>gi|26553512|ref|NP_757446.1| F0F1 ATP synthase subunit alpha [Mycoplasma penetrans HF-2] >gi|81748104|sp|Q8EWZ0|ATPA_MYCPE ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|26453518|dbj|BAC43850.1| ATP synthase subunit alpha [Mycoplasma penetrans HF-2] (513 aa)
Score = 2568, Expect = 0.0e+00, Identities = 513/513 (100%), Positives = 513/513 (100%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKTILETIDQTKDISQDLFVQIKNEFNSLITSYIKTIPDYNLDFVGL 513
           MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKTILETIDQTKDISQDLFVQIKNEFNSLITSYIKTIPDYNLDFVGL
  S:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKTILETIDQTKDISQDLFVQIKNEFNSLITSYIKTIPDYNLDFVGL 513
>gi|31544508|ref|NP_853086.1| F0F1 ATP synthase subunit alpha [Mycoplasma gallisepticum R] >gi|33860131|sp|P33252|ATPA_MYCGA ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|31541353|gb|AAP56654.1| AtpA [Mycoplasma gallisepticum R] (518 aa)
Score = 1667, Expect = 0.0e+00, Identities = 327/512 (63%), Positives = 405/512 (79%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIK-YDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKTILETIDQTKDISQDLFVQIKNEFNSLITSYIKTIPDYNLDFVG 512
           M+INL+++S +IK+QIK+Y NK +  + G +I +GDGIV+ SGL +V+LNELV FENG+YG+ LNLE  + G+VML  + D+KEGS VKRT  V+  PVGDGLLGRVID +G PIDG GE+K      PIE++A GVM R SV +PLETG LAIDSM PIGKGQRELIIGD+QTGKTTIA+D IINQKGKNV CIYV IGQKNS++ Q    L++ GA+ YTTIV+++AS+L +L+Y+APF G+TI EEWM +G+DVLI+YDDLSKHA+AYR LSLLLRRPPGREAYPGDIFYLHSRLLER+GK++ E G GSITALPIIET+AGDISAYIPTNVISITDGQLF  T+LFNSGQRPAI  GLSVSRVGS+AQ+ ++K+ SGSLKLELAQYRELD FSQF SDLD ETK VLEHG +VM++ KQ +  P  Q+ EA+LLF IK ++I+WIP D+I  FKE I+   KQ + + + I++ K    ++  ++   F  ++  Y  T+ DYN    G
  S:     1 MAINLNEYSLLIKDQIKKYANKIISDQKGYIITIGDGIVRVSGLDDVLLNELVEFENGAYGIALNLEPNSVGVVMLSDYYDLKEGSSVKRTGKVIQAPVGDGLLGRVIDPIGLPIDGKGELKNISGYAPIERLAYGVMQRKSVHQPLETGILAIDSMLPIGKGQRELIIGDRQTGKTTIALDTIINQKGKNVNCIYVAIGQKNSSVAQITRLLEETGAMAYTTIVSATASELAALSYIAPFAGVTIGEEWMRQGKDVLIVYDDLSKHAVAYRALSLLLRRPPGREAYPGDIFYLHSRLLERAGKLSDELGAGSITALPIIETQAGDISAYIPTNVISITDGQLFTTTSLFNSGQRPAIHVGLSVSRVGSAAQLKSIKQVSGSLKLELAQYRELDTFSQFSSDLDAETKIVLEHGARVMEMFKQPQAKPIDQTSEAVLLFGIKNRFIKWIPTDHIIKFKEFILDKIKQDQ-VYKKIEEKKAFDDEIEKELTAFFKDVVKKYTSTLVDYNGSLYG 512
>gi|44300|emb|CAA45549.1| adenosinetriphosphatase [Mycoplasma gallisepticum] (518 aa)
Score = 1665, Expect = 0.0e+00, Identities = 327/512 (63%), Positives = 404/512 (78%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIK-YDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKTILETIDQTKDISQDLFVQIKNEFNSLITSYIKTIPDYNLDFVG 512
           M+INL+++S +IK+QIK+Y NK +  + G +I +GDGIV+ SGL +V+LNELV FENG+YG+ LNLE  + G+VML  + D+KEGS VKRT  V+  PVGDGLLGRVID +G PIDG GE+K      PIE++A GVM R SV +PLETG LAIDSM PIGKGQRELIIGD+QTGKTTIA+D IINQKGKNV CIYV IGQKNS++ Q    L++ GA+ YTTIV+++AS+L +L+Y+APF G+TI EEWM +G+DVLI+YDDLSKHA+AYR LSLLLRRPPGREAYPGDIFYLHSRLLER+GK++ E G GSITALPIIET+AGDISAYIPTNVISITDGQLF  T+LFNSGQRPAI  GLSVSRVGS+AQ+ ++K+ SGSLKLELAQYRELD FSQF SDLD ETK VLEHG +VM++ KQ +  P  Q+ EA+LLF IK ++I+WIP D+I  FKE I+   KQ   + + I++ K    ++  ++   F  ++  Y  T+ DYN    G
  S:     1 MAINLNEYSLLIKDQIKKYANKIISDQKGYIITIGDGIVRVSGLDDVLLNELVEFENGAYGIALNLEPNSVGVVMLSDYYDLKEGSSVKRTGKVIQAPVGDGLLGRVIDPIGLPIDGKGELKNISGYAPIERLAYGVMQRKSVHQPLETGILAIDSMLPIGKGQRELIIGDRQTGKTTIALDTIINQKGKNVNCIYVAIGQKNSSVAQITRLLEETGAMAYTTIVSATASELAALSYIAPFAGVTIGEEWMRQGKDVLIVYDDLSKHAVAYRALSLLLRRPPGREAYPGDIFYLHSRLLERAGKLSDELGAGSITALPIIETQAGDISAYIPTNVISITDGQLFTTTSLFNSGQRPAIHVGLSVSRVGSAAQLKSIKQVSGSLKLELAQYRELDTFSQFSSDLDAETKIVLEHGARVMEMFKQPQAKPIDQTSEAVLLFGIKNRFIKWIPTDHIIKFKEFILDKIKQDP-VYKKIEEKKAFDDEIEKELTAFFKDVVKKYTSTLVDYNGSLYG 512
>gi|13508339|ref|NP_110289.1| F0F1 ATP synthase subunit alpha [Mycoplasma pneumoniae M129] >gi|2493019|sp|Q50329|ATPA_MYCPN ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|1209764|gb|AAC43657.1| ATP synthase alpha chain >gi|1673910|gb|AAB95890.1| ATP synthase alpha chain [Mycoplasma pneumoniae M129] (518 aa)
Score = 1652, Expect = 0.0e+00, Identities = 306/512 (59%), Positives = 406/512 (79%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKTILETIDQTKDISQDLFVQIKNEFNSLITSYIKTIPDYNLDFVG 512
           M+  L+++  +IKN+IK+Y  +   SEIG+VI+V DGI + SGL N +LNEL+ FEN   G+ LNLE  T G+ + G +  I+EGS  KRT NV+  PVGD +LGR+++A+G P+DG G IK ++   +EKIAPGVM R +V +PLETG L ID++FPIGKGQRELI+GD+QTGKT+IAID IINQ+GK+V C+YV +GQKNS++ Q ++ L+   +++YTT+V ++ASD  S+ YL PFTGITIAE W+ +G+DVLI++DDLSKHAIAYRTLSLLLRRPPGREA+PGD+FYLHSRLLER+ ++N+E+GGGSITALPIIET+AGDISAYIPTNVISITDGQLFM++NLFNSGQRPAI  GLSVSRVGS+AQI A+K+ +GSLKLELAQY ELD+FSQFGSDLD+ TK++LE GK+VM++IKQ    P+SQ+ EA+ LF+I + +I++IP+DYI  FK++I+  F ++  I + I   K  S+ L  Q    F +L+  ++  +PDY++   G
  S:     1 MADKLNEYVALIKNEIKKYSKQIFNSEIGKVISVADGIAKVSGLENALLNELIEFENNVQGIALNLEQNTVGVALFGDYSKIREGSTAKRTHNVMQTPVGDVMLGRIVNALGEPVDGRGPIKAEEFDQVEKIAPGVMTRKTVNQPLETGILTIDALFPIGKGQRELIVGDRQTGKTSIAIDTIINQRGKDVYCVYVAMGQKNSSVAQIVHQLEVTDSMKYTTVVCATASDPASMIYLTPFTGITIAEYWLKQGKDVLIVFDDLSKHAIAYRTLSLLLRRPPGREAFPGDVFYLHSRLLERACRLNEEHGGGSITALPIIETQAGDISAYIPTNVISITDGQLFMVSNLFNSGQRPAIHVGLSVSRVGSAAQIKAIKQQTGSLKLELAQYSELDSFSQFGSDLDENTKQILERGKRVMEMIKQPNGKPYSQTHEALFLFAIAKSFIKFIPLDYIAKFKQRIMEEFDKEHPIYKEIATQKSFSEALEAQTNTAFKALVKRFVSALPDYDITKYG 512
>gi|171920573|ref|ZP_02931837.1| ATP synthase F1, alpha subunit [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|185178864|ref|ZP_02964638.1| ATP synthase F1, alpha subunit [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188024257|ref|ZP_02996953.1| ATP synthase F1, alpha subunit [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188039638|ref|ZP_02998343.1| ATP synthase F1, alpha subunit [Ureaplasma urealyticum serovar 8] >gi|188518549|ref|ZP_03004010.1| ATP synthase F1, alpha subunit [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|188524099|ref|ZP_03004179.1| ATP synthase F1, alpha subunit [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|188530856|ref|ZP_03005149.1| ATP synthase F1, alpha subunit [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gi|188568718|ref|ZP_03005472.1| ATP synthase F1, alpha subunit [Ureaplasma urealyticum serovar 2] >gi|188592531|ref|ZP_03005856.1| ATP synthase F1, alpha subunit [Ureaplasma urealyticum serovar 10] >gi|195867747|ref|ZP_03079748.1| ATP synthase F1, alpha subunit [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|171903277|gb|EDT49566.1| ATP synthase F1, alpha subunit [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|184209500|gb|EDU06543.1| ATP synthase F1, alpha subunit [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188018920|gb|EDU56960.1| ATP synthase F1, alpha subunit [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188997893|gb|EDU66990.1| ATP synthase F1, alpha subunit [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|195659968|gb|EDX53348.1| ATP synthase F1, alpha subunit [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|195660602|gb|EDX53858.1| ATP synthase F1, alpha subunit [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (797 aa)
Score = 1633, Expect = 9.3e-180, Identities = 316/457 (69%), Positives = 381/457 (83%)
  Q:    12 IKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQK 468
           IK+QIK++  KAL  E+G VI++GDGIV   GL NVMLNE+V FENG  GM LNLE    G+V+LG + +IKEG  V RTK +V+VPVGD +LGRV+DA+G  +D  G I  +K   IEKIAPGVM R SV +PLETG L+ID+MFPIGKGQRELIIGD+QTGKTTIAIDAIINQKG+NV C+YV IGQKNSTI   +  L+  GA+EYTT+V ++AS+LP+L Y+APFTG+TIAEEWM +G+DVLI+YDDLSKHAIAYRTLSLLLRRPPGREAYPGD+FYLHSRLLER+ K+  E G GSITALPIIET+AGDISAYIPTNVISITDGQ+FM+T+LFN+GQRPAIDAG SVSRVGS+AQI +VK+T  SLKLELA YREL+AFSQFGSDLD ETK +L+ GK VM +IKQ+ N P++Q+ EAI+LF++KEK I  +PV+ I+DFKE ++ +FK  K
  S:    13 IKSQIKKFSEKALTLEVGNVISLGDGIVLVDGLDNVMLNEIVRFENGVEGMALNLEEDAVGVVLLGDYSNIKEGDRVYRTKKIVEVPVGDIMLGRVVDALGKAVDNKGNIVANKFSVIEKIAPGVMDRKSVHQPLETGILSIDAMFPIGKGQRELIIGDRQTGKTTIAIDAIINQKGRNVNCVYVAIGQKNSTIANVVRDLEAHGAMEYTTVVTANASELPALQYIAPFTGVTIAEEWMHQGKDVLIVYDDLSKHAIAYRTLSLLLRRPPGREAYPGDVFYLHSRLLERACKLKDELGAGSITALPIIETQAGDISAYIPTNVISITDGQIFMMTSLFNAGQRPAIDAGQSVSRVGSAAQIKSVKQTGASLKLELANYRELEAFSQFGSDLDDETKRILKLGKAVMAVIKQEPNKPYNQTDEAIILFTVKEKLIPQVPVERIQDFKEYLLNYFKGTK 469
>gi|186701980|ref|ZP_02554410.2| ATP synthase F1, alpha subunit [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|186700746|gb|EDU19028.1| ATP synthase F1, alpha subunit [Ureaplasma parvum serovar 6 str. ATCC 27818] (799 aa)
Score = 1630, Expect = 2.4e-179, Identities = 316/457 (69%), Positives = 380/457 (83%)
  Q:    12 IKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQK 468
           IK+QIK++  KAL  E+G VI++GDGIV   GL NVMLNE+V FENG  GM LNLE    G+V+LG + +IKEG  V RTK +V+VPVGD +LGRV+DA+G  +D  G I  +K   IEKIAPGVM R SV +PLETG L+ID+MFPIGKGQRELIIGD+QTGKTTIAIDAIINQKG+NV C+YV IGQKNSTI   +  L+  GA+EYTT+V ++AS+LP+L Y+APFTG+TIAEEWM +G+DVLI+YDDLSKHAIAYRTLSLLLRRPPGREAYPGD+FYLHSRLLER+ K+  E G GSITALPIIET+AGDISAYIPTNVISITDGQ+FM+T+LFN+GQRPAIDAG SVSRVGS+AQI +VK+T  SLKLELA YREL+AFSQFGSDLD ETK +L+ GK VM +IKQ  N P++Q+ EAI+LF++KEK I  +PV+ I+DFKE ++ +FK  K
  S:    13 IKSQIKKFSEKALTLEVGNVISLGDGIVLVDGLDNVMLNEIVRFENGVEGMALNLEEDAVGVVLLGDYSNIKEGDRVYRTKRIVEVPVGDVMLGRVVDALGKAVDNKGNIVANKFSVIEKIAPGVMDRKSVHQPLETGILSIDAMFPIGKGQRELIIGDRQTGKTTIAIDAIINQKGRNVNCVYVAIGQKNSTIANVVRELEAHGAMEYTTVVTANASELPALQYIAPFTGVTIAEEWMHQGKDVLIVYDDLSKHAIAYRTLSLLLRRPPGREAYPGDVFYLHSRLLERACKLKDELGAGSITALPIIETQAGDISAYIPTNVISITDGQIFMMTSLFNAGQRPAIDAGQSVSRVGSAAQIKSVKQTGASLKLELANYRELEAFSQFGSDLDDETKRILKLGKAVMAVIKQAPNKPYNQTDEAIILFTVKEKLIPQVPVERIQDFKEYLLNYFKGTK 469
>gi|13357689|ref|NP_077963.1| ATP synthase subunit A [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|170761987|ref|YP_001752215.1| ATP synthase F1, alpha subunit [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171920229|ref|ZP_02931602.1| ATP synthase F1, alpha subunit [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|183508767|ref|ZP_02689916.2| ATP synthase F1, alpha subunit homolog [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|190358202|sp|B1AIC1|ATPA_UREP2 ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|81624433|sp|Q9PR12|ATPA_UREPA ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|11356743|pir||C82929 ATP synthase alpha chain UU132 [imported] - Ureaplasma urealyticum >gi|6899091|gb|AAF30538.1|AE002114_5 ATP synthase alpha chain [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168827564|gb|ACA32826.1| ATP synthase F1, alpha subunit [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171902623|gb|EDT48912.1| ATP synthase F1, alpha subunit [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|182675704|gb|EDT87609.1| ATP synthase F1, alpha subunit homolog [Ureaplasma parvum serovar 14 str. ATCC 33697] (799 aa)
Score = 1629, Expect = 2.6e-179, Identities = 316/457 (69%), Positives = 380/457 (83%)
  Q:    12 IKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQK 468
           IK+QIK++  KAL  E+G VI++GDGIV   GL NVMLNE+V FENG  GM LNLE    G+V+LG + +IKEG  V RTK +V+VPVGD +LGRV+DA+G  +D  G I  +K   IEKIAPGVM R SV +PLETG L+ID+MFPIGKGQRELIIGD+QTGKTTIAIDAIINQKG+NV C+YV IGQKNSTI   +  L+  GA+EYTT+V ++AS+LP+L Y+APFTG+TIAEEWM +G+DVLI+YDDLSKHAIAYRTLSLLLRRPPGREAYPGD+FYLHSRLLER+ K+  E G GSITALPIIET+AGDISAYIPTNVISITDGQ+FM+T+LFN+GQRPAIDAG SVSRVGS+AQI +VK+T  SLKLELA YREL+AFSQFGSDLD ETK +L+ GK VM +IKQ  N P++Q+ EAI+LF++KEK I  +PV+ I+DFKE ++ +FK  K
  S:    13 IKSQIKKFSEKALTLEVGNVISLGDGIVLVDGLDNVMLNEIVRFENGVEGMALNLEEDAVGVVLLGDYSNIKEGDRVYRTKRIVEVPVGDVMLGRVVDALGKAVDNKGNIVANKFSVIEKIAPGVMDRKSVHQPLETGILSIDAMFPIGKGQRELIIGDRQTGKTTIAIDAIINQKGRNVNCVYVAIGQKNSTIANVVRELEAHGAMEYTTVVTANASELPALQYIAPFTGVTIAEEWMHQGKDVLIVYDDLSKHAIAYRTLSLLLRRPPGREAYPGDVFYLHSRLLERACKLKDELGAGSITALPIIETQAGDISAYIPTNVISITDGQIFMMTSLFNAGQRPAIDAGQSVSRVGSAAQIKSVKQTGASLKLELANYRELEAFSQFGSDLDDETKRILKLGKAVMAVIKQAPNKPYNQTDEAIILFTVKEKLIPQVPVERIQDFKEYLLNYFKGTK 469
>gi|110004064|emb|CAK98403.1| atp synthase alpha chain protein [Spiroplasma citri] (523 aa)
Score = 1609, Expect = 5.3e-177, Identities = 314/512 (61%), Positives = 394/512 (76%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHF--KQQKTILETIDQTKDISQDLFVQIKNEFNSLITSYIKTIPDYNLDFVG 512
           M++N+++ S IIK QIKEY  K    E G V+ VGDGI    GL N M++EL++F N  YGM LNLE    G V++G    ++EG  V+R+  +V+ PVGD LLGRV++A+G PIDG G +K  K  P+E+IAPGVM R SV EP+ETG + ID+M PIGKGQRELIIGD+QTGKT I ID I+NQKGKNVKCIYV IGQK ST+ Q +  L+  GALEYTT+V+++AS+L  L YLAP+TG+TI EEWM  GE+V+IIYDDLSKHA+AYRT++LLL RPPGREAYPGD+FYLHSRLLER+ ++ K  GGGSITALPIIET+AGDISAYIPTNVISITDGQ+F+  + FN+G RPA+DAGLSVSRVGS+AQI A+K+ +GSLKLELAQYREL AF+QFGSDLD  TKEVLEHGK+V++++KQ + +P SQ  +AI+L ++K+K IRWIPV  I++FKE+II HF  K QK   E + + K  S+ L   I NE  S++      I DY  +  G
  S:     1 MALNVNEISEIIKKQIKEYGKKIEIHEEGTVVTVGDGIALIDGLDNAMMSELLIFPNEIYGMVLNLEEGAVGAVLMGDDTTVREGDQVRRSGKIVETPVGDALLGRVVNALGQPIDGKGPLKAKKTRPVERIAPGVMTRKSVDEPMETGIMTIDAMIPIGKGQRELIIGDRQTGKTAIGIDTILNQKGKNVKCIYVAIGQKASTVAQIVEKLRAAGALEYTTVVSATASELAPLQYLAPYTGVTIGEEWMESGENVIIIYDDLSKHAVAYRTMALLLHRPPGREAYPGDVFYLHSRLLERAARVTKGYGGGSITALPIIETQAGDISAYIPTNVISITDGQIFLNNDQFNAGIRPAVDAGLSVSRVGSTAQIKAMKQVAGSLKLELAQYRELQAFAQFGSDLDDATKEVLEHGKRVIEILKQKQYSPLSQIDQAIILLAVKKKRIRWIPVGKIQEFKEEIIEHFNTKAQKYYTE-LAKVKAYSETLMTNIDNEIISVVKKITNKIADYKPEMFG 513
>gi|12045263|ref|NP_073074.1| F0F1 ATP synthase subunit alpha [Mycoplasma genitalium G37] >gi|1352027|sp|P47641|ATPA_MYCGE ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|3844993|gb|AAC71629.1| ATP synthase F1, alpha subunit [Mycoplasma genitalium G37] >gi|166078840|gb|ABY79458.1| ATP synthase F1, alpha subunit [synthetic Mycoplasma genitalium JCVI-1.0] (518 aa)
Score = 1604, Expect = 2.2e-176, Identities = 307/512 (59%), Positives = 399/512 (77%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKTILETIDQTKDISQDLFVQIKNEFNSLITSYIKTIPDYNLDFVG 512
           M+  L+++  +IK +IK+Y  K   SEIG+VI+V DGI + SGL N +LNEL+ FEN   G+ LNLE  T GI + G +  ++EGS  KRT +V+  PVGD +LGR+++A+G  IDG G+IK  +   IEKIAPGVM R SV +PLETG L ID++FPIGKGQRELI+GD+QTGKT IAID IINQK K+V C+YV IGQKNS++ Q ++ L+   +++YTT+V ++ASD  S+ YL+PFTGITIAE W+ KG+DVLI++DDLSKHA+AYRTLSLLL+RPPGREA+PGD+FYLHSRLLER+ K+N ENGGGSITALPIIET+AGDISAYIPTNVISITDGQLFM+++LFN+GQRPAI  GLSVSRVGS+AQ  A+K+ +GSLKLELAQY ELD+FSQFGSDLD+ TK+VLEHGK+VM++IKQ    P+SQ  EA+ LF+I + +I++IPVD I  FK++I   F     + + +   K+ ++DL  + K  F  L+  +I T+ DY++   G
  S:     1 MADKLNEYVALIKTEIKKYSKKIFNSEIGQVISVADGIAKVSGLENALLNELIQFENNIQGIVLNLEQNTVGIALFGDYSSLREGSTAKRTHSVMKTPVGDVMLGRIVNALGEAIDGRGDIKATEYDQIEKIAPGVMKRKSVNQPLETGILTIDALFPIGKGQRELIVGDRQTGKTAIAIDTIINQKDKDVYCVYVAIGQKNSSVAQIVHQLEVNDSMKYTTVVCATASDSDSMVYLSPFTGITIAEYWLKKGKDVLIVFDDLSKHAVAYRTLSLLLKRPPGREAFPGDVFYLHSRLLERACKLNDENGGGSITALPIIETQAGDISAYIPTNVISITDGQLFMVSSLFNAGQRPAIQIGLSVSRVGSAAQTKAIKQQTGSLKLELAQYSELDSFSQFGSDLDENTKKVLEHGKRVMEMIKQPNGKPYSQVHEALFLFAINKAFIKFIPVDEIAKFKQRITEEFNGSHPLFKELSNKKEFTEDLESKTKTAFKMLVKRFISTLTDYDITKFG 512
