K+IYQ+   + +   L+    +W  KY    + W  N + +  FFQF  +IR++IYTTN IE++N  +RK+T+ +    + ++  K ++L +   S+NW+S + +W   LQ  +++F  E
  S:   213 LKRIYQSATAEEAAAELEALDTQWGDKYRAVVRLWRGNWDNIIPFFQFVPQIRKVIYTTNAIESLNMVMRKLTRNRRIFPNDDSALKSLFLAVREASKNWRS-IHHWKPALQSFQVMFGEE 332
>gi|53802661|ref|YP_112568.1| ISMca5, transposase [Methylococcus capsulatus str. Bath] >gi|53804473|ref|YP_113683.1| ISMca5, transposase [Methylococcus capsulatus str. Bath] >gi|53756422|gb|AAU90713.1| ISMca5, transposase [Methylococcus capsulatus str. Bath] >gi|53758234|gb|AAU92525.1| ISMca5, transposase [Methylococcus capsulatus str. Bath] (411 aa)
Score = 179, Expect = 3.7e-12, Identities = 39/116 (33%), Positives = 62/116 (53%)
  Q:     1 MKKIYQAPNFD---VSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKI 116
           +K IY AP+ +   V + AL+     W  K+     +W    + +  FF F   +RR+IYTTN IE+++  +RKI K +G   +  A +KL++L L NI+ +W      W   + Q  I
  S:   294 LKPIYTAPSAEAAAVELDALE--AGPWGQKFPTVVATWRRAWDRVIPFFAFSPAVRRVIYTTNAIESLHSQLRKIIKTRGHFPNDEAATKLLWLALRNITADWGRAAREWKDAMNQFAI 410
>gi|148259307|ref|YP_001233434.1| transposase, mutator type [Acidiphilium cryptum JF-5] >gi|146400988|gb|ABQ29515.1| transposase, mutator type [Acidiphilium cryptum JF-5] (407 aa)
Score = 179, Expect = 3.7e-12, Identities = 34/95 (35%), Positives = 51/95 (53%)
  Q:    24 WSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           W  KY    +SW    +E+  FF FP ++RR+IYTTN IE +N  +R+  +A+G   S  A +KL+YL L    + W      W +   Q  ++F
  S:   303 WGQKYPAIGQSWRRVWQEVIPFFGFPGDVRRIIYTTNAIEALNSKLRRAIRARGHFPSDEAAAKLLYLILNRSEKEWVMPPREWAMAKAQFAVIF 397
>gi|51596233|ref|YP_070424.1| putative transposase (IS285) [Yersinia pseudotuberculosis IP 32953] >gi|186895263|ref|YP_001872375.1| putative transposase (IS285) [Yersinia pseudotuberculosis PB1/+] >gi|51589515|emb|CAH21143.1| putative transposase (IS285) [Yersinia pseudotuberculosis IP 32953] >gi|186698289|gb|ACC88918.1| putative transposase (IS285) [Yersinia pseudotuberculosis PB1/+] (112 aa)
Score = 179, Expect = 4.1e-12, Identities = 38/106 (35%), Positives = 60/106 (56%)
  Q:    17 LKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           L  F E W  KY   +K W  + E L TFF +P +IR+ IYTTN IE++N  IR+  K +    + +++ K+IYL + ++S+ W   + NW L +    I F + +
  S:     3 LDKFAEAWDDKYPKISKIWRTHWENLNTFFGYPPDIRKAIYTTNAIESLNSVIRQAIKKRKVFPTDDSVRKVIYLAIRDVSKKWSMPIQNWRLAMSCFIIEFGDRL 108
>gi|148243735|ref|YP_001219975.1| transposase, mutator type [Acidiphilium cryptum JF-5] >gi|146400298|gb|ABQ28833.1| transposase, mutator type [Acidiphilium cryptum JF-5] (407 aa)
Score = 179, Expect = 4.8e-12, Identities = 34/95 (35%), Positives = 51/95 (53%)
  Q:    24 WSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           W  KY    +SW    +E+  FF FP ++RR+IYTTN IE +N  +R+  +A+G   S  A +KL+YL L    + W      W +   Q  ++F
  S:   303 WGQKYPAIGQSWRRVWQEVIPFFGFPGDVRRIIYTTNAIEALNSKLRRAIRARGHFPSDEAAAKLLYLILNRSEKEWVMPPREWAMAKAQFAVIF 397
>gi|148243766|ref|YP_001220006.1| transposase, mutator type [Acidiphilium cryptum JF-5] >gi|146400329|gb|ABQ28864.1| transposase, mutator type [Acidiphilium cryptum JF-5] (407 aa)
Score = 178, Expect = 5.7e-12, Identities = 33/95 (34%), Positives = 50/95 (52%)
  Q:    24 WSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           W  KY    +SW    +E+  FF FP E+RR++YTTN IE +N  +R+  + +G   S  A +KL+YL L    + W      W +   Q  ++F
  S:   303 WGQKYPAIGQSWRRVWQEVIPFFSFPGEVRRIVYTTNAIEALNSKLRRAIRVRGHFPSDEAAAKLLYLILNRSEKEWVMPPREWAMAKAQFAVIF 397
>gi|122879208|ref|YP_201386.6| IS1113 transposase [Xanthomonas oryzae pv. oryzae KACC10331] (400 aa)
Score = 177, Expect = 7.9e-12, Identities = 37/121 (30%), Positives = 69/121 (57%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENE 121
           +K+IYQ+   + +   L+    +W  KY    + W  N + +  F QF  +IR++IYTTN IE++N  +RK+T+ +    + ++  K ++L +   S+NW+S + +W   LQ  +++F  E
  S:   274 LKRIYQSATAEEAAAELEALDTQWGDKYRAVVRLWRGNWDNIIPFLQFVPQIRKVIYTTNAIESLNMVMRKLTRNRRIFPNDDSALKSLFLAVREASKNWRS-IHHWKPALQSFQVMFGEE 393
>gi|58426964|gb|AAW76001.1| putative IS1113 transposase [Xanthomonas oryzae pv. oryzae KACC10331] (413 aa)
Score = 177, Expect = 7.9e-12, Identities = 37/121 (30%), Positives = 69/121 (57%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENE 121
           +K+IYQ+   + +   L+    +W  KY    + W  N + +  F QF  +IR++IYTTN IE++N  +RK+T+ +    + ++  K ++L +   S+NW+S + +W   LQ  +++F  E
  S:   287 LKRIYQSATAEEAAAELEALDTQWGDKYRAVVRLWRGNWDNIIPFLQFVPQIRKVIYTTNAIESLNMVMRKLTRNRRIFPNDDSALKSLFLAVREASKNWRS-IHHWKPALQSFQVMFGEE 406
>gi|84623634|ref|YP_451006.1| IS1113 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|84367574|dbj|BAE68732.1| IS1113 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] (394 aa)
Score = 177, Expect = 8.1e-12, Identities = 37/121 (30%), Positives = 69/121 (57%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENE 121
           +K+IYQ+   + +   L+    +W  KY    + W  N + +  F QF  +IR++IYTTN IE++N  +RK+T+ +    + ++  K ++L +   S+NW+S + +W   LQ  +++F  E
  S:   268 LKRIYQSATAEEAAAELEALDTQWGDKYRAVVRLWRGNWDNIIPFLQFVPQIRKVIYTTNAIESLNMVMRKLTRNRRIFPNDDSALKSLFLAVREASKNWRS-IHHWKPALQSFQVMFGEE 387
>gi|58426504|gb|AAW75541.1| putative IS1113 transposase [Xanthomonas oryzae pv. oryzae KACC10331] >gi|58426688|gb|AAW75725.1| putative IS1113 transposase [Xanthomonas oryzae pv. oryzae KACC10331] (413 aa)
Score = 177, Expect = 8.1e-12, Identities = 37/121 (30%), Positives = 69/121 (57%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENE 121
           +K+IYQ+   + +   L+    +W  KY    + W  N + +  F QF  +IR++IYTTN IE++N  +RK+T+ +    + ++  K ++L +   S+NW+S + +W   LQ  +++F  E
  S:   287 LKRIYQSATAEEAAAELEALDTQWGDKYRAVVRLWRGNWDNIIPFLQFVPQIRKVIYTTNAIESLNMVMRKLTRNRRIFPNDDSALKSLFLAVREASKNWRS-IHHWKPALQSFQVMFGEE 406
>gi|84623823|ref|YP_451195.1| IS1113 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|84624000|ref|YP_451372.1| IS1113 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|84367763|dbj|BAE68921.1| IS1113 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|84367940|dbj|BAE69098.1| IS1113 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] (394 aa)
Score = 177, Expect = 8.1e-12, Identities = 37/121 (30%), Positives = 69/121 (57%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENE 121
           +K+IYQ+   + +   L+    +W  KY    + W  N + +  F QF  +IR++IYTTN IE++N  +RK+T+ +    + ++  K ++L +   S+NW+S + +W   LQ  +++F  E
  S:   268 LKRIYQSATAEEAAAELEALDTQWGDKYRAVVRLWRGNWDNIIPFLQFVPQIRKVIYTTNAIESLNMVMRKLTRNRRIFPNDDSALKSLFLAVREASKNWRS-IHHWKPALQSFQVMFGEE 387
>gi|84622929|ref|YP_450301.1| IS1113 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|84366869|dbj|BAE68027.1| IS1113 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] (394 aa)
Score = 177, Expect = 8.1e-12, Identities = 37/121 (30%), Positives = 69/121 (57%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENE 121
           +K+IYQ+   + +   L+    +W  KY    + W  N + +  F QF  +IR++IYTTN IE++N  +RK+T+ +    + ++  K ++L +   S+NW+S + +W   LQ  +++F  E
  S:   268 LKRIYQSATAEEAAAELEALDTQWGDKYRAVVRLWRGNWDNIIPFLQFVPQIRKVIYTTNAIESLNMVMRKLTRNRRIFPNDDSALKSLFLAVREASKNWRS-IHHWKPALQSFQVMFGEE 387
>gi|84625610|ref|YP_452982.1| IS1113 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|84369550|dbj|BAE70708.1| IS1113 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] (394 aa)
Score = 177, Expect = 8.2e-12, Identities = 37/121 (30%), Positives = 69/121 (57%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENE 121
           +K+IYQ+   + +   L+    +W  KY    + W  N + +  F QF  +IR++IYTTN IE++N  +RK+T+ +    + ++  K ++L +   S+NW+S + +W   LQ  +++F  E
  S:   268 LKRIYQSATAEEAAAELEALDTQWGDKYRAVVRLWRGNWDNIIPFLQFVPQIRKVIYTTNAIESLNMVMRKLTRNRRIFPNDDSALKSLFLAVREASKNWRS-IHHWKPALQSFQVMFGEE 387
>gi|122879192|ref|YP_201110.6| IS1113 transposase [Xanthomonas oryzae pv. oryzae KACC10331] (400 aa)
Score = 176, Expect = 8.4e-12, Identities = 37/121 (30%), Positives = 69/121 (57%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENE 121
           +K+IYQ+   + +   L+    +W  KY    + W  N + +  F QF  +IR++IYTTN IE++N  +RK+T+ +    + ++  K ++L +   S+NW+S + +W   LQ  +++F  E
  S:   274 LKRIYQSATAEEAAAELEALDTQWGDKYRAVVRLWRGNWDNIIPFLQFVPQIRKVIYTTNAIESLNMVMRKLTRNRRIFPNDDSALKSLFLAVREASKNWRS-IHHWKPALQSFQVMFGEE 393
>gi|148243899|ref|YP_001220138.1| transposase, mutator type [Acidiphilium cryptum JF-5] >gi|146400462|gb|ABQ28996.1| transposase, mutator type [Acidiphilium cryptum JF-5] (407 aa)
Score = 176, Expect = 9.0e-12, Identities = 33/95 (34%), Positives = 51/95 (53%)
  Q:    24 WSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           W  KY    +SW    +E+  FF FP ++RR+IYTTN IE +N  +R+  +A+G   S  A ++L+YL L    + W      W +   Q  ++F
  S:   303 WGQKYPAIGQSWRRVWQEVIPFFGFPGDVRRIIYTTNAIEALNSKLRRAIRARGHFPSDEAAARLLYLILNRSEKEWVMPPREWAMAKAQFAVIF 397
>gi|51593888|ref|YP_068455.1| putative transposase remnant [Yersinia pseudotuberculosis IP 32953] >gi|108793680|ref|YP_636832.1| protein 25 [Yersinia pestis Antiqua] >gi|145597160|ref|YP_001154624.1| hypothetical protein YPDSF_3997 [Yersinia pestis Pestoides F] >gi|162417735|ref|YP_001604456.1| putative transposase, truncation [Yersinia pestis Angola] >gi|2996258|gb|AAC62581.1| putative transposase [Yersinia pestis KIM] >gi|51591585|emb|CAF25389.1| putative transposase remnant [Yersinia pseudotuberculosis IP 32953] >gi|108782227|gb|ABG16282.1| protein 25 [Yersinia pestis Antiqua] >gi|145212928|gb|ABP42334.1| hypothetical protein YPDSF_3997 [Yersinia pestis Pestoides F] >gi|162354755|gb|ABX88702.1| putative transposase, truncation [Yersinia pestis Angola] (99 aa)
Score = 175, Expect = 1.1e-11, Identities = 38/90 (42%), Positives = 55/90 (61%)
  Q:    33 KSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +SW      L+ +F++P  IR++IY TN IE+V+R  RK+TK KG   + N+L K +YL L+N  E W   + +W L L QL I FE  +
  S:     4 QSWRKKWANLSCYFRYPTTIRKVIYMTNAIESVHRLFRKLTKTKGIFPNENSLLKSLYLGLMNAQERWTMPIQSWNLALSQLAIYFEGRL 93
>gi|58582741|ref|YP_201757.1| IS1113 transposase [Xanthomonas oryzae pv. oryzae KACC10331] >gi|58427335|gb|AAW76372.1| putative IS1113 transposase [Xanthomonas oryzae pv. oryzae KACC10331] (356 aa)
Score = 175, Expect = 1.2e-11, Identities = 37/121 (30%), Positives = 69/121 (57%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENE 121
           +K+IYQ+   + +   L+    +W  KY    + W  N + +  F QF  +IR++IYTTN IE++N  +RK+T+ +    + ++  K ++L +   S+NW+S + +W   LQ  +++F  E
  S:   230 LKRIYQSATAEEAAAELEALDTQWGDKYRAVVRLWRGNWDNIIPFLQFVPQIRKVIYTTNAIESLNMVMRKLTRNRRIFPNDDSALKSLFLAVREASKNWRS-IHHWKPALQSFQVMFGEE 349
>gi|161523536|ref|YP_001578548.1| transposase mutator type [Burkholderia multivorans ATCC 17616] >gi|189351692|ref|YP_001947320.1| ISBmu12e transposase [Burkholderia multivorans ATCC 17616] >gi|160340965|gb|ABX14051.1| transposase mutator type [Burkholderia multivorans ATCC 17616] >gi|189335714|dbj|BAG44784.1| ISBmu12e transposase [Burkholderia multivorans ATCC 17616] (419 aa)
Score = 175, Expect = 1.4e-11, Identities = 41/118 (34%), Positives = 67/118 (56%)
  Q:     1 MKKIYQAPNFDVSMKALKIF-TEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           +K++YQAP+ + +  AL  F T  W +KY      W    +++  F+ F  +IR+++YTTN IE+++  +RKI KA+G   S  A  KLI+L L N+   W     +W   + Q  +L+
  S:   293 LKEVYQAPSAEAAAVALDAFDTSPWGTKYPPIAALWRRAWDQVIPFYAFAPDIRKIVYTTNAIESLHMQLRKIIKARGHFPSDEAALKLIWLALRNVVAKWTGSRHDWKSAMTQFALLY 411
>gi|148259816|ref|YP_001233943.1| transposase, mutator type [Acidiphilium cryptum JF-5] >gi|146401497|gb|ABQ30024.1| transposase, mutator type [Acidiphilium cryptum JF-5] (407 aa)
Score = 174, Expect = 1.5e-11, Identities = 33/95 (34%), Positives = 50/95 (52%)
  Q:    24 WSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           W  KY    +SW    +E+  FF FP ++RR+IYTTN IE +N  +R+  + +G   S  A +KL+YL L    + W      W +   Q  ++F
  S:   303 WGQKYPAIGQSWRRVWQEVIPFFGFPGDVRRIIYTTNAIEALNSKLRRAIRVRGHFPSDEAAAKLLYLILNRSEKEWVMPPREWAMAKAQFAVIF 397
>gi|122879097|ref|YP_200025.6| IS1113 transposase [Xanthomonas oryzae pv. oryzae KACC10331] (400 aa)
Score = 174, Expect = 1.5e-11, Identities = 37/121 (30%), Positives = 68/121 (56%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENE 121
           +K+IYQ+   + +   L+    +W  KY      W  N + +  F QF  +IR++IYTTN IE++N  +RK+T+ +    + ++  K ++L +   S+NW+S + +W   LQ  +++F  E
  S:   274 LKRIYQSATAEEAAAELEALDTQWGDKYRAVVSLWRGNWDNIIPFLQFVPQIRKVIYTTNAIESLNMVMRKLTRNRRIFPNDDSALKSLFLAVREASKNWRS-IHHWKPALQSFQVMFGEE 393
>gi|58425603|gb|AAW74640.1| putative IS1113 transposase [Xanthomonas oryzae pv. oryzae KACC10331] (413 aa)
Score = 174, Expect = 1.5e-11, Identities = 37/121 (30%), Positives = 68/121 (56%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENE 121
           +K+IYQ+   + +   L+    +W  KY      W  N + +  F QF  +IR++IYTTN IE++N  +RK+T+ +    + ++  K ++L +   S+NW+S + +W   LQ  +++F  E
  S:   287 LKRIYQSATAEEAAAELEALDTQWGDKYRAVVSLWRGNWDNIIPFLQFVPQIRKVIYTTNAIESLNMVMRKLTRNRRIFPNDDSALKSLFLAVREASKNWRS-IHHWKPALQSFQVMFGEE 406
>gi|148259788|ref|YP_001233915.1| transposase, mutator type [Acidiphilium cryptum JF-5] >gi|146401469|gb|ABQ29996.1| transposase, mutator type [Acidiphilium cryptum JF-5] (407 aa)
Score = 174, Expect = 1.5e-11, Identities = 33/95 (34%), Positives = 50/95 (52%)
  Q:    24 WSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           W  KY    +SW    +E+  FF FP ++RR+IYTTN IE +N  +R+  + +G   S  A +KL+YL L    + W      W +   Q  ++F
  S:   303 WGQKYPAIGQSWRRVWQEVIPFFGFPGDVRRIIYTTNAIEALNSKLRRAIRVRGHFPSDEAAAKLLYLILNRSEKEWVMPPREWAMAKAQFAVIF 397
>gi|84621837|ref|YP_449209.1| IS1113 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|84365777|dbj|BAE66935.1| IS1113 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] (331 aa)
Score = 174, Expect = 1.7e-11, Identities = 37/121 (30%), Positives = 69/121 (57%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENE 121
           +K+IYQ+   + +   L+    +W  KY    + W  N + +  F QF  +IR++IYTTN IE++N  +RK+T+ +    + ++  K ++L +   S+NW+S + +W   LQ  +++F  E
  S:   205 LKRIYQSATAEEAAAELEALDTQWGDKYRAVVRLWRGNWDNIIPFLQFVPQIRKVIYTTNAIESLNMVMRKLTRNRRIFPNDDSALKSLFLAVREASKNWRS-IHHWKPALQSFQVMFGEE 324
>gi|126458448|ref|YP_001076769.1| isrso7-transposase [Burkholderia pseudomallei 1106a] >gi|167850950|ref|ZP_02476458.1| isrso7-transposase [Burkholderia pseudomallei B7210] >gi|126232216|gb|ABN95629.1| isrso7-transposase [Burkholderia pseudomallei 1106a] (208 aa)
Score = 174, Expect = 1.8e-11, Identities = 38/118 (32%), Positives = 61/118 (51%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTE-KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           ++ IY A + + + +AL+ F +  W +KY    + W    E +  F+ FP EI R+ YTTN IE++N  +RK  K +G   +  A   L++L L N+         +W   + Q  ILF
  S:    72 LRSIYAAASEEAARQALQDFADGPWGAKYPTIVQPWQRAWEHVVPFYMFPPEILRVAYTTNAIESLNMPLRKFIKTRGHCPNDEAAITLLWLALRNVLAKTVRAAFDWKSAMNQFAILF 190
>gi|134278159|ref|ZP_01764873.1| isrso7-transposase [Burkholderia pseudomallei 305] >gi|134249943|gb|EBA50023.1| isrso7-transposase [Burkholderia pseudomallei 305] (208 aa)
Score = 173, Expect = 2.1e-11, Identities = 38/118 (32%), Positives = 61/118 (51%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTE-KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           ++ IY A + + + +AL+ F +  W +KY    + W    E +  F+ FP EI R+ YTTN IE++N  +RK  K +G   +  A   L++L L N+         +W   + Q  ILF
  S:    72 LRSIYAAASEEAARQALQDFADGPWGAKYPTIVQPWQRAWEHVVPFYMFPPEILRVAYTTNAIESLNMPLRKFIKTRGHCPNDEAAITLLWLALRNVLAKTVRAAFDWKSAMNQFAILF 190
>gi|51247021|ref|YP_066904.1| transposase (partial length) [Desulfotalea psychrophila LSv54] >gi|50878058|emb|CAG37914.1| probable transposase (partial length) [Desulfotalea psychrophila LSv54] (285 aa)
Score = 173, Expect = 2.3e-11, Identities = 33/75 (44%), Positives = 49/75 (65%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKA 75
           +K++Y+A   D++   L I  EKW+ KY    KSW NN E L+ +F++P +IRR+IYTTN IE V+  + +I  A
  S:   207 LKRVYKATTKDLAESELDILEEKWNEKYPIVIKSWRNNWERLSHYFKYPEDIRRIIYTTNTIEAVHGLVAQIEVA 281
>gi|54310846|gb|AAV33659.1| TnpA [Comamonas sp. JS46] (411 aa)
Score = 173, Expect = 2.4e-11, Identities = 34/92 (36%), Positives = 50/92 (54%)
  Q:    27 KYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           K+     +W    + +  FF F   IRR+IYTTN IE++N  +RKI K +G   S +A +KLI+L L NI+ +W      W   + Q  I +
  S:   311 KFPTVVAAWRRAWDRVIPFFAFAPSIRRVIYTTNAIESINARLRKIIKTRGHFPSDDAAAKLIWLALRNITADWGRAAKEWREAMNQFAIAY 402
>gi|83956442|ref|ZP_00964863.1| TRm3 transposase [Sulfitobacter sp. NAS-14.1] >gi|83839327|gb|EAP78514.1| TRm3 transposase [Sulfitobacter sp. NAS-14.1] (392 aa)
Score = 172, Expect = 3.0e-11, Identities = 34/83 (40%), Positives = 44/83 (53%)
  Q:    25 SSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANW 107
           + +Y     SW     E+  F  +P E+RRLIYTTN IE +N  IR+  + +G   S  A +KLIYL L   S  WK  V  W
  S:   307 AKRYPAIAPSWRRAWNEVIPFLDYPPEVRRLIYTTNAIEALNSKIRRAVRTRGHFPSDEAAAKLIYLALNATSAEWKRSVREW 389
>gi|76818612|ref|YP_336277.1| ISRSO7-transposase protein [Burkholderia pseudomallei 1710b] >gi|167743928|ref|ZP_02416702.1| ISRSO7-transposase protein [Burkholderia pseudomallei 14] >gi|76583085|gb|ABA52559.1| ISRSO7-transposase protein [Burkholderia pseudomallei 1710b] (208 aa)
Score = 171, Expect = 3.7e-11, Identities = 38/118 (32%), Positives = 60/118 (50%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTE-KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           ++ IY A + + + +AL+ F +  W +KY    + W    E    F+ FP EI R+ YTTN IE++N  +RK  K +G   +  A   L++L L N+         +W   + Q  ILF
  S:    72 LRSIYAAASEEAARQALQDFADGPWGAKYPTIVQPWQRAWEHAVPFYMFPPEILRVAYTTNAIESLNMPLRKFIKTRGHCPNDEAAITLLWLALRNVLAKTVRAAFDWKSAMNQFAILF 190
>gi|170733132|ref|YP_001765079.1| transposase mutator type [Burkholderia cenocepacia MC0-3] >gi|169816374|gb|ACA90957.1| transposase mutator type [Burkholderia cenocepacia MC0-3] (419 aa)
Score = 171, Expect = 3.9e-11, Identities = 33/98 (33%), Positives = 53/98 (54%)
  Q:    21 TEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           T  W +KY      W    +++  F+ F  +IR+++YTTN IE+++  +RKI KA+G   S  A  KLI+L L N+   W     +W   + Q  +L+
  S:   314 TSPWGTKYPPIAALWRRAWDQVIPFYAFAPDIRKIVYTTNAIESLHMQLRKIIKARGHFPSDEAALKLIWLALRNVVAKWTGSRHDWKSAMTQFALLY 411
>gi|170733128|ref|YP_001765075.1| transposase mutator type [Burkholderia cenocepacia MC0-3] >gi|169816370|gb|ACA90953.1| transposase mutator type [Burkholderia cenocepacia MC0-3] (419 aa)
Score = 171, Expect = 3.9e-11, Identities = 33/98 (33%), Positives = 53/98 (54%)
  Q:    21 TEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           T  W +KY      W    +++  F+ F  +IR+++YTTN IE+++  +RKI KA+G   S  A  KLI+L L N+   W     +W   + Q  +L+
  S:   314 TSPWGTKYPPIAALWRRAWDQVIPFYAFAPDIRKIVYTTNAIESLHMQLRKIIKARGHFPSDEAALKLIWLALRNVVAKWTGSRHDWKSAMTQFALLY 411
>gi|83717566|ref|YP_438631.1| transposase mutator family protein [Burkholderia thailandensis E264] >gi|83717711|ref|YP_438558.1| transposase mutator family protein [Burkholderia thailandensis E264] >gi|83718506|ref|YP_443626.1| transposase mutator family protein [Burkholderia thailandensis E264] >gi|83719544|ref|YP_443262.1| transposase mutator family protein [Burkholderia thailandensis E264] >gi|83719830|ref|YP_441482.1| transposase mutator family protein [Burkholderia thailandensis E264] >gi|83720922|ref|YP_441651.1| transposase mutator family protein [Burkholderia thailandensis E264] >gi|83651391|gb|ABC35455.1| transposase, Mutator family [Burkholderia thailandensis E264] >gi|83651536|gb|ABC35600.1| transposase, Mutator family [Burkholderia thailandensis E264] >gi|83652331|gb|ABC36394.1| transposase, Mutator family [Burkholderia thailandensis E264] >gi|83653369|gb|ABC37432.1| transposase, Mutator family [Burkholderia thailandensis E264] >gi|83653655|gb|ABC37718.1| transposase, Mutator family [Burkholderia thailandensis E264] >gi|83654747|gb|ABC38810.1| transposase, Mutator family [Burkholderia thailandensis E264] (419 aa)
Score = 170, Expect = 4.1e-11, Identities = 33/98 (33%), Positives = 53/98 (54%)
  Q:    21 TEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           T  W +KY      W    +++  F+ F  +IR+++YTTN IE+++  +RKI KA+G   S  A  KLI+L L N+   W     +W   + Q  +L+
  S:   314 TSPWGTKYPPIAALWRRAWDQVIPFYAFAPDIRKIVYTTNAIESLHMQLRKIIKARGHFPSDEAALKLIWLALRNVVAKWTGSRHDWKSAMTQFALLY 411
>gi|1477486|gb|AAC44170.1| transposase [Burkholderia cepacia] (419 aa)
Score = 170, Expect = 4.1e-11, Identities = 33/98 (33%), Positives = 53/98 (54%)
  Q:    21 TEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           T  W +KY      W    +++  F+ F  +IR+++YTTN IE+++  +RKI KA+G   S  A  KLI+L L N+   W     +W   + Q  +L+
  S:   314 TSPWGTKYPPIAALWRRAWDQVIPFYAFAPDIRKIVYTTNAIESLHMQLRKIIKARGHFPSDEAALKLIWLALRNVVAKWTGSRHDWKSAMTQFALLY 411
>gi|194562685|ref|YP_002097708.1| Transposase [Burkholderia dolosa AUO158] >gi|194563080|ref|YP_002098103.1| Transposase [Burkholderia dolosa AUO158] >gi|194563317|ref|YP_002098340.1| Transposase [Burkholderia dolosa AUO158] >gi|194563811|ref|YP_002098834.1| Transposase [Burkholderia dolosa AUO158] >gi|124894309|gb|EAY68189.1| Transposase [Burkholderia dolosa AUO158] >gi|124894704|gb|EAY68584.1| Transposase [Burkholderia dolosa AUO158] >gi|124894941|gb|EAY68821.1| Transposase [Burkholderia dolosa AUO158] >gi|124895435|gb|EAY69315.1| Transposase [Burkholderia dolosa AUO158] (419 aa)
Score = 170, Expect = 4.1e-11, Identities = 33/98 (33%), Positives = 53/98 (54%)
  Q:    21 TEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           T  W +KY      W    +++  F+ F  +IR+++YTTN IE+++  +RKI KA+G   S  A  KLI+L L N+   W     +W   + Q  +L+
  S:   314 TSPWGTKYPPIAALWRRAWDQVIPFYAFAPDIRKIVYTTNAIESLHMQLRKIIKARGHFPSDEAALKLIWLALRNVVAKWTGSRHDWKSAMTQFALLY 411
>gi|134292980|ref|YP_001116716.1| transposase, mutator type [Burkholderia vietnamiensis G4] >gi|134136137|gb|ABO57251.1| transposase, mutator type [Burkholderia vietnamiensis G4] (419 aa)
Score = 170, Expect = 4.1e-11, Identities = 33/98 (33%), Positives = 53/98 (54%)
  Q:    21 TEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           T  W +KY      W    +++  F+ F  +IR+++YTTN IE+++  +RKI KA+G   S  A  KLI+L L N+   W     +W   + Q  +L+
  S:   314 TSPWGTKYPPIAALWRRAWDQVIPFYAFAPDIRKIVYTTNAIESLHMQLRKIIKARGHFPSDEAALKLIWLALRNVVAKWTGSRHDWKSAMTQFALLY 411
>gi|161526105|ref|YP_001581117.1| transposase mutator type [Burkholderia multivorans ATCC 17616] >gi|189349181|ref|YP_001944809.1| ISBmu12d transposase [Burkholderia multivorans ATCC 17616] >gi|160343534|gb|ABX16620.1| transposase mutator type [Burkholderia multivorans ATCC 17616] >gi|189333203|dbj|BAG42273.1| ISBmu12d transposase [Burkholderia multivorans ATCC 17616] (419 aa)
Score = 170, Expect = 4.3e-11, Identities = 33/98 (33%), Positives = 53/98 (54%)
  Q:    21 TEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           T  W +KY      W    +++  F+ F  +IR+++YTTN IE+++  +RKI KA+G   S  A  KLI+L L N+   W     +W   + Q  +L+
  S:   314 TSPWGTKYPPIAALWRRAWDQVIPFYAFAPDIRKIVYTTNAIESLHMQLRKIIKARGHFPSDEAALKLIWLALRNVVAKWTGSRHDWKSAMTQFALLY 411
>gi|120406908|ref|YP_956737.1| transposase, mutator type [Mycobacterium vanbaalenii PYR-1] >gi|119959726|gb|ABM16731.1| transposase, mutator type [Mycobacterium vanbaalenii PYR-1] (424 aa)
Score = 170, Expect = 4.5e-11, Identities = 45/122 (36%), Positives = 66/122 (54%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISE----NWKSRVANWGLILQQLKILFENEI 122
           ++ IY A   + +  AL+ F  +W +K   A   W+    E   F  FP EIR++IYTTN IE++N  +RK+TKA+G   S  A  KL+YL + NI++    N  S    W   L    I F + +
  S:   297 LRPIYTAATEEAAKLALEEFRAEWKTKSPGAVAVWDRAWAEFVPFLAFPVEIRKIIYTTNAIESLNYQLRKVTKARGSFPSDAAALKLLYLAIRNINQKRGSNPGSGTYRWTEALNAFAIQFPDRL 422
>gi|161521343|ref|YP_001584770.1| transposase mutator type [Burkholderia multivorans ATCC 17616] >gi|189352490|ref|YP_001948117.1| ISBmu12c transposase [Burkholderia multivorans ATCC 17616] >gi|4128219|gb|AAD03556.1| transposase [Burkholderia cepacia] >gi|160345393|gb|ABX18478.1| transposase mutator type [Burkholderia multivorans ATCC 17616] >gi|189336512|dbj|BAG45581.1| ISBmu12c transposase [Burkholderia multivorans ATCC 17616] (419 aa)
Score = 170, Expect = 4.7e-11, Identities = 33/98 (33%), Positives = 53/98 (54%)
  Q:    21 TEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           T  W +KY      W    +++  F+ F  +IR+++YTTN IE+++  +RKI KA+G   S  A  KLI+L L N+   W     +W   + Q  +L+
  S:   314 TSPWGTKYPPIAALWRRAWDQVIPFYAFAPDIRKIVYTTNAIESLHMQLRKIIKARGHFPSDEAALKLIWLALRNVVAKWTGSRHDWKSAMTQFALLY 411
>gi|134293051|ref|YP_001116787.1| transposase, mutator type [Burkholderia vietnamiensis G4] >gi|134136208|gb|ABO57322.1| transposase, mutator type [Burkholderia vietnamiensis G4] (411 aa)
Score = 170, Expect = 5.0e-11, Identities = 33/98 (33%), Positives = 53/98 (54%)
  Q:    21 TEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           T  W +KY      W    +++  F+ F  +IR+++YTTN IE+++  +RKI KA+G   S  A  KLI+L L N+   W     +W   + Q  +L+
  S:   306 TSPWGTKYPPIAALWRRAWDQVIPFYAFAPDIRKIVYTTNAIESLHMQLRKIIKARGHFPSDEAALKLIWLALRNVVAKWTGSRHDWKSAMTQFALLY 403
>gi|161521325|ref|YP_001584752.1| transposase mutator type [Burkholderia multivorans ATCC 17616] >gi|161522769|ref|YP_001585698.1| transposase mutator type [Burkholderia multivorans ATCC 17616] >gi|189348385|ref|YP_001941581.1| ISBmu12b transposase [Burkholderia multivorans ATCC 17616] >gi|189352507|ref|YP_001948134.1| ISBmu12b transposase [Burkholderia multivorans ATCC 17616] >gi|160345375|gb|ABX18460.1| transposase mutator type [Burkholderia multivorans ATCC 17616] >gi|160346322|gb|ABX19406.1| transposase mutator type [Burkholderia multivorans ATCC 17616] >gi|189336529|dbj|BAG45598.1| ISBmu12b transposase [Burkholderia multivorans ATCC 17616] >gi|189338523|dbj|BAG47591.1| ISBmu12b transposase [Burkholderia multivorans ATCC 17616] (419 aa)
Score = 170, Expect = 5.3e-11, Identities = 33/98 (33%), Positives = 53/98 (54%)
  Q:    21 TEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           T  W +KY      W    +++  F+ F  +IR+++YTTN IE+++  +RKI KA+G   S  A  KLI+L L N+   W     +W   + Q  +L+
  S:   314 TSPWGTKYPPIAALWRRAWDQVIPFYAFAPDIRKIVYTTNAIESLHMQLRKIIKARGHFPSDEAALKLIWLALRNVVAKWTGSRHDWKSAMTQFALLY 411
>gi|161521267|ref|YP_001584694.1| transposase mutator type [Burkholderia multivorans ATCC 17616] >gi|189352561|ref|YP_001948188.1| ISBmu12a transposase [Burkholderia multivorans ATCC 17616] >gi|160345317|gb|ABX18402.1| transposase mutator type [Burkholderia multivorans ATCC 17616] >gi|189336583|dbj|BAG45652.1| ISBmu12a transposase [Burkholderia multivorans ATCC 17616] (419 aa)
Score = 169, Expect = 5.4e-11, Identities = 33/98 (33%), Positives = 53/98 (54%)
  Q:    21 TEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           T  W +KY      W    +++  F+ F  +IR+++YTTN IE+++  +RKI KA+G   S  A  KLI+L L N+   W     +W   + Q  +L+
  S:   314 TSPWGTKYPPIAALWRRAWDQVIPFYAFAPDIRKIVYTTNAIESLHMQLRKIIKARGHFPSDEAALKLIWLALRNVVAKWTGSRHDWKSAMTQFALLY 411
>gi|107021956|ref|YP_620283.1| transposase, mutator type [Burkholderia cenocepacia AU 1054] >gi|107022754|ref|YP_621081.1| transposase, mutator type [Burkholderia cenocepacia AU 1054] >gi|107022757|ref|YP_621084.1| transposase, mutator type [Burkholderia cenocepacia AU 1054] >gi|107027633|ref|YP_625144.1| transposase, mutator type [Burkholderia cenocepacia AU 1054] >gi|116689705|ref|YP_835328.1| transposase, mutator type [Burkholderia cenocepacia HI2424] >gi|116693655|ref|YP_839188.1| transposase, mutator type [Burkholderia cenocepacia HI2424] >gi|170736153|ref|YP_001777413.1| transposase mutator type [Burkholderia cenocepacia MC0-3] >gi|105892145|gb|ABF75310.1| transposase, mutator type [Burkholderia cenocepacia AU 1054] >gi|105892943|gb|ABF76108.1| transposase, mutator type [Burkholderia cenocepacia AU 1054] >gi|105892946|gb|ABF76111.1| transposase, mutator type [Burkholderia cenocepacia AU 1054] >gi|105897007|gb|ABF80171.1| transposase, mutator type [Burkholderia cenocepacia AU 1054] >gi|116647794|gb|ABK08435.1| transposase, mutator type [Burkholderia cenocepacia HI2424] >gi|116651655|gb|ABK12295.1| transposase, mutator type [Burkholderia cenocepacia HI2424] >gi|169818341|gb|ACA92923.1| transposase mutator type [Burkholderia cenocepacia MC0-3] (419 aa)
Score = 169, Expect = 5.4e-11, Identities = 33/98 (33%), Positives = 53/98 (54%)
  Q:    21 TEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           T  W +KY      W    +++  F+ F  +IR+++YTTN IE+++  +RKI KA+G   S  A  KLI+L L N+   W     +W   + Q  +L+
  S:   314 TSPWGAKYPPIAALWRRAWDQVIPFYAFAPDIRKIVYTTNAIESLHMQLRKIIKARGHFPSDEAALKLIWLALRNVVAKWTGSRHDWKSAMTQFALLY 411
>gi|161524088|ref|YP_001579100.1| transposase mutator type [Burkholderia multivorans ATCC 17616] >gi|189351152|ref|YP_001946780.1| ISBmu12f transposase [Burkholderia multivorans ATCC 17616] >gi|160341517|gb|ABX14603.1| transposase mutator type [Burkholderia multivorans ATCC 17616] >gi|189335174|dbj|BAG44244.1| ISBmu12f transposase [Burkholderia multivorans ATCC 17616] (419 aa)
Score = 169, Expect = 5.7e-11, Identities = 33/98 (33%), Positives = 53/98 (54%)
  Q:    21 TEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           T  W +KY      W    +++  F+ F  +IR+++YTTN IE+++  +RKI KA+G   S  A  KLI+L L N+   W     +W   + Q  +L+
  S:   314 TSPWGTKYRPIAALWRRAWDQVIPFYAFAPDIRKIVYTTNAIESLHMQLRKIIKARGHFPSDEAALKLIWLALRNVVAKWTGSRHDWKSAMTQFALLY 411
>gi|72080659|ref|YP_287717.1| transposase [Mycoplasma hyopneumoniae 7448] (89 aa)
Score = 166, Expect = 1.3e-10, Identities = 40/79 (50%), Positives = 55/79 (69%)
  Q:    44 TFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           TFF++P E+R+ IYTTN I +VN+ IRK TK KGGI SVN LSK+ YL L       + +V +W +I +QL+I+F N +
  S:     5 TFFKYPYELRQAIYTTNSIGSVNKLIRKNTKTKGGIQSVNCLSKITYLTLQKAFIKCQRQVRSWDIIKKQLEIIFPNRL 83
>gi|25026796|ref|NP_736850.1| putative transposase [Corynebacterium efficiens YS-314] >gi|25027581|ref|NP_737635.1| putative transposase [Corynebacterium efficiens YS-314] >gi|25028021|ref|NP_738075.1| putative transposase [Corynebacterium efficiens YS-314] >gi|23492075|dbj|BAC17050.1| putative transposase [Corynebacterium efficiens YS-314] >gi|23492863|dbj|BAC17835.1| putative transposase [Corynebacterium efficiens YS-314] >gi|23493304|dbj|BAC18275.1| putative transposase [Corynebacterium efficiens YS-314] (447 aa)
Score = 165, Expect = 1.6e-10, Identities = 40/120 (33%), Positives = 68/120 (56%)
  Q:     1 MKKIYQAPNFDVSMKALKIF-TEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKS--------------------RVANWGLILQQLKILFEN 120
           ++KIY AP  D ++ AL+ F   +   KY  + K W +  +    F QFP   R++IYTTN IE++N  +RK T+ +   T+  +  K ++L + NI +   +                    +VANW   + Q+ + F +
  S:   301 LRKIYTAPTEDTAIAALEEFEASELGVKYPQSAKVWRDAWDRFIPFLQFPPMARKVIYTTNSIESMNNELRKATRNRVQFTNDESAIKTLWLMICNIEDKRAAKRAKQGKRVAASSGRLIEGRKVANWKQAINQMAVAFPD 441
>gi|25028052|ref|NP_738106.1| putative transposase [Corynebacterium efficiens YS-314] >gi|23493336|dbj|BAC18306.1| putative transposase [Corynebacterium efficiens YS-314] (390 aa)
Score = 165, Expect = 1.7e-10, Identities = 40/120 (33%), Positives = 68/120 (56%)
  Q:     1 MKKIYQAPNFDVSMKALKIF-TEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKS--------------------RVANWGLILQQLKILFEN 120
           ++KIY AP  D ++ AL+ F   +   KY  + K W +  +    F QFP   R++IYTTN IE++N  +RK T+ +   T+  +  K ++L + NI +   +                    +VANW   + Q+ + F +
  S:   244 LRKIYTAPTEDTAIAALEEFEASELGVKYPQSAKVWRDAWDRFIPFLQFPPMARKVIYTTNSIESMNNELRKATRNRVQFTNDESAIKTLWLMICNIEDKRAAKRAKQGKRVAASSGRLIEGRKVANWKQAINQMAVAFPD 384
>gi|90421226|ref|ZP_01229126.1| transposase, mutator type [Aurantimonas sp. SI85-9A1] >gi|90334539|gb|EAS48324.1| transposase, mutator type [Aurantimonas sp. SI85-9A1] (155 aa)
Score = 164, Expect = 2.1e-10, Identities = 30/86 (34%), Positives = 48/86 (55%)
  Q:    33 KSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           +SW     E+  F+ FP E+RR++YTTN IE +N  +R+  +A+G   + +A  KL++L L    + WK     W +   Q  IL+
  S:    61 QSWRRAWAEVVPFYGFPEEVRRMVYTTNAIEALNSKLRRAVRARGHFPTDDAAMKLLFLVLNQSEKEWKMPPREWAMAKAQFAILY 146
>gi|134292998|ref|YP_001116734.1| transposase, mutator type [Burkholderia vietnamiensis G4] >gi|134136155|gb|ABO57269.1| transposase, mutator type [Burkholderia vietnamiensis G4] (181 aa)
Score = 164, Expect = 2.1e-10, Identities = 33/98 (33%), Positives = 53/98 (54%)
  Q:    21 TEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           T  W +KY      W    +++  F+ F  +IR+++YTTN IE+++  +RKI KA+G   S  A  KLI+L L N+   W     +W   + Q  +L+
  S:    76 TSPWGTKYPPIAALWRRAWDQVIPFYAFAPDIRKIVYTTNAIESLHMQLRKIIKARGHFPSDEAALKLIWLALRNVVAKWTGSRHDWKSAMTQFALLY 173
>gi|28894871|ref|NP_799478.1| putative transposase [Bacillus megaterium] >gi|28848570|gb|AAO52770.1| putative transposase [Bacillus megaterium] (393 aa)
Score = 164, Expect = 2.5e-10, Identities = 37/102 (36%), Positives = 58/102 (56%)
  Q:     2 KKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSR 103
           K +Y+A + ++  +AL  F EKW SKY   TK   NN   L TF+ FP  I R IY+TNLIE+ N+ I+K +K K    +  +L + +  +    ++ + +R
  S:   274 KSVYRAESLEMGQQALHSFIEKWKSKYPKVTKPLLNN-SYLFTFYSFPKSIWRSIYSTNLIESFNKQIKKYSKRKEQFPNEESLERFLVSQFDQYNQRFATR 374
>gi|125975238|ref|YP_001039148.1| transposase [Clostridium thermocellum ATCC 27405] >gi|125715463|gb|ABN53955.1| transposase [Clostridium thermocellum ATCC 27405] (86 aa)
Score = 163, Expect = 3.1e-10, Identities = 32/77 (41%), Positives = 51/77 (66%)
  Q:    42 LTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           ++ F++ P EIRR+IYTTN+IE ++R  RK+TK K    + ++L K++YL  +N+ + W  R  NW  +L QL I +
  S:     2 ISPFYKLPGEIRRIIYTTNIIEGLHRQFRKVTKTKTMFPNDSSLEKVLYLASMNVVKKWTQRYKNWDKVLSQLMIQY 78
>gi|549115|sp|P35879|TRA_CORDI Probable transposase for insertion sequence element (343 aa)
Score = 162, Expect = 3.8e-10, Identities = 33/98 (33%), Positives = 54/98 (55%)
  Q:     1 MKKIYQAPNFDVSMKALKIF-TEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISE 98
           ++++Y AP  D +  AL  F   +   KY  + K W +  +    F QFP   RR++YTTN IE++N  +RK T+ +G   +  A  K ++L + NI +
  S:   198 LREVYTAPTEDTARAALDAFEASELGRKYPQSVKVWRDAWDRFVPFLQFPPAARRVLYTTNSIESLNAELRKATRNRGQFPNDTAALKTLWLMICNIED 296
>gi|167621699|ref|YP_001672207.1| transposase, mutator type [Caulobacter sp. K31] >gi|167351822|gb|ABZ74548.1| transposase, mutator type [Caulobacter sp. K31] (121 aa)
Score = 162, Expect = 3.9e-10, Identities = 34/95 (35%), Positives = 48/95 (50%)
  Q:    24 WSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           W  KY     SW     E+  FF FP ++RRLIYTTN IE +N  +R+  +A+G   +  A  KL++L L    + W      W +   Q  +LF
  S:    18 WGRKYPAIGLSWRRAWNEVIPFFAFPHDVRRLIYTTNAIEALNSKLRRAVRARGHFPTDEAALKLLFLVLNRSEKEWTMPAREWHMAKAQFAVLF 112
>gi|68535456|ref|YP_250161.1| transposase for IS3508a [Corynebacterium jeikeium K411] >gi|68535579|ref|YP_250284.1| transposase for IS3508b [Corynebacterium jeikeium K411] >gi|68536308|ref|YP_251013.1| transposase for IS3508c [Corynebacterium jeikeium K411] >gi|68536339|ref|YP_251044.1| transposase for IS3508d [Corynebacterium jeikeium K411] >gi|68536342|ref|YP_251047.1| transposase for IS3508e [Corynebacterium jeikeium K411] >gi|68536360|ref|YP_251065.1| transposase for IS3508f [Corynebacterium jeikeium K411] >gi|68536672|ref|YP_251377.1| transposase for IS3508g [Corynebacterium jeikeium K411] >gi|68536688|ref|YP_251393.1| transposase for IS3508h [Corynebacterium jeikeium K411] >gi|68536877|ref|YP_251582.1| transposase for IS3508i [Corynebacterium jeikeium K411] >gi|68263055|emb|CAI36543.1| transposase for IS3508a [Corynebacterium jeikeium K411] >gi|68263178|emb|CAI36666.1| transposase for IS3508b [Corynebacterium jeikeium K411] >gi|68263907|emb|CAI37395.1| transposase for IS3508c [Corynebacterium jeikeium K411] >gi|68263938|emb|CAI37426.1| transposase for IS3508d [Corynebacterium jeikeium K411] >gi|68263941|emb|CAI37429.1| transposase for IS3508e [Corynebacterium jeikeium K411] >gi|68263959|emb|CAI37447.1| transposase for IS3508f [Corynebacterium jeikeium K411] >gi|68264271|emb|CAI37759.1| transposase for IS3508g [Corynebacterium jeikeium K411] >gi|68264287|emb|CAI37775.1| transposase for IS3508h [Corynebacterium jeikeium K411] >gi|68264476|emb|CAI37964.1| transposase for IS3508i [Corynebacterium jeikeium K411] (449 aa)
Score = 160, Expect = 7.6e-10, Identities = 33/98 (33%), Positives = 54/98 (55%)
  Q:     1 MKKIYQAPNFDVSMKALKIF-TEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISE 98
           ++++Y A N D +  +L  F   +   KY  + K W +  E    F QFP   RR++YTTN IE++N  +RK T+ +G   +  A  K ++L + NI +
  S:   304 LREVYTAANEDTARASLDAFEASELGRKYPQSVKVWRDAWERFIPFLQFPPAARRVLYTTNSIESLNAELRKATRNRGQFPNDTAALKTLWLMICNIED 402
>gi|157825922|ref|YP_001493642.1| transposase [Rickettsia akari str. Hartford] >gi|157799880|gb|ABV75134.1| Transposase [Rickettsia akari str. Hartford] (87 aa)
Score = 159, Expect = 8.0e-10, Identities = 35/78 (44%), Positives = 48/78 (61%)
  Q:    45 FFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           FF FP EIR++IYTTN IE++NR IRKI K K       ++ K+I+L L N S+ W   + NW + L Q  IL +  +
  S:     8 FFSFPDEIRKVIYTTNAIESINRQIRKIIKNKWVFLDDKSIQKIIFLALTNASKKWTMPIENWAMALNQFAILCDTNL 85
>gi|91205729|ref|YP_538084.1| transposase [Rickettsia bellii RML369-C] >gi|91069273|gb|ABE04995.1| Transposase and inactivated derivative [Rickettsia bellii RML369-C] (287 aa)
Score = 159, Expect = 8.6e-10, Identities = 33/72 (45%), Positives = 45/72 (62%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKI 72
           +K IYQA N + ++ AL  F +KWS +Y +  KSW NN   L  F Q+P  IRR+IYTTN IE +  +  K+
  S:   198 LKLIYQAINEEEALSALADFDKKWSKQYPHIAKSWQNNWHNLVIFLQYPEVIRRIIYTTNAIEGLIASYEKL 269
>gi|159901547|ref|YP_001547793.1| transposase, mutator type [Herpetosiphon aurantiacus ATCC 23779] >gi|159894586|gb|ABX07665.1| transposase, mutator type [Herpetosiphon aurantiacus ATCC 23779] (98 aa)
Score = 159, Expect = 8.9e-10, Identities = 38/111 (34%), Positives = 57/111 (51%)
  Q:     4 IYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQL 114
           +YQAP  +++   L    E+W  ++  A + W    EEL T F +P +IRRL+YTTN +E  NR +R                KL+YL   +I+ NW + + NW  I  Q+
  S:     1 MYQAPTRELAETKLLELGERWGGQFAMAVRCWERAWEELATMFDYPPDIRRLMYTTNAVEGYNRQLR----------------KLLYLVNRDITANWVT-LPNWVRIRNQI 94
>gi|37520087|ref|NP_923464.1| putative transposase [Gloeobacter violaceus PCC 7421] >gi|37522130|ref|NP_925507.1| putative transposase [Gloeobacter violaceus PCC 7421] >gi|37523761|ref|NP_927138.1| putative transposase [Gloeobacter violaceus PCC 7421] >gi|35211079|dbj|BAC88459.1| gll0518 [Gloeobacter violaceus PCC 7421] >gi|35213130|dbj|BAC90502.1| gll2561 [Gloeobacter violaceus PCC 7421] >gi|35214766|dbj|BAC92133.1| glr4192 [Gloeobacter violaceus PCC 7421] (302 aa)
Score = 159, Expect = 9.4e-10, Identities = 34/106 (32%), Positives = 61/106 (57%)
  Q:    17 LKIFTEKWSSKYGYATKSWNNNIEELTT--------FFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           L++ +EKW  +Y   ++ W  N   L           F+F  +IR++IYTTN IE++N  IRK+++    + +  ++ K++YL + N  + W   + +W   L +L I FE  +
  S:   187 LELLSEKWDKQYSSVSRMWRENWGSLPQRPWVRVIPIFRFGEDIRKVIYTTNAIESLNMTIRKVSRNHHIMPNDESVMKMVYLAIQNQMKKWTMPIRDWRPALNRLTIEFEGRL 300