>gi|50364928|ref|YP_053353.1| F0F1 ATP synthase subunit alpha [Mesoplasma florum L1] >gi|81612931|sp|Q6F204|ATPA_MESFL ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|50363484|gb|AAT75469.1| ATP synthase alpha chain [Mesoplasma florum L1] (525 aa)
Score = 1544, Expect = 2.3e-169, Identities = 302/512 (58%), Positives = 388/512 (75%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHF---KQQKTILETIDQTKDISQDLFVQIKNEFNSLITSYIKTIPDYNLDFVG 512
           M++N+ + S +I+ QIK Y    + +E G V+ +GDG+    GL   ++ EL++F N  YGM L+LE    G V+LG ++ IKEG IVKRT  VV+ PVGD ++GRV++A+G PID NG IK  K  P+E+IA GVMAR SV +PLETG L ID+  PIGKGQRELIIGD+QTGKT +AID IINQKGKNVKCIYV IGQK+STI Q +  LK+FGA+EYTT+V + ASD   L YLAP+TG+TI EEWM  GEDVLI+YDDLSKHA+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ ++N++ GGGSITALPIIET+A DISAYIPTNVISITDGQ+F+ ++LF +G RPAI+ G SVSRVGSSAQI AVK+ SG+LKLELAQY EL+AFS+FGSDLD+ TK  L+HG ++++++ Q + +P +Q  EAI+LF+IK   I+WIP++ I DFK +II  F   K  K +   + +  + + DL   I+ E   L+  +  T+ +YN    G
  S:     1 MALNIKEISEVIEKQIKNYGKDIIEAEQGSVVTIGDGVSLIYGLDKALMGELLIFPNDVYGMVLSLEEGAVGAVILGDYKLIKEGDIVKRTGKVVETPVGDAMIGRVVNALGQPIDNNGPIKTKKSKPVERIATGVMARKSVSQPLETGILGIDASIPIGKGQRELIIGDRQTGKTAVAIDTIINQKGKNVKCIYVSIGQKDSTIAQVVEKLKKFGAMEYTTVVNAGASDSAPLQYLAPYTGVTIGEEWMENGEDVLIVYDDLSKHAVAYREMSLLLRRPPGREAYPGDVFYLHSRLLERAARVNEKFGGGSITALPIIETQASDISAYIPTNVISITDGQIFLSSDLFMAGIRPAINIGPSVSRVGSSAQIKAVKQVSGTLKLELAQYYELEAFSKFGSDLDESTKATLDHGARIIQMLVQRQYSPLNQIDEAIILFAIKSHLIKWIPLENIRDFKTEIITFFNNEKDAKALKAELTKKLEWNADLESGIQKEIEKLVVKFTSTLKNYNPTIFG 515
>gi|193216470|ref|YP_001999712.1| ATP synthase alpha subunit [Mycoplasma arthritidis 158L3-1] >gi|193001793|gb|ACF07008.1| ATP synthase alpha subunit [Mycoplasma arthritidis 158L3-1] (527 aa)
Score = 1537, Expect = 1.2e-168, Identities = 302/507 (59%), Positives = 381/507 (75%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKTILETIDQ---TKDISQDLFVQIKNEFNSLITSYIKTIPDYN 507
           M+I     S IIK QIK++     + E+GRVI VGDGI   SGL+NV   ELV FE+G  GMT+NLE    GIV++G    I EG++VKR + V+  PVGD LLGRV++A+  PIDG G+I      PI K+APGVMAR  V EPLETG LAID+M PIGKGQRELIIGD+QTGKT IAID I+NQKGK+V CIY+ IGQKNSTI Q ++ L +  AL+YTTI+++SA++   L Y+AP+TG+TIAEEWM+KG+DVL+IYDDLSKHA+AYRTLSLLLRRPPGREAYPGD+FYLHS+LLER+ ++NKENGGGSITALPIIET+A DISAYIPTNVISITDGQ+F   +LFNSGQRPAID G SVSRVGS+AQ   +KK   SLKLELAQY E+ AF+QFGSDLD+ T+ +LEHG KV +L+KQ + +P+ Q  + ++LF  K + I  IP  YI  ++++++ +F      L+ I Q     D +++L   +     +   S+I TIP+ N
  S:     1 MAIKATDLSAIIKAQIKDFNQNVTFDEVGRVITVGDGIALVSGLNNVEYGELVQFESGVLGMTMNLEEDLVGIVVMGDDRSIVEGNLVKRMRQVISTPVGDELLGRVVNALAKPIDGKGKINTSYHAPIFKVAPGVMARQEVNEPLETGILAIDAMIPIGKGQRELIIGDRQTGKTAIAIDTILNQKGKHVYCIYIAIGQKNSTISQIVDILNKHDALKYTTIISASAAESAPLQYIAPYTGVTIAEEWMAKGKDVLVIYDDLSKHAVAYRTLSLLLRRPPGREAYPGDVFYLHSQLLERAARLNKENGGGSITALPIIETQAEDISAYIPTNVISITDGQIFTKESLFNSGQRPAIDIGYSVSRVGSAAQTKLMKKVVSSLKLELAQYNEMLAFAQFGSDLDQNTRNILEHGAKVYELLKQPQYSPYEQIKQILILFCSKYRLINPIPKAYITKYRDELLNYFLTNSKTLQVISQLTKASDWTEELIESVWEHIMAFNESFIPTIPNLN 510
>gi|83319474|ref|YP_424077.1| F0F1 ATP synthase subunit alpha [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|115312252|sp|Q2ST36|ATPA_MYCCT ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|83283360|gb|ABC01292.1| ATP synthase F1, alpha subunit [Mycoplasma capricolum subsp. capricolum ATCC 27343] (525 aa)
Score = 1515, Expect = 5.1e-166, Identities = 296/512 (57%), Positives = 381/512 (74%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK---QQKTILETIDQTKDISQDLFVQIKNEFNSLITSYIKTIPDYNLDFVG 512
           MS N+ + S +I+ QI+ Y  + + +E G V++VGDGI    GL N ++ EL+LF N  YGM LNLE    G V+LG    I+EG IVKRT  VV+ PVGD LLGRVIDA+G PID  G I + K  P+E++A  VMAR SV +PLETG LAIDS  PIGKGQRELIIGD+QTGKT IAIDAIINQK +NVKCIYV IGQK+STIVQ +   K++GA++YT +V + AS   SL YL+P+TGITIAEEWM  G DVLI+YDDL+KHA++YR +SLLLRRPPGREAYPGD+FYLHSRLLER+ ++N+  GGGSITALPIIET+AGDISAYIPTNVISITDGQ+F+ + LFN G RPA+D G SVSRVGS+AQI ++K+ SG+LKLELAQY EL++F++FGSDLD+ TK  L+ G K+++++ Q +  P  Q  +AILL +IK   ++W+P+D I +FK +I+ HFK   Q   + + +D+ K     L  +I  +   ++    K I +Y  +  G
  S:     1 MSFNIKEISEMIEKQIRNYNKEVVQTEQGTVVSVGDGIALIYGLDNAIMGELLLFSNNVYGMVLNLEEGAVGSVILGDETLIREGDIVKRTNKVVETPVGDALLGRVIDALGQPIDNLGPIDFTKTRPVERVATSVMARKSVSQPLETGILAIDSAIPIGKGQRELIIGDRQTGKTAIAIDAIINQKNRNVKCIYVAIGQKDSTIVQVVEKFKKYGAMDYTVVVNAGASQPASLQYLSPYTGITIAEEWMESGNDVLIVYDDLTKHAVSYREMSLLLRRPPGREAYPGDVFYLHSRLLERAARVNENYGGGSITALPIIETQAGDISAYIPTNVISITDGQIFLSSELFNQGVRPAVDIGPSVSRVGSAAQIKSIKQVSGTLKLELAQYYELESFAKFGSDLDETTKATLDQGAKIIQMLIQKQFNPLEQVDQAILLLTIKSHLLKWLPLDSIYNFKHEILSHFKNDQQAAKLRKKLDEQKTFDDQLQKEILKQAQKVVLKITKNIKEYKPEAFG 515
>gi|188159055|ref|ZP_02998494.1| F0F1 ATP synthase subunit alpha [Mycoplasma mycoides subsp. mycoides LC str. GM12] (525 aa)
Score = 1514, Expect = 6.2e-166, Identities = 299/512 (58%), Positives = 378/512 (73%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKTILE---TIDQTKDISQDLFVQIKNEFNSLITSYIKTIPDYNLDFVG 512
           MS N+ + S +I+ QI+ Y  + + +E G V++VGDGI    GL N ++ E + F N  YGM LNLE +  G V+LG    I+EG IVKRT  VV+ PVGD LLGRVI+A+  PID  G I + K  PIE++A  VMAR SV +PLETG LAIDS  PIGKGQRELIIGD+QTGKT IAIDAIINQ+ KNVKCIYV IGQK+STIVQ +  LK++GA+EYT +V + AS    L YL+P+ GITIAEEWM  G DVLI+YDDLSKHA++YR +SLLLRRPPGREAYPGD+FYLHSRLLER+ ++N+  GGGSITALPIIET+AGDISAYIPTNVISITDGQ+F+ + LFN G RPA+D G SVSRVGSSAQI ++K+ SG+LKLELAQY EL++F++FGSDLD+ TK  L+ G K+++++ Q ++ P  Q  +AILL +IK   I+W+PV+ I +FK +I+ HFK  K   E    +D+ K     L  QI  E   ++    K I +Y  +  G
  S:     1 MSFNIKEISEMIEKQIRNYNKEIVQTEQGTVVSVGDGIALIYGLDNAIMGEFLKFPNNVYGMVLNLEESAVGAVILGDETLIREGDIVKRTNKVVETPVGDALLGRVINALSKPIDNLGPINFTKTKPIERVATSVMARKSVSQPLETGILAIDSAIPIGKGQRELIIGDRQTGKTAIAIDAIINQRNKNVKCIYVAIGQKDSTIVQVVEKLKKYGAMEYTVVVNAGASQPAPLQYLSPYVGITIAEEWMENGSDVLIVYDDLSKHAVSYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAARVNENYGGGSITALPIIETQAGDISAYIPTNVISITDGQIFLSSELFNQGIRPAVDIGPSVSRVGSSAQIKSIKQVSGTLKLELAQYYELESFAKFGSDLDESTKATLDQGAKIIQMLIQKQHNPLEQVDQAILLLTIKSHLIKWLPVESIYNFKHEILSHFKNDKNAFELRKKLDEQKTFDDQLQQQILKEAQKVVLKITKNINEYKPETFG 515
>gi|42561405|ref|NP_975856.1| F0F1 ATP synthase subunit alpha [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|81697961|sp|Q6MS92|ATPA_MYCMS ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|42492903|emb|CAE77498.1| ATP SYNTHASE ALPHA CHAIN [Mycoplasma mycoides subsp. mycoides SC str. PG1] (525 aa)
Score = 1509, Expect = 2.1e-165, Identities = 297/506 (58%), Positives = 375/506 (74%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKTILE---TIDQTKDISQDLFVQIKNEFNSLITSYIKTIPDY 506
           MS N+ + S +I+ QI+ Y  + + +E G V++VGDGI    GL N ++ E + F N  YGM LNLE +  G ++LG    I+EG IVKRT  VV+ PVGD LLGRVI+A+  PID  G I + K  PIE++A  VMAR SV +PLETG LAIDS  PIGKGQRELIIGD+QTGKT IAIDAIINQK KNVKCIYV IGQK+STIVQ +  LK++GA+EYT +V + AS    L YL+P+ G+TIAEEWM  G DVLIIYDDLSKHA++YR +SLLLRRPPGREAYPGD+FYLHSRLLER+ ++N+  GGGSITALPIIET+AGDISAYIPTNVISITDGQ+F+ + LFN G RPA+D G SVSRVGS+AQI ++K+ SG+LKLELAQY EL+ F++FGSDLD+ TK  L+ G K+++++ Q ++ P  Q  +AILL +IK   I+W+PV+ I +FK +I+ HFK  K   E    +D+ K     L  QI  E   ++    K I +Y
  S:     1 MSFNIKEISEMIEEQIRNYNKEIVQTEQGTVVSVGDGIALIYGLDNAIMGEFLKFPNNVYGMVLNLEESAVGAIILGDETLIREGDIVKRTNKVVETPVGDALLGRVINALSKPIDNLGPINFTKTRPIERVATSVMARRSVSQPLETGILAIDSAIPIGKGQRELIIGDRQTGKTAIAIDAIINQKNKNVKCIYVAIGQKDSTIVQVVEKLKKYGAMEYTVVVNAGASQPAPLQYLSPYVGVTIAEEWMENGNDVLIIYDDLSKHAVSYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAARVNENYGGGSITALPIIETQAGDISAYIPTNVISITDGQIFLSSELFNQGVRPAVDIGSSVSRVGSAAQIKSIKQVSGTLKLELAQYYELELFAKFGSDLDEATKATLDQGAKIIQMLIQKQHNPLEQVDQAILLLTIKSHLIKWLPVESIYNFKHEILSHFKNDKHAFELRKKLDEQKTFDDQLQQQILKEAQKVVLKITKNINEY 509
>gi|169351553|ref|ZP_02868491.1| hypothetical protein CLOSPI_02333 [Clostridium spiroforme DSM 1552] >gi|169291775|gb|EDS73908.1| hypothetical protein CLOSPI_02333 [Clostridium spiroforme DSM 1552] (510 aa)
Score = 1487, Expect = 7.4e-163, Identities = 284/497 (57%), Positives = 379/497 (76%)
  Q:     6 DKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQ-QKTILETIDQTKDISQDLFVQIKNEFNSLITSYIKT 502
           D+ S++IK QIK +       ++G V+ VGDG+    GL + ML EL+ F N  YGM +NL+  + G V+LG    IKEG  VKRT  +++VPVGD +LGRV++ +G  IDGNGEI      PIE++A GVM R SV +PL+TG  +ID++ PIG+GQRELIIGD+QTGKT IAID I+NQKG+N+ CIYV IGQKNST+ Q +  L+Q GA+EYTT+V +SAS+L  + Y+AP+ G  IAEEW+ +G+DVLI+YDDLSKHA+AYRT+SLLL+RPPGREAYPGD+FYLHSRLLER+ ++N+ENGGGSITALPIIET+AGDISAYIPTNVISITDGQ+F+   LFN+G RPAID GLSVSRVGSSAQI A+K+ SGSLKLELAQY E+ AF+QFGSDLD  TK  L+HG KV +++KQ + +P S + + I LF++K  + + + V+ + +F  +++ H +  QK I++ I+  K+I+ DL  ++K+   + ++ + KT
  S:     9 DEISSLIKEQIKHFDEVIEQKDVGTVMTVGDGVSVIHGLDDAMLGELLAFPNDVYGMVMNLDEDSVGAVLLGSESTIKEGDEVKRTGKIMEVPVGDEMLGRVVNPLGQAIDGNGEIITSHTRPIERVASGVMTRKSVDQPLQTGITSIDAIIPIGRGQRELIIGDRQTGKTAIAIDTILNQKGQNIYCIYVAIGQKNSTVAQIVEKLRQGGAMEYTTVVCASASELAPVQYIAPYAGCAIAEEWLEQGKDVLIVYDDLSKHAVAYRTVSLLLKRPPGREAYPGDVFYLHSRLLERACRLNEENGGGSITALPIIETQAGDISAYIPTNVISITDGQIFLQQELFNAGFRPAIDTGLSVSRVGSSAQIKAMKQVSGSLKLELAQYAEMQAFAQFGSDLDAATKATLDHGAKVREVLKQAQYSPRSVATQVITLFALKYGFTKTLAVEQVSNFMNQLVEHIEMTQKNIIDEINDKKEITSDLEKEMKDVIGAFVSQFEKT 506
>gi|71894422|ref|YP_278530.1| F0F1 ATP synthase subunit alpha [Mycoplasma synoviae 53] >gi|115312255|sp|Q4A602|ATPA_MYCS5 ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|71851210|gb|AAZ43819.1| ATP synthase alpha chain [Mycoplasma synoviae 53] (530 aa)
Score = 1484, Expect = 2.0e-162, Identities = 290/507 (57%), Positives = 381/507 (75%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQ---KTILETIDQTKDISQDLFVQIKNEFNSLITSYIKTIPDYN 507
           M  N D  S IIK++IK +  K   SE+G+VI++GDGI   SGL  V  +E+V+F+N  YG+ LNLE    G+ + G    I EG  V+R+  V+ VPVG+ +L RV+D++G PIDG G IK  K   I K+APGVM R  V +PLETG +AIDSM P+GKGQRELIIGD+QTGKT IAID IINQKGKNV C+YV IGQKNST+ Q +  L   G+++YTT+V + AS+     Y+AP+TG+TIAEE+MS+G+DVL+IYDDLSKHAIAYRTLSLLLRRPPGREAYPGD+FYLHS+LLER+ ++NK+ GGGSITA PIIET+ GDISAYIPTNVISITDGQ+F   +LFNSGQRPA+D G SVSRVGS+AQ  A+K   GSLKLELAQY E+ AF+QFGSDLD+ TK +LEHG KV +LIKQD+ +P SQ+ +A++L  +KE+ I  +P ++I +++ ++I++ ++    K I   I     IS++ + +++     +  S + +IP+Y+
  S:     1 MKNNFDDISAIIKDRIKNFDQKIDRSEVGKVISIGDGIALVSGLDKVENSEVVIFDNDVYGLALNLEEEAVGVALFGNSNLISEGDSVRRSGQVISVPVGEAMLSRVVDSLGKPIDGKGPIKSSKMAKIFKLAPGVMTRKEVNQPLETGIIAIDSMIPVGKGQRELIIGDRQTGKTAIAIDTIINQKGKNVYCVYVAIGQKNSTVAQIVQKLNDTGSMDYTTVVVAGASESAPQQYIAPYTGVTIAEEFMSQGKDVLVIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDVFYLHSQLLERAARLNKKYGGGSITAFPIIETQQGDISAYIPTNVISITDGQIFTKESLFNSGQRPAVDVGFSVSRVGSAAQTKAMKSVVGSLKLELAQYNEMLAFAQFGSDLDENTKAILEHGAKVYELIKQDQYSPISQADQAVILIGVKERIINIVPKEWISEYRNQVIKYLQKDPDGKVIESNIINEGIISKENYAKLEQALVKICKSIVSSIPNYD 510
>gi|160914780|ref|ZP_02076994.1| hypothetical protein EUBDOL_00787 [Eubacterium dolichum DSM 3991] >gi|158433320|gb|EDP11609.1| hypothetical protein EUBDOL_00787 [Eubacterium dolichum DSM 3991] (518 aa)
Score = 1472, Expect = 4.8e-161, Identities = 283/499 (56%), Positives = 371/499 (74%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHF-KQQKTILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           +S+  ++ S ++K QI+ Y ++    E G VI +GDGI    GL N M  EL+LF +  YGM LNLE    G V++G    IKEG  VKRT  +V+VPVGD +LGRV++A+G  IDG   I  DK  P+E++APGVM R SV +PL TG   IDSM PIG+GQRELIIGD+QTGKT IAID IINQK KNVKCIYV IGQK ST+ Q +  L+  GA+EYTTIV+S+ASD   L Y+AP+ G  I EEWM  G+DVLI+YDDLSKHA+AYRT+SLLL+RPPGREAYPGD+FYLHSRLLER+ K+N E GGGS+TALPIIET+AGDI+AYIPTNVISITDGQ+F+ T LFNSG RPA+D+GLSVSRVGS+AQI A+K+ SGSLKLELAQYRE+ AF++FGSDLD  T E L HG+++ +L+ Q++  P S S + + LF+ K KY++ + V+ +  ++++++++  ++   I+  ID+ + + + L   IK   ++    +
  S:    13 VSLKPEEISKLLKEQIRRYDDEMEVDETGTVITIGDGIALVYGLRNAMAGELLLFPHDVYGMVLNLEEEHVGAVLMGNDTGIKEGDEVKRTGKIVEVPVGDMMLGRVVNALGQAIDGGEAIVSDKFRPVERVAPGVMTRKSVHQPLMTGLKVIDSMIPIGRGQRELIIGDRQTGKTAIAIDTIINQKDKNVKCIYVAIGQKASTVAQIVEKLRSHGAMEYTTIVSSTASDAAPLQYIAPYAGCAIGEEWMENGDDVLIVYDDLSKHAVAYRTMSLLLKRPPGREAYPGDVFYLHSRLLERAAKLNDELGGGSLTALPIIETQAGDIAAYIPTNVISITDGQIFLQTELFNSGVRPAVDSGLSVSRVGSAAQIKAMKQVSGSLKLELAQYREMQAFAKFGSDLDAATSETLAHGERLTRLLIQNQYDPMSASHQVLSLFAAKNKYLKNVKVEDVALYEKEMLKYMEREHHEIIAQIDEKQALDEALSESIKQALDAFAKEF 512
>gi|167755040|ref|ZP_02427167.1| hypothetical protein CLORAM_00544 [Clostridium ramosum DSM 1402] >gi|167705090|gb|EDS19669.1| hypothetical protein CLORAM_00544 [Clostridium ramosum DSM 1402] (510 aa)
Score = 1472, Expect = 5.1e-161, Identities = 280/497 (56%), Positives = 378/497 (76%)
  Q:     6 DKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQ-QKTILETIDQTKDISQDLFVQIKNEFNSLITSYIKT 502
           D+ S +IK QIK + +     ++G V+ VGDG+    GL N ML EL+ F N  YGM +NL+    G V+LG    IKEG  VKRT  ++++PVGD +LGRV++ +G  IDGNGEI      PIE++A GVM R SV +PL+TG  +ID++ PIG+GQRELIIGD+QTGKT IAID I+NQK +++ C+YV IGQKNST+ Q +  L++ GA+EYTT+V++SAS+L  + Y+AP+ G  IAEEW+ +G+DVLI+YDDLSKHA+AYRT+SLLL+RPPGREAYPGD+FYLHSRLLER+ ++N+ENGGGSITALPIIET+AGDISAYIPTNVISITDGQ+F+   LFN+G RPAID GLSVSRVGS+AQI A+K+ SGSLKLELAQY E+ AF+QFGSDLD  TK  L+HG KV +++KQ + +P + S + I LF++K  + + + V+ +  F ++++ H    Q+ I++ I++ K IS DL  ++K+  ++ +T + KT
  S:     9 DEISALIKEQIKHFDDVIELKDVGTVMTVGDGVSLIHGLDNAMLGELLAFPNDVYGMVMNLDEDCVGAVLLGSESTIKEGDEVKRTGKIMEIPVGDEMLGRVVNPLGQAIDGNGEIITAHTRPIERVASGVMTRKSVDQPLQTGITSIDAIIPIGRGQRELIIGDRQTGKTAIAIDTILNQKDQDIYCVYVAIGQKNSTVAQIVEKLRKGGAMEYTTVVSASASELAPVQYIAPYAGCAIAEEWLDQGKDVLIVYDDLSKHAVAYRTVSLLLKRPPGREAYPGDVFYLHSRLLERACRLNEENGGGSITALPIIETQAGDISAYIPTNVISITDGQIFLQQELFNAGFRPAIDTGLSVSRVGSAAQIKAMKQVSGSLKLELAQYAEMQAFAQFGSDLDAATKATLDHGAKVREVLKQAQYSPRTVSTQVITLFALKYGFTKTLEVEQVSAFMDQLVEHINMTQRDIIDEINEQKAISADLEKRMKDVMSAFVTQFEKT 506
>gi|15828739|ref|NP_326099.1| F0F1 ATP synthase subunit alpha [Mycoplasma pulmonis UAB CTIP] >gi|81620611|sp|Q98QU3|ATPA1_MYCPU ATP synthase subunit alpha 1 (ATPase subunit alpha 1) (ATP synthase F1 sector subunit alpha 1) >gi|14089681|emb|CAC13441.1| ATP SYNTHASE ALPHA CHAIN [Mycoplasma pulmonis] (528 aa)
Score = 1470, Expect = 7.7e-161, Identities = 303/507 (59%), Positives = 379/507 (74%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKTILE---TIDQTKDISQDLFVQIKNEFNSLITSYIKTIPDYN 507
           M++     S+IIK +I+ Y+ + +  E+G+VI++GDGI   SGL NV   EL++F    YG+TLNLE    G+ +LG    +KEG   KRT  V+ + VG  +LGRVI+A+G PIDG GEI  +    I ++APGVMAR SV E L TG LAIDSM PIGKGQRELIIGD+QTGKT IAIDAIINQKGKNVKCIYV IGQKNST+ Q +  L+  GA+EYT++V++SAS+L  + YLAP+TG+TIAEE+M  G+DVLI+YDDLSKHA+AYRTLSLLLRRPPGREAYPGD+FYLHS+LLER+ K+NKENGGGSITALPIIET+ GDISAYI TNVISITDGQ+F   +LFNSGQRPAID G SVSRVGSSAQI+A+K+ + SLKL+LAQY E+ AFSQFGSDLD  TK +LE+G K+ +++KQD+ +P  Q  + IL  +IK+  I  IP++YI  FK+ II  F +    L     I   K +S  L  +I       I +  K+I +YN
  S:     1 MALKNKDISSIIKERIRNYKIEKINDEVGKVISIGDGIALVSGLKNVKNGELIIFNESVYGLTLNLEIDYIGVAILGNDTLLKEGDEAKRTFEVISIKVGPEILGRVINALGEPIDGKGEIDSEIHRQIFRVAPGVMARESVNEALSTGILAIDSMIPIGKGQRELIIGDRQTGKTAIAIDAIINQKGKNVKCIYVAIGQKNSTVAQIVRKLENHGAMEYTSVVSASASELSPMQYLAPYTGVTIAEEFMETGQDVLIVYDDLSKHAVAYRTLSLLLRRPPGREAYPGDVFYLHSQLLERAAKVNKENGGGSITALPIIETQQGDISAYIATNVISITDGQIFTKESLFNSGQRPAIDVGFSVSRVGSSAQISAMKEVTSSLKLQLAQYNEMLAFSQFGSDLDDSTKAILENGSKIYEILKQDQYSPIDQYTQVILFLAIKQNLINPIPLEYISKFKKAIIHKFNKDAKALNLKTLIRNDKKLSTKLRNEITKIIIEEIKNITKSIANYN 510