>gi|91780358|ref|YP_555565.1| putative transposase, mutator type [Burkholderia xenovorans LB400] >gi|91693018|gb|ABE36215.1| Putative transposase, mutator type [Burkholderia xenovorans LB400] (418 aa)
Score = 156, Expect = 1.8e-09, Identities = 31/76 (40%), Positives = 45/76 (59%)
  Q:    16 ALKIFTE-KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYL 91
           AL  F + +W  K+      W    E++  FF +P E+RR++YTTN IE+++   RKI K +G   S  A SKL+YL
  S:   294 ALDAFAQGEWGRKFPTVAAMWQRQWEQVIPFFAYPPEMRRIVYTTNAIESMHMQWRKIVKNRGHFPSDEAASKLLYL 370
>gi|115360192|ref|YP_777330.1| transposase, mutator type [Burkholderia ambifaria AMMD] >gi|115285480|gb|ABI90996.1| transposase, mutator type [Burkholderia ambifaria AMMD] (240 aa)
Score = 156, Expect = 1.8e-09, Identities = 31/87 (35%), Positives = 48/87 (55%)
  Q:    21 TEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANW 107
           T  W +KY      W    +++  F+ F  +IR+++YTTN IE+++  +RKI KA+G   S  A  KLI+L L N+   W     +W
  S:   151 TSPWGTKYPPIAALWRRAWDQVIPFYAFAPDIRKIVYTTNAIESLHMQLRKIIKARGHFPSDEAALKLIWLALRNVVAKWTGSRHDW 237
>gi|125974491|ref|YP_001038401.1| transposase, mutator type [Clostridium thermocellum ATCC 27405] >gi|125714716|gb|ABN53208.1| transposase, mutator type [Clostridium thermocellum ATCC 27405] (328 aa)
Score = 154, Expect = 3.2e-09, Identities = 29/72 (40%), Positives = 46/72 (63%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKI 72
           +K+IY APN       +   +EKW  KY  A KSW +N + +  FF++  E+R+++YTTN IE++N + R+I
  S:   257 LKRIYTAPNEKAGYDQMLEVSEKWEKKYPAAMKSWKSNWDVICPFFKYSEELRKIMYTTNTIESLNSSYRRI 328
>gi|56707163|ref|YP_163793.1| transposase [Lactobacillus salivarius UCC118] (289 aa)
Score = 153, Expect = 4.0e-09, Identities = 34/102 (33%), Positives = 58/102 (56%)
  Q:     2 KKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSR 103
           K I QA N   + + L  F+ KW S Y    K+    + EL TFF FP  IR+  Y+TNLIE+ N++++K+ + K    +  AL + I  +++  ++ +++R
  S:   173 KAIRQAENLQAAKERLAAFSAKWESSYKRRIKNLVQ-MAELFTFFSFPTAIRQTTYSTNLIESFNKSLKKMARRKEQFPNEGALDRFIMTQVMEYNDKFENR 273
>gi|116510946|ref|YP_808162.1| transposase [Lactococcus lactis subsp. cremoris SK11] >gi|116511903|ref|YP_809119.1| transposase [Lactococcus lactis subsp. cremoris SK11] >gi|116106600|gb|ABJ71740.1| Transposase [Lactococcus lactis subsp. cremoris SK11] >gi|116107557|gb|ABJ72697.1| Transposase [Lactococcus lactis subsp. cremoris SK11] (391 aa)
Score = 153, Expect = 4.9e-09, Identities = 34/88 (38%), Positives = 55/88 (62%)
  Q:     2 KKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLI 89
           K IY+A N +++++AL+ F  +W  KY    +S  N  + L TF+QFP +I   IY+TNLIE++N+ I++ TK K    +  AL + +
  S:   274 KTIYRAENLEMAVQALENFIAEWKPKYRKVMESLENT-DNLLTFYQFPYQIWHSIYSTNLIESLNKEIKRQTKKKVLFPNEEALERYL 360
>gi|116627245|ref|YP_819864.1| transposase [Streptococcus thermophilus LMD-9] >gi|116100522|gb|ABJ65668.1| Transposase [Streptococcus thermophilus LMD-9] (391 aa)
Score = 153, Expect = 4.9e-09, Identities = 34/88 (38%), Positives = 55/88 (62%)
  Q:     2 KKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLI 89
           K IY+A N +++++AL+ F  +W  KY    +S  N  + L TF+QFP +I   IY+TNLIE++N+ I++ TK K    +  AL + +
  S:   274 KTIYRAENLEMAVQALESFIAEWKPKYRKVMESLENT-DNLLTFYQFPYQIWHSIYSTNLIESLNKEIKRQTKKKVLFPNEEALERYL 360
>gi|116511350|ref|YP_808566.1| transposase [Lactococcus lactis subsp. cremoris SK11] >gi|116107004|gb|ABJ72144.1| Transposase [Lactococcus lactis subsp. cremoris SK11] (391 aa)
Score = 152, Expect = 5.1e-09, Identities = 34/88 (38%), Positives = 55/88 (62%)
  Q:     2 KKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLI 89
           K IY+A N +++++AL+ F  +W  KY    +S  N  + L TF+QFP +I   IY+TNLIE++N+ I++ TK K    +  AL + +
  S:   274 KTIYRAENLEMAVQALENFIAEWKPKYRKVMESLENT-DNLLTFYQFPYQIWHSIYSTNLIESLNKEIKRQTKKKVLFPNEEALERYL 360
>gi|116512071|ref|YP_809287.1| transposase [Lactococcus lactis subsp. cremoris SK11] >gi|116512087|ref|YP_809303.1| transposase [Lactococcus lactis subsp. cremoris SK11] >gi|116107725|gb|ABJ72865.1| Transposase [Lactococcus lactis subsp. cremoris SK11] >gi|116107741|gb|ABJ72881.1| Transposase [Lactococcus lactis subsp. cremoris SK11] (391 aa)
Score = 152, Expect = 5.7e-09, Identities = 34/88 (38%), Positives = 55/88 (62%)
  Q:     2 KKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLI 89
           K IY+A N +++++AL+ F  +W  KY    +S  N  + L TF+QFP +I   IY+TNLIE++N+ I++ TK K    +  AL + +
  S:   274 KTIYRAENLEMAVQALENFIAEWKPKYRKVMESLENT-DNLLTFYQFPYQIWHSIYSTNLIESLNKEIKRQTKKKVLFPNEEALERYL 360
>gi|15673186|ref|NP_267360.1| transposase of IS905 [Lactococcus lactis subsp. lactis Il1403] >gi|125622944|ref|YP_001031427.1| transposase for insertion sequence element IS905A [Lactococcus lactis subsp. cremoris MG1363] >gi|125623973|ref|YP_001032456.1| transposase for insertion sequence element IS905F [Lactococcus lactis subsp. cremoris MG1363] >gi|125624139|ref|YP_001032622.1| transposase for insertion sequence element IS905H [Lactococcus lactis subsp. cremoris MG1363] >gi|125624143|ref|YP_001032626.1| transposase for insertion sequence element IS905I [Lactococcus lactis subsp. cremoris MG1363] >gi|125625249|ref|YP_001033732.1| transposase for insertion sequence element IS905N [Lactococcus lactis subsp. cremoris MG1363] >gi|549109|sp|P35881|TRA5_LACLA Transposase for insertion sequence element IS905 >gi|12724173|gb|AAK05302.1|AE006353_1 transposase of IS905 [Lactococcus lactis subsp. lactis Il1403] >gi|437389|gb|AAA25167.1| transposase >gi|124491752|emb|CAL96671.1| transposase for insertion sequence element IS905A [Lactococcus lactis subsp. cremoris MG1363] >gi|124492781|emb|CAL97736.1| transposase for insertion sequence element IS905F [Lactococcus lactis subsp. cremoris MG1363] >gi|124492947|emb|CAL97910.1| transposase for insertion sequence element IS905H [Lactococcus lactis subsp. cremoris MG1363] >gi|124492951|emb|CAL97914.1| transposase for insertion sequence element IS905I [Lactococcus lactis subsp. cremoris MG1363] >gi|124494057|emb|CAL99057.1| transposase for insertion sequence element IS905N [Lactococcus lactis subsp. cremoris MG1363] (391 aa)
Score = 152, Expect = 5.7e-09, Identities = 34/88 (38%), Positives = 55/88 (62%)
  Q:     2 KKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLI 89
           K IY+A N +++++AL+ F  +W  KY    +S  N  + L TF+QFP +I   IY+TNLIE++N+ I++ TK K    +  AL + +
  S:   274 KTIYRAENLEMAVQALENFIAEWKPKYRKVMESLENT-DNLLTFYQFPYQIWHSIYSTNLIESLNKEIKRQTKKKVLFPNEEALERYL 360
>gi|125623419|ref|YP_001031902.1| transposase for insertion sequence element IS905B [Lactococcus lactis subsp. cremoris MG1363] >gi|124492227|emb|CAL97156.1| transposase for insertion sequence element IS905B [Lactococcus lactis subsp. cremoris MG1363] (391 aa)
Score = 152, Expect = 5.8e-09, Identities = 34/88 (38%), Positives = 55/88 (62%)
  Q:     2 KKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLI 89
           K IY+A N +++++AL+ F  +W  KY    +S  N  + L TF+QFP +I   IY+TNLIE++N+ I++ TK K    +  AL + +
  S:   274 KTIYRAENLEMAVQALENFIAEWKPKYRKVMESLENT-DNLLTFYQFPYQIWHSIYSTNLIESLNKEIKRQTKKKVLFPNEEALERYL 360
>gi|55821065|ref|YP_139507.1| IS1191 transposase [Streptococcus thermophilus LMG 18311] >gi|55737050|gb|AAV60692.1| IS1191, transposase, IS256 family [Streptococcus thermophilus LMG 18311] (362 aa)
Score = 152, Expect = 5.8e-09, Identities = 34/88 (38%), Positives = 55/88 (62%)
  Q:     2 KKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLI 89
           K IY+A N +++++AL+ F  +W  KY    +S  N  + L TF+QFP +I   IY+TNLIE++N+ I++ TK K    +  AL + +
  S:   245 KTIYRAENLEMAVQALENFIAEWKPKYRKVMESLENT-DNLLTFYQFPYQIWHSIYSTNLIESLNKEIKRQTKKKVLFPNEEALERYL 331
>gi|116511320|ref|YP_808536.1| transposase [Lactococcus lactis subsp. cremoris SK11] >gi|116511444|ref|YP_808660.1| transposase [Lactococcus lactis subsp. cremoris SK11] >gi|116511474|ref|YP_808690.1| transposase [Lactococcus lactis subsp. cremoris SK11] >gi|116512995|ref|YP_811902.1| transposase [Lactococcus lactis subsp. cremoris SK11] >gi|116513120|ref|YP_812027.1| transposase [Lactococcus lactis subsp. cremoris SK11] >gi|116106974|gb|ABJ72114.1| Transposase [Lactococcus lactis subsp. cremoris SK11] >gi|116107098|gb|ABJ72238.1| Transposase [Lactococcus lactis subsp. cremoris SK11] >gi|116107128|gb|ABJ72268.1| Transposase [Lactococcus lactis subsp. cremoris SK11] >gi|116108649|gb|ABJ73789.1| Transposase [Lactococcus lactis subsp. cremoris SK11] >gi|116108774|gb|ABJ73914.1| Transposase [Lactococcus lactis subsp. cremoris SK11] (391 aa)
Score = 152, Expect = 5.8e-09, Identities = 34/88 (38%), Positives = 55/88 (62%)
  Q:     2 KKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLI 89
           K IY+A N +++++AL+ F  +W  KY    +S  N  + L TF+QFP +I   IY+TNLIE++N+ I++ TK K    +  AL + +
  S:   274 KTIYRAENLEMAVQALENFIAEWKPKYRKVMESLENT-DNLLTFYQFPYQIWHSIYSTNLIESLNKEIKRQTKKKVLFPNEEALERYL 360
>gi|116627694|ref|YP_820313.1| transposase [Streptococcus thermophilus LMD-9] >gi|116100971|gb|ABJ66117.1| Transposase [Streptococcus thermophilus LMD-9] (391 aa)
Score = 152, Expect = 6.1e-09, Identities = 34/88 (38%), Positives = 55/88 (62%)
  Q:     2 KKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLI 89
           K IY+A N +++++AL+ F  +W  KY    +S  N  + L TF+QFP +I   IY+TNLIE++N+ I++ TK K    +  AL + +
  S:   274 KTIYRAKNLEMAVQALENFIAEWKPKYRKVMESLENT-DNLLTFYQFPYQIWHSIYSTNLIESLNKEIKRQTKKKVLFPNEEALERYL 360
>gi|116627696|ref|YP_820315.1| transposase [Streptococcus thermophilus LMD-9] >gi|116100973|gb|ABJ66119.1| Transposase [Streptococcus thermophilus LMD-9] (391 aa)
Score = 152, Expect = 6.4e-09, Identities = 34/88 (38%), Positives = 55/88 (62%)
  Q:     2 KKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLI 89
           K IY+A N +++++AL+ F  +W  KY    +S  N  + L TF+QFP +I   IY+TNLIE++N+ I++ TK K    +  AL + +
  S:   274 KTIYRAKNLEMAVQALENFIAEWKPKYRKVMESLENT-DNLLTFYQFPYQIWHSIYSTNLIESLNKEIKRQTKKKVLFPNEEALERYL 360
>gi|22218130|gb|AAM94581.1|AF448502_2 transposase [Streptococcus thermophilus] (391 aa)
Score = 152, Expect = 6.5e-09, Identities = 34/88 (38%), Positives = 55/88 (62%)
  Q:     2 KKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLI 89
           K IY+A N +++++AL+ F  +W  KY    +S  N  + L TF+QFP +I   IY+TNLIE++N+ I++ TK K    +  AL + +
  S:   274 KTIYRAENLEMAVQALENFIAEWKPKYRKVMESLENT-DNLLTFYQFPYQIWHSIYSTNLIESLNKEIKRQTKKKVLFPNEEALERYL 360
>gi|55820887|ref|YP_139329.1| IS1191 transposase [Streptococcus thermophilus LMG 18311] >gi|55736872|gb|AAV60514.1| IS1191, transposase, IS256 family [Streptococcus thermophilus LMG 18311] (402 aa)
Score = 151, Expect = 7.2e-09, Identities = 34/88 (38%), Positives = 55/88 (62%)
  Q:     2 KKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLI 89
           K IY+A N +++++AL+ F  +W  KY    +S  N  + L TF+QFP +I   IY+TNLIE++N+ I++ TK K    +  AL + +
  S:   285 KTIYRAKNLEMAVQALENFIAEWKPKYRKVMESLENT-DNLLTFYQFPYQIWHSIYSTNLIESLNKEIKRQTKKKVLFPNEEALERYL 371
>gi|24636989|gb|AAN63505.1|AF410175_2 transposase [Streptococcus thermophilus] (391 aa)
Score = 151, Expect = 7.3e-09, Identities = 34/88 (38%), Positives = 55/88 (62%)
  Q:     2 KKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLI 89
           K IY+A N +++++AL+ F  +W  KY    +S  N  + L TF+QFP +I   IY+TNLIE++N+ I++ TK K    +  AL + +
  S:   274 KTIYRAENLEMAVQALENFIAEWKPKYRKVMESLENT-DNLLTFYQFPYQIWHSIYSTNLIESLNKEIKRQTKKKVLFPNEEALERYL 360
>gi|55822813|ref|YP_141254.1| IS1191 transposase [Streptococcus thermophilus CNRZ1066] >gi|55738798|gb|AAV62439.1| IS1191, transposase, IS256 family [Streptococcus thermophilus CNRZ1066] (392 aa)
Score = 151, Expect = 7.3e-09, Identities = 34/88 (38%), Positives = 55/88 (62%)
  Q:     2 KKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLI 89
           K IY+A N +++++AL+ F  +W  KY    +S  N  + L TF+QFP +I   IY+TNLIE++N+ I++ TK K    +  AL + +
  S:   275 KTIYRAENLEMAVQALENFIAEWKPKYRKVMESLENT-DNLLTFYQFPYQIWHSIYSTNLIESLNKEIKRQTKKKVLFPNEEALERYL 361
>gi|116627700|ref|YP_820319.1| transposase [Streptococcus thermophilus LMD-9] >gi|22416337|emb|CAC87148.1| transposase [Streptococcus thermophilus] >gi|116100977|gb|ABJ66123.1| Transposase [Streptococcus thermophilus LMD-9] (391 aa)
Score = 151, Expect = 7.3e-09, Identities = 34/88 (38%), Positives = 55/88 (62%)
  Q:     2 KKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLI 89
           K IY+A N +++++AL+ F  +W  KY    +S  N  + L TF+QFP +I   IY+TNLIE++N+ I++ TK K    +  AL + +
  S:   274 KTIYRAENLEMAVQALENFIAEWKPKYRKVMESLENT-DNLLTFYQFPYQIWHSIYSTNLIESLNKEIKRQTKKKVLFPNEEALERYL 360
>gi|55822804|ref|YP_141245.1| IS1191 transposase [Streptococcus thermophilus CNRZ1066] >gi|55738789|gb|AAV62430.1| IS1191, transposase, IS256 family [Streptococcus thermophilus CNRZ1066] (402 aa)
Score = 151, Expect = 7.7e-09, Identities = 34/88 (38%), Positives = 55/88 (62%)
  Q:     2 KKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLI 89
           K IY+A N +++++AL+ F  +W  KY    +S  N  + L TF+QFP +I   IY+TNLIE++N+ I++ TK K    +  AL + +
  S:   285 KTIYRAKNLEMAVQALENFIAEWKPKYRKVMESLENT-DNLLTFYQFPYQIWHSIYSTNLIESLNKEIKRQTKKKVLFPNEEALERYL 371
>gi|116511735|ref|YP_808951.1| transposase [Lactococcus lactis subsp. cremoris SK11] >gi|116107389|gb|ABJ72529.1| Transposase [Lactococcus lactis subsp. cremoris SK11] (391 aa)
Score = 151, Expect = 7.7e-09, Identities = 34/88 (38%), Positives = 54/88 (61%)
  Q:     2 KKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLI 89
           K IY A N +++++AL+ F  +W  KY    +S  N  + L TF+QFP +I   IY+TNLIE++N+ I++ TK K    +  AL + +
  S:   274 KTIYSAENLEMAVQALENFIAEWKPKYRKVMESLENT-DNLLTFYQFPYQIWHSIYSTNLIESLNKEIKRQTKKKVLFPNEEALERYL 360
>gi|116511796|ref|YP_809012.1| transposase [Lactococcus lactis subsp. cremoris SK11] >gi|116511821|ref|YP_809037.1| transposase [Lactococcus lactis subsp. cremoris SK11] >gi|116107450|gb|ABJ72590.1| Transposase [Lactococcus lactis subsp. cremoris SK11] >gi|116107475|gb|ABJ72615.1| Transposase [Lactococcus lactis subsp. cremoris SK11] (391 aa)
Score = 151, Expect = 7.7e-09, Identities = 34/88 (38%), Positives = 54/88 (61%)
  Q:     2 KKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLI 89
           K IY A N +++++AL+ F  +W  KY    +S  N  + L TF+QFP +I   IY+TNLIE++N+ I++ TK K    +  AL + +
  S:   274 KTIYSAENLEMAVQALENFIAEWKPKYRKVMESLENT-DNLLTFYQFPYQIWHSIYSTNLIESLNKEIKRQTKKKVLFPNEEALERYL 360
>gi|55820420|ref|YP_138862.1| IS1191 transposase [Streptococcus thermophilus LMG 18311] >gi|55736405|gb|AAV60047.1| IS1191, transposase, IS256 family [Streptococcus thermophilus LMG 18311] (402 aa)
Score = 151, Expect = 8.2e-09, Identities = 34/88 (38%), Positives = 55/88 (62%)
  Q:     2 KKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLI 89
           K IY+A N +++++AL+ F  +W  KY    +S  N  + L TF+QFP +I   IY+TNLIE++N+ I++ TK K    +  AL + +
  S:   285 KTIYRAENLEMAVQALENFIAEWKPKYRKVMESLENT-DNLLTFYQFPYQIWHSIYSTNLIESLNKEIKRQTKKKVLFPNEEALERYL 371
>gi|24637504|gb|AAN63774.1|AF454500_16 transposase [Streptococcus thermophilus] (391 aa)
Score = 151, Expect = 8.2e-09, Identities = 34/88 (38%), Positives = 55/88 (62%)
  Q:     2 KKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLI 89
           K IY+A N +++++AL+ F  +W  KY    +S  N  + L TF+QFP +I   IY+TNLIE++N+ I++ TK K    +  AL + +
  S:   274 KTIYRAENLEMAVQALENFIAEWKPKYRKVMESLENT-DNLLTFYQFPYQIWHSIYSTNLIESLNKEIKRQTKKKVLFPNEEALERYL 360
>gi|134099087|ref|YP_001104748.1| transposase, mutator type [Saccharopolyspora erythraea NRRL 2338] >gi|133911710|emb|CAM01823.1| transposase, mutator type [Saccharopolyspora erythraea NRRL 2338] (273 aa)
Score = 149, Expect = 1.2e-08, Identities = 32/101 (31%), Positives = 52/101 (51%)
  Q:    22 EKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKS---RVANWGLILQQLKILFENEI 122
           + W  KY    + W ++ E+ T F  FP EIR++IYTTN +E++N   R+ T  +G   +  A  K++YL +     N  +   R   W   L  L + + + I
  S:   167 QDWGRKYPAIIRLWRSSWEQFTPFLAFPPEIRKIIYTTNAVESLNARFRQATHRRGHFPNEQAALKVLYLVIRTPQRNRTNVTGRTGGWKTALNTLAMFYGDRI 270
>gi|194565393|ref|YP_002100415.1| Transposase [Burkholderia dolosa AUO158] >gi|124899053|gb|EAY70896.1| Transposase [Burkholderia dolosa AUO158] (103 aa)
Score = 148, Expect = 1.5e-08, Identities = 31/93 (33%), Positives = 51/93 (54%)
  Q:    26 SKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           +KY      W    +++  F+ F  +IR+++YTTN IE+++  +RKI KA+G   S  A  KLI+L L N+   W     +W   + Q  +L+
  S:     3 TKYPPIAALWRRAWDQVIPFYAFAPDIRKIVYTTNAIESLHMQLRKIIKARGHFPSDEAALKLIWLALRNVVAKWTGSRHDWKSAMTQFALLY 95
>gi|18265930|gb|AAL67403.1|AF447814_71 putative transposase [Escherichia coli] (237 aa)
Score = 147, Expect = 2.2e-08, Identities = 29/74 (39%), Positives = 46/74 (62%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITK 74
           +K +Y+A + + +  AL     K   +Y    +SW    E L+ +F++PA IR++IYTTN IE+V+R  RK+TK
  S:   163 LKPVYRAVSKEAAETALDELEAKRGQQYPVVLQSWRRKRENLSAYFRYPANIRKVIYTTNAIESVHRQFRKLTK 236
>gi|26250984|ref|NP_757024.1| transposase [Escherichia coli CFT073] >gi|26111416|gb|AAN83598.1|AE016771_109 Putative Transposase within prophage [Escherichia coli CFT073] (260 aa)
Score = 147, Expect = 2.4e-08, Identities = 29/74 (39%), Positives = 46/74 (62%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITK 74
           +K +Y+A + + +  AL     K   +Y    +SW    E L+ +F++PA IR++IYTTN IE+V+R  RK+TK
  S:   186 LKPVYRAVSKEAAETALDELEAKRGQQYPVVLQSWRRKRENLSAYFRYPANIRKVIYTTNAIESVHRQFRKLTK 259
>gi|15923405|ref|NP_370939.1| transposase [Staphylococcus aureus subsp. aureus Mu50] >gi|156978743|ref|YP_001441002.1| transposase [Staphylococcus aureus subsp. aureus Mu3] >gi|14246183|dbj|BAB56577.1| transposase [Staphylococcus aureus subsp. aureus Mu50] >gi|156720878|dbj|BAF77295.1| transposase [Staphylococcus aureus subsp. aureus Mu3] (396 aa)
Score = 146, Expect = 2.6e-08, Identities = 31/88 (35%), Positives = 53/88 (60%)
  Q:     2 KKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLI 89
           K +YQA + +V+++A   F EKW + Y    +S  +N + L TF+ FP  IR+ IY+TNLIE+ N+ I+K +  K    +  ++ + +
  S:   274 KMVYQASSKEVALEARGTFAEKWKTSYPKVVESILSN-DHLLTFYDFPLAIRKSIYSTNLIESFNKQIKKYSHRKEQFQNEESMERFL 360
>gi|14389012|gb|AAK61894.1|AF373595_2 transposase [Streptococcus thermophilus] (391 aa)
Score = 146, Expect = 2.7e-08, Identities = 33/88 (37%), Positives = 54/88 (61%)
  Q:     2 KKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLI 89
           K IY+A N +++++ L+ F  +W  KY    +S  N  + L TF+QFP +I   IY+TNLIE++N+ I++ TK K    +  AL + +
  S:   274 KTIYRAENLEMAVQILENFIAEWKPKYRKVMESLENT-DNLLTFYQFPYQIWHSIYSTNLIESLNKEIKRQTKKKVLFPNEEALERYL 360
>gi|113120164|gb|ABI30225.1| putative transposase [Streptococcus macedonicus] (391 aa)
Score = 146, Expect = 3.0e-08, Identities = 33/88 (37%), Positives = 54/88 (61%)
  Q:     2 KKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLI 89
           K IY+A N +++++ L+ F  +W  KY    +S  N  + L TF+QFP +I   IY+TNLIE++N+ I++ TK K    +  AL + +
  S:   274 KTIYRAENLEMAVQILENFIAEWKPKYRKVMESLENT-DNLLTFYQFPYQIWHSIYSTNLIESLNKEIKRQTKKKVLFPNEEALERYL 360
>gi|405804|emb|CAA50683.1| transposase [Streptococcus thermophilus] >gi|15485431|emb|CAC67525.1| putative transposase [Streptococcus thermophilus] (391 aa)
Score = 146, Expect = 3.2e-08, Identities = 33/88 (37%), Positives = 54/88 (61%)
  Q:     2 KKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLI 89
           K IY+A N +++++ L+ F  +W  KY    +S  N  + L TF+QFP +I   IY+TNLIE++N+ I++ TK K    +  AL + +
  S:   274 KTIYRAENLEMAVQILENFIAEWKPKYRKVMESLENT-DNLLTFYQFPYQIWHSIYSTNLIESLNKEIKRQTKKKVLFPNEEALERYL 360
>gi|70608374|gb|AAZ04446.1| hypothetical protein ORF_37 [Escherichia coli] (121 aa)
Score = 145, Expect = 3.3e-08, Identities = 29/74 (39%), Positives = 46/74 (62%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITK 74
           +K +Y+A + + +  AL     K   +Y    +SW    E L+ +F++PA IR++IYTTN IE+V+R  RK+TK
  S:    47 LKPVYRAVSKEAAETALDELEAKRGQQYPVVLQSWRRKRENLSAYFRYPANIRKVIYTTNAIESVHRKFRKLTK 120
>gi|55823022|ref|YP_141463.1| IS1191 transposase [Streptococcus thermophilus CNRZ1066] >gi|55739007|gb|AAV62648.1| IS1191, transposase, IS256 family [Streptococcus thermophilus CNRZ1066] (402 aa)
Score = 145, Expect = 3.7e-08, Identities = 33/88 (37%), Positives = 54/88 (61%)
  Q:     2 KKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLI 89
           K IY+A N +++++ L+ F  +W  KY    +S  N  + L TF+QFP +I   IY+TNLIE++N+ I++ TK K    +  AL + +
  S:   285 KTIYRAENLEMAVQILENFIAEWKPKYRKVMESLENT-DNLLTFYQFPYQIWHSIYSTNLIESLNKEIKRQTKKKVLFPNEEALERYL 371
>gi|24637415|gb|AAN63693.1|AF454495_20 tnp-IS1191 [Streptococcus thermophilus] (391 aa)
Score = 144, Expect = 4.5e-08, Identities = 33/88 (37%), Positives = 53/88 (60%)
  Q:     2 KKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLI 89
           K IY+A N +++++ L  F  +W  KY    +S  N  + L TF+QFP +I   IY+TNLIE++N+ I++ TK K    +  AL + +
  S:   274 KTIYRAENLEMAVQILDNFIAEWKPKYRKVMESLENT-DNLLTFYQFPYQIWHSIYSTNLIESLNKEIKRQTKKKVLFPNEEALERYL 360
>gi|20385127|gb|AAM21176.1|AF329367_2 transposase [Enterococcus faecalis] >gi|20385135|gb|AAM21184.1|AF329367_12 transposase [Enterococcus faecalis] >gi|21693315|gb|AAM75262.1|AF454824_57 EF0057 [Enterococcus faecalis] >gi|30058666|gb|AAK67275.1| transposase [Enterococcus faecalis] (392 aa)
Score = 144, Expect = 5.3e-08, Identities = 35/105 (33%), Positives = 58/105 (55%)
  Q:     2 KKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVAN 106
           K +YQA + + +   L    EKW   Y   T+S   N ++L TF+ FP  IRR IY+TNLIE+ N+ I++ ++ KG   +  +L +     L++I + +  +  N
  S:   274 KAVYQANSKEEANTFLSGMIEKWKKNYPKVTQSLIEN-QDLLTFYDFPPSIRRTIYSTNLIESFNKQIKRYSRRKGQFQNEESLERF----LVSIFDTYNQKFLN 373
>gi|27817685|emb|CAD61112.1| putative transposase [Cupriavidus oxalaticus] (381 aa)
Score = 143, Expect = 6.5e-08, Identities = 24/54 (44%), Positives = 34/54 (62%)
  Q:    24 WSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKG 77
           W  K+     +W    +++  FF FP E+RR+IYTTN IE+VN  +RKI K +G
  S:   318 WGQKFPTVVGAWRRAWDKVIPFFAFPPEVRRVIYTTNAIESVNARLRKIIKTRG 371
>gi|115359398|ref|YP_776536.1| transposase mutator family protein [Burkholderia ambifaria AMMD] >gi|115284686|gb|ABI90202.1| transposase, mutator family [Burkholderia ambifaria AMMD] (105 aa)
Score = 143, Expect = 6.6e-08, Identities = 28/79 (35%), Positives = 47/79 (59%)
  Q:    40 EELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           +++  F+ F  +IR+++YTTN IE+++  +RKI KA+G   S  A  KLI+L L N+   W     +W   + Q  +L+
  S:    19 DQVIPFYAFAPDIRKIVYTTNAIESLHMQLRKIIKARGHFPSDEAALKLIWLALRNVVAKWTGSRHDWKSAMTQFALLY 97
>gi|55820896|ref|YP_139338.1| IS1191 transposase [Streptococcus thermophilus LMG 18311] >gi|55736881|gb|AAV60523.1| IS1191, transposase, IS256 family [Streptococcus thermophilus LMG 18311] (402 aa)
Score = 142, Expect = 8.1e-08, Identities = 33/88 (37%), Positives = 54/88 (61%)
  Q:     2 KKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLI 89
           K IY+A N +++++AL+ F  +W  KY    +S  N  + L TF+QF  +I   IY+TNLIE++N+ I++ TK K    +  AL + +
  S:   285 KTIYRAENLEMAVQALENFIAEWKPKYRKVMESLENT-DNLLTFYQFSYQIWHSIYSTNLIESLNKEIKRQTKKKVLFPNEEALERYL 371
>gi|68536876|ref|YP_251581.1| transposase for IS3525 [Corynebacterium jeikeium K411] >gi|68264475|emb|CAI37963.1| transposase for IS3525 [Corynebacterium jeikeium K411] (166 aa)
Score = 142, Expect = 8.6e-08, Identities = 35/108 (32%), Positives = 56/108 (51%)
  Q:     1 MKKIYQAPNFDVSMKALKIF-TEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWG 108
           +KKIY A +   +  AL  F   +   KY  + K W +  +    F QFP   R++IYTTN IE+ N  +RK T+ +   T+  +  K ++L + NI +   ++ A  G
  S:    29 LKKIYTAADESTAQAALDEFEASELGEKYPRSVKVWRDAWQRFVPFLQFPPAARKVIYTTNSIESFNNELRKATRNRVQFTNDESALKTLWLMICNIEDKRAAKRAKQG 137
>gi|69246162|ref|ZP_00603831.1| Transposase, mutator type [Enterococcus faecium DO] >gi|68195370|gb|EAN09818.1| Transposase, mutator type [Enterococcus faecium DO] (228 aa)
Score = 142, Expect = 9.1e-08, Identities = 32/103 (31%), Positives = 54/103 (52%)
  Q:     2 KKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRV 104
           K +YQA + + +M  +    +KW  +Y    K   N    + TF+ FP  IRR IY+TNLIE  N+ ++K TK K    +  +L + +  +  N ++ +  R+
  S:   113 KLVYQAASKEEAMNQISFMIDKWKKQYPRVVKLLMN--PAILTFYNFPPSIRRTIYSTNLIEGFNKQLKKYTKRKEQFPNEESLERFLVSQFNNYNQKFLCRI 213
>gi|55821914|ref|YP_140356.1| IS1191 transposase [Streptococcus thermophilus LMG 18311] >gi|55737899|gb|AAV61541.1| IS1191, transposase, IS256 family [Streptococcus thermophilus LMG 18311] (402 aa)
Score = 141, Expect = 9.5e-08, Identities = 31/75 (41%), Positives = 48/75 (64%)
  Q:     2 KKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAK 76
           K IY+A N +++++ L+ F  +W  KY    +S  N  + L TF QFP +I   IY+TNLIE++N+ I++ TK K
  S:   285 KTIYRAENLEMAVQILENFIAEWKPKYRKVMESLENT-DNLLTFHQFPYQIWHSIYSTNLIESLNKEIKRQTKKK 358
>gi|56962597|ref|YP_174323.1| IS256 family transposase [Bacillus clausii KSM-K16] >gi|56962935|ref|YP_174662.1| IS256 family transposase [Bacillus clausii KSM-K16] >gi|56962977|ref|YP_174704.1| IS256 family transposase [Bacillus clausii KSM-K16] >gi|56965034|ref|YP_176765.1| IS256 family transposase [Bacillus clausii KSM-K16] >gi|56908835|dbj|BAD63362.1| IS256 family transposase [Bacillus clausii KSM-K16] >gi|56909174|dbj|BAD63701.1| IS256 family transposase [Bacillus clausii KSM-K16] >gi|56909216|dbj|BAD63743.1| IS256 family transposase [Bacillus clausii KSM-K16] >gi|56909412|dbj|BAD63939.1| IS256 family transposase [Bacillus clausii KSM-K16] >gi|56911277|dbj|BAD65804.1| IS256 family transposase [Bacillus clausii KSM-K16] (394 aa)
Score = 141, Expect = 9.6e-08, Identities = 32/75 (42%), Positives = 44/75 (58%)
  Q:     2 KKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAK 76
           K++Y+A +     KAL  F  KW   Y  ATKS   N   + TF+ FP  I R IY+TNLIE+ N+ ++K +K K
  S:   274 KRVYRATSKQEGQKALDDFVTKWKKVYPRATKSLEEN-PFILTFYDFPQAIWRSIYSTNLIESFNKQLKKYSKRK 347
>gi|55822987|ref|YP_141428.1| truncated IS1191 transposase [Streptococcus thermophilus CNRZ1066] >gi|55738972|gb|AAV62613.1| IS1191, transposase, IS256 family, truncated [Streptococcus thermophilus CNRZ1066] (268 aa)
Score = 141, Expect = 1.2e-07, Identities = 32/88 (36%), Positives = 54/88 (61%)
  Q:     2 KKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLI 89
           K IY+A N +++++ L+ F  +W  KY    +S  N  + L TF+QFP +I   +Y+TNLIE++N+ I++ TK K    +  AL + +
  S:   151 KTIYRAENLEMAVQILENFIAEWKPKYRKVMESLENT-DNLLTFYQFPYQIWHSMYSTNLIESLNKEIKRQTKKKVLFPNEEALERYL 237
>gi|121633864|ref|YP_976102.1| IS256 family transposase [Enterococcus faecium] >gi|124112030|ref|YP_001019059.1| IS256 family transposase [Enterococcus faecium] >gi|121490923|emb|CAL36559.1| transposase, IS256 family [Enterococcus faecium] >gi|124012132|emb|CAL90965.1| putative transposase, IS256 family [Enterococcus faecium] (396 aa)
Score = 140, Expect = 1.3e-07, Identities = 30/88 (34%), Positives = 51/88 (57%)
  Q:     2 KKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLI 89
           K +YQA +   +++A   F EKW + Y    +S  +N + L TF+ FP  IR+ IY+TNLIE+ N+ I+K +  K    +  ++ + +
  S:   274 KMVYQASSKKAALEARGAFAEKWKTSYPKMVESILSN-DYLLTFYDFPLAIRKTIYSTNLIESFNKQIKKYSHCKEQFQNEESMERFL 360
>gi|61387415|gb|AAX45363.1| transposase [Enterococcus faecium] (392 aa)
Score = 140, Expect = 1.4e-07, Identities = 35/105 (33%), Positives = 58/105 (55%)
  Q:     2 KKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVAN 106
           K +YQA + + +   L    EKW   Y   T+S   N ++L TF++FP  IRR IY+TNLIE+ N+ I+K ++ K    +  +L +     L++I + +  +  N
  S:   274 KAVYQASSKEEANTFLGSMIEKWQKTYPKVTQSLIKN-QDLLTFYEFPPGIRRSIYSTNLIESFNKQIKKYSRRKEQFQNEESLERF----LVSIFDTYNQKFLN 373
>gi|69246180|ref|ZP_00603849.1| Transposase, mutator type [Enterococcus faecium DO] >gi|68195388|gb|EAN09836.1| Transposase, mutator type [Enterococcus faecium DO] (392 aa)
Score = 140, Expect = 1.4e-07, Identities = 35/105 (33%), Positives = 58/105 (55%)
  Q:     2 KKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVAN 106
           K +YQA + + +   L    EKW   Y   T+S   N ++L TF++FP  IRR IY+TNLIE+ N+ I+K ++ K    +  +L +     L++I + +  +  N
  S:   274 KAVYQASSKEEANTFLGSMIEKWQKTYPKVTQSLIKN-QDLLTFYEFPPGIRRSIYSTNLIESFNKQIKKYSRRKEQFQNEESLERF----LVSIFDTYNQKFLN 373
>gi|21693294|gb|AAM75241.1|AF454824_35 EF0035 [Enterococcus faecalis] (231 aa)
Score = 140, Expect = 1.5e-07, Identities = 35/105 (33%), Positives = 58/105 (55%)
  Q:     2 KKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVAN 106
           K +YQA + + +   L    EKW   Y   T+S   N ++L TF++FP  IRR IY+TNLIE+ N+ I+K ++ K    +  +L +     L++I + +  +  N
  S:   113 KAVYQASSKEEANTFLGSMIEKWQKTYPKVTQSLIKN-QDLLTFYEFPPGIRRSIYSTNLIESFNKQIKKYSRRKEQFQNEESLERF----LVSIFDTYNQKFLN 212
>gi|111017032|ref|YP_700004.1| transposase mutator family protein [Rhodococcus sp. RHA1] >gi|110816562|gb|ABG91846.1| probable transposase, mutator family protein [Rhodococcus sp. RHA1] (338 aa)
Score = 140, Expect = 1.5e-07, Identities = 38/122 (31%), Positives = 58/122 (47%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSR---VANWGLILQQLKILFENEI 122
           ++ IY A N   + +    F +KW  +Y    + W +   E   F  +  EIRR+I +TN IE++N   R+  +A+G   S  A  K +YL   ++  + K R   V  W   L    I FE  I
  S:   209 LRPIYTAVNEAAAKEQFTEFADKWGPRYPAIVRLWESAWSEFVPFLDYDPEIRRVICSTNAIESLNARYRRAVRARGHFPSEQAALKCLYLATRSLDPSGKGRARWVTRWKPALNAFAITFEGRI 333
>gi|29376403|ref|NP_815557.1| IS256 family transposase [Enterococcus faecalis V583] >gi|29343866|gb|AAO81627.1| transposase, IS256 family [Enterococcus faecalis V583] (396 aa)
Score = 140, Expect = 1.5e-07, Identities = 30/88 (34%), Positives = 51/88 (57%)
  Q:     2 KKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLI 89
           K +YQ  +  V+++A   F EKW + Y    +S  +N + L TF+ FP  IR+ IY+TNLIE+ N+ I+K +  K    +  ++ + +
  S:   274 KMVYQTSSKKVALEARGAFAEKWKTSYPKVVESILSN-DHLLTFYDFPLAIRKSIYSTNLIESFNKQIKKYSHRKEQFQNEESMERFL 360
>gi|111025269|ref|YP_707689.1| transposase mutator family protein [Rhodococcus sp. RHA1] >gi|110824248|gb|ABG99531.1| probable transposase, mutator family protein [Rhodococcus sp. RHA1] (421 aa)
Score = 139, Expect = 1.7e-07, Identities = 38/122 (31%), Positives = 57/122 (46%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSR---VANWGLILQQLKILFENEI 122
           ++ IY A N   + +    F +KW  +Y    + W +   E   F  +  EIRR+I +TN IE++N   R+  +A+G   S  A  K +YL   ++    K R   V  W   L    I FE  I
  S:   292 LRPIYTAVNEAAAKEQFTEFADKWGPRYPAIVRLWESAWSEFVPFLDYDPEIRRVICSTNAIESLNARYRRAVRARGHFPSEQAALKCLYLATRSLDPTGKGRARWVTRWKPALNAFAITFEGRI 416
>gi|55822806|ref|YP_141247.1| truncated IS1191 transposase [Streptococcus thermophilus CNRZ1066] >gi|55738791|gb|AAV62432.1| IS1191, transposase, IS256 family, truncated [Streptococcus thermophilus CNRZ1066] (166 aa)
Score = 139, Expect = 2.0e-07, Identities = 33/88 (37%), Positives = 54/88 (61%)
  Q:     2 KKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLI 89
           K IY+A N +++++ L+ F  +W  KY    +S  N  + L TF+QFP +I   IY+TNLIE++N+ I++ TK K    +  AL + +
  S:    49 KTIYRAENLEMAVQILENFIAEWKPKYRKVMESLENT-DNLLTFYQFPYQIWHSIYSTNLIESLNKEIKRQTKKKVLFPNEEALERYL 135
>gi|5832486|emb|CAB54943.1| YPCD1.66 [Yersinia pestis CO92] (92 aa)
Score = 138, Expect = 2.4e-07, Identities = 30/83 (36%), Positives = 49/83 (59%)
  Q:    40 EELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           E L TFF +P +IR+ IYTTN IE++N  IR+  K      + +++ K+IYL + + S+ W   + NW L + +  I F + +
  S:     6 ENLNTFFGYPPDIRKAIYTTNAIESLNSVIRQAIKKCKVFPTDDSVRKVIYLAIRDASKKWSMPIQNWRLAMSRFIIEFGDRL 88
>gi|69246054|ref|ZP_00603781.1| Transposase, mutator type [Enterococcus faecium DO] >gi|68195426|gb|EAN09872.1| Transposase, mutator type [Enterococcus faecium DO] (389 aa)
Score = 138, Expect = 2.4e-07, Identities = 32/103 (31%), Positives = 54/103 (52%)
  Q:     2 KKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRV 104
           K +YQA + + +   ++   +KW  +Y    K   N    + TF+ FP  IRR IY+TNLIE  N+ ++K TK K    +  +L + +  +  N ++ +  RV
  S:   274 KLVYQASSKEEANNQIRFMIDKWKKQYPRVVKLLMN--PAILTFYNFPPSIRRTIYSTNLIEGFNKQLKKYTKRKEQFPNEESLERFLVSQFNNYNQKFLCRV 374
>gi|160871574|ref|ZP_02061706.1| transposase, mutator type [Rickettsiella grylli] >gi|160872596|ref|ZP_02062728.1| transposase, mutator type [Rickettsiella grylli] >gi|159120373|gb|EDP45711.1| transposase, mutator type [Rickettsiella grylli] >gi|159121395|gb|EDP46733.1| transposase, mutator type [Rickettsiella grylli] (126 aa)
Score = 138, Expect = 2.5e-07, Identities = 36/93 (38%), Positives = 49/93 (52%)
  Q:    30 YATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           Y   SW N I     FF +P EIR++IYTTN IE++N  +RK  K K    S  A  K IYL +  I++ W   + +W   L +  I F + I
  S:    11 YRLTSWENVI----PFFGYPTEIRKVIYTTNAIESLNMTLRKFIKNKRIFPSDEAAFKQIYLAMQIIAKKWTMPIRDWKPALARFTIEFGDRI 99
>gi|55823832|ref|YP_142273.1| truncated IS1191 transposase [Streptococcus thermophilus CNRZ1066] >gi|55739817|gb|AAV63458.1| IS1191, transposase, IS256 family, truncated [Streptococcus thermophilus CNRZ1066] (268 aa)
Score = 137, Expect = 3.0e-07, Identities = 32/88 (36%), Positives = 53/88 (60%)
  Q:     2 KKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLI 89
           K IY+A N +++++ L+ F  +W  KY    +S  N  + L TF+QFP +I   IY+T LIE++N+ I++ TK K    +  AL + +
  S:   151 KTIYRAENLEMAVQILENFIAEWKPKYRKVMESLENT-DNLLTFYQFPYQIWHSIYSTTLIESLNKEIKRQTKKKVLFPNEEALERYL 237
>gi|13375365|gb|AAK20297.1|AF323462_1 transposase [Lactococcus lactis subsp. cremoris MG1363] (118 aa)
Score = 137, Expect = 3.2e-07, Identities = 33/88 (37%), Positives = 54/88 (61%)
  Q:     2 KKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLI 89
           K IY+A N +++++AL+ F  +W  KY    +S  N  + L TF+QFP +I   IY+TNL E++N+ I++ TK K    +  AL + +
  S:     1 KTIYRAENLEMAVQALENFIAEWKPKYRKVMESLENT-DNLLTFYQFPYQIWHSIYSTNLTESLNKEIKRQTKKKVLFPNEEALERYL 87
>gi|69245595|ref|ZP_00603533.1| ISEf1, transposase [Enterococcus faecium DO] >gi|68195722|gb|EAN10160.1| ISEf1, transposase [Enterococcus faecium DO] (177 aa)
Score = 136, Expect = 4.4e-07, Identities = 34/105 (32%), Positives = 57/105 (54%)
  Q:     2 KKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVAN 106
           K +YQA + + +   L    EKW   Y   T+S   N ++L TF+ FP  IRR IY+TNLIE+ N+ I++ ++ K    +  +L +     L++I + +  +  N
  S:    59 KAVYQANSKEEANTFLSGMIEKWKKNYPKVTQSLIEN-QDLLTFYDFPPSIRRTIYSTNLIESFNKQIKRYSRRKEQFQNEESLERF----LVSIFDTYNQKFLN 158
>gi|29375002|ref|NP_814155.1| ISEf1, transposase [Enterococcus faecalis V583] >gi|29375204|ref|NP_814357.1| ISEf1, transposase [Enterococcus faecalis V583] >gi|29376681|ref|NP_815835.1| ISEf1, transposase [Enterococcus faecalis V583] >gi|29376693|ref|NP_815847.1| ISEf1, transposase [Enterococcus faecalis V583] >gi|29377271|ref|NP_816425.1| ISEf1, transposase [Enterococcus faecalis V583] >gi|69244269|ref|ZP_00602737.1| Transposase, mutator type [Enterococcus faecium DO] >gi|69244966|ref|ZP_00603156.1| Transposase, mutator type [Enterococcus faecium DO] >gi|29342461|gb|AAO80226.1| ISEf1, transposase [Enterococcus faecalis V583] >gi|29342663|gb|AAO80428.1| ISEf1, transposase [Enterococcus faecalis V583] >gi|29344145|gb|AAO81905.1| ISEf1, transposase [Enterococcus faecalis V583] >gi|29344157|gb|AAO81917.1| ISEf1, transposase [Enterococcus faecalis V583] >gi|29344737|gb|AAO82495.1| ISEf1, transposase [Enterococcus faecalis V583] >gi|68196132|gb|EAN10563.1| Transposase, mutator type [Enterococcus faecium DO] >gi|68196455|gb|EAN10882.1| Transposase, mutator type [Enterococcus faecium DO] >gi|117979178|gb|ABK59940.1| transposase [Enterococcus faecalis] (392 aa)
Score = 136, Expect = 4.4e-07, Identities = 34/105 (32%), Positives = 57/105 (54%)
  Q:     2 KKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVAN 106
           K +YQA + + +   L    EKW   Y   T+S   N ++L TF+ FP  IRR IY+TNLIE+ N+ I++ ++ K    +  +L +     L++I + +  +  N
  S:   274 KAVYQANSKEEANTFLSGMIEKWKKNYPKVTQSLIEN-QDLLTFYDFPPSIRRTIYSTNLIESFNKQIKRYSRRKEQFQNEESLERF----LVSIFDTYNQKFLN 373
>gi|111025086|ref|YP_707506.1| transposase [Rhodococcus sp. RHA1] >gi|110824065|gb|ABG99348.1| possible transposase [Rhodococcus sp. RHA1] (203 aa)
Score = 136, Expect = 4.6e-07, Identities = 38/122 (31%), Positives = 57/122 (46%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSR---VANWGLILQQLKILFENEI 122
           ++ IY A N   + +    F +KW  +Y    + W +   E   F  +  EIRR+I +TN IE++N   R+  +A+G   S  A  K +YL   ++    K R   V  W   L    I FE  I
  S:    74 LRPIYTAVNEAAAKEQFTEFADKWGPRYPAIVRLWESAWSEFVPFLDYDPEIRRVICSTNAIESLNARYRRAVRARGHFPSEQAALKCLYLATRSLDPTGKGRARWVTRWKPALNAFAITFEGRI 198
>gi|67458497|ref|YP_246121.1| transposase [Rickettsia felis URRWXCal2] >gi|67458551|ref|YP_246175.1| transposase [Rickettsia felis URRWXCal2] >gi|67459272|ref|YP_246896.1| transposase [Rickettsia felis URRWXCal2] >gi|67459445|ref|YP_247069.1| transposase [Rickettsia felis URRWXCal2] >gi|67459573|ref|YP_247197.1| transposase [Rickettsia felis URRWXCal2] >gi|67459784|ref|YP_247408.1| transposase [Rickettsia felis URRWXCal2] >gi|67459824|ref|YP_247447.1| transposase [Rickettsia felis URRWXCal2] >gi|67004030|gb|AAY60956.1| Transposase [Rickettsia felis URRWXCal2] >gi|67004084|gb|AAY61010.1| Transposase [Rickettsia felis URRWXCal2] >gi|67004805|gb|AAY61731.1| Transposase [Rickettsia felis URRWXCal2] >gi|67004978|gb|AAY61904.1| Transposase [Rickettsia felis URRWXCal2] >gi|67005106|gb|AAY62032.1| Transposase [Rickettsia felis URRWXCal2] >gi|67005317|gb|AAY62243.1| Transposase [Rickettsia felis URRWXCal2] >gi|67005357|gb|AAY62282.1| Transposase [Rickettsia felis URRWXCal2] (80 aa)
Score = 135, Expect = 4.9e-07, Identities = 29/78 (37%), Positives = 46/78 (58%)
  Q:    45 FFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           F  +P EIR++IYTTN +E+VN  +RK+TK K    + NA+ K +YL +  +++ W   + NW   +    I F+  I
  S:     3 FLGYPEEIRKIIYTTNAVESVNSQLRKVTKNKRVFPNDNAVFKSLYLAIDYMTKKWSMPIPNWNAAMAHFLIKFDERI 80
>gi|69246944|ref|ZP_00604199.1| ISEf1, transposase [Enterococcus faecium DO] >gi|68195017|gb|EAN09482.1| ISEf1, transposase [Enterococcus faecium DO] (171 aa)
Score = 135, Expect = 5.3e-07, Identities = 34/105 (32%), Positives = 57/105 (54%)
  Q:     2 KKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVAN 106
           K +YQA + + +   L    EKW   Y   T+S   N ++L TF+ FP  IRR IY+TNLIE+ N+ I++ ++ K    +  +L +     L++I + +  +  N
  S:    53 KAVYQANSKEEANTFLSGMIEKWKKNYPKVTQSLIEN-QDLLTFYDFPPSIRRTIYSTNLIESFNKQIKRYSRRKEQFQNEESLERF----LVSIFDTYNQKFLN 152
>gi|69244962|ref|ZP_00603152.1| ISEf1, transposase [Enterococcus faecium DO] >gi|68196128|gb|EAN10559.1| ISEf1, transposase [Enterococcus faecium DO] (170 aa)
Score = 135, Expect = 5.3e-07, Identities = 34/105 (32%), Positives = 57/105 (54%)
  Q:     2 KKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVAN 106
           K +YQA + + +   L    EKW   Y   T+S   N ++L TF+ FP  IRR IY+TNLIE+ N+ I++ ++ K    +  +L +     L++I + +  +  N
  S:    52 KAVYQANSKEEANTFLSGMIEKWKKNYPKVTQSLIEN-QDLLTFYDFPPSIRRTIYSTNLIESFNKQIKRYSRRKEQFQNEESLERF----LVSIFDTYNQKFLN 151
>gi|85717435|ref|ZP_01048384.1| putative transposase [Nitrobacter sp. Nb-311A] >gi|85695737|gb|EAQ33646.1| putative transposase [Nitrobacter sp. Nb-311A] (132 aa)
Score = 135, Expect = 5.4e-07, Identities = 31/101 (30%), Positives = 58/101 (57%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIR-KITKAKGGITSVNALSKLIYLRLINISENWK 101