>gi|157151415|ref|YP_001450823.1| F0F1 ATP synthase subunit alpha [Streptococcus gordonii str. Challis substr. CH1] >gi|189081324|sp|A8AYG3|ATPA_STRGC ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|157076209|gb|ABV10892.1| ATP synthase F1, alpha subunit [Streptococcus gordonii str. Challis substr. CH1] (501 aa)
Score = 1445, Expect = 5.9e-158, Identities = 278/483 (57%), Positives = 365/483 (75%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK-QQKTILETIDQTKDISQD 483
           M+IN  + S +IK QI+ +Q     +E G V  VGDGI +A GL N M  EL++FENGSYGM  NLE+   GI++LG F DI+EG  ++RT  +++VPVG+ L+GRV+D +G P+DG GEI  DK  P+E  APGVM R SV EPL+TG  AID++ PIG+GQRELIIGD+QTGKTTIAIDAI+NQKG+++ CIYV IGQK ST+   + TL+Q+GAL+YT +V +SAS    L YLAP+ G+ +AEE+M  G+ VLI+YDDLSK A+AYR LSLLLRRPPGREA+PGD+FYLHSRLLERS K++ E GGGSITALP IET+AGDISAYI TNVISITDGQ+F+   LFN G RPAIDAG SVSRVG SAQI A+KK +G+L+++LA YREL+AF++FGSDLD  T+  L  G++ ++++KQ  + P     + ++L+++   ++  +PVD I  F+E++  +F   Q+ I ETI  TKD+  +
  S:     1 MAINAQEISALIKQQIENFQPDFDVTETGVVTYVGDGIARAHGLDNAMSGELLVFENGSYGMAQNLESNDVGIIILGDFTDIREGDTIRRTGKIMEVPVGEALIGRVVDPLGRPVDGLGEIATDKTRPVETPAPGVMQRKSVSEPLQTGLKAIDALVPIGRGQRELIIGDRQTGKTTIAIDAILNQKGQDMICIYVAIGQKESTVRTQVETLRQYGALDYTIVVTASASQPSPLLYLAPYAGVAMAEEFMYNGKHVLIVYDDLSKQAVAYRELSLLLRRPPGREAFPGDVFYLHSRLLERSAKVSDELGGGSITALPFIETQAGDISAYIATNVISITDGQIFLSDGLFNGGVRPAIDAGSSVSRVGGSAQIKAMKKVAGTLRIDLASYRELEAFTKFGSDLDAATQAKLNRGRRTVEVLKQPVHKPLPVEKQVVILYALTHGFLDSVPVDDILRFEEELFAYFDAHQEGIYETIRTTKDLPSE 484
>gi|77964179|gb|ABB13424.1| ATP synthase subunit alpha [Clostridium paradoxum] (504 aa)
Score = 1439, Expect = 2.8e-157, Identities = 282/500 (56%), Positives = 378/500 (75%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIR-----HFKQQKTILETIDQTKDISQDLFVQIKNEFNSLITSYI 500
           M++  ++ S+IIK QIK Y++K    ++G VI VGDGI +  GL   M  EL+ F    YGM LNLE    G V+LG  E+IKEG  VKRT  +V+VPVGD LLGRV++A+G PIDG G IK DK  PIE  APG++ R SV EPL+TG  AIDSM PIG+GQRELIIGD+QTGKT+IAID IINQKGK+V CIYV IGQK ST+ Q ++ L+++GA++YT +V+++AS+L  L Y+AP++G  + EE+M +G+ VLIIYDDLSKHA+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K++ + GGGS+TALPIIET+AGD+SAYIPTNVISITDGQ+F+ + LF SG RPA++ G+SVSRVG +AQI A+KK +G+LKL  AQYREL AF+QFGSDLDK+T+E L  G+++++++KQ +  P     + ++++++   Y++ IPV+ I+ F+++  +     H +  K ILET D TK+  + L    KN      T ++
  S:     1 MNLRPEEISSIIKEQIKRYESKIELKDVGTVIQVGDGIARIHGLEKCMAGELLEFPGEIYGMALNLEEDFVGAVLLGSDENIKEGDTVKRTGRIVEVPVGDALLGRVVNALGQPIDGKGPIKADKFRPIETQAPGIIERKSVHEPLQTGIKAIDSMIPIGRGQRELIIGDRQTGKTSIAIDTIINQKGKDVICIYVAIGQKRSTVAQIVDRLEKYGAMDYTIVVSATASELAPLQYMAPYSGCAMGEEFMHQGKHVLIIYDDLSKHAVAYRAMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSDDLGGGSLTALPIIETQAGDVSAYIPTNVISITDGQIFLESELFYSGVRPAVNPGISVSRVGGNAQIKAMKKVAGTLKLGYAQYRELQAFAQFGSDLDKDTRERLAQGERIVEVLKQAETKPVDVEKQVMIIYAVTNGYLKDIPVEQIKRFEDEFFKFMDDIHPQIGKNILETKDLTKENEEAL----KNAIEEFKTKFV 501
>gi|4100655|gb|AAD00916.1| proton-translocating ATPase alpha subunit [Streptococcus sanguinis] (501 aa)
Score = 1438, Expect = 3.9e-157, Identities = 275/483 (56%), Positives = 368/483 (76%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK-QQKTILETIDQTKDISQD 483
           M+IN  + S +IK QI+ +Q     +E G V  +GDGI +A GL N M  EL++FENGSYGM  NLE+T  GI++LG F DI+EG  ++RT  +++VPVG+ L+GRV+D +G P+DG G+I  DK  P+E  APGVM R SV EPL+TG  AID++ PIG+GQRELIIGD+QTGKTTIAIDAI+NQKG+++ CIYV IGQK ST+   + TL+Q+GAL+YT +V +SAS    L +LAP+ G+ +AEE+M  G+ VLI+YDDLSK A+AYR LSLLLRRPPGREA+PGD+FYLHSRLLERS K++ E GGGSITALP IET+AGDISAYI TNVISITDGQ+F+  +LFN+G RPAIDAG SVSRVG SAQI A+KK +G+L+++LA YREL+AF++FGSDLD  T+  L  G++ ++++KQ  + P     + ++L+++   ++  +PVD I  F+ ++  +F   Q++I ETI  TKD+  +
  S:     1 MAINAQEISALIKQQIENFQPNFDVTETGVVTYIGDGIARAHGLDNAMSGELLIFENGSYGMAQNLESTDVGIIILGDFTDIREGDTIRRTGKIMEVPVGEALIGRVVDPLGRPVDGLGDIVTDKTRPVETPAPGVMQRKSVSEPLQTGLKAIDALVPIGRGQRELIIGDRQTGKTTIAIDAILNQKGQDMICIYVAIGQKESTVRTQVETLRQYGALDYTIVVTASASQPSPLLFLAPYAGVAMAEEFMYNGKHVLIVYDDLSKQAVAYRELSLLLRRPPGREAFPGDVFYLHSRLLERSAKVSDELGGGSITALPFIETQAGDISAYIATNVISITDGQIFLSDSLFNAGVRPAIDAGSSVSRVGGSAQIKAMKKVAGTLRIDLASYRELEAFTKFGSDLDAATQAKLNRGRRTVEVLKQPIHEPLPVEKQVVILYALTHGFLDSVPVDDILRFESELFAYFDAHQESIYETIRTTKDLPSE 484
>gi|148992606|ref|ZP_01822274.1| F0F1 ATP synthase subunit alpha [Streptococcus pneumoniae SP9-BS68] >gi|148997430|ref|ZP_01825035.1| F0F1 ATP synthase subunit alpha [Streptococcus pneumoniae SP11-BS70] >gi|149011744|ref|ZP_01832940.1| F0F1 ATP synthase subunit alpha [Streptococcus pneumoniae SP19-BS75] >gi|149021776|ref|ZP_01835783.1| F0F1 ATP synthase subunit alpha [Streptococcus pneumoniae SP23-BS72] >gi|168487557|ref|ZP_02712065.1| ATP synthase F1, alpha subunit [Streptococcus pneumoniae CDC1087-00] >gi|168489670|ref|ZP_02713869.1| ATP synthase F1, alpha subunit [Streptococcus pneumoniae SP195] >gi|168493411|ref|ZP_02717554.1| ATP synthase F1, alpha subunit [Streptococcus pneumoniae CDC3059-06] >gi|168575965|ref|ZP_02721880.1| ATP synthase F1, alpha subunit [Streptococcus pneumoniae MLV-016] >gi|182684464|ref|YP_001836211.1| ATP synthase subunit A [Streptococcus pneumoniae CGSP14] >gi|147756485|gb|EDK63526.1| F0F1 ATP synthase subunit alpha [Streptococcus pneumoniae SP11-BS70] >gi|147764175|gb|EDK71107.1| F0F1 ATP synthase subunit alpha [Streptococcus pneumoniae SP19-BS75] >gi|147928623|gb|EDK79637.1| F0F1 ATP synthase subunit alpha [Streptococcus pneumoniae SP9-BS68] >gi|147930012|gb|EDK80999.1| F0F1 ATP synthase subunit alpha [Streptococcus pneumoniae SP23-BS72] >gi|182629798|gb|ACB90746.1| ATP synthase subunit A [Streptococcus pneumoniae CGSP14] >gi|183569629|gb|EDT90157.1| ATP synthase F1, alpha subunit [Streptococcus pneumoniae CDC1087-00] >gi|183571966|gb|EDT92494.1| ATP synthase F1, alpha subunit [Streptococcus pneumoniae SP195] >gi|183576573|gb|EDT97101.1| ATP synthase F1, alpha subunit [Streptococcus pneumoniae CDC3059-06] >gi|183578224|gb|EDT98752.1| ATP synthase F1, alpha subunit [Streptococcus pneumoniae MLV-016] (501 aa)
Score = 1433, Expect = 1.6e-156, Identities = 277/483 (57%), Positives = 365/483 (75%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK-QQKTILETIDQTKDISQD 483
           M+IN  + S +IK QI+ ++     +E G V  +GDGI +A GL NVM  EL+ FENGSYGM  NLE+T  GI++LG F DI+EG  ++RT  +++VPVG+ L+GRV+D +G P+DG GEI  DK  P+E  APGVM R SV EPL+TG  AID++ PIG+GQRELIIGD+QTGKTTIAID I+NQK +++ CIYV IGQK ST+   + TL+Q+GAL+YT +V +SAS    L +LAP+TG+ +AEE+M +G+ VLI+YDDLSK A+AYR LSLLLRRPPGREA+PGD+FYLHSRLLERS K++ E GGGSITALP IET+AGDISAYI TNVISITDGQ+F+   LFN+G RPAIDAG SVSRVG SAQI A+KK +G+L+++LA YREL+AF++FGSDLD  T+  L  G++ ++++KQ  + P     +  +L+++   ++  +PVD I  F+E+    F  Q   ILETI  TKD+ ++
  S:     1 MAINAQEISALIKQQIENFKPNFDVTETGVVTYIGDGIARAHGLENVMSGELLNFENGSYGMAQNLESTDVGIIILGDFTDIREGDTIRRTGKIMEVPVGESLIGRVVDPLGRPVDGLGEIHTDKTRPVEAPAPGVMQRKSVSEPLQTGLKAIDALVPIGRGQRELIIGDRQTGKTTIAIDTILNQKDQDMICIYVAIGQKESTVRTQVETLRQYGALDYTIVVTASASQPSPLLFLAPYTGVAMAEEFMYQGKHVLIVYDDLSKQAVAYRELSLLLRRPPGREAFPGDVFYLHSRLLERSAKVSDELGGGSITALPFIETQAGDISAYIATNVISITDGQIFLGDGLFNAGIRPAIDAGSSVSRVGGSAQIKAMKKVAGTLRIDLASYRELEAFTKFGSDLDAATQAKLNRGRRTVEVLKQPVHKPLPVEKQVTILYALTHGFLDTVPVDDIVRFEEEFHAFFDAQHPEILETIRDTKDLPEE 484
>gi|168483881|ref|ZP_02708833.1| ATP synthase F1, alpha subunit [Streptococcus pneumoniae CDC1873-00] >gi|168492579|ref|ZP_02716722.1| ATP synthase F1, alpha subunit [Streptococcus pneumoniae CDC0288-04] >gi|194398243|ref|YP_002038140.1| ATP synthase F1, alpha subunit [Streptococcus pneumoniae G54] >gi|172042777|gb|EDT50823.1| ATP synthase F1, alpha subunit [Streptococcus pneumoniae CDC1873-00] >gi|183573277|gb|EDT93805.1| ATP synthase F1, alpha subunit [Streptococcus pneumoniae CDC0288-04] >gi|194357910|gb|ACF56358.1| ATP synthase F1, alpha subunit [Streptococcus pneumoniae G54] (501 aa)
Score = 1432, Expect = 1.9e-156, Identities = 277/483 (57%), Positives = 365/483 (75%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK-QQKTILETIDQTKDISQD 483
           M+IN  + S +IK QI+ ++     +E G V  +GDGI +A GL NVM  EL+ FENGSYGM  NLE+T  GI++LG F DI+EG  ++RT  +++VPVG+ L+GRV+D +G P+DG GEI  DK  P+E  APGVM R SV EPL+TG  AID++ PIG+GQRELIIGD+QTGKTTIAID I+NQK +++ CIYV IGQK ST+   + TL+Q+GAL+YT +V +SAS    L +LAP+TG+ +AEE+M +G+ VLI+YDDLSK A+AYR LSLLLRRPPGREA+PGD+FYLHSRLLERS K++ E GGGSITALP IET+AGDISAYI TNVISITDGQ+F+   LFN+G RPAIDAG SVSRVG SAQI A+KK +G+L+++LA YREL+AF++FGSDLD  T+  L  G++ ++++KQ  + P     +  +L+++   ++  +PVD I  F+E+    F  Q   ILETI  TKD+ ++
  S:     1 MAINAQEISALIKQQIENFKPNFDVTETGVVTYIGDGIARAHGLENVMSGELLNFENGSYGMAQNLESTDVGIIILGDFTDIREGDTIRRTGKIMEVPVGESLIGRVVDPLGRPVDGLGEIHTDKTRPVEAPAPGVMQRKSVSEPLQTGLKAIDALVPIGRGQRELIIGDRQTGKTTIAIDTILNQKDQDMICIYVAIGQKESTVRTQVETLRQYGALDYTIVVTASASQPSPLLFLAPYTGVAMAEEFMYQGKHVLIVYDDLSKQAVAYRELSLLLRRPPGREAFPGDVFYLHSRLLERSAKVSDELGGGSITALPFIETQAGDISAYIATNVISITDGQIFLGDGLFNAGIRPAIDAGSSVSRVGGSAQIKAMKKVAGTLRIDLASYRELEAFTKFGSDLDAATQAKLNRGRRTVEVLKQPVHKPLPVEKQVTILYALTHGFLDTVPVDDIVRFEEEFHTFFDAQHPEILETIRDTKDLPEE 484
>gi|160881856|ref|YP_001560824.1| ATP synthase F1, alpha subunit [Clostridium phytofermentans ISDg] >gi|189081294|sp|A9KK94|ATPA_CLOPH ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|160430522|gb|ABX44085.1| ATP synthase F1, alpha subunit [Clostridium phytofermentans ISDg] (502 aa)
Score = 1431, Expect = 2.3e-156, Identities = 275/460 (59%), Positives = 355/460 (77%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKI 460
           M++  ++ S++IK QIK Y  +   S++G VI V DGI +  GL N M  EL+ F    YGM LNLE    G V+LG  ++I EG  VK T  VV+VPVGD LLGRV++A+G PIDG G I+  K   IE++A GV+AR SV  PL+TG  AIDSM PIG+GQRELIIGDKQTGKT IAID IINQKG+NVKCIYV IGQK ST+   + TL+++GAL+YTT+VAS+AS+L  L Y+AP++G  I EEWM  G+DVL+IYDDL+KHA AYRTLSLLL+RPPGREAYPGD+FYLHSRLLER+ ++N E GGGS+TALPIIET+AGD+SAYIPTNVISITDGQ+++ T++FN+G RPA++AGLSVSRVG SAQI A+KK +G +++ELAQYREL AF+QFGSDLD +TKE L  G+++ +++KQ +  P     + I++F+  +KY+  I V  I  F++++
  S:     1 MNLRPEEISSVIKEQIKNYSMQLEVSDVGTVIQVADGIARIHGLENAMQGELLEFPGDVYGMVLNLEEDNVGAVLLGDMKNINEGDTVKTTGRVVEVPVGDALLGRVVNALGQPIDGKGPIETKKYRQIERVASGVIARKSVDTPLQTGIKAIDSMVPIGRGQRELIIGDKQTGKTAIAIDTIINQKGQNVKCIYVAIGQKASTVANIVKTLEEYGALDYTTVVASTASELAPLQYIAPYSGCAIGEEWMESGQDVLVIYDDLTKHAAAYRTLSLLLKRPPGREAYPGDVFYLHSRLLERAARLNDELGGGSLTALPIIETQAGDVSAYIPTNVISITDGQIYLETDMFNAGFRPAVNAGLSVSRVGGSAQIKAMKKIAGPIRIELAQYRELAAFAQFGSDLDADTKEKLAQGERIREILKQPQYKPMPVEYQVIIIFAATKKYLLDIEVSKIRSFEKEL 460
>gi|148377620|ref|YP_001256496.1| F0F1 ATP synthase subunit alpha [Mycoplasma agalactiae PG2] >gi|148291666|emb|CAL59052.1| ATP synthase alpha chain [Mycoplasma agalactiae PG2] (528 aa)
Score = 1431, Expect = 2.4e-156, Identities = 286/498 (57%), Positives = 364/498 (73%)
  Q:     9 SNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKTILETIDQTKDISQDLFVQIKNEFNS----LITSYIKTIPDY 506
           S IIK++I+ + +K  YSEIG ++ +GDGI   +GL N    E+V F+N   G+ LNLE    G+ + G    + E  +  RT  V+ VPVGD L GRVI+A+GNPIDG G I   K+  I K+APGVM+R  V EPLETG +AIDSM PIGKGQRELIIGD+QTGKT+IAID IINQK KNVKCIYV IGQKNST+ Q    L+  GA+EYTT++ S AS+L    Y+AP++G  IAEEWMS+G+D LIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGD+FYLHS+LLER+ K+N   GGGSITALPIIET+ GDISAYIPTNVISITDGQ+F   NLF+SGQRPA+D G SVSRVGSSAQI A+K+ S SLKLELAQY E+ AF+QFGSDLD  T  +L+HG KV +L+KQ++  P +Q  +  +L  +KEK I  +P   +  +++++I+   ++   ++  ++ K  +  L   IK E  +    ++   I ++ DY
  S:     9 SAIIKDRIRRFDSKIDYSEIGYIVTIGDGIALVNGLDNAKNGEIVKFKNNITGLVLNLEEEVVGVAIFGDANMLSEADLCTRTGEVIAVPVGDELTGRVINAIGNPIDGKGPINSTKRREIFKVAPGVMSRVEVNEPLETGIIAIDSMIPIGKGQRELIIGDRQTGKTSIAIDTIINQKDKNVKCIYVAIGQKNSTVAQITKKLQDSGAMEYTTVIVSGASELAPQQYIAPYSGTAIAEEWMSEGKDCLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDVFYLHSQLLERAAKVNYSYGGGSITALPIIETQQGDISAYIPTNVISITDGQIFTRENLFHSGQRPAVDVGFSVSRVGSSAQIKAMKEVSSSLKLELAQYNEMQAFAQFGSDLDDSTIAILKHGHKVYELLKQEQYYPINQLAQTAILLGVKEKIINPLPASQLRRYRDEVIKFMTKELEGIKIGEKIKQNNNALNSSIKEEITTHLVKIVNKIIASLHDY 510
>gi|47459046|ref|YP_015908.1| F0F1 ATP synthase subunit alpha [Mycoplasma mobile 163K] >gi|81697070|sp|Q6KI79|ATPA_MYCMO ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|47458375|gb|AAT27697.1| ATP synthase alpha chain [Mycoplasma mobile 163K] (523 aa)
Score = 1429, Expect = 4.5e-156, Identities = 287/500 (57%), Positives = 372/500 (74%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKTI--LETIDQTKDISQDLFVQIKNEFNSLITSYI 500
           MSI     S+IIK QIK++   +   EIG ++ VGDGI   SGL N  L ELV+FEN +YG+ LNLE    G+ ++    D+ EG  V+RT  V+ V VGD L+GRV++ +G PIDG G+I   K   I +IAPGVM R  V  PL+TG + IDSM PIG+GQRELIIGD+QTGKT IA+D IINQK K+V CIYV IGQKNS+I Q +  LK   A++YTT++ SSAS+L  L Y+AP+TG+TIAEEWM+ G+DVLI+YDDLSKHAIAYRTLSLLLRRPPGREA+PGD+FYLHS+LLER+ ++ KE GGGSITALPI+ET++GDISAYIPTN+ISITDGQ+F + +LF SGQRPAID G SVSRVGS+AQI A+K  + SLKLELAQY E+ AF+QFGSDLD+ T  +L+HG+K+ +++KQ + +P SQ  +AI+L +IKEK I  IPV+ I  ++ ++I+  K    I  L  I + + I+ D+  ++     S +  +I
  S:     1 MSIKASDISSIIKQQIKDFNVTSDKKEIGEILTVGDGIAYVSGLENARLGELVVFENENYGLVLNLEEYAVGVAIMDGSNDLIEGQKVRRTGKVISVKVGDQLIGRVLNGLGEPIDGLGQITSTKTRKIFQIAPGVMTRKEVNVPLDTGIITIDSMIPIGRGQRELIIGDRQTGKTAIAMDTIINQKDKDVLCIYVAIGQKNSSIAQIVQKLKDHDAMKYTTVINSSASELAPLQYIAPYTGVTIAEEWMANGKDVLIVYDDLSKHAIAYRTLSLLLRRPPGREAFPGDVFYLHSQLLERAARVTKEFGGGSITALPIVETQSGDISAYIPTNIISITDGQIFTIESLFKSGQRPAIDIGFSVSRVGSAAQIPAIKSFASSLKLELAQYNEVKAFAQFGSDLDETTTNILKHGQKIYEILKQSQYSPISQFYQAIILLAIKEKLISQIPVEKIRKYRSELIKFIKNNSEIIALRPIIEKEKINNDIKEKLIYSIKSFVKKFI 502
>gi|158321582|ref|YP_001514089.1| ATP synthase F1, alpha subunit [Alkaliphilus oremlandii OhILAs] >gi|166990352|sp|A8MJW1|ATPA_ALKOO ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|158141781|gb|ABW20093.1| ATP synthase F1, alpha subunit [Alkaliphilus oremlandii OhILAs] (505 aa)
Score = 1429, Expect = 4.8e-156, Identities = 277/495 (55%), Positives = 367/495 (74%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHF-KQQKTILETIDQTKDISQDLFVQIKNEFNSL 495
           M++  ++ S+IIK QIK Y+NK    ++G VI VGDGI +  GL   M  EL+ F N  YGM  NLE    G V+LG    I+EG IVKRT  +V+VPVG+ LLGRV++A+G PIDG G I  D    +E++APG+++R SV EPL+TG  AIDSM PIG+GQRELIIGD+QTGKT +AID IINQK  +V CIYV IGQK ST+ Q  ++L++ GA+EYT IV+S+A +L  L YLAP+ G  + EE+M KG+ VLIIYDDLSKHA+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K++ E GGGS+TALPIIET+AGD+SAYIPTNVISITDGQ+F+ T LFN+G RPA++ G+SVSRVG +AQI A+KK +G+L+LELAQYREL AF+QFGSDLDKET+E L  G+++++++KQ +  P     + +++++  +KY+  I V+ I DF+   +R    +   + + I  T  IS++   ++K    S 
  S:     1 MNLRPEEISSIIKEQIKRYENKLEVKDVGTVIQVGDGIARIHGLEKCMAGELLEFPNAVYGMAQNLEEDNVGCVLLGSDATIREGDIVKRTGRIVEVPVGEALLGRVVNALGQPIDGKGPINTDAYREVERVAPGIISRKSVHEPLQTGIKAIDSMIPIGRGQRELIIGDRQTGKTALAIDTIINQKNTDVICIYVAIGQKKSTVAQIKDSLEKAGAMEYTIIVSSTADELAPLQYLAPYAGCAMGEEFMEKGKHVLIIYDDLSKHAVAYRAMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSDERGGGSLTALPIIETQAGDVSAYIPTNVISITDGQIFLETELFNAGIRPAVNPGISVSRVGGNAQIKAMKKVAGTLRLELAQYRELAAFAQFGSDLDKETQERLSQGERILEILKQPQYDPMPVEKQIMMIYATTKKYLTDIAVEDIRDFESGFLRFMDNEHPEVGKDIVATGSISEETEAKLKEAIESF 496
>gi|149003276|ref|ZP_01828172.1| F0F1 ATP synthase subunit alpha [Streptococcus pneumoniae SP14-BS69] >gi|147758736|gb|EDK65733.1| F0F1 ATP synthase subunit alpha [Streptococcus pneumoniae SP14-BS69] (501 aa)
Score = 1428, Expect = 5.5e-156, Identities = 276/483 (57%), Positives = 364/483 (75%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK-QQKTILETIDQTKDISQD 483
           M+IN  + S +IK QI+ ++     +E G V  +GDGI +A GL NVM  EL+ FENGSYGM  NLE+T  GI++LG F DI+EG  ++RT  +++VPVG+ L+GRV+D +G P+DG GEI  DK  P+E  APGVM R SV EPL+TG  AID++ PIG+GQRELIIGD+QTGKTTIAID I+NQK +++ CIYV IGQK ST+   + TL+Q+GAL+YT +V +SAS    L +LAP+ G+ +AEE+M +G+ VLI+YDDLSK A+AYR LSLLLRRPPGREA+PGD+FYLHSRLLERS K++ E GGGSITALP IET+AGDISAYI TNVISITDGQ+F+   LFN+G RPAIDAG SVSRVG SAQI A+KK +G+L+++LA YREL+AF++FGSDLD  T+  L  G++ ++++KQ  + P     +  +L+++   ++  +PVD I  F+E+    F  Q   ILETI  TKD+ ++
  S:     1 MAINAQEISALIKQQIENFKPNFDVTETGVVTYIGDGIARAHGLENVMSGELLNFENGSYGMAQNLESTDVGIIILGDFTDIREGDTIRRTGKIMEVPVGESLIGRVVDPLGRPVDGLGEIHTDKTRPVEAPAPGVMQRKSVSEPLQTGLKAIDALVPIGRGQRELIIGDRQTGKTTIAIDTILNQKDQDMICIYVAIGQKESTVRTQVETLRQYGALDYTIVVTASASQPSPLLFLAPYAGVAMAEEFMYQGKHVLIVYDDLSKQAVAYRELSLLLRRPPGREAFPGDVFYLHSRLLERSAKVSDELGGGSITALPFIETQAGDISAYIATNVISITDGQIFLGDGLFNAGIRPAIDAGSSVSRVGGSAQIKAMKKVAGTLRIDLASYRELEAFTKFGSDLDAATQAKLNRGRRTVEVLKQPVHKPLPVEKQVTVLYALTHGFLDTVPVDDIVRFEEEFHAFFDAQHPEILETIRDTKDLPEE 484
>gi|15901357|ref|NP_345961.1| F0F1 ATP synthase subunit alpha [Streptococcus pneumoniae TIGR4] >gi|15903405|ref|NP_358955.1| F0F1 ATP synthase subunit alpha [Streptococcus pneumoniae R6] >gi|111657412|ref|ZP_01408165.1| hypothetical protein SpneT_02001382 [Streptococcus pneumoniae TIGR4] >gi|148984853|ref|ZP_01818106.1| F0F1 ATP synthase subunit alpha [Streptococcus pneumoniae SP3-BS71] >gi|81620385|sp|Q97PT4|ATPA_STRPN ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|81706932|sp|Q7CRB1|ATPA_STRR6 ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|18253299|gb|AAL66411.1|AF368465_1 proton-translocating ATPase alpha subunit [Streptococcus pneumoniae] >gi|14973000|gb|AAK75601.1| ATP synthase F1, alpha subunit [Streptococcus pneumoniae TIGR4] >gi|15459010|gb|AAL00166.1| Proton-translocating ATPase, F1 sector, alpha-subunit [Streptococcus pneumoniae R6] >gi|147922875|gb|EDK73991.1| F0F1 ATP synthase subunit alpha [Streptococcus pneumoniae SP3-BS71] (501 aa)
Score = 1428, Expect = 5.8e-156, Identities = 276/483 (57%), Positives = 364/483 (75%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK-QQKTILETIDQTKDISQD 483
           M+IN  + S +IK QI+ ++     +E G V  +GDGI +A GL NVM  EL+ FENGSYGM  NLE+T  GI++LG F DI+EG  ++RT  +++VPVG+ L+GRV+D +G P+DG GEI  DK  P+E  APGVM R SV EPL+TG  AID++ PIG+GQRELIIGD+QTGKTTIAID I+NQK +++ CIYV IGQK ST+   + TL+Q+GAL+YT +V +SAS    L +LAP+ G+ +AEE+M +G+ VLI+YDDLSK A+AYR LSLLLRRPPGREA+PGD+FYLHSRLLERS K++ E GGGSITALP IET+AGDISAYI TNVISITDGQ+F+   LFN+G RPAIDAG SVSRVG SAQI A+KK +G+L+++LA YREL+AF++FGSDLD  T+  L  G++ ++++KQ  + P     +  +L+++   ++  +PVD I  F+E+    F  Q   ILETI  TKD+ ++
  S:     1 MAINAQEISALIKQQIENFKPNFDVTETGVVTYIGDGIARAHGLENVMSGELLNFENGSYGMAQNLESTDVGIIILGDFTDIREGDTIRRTGKIMEVPVGESLIGRVVDPLGRPVDGLGEIHTDKTRPVEAPAPGVMQRKSVSEPLQTGLKAIDALVPIGRGQRELIIGDRQTGKTTIAIDTILNQKDQDMICIYVAIGQKESTVRTQVETLRQYGALDYTIVVTASASQPSPLLFLAPYAGVAMAEEFMYQGKHVLIVYDDLSKQAVAYRELSLLLRRPPGREAFPGDVFYLHSRLLERSAKVSDELGGGSITALPFIETQAGDISAYIATNVISITDGQIFLGDGLFNAGIRPAIDAGSSVSRVGGSAQIKAMKKVAGTLRIDLASYRELEAFTKFGSDLDAATQAKLNRGRRTVEVLKQPVHKPLPVEKQVTILYALTHGFLDTVPVDDIVRFEEEFHAFFDAQHPEILETIRDTKDLPEE 484
>gi|148988554|ref|ZP_01819987.1| F0F1 ATP synthase subunit alpha [Streptococcus pneumoniae SP6-BS73] >gi|169833419|ref|YP_001694916.1| ATP synthase F1, alpha subunit [Streptococcus pneumoniae Hungary19A-6] >gi|147925755|gb|EDK76830.1| F0F1 ATP synthase subunit alpha [Streptococcus pneumoniae SP6-BS73] >gi|168995921|gb|ACA36533.1| ATP synthase F1, alpha subunit [Streptococcus pneumoniae Hungary19A-6] (501 aa)
Score = 1424, Expect = 1.6e-155, Identities = 275/483 (56%), Positives = 363/483 (75%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK-QQKTILETIDQTKDISQD 483
           M+IN  + S +IK QI+ ++     +E G V  +GDGI +A GL N M  EL+ FENGSYGM  NLE+T  GI++LG F DI+EG  ++RT  +++VPVG+ L+GRV+D +G P+DG GEI  DK  P+E  APGVM R SV EPL+TG  AID++ PIG+GQRELIIGD+QTGKTTIAID I+NQK +++ CIYV IGQK ST+   + TL+Q+GAL+YT +V +SAS    L +LAP+ G+ +AEE+M +G+ VLI+YDDLSK A+AYR LSLLLRRPPGREA+PGD+FYLHSRLLERS K++ E GGGSITALP IET+AGDISAYI TNVISITDGQ+F+   LFN+G RPAIDAG SVSRVG SAQI A+KK +G+L+++LA YREL+AF++FGSDLD  T+  L  G++ ++++KQ  + P     +  +L+++   ++  +PVD I  F+E+    F  Q   ILETI  TKD+ ++
  S:     1 MAINAQEISALIKQQIENFKPNFDVTETGVVTYIGDGIARAHGLENAMSGELLNFENGSYGMAQNLESTDVGIIILGDFTDIREGDTIRRTGKIMEVPVGESLIGRVVDPLGRPVDGLGEIHTDKTRPVEAPAPGVMQRKSVSEPLQTGLKAIDALVPIGRGQRELIIGDRQTGKTTIAIDTILNQKDQDMICIYVAIGQKESTVRTQVETLRQYGALDYTIVVTASASQPSPLLFLAPYAGVAMAEEFMYQGKHVLIVYDDLSKQAVAYRELSLLLRRPPGREAFPGDVFYLHSRLLERSAKVSDELGGGSITALPFIETQAGDISAYIATNVISITDGQIFLGDGLFNAGIRPAIDAGSSVSRVGGSAQIKAMKKVAGTLRIDLASYRELEAFTKFGSDLDAATQAKLNRGRRTVEVLKQPVHKPLPVEKQVTILYALTHGFLDTVPVDDIVRFEEEFHAFFDAQHPEILETIRDTKDLPEE 484
>gi|146296977|ref|YP_001180748.1| ATP synthase F1, alpha subunit [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145410553|gb|ABP67557.1| ATP synthase F1, alpha subunit [Caldicellulosiruptor saccharolyticus DSM 8903] (507 aa)
Score = 1422, Expect = 2.8e-155, Identities = 275/494 (55%), Positives = 372/494 (75%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQ-KTILETIDQTKDIS-------QDLFVQIKNEFNS 494
           ++I  D+ ++IIK QIK Y+ K   +++G VI  GDGI +  GL N M  EL+ F N  YGM LNLE    G V+LG   +IKEG+IVKRT  VV+VPVG+ LLGRV++A+G PIDG G I   K  P+E+IAPGV+ R  V  PL+TG +AID+M PIG+GQRELIIGD+QTGKT IAID IINQK + V CIYV IGQK ST+ Q ++TLK++GA++YT +V+++ASD   L +LAP+ G  + EE+M  G+D LI+YDDLSKHA+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+N + GGGS+TALPIIET+AGD+SAYIPTNVISITDGQ+++ + LF +G RPAI+AG+SVSRVG +AQI A+KK +G L+L+LAQYREL+AF+QFGS+LDK T+E L  G+++++ +KQ +        + ++L+S    Y+  I V+ + +F EK++++       I ++I +TKD++       + + V+ K  F S
  S:     4 VTIRPDEIASIIKEQIKNYEKKIETNDVGVVIMSGDGIARIHGLDNCMAGELLEFPNNVYGMALNLEEDNVGCVILGNDREIKEGTIVKRTGRVVEVPVGEELLGRVVNALGQPIDGLGPINAKKYRPVERIAPGVIEREPVKTPLQTGIMAIDAMIPIGRGQRELIIGDRQTGKTAIAIDTIINQKDQGVYCIYVAIGQKASTVAQIVHTLKEYGAMDYTIVVSATASDSAPLQFLAPYAGCAMGEEFMESGKDALIVYDDLSKHAVAYRAMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNSQRGGGSLTALPIIETQAGDVSAYIPTNVISITDGQIYLESELFYAGIRPAINAGISVSRVGGNAQIKAMKKVAGRLRLDLAQYRELEAFAQFGSELDKSTRERLAQGQRIVETLKQPQYKTLPVWHQVVILYSAVNGYLMDIEVNKVREFNEKLVQYISANYPQIFDSIKETKDLTLENEELLKKVIVEFKERFKS 505
>gi|29377095|ref|NP_816249.1| F0F1 ATP synthase subunit alpha [Enterococcus faecalis V583] >gi|81436389|sp|Q831A3|ATPA_ENTFA ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|29344561|gb|AAO82319.1| ATP synthase F1, alpha subunit [Enterococcus faecalis V583] (518 aa)
Score = 1420, Expect = 5.0e-155, Identities = 270/480 (56%), Positives = 361/480 (75%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK-QQKTILETIDQTKDI 480
           M+I  ++ S +IK QI+ YQ +    E+G V  VGDGI +A GL N M  ELV F NGSYGM  NLE    GI++LG FE I+EG  V+RT  +++VPVG+ L+GRV++ +G P+DG GEIK DK  P+E  APGVM R SV EP++TG  AID++ PIG+GQREL+IGD++TGKT+IAID IINQKG++V CIYV IGQK ST+   + TL++FGAL+YT +V + AS    L Y+AP+ G  + EE+M  G+ VLII+DDLSK A+AYR LSLLLRRPPGREAYPGD+FYLHSRLLER+ K++ E GGGS+TALP +ET+AGDISAYIPTNVISITDGQ+F+ ++LF +G RPA+DAGLSVSRVG SAQI A+KK +G+L+L+LA YREL+AF+QFGSDLD  T+  L  G++ ++++KQ  + P     + ++L+++   ++  + VD I  F++ +  +F  +   +LETI  TKD+
  S:     1 MAIKAEEISALIKEQIENYQQQLAVEEVGTVTYVGDGIARAHGLENAMSGELVEFSNGSYGMAQNLETNDVGIIILGDFETIREGDKVQRTGKIMEVPVGEALIGRVVNPLGQPLDGLGEIKTDKTRPVEATAPGVMQRQSVAEPMQTGLKAIDALVPIGRGQRELVIGDRKTGKTSIAIDTIINQKGQDVICIYVAIGQKESTVRNQVETLRKFGALDYTIVVTAGASQPAPLLYIAPYAGTAMGEEFMYNGKHVLIIFDDLSKQAVAYRELSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSDELGGGSMTALPFVETQAGDISAYIPTNVISITDGQIFLESDLFYAGTRPAVDAGLSVSRVGGSAQIKAMKKVAGTLRLDLASYRELEAFTQFGSDLDAATQAKLNRGRRTVEILKQKLHAPLPVEKQVLILYALTHGFLDSVSVDKILHFEQDLFDYFDGKHADLLETIRTTKDL 481
>gi|69247777|ref|ZP_00604482.1| ATP synthase F1, alpha subunit [Enterococcus faecium DO] >gi|68194706|gb|EAN09188.1| ATP synthase F1, alpha subunit [Enterococcus faecium DO] (518 aa)
Score = 1419, Expect = 6.3e-155, Identities = 275/499 (55%), Positives = 370/499 (74%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKT-ILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           M+I  ++ S +IK QI+ YQN     EIG V  VGDGI +A GL N M  EL+ F NGSYGM  NLE+   GI++LG FE I+EG  VKRT  +++VPVG+ L+GRV++ +G PIDG GEI  DK  P+E +APGVM R SV EP++TG  AID++ PIG+GQREL+IGD++TGKT+IAID IINQKG+++ CIYV IGQK+ST+   + TLK++GA++YT +V + AS    L Y+AP+ G  + EE+M  G+ VLII+DDLSK A+AYR LSLLLRRPPGREAYPGD+FYLHSRLLER+ K++ + GGGS+TALP +ET+AGDISAYIPTNVISITDGQ+F+ ++LF +G RPA+DAGLSVSRVG SAQI A+KK +G+L+L+LA YREL+AF+QFGSDLD  T+  L  G++ ++++KQ  + P +   + ++L+++   ++  IPVD I DF+ ++  +     + I ETI  TKD+ ++         NS I  Y
  S:     1 MAIKAEEISALIKEQIENYQNVLSVEEIGTVTYVGDGIARAHGLENAMSGELLEFSNGSYGMAQNLESNDVGIIILGDFESIREGDKVKRTGKIMEVPVGEALIGRVVNPLGQPIDGLGEIVTDKARPVEAMAPGVMQRKSVNEPMQTGLKAIDALVPIGRGQRELVIGDRKTGKTSIAIDTIINQKGQDMICIYVAIGQKDSTVRTQVETLKKYGAMDYTIVVNAGASQPAPLLYIAPYAGTAMGEEFMYNGKHVLIIFDDLSKQAVAYRELSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSDDLGGGSMTALPFVETQAGDISAYIPTNVISITDGQIFLESDLFYAGTRPAVDAGLSVSRVGGSAQIKAMKKVAGTLRLDLASYRELEAFTQFGSDLDAATQAKLNRGRRTVEILKQKLHAPLAVEKQVVILYALTHGFLDSIPVDSILDFEHELFEYLDTNHSDIFETIRTTKDLPEE------EALNSAIQEY 494
>gi|114515|sp|P26679|ATPA_ENTHR ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|153571|gb|AAA26857.1| H+ ATPase >gi|153579|gb|AAA26864.1| F1F0-ATPase alpha subunit (518 aa)
Score = 1418, Expect = 7.5e-155, Identities = 271/483 (56%), Positives = 365/483 (75%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHF-KQQKTILETIDQTKDISQD 483
           M+I  ++ S +IK QI+ YQN     EIG V  VGDGI +A GL N M  EL+ F NGSYGM  NLE+   GI++LG FE I+EG  VKRT  +++VPVGD L+GRV++ +G PIDG GEI  DK  P+E +APGVM R SV EP++TG  AID++ PIG+GQREL+IGD++TGKT+IAID I+NQKG+++ CIYV IGQK+ST+   + TLK++GA++YT +V + AS    L Y+AP+ G  + EE+M  G+ VLII+DDLSK A+AYR LSLLLRRPPGREAYPGD+FYLHSRLLER+ K++ + GGGS+TALP +ET+AGDISAYIPTNVISITDGQ+F+ ++LF +G RPA+DAGLSVSRVG SAQI A+KK +G+L+L+LA YREL+AF+QFGSDLD  T+  L  G++ ++++KQ  + P +   + ++L+++   ++  IPVD I DF+ ++  +       I ETI  TKD+ ++
  S:     1 MAIKAEEISALIKEQIENYQNVLSVEEIGTVTYVGDGIARAHGLENAMSGELLEFSNGSYGMAQNLESNDVGIIILGDFESIREGDKVKRTGKIMEVPVGDALIGRVVNPLGQPIDGLGEIVTDKVRPVEAMAPGVMQRKSVNEPMQTGLKAIDALVPIGRGQRELVIGDRKTGKTSIAIDTILNQKGQDMICIYVAIGQKDSTVRTQVETLKKYGAMDYTIVVNAGASQPAPLLYIAPYAGTAMGEEFMYNGKHVLIIFDDLSKQAVAYRELSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSDDLGGGSMTALPFVETQAGDISAYIPTNVISITDGQIFLESDLFYAGTRPAVDAGLSVSRVGGSAQIKAMKKVAGTLRLDLASYRELEAFTQFGSDLDAATQAKLNRGRRTVEILKQKLHAPLAVEKQVVILYALTHGFLDSIPVDSILDFEHELFEYLDTNHADIFETIRTTKDLPEE 484
>gi|167768336|ref|ZP_02440389.1| hypothetical protein CLOSS21_02892 [Clostridium sp. SS2/1] >gi|167709860|gb|EDS20439.1| hypothetical protein CLOSS21_02892 [Clostridium sp. SS2/1] (502 aa)
Score = 1417, Expect = 9.5e-155, Identities = 277/491 (56%), Positives = 370/491 (75%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQ-KTILETIDQTK---DISQDLFVQIKNE 491
           M++  ++ S++IK QIK+Y  K   S+IG VI V DGI +  GL   M  EL+ F    YGM LNLE    G V+LG  ++I EG IVK T  VV+VPVGD L GRV++++G PID  G I+ DK  PIE++A GV++R SV  P++TG  AID+M PIG+GQRELIIGD+QTGKT IAID IINQKG+ V CIYV IGQK ST+   + TL++FGA++YTTIVAS+AS+L  L Y+AP+ G  I EEWM +GEDVL++YDDLSKHA AYRTLSLLLRRPPGREAYPGD+FYLHSRLLER+ +++ E GGGS+TALPIIET+AGD+SAYIPTNVISITDGQ+++ T +FN+G RPAI+AGLSVSRVG SAQI A+KK +G ++ +LAQYREL AF+QFGS+LD +TKE L+ G+++ +++KQ +  P     +  ++++  +K++  +PVD I DF++++      +   I  +I +TK   D +++  ++  NE
  S:     1 MNLRPEEISSVIKEQIKQYSTKLETSDIGTVIQVADGIARIHGLEKAMQGELLEFPGEVYGMVLNLEEDNVGAVLLGDRKNINEGDIVKTTGRVVEVPVGDQLTGRVVNSLGQPIDNKGPIETDKYRPIERVASGVISRKSVDTPIQTGIKAIDAMVPIGRGQRELIIGDRQTGKTAIAIDTIINQKGQGVHCIYVAIGQKASTVANIVKTLEEFGAMDYTTIVASTASELAPLQYIAPYAGCAIGEEWMERGEDVLVVYDDLSKHATAYRTLSLLLRRPPGREAYPGDVFYLHSRLLERAARLSDELGGGSLTALPIIETQAGDVSAYIPTNVISITDGQIYLETEMFNAGFRPAINAGLSVSRVGGSAQIKAMKKIAGPIRTDLAQYRELAAFAQFGSELDDDTKERLDQGERIREILKQPQYQPLPVEKQVAIIYAAVKKHLLDLPVDQILDFQKELFELIDTKYPEIFTSIAETKVMDDATEEKLIKAINE 495
>gi|167750155|ref|ZP_02422282.1| hypothetical protein EUBSIR_01124 [Eubacterium siraeum DSM 15702] >gi|167656898|gb|EDS01028.1| hypothetical protein EUBSIR_01124 [Eubacterium siraeum DSM 15702] (501 aa)
Score = 1417, Expect = 1.2e-154, Identities = 276/500 (55%), Positives = 371/500 (74%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQ-QKTILETIDQTKDISQDLFVQIKNEFNSLITSYI 500
           M +  D+ + IIK++IK+Y +K    + G V+ VGDGIV+  GL   M+NEL+ FENG   M LNLE    G VMLG   +IKEG  VKRT +VV VPVG+ LLGRV++A+G PIDG G I   +  PIEKIAPG++ R SV  PL+TG  AIDSM PIG+GQRELIIGD+QTGKT IAID IINQK  +V CIYV IGQK ST+   +  L   GA++YT +V+++AS+L  L Y+AP++G T+ E +M KG+D LIIYDDLSKHA+AYR LSLLL+RPPGREAYPGD+FYLHSRLLER+  +N+  GGGS+TALPIIET+AGD+SAYIPTNVISITDGQ+F+ T LF+SG RPA++ G+SVSRVG +AQI A+KK SG+LKLE +Q+REL +FSQFGSDLDK+TKE L  G+++++++KQ +N+P +   + I+++++   Y++ IP++ + DF+  + +H ++    I  +I + K ++ D   ++K         Y+
  S:     1 MDLRPDEITGIIKSRIKDYGSKIRLEDTGTVVTVGDGIVRIHGLEKCMMNELLEFENGVRCMALNLEQDFVGAVMLGSDAEIKEGDTVKRTGSVVSVPVGEELLGRVVNALGQPIDGKGAILAKETRPIEKIAPGIITRKSVNVPLQTGIKAIDSMIPIGRGQRELIIGDRQTGKTAIAIDTIINQKKTDVICIYVAIGQKASTVANVVEQLTAAGAMDYTIVVSATASELAPLQYIAPYSGCTMGEYFMEKGKDALIIYDDLSKHAVAYRALSLLLKRPPGREAYPGDVFYLHSRLLERAANLNENYGGGSLTALPIIETQAGDVSAYIPTNVISITDGQIFLETELFHSGVRPAVNPGISVSRVGGNAQIKAMKKVSGTLKLEYSQFRELQSFSQFGSDLDKDTKERLAKGERIVEILKQGQNSPVAVENQVIIIYAVINNYLKDIPLEKVGDFERDLYKHMEEAHPDITASIREEKVLTPDNEEKLKTALKDFSEKYV 501
>gi|81096630|ref|ZP_00874967.1| ATP synthase F1, alpha subunit [Streptococcus suis 89/1591] >gi|80977309|gb|EAP40855.1| ATP synthase F1, alpha subunit [Streptococcus suis 89/1591] (500 aa)
Score = 1415, Expect = 1.7e-154, Identities = 275/497 (55%), Positives = 371/497 (74%)
  Q:     3 INLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK-QQKTILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           IN  + S ++K QI+ +Q    Y+E G V  +GDGI +A GL N M  EL++FENG+ GM  NLE    GI++LG+F DI+EGS+V+RT  +++VPVG  L+GRVI+ +G P+DG GEI+  K  PIE  APGVM R SV EPL+TG  AID++ PIG+GQRELIIGD+QTGKT++AIDAI+NQKG+++ CIYV IGQK ST+   + TL+Q+GAL+YT +V +SAS    L +LAP+ G+ +AEE+M +G+ VLI+YDDLSK A+AYR LSLLLRRPPGREAYPGD+FYLHSRLLERS K++ E GGGSITALP IET+AGDISAYI TNVISITDGQ+F+  +LFNSG RPAIDAG SVSRVG SAQI A+KK +G+L+++LA YREL+AF+QFGSDLD  T+  L  G++ ++++KQ  + P     + ++L+++   ++  +P+D I  F+E++  +F      +L+ I  TKD+         +E N+ I ++