           ++++Y+AP+   +  A+ +F EK+ +KYG A +    N + L  F+ FPAE    + TTN IE+V   +R +  + K  ++S  A   +++  +I  S+ W+
  S:    23 LREVYRAPSRAAAEVAIDVFAEKYRAKYGRAVECLAKNRDALRAFYDFPAEHWDHLRTTNPIESVFATVRHRTVRTKASLSSTTA-RLMVFKLVIAASKTWR 123
>gi|55822304|ref|YP_140745.1| truncated IS1191 transposase [Streptococcus thermophilus CNRZ1066] >gi|55738289|gb|AAV61930.1| IS1191, transposase, IS256 family, truncated [Streptococcus thermophilus CNRZ1066] (268 aa)
Score = 135, Expect = 6.0e-07, Identities = 32/88 (36%), Positives = 53/88 (60%)
  Q:     2 KKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLI 89
           K IY+A N +++++ L+ F  +W  KY    +S  N  + L TF+QF  +I   IY+TNLIE++N+ I++ TK K    +  AL + +
  S:   151 KTIYRAENLEMAVQILENFIAEWKPKYRKVMESLENT-DNLLTFYQFSYQIWHSIYSTNLIESLNKEIKRQTKKKVLFPNEEALERYL 237
>gi|67459323|ref|YP_246947.1| transposase [Rickettsia felis URRWXCal2] >gi|67459391|ref|YP_247015.1| transposase [Rickettsia felis URRWXCal2] >gi|67004856|gb|AAY61782.1| Transposase [Rickettsia felis URRWXCal2] >gi|67004924|gb|AAY61850.1| Transposase [Rickettsia felis URRWXCal2] (80 aa)
Score = 134, Expect = 6.5e-07, Identities = 30/78 (38%), Positives = 46/78 (58%)
  Q:    45 FFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           F  +P EIR++IYTTN +E+VN  +RKITK K    + NA+ K +YL +  +++ W   + NW   +    I F+  I
  S:     3 FLGYPEEIRKIIYTTNAVESVNSQLRKITKNKRVFPNDNAVFKSLYLAIDYMTKKWSMPIPNWNKAMAHFLIKFDERI 80
>gi|67459318|ref|YP_246942.1| transposase [Rickettsia felis URRWXCal2] >gi|67004851|gb|AAY61777.1| Transposase [Rickettsia felis URRWXCal2] (80 aa)
Score = 134, Expect = 7.1e-07, Identities = 30/78 (38%), Positives = 46/78 (58%)
  Q:    45 FFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           F  +P EIR++IYTTN +E+VN  +RKITK K    + NA+ K +YL +  +++ W   + NW   +    I F+  I
  S:     3 FLGYPEEIRKIIYTTNAVESVNSQLRKITKNKRVFPNDNAVFKSLYLAIDYMTKKWSMSIPNWNKAMAHFLIKFDERI 80
>gi|69249487|ref|ZP_00604996.1| ISEf1, transposase [Enterococcus faecium DO] >gi|68194142|gb|EAN08677.1| ISEf1, transposase [Enterococcus faecium DO] (160 aa)
Score = 134, Expect = 7.9e-07, Identities = 34/105 (32%), Positives = 57/105 (54%)
  Q:     2 KKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVAN 106
           K +YQA + + +   L    EKW   Y   T+S   N ++L TF+ FP  IRR IY+TNLIE+ N+ I++ ++ K    +  +L +     L++I + +  +  N
  S:    42 KAVYQANSKEEANTFLSGMIEKWKKNYPKVTQSLIEN-QDLLTFYDFPPSIRRTIYSTNLIESFNKQIKRYSRRKEQFQNEESLERF----LVSIFDTYNQKFLN 141
>gi|67459532|ref|YP_247156.1| transposase [Rickettsia felis URRWXCal2] >gi|67459597|ref|YP_247221.1| transposase [Rickettsia felis URRWXCal2] >gi|67005065|gb|AAY61991.1| Transposase [Rickettsia felis URRWXCal2] >gi|67005130|gb|AAY62056.1| Transposase [Rickettsia felis URRWXCal2] (80 aa)
Score = 133, Expect = 8.4e-07, Identities = 29/78 (37%), Positives = 46/78 (58%)
  Q:    45 FFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           F  +P EIR++IYTTN +E+VN  +RK+TK K    + NA+ K +YL +  +++ W   + NW   +    I F+  I
  S:     3 FLGYPEEIRKIIYTTNAVESVNSQLRKVTKNKRVFPNDNAVFKSLYLAIDYMTKKWSMPIPNWNKAMAHFLIKFDERI 80
>gi|67458713|ref|YP_246337.1| transposase [Rickettsia felis URRWXCal2] >gi|67458785|ref|YP_246409.1| transposase [Rickettsia felis URRWXCal2] >gi|67458979|ref|YP_246603.1| transposase [Rickettsia felis URRWXCal2] >gi|67459463|ref|YP_247087.1| transposase [Rickettsia felis URRWXCal2] >gi|67004246|gb|AAY61172.1| Transposase [Rickettsia felis URRWXCal2] >gi|67004318|gb|AAY61244.1| Transposase [Rickettsia felis URRWXCal2] >gi|67004512|gb|AAY61438.1| Transposase [Rickettsia felis URRWXCal2] >gi|67004996|gb|AAY61922.1| Transposase [Rickettsia felis URRWXCal2] (80 aa)
Score = 133, Expect = 8.4e-07, Identities = 29/78 (37%), Positives = 46/78 (58%)
  Q:    45 FFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           F  +P EIR++IYTTN +E+VN  +RK+TK K    + NA+ K +YL +  +++ W   + NW   +    I F+  I
  S:     3 FLGYPEEIRKIIYTTNAVESVNSQLRKVTKNKRVFPNDNAVFKSLYLAIDYMTKKWSMSIPNWNKAMAHFLIKFDERI 80
>gi|69246522|ref|ZP_00603985.1| ISEf1, transposase [Enterococcus faecium DO] >gi|68195252|gb|EAN09706.1| ISEf1, transposase [Enterococcus faecium DO] (148 aa)
Score = 132, Expect = 1.1e-06, Identities = 34/105 (32%), Positives = 57/105 (54%)
  Q:     2 KKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVAN 106
           K +YQA + + +   L    EKW   Y   T+S   N ++L TF+ FP  IRR IY+TNLIE+ N+ I++ ++ K    +  +L +     L++I + +  +  N
  S:    30 KAVYQANSKEEANTFLSGMIEKWKKNYPKVTQSLIEN-QDLLTFYDFPPSIRRTIYSTNLIESFNKQIKRYSRRKEQFQNEESLERF----LVSIFDTYNQKFLN 129
>gi|29826765|ref|NP_821399.1| IS6120-like transposase [Streptomyces avermitilis MA-4680] >gi|29603861|dbj|BAC67934.1| putative IS256 family IS666-like transposase [Streptomyces avermitilis MA-4680] (425 aa)
Score = 132, Expect = 1.3e-06, Identities = 29/102 (28%), Positives = 56/102 (54%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKS 102
           +++IY A + D ++KA+  F + + +K+  A K   ++++EL  F+ FPAE    + TTN IE+    +R  TK   G  S  A   +++  + +  + W++
  S:   295 LQEIYNAEDRDHALKAVAEFAKTYGAKFPKAVKKITDDVDELLAFYDFPAEHWVHLRTTNPIESTFATVRLRTKVARGAGSPAAALAMVFKLVESAQQRWRA 396
>gi|193065415|ref|ZP_03046485.1| transposase [Escherichia coli E22] >gi|192926942|gb|EDV81566.1| transposase [Escherichia coli E22] (136 aa)
Score = 132, Expect = 1.3e-06, Identities = 28/94 (29%), Positives = 53/94 (56%)
  Q:    29 GYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           G  +++   N   L TFF +P +IR+ IYTTN IE++N  IR   K +    + +++ K+++L + + S+ W   + +W L + +  I F + +
  S:    18 GADSRTRQANRPNLATFFAYPTDIRKEIYTTNAIESLNSVIRHAIKKRKVFPTDDSVKKVVWLAIQSASQKWTMPLKDWRLAMSRFIIEFGDRL 111
>gi|69247434|ref|ZP_00604347.1| Transposase, mutator type [Enterococcus faecium DO] >gi|68194836|gb|EAN09310.1| Transposase, mutator type [Enterococcus faecium DO] (396 aa)
Score = 132, Expect = 1.4e-06, Identities = 27/75 (36%), Positives = 48/75 (64%)
  Q:     2 KKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAK 76
           K++Y++ + + ++ +LK F ++W  KY    KS +NN + L TF+ +P  +R  IY+TNLIE  N+ +++  K K
  S:   280 KEVYRSKSKEEALTSLKKFIDRWKHKYPSMVKSLSNN-DYLFTFYDYPESVRHTIYSTNLIEGNNKQLKRSFKKK 353
>gi|33321489|gb|AAQ06499.1| transposase [Lactobacillus crispatus] >gi|48926948|gb|AAT47511.1| transposase [Lactobacillus crispatus] (408 aa)
Score = 130, Expect = 1.9e-06, Identities = 27/103 (26%), Positives = 55/103 (53%)
  Q:     2 KKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRV 104
           K+++Q  N + +   L  F  KW   Y +  +S  +   +L  F+ +P +IR  IY+TN+IE+ N  I++  K K    +  +L   I ++ ++ ++ + +R+
  S:   290 KQVHQQTNKEEATAVLHDFYTKWGKVYSHVIRSLKDIEPDLLVFYNYPKQIRASIYSTNMIESFNNVIKRKAKPKAEFPTEQSLDAFIGIQAMSYNDRYFNRI 392
>gi|77407137|ref|ZP_00784131.1| transposase, Mutator family [Streptococcus agalactiae H36B] >gi|77174256|gb|EAO77131.1| transposase, Mutator family [Streptococcus agalactiae H36B] (317 aa)
Score = 130, Expect = 1.9e-06, Identities = 29/75 (38%), Positives = 46/75 (61%)
  Q:     2 KKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAK 76
           K IY+A N + + +AL  F  +W   Y    ++  + IE L  F++FP +I   IY+TNLIE++N+ I++ TK K
  S:   200 KTIYRAINVEEAKQALDSFINEWKPHYKKVIETLES-IENLLIFYEFPHQIWGSIYSTNLIESLNKEIKRQTKKK 273
>gi|15706280|emb|CAC69998.1| putative transposase [Lactobacillus delbrueckii] >gi|21530790|emb|CAD33970.1| putative transposase [Lactobacillus delbrueckii subsp. lactis] (392 aa)
Score = 130, Expect = 2.0e-06, Identities = 32/118 (27%), Positives = 62/118 (52%)
  Q:     2 KKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRV-ANWGLILQQLKILFE 119
           K++++  +   +   L  F +K+ SKY    K+     E+L  F+Q P +IR  IY+TN+IE++N  I++ TK K    +  +L   + ++ I  ++   +R    +G +   L+  F+
  S:   274 KQVHKQSSLKEAETVLHAFYDKYDSKYSSMIKNLQKIEEDLLVFYQSPKQIRPSIYSTNMIESINNMIKRKTKPKSEFPTEESLDNFLGVQAIGYNDRNANRTHKGFGQVTDTLESYFD 392
>gi|22536628|ref|NP_687479.1| IS256 family transposase [Streptococcus agalactiae 2603V/R] >gi|76797756|ref|ZP_00780023.1| transposase, Mutator family [Streptococcus agalactiae 18RS21] >gi|22533466|gb|AAM99351.1|AE014212_10 transposase, IS256 family [Streptococcus agalactiae 2603V/R] >gi|76586904|gb|EAO63395.1| transposase, Mutator family [Streptococcus agalactiae 18RS21] (391 aa)
Score = 130, Expect = 2.3e-06, Identities = 29/75 (38%), Positives = 46/75 (61%)
  Q:     2 KKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAK 76
           K IY+A N + + +AL  F  +W   Y    ++  + IE L  F++FP +I   IY+TNLIE++N+ I++ TK K
  S:   274 KTIYRAINVEEAKQALDSFINEWKPHYKKVIETLES-IENLLIFYEFPHQIWGSIYSTNLIESLNKEIKRQTKKK 347
>gi|86559622|ref|YP_473442.1| transposase [Clostridium perfringens] >gi|86475894|dbj|BAE79069.1| transposase [Clostridium perfringens] (74 aa)
Score = 129, Expect = 2.6e-06, Identities = 29/68 (42%), Positives = 40/68 (58%)
  Q:    55 LIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +IYTTNL E  NR +RK TK +    +  +L K +YL    + + W S +ANWG IL Q +I+F   I
  S:     1 MIYTTNLFEGFNRQLRKFTKIRTVFPTDESLRKSLYLATDQVMKKWTSPIANWGPILLQFEIIFVERI 68
>gi|27376890|ref|NP_768419.1| putative transposase [Bradyrhizobium japonicum USDA 110] >gi|27350032|dbj|BAC47044.1| bll1779 [Bradyrhizobium japonicum USDA 110] (435 aa)
Score = 129, Expect = 2.6e-06, Identities = 36/122 (29%), Positives = 64/122 (52%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIR-KITKAKGGITSVNALSKLIYLRLI-NISENWKSRVANWGLILQQLKILFENEI 122
           ++++Y A N   +  A+ +F EK+ +KY  A +    + + +  F++FPAE    + TTN IE+V   +R +  + KG ++S  A  KL+  +L+   S+ W+       L      + FEN I
  S:   303 LREVYLASNRASAEVAIDVFAEKYGAKYDKAVECLTKDRDAMLAFYEFPAEHWDHLRTTNPIESVFATVRHRTVRTKGSLSSTTA--KLMVFKLLCAASKTWRRLKGTNQLPKVSAGVRFENGI 424
>gi|134277953|ref|ZP_01764668.1| ISPsy18, transposase [Burkholderia pseudomallei 305] >gi|134251603|gb|EBA51682.1| ISPsy18, transposase [Burkholderia pseudomallei 305] (89 aa)
Score = 129, Expect = 2.7e-06, Identities = 28/71 (39%), Positives = 42/71 (59%)
  Q:     2 KKIYQAPNFDVSMKALKIFTE-KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKI 72
           + IY A + + + +AL+ F +  W +KY     SW    E +  F+ FP EIRR++Y TN IE +N  +RKI
  S:     7 RPIYAAASEETARQALQDFADGPWGAKYPTIVHSWQRAWEHVVPFYVFPPEIRRVVY-TNSIERMNAQLRKI 77
>gi|67459313|ref|YP_246937.1| transposase [Rickettsia felis URRWXCal2] >gi|67004846|gb|AAY61772.1| Transposase [Rickettsia felis URRWXCal2] (80 aa)
Score = 129, Expect = 2.8e-06, Identities = 28/78 (35%), Positives = 45/78 (57%)
  Q:    45 FFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           F  +P EIR++IYTTN +E+VN  +RK+TK K    + N + K +YL +  +++ W   + NW   +    I F+  I
  S:     3 FLGYPEEIRKIIYTTNAVESVNSQLRKVTKNKRVFPNDNTVFKSLYLAIDYMTKKWSMPIPNWNKAMAHFLIKFDERI 80
>gi|69249482|ref|ZP_00604991.1| ISEf1, transposase [Enterococcus faecium DO] >gi|68194137|gb|EAN08672.1| ISEf1, transposase [Enterococcus faecium DO] (124 aa)
Score = 129, Expect = 2.9e-06, Identities = 34/105 (32%), Positives = 57/105 (54%)
  Q:     2 KKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVAN 106
           K +YQA + + +   L    EKW   Y   T+S   N ++L TF+ FP  IRR IY+TNLIE+ N+ I++ ++ K    +  +L +     L++I + +  +  N
  S:     6 KPVYQANSKEEANTFLSGMIEKWKKNYPKVTQSLIEN-QDLLTFYDFPPSIRRTIYSTNLIESFNKQIKRYSRRKEQFQNEESLERF----LVSIFDTYNQKFLN 105
>gi|116514780|ref|YP_813686.1| transposase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|116094095|gb|ABJ59248.1| Transposase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (389 aa)
Score = 128, Expect = 3.1e-06, Identities = 31/103 (30%), Positives = 57/103 (55%)
  Q:    17 LKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRV-ANWGLILQQLKILFE 119
           L  F +K+ SKY    K+     E+L  F+Q+P +IR  IY+TN+IE++N  I++ TK K    +  +L  ++ ++ I  ++   +R    +G +   L+  F+
  S:   286 LHAFYDKYDSKYSSMIKNLQKIEEDLLVFYQYPKQIRPSIYSTNIIESINNMIKRKTKPKSEFPTEESLDNVLGVQAIGYNDRNANRTHKGFGQVTDTLESYFD 389
>gi|12620487|gb|AAG60763.1|AF322012_68 ID145 [Bradyrhizobium japonicum] (422 aa)
Score = 128, Expect = 3.1e-06, Identities = 36/122 (29%), Positives = 64/122 (52%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIR-KITKAKGGITSVNALSKLIYLRLI-NISENWKSRVANWGLILQQLKILFENEI 122
           ++++Y A N   +  A+ +F EK+ +KY  A +    + + +  F++FPAE    + TTN IE+V   +R +  + KG ++S  A  KL+  +L+   S+ W+       L      + FEN I
  S:   290 LREVYLASNRASAEVAIDVFAEKYGAKYDKAVECLTKDRDAMLAFYEFPAEHWDHLRTTNPIESVFATVRHRTVRTKGSLSSTTA--KLMVFKLLCAASKTWRRLKGTNQLPKVSAGVRFENGI 411
>gi|146295127|ref|YP_001178898.1| transposase, mutator type [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|146295136|ref|YP_001178907.1| transposase, mutator type [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|146295347|ref|YP_001179118.1| transposase, mutator type [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|146295390|ref|YP_001179161.1| transposase, mutator type [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|146295393|ref|YP_001179164.1| transposase, mutator type [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|146295414|ref|YP_001179185.1| transposase, mutator type [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|146295493|ref|YP_001179264.1| transposase, mutator type [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|146295538|ref|YP_001179309.1| transposase, mutator type [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|146295594|ref|YP_001179365.1| transposase, mutator type [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|146295606|ref|YP_001179377.1| transposase, mutator type [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|146295616|ref|YP_001179387.1| transposase, mutator type [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|146295880|ref|YP_001179651.1| transposase, mutator type [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|146295882|ref|YP_001179653.1| transposase, mutator type [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|146296120|ref|YP_001179891.1| transposase, mutator type [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|146296182|ref|YP_001179953.1| transposase, mutator type [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|146296200|ref|YP_001179971.1| transposase, mutator type [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|146296203|ref|YP_001179974.1| transposase, mutator type [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|146296502|ref|YP_001180273.1| transposase, mutator type [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|146297215|ref|YP_001180986.1| transposase, mutator type [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|146297385|ref|YP_001181156.1| transposase, mutator type [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|146297466|ref|YP_001181237.1| transposase, mutator type [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|146297591|ref|YP_001181362.1| transposase, mutator type [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|146297599|ref|YP_001181370.1| transposase, mutator type [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|146297601|ref|YP_001181372.1| transposase, mutator type [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145408703|gb|ABP65707.1| transposase, mutator type [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145408712|gb|ABP65716.1| transposase, mutator type [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145408923|gb|ABP65927.1| transposase, mutator type [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145408966|gb|ABP65970.1| transposase, mutator type [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145408969|gb|ABP65973.1| transposase, mutator type [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145408990|gb|ABP65994.1| transposase, mutator type [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145409069|gb|ABP66073.1| transposase, mutator type [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145409114|gb|ABP66118.1| transposase, mutator type [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145409170|gb|ABP66174.1| transposase, mutator type [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145409182|gb|ABP66186.1| transposase, mutator type [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145409192|gb|ABP66196.1| transposase, mutator type [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145409456|gb|ABP66460.1| transposase, mutator type [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145409458|gb|ABP66462.1| transposase, mutator type [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145409696|gb|ABP66700.1| transposase, mutator type [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145409758|gb|ABP66762.1| transposase, mutator type [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145409776|gb|ABP66780.1| transposase, mutator type [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145409779|gb|ABP66783.1| transposase, mutator type [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145410078|gb|ABP67082.1| transposase, mutator type [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145410791|gb|ABP67795.1| transposase, mutator type [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145410961|gb|ABP67965.1| transposase, mutator type [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145411042|gb|ABP68046.1| transposase, mutator type [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145411167|gb|ABP68171.1| transposase, mutator type [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145411175|gb|ABP68179.1| transposase, mutator type [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145411177|gb|ABP68181.1| transposase, mutator type [Caldicellulosiruptor saccharolyticus DSM 8903] (409 aa)
Score = 128, Expect = 3.1e-06, Identities = 35/98 (35%), Positives = 52/98 (53%)
  Q:     7 APNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGG-ITSVNALSKLIYLRLINISE-NWKSRV 104
           + +FD ++   K+  E++SSKY    K      E      ++P ++R+ IYTTN +E+VN  I KI    GG   SV  L   IYL+  N+    WK+ V
  S:   285 SADFDEAISKFKLLCEQYSSKYPRFIKGICEKAEFYLAHMRYPEDLRKYIYTTNAVESVNSMIEKIRINSGGYFQSVEVLEINIYLQRENLRRGKWKNGV 384
>gi|146297729|ref|YP_001181500.1| transposase, mutator type [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145411305|gb|ABP68309.1| transposase, mutator type [Caldicellulosiruptor saccharolyticus DSM 8903] (383 aa)
Score = 128, Expect = 3.4e-06, Identities = 35/98 (35%), Positives = 52/98 (53%)
  Q:     7 APNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGG-ITSVNALSKLIYLRLINISE-NWKSRV 104
           + +FD ++   K+  E++SSKY    K      E      ++P ++R+ IYTTN +E+VN  I KI    GG   SV  L   IYL+  N+    WK+ V
  S:   266 SADFDEAISKFKLLCEQYSSKYPRFIKGICEKAEFYLAHMRYPEDLRKYIYTTNAVESVNSMIEKIRINSGGYFQSVEVLEINIYLQRENLRRGKWKNGV 365
>gi|146295231|ref|YP_001179002.1| transposase, mutator type [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|146295356|ref|YP_001179127.1| transposase, mutator type [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|146297518|ref|YP_001181289.1| transposase, mutator type [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145408807|gb|ABP65811.1| transposase, mutator type [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145408932|gb|ABP65936.1| transposase, mutator type [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145411094|gb|ABP68098.1| transposase, mutator type [Caldicellulosiruptor saccharolyticus DSM 8903] (409 aa)
Score = 128, Expect = 3.4e-06, Identities = 35/98 (35%), Positives = 52/98 (53%)
  Q:     7 APNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGG-ITSVNALSKLIYLRLINISE-NWKSRV 104
           + +FD ++   K+  E++SSKY    K      E      ++P ++R+ IYTTN +E+VN  I KI    GG   SV  L   IYL+  N+    WK+ V
  S:   285 SADFDEAISKFKLLCEQYSSKYPRFIKGICEKAEFYLAHMRYPEDLRKYIYTTNAVESVNSMIEKIRINSGGYFQSVEVLEINIYLQRENLRRGKWKNGV 384
>gi|90655850|gb|ABD96553.1| IS1191 [Streptococcus thermophilus] (157 aa)
Score = 128, Expect = 3.4e-06, Identities = 29/73 (39%), Positives = 48/73 (65%)
  Q:     2 KKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITK 74
           K IY+A N +++++ L+ F  +W  KY    +S  N  + L TF+QFP +I   IY+TNLI+++N+ I++ TK
  S:    79 KTIYRAENLEMAVQILENFIAEWKPKYRKVMESLENT-DNLLTFYQFPYQIWHSIYSTNLIKSLNKEIKRQTK 150
>gi|69246929|ref|ZP_00604184.1| ISEf1, transposase [Enterococcus faecium DO] >gi|68195002|gb|EAN09467.1| ISEf1, transposase [Enterococcus faecium DO] (133 aa)
Score = 128, Expect = 3.5e-06, Identities = 34/105 (32%), Positives = 57/105 (54%)
  Q:     2 KKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVAN 106
           K +YQA + + +   L    EKW   Y   T+S   N ++L TF+ FP  IRR IY+TNLIE+ N+ I++ ++ K    +  +L +     L++I + +  +  N
  S:    15 KAVYQANSKEEANTFLSGMIEKWKKNYPKVTQSLIEN-QDLLTFYDFPPSIRRTIYSTNLIESFNKQIKRYSRRKEQFQNEESLERF----LVSIFDTYNQKFLN 114
>gi|27376823|ref|NP_768352.1| putative transposase [Bradyrhizobium japonicum USDA 110] >gi|27349965|dbj|BAC46977.1| blr1712 [Bradyrhizobium japonicum USDA 110] (385 aa)
Score = 128, Expect = 3.6e-06, Identities = 36/122 (29%), Positives = 64/122 (52%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIR-KITKAKGGITSVNALSKLIYLRLI-NISENWKSRVANWGLILQQLKILFENEI 122
           ++++Y A N   +  A+ +F EK+ +KY  A +    + + +  F++FPAE    + TTN IE+V   +R +  + KG ++S  A  KL+  +L+   S+ W+       L      + FEN I
  S:   253 LREVYLASNRASAEVAIDVFAEKYGAKYDKAVECLTKDRDAMLAFYEFPAEHWDHLRTTNPIESVFATVRHRTVRTKGSLSSTTA--KLMVFKLLCAASKTWRRLKGTNQLPKVSAGVRFENGI 374
>gi|125718819|ref|YP_001035952.1| transposase [Streptococcus sanguinis SK36] >gi|125498736|gb|ABN45402.1| Transposase and inactivated derivatives, putative [Streptococcus sanguinis SK36] (131 aa)
Score = 128, Expect = 3.9e-06, Identities = 31/86 (36%), Positives = 51/86 (59%)
  Q:     4 IYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLI 89
           IY+A N +++ +AL+ F  +W  KY    +S     + L TF+QFP +I   +Y+TNLIE++N+ I+  TK K    +  AL + +
  S:    16 IYRAENLEMAGQALEDFLAEWKPKYRKVMESLEKT-DNLLTFYQFPYQIWHSMYSTNLIESLNKEIKHQTKKKVLFPNEEALERYL 100
>gi|126442501|ref|YP_001063883.1| isrso7-transposase [Burkholderia pseudomallei 668] >gi|126221992|gb|ABN85497.1| isrso7-transposase [Burkholderia pseudomallei 668] (105 aa)
Score = 127, Expect = 4.5e-06, Identities = 28/86 (32%), Positives = 43/86 (50%)
  Q:    33 KSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           + W    E +  F+ FP E  R++YTTN IE++N  +RK  K +G   +  A   L++L L N+         +W   + Q  ILF
  S:     2 QPWQRAWEHVVPFYMFPPETLRVVYTTNAIESLNMPLRKFIKTRGHFPNDEAAITLLWLALRNVLAKTVRAAFDWKSAMNQFAILF 87
>gi|62860881|gb|AAY16474.1| putative transposase [Bifidobacterium breve] (429 aa)
Score = 125, Expect = 7.6e-06, Identities = 29/99 (29%), Positives = 48/99 (48%)
  Q:    22 EKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRV---ANWGLILQQLKILFEN 120
           +KW ++Y    + W +  E    F  +  EIRR+I TTN IE++N   ++  +A G      A  K +YL + ++    K ++   A W   L    I F +
  S:   319 DKWEARYPAIRRLWMDAWERFIPFLDYDVEIRRVIRTTNAIESLNAGFKRSIRACGHFPDEQAALKCMYLTVRSLDPTGKGQIRWSARWKPALNAFAITFAD 420
>gi|549104|sp|P35880|TRA1_LACHE Transposase for insertion sequence element IS1201 >gi|425467|gb|AAA25249.1| transposase >gi|745531|prf||2016315A transposase (369 aa)
Score = 125, Expect = 8.2e-06, Identities = 26/88 (29%), Positives = 45/88 (51%)
  Q:     2 KKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLI 89
           K+I+Q  N   ++  L  F  KW   Y +  ++  +   +L  F+ +P +IR  IY+TN+IE+ N  I++  K K    +  +L   I
  S:   274 KQIHQQANKAAAVDVLHAFYAKWDKSYNHVIRNLKDIEPDLLVFYNYPKQIRASIYSTNMIESFNNVIKRKVKPKAEFPTEQSLDTFI 361
>gi|15801936|ref|NP_287957.1| putative putative transposase [Escherichia coli O157:H7 EDL933] >gi|168712905|ref|ZP_02745182.1| putative transposase within CP-933O; partial [Escherichia coli O157:H7 str. EC4045] >gi|168721613|ref|ZP_02753890.1| putative transposase within CP-933O; partial [Escherichia coli O157:H7 str. EC4206] >gi|168739392|ref|ZP_02771669.1| putative transposase within CP-933O; partial [Escherichia coli O157:H7 str. EC4115] >gi|168796358|ref|ZP_02821365.1| putative transposase within CP-933O; partial [Escherichia coli O157:H7 str. EC4042] >gi|13259563|gb|AAK16935.1|AE006457_8 putative transposase fragment [Escherichia coli O157:H7 EDL933] >gi|13361281|dbj|BAB35239.1| hypothetical protein [Escherichia coli O157:H7 str. Sakai] (85 aa)
Score = 125, Expect = 8.6e-06, Identities = 24/81 (29%), Positives = 48/81 (59%)
  Q:    42 LTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           + TFF +PA+IR++IYTTN IE++N  IR   + +    +  ++ K+++L +   S+ W   + +W + + +  I F + +
  S:     1 MATFFAYPADIRKVIYTTNAIESLNSVIRHAIRKRKVFPTDESVKKVVWLAIQAASQKWTMPLRDWRMAMSRFIIEFGDRL 81
>gi|21234258|ref|NP_639869.1| putative transposon transposase [Streptomyces coelicolor A3(2)] >gi|13620745|emb|CAC36785.1| putative transposon transposase [Streptomyces coelicolor A3(2)] (416 aa)
Score = 124, Expect = 9.9e-06, Identities = 30/102 (29%), Positives = 53/102 (51%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKS 102
           ++ IY A +   +  A+K F++ + +K+  A K   ++  EL TFF FPAE    + TTN IE+    +R  TK   G  S  A   +++  + +  + W++
  S:   286 IQDIYNAEDKQHAQAAVKTFSQLYGAKFPKAVKKITDDQAELLTFFDFPAEHWIHLRTTNPIESTFATVRLRTKVTRGAGSRTAALAMVFKLVESAQQRWRA 387
>gi|148259119|ref|YP_001233246.1| transposase [Acidiphilium cryptum JF-5] >gi|146400800|gb|ABQ29327.1| Transposase and inactivated derivatives-like protein [Acidiphilium cryptum JF-5] (140 aa)
Score = 124, Expect = 1.1e-05, Identities = 22/51 (43%), Positives = 31/51 (60%)
  Q:    27 KYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKG 77
           KY    +SW    +E+  FF FP E+RR+IY TN IE +N  +R+   A+G
  S:    77 KYPDIGQSWRRVWQEVIPFFSFPGEVRRIIYATNAIEALNSKLRRAIPARG 127
>gi|2982675|dbj|BAA25264.1| transposase [Bradyrhizobium japonicum] (228 aa)
Score = 123, Expect = 1.2e-05, Identities = 33/101 (32%), Positives = 56/101 (55%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIR-KITKAKGGITSVNALSKLIYLRLIN-ISENWK 101
           ++ IY AP+   +  A+ +F EK+  KYG A +    +   L  FF FPAE    + ++N IE+V   +R +  + KG ++   A  KL+  +LI+  S+ W+
  S:    96 LRNIYLAPHRAEAETAIDVFVEKYHVKYGRAVECLIKDRHALLAFFDFPAEHWIHLRSSNPIESVFATVRHRTVRTKGSLSQQTA--KLMVFKLIDAASKTWR 196
>gi|134294141|ref|YP_001117876.1| transposase, mutator type [Burkholderia vietnamiensis G4] >gi|134137298|gb|ABO53041.1| transposase, mutator type [Burkholderia vietnamiensis G4] (394 aa)
Score = 123, Expect = 1.5e-05, Identities = 24/70 (34%), Positives = 40/70 (57%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTE-KWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIR 70
           ++ IY A + + + +AL+ F +  W +KY    +SW    E +  FF FP EIRR++YTT+ +      +R
  S:   299 LRPIYAAASEEAARQALQDFADGPWGAKYPTIVQSWQRAWEHVIPFFVFPPEIRRVVYTTDEMHKSRTALR 369
>gi|149173100|ref|ZP_01851731.1| TRANSPOSASE FOR INSERTION SEQUENCE ELEMENT ISRM5 [Planctomyces maris DSM 8797] >gi|148847906|gb|EDL62238.1| TRANSPOSASE FOR INSERTION SEQUENCE ELEMENT ISRM5 [Planctomyces maris DSM 8797] (183 aa)
Score = 123, Expect = 1.5e-05, Identities = 30/102 (29%), Positives = 56/102 (54%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSW-NNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKS 102
           ++ I+ A + D ++K LK F      K      SW  +NI E  T F  PA  R+ + TTN++E  N+ +++ T+  G   +  +L +L+   L+ +S++W++
  S:    75 LRNIFNARDLDDALKELKRFVTS-HEKTAPKLASWAEDNIPEGLTVFTIPAGHRKRMRTTNMLERQNKELKRRTRVAGLFPNEESLLRLVTAVLVELSDDWET 176
>gi|111025216|ref|YP_707636.1| transposase mutator family protein [Rhodococcus sp. RHA1] >gi|111025377|ref|YP_707797.1| transposase [Rhodococcus sp. RHA1] >gi|110824195|gb|ABG99478.1| transposase, mutator family protein [Rhodococcus sp. RHA1] >gi|110824356|gb|ABG99639.1| transposase [Rhodococcus sp. RHA1] (435 aa)
Score = 121, Expect = 2.0e-05, Identities = 33/102 (32%), Positives = 56/102 (54%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISE-NWKS 102
           MK+IY A + D +  A+K F   + +KY  A K   ++++ L  F+++PAE    + TTN IE+    +R  TK   G  S  A   + Y +LI+ ++  W++
  S:   289 MKEIYNAEDIDKAQVAIKAFELDYGAKYPKAVKKITDDMDVLLEFYKYPAEHWVHLRTTNPIESTFATVRLRTKVTKGPGSRAAGLAMAY-KLIDAAQARWRA 390
>gi|46255253|ref|YP_006165.1| transposase [Thermus thermophilus HB27] >gi|46198102|gb|AAS82512.1| transposase [Thermus thermophilus HB27] (329 aa)
Score = 119, Expect = 3.9e-05, Identities = 26/91 (28%), Positives = 50/91 (54%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGG-ITSVNALSKLIYL 91
           +  I +A + + ++KAL  F  +W+ KY     SW  +   L  F  +P  ++ +I +TNL+E + + I++ TK +     + +A+ K+IY 
  S:   203 LSSIVRASDRNEALKALNSFRGRWADKYPQVVASWIQHSAALLRFLDYPKALQPVIKSTNLLERMIKEIKRTTKTRDNTFPTPDAVLKVIYF 294
>gi|124548401|ref|ZP_01707077.1| transposase, mutator family [Shewanella putrefaciens 200] >gi|124508461|gb|EAY52556.1| transposase, mutator family [Shewanella putrefaciens 200] (70 aa)
Score = 119, Expect = 4.0e-05, Identities = 23/68 (33%), Positives = 44/68 (64%)
  Q:    55 LIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           +IYTTN IE++N ++R++TK +    S +A+ KL+YL L  I++ W   + +W   ++Q  +++ N +
  S:     1 MIYTTNAIESLNASLRQVTKTRRSFPSDDAVLKLLYLALHQIAKKWTMPLRDWKPAMRQFMLMYSNRV 68
>gi|126726542|ref|ZP_01742383.1| transposase [Rhodobacterales bacterium HTCC2150] >gi|126704405|gb|EBA03497.1| transposase [Rhodobacterales bacterium HTCC2150] (415 aa)
Score = 119, Expect = 4.0e-05, Identities = 30/101 (29%), Positives = 50/101 (49%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWK 101
           +  I+QA   + + KA  +F + + +KY  AT     +  EL  FF FPA+  + I T+N IE+    IR  TK   G  S + +  +++       +NW+
  S:   284 IHNIWQAETKEDAEKAFDLFIKTYEAKYPKATLCLQKDRAELMAFFDFPAQHWQSIRTSNPIESAFATIRHRTKRSKGCLSRDGMLHMMFKLGQCAEQNWR 384
>gi|126727703|ref|ZP_01743534.1| transposase [Rhodobacterales bacterium HTCC2150] >gi|126702959|gb|EBA02061.1| transposase [Rhodobacterales bacterium HTCC2150] (415 aa)
Score = 119, Expect = 4.2e-05, Identities = 30/101 (29%), Positives = 50/101 (49%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWK 101
           +  I+QA   + + KA  +F + + +KY  AT     +  EL  FF FPA+  + I T+N IE+    IR  TK   G  S + +  +++       +NW+
  S:   284 IHNIWQAETKEDAEKAFDLFIKTYEAKYPKATLCLQKDRAELMAFFDFPAQHWQSIRTSNPIESAFATIRHRTKRSKGCLSRDGMLHMMFKLGQCAEQNWR 384
>gi|69246069|ref|ZP_00603796.1| Transposase, mutator type [Enterococcus faecium DO] >gi|68195441|gb|EAN09887.1| Transposase, mutator type [Enterococcus faecium DO] (389 aa)
Score = 119, Expect = 4.2e-05, Identities = 29/103 (28%), Positives = 50/103 (48%)
  Q:     2 KKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRV 104
           K +YQA + + ++  +   T KW  +Y        N    L TF+ FP  IRR IY TNLIE  N+ +++ T+ K    +  +L +    +    ++ +  R+
  S:   274 KLVYQANSKEEALDHIDFMTRKWKKQYPRVVNLLLN--PALLTFYNFPHAIRRTIYLTNLIEGFNKQLKRYTRRKEQFPNEESLERFFISQFNQYNQKFLGRI 374
>gi|549107|sp|P35884|TRA2_THIFE Transposase for insertion sequence element IST2 >gi|472419|gb|AAA27371.1| unknown [Acidithiobacillus ferrooxidans] (296 aa)
Score = 118, Expect = 5.7e-05, Identities = 30/100 (30%), Positives = 46/100 (46%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENW 100
           +++I+ A N   + KAL +F   + +KY  A      +  EL  F+ FPAE  R I TTN IE+    +R  T       S ++   L +  L    + W
  S:   161 LQEIWMAANRQAAEKALDVFVRNYQAKYPKAVAKLEKDRAELLAFYDFPAEHWRHIRTTNAIESTFATVRHRTTRTKNCVSRSSFLGLGFKMLQQAEKRW 260
>gi|108802544|ref|YP_642740.1| transposase, mutator type [Mycobacterium sp. MCS] >gi|108772963|gb|ABG11684.1| transposase, mutator type [Mycobacterium sp. MCS] (464 aa)
Score = 117, Expect = 5.8e-05, Identities = 30/102 (29%), Positives = 51/102 (50%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKS 102
           +K+IY A + D +  A+K FT  + +KY  A     ++++ L  F+ +PAE    + TTN IE+    +R  TK   G  S  A   + Y  +   +  W++
  S:   292 LKEIYNAEDIDKAQVAVKAFTVDFGAKYPKAVAKITDDLDTLLEFYHYPAEHWIHLRTTNPIESTFATVRLRTKVTKGPGSRAAGLAMAYKLIDAAAARWRA 393
>gi|108797816|ref|YP_638013.1| transposase, mutator type [Mycobacterium sp. MCS] >gi|108797911|ref|YP_638108.1| transposase, mutator type [Mycobacterium sp. MCS] >gi|108798446|ref|YP_638643.1| transposase, mutator type [Mycobacterium sp. MCS] >gi|108802393|ref|YP_642589.1| transposase, mutator type [Mycobacterium sp. MCS] >gi|108802419|ref|YP_642615.1| transposase, mutator type [Mycobacterium sp. MCS] >gi|119855216|ref|YP_935819.1| transposase, mutator type [Mycobacterium sp. KMS] >gi|119855242|ref|YP_935845.1| transposase, mutator type [Mycobacterium sp. KMS] >gi|119871473|ref|YP_941425.1| transposase, mutator type [Mycobacterium sp. KMS] >gi|108768235|gb|ABG06957.1| transposase, mutator type [Mycobacterium sp. MCS] >gi|108768330|gb|ABG07052.1| transposase, mutator type [Mycobacterium sp. MCS] >gi|108768865|gb|ABG07587.1| transposase, mutator type [Mycobacterium sp. MCS] >gi|108772812|gb|ABG11533.1| transposase, mutator type [Mycobacterium sp. MCS] >gi|108772838|gb|ABG11559.1| transposase, mutator type [Mycobacterium sp. MCS] >gi|119697562|gb|ABL94635.1| transposase, mutator type [Mycobacterium sp. KMS] >gi|119697933|gb|ABL95004.1| transposase, mutator type [Mycobacterium sp. KMS] >gi|119697959|gb|ABL95030.1| transposase, mutator type [Mycobacterium sp. KMS] (439 aa)
Score = 117, Expect = 5.8e-05, Identities = 30/102 (29%), Positives = 51/102 (50%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKS 102
           +K+IY A + D +  A+K FT  + +KY  A     ++++ L  F+ +PAE    + TTN IE+    +R  TK   G  S  A   + Y  +   +  W++
  S:   292 LKEIYNAEDIDKAQVAVKAFTVDFGAKYPKAVAKITDDLDTLLEFYHYPAEHWIHLRTTNPIESTFATVRLRTKVTKGPGSRAAGLAMAYKLIDAAAARWRA 393
>gi|16081782|ref|NP_394168.1| transposase related protein [Thermoplasma acidophilum DSM 1728] >gi|10639983|emb|CAC11835.1| transposase related protein [Thermoplasma acidophilum] (130 aa)
Score = 117, Expect = 5.9e-05, Identities = 28/93 (30%), Positives = 49/93 (52%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRL 93
           +K I+ + + D S++ L  F  KW  +Y         N+  L  + +FP  ++R I++TN+IE +N+ IR+  K    + S   +  + YLRL
  S:    37 LKGIFLSGSKDESIRRLNDFKSKWLPEYMKPIYIIGKNLGVLLEYCKFPRSVKRSIHSTNIIERINKEIRRRIKIIDSLPSEENIMNITYLRL 129
>gi|15608060|ref|NP_215435.1| transposase [Mycobacterium tuberculosis H37Rv] >gi|15840343|ref|NP_335380.1| IS1554 transposase [Mycobacterium tuberculosis CDC1551] >gi|148660699|ref|YP_001282222.1| IS2606-like transposase [Mycobacterium tuberculosis H37Ra] >gi|148822129|ref|YP_001286883.1| transposase [Mycobacterium tuberculosis F11] >gi|167967050|ref|ZP_02549327.1| transposase [Mycobacterium tuberculosis H37Ra] >gi|194543281|ref|YP_002078310.1| hypothetical protein TBCG_00912 [Mycobacterium tuberculosis C] >gi|2078069|emb|CAB08502.1| PROBABLE TRANSPOSASE [Mycobacterium tuberculosis H37Rv] >gi|13880507|gb|AAK45194.1| IS1554, transposase [Mycobacterium tuberculosis CDC1551] >gi|124600288|gb|EAY59298.1| hypothetical protein TBCG_00912 [Mycobacterium tuberculosis C] >gi|134149362|gb|EBA41407.1| transposase [Mycobacterium tuberculosis str. Haarlem] >gi|148504851|gb|ABQ72660.1| IS2606-like transposase [Mycobacterium tuberculosis H37Ra] >gi|148720656|gb|ABR05281.1| transposase [Mycobacterium tuberculosis F11] (439 aa)
Score = 117, Expect = 6.5e-05, Identities = 36/122 (29%), Positives = 61/122 (50%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYL--RLINISENWKSRVA-NWGLILQQLKILFENEI 122
           +K IY A +   +    + F EKW   Y   T+ W++  EE   F  +  EIRR+  +TN IE++N   R+  +A+G   +  +  K +YL  R ++     +++ A  W   L  L I F + +
  S:   309 LKPIYTAASAAEARLRYEEFAEKWGKPYPAITRLWDSAWEEFIPFLDYDVEIRRVPCSTNAIESLNARYRRAVRARGHFPNEQSALKTLYLVTRSLDPKGTGQTKWAVRWKPALNALAITFADRM 433
>gi|31544677|ref|NP_853255.1| transposase [Mycoplasma gallisepticum R] >gi|31541523|gb|AAP56823.1| predicted transposase [Mycoplasma gallisepticum R] (412 aa)
Score = 117, Expect = 6.6e-05, Identities = 34/120 (28%), Positives = 57/120 (47%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRL--------INISENWKSRVANWGLILQQLKILFEN 120
           +K IY A N++ +  + +    KW      A +     ++ +   F F   +R L+YT+N++EN N  I     AK    ++N L   +Y+          +N   N   RV NW  I ++L  +F N
  S:   283 LKNIYGADNWESAKHSFEYLKNKWGCSNKRAVEVVERAMDNIEKLFSFSKALRTLVYTSNMVENYNSVIGSFLAAKKSFNNINQLLLDLYVHFGYNPRYKKLNQKSN---RVRNWYRIYEELMDVFPN 407
>gi|85858865|ref|YP_461067.1| transposase [Syntrophus aciditrophicus SB] >gi|85721956|gb|ABC76899.1| transposase [Syntrophus aciditrophicus SB] (420 aa)
Score = 117, Expect = 6.6e-05, Identities = 25/102 (24%), Positives = 51/102 (50%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKS 102
           ++ I+ AP+ + +    + F ++W      A +    +I+   TFF FP+E    + TTN+IE +N+  R+ TK    +    A  +++    + +  +W+S
  S:   294 LRSIFYAPSRETAWACFEAFIKRWEKTLPSAVECLKRSIDACLTFFNFPSEEWISLRTTNIIERLNKEFRRRTKVMEIVAGETACYRILAYISLKMELHWRS 395
>gi|85860591|ref|YP_462793.1| transposase [Syntrophus aciditrophicus SB] >gi|85723682|gb|ABC78625.1| transposase [Syntrophus aciditrophicus SB] (420 aa)
Score = 117, Expect = 6.7e-05, Identities = 25/102 (24%), Positives = 51/102 (50%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKS 102
           ++ I+ AP+ + +    + F ++W      A +    +I+   TFF FP+E    + TTN+IE +N+  R+ TK    +    A  +++    + +  +W+S
  S:   294 LRSIFYAPSRETAWACFEAFIKRWEKTLPSAVECLKRSIDACLTFFNFPSEEWISLRTTNIIERLNKEFRRRTKVMEIVAGETACYRILAYISLKMELHWRS 395
>gi|31792108|ref|NP_854601.1| putative transposase [Mycobacterium bovis AF2122/97] >gi|121636843|ref|YP_977066.1| putative transposase [Mycobacterium bovis BCG str. Pasteur 1173P2] >gi|31617696|emb|CAD93805.1| PUTATIVE TRANSPOSASE [Mycobacterium bovis AF2122/97] >gi|121492490|emb|CAL70958.1| Putative transposase [Mycobacterium bovis BCG str. Pasteur 1173P2] (439 aa)
Score = 117, Expect = 6.7e-05, Identities = 36/122 (29%), Positives = 61/122 (50%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYL--RLINISENWKSRVA-NWGLILQQLKILFENEI 122
           +K IY A +   +    + F EKW   Y   T+ W++  EE   F  +  EIRR+  +TN IE++N   R+  +A+G   +  +  K +YL  R ++     +++ A  W   L  L I F + +
  S:   309 LKPIYTAASAAEARLRYEEFAEKWGKPYPAITRLWDSAWEEFIPFLDYDVEIRRVPCSTNAIESLNARYRRAVRARGHFPNEQSALKTLYLVTRSLDPKGTGQTKWAVRWKPALNALAITFADRM 433
>gi|46204658|ref|ZP_00049662.2| COG3328: Transposase and inactivated derivatives [Magnetospirillum magnetotacticum MS-1] >gi|46205053|ref|ZP_00049106.2| COG3328: Transposase and inactivated derivatives [Magnetospirillum magnetotacticum MS-1] (137 aa)
Score = 117, Expect = 7.1e-05, Identities = 31/101 (30%), Positives = 56/101 (55%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIR-KITKAKGGITSVNALSKLIYLRLI-NISENWK 101
           +++I+ AP    +  AL +F EK+ +KY  A      + E L  F+ FPAE    + ++N IE+V   +R +  + KG +++  A  KL+  +L+   S+ W+
  S:     5 LREIHGAPTRAAAEAALAVFVEKYGAKYPRAATCLTKDREALLAFYDFPAEHWDHLRSSNPIESVFATVRHRTVRTKGALSATTA--KLMVFKLVMAASKTWR 105
>gi|51247024|ref|YP_066907.1| transposase (partial length) [Desulfotalea psychrophila LSv54] >gi|50878061|emb|CAG37917.1| probable transposase (partial length) [Desulfotalea psychrophila LSv54] (84 aa)
Score = 116, Expect = 7.7e-05, Identities = 24/58 (41%), Positives = 35/58 (60%)
  Q:    65 VNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILFENEI 122
           V+R  RK+TK KG   + ++L KL+YL + N S+ W   + NW L + QL I FE  +
  S:    21 VHRQFRKLTKTKGAFPNKDSLLKLLYLGIQNASKKWTMPIQNWALTISQLVIYFEGRL 78