  S:     2 INAQEISALLKQQIEGFQPDFDYTETGVVTYIGDGIARAQGLDNAMSGELLVFENGTIGMAQNLETNDVGIIILGQFTDIREGSVVRRTGKIMEVPVGSALIGRVINPLGQPVDGLGEIRTSKTRPIEYPAPGVMQRKSVNEPLQTGLKAIDALVPIGRGQRELIIGDRQTGKTSVAIDAILNQKGQDMICIYVAIGQKESTVRTQVETLRQYGALDYTIVVTASASQPSPLLFLAPYAGVAMAEEFMYEGKHVLIVYDDLSKQAVAYRELSLLLRRPPGREAYPGDVFYLHSRLLERSAKVSDELGGGSITALPFIETQAGDISAYIATNVISITDGQIFLKDDLFNSGIRPAIDAGSSVSRVGGSAQIKAMKKVAGTLRIDLASYRELEAFTQFGSDLDAATQAKLNRGRRTVEVLKQPLHKPLPVEKQVLILYALTNGFLDSVPIDDILAFEEELYSYFDLHYDGLLDVIRTTKDLPD------TDELNAAIQAF 493
>gi|146318828|ref|YP_001198540.1| F0F1 ATP synthase subunit alpha [Streptococcus suis 05ZYH33] >gi|146321037|ref|YP_001200748.1| F0F1 ATP synthase subunit alpha [Streptococcus suis 98HAH33] >gi|190358200|sp|A4W1V9|ATPA_STRS2 ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|190358201|sp|A4VVK1|ATPA_STRSY ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|145689634|gb|ABP90140.1| F0F1-type ATP synthase, alpha subunit [Streptococcus suis 05ZYH33] >gi|145691843|gb|ABP92348.1| F0F1-type ATP synthase, alpha subunit [Streptococcus suis 98HAH33] (500 aa)
Score = 1415, Expect = 1.7e-154, Identities = 275/497 (55%), Positives = 371/497 (74%)
  Q:     3 INLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK-QQKTILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           IN  + S ++K QI+ +Q    Y+E G V  +GDGI +A GL N M  EL++FENG+ GM  NLE    GI++LG+F DI+EGS+V+RT  +++VPVG  L+GRVI+ +G P+DG GEI+  K  PIE  APGVM R SV EPL+TG  AID++ PIG+GQRELIIGD+QTGKT++AIDAI+NQKG+++ CIYV IGQK ST+   + TL+Q+GAL+YT +V +SAS    L +LAP+ G+ +AEE+M +G+ VLI+YDDLSK A+AYR LSLLLRRPPGREAYPGD+FYLHSRLLERS K++ E GGGSITALP IET+AGDISAYI TNVISITDGQ+F+  +LFNSG RPAIDAG SVSRVG SAQI A+KK +G+L+++LA YREL+AF+QFGSDLD  T+  L  G++ ++++KQ  + P     + ++L+++   ++  +P+D I  F+E++  +F      +L+ I  TKD+         +E N+ I ++
  S:     2 INAQEISALLKQQIEGFQPDFDYTETGVVTYIGDGIARAQGLDNAMSGELLVFENGTIGMAQNLETNDVGIIILGQFTDIREGSVVRRTGKIMEVPVGSALIGRVINPLGQPVDGLGEIRTSKTRPIEYPAPGVMQRKSVNEPLQTGLKAIDALVPIGRGQRELIIGDRQTGKTSVAIDAILNQKGQDMICIYVAIGQKESTVRTQVETLRQYGALDYTIVVTASASQPSPLLFLAPYAGVAMAEEFMYEGKHVLIVYDDLSKQAVAYRELSLLLRRPPGREAYPGDVFYLHSRLLERSAKVSDELGGGSITALPFIETQAGDISAYIATNVISITDGQIFLKDDLFNSGIRPAIDAGSSVSRVGGSAQIKAMKKVAGTLRIDLASYRELEAFTQFGSDLDAATQAKLNRGRRTVEVLKQPLHKPLPVEKQVLILYALTNGFLDSVPIDDILAFEEELYAYFDLHYDGLLDVIRTTKDLPD------TDELNAAIQAF 493
>gi|192809058|ref|ZP_03037733.1| ATP synthase F1, alpha subunit [Geobacillus sp. Y412MC10] >gi|192801729|gb|EDV78234.1| ATP synthase F1, alpha subunit [Geobacillus sp. Y412MC10] (507 aa)
Score = 1412, Expect = 4.4e-154, Identities = 276/483 (57%), Positives = 357/483 (73%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQK-TILETIDQTKDISQD 483
           +SI  ++ S +IK+QI+EY++    SE+G VI V DGI +  GL N M  EL+ F+NG +G+ LNLE +  G+V+LG + +IKEG  VKRT  +++VPVG+ LLGRV++ +G P+DG G I+     P+E  APGV+ R SV EP++TG  AID+M PIG+GQRELIIGD+QTGKTT+AID I+NQKG  VKCIYV IGQK ST+ Q + TL++ GALEYT +V +SAS+   L Y+AP+ G  + E +M KGE  LIIYDDLSK A AYR LSLLLRRPPGREAYPGD+FYLHSRLLER+ K+N E GGGS+TALP IET+A D+SAYIPTNVISITDGQ+F+ + LF SGQRPAI+ G+SVSRVG SAQI A+KK +G +KL+LAQYREL AFSQFGSDLDK T   L  G ++M+++KQ  N P S   + + L++  + YI  I V  +  F+ + +      K  IL++I  TKD++ D
  S:     4 LSIRPEEISTLIKSQIEEYKSDITVSEVGTVIQVSDGIARVYGLENAMSGELLEFQNGVFGLALNLEESNVGVVILGPYSEIKEGDQVKRTGRIMEVPVGEALLGRVVNPLGQPLDGKGPIEATAFRPVESSAPGVIDRKSVHEPMQTGIKAIDAMVPIGRGQRELIIGDRQTGKTTVAIDTILNQKGSGVKCIYVAIGQKQSTVAQVVETLRRHGALEYTIVVTASASEPAPLQYIAPYAGCAMGEYFMYKGEHALIIYDDLSKQAAAYRELSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNDELGGGSLTALPFIETQASDVSAYIPTNVISITDGQIFLESELFYSGQRPAINVGISVSRVGGSAQIKAMKKVAGGMKLDLAQYRELQAFSQFGSDLDKSTLARLNRGARLMEILKQGVNQPLSVEQQVVSLYAAVKGYIDDIEVADVRRFESEFLAFIGSNKPEILQSITDTKDLTSD 487
>gi|15674806|ref|NP_268980.1| F0F1 ATP synthase subunit alpha [Streptococcus pyogenes M1 GAS] >gi|21910033|ref|NP_664301.1| F0F1 ATP synthase subunit alpha [Streptococcus pyogenes MGAS315] >gi|28896269|ref|NP_802619.1| F0F1 ATP synthase subunit alpha [Streptococcus pyogenes SSI-1] >gi|50913942|ref|YP_059914.1| F0F1 ATP synthase subunit alpha [Streptococcus pyogenes MGAS10394] >gi|56808121|ref|ZP_00365909.1| COG0056: F0F1-type ATP synthase, alpha subunit [Streptococcus pyogenes M49 591] >gi|71903223|ref|YP_280026.1| F0F1 ATP synthase subunit alpha [Streptococcus pyogenes MGAS6180] >gi|71910392|ref|YP_281942.1| F0F1 ATP synthase subunit alpha [Streptococcus pyogenes MGAS5005] >gi|94988264|ref|YP_596365.1| F0F1 ATP synthase subunit alpha [Streptococcus pyogenes MGAS9429] >gi|94992138|ref|YP_600237.1| F0F1 ATP synthase subunit alpha [Streptococcus pyogenes MGAS2096] >gi|94994059|ref|YP_602157.1| F0F1 ATP synthase subunit alpha [Streptococcus pyogenes MGAS10750] >gi|81679689|sp|Q5XCY2|ATPA_STRP6 ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|81706732|sp|Q7CFA2|ATPA_STRP3 ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|81782496|sp|Q9A0I9|ATPA_STRP1 ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|118573493|sp|Q1JCL5|ATPA_STRPB ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|118573494|sp|Q1JMJ1|ATPA_STRPC ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|118573496|sp|Q1J7G1|ATPA_STRPF ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|124007218|sp|Q48UD5|ATPA_STRPM ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|13621936|gb|AAK33701.1| putative proton-translocating ATPase, alpha subunit [Streptococcus pyogenes M1 GAS] >gi|21904223|gb|AAM79104.1| putative putative proton-translocating ATPase alpha subunit [Streptococcus pyogenes MGAS315] >gi|28811520|dbj|BAC64452.1| putative proton-translocating ATPase, alpha subunit [Streptococcus pyogenes SSI-1] >gi|50903016|gb|AAT86731.1| ATP synthase alpha chain [Streptococcus pyogenes MGAS10394] >gi|71802318|gb|AAX71671.1| ATP synthase alpha chain [Streptococcus pyogenes MGAS6180] >gi|71853174|gb|AAZ51197.1| ATP synthase alpha chain [Streptococcus pyogenes MGAS5005] >gi|94541772|gb|ABF31821.1| ATP synthase alpha chain [Streptococcus pyogenes MGAS9429] >gi|94545646|gb|ABF35693.1| ATP synthase alpha chain [Streptococcus pyogenes MGAS2096] >gi|94547567|gb|ABF37613.1| ATP synthase alpha chain [Streptococcus pyogenes MGAS10750] (502 aa)
Score = 1410, Expect = 7.6e-154, Identities = 270/483 (55%), Positives = 364/483 (75%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK-QQKTILETIDQTKDISQD 483
           M+IN  + S +IK QI+ +Q     +E G V  +GDGI +A GL N M  EL+ FENG+YGM  NLE+   GI++LG F  I+EG +VKRT  +++VPVG+ L+GRV++ +G P+DG G+I+     P+E  APGVM R SV EPL+TG  AID++ PIG+GQRELIIGD+QTGKT++AIDAI+NQKG+++ CIYV IGQK ST+   + TL+++GAL+YT +V +SAS    L ++AP+ G+ +AEE+M +G+ VLI+YDDLSK A+AYR LSLLLRRPPGREAYPGD+FYLHSRLLERS K++ + GGGSITALP IET+AGDISAYI TNVISITDGQ+F+  NLFNSG RPAIDAG SVSRVG SAQI A+KK +G+L+L+LA YREL+AF+QFGSDLD  T+  L  G++ ++++KQ  + P     + ++L+++   ++  +PVD I  F+E +  +F      + ETI  TKD+ ++
  S:     1 MAINAQEISALIKKQIENFQPNFDVTETGIVTYIGDGIARARGLDNAMSGELLEFENGAYGMAQNLESNDVGIIILGDFSAIREGDVVKRTGKIMEVPVGEALIGRVVNPLGQPVDGLGDIETTGFRPVETPAPGVMQRKSVSEPLQTGLKAIDALVPIGRGQRELIIGDRQTGKTSVAIDAILNQKGQDMICIYVAIGQKESTVRTQVETLRRYGALDYTIVVTASASQPSPLLFIAPYAGVAMAEEFMYQGKHVLIVYDDLSKQAVAYRELSLLLRRPPGREAYPGDVFYLHSRLLERSAKVSDDLGGGSITALPFIETQAGDISAYIATNVISITDGQIFLQENLFNSGIRPAIDAGSSVSRVGGSAQIKAMKKVAGTLRLDLASYRELEAFTQFGSDLDAATQAKLNRGRRTVEILKQPLHKPLPVEKQVVILYALTHGFLDDVPVDDILAFEEALYDYFDVHYNDLFETIRTTKDLPEE 484
>gi|168333942|ref|ZP_02692174.1| ATP synthase F1, alpha subunit [Epulopiscium sp. 'N.t. morphotype B'] (505 aa)
Score = 1409, Expect = 8.8e-154, Identities = 271/484 (55%), Positives = 361/484 (74%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKII-----RHFKQQKTILETIDQTKDISQDL 484
           M++  ++ S++IK QI  Y+ +    E+G V+ VGDGI +  GL N    EL+ F  G  GM LNLE    G+V+LG  ++IKEG +V+ T NV  VPVGD +LGRV++A+G PIDG G IK     P+EK+A GVM+R SV  PL+TG  AIDSM PIG+GQRELIIGD+QTGKT IAID IINQKG+ V CIYV IGQK ST+   ++TL++ GA+ YTT+VAS+AS+L  L Y+AP+ G+TIAEEWM  G+D LIIYDDLSKHA+AYRT++LLLRRPPGREAYPGD+FYLHSRLLER+ K+N E GGGSITA PIIET+AGDISAYIPTNVISITDGQ+F+ + LFN+G RPA++ GLSVSRVG +AQI A+K+ +G +++ELAQYR L AF+QFGSDLD  T+  L  G+++M+++KQ +  P   + + ++L++   KY+  +P+  ++ F++ +      +H +    I++    T D+   L
  S:     1 MNLKPEEISSVIKAQINNYKAQLEVKEVGTVMQVGDGIARVHGLQNAKAGELLEFPGGVKGMVLNLEEDNIGVVLLGSDKNIKEGDVVQSTGNVASVPVGDAMLGRVVNALGEPIDGKGPIKTTHTRPVEKVASGVMSRKSVDTPLQTGEKAIDSMVPIGRGQRELIIGDRQTGKTAIAIDTIINQKGQGVNCIYVAIGQKASTVANIVSTLEKHGAMAYTTVVASTASELAPLQYIAPYAGVTIAEEWMDAGKDNLIIYDDLSKHAVAYRTMALLLRRPPGREAYPGDVFYLHSRLLERAAKLNDELGGGSITAXPIIETQAGDISAYIPTNVISITDGQIFLESELFNAGVRPAVNPGLSVSRVGGAAQIKAMKQIAGPIRVELAQYRSLAAFAQFGSDLDTATQNALTQGERIMEVLKQGQYEPMPVAKQVLILYAATRKYLMDVPLSAVKQFEQDLFTFVDTKHAEVYAEIIKKDGLTADLDNKL 489
>gi|55820565|ref|YP_139007.1| F0F1 ATP synthase subunit alpha [Streptococcus thermophilus LMG 18311] >gi|55822455|ref|YP_140896.1| F0F1 ATP synthase subunit alpha [Streptococcus thermophilus CNRZ1066] >gi|116627374|ref|YP_819993.1| F0F1 ATP synthase subunit alpha [Streptococcus thermophilus LMD-9] >gi|122268025|sp|Q03LX5|ATPA_STRTD ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|81676598|sp|Q5M106|ATPA_STRT1 ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|81676747|sp|Q5M5J3|ATPA_STRT2 ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|55736550|gb|AAV60192.1| H+-translocating ATPase alpha subunit [Streptococcus thermophilus LMG 18311] >gi|55738440|gb|AAV62081.1| proton-translocating ATPase, alpha subunit [Streptococcus thermophilus CNRZ1066] >gi|116100651|gb|ABJ65797.1| F0F1-type ATP synthase, alpha subunit [Streptococcus thermophilus LMD-9] (501 aa)
Score = 1408, Expect = 1.2e-153, Identities = 272/483 (56%), Positives = 362/483 (74%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHF-KQQKTILETIDQTKDISQD 483
           M+IN  + S +IK QI+ +Q     +E G V  +GDGI +A GL N M  EL+ F NG +GM  NLE+   GI++LG F  I+EG  VKRT  +++VPVG+ L+GRV++ +G PIDG G+IK     P+E  APGVM R SV EPL+TG  A+D++ PIG+GQRELIIGD+QTGKT++AIDAI+NQKG++V CIYV IGQK ST+   + +L++ GAL+YT +V +SAS    L Y+AP+ G+ +AEE+M  G+ VLI+YDDLSK A+AYR LSLLLRRPPGREAYPGD+FYLHSRLLERS K++ + GGGSITALPII+T+AGDISAYI TNVISITDGQ+F+  NLFNSG RPAIDAG SVSRVG SAQI A+KK +G+L+L+LA YREL+AF+QFGSDLD  T+  L  G++ ++++KQ  + P     + ++L+++   ++  +PVD I DF+E +  +F    + I ETI  TKD+ ++
  S:     1 MAINAQEISALIKKQIENFQPNFDVTETGVVTYIGDGIARARGLDNAMSGELLEFSNGVFGMAQNLESNDVGIIILGDFYTIREGDEVKRTGKIMEVPVGEALIGRVVNPLGQPIDGLGDIKTTATRPVEAPAPGVMQRKSVSEPLQTGLKAVDALVPIGRGQRELIIGDRQTGKTSVAIDAILNQKGQDVICIYVAIGQKESTVRTQVESLRKHGALDYTIVVTASASQPSPLLYIAPYAGVAMAEEFMYNGKHVLIVYDDLSKQAVAYRELSLLLRRPPGREAYPGDVFYLHSRLLERSAKLSDDLGGGSITALPIIQTQAGDISAYIATNVISITDGQIFLQENLFNSGIRPAIDAGSSVSRVGGSAQIKAMKKVAGTLRLDLASYRELEAFTQFGSDLDAATQAKLNRGRRTVEVLKQPLHKPLPVEKQVLILYALTHGFLDSVPVDQILDFEEALYDYFDSHHEDIFETIRSTKDLPEE 484
>gi|19745845|ref|NP_606981.1| F0F1 ATP synthase subunit alpha [Streptococcus pyogenes MGAS8232] >gi|81763189|sp|Q8P1K6|ATPA_STRP8 ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|19747993|gb|AAL97480.1| putative proton-translocating ATPase, alpha subunit [Streptococcus pyogenes MGAS8232] (502 aa)
Score = 1408, Expect = 1.2e-153, Identities = 270/483 (55%), Positives = 364/483 (75%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK-QQKTILETIDQTKDISQD 483
           M+IN  + S +IK QI+ +Q     +E G V  +GDGI +A GL N M  EL+ FENG+YGM  NLE+   GI++LG F  I+EG +VKRT  +++VPVG+ L+GRV++ +G P+DG G+I+     P+E  APGVM R SV EPL+TG  AID++ PIG+GQRELIIGD+QTGKT++AIDAI+NQKG+++ CIYV IGQK ST+   + TL+++GAL+YT +V +SAS    L ++AP+ G+ +AEE+M +G+ VLI+YDDLSK A+AYR LSLLLRRPPGREAYPGD+FYLHSRLLERS K++ + GGGSITALP IET+AGDISAYI TNVISITDGQ+F+  NLFNSG RPAIDAG SVSRVG SAQI A+KK +G+L+L+LA YREL+AF+QFGSDLD  T+  L  G++ ++++KQ  + P     + ++L+++   ++  +PVD I  F+E +  +F      + ETI  TKD+ ++
  S:     1 MAINAQEISALIKKQIENFQPNFDVTETGIVTYIGDGIARARGLDNAMSGELLEFENGAYGMAQNLESNDVGIIILGDFSAIREGDVVKRTGKIMEVPVGEALIGRVVNPLGQPVDGLGDIETTGFRPVETPAPGVMQRKSVSEPLQTGLKAIDALVPIGRGQRELIIGDRQTGKTSVAIDAILNQKGQDMICIYVAIGQKESTVRTQVETLRRYGALDYTIVVTASASQPSPLLFIAPYAGVAMAEEFMYQGKHVLIVYDDLSKQAVAYRELSLLLRRPPGREAYPGDVFYLHSRLLERSAKVSDDLGGGSITALPFIETQAGDISAYIATNVISITDGQIFLQENLFNSGIRPAIDAGSSVSRVGGSAQIKAMKKVAGTLRLDLASYRELEAFTQFGSDLDAATQAKLNRGRRTVEILKQPLHKPLPVEKQVVILYALTHGFLDDVPVDDILAFEEALYDYFDVHYNDLFETIRTTKDLPEE 484
>gi|15896121|ref|NP_349470.1| F0F1 ATP synthase subunit alpha [Clostridium acetobutylicum ATCC 824] >gi|20137590|sp|Q9Z689|ATPA_CLOAB ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|15025913|gb|AAK80810.1|AE007784_7 FoF1-type ATP synthase alpha subunit [Clostridium acetobutylicum ATCC 824] >gi|4323566|gb|AAD16424.1| ATP synthase subunit alpha [Clostridium acetobutylicum] (505 aa)
Score = 1408, Expect = 1.3e-153, Identities = 284/495 (57%), Positives = 376/495 (75%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFK----EKIIRHFKQ-QKTILETIDQTKDISQDLFVQIKNEFNSL 495
           M+I  ++ ++IIK+QI+ Y++K    + G +I +GDGI +  GL N M  EL+ F N  YGM LNLE    G V+LG  E IKEG IVK T  VV+VPVG+ +LGRV++A+G PIDG G IK +   P++  A GV+ R SV +PL+TG  AIDSM PIGKGQRELIIGD+QTGKT IAID I+NQKGK+V CIYV IGQK ST+   +NT ++ GA++Y+ +VA++ASD   L YLAP++G+TIAE +M KG+DVLI+YDDLSKHA+AYRT+SLLLRRPPGREAYPGD+FYLHSRLLER+ K++++ GGGSITALPIIET AGD++ YIPTNVISITDGQ+F+ + LF +GQRPA+++G+SVSRVG SAQI A+KK SG+L+LELAQYREL AF+QFGSDLDKE+K+ LE GK++ +++KQ +  P     + ++L+++  +Y+  I V  +  F+    E +  H++   K ILE  + T DIS  L   I NE+  +
  S:     1 MNIKPEEITSIIKSQIEGYESKLETVDSGTIIEIGDGIARIYGLQNCMAGELLEFPNDVYGMALNLEQDNVGCVLLGSEEGIKEGDIVKSTGKVVEVPVGEEMLGRVVNALGQPIDGKGPIKAEDSKPVDIKATGVIDRQSVNQPLQTGIKAIDSMIPIGKGQRELIIGDRQTGKTAIAIDTILNQKGKDVICIYVAIGQKQSTVAHIVNTFEEMGAMDYSIVVAATASDSAPLQYLAPYSGVTIAENFMFKGKDVLIVYDDLSKHAVAYRTMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSQKLGGGSITALPIIETLAGDVAGYIPTNVISITDGQIFLESELFYAGQRPAVNSGISVSRVGGSAQIKAMKKLSGTLRLELAQYRELAAFAQFGSDLDKESKKRLEKGKRLTEMMKQPQYKPMPVEKQIMILYAVVNEYVMDIDVSKLSAFESGLFEYVDAHYRDLGKQILEKKELTDDISSQLTKAI-NEYKKI 499
>gi|94990143|ref|YP_598243.1| F0F1 ATP synthase subunit alpha [Streptococcus pyogenes MGAS10270] >gi|139474052|ref|YP_001128768.1| F0F1 ATP synthase subunit alpha [Streptococcus pyogenes str. Manfredo] >gi|158512783|sp|A2RFC4|ATPA_STRPG ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|118573495|sp|Q1JHN7|ATPA_STRPD ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|94543651|gb|ABF33699.1| ATP synthase alpha chain [Streptococcus pyogenes MGAS10270] >gi|134272299|emb|CAM30553.1| ATP synthase alpha chain [Streptococcus pyogenes str. Manfredo] (501 aa)
Score = 1407, Expect = 1.8e-153, Identities = 270/483 (55%), Positives = 364/483 (75%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK-QQKTILETIDQTKDISQD 483