>gi|23013207|ref|ZP_00053133.1| COG3328: Transposase and inactivated derivatives [Magnetospirillum magnetotacticum MS-1] >gi|156452562|ref|ZP_02058932.1| transposase, mutator type [Methylobacterium chloromethanicum CM4] >gi|156188489|gb|EDO20688.1| transposase, mutator type [Methylobacterium chloromethanicum CM4] (422 aa)
Score = 116, Expect = 8.0e-05, Identities = 31/101 (30%), Positives = 56/101 (55%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIR-KITKAKGGITSVNALSKLIYLRLI-NISENWK 101
           +++I+ AP    +  AL +F EK+ +KY  A      + E L  F+ FPAE    + ++N IE+V   +R +  + KG +++  A  KL+  +L+   S+ W+
  S:   290 LREIHGAPTRAAAEAALAVFVEKYGAKYPRAATCLTKDREALLAFYDFPAEHWDHLRSSNPIESVFATVRHRTVRTKGALSATTA--KLMVFKLVMAASKTWR 390
>gi|120554551|ref|YP_958902.1| transposase, mutator type [Marinobacter aquaeolei VT8] >gi|120555061|ref|YP_959412.1| transposase, mutator type [Marinobacter aquaeolei VT8] >gi|120556111|ref|YP_960462.1| transposase, mutator type [Marinobacter aquaeolei VT8] >gi|120324400|gb|ABM18715.1| transposase, mutator type [Marinobacter aquaeolei VT8] >gi|120324910|gb|ABM19225.1| transposase, mutator type [Marinobacter aquaeolei VT8] >gi|120325960|gb|ABM20275.1| transposase, mutator type [Marinobacter aquaeolei VT8] (415 aa)
Score = 116, Expect = 8.4e-05, Identities = 30/101 (29%), Positives = 49/101 (48%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWK 101
           ++ I+ A   + + KA   F   + +KY    +    + EEL +FF FPA+  + I TTN IE+    IR  TK   G  S N +  +++   +   E W+
  S:   284 LQAIWHAETREDAEKAFDAFIRTYDAKYPKVAECLLKDHEELMSFFDFPAKHWQSIRTTNPIESTFGTIRHRTKRSKGCLSRNGMLHMMFKLGMCAEERWR 384
>gi|69244012|ref|ZP_00602590.1| Transposase, mutator type [Enterococcus faecium DO] >gi|68196738|gb|EAN11163.1| Transposase, mutator type [Enterococcus faecium DO] (399 aa)
Score = 116, Expect = 9.4e-05, Identities = 27/84 (32%), Positives = 45/84 (53%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNA 84
           MKK Y A + + +  A   F  +  S Y  A      N   +   F + + IR+++YTTN +E+++ + RK+TK KG  ++ NA
  S:   285 MKKFYSASSLNAAHAAFDSFQNR-RSHYSGAVDVCKRNFSHVEQLFDYGSAIRKIMYTTNAVESIHSSFRKVTK-KGVFSNENA 366
>gi|31544678|ref|NP_853256.1| transposase [Mycoplasma gallisepticum R] >gi|31541524|gb|AAP56824.1| predicted transposase [Mycoplasma gallisepticum R] (336 aa)
Score = 115, Expect = 1.0e-04, Identities = 33/120 (27%), Positives = 59/120 (49%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYL------RLINISENWKSRVANWGLILQQLKILFEN 120
           +K IY A N++ +  + +    KW      A +     ++ +   F F   +R L+YT+N++EN N  I     AK    ++N L   +Y+      R   +++   +RV NW  I ++L  +F N
  S:   207 LKNIYGADNWESAKHSFEYLKNKWGCSNKRAVEVVERAMDNIEKLFSFSKALRTLVYTSNIVENYNSVIGSFLAAKKSFNNINQLLLDLYVHFGYNPRYKKLNQK-SNRVRNWYRIYEELMDVFPN 331
>gi|56159740|gb|AAV80716.1| unknown [Acidithiobacillus ferrooxidans] (297 aa)
Score = 115, Expect = 1.2e-04, Identities = 30/100 (30%), Positives = 47/100 (47%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENW 100
           +++I+ A +   + KAL+IF   + +KY  A      +  EL  F+ +PAE  R I TTN IE+    +R  T       S N+   L +  L    + W
  S:   162 LQEIWMAESRKAAEKALEIFVRNYQAKYPKAVAKLEKDRTELLAFYDYPAEHWRHIRTTNAIESTFATVRHRTSRTKNCVSRNSFIGLGFKMLQQAEKRW 261
>gi|158315377|ref|YP_001507885.1| transposase mutator type [Frankia sp. EAN1pec] >gi|158110782|gb|ABW12979.1| transposase mutator type [Frankia sp. EAN1pec] (196 aa)
Score = 114, Expect = 1.4e-04, Identities = 38/120 (31%), Positives = 60/120 (50%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYL--RLINISENWKSR-VANWGLILQQLKILFEN 120
           +K IY AP    +  A+  F E W  KY      W N  EE   F  +  EIRRL+ +TN IE++N   R+  +A+G   S  +  K +YL  R ++ +   ++R +  W  ++    I F +
  S:    66 LKPIYTAPTPAAAAAAMDAFEEAWGRKYRAVVWLWRNAWEEFIPFLDYDIEIRRLLCSTNAIESLNARYRRAVRARGHFPSDQSALKCLYLVTRSLDPTGTGRARWMIRWKPVIDAFAITFRD 188
>gi|56707134|ref|YP_163764.1| putative transposase [Lactobacillus salivarius UCC118] >gi|33321078|gb|AAQ06321.1| transposase ISLasa17c, IS256 family [Lactobacillus salivarius UCC118] (406 aa)
Score = 114, Expect = 1.5e-04, Identities = 26/102 (25%), Positives = 52/102 (50%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKS 102
           +K ++ AP +D +++      + W +++    K   N+  EL   +Q P E+R+ + T N IE VN+ IR+  +      +  ++ +L+   LI  +E W +
  S:   276 LKDLFNAPTYDQAVERRDQLVKDWQAEFPKVVKKLENSFNELMVVYQLPEELRKRLRTNNTIERVNQEIRRRDRVIRIFPNDLSVLRLMGALLIEQNEKWAA 377
>gi|69243906|ref|ZP_00602484.1| ISEf1, transposase [Enterococcus faecium DO] >gi|68196632|gb|EAN11057.1| ISEf1, transposase [Enterococcus faecium DO] (101 aa)
Score = 114, Expect = 1.6e-04, Identities = 26/68 (38%), Positives = 41/68 (60%)
  Q:    22 EKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLI 89
           EKW   Y   T+S   N ++L TF+ FP  IRR IY+TNLIE+ N+ I++ ++ K    +  +L + +
  S:     3 EKWKKNYPKVTQSLIEN-QDLLTFYDFPPSIRRTIYSTNLIESFNKQIKRYSRRKEQFQNEESLERFL 69
>gi|75181836|gb|ABA12823.1| transposase-like [Lactobacillus paracasei subsp. paracasei] >gi|75182237|gb|ABA12846.1| transposase-like [Lactobacillus paracasei subsp. paracasei] (406 aa)
Score = 114, Expect = 1.6e-04, Identities = 26/102 (25%), Positives = 52/102 (50%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKS 102
           +K ++ AP +D +++      + W +++    K   N+  EL   +Q P E+R+ + T N IE VN+ IR+  +      +  ++ +L+   LI  +E W +
  S:   276 LKDLFNAPTYDQAVERRDQLVKDWQAEFPKVVKKLENSFNELMVVYQLPEELRKRLRTNNTIERVNQEIRRRDRVIRIFPNDLSVLRLMGALLIEQNEKWAA 377
>gi|149914158|ref|ZP_01902689.1| putative transposase [Roseobacter sp. AzwK-3b] >gi|149811677|gb|EDM71510.1| putative transposase [Roseobacter sp. AzwK-3b] (422 aa)
Score = 113, Expect = 1.9e-04, Identities = 30/101 (29%), Positives = 52/101 (51%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIR-KITKAKGGITSVNALSKLIYLRLIN-ISENWK 101
           +K+I++A     +  A+  F EK+ +KY  A      N E L  F+ FP E    + T N IE+V   +R +  + KG ++   A  KL+  +L+   ++ W+
  S:   291 LKEIWRADTRAAAETAMDTFAEKYGAKYDKAVTCLTKNREALLAFYDFPGEHWDHLRTGNPIESVFATVRHRTVRTKGALSQKTA--KLMVFKLVQAAAKTWR 391
>gi|55418550|gb|AAV51395.1| transposase [Pseudomonas syringae pv. phaseolicola] >gi|55418552|gb|AAV51396.1| transposase [Pseudomonas syringae pv. phaseolicola] >gi|55469122|gb|AAV52294.1| transposase [Pseudomonas syringae pv. phaseolicola] >gi|55469123|gb|AAV52295.1| transposase [Pseudomonas syringae pv. phaseolicola] (69 aa)
Score = 113, Expect = 2.0e-04, Identities = 24/60 (40%), Positives = 36/60 (60%)
  Q:    59 TNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKSRVANWGLILQQLKILF 118
           TN IE++N  +RKI K +G   +  A +KLI+L L NI+ NW     +W + + Q  IL+
  S:     1 TNAIESINAQLRKIIKTRGHFPTDEAATKLIWLGLRNITANWGHAAHDWKVAMNQFAILY 60
>gi|46199734|ref|YP_005401.1| transposase [Thermus thermophilus HB27] >gi|46197360|gb|AAS81774.1| transposase [Thermus thermophilus HB27] (385 aa)
Score = 113, Expect = 2.0e-04, Identities = 24/91 (26%), Positives = 49/91 (53%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGG-ITSVNALSKLIYL 91
           +  I +A + + ++KAL  F  +W+ KY     SW  +   L  F  +P  ++ +I + NL+E + + +++ TK +     + +A+ K+IY 
  S:   259 LSSIVRASDRNEALKALNSFRGRWADKYPQVVASWIQHSAALLRFLDYPKALQPVIKSANLLERMIKEVKRTTKTRDNTFPTPDAVLKVIYF 350
>gi|31544369|ref|NP_852947.1| transposase [Mycoplasma gallisepticum R] >gi|31541213|gb|AAP56515.1| predicted transposase [Mycoplasma gallisepticum R] (421 aa)
Score = 113, Expect = 2.1e-04, Identities = 33/120 (27%), Positives = 58/120 (48%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYL------RLINISENWKSRVANWGLILQQLKILFEN 120
           +K IY A N++ +    +    KW      A +     ++ +   F F   +R L+YT+N++EN N  I     AK    ++N L   +Y+      R   +++   +RV NW  I ++L  +F N
  S:   292 LKNIYGADNWESAKHNFEYLKNKWGGSNKRAVEVVERAMDNIEKLFSFSKALRTLVYTSNIVENYNSVIGSFLAAKKSFNNINQLLLDLYVHFGYNPRYKKLNQK-SNRVRNWYRIYEELMDVFPN 416
>gi|115430531|emb|CAJ75429.1| putative transposase [Desulfitobacterium dichloroeliminans] (356 aa)
Score = 112, Expect = 2.3e-04, Identities = 31/102 (30%), Positives = 56/102 (54%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKS 102
           +K+I+  P++  + K      +++ +KY  A K+    +E+   FF F     R I +TNL+E +NR +R+ T+  G   S+++  +L+   LI  SE+W S
  S:   234 LKQIWLQPDYSSAKKYANSLMDEFEAKYPEAIKTLEEGLEDSLQFFSFAEIDSRKIASTNLLERLNREVRRRTRVVGIFPSMDSYIRLVTSYLIEYSEDWCS 335
>gi|89893589|ref|YP_517076.1| hypothetical protein DSY0843 [Desulfitobacterium hafniense Y51] >gi|89895580|ref|YP_519067.1| transposase [Desulfitobacterium hafniense Y51] >gi|89895586|ref|YP_519073.1| transposase [Desulfitobacterium hafniense Y51] >gi|49613989|emb|CAG70350.1| putative transposase [Desulfitobacterium hafniense] >gi|49613995|emb|CAG70355.1| putative transposase [Desulfitobacterium hafniense] >gi|89333037|dbj|BAE82632.1| hypothetical protein [Desulfitobacterium hafniense Y51] >gi|89335028|dbj|BAE84623.1| transposase [Desulfitobacterium hafniense Y51] >gi|89335034|dbj|BAE84629.1| transposase [Desulfitobacterium hafniense Y51] (397 aa)
Score = 112, Expect = 2.4e-04, Identities = 31/102 (30%), Positives = 56/102 (54%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKS 102
           +K+I+  P++  + K      +++ +KY  A K+    +E+   FF F     R I +TNL+E +NR +R+ T+  G   S+++  +L+   LI  SE+W S
  S:   275 LKQIWLQPDYSSAKKYANSLMDEFEAKYPEAIKTLEEGLEDSLQFFSFAEIDSRKIASTNLLERLNREVRRRTRVVGIFPSMDSYIRLVTSYLIEYSEDWCS 376
>gi|66271271|gb|AAY43849.1| putative IS256 family transposase [Desulfitobacterium hafniense Y51] (385 aa)
Score = 112, Expect = 2.4e-04, Identities = 31/102 (30%), Positives = 56/102 (54%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKS 102
           +K+I+  P++  + K      +++ +KY  A K+    +E+   FF F     R I +TNL+E +NR +R+ T+  G   S+++  +L+   LI  SE+W S
  S:   263 LKQIWLQPDYSSAKKYANSLMDEFEAKYPEAIKTLEEGLEDSLQFFSFAEIDSRKIASTNLLERLNREVRRRTRVVGIFPSMDSYIRLVTSYLIEYSEDWCS 364
>gi|27353421|dbj|BAC53583.1| putative transposase [Mycoplasma imitans] (419 aa)
Score = 112, Expect = 2.7e-04, Identities = 32/120 (26%), Positives = 58/120 (48%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYL------RLINISENWKSRVANWGLILQQLKILFEN 120
           +K IY A N++ +  + +    KW      A +     ++ +   F F   +R L+YT+N++EN N  I     AK     +N L   +Y+      R   +++   +R+ NW  I ++L  +F N
  S:   290 LKNIYGADNWESAKNSFEYLKNKWGGSNKRAVEVVERAMDNIEKLFTFSKALRTLVYTSNIVENYNSVIGSFLAAKKSFNKINQLLLDLYVHFGYNPRYKKLNQK-SNRLRNWYRIYEELMDVFPN 414
>gi|58701083|gb|AAW81294.1| transposase [Lactobacillus paracasei subsp. paracasei] (196 aa)
Score = 111, Expect = 2.9e-04, Identities = 26/102 (25%), Positives = 52/102 (50%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKS 102
           +K ++ AP +D +++      + W +++    K   N+  EL   +Q P E+R+ + T N IE VN+ IR+  +      +  ++ +L+   LI  +E W +
  S:    66 LKDLFNAPTYDQAVERRDQLVKDWQAEFPKVVKKLENSFNELMVVYQLPEELRKRLRTNNTIERVNQEIRRRDRVIRIFPNDLSVLRLMGALLIEQNEKWAA 167
>gi|118470391|ref|YP_888439.1| IS6120, transposase [Mycobacterium smegmatis str. MC2 155] >gi|118473511|ref|YP_886104.1| IS6120, transposase [Mycobacterium smegmatis str. MC2 155] >gi|118171678|gb|ABK72574.1| IS6120, transposase [Mycobacterium smegmatis str. MC2 155] >gi|118174798|gb|ABK75694.1| IS6120, transposase [Mycobacterium smegmatis str. MC2 155] (439 aa)
Score = 111, Expect = 3.3e-04, Identities = 29/102 (28%), Positives = 51/102 (50%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKS 102
           +K+IY A + D +  A+K F   + +KY  A     ++++ L  F+++PAE    + TTN IE+    +R  TK   G  S  A   + Y  +   +  W++
  S:   292 IKEIYNAEDIDKAQIAVKAFEADFGAKYPKAVAKITDDLDVLLEFYKYPAEHWIHLRTTNPIESTFATVRLRTKVTKGPGSRAAGLAMAYKLIDAAAARWRA 393
>gi|549099|sp|P35883|TRA0_MYCSM Transposase for insertion sequence element IS6120 >gi|149086|gb|AAA25034.1| transposase [Mycobacterium smegmatis] (323 aa)
Score = 111, Expect = 3.3e-04, Identities = 29/102 (28%), Positives = 51/102 (50%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKS 102
           +K+IY A + D +  A+K F   + +KY  A     ++++ L  F+++PAE    + TTN IE+    +R  TK   G  S  A   + Y  +   +  W++
  S:   176 IKEIYNAEDIDKAQIAVKAFEADFGAKYPKAVAKITDDLDVLLEFYKYPAEHWIHLRTTNPIESTFATVRLRTKVTKGPGSRAAGLAMAYKLIDAAAARWRA 277
>gi|15965305|ref|NP_385658.1| transposase ISRM3 [Sinorhizobium meliloti 1021] >gi|15074485|emb|CAC46131.1| Transposase for insertion sequence element ISRm5 [Sinorhizobium meliloti 1021] (398 aa)
Score = 111, Expect = 3.4e-04, Identities = 25/100 (25%), Positives = 47/100 (47%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENW 100
           ++ +Y   + D +   L  +  KWS +Y   T      IE+  TFF+ P +  + + +TN++E +N  IR+ T       +  +  +L+    +   ENW
  S:   275 LRWLYDRRDLDEAKADLAAWLGKWSVRYPRLTSWVEETIEQTLTFFRLPRQHHKHLKSTNMLERLNEEIRRRTYVVRIFPNTESCLRLVRALAVETHENW 374
>gi|16263808|ref|NP_436600.1| ISRm5 transposase protein [Sinorhizobium meliloti 1021] >gi|15139932|emb|CAC48460.1| probable ISRm5 transposase protein [Sinorhizobium meliloti 1021] (398 aa)
Score = 111, Expect = 3.4e-04, Identities = 25/100 (25%), Positives = 47/100 (47%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENW 100
           ++ +Y   + D +   L  +  KWS +Y   T      IE+  TFF+ P +  + + +TN++E +N  IR+ T       +  +  +L+    +   ENW
  S:   275 LRWLYDRRDLDEAKADLAAWLGKWSVRYPRLTSWVEETIEQTLTFFRLPRQHHKHLKSTNMLERLNEEIRRRTYVVRIFPNTESCLRLVRALAVETHENW 374
>gi|76880813|gb|ABA55983.1| ISRm5 transposase [Sinorhizobium meliloti] (398 aa)
Score = 111, Expect = 3.5e-04, Identities = 25/100 (25%), Positives = 47/100 (47%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENW 100
           ++ +Y   + D +   L  +  KWS +Y   T      IE+  TFF+ P +  + + +TN++E +N  IR+ T       +  +  +L+    +   ENW
  S:   275 LRWLYDRRDLDEAKADLAAWLGKWSVRYPRLTSWVEETIEQTLTFFRLPRQHHKHLKSTNMLERLNEEIRRRTYVVRIFPNTESCLRLVRALAVETHENW 374
>gi|15965977|ref|NP_386330.1| transposase ISRM3 [Sinorhizobium meliloti 1021] >gi|15966161|ref|NP_386514.1| transposase ISRM3 [Sinorhizobium meliloti 1021] >gi|15966519|ref|NP_386872.1| transposase ISRM3 [Sinorhizobium meliloti 1021] >gi|2501306|sp|Q52873|TRA5_RHIME Transposase for insertion sequence element ISRM5 >gi|533461|gb|AAA81001.1| transposase [Sinorhizobium meliloti] >gi|15075247|emb|CAC46803.1| Transposase for insertion sequence element ISRm5 [Sinorhizobium meliloti 1021] >gi|15075431|emb|CAC46987.1| Transposase for insertion sequence element ISRm5 [Sinorhizobium meliloti 1021] >gi|15075790|emb|CAC47345.1| Transposase for insertion sequence element ISRm5 [Sinorhizobium meliloti 1021] (398 aa)
Score = 111, Expect = 3.5e-04, Identities = 25/100 (25%), Positives = 47/100 (47%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENW 100
           ++ +Y   + D +   L  +  KWS +Y   T      IE+  TFF+ P +  + + +TN++E +N  IR+ T       +  +  +L+    +   ENW
  S:   275 LRWLYDRRDLDEAKADLAAWLGKWSVRYPRLTSWVEETIEQTLTFFRLPRQHHKHLKSTNMLERLNEEIRRRTYVVRIFPNTESCLRLVRALAVETHENW 374
>gi|15965466|ref|NP_385819.1| transposase ISRM3 [Sinorhizobium meliloti 1021] >gi|15074647|emb|CAC46292.1| Transposase for insertion sequence element ISRm5 [Sinorhizobium meliloti 1021] (398 aa)
Score = 111, Expect = 3.5e-04, Identities = 25/100 (25%), Positives = 47/100 (47%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENW 100
           ++ +Y   + D +   L  +  KWS +Y   T      IE+  TFF+ P +  + + +TN++E +N  IR+ T       +  +  +L+    +   ENW
  S:   275 LRWLYDRRDLDEAKADLAAWLGKWSVRYPRLTSWVEETIEQTLTFFRLPRQHHKHLKSTNMLERLNEEIRRRTYVVRIFPNTESCLRLVRALAVETHENW 374
>gi|149916299|ref|ZP_01904819.1| putative transposase [Roseobacter sp. AzwK-3b] >gi|149809753|gb|EDM69605.1| putative transposase [Roseobacter sp. AzwK-3b] (422 aa)
Score = 111, Expect = 3.5e-04, Identities = 29/101 (28%), Positives = 52/101 (51%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIR-KITKAKGGITSVNALSKLIYLRLIN-ISENWK 101
           +++I+QA     +  A+  F EK+ +KY  A      + E L  F+ FP E    + T N IE+V   +R +  + KG ++   A  KL+  +L+   ++ W+
  S:   291 LREIWQADTRAAAETAMDTFAEKYGAKYDKAVTCLTKDREALLAFYDFPGEHWDHLRTGNPIESVFATVRHRTVRTKGALSQKTA--KLMVFKLVQAAAKTWR 391
>gi|145225982|ref|YP_001136636.1| transposase, mutator type [Mycobacterium gilvum PYR-GCK] >gi|145218445|gb|ABP47848.1| transposase, mutator type [Mycobacterium gilvum PYR-GCK] (438 aa)
Score = 110, Expect = 3.9e-04, Identities = 29/102 (28%), Positives = 50/102 (49%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWKS 102
           +K+IY A + D +  A+K F   + +KY  A     ++++ L  F+ +PAE    + TTN IE+    +R  TK   G  S  A   + Y  +   +  W++
  S:   291 IKEIYNAEDIDKAQLAVKAFEVDFGAKYPKAVAKITDDLDTLLEFYHYPAEHWIHLRTTNPIESTFATVRLRTKVTKGPGSRAAGLAMAYKLIDAAAARWRA 392
>gi|13398533|gb|AAK21919.1| truncated transposase [Lactobacillus helveticus] (203 aa)
Score = 110, Expect = 4.4e-04, Identities = 21/65 (32%), Positives = 36/65 (55%)
  Q:     2 KKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVN 66
           K+I+Q  N   ++  L  F  KW   Y +  ++  +   +L  F+ +P +IR  IY+TN+IE+ N
  S:   136 KQIHQQANKAAAVDVLHAFYAKWDKSYNHVIRNLKDIEPDLLVFYNYPKQIRASIYSTNMIESFN 200
>gi|149914797|ref|ZP_01903327.1| putative transposase [Roseobacter sp. AzwK-3b] >gi|149811590|gb|EDM71425.1| putative transposase [Roseobacter sp. AzwK-3b] (422 aa)
Score = 109, Expect = 5.1e-04, Identities = 29/101 (28%), Positives = 52/101 (51%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIR-KITKAKGGITSVNALSKLIYLRLIN-ISENWK 101
           +K+I++A     +  A+  F EK+ +KY  A      + E L  F+ FP E    + T N IE+V   +R +  + KG ++   A  KL+  +L+   ++ W+
  S:   291 LKEIWRADTRATAETAMDTFAEKYGAKYDKAVTCLTKDREALLAFYDFPGEHWDHLRTGNPIESVFATVRHRTVRTKGALSQKTA--KLMVFKLVQAAAKTWR 391
>gi|15384307|gb|AAK96240.1|AF406971_5 transposase [Enterococcus hirae] (391 aa)
Score = 109, Expect = 5.8e-04, Identities = 26/88 (29%), Positives = 45/88 (51%)
  Q:     2 KKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLI 89
           K+++ A N + +   L  F   W   Y    K     +  L TF  FP  IR+ +Y+TNLIEN N+++++ T  K    + ++L + +
  S:   274 KQVHWAANREAAELKLNEFANNWHRTYPKLIKDLLK-MPNLLTFMDFPPAIRQSLYSTNLIENFNKHLKRTTHRKEQFPTEDSLDRFL 360
>gi|118616726|ref|YP_905058.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118568836|gb|ABL03587.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] (444 aa)
Score = 108, Expect = 6.6e-04, Identities = 36/122 (29%), Positives = 60/122 (49%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINI------SENWKSRVANWGLILQQLKILFENEI 122
           +K IY A N   + +AL  F  +W  +Y  A + W N   E   F  +  EIR++I +TN IE++N   R+  +A+G   +  +  K +YL   ++       + W +R   W   L    I F + +
  S:   314 LKPIYTAVNAAAAAEALDAFDTEWGHRYPAAIRLWRNAWNEFIPFLDYDTEIRKVICSTNAIESLNARYRRAIRARGHFPTEQSALKCLYLVTRSLDPTGTGQKRWTTR---WKPALNAFAITFADRM 438
>gi|40445299|ref|NP_954759.1| transposase [Gordonia westfalica] >gi|40217329|emb|CAE09080.1| putative transposase [Gordonia westfalica] (546 aa)
Score = 108, Expect = 7.0e-04, Identities = 27/91 (29%), Positives = 45/91 (49%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYL 91
           +K IY A     +    + F E+W + Y      W +  EE   F  +  EIRR++ +TN IE++N   R+  +A+G   +  +  K +YL
  S:   316 LKPIYTASTAAEARLRWEEFAERWGTPYPAIVTLWESAWEEFIPFLDYDVEIRRVLCSTNAIESLNARYRRAVRARGHFPNEQSALKTLYL 406
>gi|118727887|ref|ZP_01576471.1| putative transposase [Clostridium cellulolyticum H10] >gi|118662701|gb|EAV69378.1| putative transposase [Clostridium cellulolyticum H10] (126 aa)
Score = 108, Expect = 7.3e-04, Identities = 33/103 (32%), Positives = 49/103 (47%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSS-KYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINIS-ENWKSR 103
           M K+   P      +  K+  E+  S K   A K   + IEE  T+ +FP E    I T N IE +NR IR+ T+  G     N+   L+  RL +++   W S+
  S:     1 MDKLLCTPRLSAYREKAKLVAEELKSMKLREAAKKLEDGIEETLTYMEFPYEHWTRIRTNNTIERLNREIRRRTRVVGTFPDGNSALMLVCARLRHVAGTQWGSK 105
>gi|23011822|ref|ZP_00052070.1| COG3328: Transposase and inactivated derivatives [Magnetospirillum magnetotacticum MS-1] (120 aa)
Score = 108, Expect = 7.6e-04, Identities = 27/88 (30%), Positives = 48/88 (54%)
  Q:    14 MKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIR-KITKAKGGITSVNALSKLIYLRLI-NISENWK 101
           M A+ +F EK+ +KY  A      + + L  FF  PAE    + TTN IE+V   +R +  + KG ++   A  +L+  +L+   +++W+
  S:     1 MAAMAVFVEKYGTKYARAADGLIKDRDALLAFFDMPAEHWDHLRTTNPIESVFATVRHRTVRTKGALSPTTA--RLMVFKLVMAAAKSWR 88
>gi|124515414|gb|EAY56924.1| transposase [Leptospirillum sp. Group II UBA] (416 aa)
Score = 107, Expect = 8.7e-04, Identities = 27/101 (26%), Positives = 46/101 (45%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWK 101
           + +I+ A   + + KA   F   + +KY  A +    + E L  F+ FPAE    I TTN IE+    +R  T    G  S  ++  +++   I   + W+
  S:   287 LHQIWMAETREAAHKAFDYFLSAYQAKYPKAAECLKKDREALLAFYDFPAEHWIHIRTTNPIESTFATVRHRTVKTRGCVSRESMLAMVFKLAITAQQRWR 387
>gi|85858847|ref|YP_461049.1| transposase [Syntrophus aciditrophicus SB] >gi|85858864|ref|YP_461066.1| transposase [Syntrophus aciditrophicus SB] >gi|85858895|ref|YP_461097.1| transposase [Syntrophus aciditrophicus SB] >gi|85721938|gb|ABC76881.1| transposase [Syntrophus aciditrophicus SB] >gi|85721955|gb|ABC76898.1| transposase [Syntrophus aciditrophicus SB] >gi|85721986|gb|ABC76929.1| transposase [Syntrophus aciditrophicus SB] (446 aa)
Score = 107, Expect = 8.9e-04, Identities = 27/101 (26%), Positives = 47/101 (46%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENWK 101
           ++ +Y AP  + ++KA   F  ++ +KY  A      +   L  F+ FPAE  R I +TN IE+    +R  T    G  S  A   +++   +   + W+
  S:   319 IRDMYMAPTKEEALKAFHHFLSQYQAKYERACNCLEKDTNSLFAFYDFPAEHWRHIRSTNPIESTFATVRLRTNRTKGCGSRLATLTMVFKLAMEAEKTWQ 419
>gi|66392695|emb|CAG29802.1| transposase [Rhodococcus erythropolis] >gi|66392701|emb|CAG29806.1| transposase IS1166 [Rhodococcus erythropolis] (434 aa)
Score = 107, Expect = 9.1e-04, Identities = 31/102 (30%), Positives = 54/102 (52%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISE-NWKS 102
           M++IY A + D +  A+K F   + +KY  A     ++ + L  F+++PAE    + TTN IE+    +R  TK   G  S  A   + Y +LI+ ++  W++
  S:   291 MREIYNAEDIDKAQVAIKAFEVDYGAKYPKAVAKIVDDADVLLEFYRYPAEHWIHLRTTNPIESTFATVRLRTKVTKGPGSRAAGIAMAY-KLIDAAQARWRA 392
>gi|66392688|emb|CAG29796.1| transposase [Microbacterium sp. AJ115] (434 aa)
Score = 107, Expect = 9.1e-04, Identities = 31/102 (30%), Positives = 54/102 (52%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISE-NWKS 102
           M++IY A + D +  A+K F   + +KY  A     ++ + L  F+++PAE    + TTN IE+    +R  TK   G  S  A   + Y +LI+ ++  W++
  S:   291 MREIYNAEDIDKAQVAIKAFEVDYGAKYPKAVAKIVDDADVLLEFYRYPAEHWIHLRTTNPIESTFATVRLRTKVTKGPGSRAAGIAMAY-KLIDAAQARWRA 392
>gi|161522756|ref|YP_001585685.1| transposase mutator type [Burkholderia multivorans ATCC 17616] >gi|161523369|ref|YP_001578381.1| transposase mutator type [Burkholderia multivorans ATCC 17616] >gi|161524341|ref|YP_001579353.1| transposase mutator type [Burkholderia multivorans ATCC 17616] >gi|161524983|ref|YP_001579995.1| transposase mutator type [Burkholderia multivorans ATCC 17616] >gi|161525450|ref|YP_001580462.1| transposase mutator type [Burkholderia multivorans ATCC 17616] >gi|161525453|ref|YP_001580465.1| transposase mutator type [Burkholderia multivorans ATCC 17616] >gi|161525783|ref|YP_001580795.1| transposase mutator type [Burkholderia multivorans ATCC 17616] >gi|189348394|ref|YP_001941590.1| IS406 transposase [Burkholderia multivorans ATCC 17616] >gi|189349496|ref|YP_001945124.1| IS406 transposase [Burkholderia multivorans ATCC 17616] >gi|189349812|ref|YP_001945440.1| IS406 transposase [Burkholderia multivorans ATCC 17616] >gi|189349814|ref|YP_001945442.1| IS406 transposase [Burkholderia multivorans ATCC 17616] >gi|189350273|ref|YP_001945901.1| IS406 transposase [Burkholderia multivorans ATCC 17616] >gi|189350904|ref|YP_001946532.1| IS406 transposase [Burkholderia multivorans ATCC 17616] >gi|189351858|ref|YP_001947486.1| IS406 transposase [Burkholderia multivorans ATCC 17616] >gi|140831|sp|P24575|TRA6_BURCE Transposase for insertion sequence element IS406 >gi|208687|gb|AAA25037.1| ORF1 [Burkholderia cepacia] >gi|160340798|gb|ABX13884.1| transposase mutator type [Burkholderia multivorans ATCC 17616] >gi|160341770|gb|ABX14856.1| transposase mutator type [Burkholderia multivorans ATCC 17616] >gi|160342412|gb|ABX15498.1| transposase mutator type [Burkholderia multivorans ATCC 17616] >gi|160342879|gb|ABX15965.1| transposase mutator type [Burkholderia multivorans ATCC 17616] >gi|160342882|gb|ABX15968.1| transposase mutator type [Burkholderia multivorans ATCC 17616] >gi|160343212|gb|ABX16298.1| transposase mutator type [Burkholderia multivorans ATCC 17616] >gi|160346309|gb|ABX19393.1| transposase mutator type [Burkholderia multivorans ATCC 17616] >gi|189333518|dbj|BAG42588.1| IS406 transposase [Burkholderia multivorans ATCC 17616] >gi|189333834|dbj|BAG42904.1| IS406 transposase [Burkholderia multivorans ATCC 17616] >gi|189333836|dbj|BAG42906.1| IS406 transposase [Burkholderia multivorans ATCC 17616] >gi|189334295|dbj|BAG43365.1| IS406 transposase [Burkholderia multivorans ATCC 17616] >gi|189334926|dbj|BAG43996.1| IS406 transposase [Burkholderia multivorans ATCC 17616] >gi|189335880|dbj|BAG44950.1| IS406 transposase [Burkholderia multivorans ATCC 17616] >gi|189338532|dbj|BAG47600.1| IS406 transposase [Burkholderia multivorans ATCC 17616] (388 aa)
Score = 107, Expect = 9.3e-04, Identities = 26/100 (26%), Positives = 47/100 (47%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENW 100
           M+ I+ AP+   + + LK     W  ++    +     I E  T F FPA  R  + TTN +E +NR +R+ T+      + ++  +L+   L  + + W
  S:   278 MRAIFNAPDRTEAERLLKAALTLWCKEHPKLAEWAETAIPESLTVFDFPAAHRIRLRTTNGLERINRELRRRTRVASIFPNPDSCLRLVSALLAELDDEW 377
>gi|118617156|ref|YP_905488.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118619581|ref|YP_907913.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118619675|ref|YP_908007.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118569266|gb|ABL04017.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118571691|gb|ABL06442.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118571785|gb|ABL06536.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] (444 aa)
Score = 107, Expect = 1.0e-03, Identities = 30/91 (32%), Positives = 48/91 (52%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYL 91
           +K IY A N   + +AL  F  +W  +Y  A + W N   E   F  +  EIR++I +TN IE++N   R+  +A+G   +  +  K +YL
  S:   314 LKPIYTAVNAAAAAEALDAFDTEWGHRYPAAIRLWRNAWNEFIPFLDYDTEIRKVICSTNAIESLNARYRRAIRARGHFPTEQSALKCLYL 404
>gi|85860686|ref|YP_462888.1| transposase [Syntrophus aciditrophicus SB] >gi|85723777|gb|ABC78720.1| transposase [Syntrophus aciditrophicus SB] (393 aa)
Score = 107, Expect = 1.0e-03, Identities = 29/102 (28%), Positives = 56/102 (54%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIR-KITKAKGGITSVNALSKLIYLRL---INISENWKS 102
           ++ +Y AP  + ++KA   F  ++ +KY  A      +++ L  F+ FPAE  R I +TN IE+    +R +  + KG  + +  L+ +  L +    N++EN ++
  S:   281 IRDMYMAPTKEEALKACHHFLSQYQAKYERACNCLAKDMDSLFAFYDFPAEHWRHIRSTNPIESTFATVRLRTNRTKGCGSRLATLTMVFKLAMETEKNLAENQRT 386
>gi|118618883|ref|YP_907215.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118570993|gb|ABL05744.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] (444 aa)
Score = 107, Expect = 1.1e-03, Identities = 30/91 (32%), Positives = 48/91 (52%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYL 91
           +K IY A N   + +AL  F  +W  +Y  A + W N   E   F  +  EIR++I +TN IE++N   R+  +A+G   +  +  K +YL
  S:   314 LKPIYTAVNAAAAAEALDAFDTEWGHRYPAAIRLWRNAWNEFIPFLDYDTEIRKVICSTNAIESLNARYRRAIRARGHFPTEQSALKCLYL 404
>gi|49146139|ref|YP_025577.1| transposase for the insertion element IS2606 [Mycobacterium ulcerans Agy99] >gi|42414773|emb|CAE46866.1| probable transposase for the insertion element IS2606 [Mycobacterium ulcerans Agy99] (444 aa)
Score = 107, Expect = 1.1e-03, Identities = 30/91 (32%), Positives = 48/91 (52%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYL 91
           +K IY A N   + +AL  F  +W  +Y  A + W N   E   F  +  EIR++I +TN IE++N   R+  +A+G   +  +  K +YL
  S:   314 LKPIYTAVNAAAAAEALDAFDTEWGHRYPAAIRLWRNAWNEFIPFLDYDTEIRKVICSTNAIESLNARYRRAIRARGHFPTEQSALKCLYL 404
>gi|118616029|ref|YP_904361.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118619697|ref|YP_908029.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118619794|ref|YP_908126.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118568139|gb|ABL02890.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118571807|gb|ABL06558.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118571904|gb|ABL06655.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] (444 aa)
Score = 107, Expect = 1.1e-03, Identities = 30/91 (32%), Positives = 48/91 (52%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYL 91
           +K IY A N   + +AL  F  +W  +Y  A + W N   E   F  +  EIR++I +TN IE++N   R+  +A+G   +  +  K +YL
  S:   314 LKPIYTAVNAAAAAEALDAFDTEWGHRYPAAIRLWRNAWNEFIPFLDYDTEIRKVICSTNAIESLNARYRRAIRARGHFPTEQSALKCLYL 404
>gi|118619528|ref|YP_907860.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118571638|gb|ABL06389.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] (444 aa)
Score = 107, Expect = 1.1e-03, Identities = 30/91 (32%), Positives = 48/91 (52%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYL 91
           +K IY A N   + +AL  F  +W  +Y  A + W N   E   F  +  EIR++I +TN IE++N   R+  +A+G   +  +  K +YL
  S:   314 LKPIYTAVNAAAAAEALDAFDTEWGHRYPAAIRLWRNAWNEFIPFLDYDTEIRKVICSTNAIESLNARYRRAIRARGHFPTEQSALKCLYL 404
>gi|118617916|ref|YP_906248.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118570026|gb|ABL04777.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] (444 aa)
Score = 107, Expect = 1.1e-03, Identities = 30/91 (32%), Positives = 48/91 (52%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYL 91
           +K IY A N   + +AL  F  +W  +Y  A + W N   E   F  +  EIR++I +TN IE++N   R+  +A+G   +  +  K +YL
  S:   314 LKPIYTAVNAAAAAEALDAFDTEWGHRYPAAIRLWRNAWNEFIPFLDYDTEIRKVICSTNAIESLNARYRRAIRARGHFPTEQSALKCLYL 404
>gi|118617550|ref|YP_905882.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118569660|gb|ABL04411.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] (444 aa)
Score = 107, Expect = 1.1e-03, Identities = 30/91 (32%), Positives = 48/91 (52%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYL 91
           +K IY A N   + +AL  F  +W  +Y  A + W N   E   F  +  EIR++I +TN IE++N   R+  +A+G   +  +  K +YL
  S:   314 LKPIYTAVNAAAAAEALDAFDTEWGHRYPAAIRLWRNAWNEFIPFLDYDTEIRKVICSTNAIESLNARYRRAIRARGHFPTEQSALKCLYL 404
>gi|118618748|ref|YP_907080.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118570858|gb|ABL05609.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] (443 aa)
Score = 107, Expect = 1.1e-03, Identities = 30/91 (32%), Positives = 48/91 (52%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYL 91
           +K IY A N   + +AL  F  +W  +Y  A + W N   E   F  +  EIR++I +TN IE++N   R+  +A+G   +  +  K +YL
  S:   313 LKPIYTAVNAAAAAEALDAFDTEWGHRYPAAIRLWRNAWNEFIPFLDYDTEIRKVICSTNAIESLNARYRRAIRARGHFPTEQSALKCLYL 403
>gi|118616414|ref|YP_904746.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118568524|gb|ABL03275.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] (443 aa)
Score = 107, Expect = 1.1e-03, Identities = 30/91 (32%), Positives = 48/91 (52%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYL 91
           +K IY A N   + +AL  F  +W  +Y  A + W N   E   F  +  EIR++I +TN IE++N   R+  +A+G   +  +  K +YL
  S:   313 LKPIYTAVNAAAAAEALDAFDTEWGHRYPAAIRLWRNAWNEFIPFLDYDTEIRKVICSTNAIESLNARYRRAIRARGHFPTEQSALKCLYL 403
>gi|118618184|ref|YP_906516.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118618517|ref|YP_906849.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118570294|gb|ABL05045.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118570627|gb|ABL05378.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] (444 aa)
Score = 106, Expect = 1.1e-03, Identities = 30/91 (32%), Positives = 48/91 (52%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYL 91
           +K IY A N   + +AL  F  +W  +Y  A + W N   E   F  +  EIR++I +TN IE++N   R+  +A+G   +  +  K +YL
  S:   314 LKPIYTAVNAAAAAEALDAFDTEWGHRYPAAIRLWRNAWNEFIPFLDYDTEIRKVICSTNAIESLNARYRRAIRARGHFPTEQSALKCLYL 404
>gi|118619677|ref|YP_908009.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118571787|gb|ABL06538.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] (447 aa)
Score = 106, Expect = 1.1e-03, Identities = 30/91 (32%), Positives = 48/91 (52%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYL 91
           +K IY A N   + +AL  F  +W  +Y  A + W N   E   F  +  EIR++I +TN IE++N   R+  +A+G   +  +  K +YL
  S:   317 LKPIYTAVNAAAAAEALDAFDTEWGHRYPAAIRLWRNAWNEFIPFLDYDTEIRKVICSTNAIESLNARYRRAIRARGHFPTEQSALKCLYL 407
>gi|118617231|ref|YP_905563.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118569341|gb|ABL04092.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] (444 aa)
Score = 106, Expect = 1.1e-03, Identities = 30/91 (32%), Positives = 48/91 (52%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYL 91
           +K IY A N   + +AL  F  +W  +Y  A + W N   E   F  +  EIR++I +TN IE++N   R+  +A+G   +  +  K +YL
  S:   314 LKPIYTAVNAAAAAEALDAFDTEWGHRYPAAIRLWRNAWNEFIPFLDYDTEIRKVICSTNAIESLNARYRRAIRARGHFPTEQSALKCLYL 404
>gi|118619509|ref|YP_907841.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118571619|gb|ABL06370.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] (444 aa)
Score = 106, Expect = 1.1e-03, Identities = 30/91 (32%), Positives = 48/91 (52%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYL 91
           +K IY A N   + +AL  F  +W  +Y  A + W N   E   F  +  EIR++I +TN IE++N   R+  +A+G   +  +  K +YL
  S:   314 LKPIYTAVNAAAAAEALDAFDTEWGHRYPAAIRLWRNAWNEFIPFLDYDTEIRKVICSTNAIESLNARYRRAIRARGHFPTEQSALKCLYL 404
>gi|118619386|ref|YP_907718.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118571496|gb|ABL06247.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] (444 aa)
Score = 106, Expect = 1.1e-03, Identities = 30/91 (32%), Positives = 48/91 (52%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYL 91
           +K IY A N   + +AL  F  +W  +Y  A + W N   E   F  +  EIR++I +TN IE++N   R+  +A+G   +  +  K +YL
  S:   314 LKPIYTAVNAAAAAEALHAFDTEWGHRYPAAIRLWRNAWNEFIPFLDYDTEIRKVICSTNAIESLNARYRRAIRARGHFPTEQSALKCLYL 404
>gi|49146120|ref|YP_025558.1| transposase for the insertion element IS2606 [Mycobacterium ulcerans Agy99] >gi|42414754|emb|CAE46847.1| probable transposase for the insertion element IS2606 [Mycobacterium ulcerans Agy99] (444 aa)
Score = 106, Expect = 1.1e-03, Identities = 30/91 (32%), Positives = 48/91 (52%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYL 91
           +K IY A N   + +AL  F  +W  +Y  A + W N   E   F  +  EIR++I +TN IE++N   R+  +A+G   +  +  K +YL
  S:   314 LKPIYTAVNAAAAAEALDAFDTEWGHRYPAAIRLWRNAWNEFIPFLDYDTEIRKVICSTNAIESLNARYRRAIRARGHFPTEQSALKCLYL 404
>gi|118617932|ref|YP_906264.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118570042|gb|ABL04793.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] (444 aa)
Score = 106, Expect = 1.1e-03, Identities = 30/91 (32%), Positives = 48/91 (52%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYL 91
           +K IY A N   + +AL  F  +W  +Y  A + W N   E   F  +  EIR++I +TN IE++N   R+  +A+G   +  +  K +YL
  S:   314 LKPIYTAVNAAAAAEALDAFDTEWGHRYPAAIRLWRNAWNEFIPFLDYDTEIRKVICSTNAIESLNARYRRAIRARGHFPTEQSALKCLYL 404
>gi|118617854|ref|YP_906186.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118569964|gb|ABL04715.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] (444 aa)
Score = 106, Expect = 1.1e-03, Identities = 30/91 (32%), Positives = 48/91 (52%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYL 91
           +K IY A N   + +AL  F  +W  +Y  A + W N   E   F  +  EIR++I +TN IE++N   R+  +A+G   +  +  K +YL
  S:   314 LKPIYTAVNAAAAAEALDAFDTEWGHRYPAAIRLWRNAWNEFIPFLDYDTEIRKVICSTNAIESLNARYRRAIRARGHFPTEQSALKCLYL 404
>gi|126434041|ref|YP_001069732.1| transposase, mutator type [Mycobacterium sp. JLS] >gi|126233841|gb|ABN97241.1| transposase, mutator type [Mycobacterium sp. JLS] (434 aa)
Score = 106, Expect = 1.1e-03, Identities = 31/102 (30%), Positives = 54/102 (52%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISE-NWKS 102
           M++IY A + D +  A+K F   + +KY  A     ++ + L  F+++PAE    + TTN IE+    +R  TK   G  S  A   + Y +LI+ ++  W++
  S:   291 MREIYNAEDLDHAQVAIKAFEIDYGAKYPKAVAKIVDDADVLLEFYKYPAEHWIHLRTTNPIESTFATVRLRTKVTKGPGSRAAGIAMAY-KLIDAAQARWRA 392
>gi|49146134|ref|YP_025572.1| transposase for the insertion element IS2606 [Mycobacterium ulcerans Agy99] >gi|42414768|emb|CAE46861.1| probable transposase for the insertion element IS2606 [Mycobacterium ulcerans Agy99] (444 aa)
Score = 106, Expect = 1.1e-03, Identities = 30/91 (32%), Positives = 48/91 (52%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYL 91
           +K IY A N   + +AL  F  +W  +Y  A + W N   E   F  +  EIR++I +TN IE++N   R+  +A+G   +  +  K +YL
  S:   314 LKPIYTAVNAAAAAEALDAFDTEWGHRYPAAIRLWRNAWNEFIPFLDYDTEIRKVICSTNAIESLNARYRRAIRARGHFPTEQSALKCLYL 404
>gi|118462901|ref|YP_881861.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118464417|ref|YP_881718.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118464836|ref|YP_880706.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118465269|ref|YP_880482.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118465367|ref|YP_881146.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118465846|ref|YP_881434.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118466779|ref|YP_881429.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|4335673|gb|AAD02885.2| transposase [Mycobacterium avium] >gi|118164188|gb|ABK65085.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118165704|gb|ABK66601.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118166123|gb|ABK67020.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118166556|gb|ABK67453.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118166654|gb|ABK67551.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118167133|gb|ABK68030.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118168066|gb|ABK68963.1| transposase, Mutator family protein [Mycobacterium avium 104] (434 aa)
Score = 106, Expect = 1.2e-03, Identities = 31/102 (30%), Positives = 54/102 (52%)
  Q:     1 MKKIYQAPNFDVSMKALKIFTEKWSSKYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISE-NWKS 102
           M++IY A + D +  A+K F   + +KY  A     ++ + L  F+++PAE    + TTN IE+    +R  TK   G  S  A   + Y +LI+ ++  W++
  S:   291 MREIYNAEDIDHAQVAIKAFEVDYGAKYPKAVAKIVDDADVLLEFYRYPAEHWIHLRTTNPIESTFATVRLRTKVTKGPGSRAAGIAMAY-KLIDAAQARWRA 392
>gi|21228492|ref|NP_634414.1| transposase [Methanosarcina mazei Go1] >gi|21228552|ref|NP_634474.1| transposase [Methanosarcina mazei Go1] >gi|21228632|ref|NP_634554.1| transposase [Methanosarcina mazei Go1] >gi|20906976|gb|AAM32086.1| Transposase [Methanosarcina mazei Go1] >gi|20907043|gb|AAM32146.1| Transposase [Methanosarcina mazei Go1] >gi|20907131|gb|AAM32226.1| Transposase [Methanosarcina mazei Go1] (392 aa)
Score = 106, Expect = 1.2e-03, Identities = 23/74 (31%), Positives = 41/74 (55%)
  Q:    27 KYGYATKSWNNNIEELTTFFQFPAEIRRLIYTTNLIENVNRNIRKITKAKGGITSVNALSKLIYLRLINISENW 100
           +Y  A  +  N   ++  + QFP    R I TTN++E  N+ I++ TK  G   +  ++ +L+   LI+I+E+W
  S:   308 EYKSAADTLENFQYDVMNYMQFPQSHWRKIRTTNMMERTNKEIKRRTKVVGAFPNQESVLRLVVSILIDINEDW 381