           M+IN  + S +IK QI+ +Q     +E G V  +GDGI +A GL N M  EL+ FENG+YGM  NLE+   GI++LG F  I+EG +VKRT  +++VPVG+ L+GRV++ +G P+DG G+I+     P+E  APGVM R SV EPL+TG  AID++ PIG+GQRELIIGD+QTGKT++AIDAI+NQKG+++ CIYV IGQK ST+   + TL+++GAL+YT +V +SAS    L ++AP+ G+ +AEE+M +G+ VLI+YDDLSK A+AYR LSLLLRRPPGREAYPGD+FYLHSRLLERS K++ + GGGSITALP IET+AGDISAYI TNVISITDGQ+F+  NLFNSG RPAIDAG SVSRVG SAQI A+KK +G+L+L+LA YREL+AF+QFGSDLD  T+  L  G++ ++++KQ  + P     + ++L+++   ++  +PVD I  F+E +  +F      + ETI  TKD+ ++
  S:     1 MAINAQEISALIKKQIENFQPNFDVTETGIVTYIGDGIARARGLDNAMSGELLEFENGAYGMAQNLESNDVGIIILGDFSAIREGDVVKRTGKIMEVPVGEALIGRVVNPLGQPVDGLGDIETTGFRPVETPAPGVMQRKSVSEPLQTGLKAIDALVPIGRGQRELIIGDRQTGKTSVAIDAILNQKGQDMICIYVAIGQKESTVRTQVETLRRYGALDYTIVVTASASQPSPLLFIAPYAGVAMAEEFMYQGKHVLIVYDDLSKQAVAYRELSLLLRRPPGREAYPGDVFYLHSRLLERSAKVSDDLGGGSITALPFIETQAGDISAYIATNVISITDGQIFLQENLFNSGIRPAIDAGSSVSRVGGSAQIKAMKKVAGTLRLDLASYRELEAFTQFGSDLDAATQAKLNRGRRTVEILKQPLHKPLPVEKQVVILYALTHGFLDDVPVDDILAFEEALYDYFDVHYDNLFETIRTTKDLPEE 484
>gi|167747406|ref|ZP_02419533.1| hypothetical protein ANACAC_02126 [Anaerostipes caccae DSM 14662] >gi|167652768|gb|EDR96897.1| hypothetical protein ANACAC_02126 [Anaerostipes caccae DSM 14662] (503 aa)
Score = 1405, Expect = 2.6e-153, Identities = 272/489 (55%), Positives = 365/489 (74%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQ-----KTILETIDQTKDISQDLFVQIK 489
           M++  ++ S++IK QIK+Y  K   S+IG VI V DGI +  GL   M  EL+ F    YGM LNLE    G V+LG  ++I EG +VK T  VV+VPVGD + GRV++++G PIDG G I+ +K  PIE++A GV++R SV  PL+TG  AID+M PIG+GQRELIIGD+QTGKT IA+D IINQKG+ V CIYV IGQK+ST+   + T +++GA++YTT+VAS+AS+L  L Y+AP+ G  I EEWM  GEDVL+IYDDLSKHA AYRTLSLLLRRPPGREAYPGD+FYLHSRLLER+ K++ E GGGS+TALP+IET+AGD+SAYIPTNVISITDGQ+++ T +FN+G RPAI+AGLSVSRVG +AQI A+KK +G ++ +LAQYREL AF+QFGS+LD +TKE L  G+++ +++KQ +  P     + +++++   KY+  I VD I  F++++      +     ++I ET +  K+  + L   IK
  S:     1 MNLRPEEISSVIKEQIKQYSTKLETSDIGTVIQVADGIARIHGLDEAMQGELLEFPGEVYGMVLNLEEDNVGAVLLGDQKNISEGDVVKTTGRVVEVPVGDAMTGRVVNSLGQPIDGKGPIETEKYRPIERVASGVISRKSVDTPLQTGIKAIDAMVPIGRGQRELIIGDRQTGKTAIAVDTIINQKGQGVHCIYVAIGQKSSTVANIVKTFEEYGAMDYTTVVASTASELAPLQYIAPYAGCAIGEEWMENGEDVLVIYDDLSKHATAYRTLSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSDELGGGSLTALPLIETQAGDVSAYIPTNVISITDGQIYLETEMFNAGFRPAINAGLSVSRVGGAAQIKAMKKIAGPIRTDLAQYRELAAFAQFGSELDDDTKERLAQGERIKEVLKQPQYQPLPVEQQVVIIYAATRKYLLEIKVDDILAFQKELFELIDTKYPDVFRSIRETKELGKETEEMLITAIK 494
>gi|167748910|ref|ZP_02421037.1| hypothetical protein ANACAC_03684 [Anaerostipes caccae DSM 14662] >gi|167651532|gb|EDR95661.1| hypothetical protein ANACAC_03684 [Anaerostipes caccae DSM 14662] (502 aa)
Score = 1405, Expect = 2.8e-153, Identities = 271/487 (55%), Positives = 374/487 (76%)
  Q:     2 SINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKT-ILETIDQTKDISQDLFVQI 488
           +IN +   +++K++I++Y+NK    E G VI VGDGI    GL++ M  ELV FENG+ G+  NLE  T G V+LG    + EGS V R+     VPVGD L+GRV++A+G PIDGNG IK D  +PIE+ A GV+ R SV  PLETG LAID+MFPIG+GQRELIIGD+QTGKT+IA+D I+NQKGK+V C+YV IGQK ST+ + ++TLK+  A++Y+ +V++SASD+  + Y+AP++G  +AE +M KG+DVLI+YDDLSKHA+AYR +SLLL+RPPGREAYPGD+FYLHSRLLERS ++N+E+GGGSITALPIIET AGD+SAYIPTNVISITDGQ+F+ ++LF SG RPA++ GLSVSRVG +AQ  A+KK SGSL+++LAQ+RE++ F+QF SDLD +TKE+L+HG ++++L+KQ    P S   + ILL +   + +  +PV+ I+ F E ++  F+ + + ++  ID+ K ++ ++  QI
  S:     6 NINPEGIISVLKSEIEDYENKIEVQEEGTVIQVGDGIATVHGLNHAMYGELVEFENGTRGIVQNLEMKTIGCVLLGSDHGLIEGSKVVRSGKRAGVPVGDALVGRVVNALGAPIDGNGPIKTDGYLPIEREAAGVIDRKSVDVPLETGILAIDAMFPIGRGQRELIIGDRQTGKTSIAVDTILNQKGKDVICVYVAIGQKASTLAKIVSTLKKHDAMDYSIVVSASASDVAPVQYIAPYSGTAMAEYFMDKGKDVLIVYDDLSKHAVAYRAMSLLLQRPPGREAYPGDVFYLHSRLLERSCRLNEEHGGGSITALPIIETLAGDVSAYIPTNVISITDGQIFLESDLFFSGIRPAVNVGLSVSRVGGAAQTKAMKKVSGSLRIDLAQFREMEVFTQFSSDLDPQTKELLDHGNRLVELLKQPLYHPMSLHKQVILLCAANHRLLMDVPVNEIKSFTEDLVSFFEAKYSQLVREIDEKKVLTDEVTEQI 493
>gi|104773793|ref|YP_618773.1| F0F1 ATP synthase subunit alpha [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|118573479|sp|Q1GAW7|ATPA_LACDA ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|103422874|emb|CAI97536.1| H+ transporting ATPase / ATP synthase, alpha subunit [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] (503 aa)
Score = 1403, Expect = 4.0e-153, Identities = 261/464 (56%), Positives = 364/464 (78%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHF 464
           MSI  ++ S++IK Q++ Y +K    E+G V  VGDGI +A GL+NV+ +EL+ F+NG+YG+  NLE+   GI++LGKF+DI+EG  VKRT  +++VPVGD L+GRV++ +G P+DG GEIK DK  PIE  APGVM R SV +PL+TG  AID++ PIG+GQREL+IGD++TGKT++AID I+NQKG++V CIYV IGQK ST+   + TLK+ GA++YT +V +  S+   + Y+AP++GI + EE+M  G+DVL+++DDLSK A+AYR LSLLLRRPPGREAYPGD+FYLHSRLLERS K++KE GGGS+TALP+I+TEAGDISAYIPTNVISITDGQ+F+ +++F SG RPAIDAG SVSRVG +AQI A+KK +G+L+ +LA YREL++F+QFGSDLD+ T+  L  G++ ++++KQ  + P +   + +LL+++   ++  +PVD I  F++++   F
  S:     1 MSIKAEEISSLIKQQLEHYDDKLDIEEVGVVTYVGDGIARAHGLNNVLSSELLQFDNGAYGIAQNLESNDVGIIILGKFDDIREGDRVKRTGRIMEVPVGDALIGRVVNPLGQPVDGLGEIKTDKTRPIESKAPGVMQRQSVNQPLQTGIKAIDALVPIGRGQRELVIGDRKTGKTSLAIDTILNQKGQDVICIYVSIGQKESTVRAQVETLKKLGAMDYTIVVEAGPSEPAPMLYIAPYSGIAMGEEFMYAGKDVLVVFDDLSKQAVAYRELSLLLRRPPGREAYPGDVFYLHSRLLERSAKLSKELGGGSLTALPVIQTEAGDISAYIPTNVISITDGQIFLQSDMFFSGTRPAIDAGASVSRVGGAAQIPAMKKVAGTLRTDLASYRELESFAQFGSDLDQATQAKLARGRRTVEVLKQPLHKPVAVEKQVVLLYALTHGFMDAVPVDDIARFEQELYTDF 464
>gi|20070091|gb|AAM01188.1| H+-ATPase cytoplasmic F1-part alpha-subunit [Streptococcus thermophilus] (501 aa)
Score = 1403, Expect = 4.9e-153, Identities = 271/483 (56%), Positives = 361/483 (74%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHF-KQQKTILETIDQTKDISQD 483
           M+IN  + S +IK QI+ +Q     +E G V  +GDGI +A GL N M  E + F NG +GM  NLE+   GI++LG F  I+EG  VKRT  +++VPVG+ L+GRV++ +G PIDG G+IK     P+E  APGVM R SV EPL+TG  A+D++ PIG+GQRELIIGD+QTGKT++AIDAI+NQKG++V CIYV IGQK ST+   + +L++ GAL+YT +V +SAS    L Y+AP+ G+ +AEE+M  G+ VLI+YDDLSK A+AYR LSLLLRRPPGREAYPGD+FYLHSRLLERS K++ + GGGSITALPII+T+AGDISAYI TNVISITDGQ+F+  NLFNSG RPAIDAG SVSRVG SAQI A+KK +G+L+L+LA YREL+AF+QFGSDLD  T+  L  G++ ++++KQ  + P     + ++L+++   ++  +PVD I DF+E +  +F    + I ETI  TKD+ ++
  S:     1 MAINAQEISALIKKQIENFQPNFDVTETGVVTYIGDGIARARGLDNAMSGEALEFSNGVFGMAQNLESNDVGIIILGDFYTIREGDEVKRTGKIMEVPVGEALIGRVVNPLGQPIDGLGDIKTTATRPVEAPAPGVMQRKSVSEPLQTGLKAVDALVPIGRGQRELIIGDRQTGKTSVAIDAILNQKGQDVICIYVAIGQKESTVRTQVESLRKHGALDYTIVVTASASQPSPLLYIAPYAGVAMAEEFMYNGKHVLIVYDDLSKQAVAYRELSLLLRRPPGREAYPGDVFYLHSRLLERSAKLSDDLGGGSITALPIIQTQAGDISAYIATNVISITDGQIFLQENLFNSGIRPAIDAGSSVSRVGGSAQIKAMKKVAGTLRLDLASYRELEAFTQFGSDLDAATQAKLNRGRRTVEVLKQPLHKPLPVEKQVLILYALTHGFLDSVPVDQILDFEEALYDYFDSHHEDIFETIRSTKDLPEE 484
>gi|150388191|ref|YP_001318240.1| ATP synthase F1, alpha subunit [Alkaliphilus metalliredigens QYMF] >gi|166990351|sp|A6TK63|ATPA_ALKMQ ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|149948053|gb|ABR46581.1| ATP synthase F1, alpha subunit [Alkaliphilus metalliredigens QYMF] (505 aa)
Score = 1402, Expect = 5.2e-153, Identities = 270/463 (58%), Positives = 353/463 (76%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRH 463
           M++  ++ S+II+ QIK Y+NK    ++G VI VGD I +  GL   M  EL+ F  G YGM LNLE    G V+LG  + IKEG  VKRT  +V+VPVG+ LLGRV++++G PIDG G I+ DK   IE++APG++AR SV EPL+TG  AIDSM PIG+GQRELIIGD+QTGKT IAID IINQK  +V CIYV IGQK ST+ Q  +TL++ GA+EYT IVAS+AS+L  L Y+AP+ G  + EE+M  G+ VLIIYDDLSKHA+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K++ E GGGS+TALP+IET+AGD+SAYIPTNVISITDGQ+F+ + LF SG RPA++ G+SVSRVG +AQI A+KK +G+L+LELAQYREL AF+QFGS+LDKET+  L  G+++++++KQ +  P     + +++++I  KY+  I V  I  F+ + I +
  S:     1 MNLRPEEISSIIQEQIKRYENKLEVKDVGTVIQVGDAIARIHGLEKCMAGELLEFPGGVYGMALNLEEDNVGCVLLGSDDKIKEGDTVKRTGRIVEVPVGEALLGRVVNSLGQPIDGKGPIQTDKYRDIERVAPGIIARKSVHEPLQTGIKAIDSMIPIGRGQRELIIGDRQTGKTAIAIDTIINQKHSDVICIYVAIGQKKSTVSQIQDTLEKNGAMEYTIIVASTASELAPLQYIAPYAGCAMGEEFMENGKHVLIIYDDLSKHAVAYRAMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSDERGGGSLTALPLIETQAGDVSAYIPTNVISITDGQIFLESELFYSGVRPAVNPGISVSRVGGNAQIKAMKKVAGTLRLELAQYRELAAFAQFGSELDKETQARLAQGERIIEMLKQPQFKPMPVEEQVMMIYAITNKYLTDIEVVEIGPFESQFISY 463
>gi|196251787|ref|ZP_03150453.1| ATP synthase F1, alpha subunit [Clostridium thermocellum DSM 4150] >gi|196198727|gb|EDX93558.1| ATP synthase F1, alpha subunit [Clostridium thermocellum DSM 4150] (506 aa)
Score = 1401, Expect = 7.6e-153, Identities = 272/502 (54%), Positives = 367/502 (73%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWM-SKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQ-KTILETIDQTKDISQDLFVQIKNEFNSLITSYIKT 502
           M +  ++ S IIK QI +Y NK+   ++G V+  GDGI +  GL+N M  EL+ FENG +GM +NLE    G V+     D+KEG++VKRT   V+VPVG+ L+GRVID +GNP+DG G+IK +K  PIE  AP VM R  V  PL+TG +AID+M PIG+GQRELIIGD+QTGKT IA+D I+NQKGK+V CIYV IGQK S++ + INTL++ GA+EYT +V+S+AS++P+L Y+AP+ G +IAEE+M +  +DVLI+YDDLSKHA+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ +++ E GGGSITALPIIET+ GD+SAYIPTNVISITDGQ+++ T LF SGQRPA++ GLSVSRVG +AQI A+KK +G+L++ LAQYREL  F+QFGSDLDK TK+ L  G+++++ +KQ +        + I+L+    KY+  +PV  +  F ++ ++        I   I  T D+S +    +K         Y++T
  S:     1 MDLRPEEVSAIIKQQIDKYGNKSHVDDVGYVLQAGDGIARVYGLNNCMSGELLEFENGVFGMAMNLEEDNIGCVLFRGERDVKEGTLVKRTGKTVEVPVGNSLIGRVIDPLGNPLDGKGKIKTEKFRPIEYPAPSVMDRKPVNRPLQTGIMAIDAMVPIGRGQRELIIGDRQTGKTAIAVDTILNQKGKDVICIYVAIGQKASSVAEVINTLEEGGAMEYTVVVSSTASEMPTLQYIAPYAGCSIAEEFMYNDHKDVLIVYDDLSKHAVAYRAMSLLLRRPPGREAYPGDVFYLHSRLLERAAQLSDELGGGSITALPIIETQVGDVSAYIPTNVISITDGQIYLETELFYSGQRPAVNVGLSVSRVGGAAQIKAMKKVAGALRINLAQYRELAVFAQFGSDLDKVTKDKLIQGERLVESLKQSRRATMPVEDQVIVLYMATNKYLMDLPVKEVRSFNKEFVKFVNSNYPEIPNEIRATGDLSSETENMLKKAAEEFKDQYLRT 504
>gi|2662324|dbj|BAA23753.1| proton-translocating ATPase alpha subunit [Streptococcus equinus] (501 aa)
Score = 1400, Expect = 9.3e-153, Identities = 270/483 (55%), Positives = 362/483 (74%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQ-KTILETIDQTKDISQD 483
           M+IN  + S +IK QI+ +Q     +E G V  +GDGI +A GL N M  EL+ F NG++GM  NLE+   GI++LG F  I+EG  VKRT  +++VPVG+ L+GRV++ +G P+DG G+IK     P+E  APGVM R SV EPL+TG  AID++ PIG+GQRELIIGD+QTGKT++AIDAI+NQKG+++ CIYV IGQK ST+   + TL+++GAL+YT +V +SAS    L Y+AP+ G+ +AEE+M  G+ VLI+YDDLSK A+AYR LSLLLRRPPGREAYPGD+FYLHSRLLERS K++   GGGSITALP IET+AGDISAYI TNVISITDGQ+F+  NLFNSG RPAIDAG SVSRVG SAQI A+KK +G+L+L+LA YREL+AF+QFGSDLD  T+  L  G++ ++++KQ  + P     + ++L+++   ++  +PV+ I  F+E +  +F    ++I ETI  TKD+ ++
  S:     1 MAINAQEISALIKKQIENFQPNFDVTETGVVTYIGDGIARARGLDNAMSGELLEFSNGAFGMAQNLESNDVGIIILGDFSTIREGDEVKRTGKIMEVPVGEALIGRVVNPLGQPVDGLGDIKTTATRPVETPAPGVMQRKSVSEPLQTGLKAIDALVPIGRGQRELIIGDRQTGKTSVAIDAILNQKGQDMICIYVAIGQKESTVRTQVETLRKYGALDYTIVVTASASQPSPLLYIAPYAGVAMAEEFMYNGKHVLIVYDDLSKQAVAYRELSLLLRRPPGREAYPGDVFYLHSRLLERSAKVSDALGGGSITALPFIETQAGDISAYIATNVISITDGQIFLQENLFNSGIRPAIDAGSSVSRVGGSAQIKAMKKVAGTLRLDLASYRELEAFTQFGSDLDAATQAKLNRGRRTVEVLKQPVHKPLPVEKQVVILYALTHGFLDDVPVNDILAFEEALYDYFDAHYESIFETIRTTKDLPEE 484
>gi|125975089|ref|YP_001038999.1| ATP synthase F1, alpha subunit [Clostridium thermocellum ATCC 27405] >gi|158513256|sp|A3DIM7|ATPA_CLOTH ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|125715314|gb|ABN53806.1| ATP synthase F1, alpha subunit [Clostridium thermocellum ATCC 27405] (506 aa)
Score = 1400, Expect = 1.1e-152, Identities = 272/502 (54%), Positives = 366/502 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWM-SKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQ-KTILETIDQTKDISQDLFVQIKNEFNSLITSYIKT 502
           M +  ++ S IIK QI +Y NK+   ++G V+  GDGI +  GL+N M  EL+ FENG +GM +NLE    G V+     D+KEG++VKRT   V+VPVG  L+GRVID +GNP+DG GEI+ +K  PIE  AP VM R  V  PL+TG +AID+M PIG+GQRELIIGD+QTGKT IA+D I+NQKGK+V CIYV IGQK S++ + INTL++ GA+EYT +V+S+AS++P+L Y+AP+ G +IAEE+M +  +DVLI+YDDLSKHA+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ +++ E GGGSITALPIIET+ GD+SAYIPTNVISITDGQ+++ T LF SGQRPA++ GLSVSRVG +AQI A+KK +G+L++ LAQYREL  F+QFGSDLDK TK+ L  G+++++ +KQ +        + I+L+    KY+  +PV  +  F ++ ++        I   I  T D+S +    +K         Y++T
  S:     1 MDLRPEEVSAIIKQQIDKYGNKSHVDDVGYVLQAGDGIARVYGLNNCMSGELLEFENGVFGMAMNLEEDNIGCVLFRGERDVKEGTLVKRTGKTVEVPVGKALIGRVIDPLGNPLDGKGEIETEKFRPIEYPAPSVMDRKPVNRPLQTGIMAIDAMVPIGRGQRELIIGDRQTGKTAIAVDTILNQKGKDVICIYVAIGQKASSVAEVINTLEEGGAMEYTVVVSSTASEMPTLQYIAPYAGCSIAEEFMYNDHKDVLIVYDDLSKHAVAYRAMSLLLRRPPGREAYPGDVFYLHSRLLERAAQLSDELGGGSITALPIIETQVGDVSAYIPTNVISITDGQIYLETELFYSGQRPAVNVGLSVSRVGGAAQIKAMKKVAGALRINLAQYRELAVFAQFGSDLDKVTKDKLIQGERLVESLKQSRRATMPVEDQVIVLYMATNKYLMDLPVKEVRSFNKEFVKFVNSNYPEIPNEIRATGDLSSETENMLKKAAEEFKDQYLRT 504
>gi|22537024|ref|NP_687875.1| F0F1 ATP synthase subunit alpha [Streptococcus agalactiae 2603V/R] >gi|76787122|ref|YP_329606.1| F0F1 ATP synthase subunit alpha [Streptococcus agalactiae A909] >gi|76799294|ref|ZP_00781461.1| ATP synthase F1, alpha subunit [Streptococcus agalactiae 18RS21] >gi|77406456|ref|ZP_00783512.1| ATP synthase F1, alpha subunit [Streptococcus agalactiae H36B] >gi|77407975|ref|ZP_00784725.1| ATP synthase F1, alpha subunit [Streptococcus agalactiae COH1] >gi|77410734|ref|ZP_00787093.1| ATP synthase F1, alpha subunit [Streptococcus agalactiae CJB111] >gi|77414092|ref|ZP_00790260.1| ATP synthase F1, alpha subunit [Streptococcus agalactiae 515] >gi|81744392|sp|Q8E074|ATPA_STRA5 ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|109939721|sp|Q3K1J7|ATPA_STRA1 ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|22533881|gb|AAM99747.1|AE014231_5 ATP synthase F1, alpha subunit [Streptococcus agalactiae 2603V/R] >gi|76562179|gb|ABA44763.1| ATP synthase F1, alpha subunit [Streptococcus agalactiae A909] >gi|76585354|gb|EAO61945.1| ATP synthase F1, alpha subunit [Streptococcus agalactiae 18RS21] >gi|77159844|gb|EAO70987.1| ATP synthase F1, alpha subunit [Streptococcus agalactiae 515] >gi|77163270|gb|EAO74222.1| ATP synthase F1, alpha subunit [Streptococcus agalactiae CJB111] >gi|77173433|gb|EAO76552.1| ATP synthase F1, alpha subunit [Streptococcus agalactiae COH1] >gi|77174925|gb|EAO77738.1| ATP synthase F1, alpha subunit [Streptococcus agalactiae H36B] (501 aa)
Score = 1400, Expect = 1.1e-152, Identities = 266/483 (55%), Positives = 363/483 (75%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQ-KTILETIDQTKDISQD 483
           M+IN  + S +IK QI+++Q     +E G V  +GDGI +A GL N M  EL+ F NG+YGM  NLE+   GI++LG F +I+EG +VKRT  +++VPVG+ ++GRV++ +G P+DG GEI+     P+E  APGVM R SV EPL+TG  AID++ PIG+GQRELIIGD+QTGKT++AIDAI+NQKG+++ CIYV IGQK ST+   + TL+++GAL+YT +V +SAS    L ++AP+ G+ +AEE+M  G+ VLI+YDDLSK A+AYR LSLLLRRPPGREAYPGD+FYLHSRLLERS K++   GGGSITALP IET+AGDISAYI TNVISITDGQ+F+  NLFNSG RPAIDAG SVSRVG +AQI A+K+ +G+L+L+LA YREL+AF+QFGSDLD  T+  L  G++ ++++KQ  + P     + ++L+++   ++  +PV+ I  F+E +  +F      + ETI  TKD+ ++
  S:     1 MAINAQEISALIKKQIEDFQPNFDVTETGIVTYIGDGIARARGLDNAMSGELLEFSNGAYGMAQNLESNDVGIIILGDFSEIREGDVVKRTGKIMEVPVGEAMIGRVVNPLGQPVDGLGEIETTATRPVETPAPGVMQRKSVFEPLQTGLKAIDALVPIGRGQRELIIGDRQTGKTSVAIDAILNQKGQDMICIYVAIGQKESTVRTQVETLRKYGALDYTIVVTASASQPSPLLFIAPYAGVAMAEEFMYNGKHVLIVYDDLSKQAVAYRELSLLLRRPPGREAYPGDVFYLHSRLLERSAKVSDALGGGSITALPFIETQAGDISAYIATNVISITDGQIFLQENLFNSGIRPAIDAGSSVSRVGGAAQIKAMKRVAGTLRLDLASYRELEAFTQFGSDLDAATQAKLNRGRRTVEVLKQPLHKPLPVEKQVVILYALTHGFLDDVPVNDILAFEEALYDYFDAHYDNLFETIRTTKDLPEE 484
>gi|118443884|ref|YP_878998.1| F0F1 ATP synthase subunit alpha [Clostridium novyi NT] >gi|158512414|sp|A0Q2Z6|ATPA_CLONN ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|118134340|gb|ABK61384.1| ATP synthase F1, alpha subunit [Clostridium novyi NT] (502 aa)
Score = 1399, Expect = 1.2e-152, Identities = 278/501 (55%), Positives = 372/501 (74%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQ-KTILETIDQTKDISQDLFVQIKNEFNSLITSYIK 501
           M++  ++ ++IIK QI+ Y++K    + G +I +GDGI +  G+ + M  EL+ F N  YGM LNLE    G V+LG  + IKEG +VKRT  VV+VPVG+ L+GRV++A+G P+DG G IK  +   IE  APGV+ R SV EPL+TG  AIDSM PIGKGQRELIIGD+Q GKT IAID IINQK KNVKCIYV IGQK ST+   +NTL + GA++YT +V+S+ASD   L +L+P++G ++AE +M KGEDVLIIYDDLSKHA+AYRT+SLLLRRPPGREAYPGD+FY+HSRLLER+ K++ + GGGSITALPIIET AGD++AYIPTNVISITDGQ+F+ + LF +GQ+PA++AG+SVSRVG +AQI A+K+ SG+L+LELAQYREL AF+QFGSDLD  +KE LE GK++++++KQD+  P     + I+L++    Y+  I V  I  F+ + + +     + + + I   K+++ D    IK E N+ I  + K
  S:     1 MNVKPEEITSIIKKQIESYEHKIQTVDSGTIIQIGDGIARVYGIEDCMEGELLEFPNDVYGMALNLEQDNVGCVLLGPEKGIKEGDVVKRTGRVVEVPVGEALIGRVVNALGQPLDGKGPIKCTQTRAIELEAPGVIERKSVKEPLQTGIKAIDSMVPIGKGQRELIIGDRQIGKTAIAIDTIINQKDKNVKCIYVAIGQKQSTVAHIVNTLTEMGAMDYTIVVSSTASDSAPLQFLSPYSGCSMAEYFMLKGEDVLIIYDDLSKHAVAYRTMSLLLRRPPGREAYPGDVFYIHSRLLERAAKLSDKLGGGSITALPIIETLAGDVTAYIPTNVISITDGQIFLESELFYAGQKPAVNAGISVSRVGGNAQIKAMKQVSGTLRLELAQYRELAAFAQFGSDLDNSSKERLEKGKRLVEILKQDQYKPMPVEKQIIILYAAVNNYLSDIKVSDIRTFEREFLEYVDTHYRDLGQKILDKKELTDD----IKGELNTAIQEFKK 498
>gi|168185930|ref|ZP_02620565.1| ATP synthase F1, alpha subunit [Clostridium botulinum C str. Eklund] >gi|169296141|gb|EDS78274.1| ATP synthase F1, alpha subunit [Clostridium botulinum C str. Eklund] (502 aa)
Score = 1399, Expect = 1.2e-152, Identities = 277/501 (55%), Positives = 371/501 (74%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQ-KTILETIDQTKDISQDLFVQIKNEFNSLITSYIK 501
           M++  ++ ++IIK QI+ Y++K    + G +I +GDGI +  G+ + M  EL+ F N  YGM LNLE    G V+LG  + IKEG +VKRT  VV+VPVG+ L+GRV++A+G P+DG G IK  +   IE  APGV+ R SV EPL+TG  AIDSM PIGKGQRELIIGD+Q GKT IAID I+NQKGK+VKCIYV IGQK ST+   +NTL + GA++YT +V+S+ASD   L +L+P+ G ++AE +M KGEDVLIIYDDLSKHA+AYRT+SLLLRRPPGREAYPGD+FY+HSRLLER+ K++ + GGGSITALPIIET AGD++AYIPTNVISITDGQ+F+ + LF +GQ+PA++AG+SVSRVG +AQI A+K+ SG+L+LELAQYREL AF+QFGSDLD  +KE LE GK++++++KQD+  P     + I+L++    Y+  I V  I  F+ + + +     + +   I   K+++ D    IK E N+ I  + K
  S:     1 MNVKPEEITSIIKKQIESYEHKIQTVDSGTIIQIGDGIARVYGIEDCMEGELLEFPNDVYGMALNLEQDNVGCVLLGPEKGIKEGDVVKRTGRVVEVPVGEALIGRVVNALGQPLDGKGPIKCTQTRAIELEAPGVIERKSVKEPLQTGIKAIDSMVPIGKGQRELIIGDRQIGKTAIAIDTILNQKGKDVKCIYVAIGQKQSTVAHIVNTLTEMGAMDYTIVVSSTASDSAPLQFLSPYAGCSMAEYFMLKGEDVLIIYDDLSKHAVAYRTMSLLLRRPPGREAYPGDVFYIHSRLLERAAKLSDKLGGGSITALPIIETLAGDVTAYIPTNVISITDGQIFLESELFYAGQKPAVNAGISVSRVGGNAQIKAMKQVSGTLRLELAQYRELAAFAQFGSDLDNSSKERLEKGKRLVEILKQDQYKPMPVEKQIIILYAAVNNYLSDIKVSDIRTFEREFLEYVDTHYRDLGSKILDKKELTDD----IKGELNTAIQEFKK 498
>gi|171779636|ref|ZP_02920592.1| hypothetical protein STRINF_01473 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gi|171281738|gb|EDT47172.1| hypothetical protein STRINF_01473 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] (501 aa)
Score = 1399, Expect = 1.4e-152, Identities = 269/483 (55%), Positives = 362/483 (74%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQ-KTILETIDQTKDISQD 483
           M+IN  + S +I+ QI+ +Q     +E G V  +GDGI +A GL N M  EL+ F NG++GM  NLE+   GI++LG F  I+EG  VKRT  +++VPVG+ L+GRV++ +G P+DG G+IK     P+E  APGVM R SV EPL+TG  AID++ PIG+GQRELIIGD+QTGKT++AIDAI+NQKG+++ CIYV IGQK ST+   + TL+++GAL+YT +V +SAS    L Y+AP+ G+ +AEE+M  G+ VLI+YDDLSK A+AYR LSLLLRRPPGREAYPGD+FYLHSRLLERS K++   GGGSITALP IET+AGDISAYI TNVISITDGQ+F+  NLFNSG RPAIDAG SVSRVG SAQI A+KK +G+L+L+LA YREL+AF+QFGSDLD  T+  L  G++ ++++KQ  + P     + ++L+++   ++  +PV+ I  F+E +  +F    ++I ETI  TKD+ ++
  S:     1 MAINAQEISALIRKQIENFQPNFDVTETGVVTYIGDGIARARGLDNAMSGELLEFSNGAFGMAQNLESNDVGIIILGDFSTIREGDEVKRTGKIMEVPVGEALIGRVVNPLGQPVDGLGDIKTTATRPVETPAPGVMQRKSVSEPLQTGLKAIDALVPIGRGQRELIIGDRQTGKTSVAIDAILNQKGQDMICIYVAIGQKESTVRTQVETLRKYGALDYTIVVTASASQPSPLLYIAPYAGVAMAEEFMYNGKHVLIVYDDLSKQAVAYRELSLLLRRPPGREAYPGDVFYLHSRLLERSAKVSDALGGGSITALPFIETQAGDISAYIATNVISITDGQIFLQENLFNSGIRPAIDAGSSVSRVGGSAQIKAMKKVAGTLRLDLASYRELEAFTQFGSDLDAATQAKLNRGRRTVEVLKQPVHKPLPVEKQVVILYALTHGFLDDVPVNDILAFEESLYDYFDAHYESIFETIRTTKDLPEE 484
>gi|25010934|ref|NP_735329.1| F0F1 ATP synthase subunit alpha [Streptococcus agalactiae NEM316] >gi|81744547|sp|Q8E5V0|ATPA_STRA3 ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|23095313|emb|CAD46523.1| H+-transporting ATP synthase alpha chain [Streptococcus agalactiae NEM316] (501 aa)
Score = 1398, Expect = 1.5e-152, Identities = 266/483 (55%), Positives = 363/483 (75%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQ-KTILETIDQTKDISQD 483
           M+IN  + S +IK QI+++Q     +E G V  +GDGI +A GL N M  EL+ F NG+YGM  NLE+   GI++LG F +I+EG +VKRT  +++VPVG+ ++GRV++ +G P+DG GEI+     P+E  APGVM R SV EPL+TG  AID++ PIG+GQRELIIGD+QTGKT++AIDAI+NQKG+++ CIYV IGQK ST+   + TL+++GAL+YT +V +SAS    L ++AP+ G+ +AEE+M  G+ VLI+YDDLSK A+AYR LSLLLRRPPGREAYPGD+FYLHSRLLERS K++   GGGSITALP IET+AGDISAYI TNVISITDGQ+F+  NLFNSG RPAIDAG SVSRVG +AQI A+K+ +G+L+L+LA YREL+AF+QFGSDLD  T+  L  G++ ++++KQ  + P     + ++L+++   ++  +PV+ I  F+E +  +F      + ETI  TKD+ ++
  S:     1 MAINAQEISALIKKQIEDFQPNFDVTETGIVTYIGDGIARARGLDNAMSGELLEFSNGAYGMAQNLESNDVGIIILGDFSEIREGDVVKRTGKIMEVPVGEAMIGRVVNPLGQPVDGLGEIETTATRPVETPAPGVMQRKSVFEPLQTGLKAIDALVPIGRGQRELIIGDRQTGKTSVAIDAILNQKGQDMICIYVAIGQKESTVRTQVETLRKYGALDYTIVVTASASQPSPLLFIAPYAGVAMAEEFMYNGKHVLIVYDDLSKQAVAYRELSLLLRRPPGREAYPGDVFYLHSRLLERSAKLSDALGGGSITALPFIETQAGDISAYIATNVISITDGQIFLQENLFNSGIRPAIDAGSSVSRVGGAAQIKAMKRVAGTLRLDLASYRELEAFTQFGSDLDAATQAKLNRGRRTVEVLKQPLHKPLPVEKQVVILYALTHGFLDDVPVNDILAFEEALYDYFDAHYDNLFETIRTTKDLPEE 484
>gi|24379919|ref|NP_721874.1| F0F1 ATP synthase subunit alpha [Streptococcus mutans UA159] >gi|2493021|sp|P95787|ATPA_STRMU ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|24377899|gb|AAN59180.1|AE014985_4 FoF1 membrane-bound proton-translocating ATPase, alpha subunit [Streptococcus mutans UA159] >gi|1773264|gb|AAD13381.1| ATPase, alpha subunit [Streptococcus mutans] (501 aa)
Score = 1398, Expect = 1.6e-152, Identities = 269/483 (55%), Positives = 360/483 (74%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKT-ILETIDQTKDISQD 483
           M+IN  + S +IK QI+ +Q     +E G V  +GDGI +A GL N M  EL+ F+NG++GM  NLE++  GI++LG F  I+EG  VKRT  +++VPVG  L+GRV++ +G P+DG GEI+     P+E  APGVM R SV EPL+TG  AID++ PIG+GQREL+IGD+QTGKT+IAIDAIINQKG+++ CIYV IGQK ST+   +  L+++GAL+YT +V +SAS    L Y+AP+ G+ +AEE+M  G+  LI+YDDLSK A+AYR LSLLLRRPPGREAYPGD+FYLHSRLLERS K++ E GGGSITALP IET+AGDISAYI TNVISITDGQ+F+  NLFNSG RPAIDAG SVSRVG SAQI A+KK +G+L+L+LA YREL+AF+QFGSDLD  T+  L  G++ ++++KQ  + P +   + ++L+++   ++  +PVD I  F++ +  +       I ETI  TKD+ ++
  S:     1 MAINAQEISALIKKQIENFQPNFDVTETGVVTYIGDGIARACGLDNAMSGELLEFDNGTFGMAQNLESSDIGIIILGDFNSIREGDTVKRTGKIMEVPVGQSLIGRVVNPLGQPVDGLGEIETTATRPVEAAAPGVMQRQSVSEPLQTGIKAIDALVPIGRGQRELVIGDRQTGKTSIAIDAIINQKGQDMICIYVAIGQKESTVRSQVEVLRKYGALDYTIVVTASASQPSPLLYIAPYAGVAMAEEFMYNGKHALIVYDDLSKQAVAYRELSLLLRRPPGREAYPGDVFYLHSRLLERSAKLSDELGGGSITALPFIETQAGDISAYIATNVISITDGQIFLQENLFNSGIRPAIDAGSSVSRVGGSAQIKAMKKVAGTLRLDLASYRELEAFTQFGSDLDSATQAKLNRGRRTVEVLKQGLHKPLAVEKQVLILYALTHGFLDSVPVDDILTFQDDMFDYIDSHDADIFETIRTTKDLPEE 484
>gi|171323834|ref|ZP_02912352.1| ATP synthase F1, alpha subunit [Geobacillus sp. WCH70] >gi|171090145|gb|EDT36457.1| ATP synthase F1, alpha subunit [Geobacillus sp. WCH70] (502 aa)
Score = 1398, Expect = 1.6e-152, Identities = 275/502 (54%), Positives = 368/502 (73%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQ-KTILETIDQTKDISQDLFVQIKNEFNSLITSYIKT 502
           MSI  ++ S +IK QI+ Y+++   S++G VI +GDGI +A GL NVM  ELV F NG  GM LNLE    GIV+LG +  IKEG  V+RT  +++VPVG+ L+GRV++ +G P+DG G I+  +  PIE  APGVM R SV EPL+TG  AID++ PIG+GQRELIIGD+QTGKT+IAID IINQK +N+ CIYV IGQK ST+   + TL++ GAL+YT +V +SAS    L +LAP+ G+T+ E +M KG+ VL++YDDLSK A AYR LSLLLRRPPGREAYPGDIFYLHSRLLER+ K++   GGGS+TALP +ET+AGDISAYIPTNVISITDGQ+F+ ++LF SG RPAI+AGLSVSRVG +AQI A+KK SG+L+L+LA YREL+AF+QFGSDLDK T+  L  G + ++++KQD + P     +  +++++   ++  IPV+ I  F+++      Q  + +LE I  TK++  +       +FN  I ++ KT
  S:     1 MSIRAEEISALIKQQIENYESEIQVSDVGTVIQIGDGIARAHGLDNVMSGELVEFSNGVMGMALNLEENNVGIVILGPYTGIKEGDEVRRTGRIMEVPVGEALIGRVVNPLGQPVDGLGPIETTETRPIESPAPGVMDRKSVHEPLQTGIKAIDALVPIGRGQRELIIGDRQTGKTSIAIDTIINQKDQNMICIYVAIGQKESTVRTVVETLRKHGALDYTIVVTASASQPAPLLFLAPYAGVTMGEYFMYKGQHVLVVYDDLSKQAAAYRELSLLLRRPPGREAYPGDIFYLHSRLLERAAKLSDAKGGGSLTALPFVETQAGDISAYIPTNVISITDGQIFLQSDLFFSGVRPAINAGLSVSRVGGAAQIKAMKKVSGTLRLDLAAYRELEAFAQFGSDLDKATQAKLARGARTVEVLKQDLHAPIPVEKQVAIIYALTHGFLDDIPVEDIRRFEKEFFLWLDQNGQHLLEHIRTTKELPNE------EDFNKAIEAFKKT 497
>gi|116513799|ref|YP_812705.1| F0F1 ATP synthase subunit alpha [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|122275431|sp|Q04BA5|ATPA_LACDB ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|116093114|gb|ABJ58267.1| F0F1-type ATP synthase, alpha subunit [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (503 aa)
Score = 1395, Expect = 4.1e-152, Identities = 260/464 (56%), Positives = 363/464 (78%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHF 464
           MSI  ++ S++IK Q++ Y +K    E+G V  VGDGI +A GL+NV+ +EL+ F+NG+YG+  NLE+   GI++LGKF+DI+EG  VKRT  +++VPVGD L+GRV++ +G P+DG GEIK DK  PIE  APGVM R SV +PL+TG  AID++ PIG+GQREL+IGD++TGKT++AID I+NQKG++V CIYV IGQK ST+   + TLK+ GA++YT +V +  S+   + Y+AP++GI + EE+M  G+DVL+++DDLSK A+AYR LSLLLRRPPGREAYPGD+FYLHSRLLERS K++KE GGGS+TALP+I+TEAGDISAYIPTNVISITDGQ+F+ +++F SG RPAIDAG SVSRVG +AQI A+KK +G+L+ +LA YREL++F+QFGSDLD+ T+  L  G++ ++++KQ  + P +   + +LL+++   ++  + VD I  F++++   F
  S:     1 MSIKAEEISSLIKQQLEHYDDKLDIEEVGVVTYVGDGIARAHGLNNVLSSELLQFDNGAYGIAQNLESNDVGIIILGKFDDIREGDRVKRTGRIMEVPVGDALIGRVVNPLGQPVDGLGEIKTDKTRPIESKAPGVMQRQSVNQPLQTGIKAIDALVPIGRGQRELVIGDRKTGKTSLAIDTILNQKGQDVICIYVSIGQKESTVRAQVETLKKLGAMDYTIVVEAGPSEPAPMLYIAPYSGIAMGEEFMYAGKDVLVVFDDLSKQAVAYRELSLLLRRPPGREAYPGDVFYLHSRLLERSAKLSKELGGGSLTALPVIQTEAGDISAYIPTNVISITDGQIFLQSDMFFSGTRPAIDAGASVSRVGGAAQIPAMKKVAGTLRTDLASYRELESFAQFGSDLDQATQAKLARGRRTVEVLKQPLHKPVAVEKQVVLLYALTHGFMDAVSVDDIARFEQELYTDF 464
>gi|20807128|ref|NP_622299.1| F0F1 ATP synthase subunit alpha [Thermoanaerobacter tengcongensis MB4] >gi|81590746|sp|Q8RC17|ATPA_THETN ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|20515623|gb|AAM23903.1| F0F1-type ATP synthase alpha subunit [Thermoanaerobacter tengcongensis MB4] (506 aa)
Score = 1393, Expect = 6.0e-152, Identities = 267/489 (54%), Positives = 364/489 (74%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQ-KTILETIDQTKDISQDLFVQIK 489
           M I  ++ S+++  +IK +       EIG VI  GDGI +  GL N +  E+V FE+G  GM LNLE  T G+V+LG  E +KEG +VKRT  +++VPVG GLLGRV++ +G PIDG G I+Y+ K PIE  AP ++ R  V  PL+TG LAIDSM PIG+GQRELIIGD+QTGKT IA+D IINQK K V CIYV IGQK ST+   +NTL+++GA+EYTT+VA++AS+  +L Y+AP+ G  + E +M +G+DVL++YDDLSKHA+AYRTLSLLLRRPPGREAYPGD+FYLHSRLLERS +++ E GGGS+TALPI+ET+AGDISAYIPTNVISITDGQ+++ + LF SG RPAI+ GLSVSRVG +AQI A+KK +G L+LEL+QYREL  F++FG+DLDK T EVL  G++++++ KQ +  P +   + I ++++  +Y+  I V  +  F   +++   +    I ++I  TKD++++   ++K
  S:     1 MGIRPEEISSVLAEKIKNFDFSVETQEIGYVIQSGDGIARIYGLDNAVYGEMVEFESGVVGMVLNLEEDTVGVVVLGDPEKVKEGDVVKRTGRIMEVPVGKGLLGRVVNPLGEPIDGKGPIEYEGKRPIESPAPPIVRRQPVNTPLQTGILAIDSMIPIGRGQRELIIGDRQTGKTAIAVDTIINQKDKGVYCIYVAIGQKASTVASVVNTLEKYGAMEYTTVVAATASESAALQYIAPYAGCAMGEHFMYQGKDVLVVYDDLSKHAVAYRTLSLLLRRPPGREAYPGDVFYLHSRLLERSARLSDEYGGGSLTALPIVETQAGDISAYIPTNVISITDGQIYLESELFYSGIRPAINVGLSVSRVGGAAQIKAMKKVAGRLRLELSQYRELQVFARFGTDLDKATLEVLRQGERIVEITKQPQYQPMAVEDQVIAIYTVMNRYVTDIEVSEVRPFVMGLLKFLDEAYPEIKQSIRDTKDLTKETEEKLK 490
>gi|148322973|gb|EDK88223.1| F-type two-sector ATPase, F(1) alpha subunit [Fusobacterium nucleatum subsp. polymorphum ATCC 10953] (500 aa)
Score = 1393, Expect = 6.9e-152, Identities = 277/499 (55%), Positives = 361/499 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKTILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           M+I  ++ S+IIK +I  Y+        G V+ VGDGI +  GLSNVM  EL+ F +G  GM LNLE    G V+LG    IKEG  V+ T  VV VP G+ LLGRVI+A+G+PIDG GEI+ DK MPIE+ A G++AR  V EPL+TG  +ID M PIG+GQRELIIGD+QTGKT IAID IINQKG++VKCIYV IGQK ST+ Q    L   G ++YT IVA++AS+   L Y+AP++G+ I E +M KGE VLIIYDDLSKHA+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K++ E GGGSITALPIIET+AGD+SAYIPTNVISITDGQ+F+ + LFNSG RPAI+AG+SVSRVG +AQI A+K+ +  +KLELAQY EL  F+QFGSDLDK TK  LE G ++M+++KQ +  PF+   + +  +++   ++  I V  +  F+++++ + K    IL  I   K + +DL  ++K   ++   S+
  S:     1 MNIRPEEVSSIIKKEIDNYKKSLEIKTSGTVLEVGDGIARIFGLSNVMSGELLEFPHGVMGMALNLEEDNVGAVILGNASLIKEGDEVRATGKVVSVPAGENLLGRVINALGDPIDGKGEIRADKYMPIERKASGIIARQPVSEPLQTGIKSIDGMVPIGRGQRELIIGDRQTGKTAIAIDTIINQKGQDVKCIYVAIGQKRSTVAQIYKKLSDLGCMDYTIIVAATASEAAPLQYMAPYSGVAIGEYFMEKGEHVLIIYDDLSKHAVAYREMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSDELGGGSITALPIIETQAGDVSAYIPTNVISITDGQIFLESQLFNSGFRPAINAGISVSRVGGAAQIKAMKQVASKVKLELAQYTELLTFAQFGSDLDKATKAQLERGHRIMEILKQPQYHPFAVERQVVSFYTVINGHLDDIEVSKVRRFEKELLEYLKANTNILTEIADKKTLDKDLEEKLKESISNFKKSF 499
>gi|158430150|pdb|2QE7|A Chain A, Crystal Structure Of The F1-Atpase From The Thermoalkaliphilic Bacterium Bacillus Sp. Ta2.A1 >gi|158430151|pdb|2QE7|B Chain B, Crystal Structure Of The F1-Atpase From The Thermoalkaliphilic Bacterium Bacillus Sp. Ta2.A1 >gi|158430152|pdb|2QE7|C Chain C, Crystal Structure Of The F1-Atpase From The Thermoalkaliphilic Bacterium Bacillus Sp. Ta2.A1 >gi|33329385|gb|AAQ10088.1| ATP synthase subunit alpha [Bacillus sp. TA2.A1] (502 aa)
Score = 1392, Expect = 9.2e-152, Identities = 268/480 (55%), Positives = 359/480 (74%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQK-TILETIDQTKDI 480
           MSI  ++ S +IK QI+ Y+      E+G VI VGDGI +  GL  VM  EL+ FENG  GM  NLE    G+V+LG + +I+EG+ VKRT  +++VPVG+ LLGRV++ +G P+DG G I+  +  PIE  APGVM R SV EPL+TG  AIDSM PIG+GQRELIIGD+QTGKTTIAID IINQKG++V CIYV IGQK ST+   + TL+Q  AL+YT +V +SAS+   L YLAP+ G  + E +M KG+  L++YDDLSK A AYR LSLLLRRPPGREAYPGD+FYLHSRLLER+ K++ E GGGS+TALP IET+AGD+SAYIPTNVISITDGQ+F+ ++LF SG RPA++ G+SVSRVG +AQI A+KK +G+L+L+LAQYREL AF+QFGSDLDK T+  L  G++ ++++KQD++ P     + I ++++   ++  IPV+ +  F+E+++   +  K ++L+ I QT ++
  S:     1 MSIRPEEISALIKKQIENYEADLEVVEVGTVIQVGDGIARVHGLEKVMAGELLEFENGVMGMAQNLEEDNVGVVILGPYTEIREGTQVKRTGRIMEVPVGEALLGRVVNPLGQPLDGRGPIETAEYRPIESPAPGVMDRKSVHEPLQTGIKAIDSMIPIGRGQRELIIGDRQTGKTTIAIDTIINQKGQDVICIYVAIGQKQSTVAGVVETLRQHDALDYTIVVTASASEPAPLLYLAPYAGCAMGEYFMYKGKHALVVYDDLSKQAAAYRELSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSDEKGGGSLTALPFIETQAGDVSAYIPTNVISITDGQIFLESDLFYSGVRPAVNVGISVSRVGGAAQIKAMKKVAGTLRLDLAQYRELQAFAQFGSDLDKATQAKLNRGERTVEILKQDEHKPMPVEEQVISIYAVTNGFMDDIPVEDVRRFEEELLSFMRANKDSLLDHIRQTGEL 481
>gi|195977925|ref|YP_002123169.1| ATP synthase alpha chain AtpA [Streptococcus equi subsp. zooepidemicus str. MGCS10565] >gi|195974630|gb|ACG62156.1| ATP synthase alpha chain AtpA [Streptococcus equi subsp. zooepidemicus str. MGCS10565] (501 aa)
Score = 1390, Expect = 1.3e-151, Identities = 267/483 (55%), Positives = 361/483 (74%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQ-KTILETIDQTKDISQD 483
           M+IN  + S +IK QI+ +Q     +E G V  +GDGI +A GL N M  EL+ F NG++GM  NLE+   GI++LG F  I+EG  VKRT  +++VPVG+ L+GRV++ +G P+DG G+I+     P+E  APGVM R SV EPL+TG  AID++ PIG+GQRELIIGD+QTGKT++AIDAI+NQKG+++ CIYV IGQK ST+   + TL+++GAL+YT +V +SAS    L ++AP+ G+ +AEE+M  G+ VLI+YDDLSK A+AYR LSLLLRRPPGREAYPGD+FYLHSRLLERS K++ + GGGSITALP IET+AGDISAYI TNVISITDGQ+F+  +LFNSG RPAIDAG SVSRVG SAQI A+K+ +G+L+L+LA YREL+AF+QFGSDLD  T+  L  G++ ++++KQ  + P     + ++L+++   ++  +PVD I  F+E +  +F      + ETI  TKD+ Q+
  S:     1 MAINAQEISALIKKQIENFQPNFDVTETGVVTYIGDGIARARGLDNAMSGELLEFSNGTFGMAQNLESNDVGIIILGDFSTIREGDEVKRTGKIMEVPVGEALIGRVVNPLGQPVDGLGDIETTGFRPVETPAPGVMQRKSVFEPLQTGLKAIDALVPIGRGQRELIIGDRQTGKTSVAIDAILNQKGQDMICIYVAIGQKESTVRTQVETLRRYGALDYTIVVTASASQPSPLLFIAPYAGVAMAEEFMYNGKHVLIVYDDLSKQAVAYRELSLLLRRPPGREAYPGDVFYLHSRLLERSAKVSDDLGGGSITALPFIETQAGDISAYIATNVISITDGQIFLQEDLFNSGIRPAIDAGSSVSRVGGSAQIKAMKRVAGTLRLDLASYRELEAFTQFGSDLDAATQAKLNRGRRTVEILKQPLHKPLPVEKQVVILYALTHGFLDDVPVDDILAFEEALYDYFDAHYDHLFETIRTTKDLPQE 484
>gi|56421895|ref|YP_149213.1| F0F1 ATP synthase subunit alpha [Geobacillus kaustophilus HTA426] >gi|81557689|sp|Q5KUJ1|ATPA_GEOKA ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|56381737|dbj|BAD77645.1| F0F1-type ATP synthasealpha chain [Geobacillus kaustophilus HTA426] (502 aa)
Score = 1390, Expect = 1.3e-151, Identities = 271/502 (53%), Positives = 368/502 (73%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQ-KTILETIDQTKDISQDLFVQIKNEFNSLITSYIKT 502
           MSI  ++ S +IK QI+ Y+++   S++G VI VGDGI +A GL NVM  ELV F NG  GM LNLE    GIV+LG +  IKEG  V+RT  +++VPVG+ L+GRV++ +G P+DG G ++  +  PIE  APGVM R SV EPL+TG  AID++ PIG+GQRELIIGD+QTGKT++AID IINQK +N+ CIYV IGQK ST+   + TL++ GAL+YT +V +SAS    L +LAP+ G+ + E +M KG+ VL++YDDLSK A AYR LSLLLRRPPGREAYPGDIFYLHSRLLER+ K++   GGGS+TALP +ET+AGDISAYIPTNVISITDGQ+F+ ++LF SG RPAI+AGLSVSRVG +AQI A+KK +G+L+L+LA YREL+AF+QFGSDLDK T+  L  G + ++++KQD + P     + ++++++   ++  IPV+ +  F+++      Q  + +LE I  TKD+  +      ++ N  I ++ KT
  S:     1 MSIRAEEISALIKQQIENYESQIQVSDVGTVIQVGDGIARAHGLDNVMSGELVEFANGVMGMALNLEENNVGIVILGPYTGIKEGDEVRRTGRIMEVPVGEALIGRVVNPLGQPVDGLGPVETTETRPIESPAPGVMDRRSVHEPLQTGIKAIDALVPIGRGQRELIIGDRQTGKTSVAIDTIINQKDQNMICIYVAIGQKESTVRTVVETLRKHGALDYTIVVTASASQPAPLLFLAPYAGVAMGEYFMYKGQHVLVVYDDLSKQAAAYRELSLLLRRPPGREAYPGDIFYLHSRLLERAAKLSDAKGGGSLTALPFVETQAGDISAYIPTNVISITDGQIFLQSDLFFSGVRPAINAGLSVSRVGGAAQIKAMKKVAGTLRLDLAAYRELEAFAQFGSDLDKATQAKLARGARTVEVLKQDLHQPIPVEKQVLIIYALTRGFLDDIPVEDVRRFEKEFYLWLDQNGQHLLEHIRTTKDLPNE------DDLNKAIEAFKKT 497
>gi|16080736|ref|NP_391564.1| F0F1 ATP synthase subunit alpha [Bacillus subtilis subsp. subtilis str. 168] >gi|584804|sp|P37808|ATPA_BACSU ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) (Vegetative protein 100) (VEG100) >gi|580831|emb|CAA82258.1| ATP synthase subunit alpha [Bacillus subtilis] >gi|2636208|emb|CAB15700.1| ATP synthase (subunit alpha) [Bacillus subtilis subsp. subtilis str. 168] (502 aa)
Score = 1390, Expect = 1.4e-151, Identities = 274/507 (54%), Positives = 366/507 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQ-QKTILETIDQTKDISQDLFVQIKNEFNSLITSYIKTIPDYN 507
           MSI  ++ S +IK QI+ YQ+     ++G VI VGDGI +  GL N M  ELV F NG  GM  NLE +  GIV+LG F +I+EG  VKRT  +++VPVG+ L+GR+++ +G P+DG G I   K  PIE  APGVM R SV EPL+TG  AID++ PIG+GQRELIIGD+QTGKT++AIDAI+NQK +++ C+YV IGQK ST+   + TL++ GAL+YT +V +SAS    L YLAP+ G+T+AEE+M  G+ VL++YDDLSK A AYR LSLLLRRPPGREA+PGD+FYLHSRLLER+ K++   G GSITALP +ET+AGDISAYIPTNVISITDGQ+F+ ++LF SG RPAI+AGLSVSRVG SAQI A+KK SG+L+L+LA YREL+AF+QFGSDLD+ T+  L  G + ++++KQD N P     +  +L+++ + Y+  IPV  I  F+E+   +  Q  K +L+ I +T ++  D       +F + I  + +T    N
  S:     1 MSIKAEEISTLIKQQIQNYQSDIEVQDVGTVIQVGDGIARVHGLDNCMAGELVEFSNGVLGMAQNLEESNVGIVILGPFSEIREGDEVKRTGRIMEVPVGEELIGRIVNPLGQPVDGLGPILTSKTRPIESPAPGVMDRKSVHEPLQTGIKAIDALIPIGRGQRELIIGDRQTGKTSVAIDAILNQKDQDMICVYVAIGQKESTVRGVVETLRKHGALDYTIVVTASASQPAPLLYLAPYAGVTMAEEFMYNGKHVLVVYDDLSKQAAAYRELSLLLRRPPGREAFPGDVFYLHSRLLERAAKLSDAKGAGSITALPFVETQAGDISAYIPTNVISITDGQIFLQSDLFFSGVRPAINAGLSVSRVGGSAQIKAMKKVSGTLRLDLASYRELEAFAQFGSDLDQATQAKLNRGARTVEVLKQDLNKPLPVEKQVAILYALTKGYLDDIPVADIRRFEEEYYMYLDQNHKDLLDGIAKTGNLPAD------EDFKAAIEGFKRTFAPSN 502
>gi|34763444|ref|ZP_00144391.1| ATP synthase alpha chain, sodium ion specific [Fusobacterium nucleatum subsp. vincentii ATCC 49256] >gi|27886885|gb|EAA24010.1| ATP synthase alpha chain, sodium ion specific [Fusobacterium nucleatum subsp. vincentii ATCC 49256] (500 aa)
Score = 1390, Expect = 1.5e-151, Identities = 277/499 (55%), Positives = 359/499 (71%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKTILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           M+I  ++ S+IIK +I  Y+        G V+ VGDGI +  GLSNVM  EL+ F +G  GM LNLE    G V+LG    IKEG  V+ T  VV VP G+ LLGRVI+A+G+PIDG GEI  DK MPIE+ A G++AR  V EPL+TG  +ID M PIG+GQRELIIGD+QTGKT IAID IINQKG++VKCIYV IGQK ST+ Q    L   G ++YT IVA++AS+   L Y+AP++G+ I E +M KGE VLIIYDDLSKHA+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K++ E GGGSITALPIIET+AGD+SAYIPTNVISITDGQ+F+ + LFNSG RPAI+AG+SVSRVG +AQI A+K+ +  +KLELAQY EL  F+QFGSDLDK TK  LE G ++M+++KQ +  PF+   + +  +++   ++  I V  +  F+++++ + K    IL  I   K + +DL  ++K    +   S+
  S:     1 MNIRPEEVSSIIKKEIDNYKKSLEIKTSGTVLEVGDGIARIFGLSNVMSGELLEFPHGVMGMALNLEEDNVGAVILGNASLIKEGDEVRATGKVVSVPAGENLLGRVINALGDPIDGKGEIHADKYMPIERKASGIIARQPVSEPLQTGIKSIDGMVPIGRGQRELIIGDRQTGKTAIAIDTIINQKGQDVKCIYVAIGQKRSTVAQIYKKLSDLGCMDYTIIVAATASEAAPLQYMAPYSGVAIGEYFMEKGEHVLIIYDDLSKHAVAYREMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSDELGGGSITALPIIETQAGDVSAYIPTNVISITDGQIFLESQLFNSGFRPAINAGISVSRVGGAAQIKAMKQVASRVKLELAQYTELLTFAQFGSDLDKATKAQLERGHRIMEILKQPQYHPFAVERQVVSFYTVINGHLDDIEVSKVRRFEKELLEYLKANTDILTEIADKKALDKDLEERLKESIANFKKSF 499
>gi|148378160|ref|YP_001252701.1| ATP synthase F1, alpha subunit [Clostridium botulinum A str. ATCC 3502] >gi|153934062|ref|YP_001382561.1| F0F1 ATP synthase subunit alpha [Clostridium botulinum A str. ATCC 19397] >gi|153937693|ref|YP_001386113.1| F0F1 ATP synthase subunit alpha [Clostridium botulinum A str. Hall] >gi|168177487|ref|ZP_02612151.1| ATP synthase F1, alpha subunit [Clostridium botulinum NCTC 2916] >gi|168182236|ref|ZP_02616900.1| ATP synthase F1, alpha subunit [Clostridium botulinum Bf] >gi|166201661|sp|A7FQH7|ATPA_CLOB1 ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|166201662|sp|A5HY50|ATPA_CLOBH ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|148287644|emb|CAL81709.1| ATP synthase alpha chain [Clostridium botulinum A str. ATCC 3502] >gi|152930106|gb|ABS35606.1| ATP synthase F1, alpha subunit [Clostridium botulinum A str. ATCC 19397] >gi|152933607|gb|ABS39106.1| ATP synthase F1, alpha subunit [Clostridium botulinum A str. Hall] >gi|182670565|gb|EDT82539.1| ATP synthase F1, alpha subunit [Clostridium botulinum NCTC 2916] >gi|182674508|gb|EDT86469.1| ATP synthase F1, alpha subunit [Clostridium botulinum Bf] (504 aa)
Score = 1390, Expect = 1.6e-151, Identities = 275/500 (55%), Positives = 375/500 (75%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQ-----KTILETIDQTKDISQDLFVQIKNEFNSLITSYI 500
           M+I  ++ ++II+ QI+ +       + G +I +GDGI +  GL + M  EL+ F N  YGM LNLE    G V+LG  E IKEG++VKRTK VV+VPVG+ L+GRV++++G PIDG G +   +   +E  APGV+ R SV EPL+TG  AIDSM PIGKGQRELIIGD+QTGKT IA+D I+NQKGK+V CIYV IGQK ST+   +N L + GA++YT +V+S+ASD   L YLAP+ G ++ E +M KG+DVLI+YDDLSKHA+AYRT+SLLLRRPPGREAYPGD+FYLHSRLLERS +++++ GGGS+TALPI+ET AGD++AYIPTNVISITDGQ+F+ + LFN+GQRPA++AG+SVSRVG +AQI A+K+ +G+L+LELAQYREL AFSQFGSDLDKE+ + LE GK++++++KQ + +P     E I+L++    ++  IPV+ I++F++++  +         K ILE    T ++   L   I N+F ++  S I
  S:     1 MNIKPEEITSIIRQQIENFNTNIETIDSGTIIQIGDGIARVYGLEDCMEGELIEFPNDVYGMALNLEQDNVGCVLLGSEEGIKEGNVVKRTKKVVEVPVGEALVGRVVNSLGMPIDGKGPVLTTETRDVEVPAPGVIDRQSVKEPLQTGIKAIDSMIPIGKGQRELIIGDRQTGKTAIAMDTILNQKGKDVICIYVAIGQKQSTVAHIVNDLTKMGAMDYTIVVSSTASDSAPLQYLAPYAGCSMGEYFMHKGKDVLIVYDDLSKHAVAYRTMSLLLRRPPGREAYPGDVFYLHSRLLERSARLSEKLGGGSLTALPIVETLAGDVTAYIPTNVISITDGQIFLESELFNAGQRPAVNAGISVSRVGGNAQIKAMKQVAGTLRLELAQYRELAAFSQFGSDLDKESVKRLEKGKRLVEILKQPQYSPMPVEKEIIILYAAVSNHLIDIPVNKIKEFEKELFNYIDTHYRDIGKDILEHKQLTDELKSKLDKAI-NDFKNVFLSEI 504
>gi|42518863|ref|NP_964793.1| F0F1 ATP synthase subunit alpha [Lactobacillus johnsonii NCC 533] >gi|81667994|sp|Q74K17|ATPA_LACJO ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|41583149|gb|AAS08759.1| ATP synthase alpha chain [Lactobacillus johnsonii NCC 533] (503 aa)
Score = 1388, Expect = 2.5e-151, Identities = 265/483 (54%), Positives = 369/483 (76%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQ-KTILETIDQTKDISQD 483
           MSI  ++ S +IK Q+++Y +K   +E+G V  VGDGI +A GL+NV+ +EL+ F NGSYG+  NLEA   GI++LG+F+DI+EG  VKRT  +++VPVGD L+GRV++ +G P+DG GEIK DK  PIE  APGVM R SV +PL+TG  AID++ PIG+GQRELIIGD++TGKT +A+D IINQKG++V CIYV IGQK ST+   + TLK+FGA++YT +V +  S+   + Y+AP+ G  + EE+M  G+DVLI++DDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLERS K+NK+ GGGS+TALP I+T+AGDISAYIPTNVISITDGQ+F+  +LF +G RPAI+AG SVSRVG SAQI A+KK +G+L+++LA YREL++F+QFGSDLD+ T+  L  G++ ++++KQ  + P     E ++L+++   ++  IPV  I+ ++ ++  +F      +L+ I  T D+ ++
  S:     1 MSIKAEEISALIKQQLEKYDDKLNVNEVGTVTYVGDGIARAHGLNNVLSSELLQFSNGSYGIAQNLEANDVGIIILGRFDDIREGDQVKRTGRIMEVPVGDQLIGRVVNPLGQPVDGLGEIKTDKTRPIESKAPGVMDRQSVNQPLQTGIKAIDALVPIGRGQRELIIGDRKTGKTALALDTIINQKGQDVICIYVAIGQKESTVKNSVETLKRFGAMDYTIVVEAGPSEPAPMLYIAPYAGTAMGEEFMYNGKDVLIVFDDLSKQAVAYREISLLLRRPPGREAYPGDVFYLHSRLLERSAKLNKKLGGGSMTALPFIQTQAGDISAYIPTNVISITDGQIFLEADLFFAGTRPAINAGESVSRVGGSAQIKAMKKVAGTLRVDLASYRELESFAQFGSDLDQATQAKLNRGRRTVEVLKQPLHKPLPVEDEVLILYALTHGFLDAIPVPDIQRYELELYDYFASNYNDLLDVIRTTGDLPEE 484
>gi|153938181|ref|YP_001389517.1| F0F1 ATP synthase subunit alpha [Clostridium botulinum F str. Langeland] >gi|166201663|sp|A7G9Q7|ATPA_CLOBL ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|152934077|gb|ABS39575.1| ATP synthase F1, alpha subunit [Clostridium botulinum F str. Langeland] (504 aa)
Score = 1387, Expect = 2.9e-151, Identities = 275/500 (55%), Positives = 374/500 (74%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQ-----KTILETIDQTKDISQDLFVQIKNEFNSLITSYI 500
           M+I  ++ ++II+ QI+ +       + G +I +GDGI +  GL + M  EL+ F N  YGM LNLE    G V+LG  E IKEG++VKRTK VV+VPVG+ L+GRV++++G PIDG G +   +   +E  APGV+ R SV EPL+TG  AIDSM PIGKGQRELIIGD+QTGKT IA+D I+NQKGK+V CIYV IGQK ST+   +N L + GA++YT +V+S+ASD   L YLAP+ G ++ E +M KG+DVLI+YDDLSKHA+AYRT+SLLLRRPPGREAYPGD+FYLHSRLLERS +++++ GGGS+TALPI+ET AGD++AYIPTNVISITDGQ+F+ + LFN+GQRPA++AG+SVSRVG +AQI A+K+ +G+L+LELAQYREL AFSQFGSDLDKE+ + LE GK++++++KQ +  P     E I+L++    ++  IPV+ I++F++++  +         K ILE    T ++   L   I N+F ++  S I
  S:     1 MNIKPEEITSIIRQQIENFNTNIETIDSGTIIQIGDGIARVYGLEDCMEGELIEFPNDVYGMALNLEQDNVGCVLLGAEEGIKEGNVVKRTKKVVEVPVGEALVGRVVNSLGMPIDGKGPVLTTENRDVEVPAPGVIDRQSVKEPLQTGIKAIDSMIPIGKGQRELIIGDRQTGKTAIAMDTILNQKGKDVICIYVAIGQKQSTVAHIVNDLTKMGAMDYTIVVSSTASDSAPLQYLAPYAGCSMGEYFMHKGKDVLIVYDDLSKHAVAYRTMSLLLRRPPGREAYPGDVFYLHSRLLERSARLSEKLGGGSLTALPIVETLAGDVTAYIPTNVISITDGQIFLESELFNAGQRPAVNAGISVSRVGGNAQIKAMKQVAGTLRLELAQYRELAAFSQFGSDLDKESVKRLEKGKRLVEILKQPQYGPMPVEKEIIILYAAVNNHLIDIPVNKIKEFEKELFNYIDTHYRDIGKDILEHKQLTDELKSKLDKAI-NDFKNVFLSEI 504
>gi|149183572|ref|ZP_01861994.1| F0F1 ATP synthase subunit alpha [Bacillus sp. SG-1] >gi|148848713|gb|EDL62941.1| F0F1 ATP synthase subunit alpha [Bacillus sp. SG-1] (502 aa)
Score = 1387, Expect = 2.9e-151, Identities = 270/483 (55%), Positives = 361/483 (74%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKT-ILETIDQTKDISQD 483
           MSI  ++ S +IK QI+ YQ++   S++G VI +GDGI +A GL NVM  ELV F NG  GM  NLE    GIV+LG + DIKEG  V+RT  +++VPVG+ L+GRV++++G P+DG G I   K  PIE  A GVM R SV EPL+TG  AID++ PIG+GQRELIIGD+QTGKT++AID I+NQK +++ CIYV IGQK ST+   + TL++ GAL+YT +V +SAS    + +LAP+ G+T+ EE+M  G+ VL++YDDLSK A AYR LSLLLRRPPGREA+PGD+FYLHSRLLER+ K++ E G GSITALP +ET+AGDISAYIPTNVISITDGQ+F+ ++LF SG RPAI+AGLSVSRVG SAQI A+KK SG+L+L+LA YREL+AF+QFGSDLDK T+  L  G + ++++KQD N P     + ++L+++ + ++  IPV  I  F+E+ +    +  T +L+ I  TK + +D
  S:     1 MSIKAEEISALIKKQIENYQSEMKVSDVGTVIQIGDGIARAHGLDNVMAGELVEFSNGVMGMAQNLEENNVGIVILGPYRDIKEGDEVRRTGRIMEVPVGEELIGRVVNSLGQPVDGLGPINATKTRPIESKATGVMDRKSVHEPLQTGIKAIDALVPIGRGQRELIIGDRQTGKTSVAIDTILNQKDQDMVCIYVAIGQKESTVRNAVETLRKHGALDYTIVVTASASQPAPMLFLAPYAGVTMGEEFMFNGKHVLVVYDDLSKQAAAYRELSLLLRRPPGREAFPGDVFYLHSRLLERAAKLSDEKGAGSITALPFVETQAGDISAYIPTNVISITDGQIFLQSDLFFSGVRPAINAGLSVSRVGGSAQIKAMKKVSGTLRLDLAAYRELEAFAQFGSDLDKATQAKLNRGARTVEVLKQDLNKPLKVEKQVMILYALTKGHLDDIPVGDIRRFEEEFLSWLDRNHTELLDHIRTTKGLPED 484
>gi|170756775|ref|YP_001779782.1| ATP synthase F1, alpha subunit [Clostridium botulinum B1 str. Okra] >gi|169121987|gb|ACA45823.1| ATP synthase F1, alpha subunit [Clostridium botulinum B1 str. Okra] (504 aa)
Score = 1387, Expect = 3.3e-151, Identities = 275/500 (55%), Positives = 374/500 (74%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQ-----KTILETIDQTKDISQDLFVQIKNEFNSLITSYI 500
           M+I  ++ ++II+ QI+ +       + G +I +GDGI +  GL + M  EL+ F N  YGM LNLE    G V+LG  E IKEG++VKRTK VV+VPVG+ L+GRV++++G PIDG G +   +   +E  APGV+ R SV EPL+TG  AIDSM PIGKGQRELIIGD+QTGKT IA+D I+NQKGK+V CIYV IGQK ST+   +N L + GA++YT +V+S+ASD   L YLAP+ G ++ E +M KG+DVLI+YDDLSKHA+AYRT+SLLLRRPPGREAYPGD+FYLHSRLLERS +++++ GGGS+TALPI+ET AGD++AYIPTNVISITDGQ+F+ + LFN+GQRPA++AG+SVSRVG +AQI A+K+ +G+L+LELAQYREL AFSQFGSDLDKE+ + LE GK++++++KQ +  P     E I+L++    ++  IPV+ I++F++++  +         K ILE    T ++   L   I N+F ++  S I
  S:     1 MNIKPEEITSIIRQQIENFNTNIETIDSGTIIQIGDGIARVYGLEDCMEGELIEFPNDVYGMALNLEQDNVGCVLLGAEEGIKEGNVVKRTKKVVEVPVGEALVGRVVNSLGMPIDGKGPVLTTETRDVEVPAPGVIDRQSVKEPLQTGIKAIDSMIPIGKGQRELIIGDRQTGKTAIAMDTILNQKGKDVICIYVAIGQKQSTVAHIVNDLTKMGAMDYTIVVSSTASDSAPLQYLAPYAGCSMGEYFMHKGKDVLIVYDDLSKHAVAYRTMSLLLRRPPGREAYPGDVFYLHSRLLERSARLSEKLGGGSLTALPIVETLAGDVTAYIPTNVISITDGQIFLESELFNAGQRPAVNAGISVSRVGGNAQIKAMKQVAGTLRLELAQYRELAAFSQFGSDLDKESVKRLEKGKRLVEILKQPQYGPMPVEKEIIILYAAVNNHLIDIPVNKIKEFEKELFNYIDTHYRDIGKDILEHKQLTDELKSKLDKAI-NDFKNVFLSEI 504
>gi|194016315|ref|ZP_03054929.1| ATP synthase F1, alpha subunit [Bacillus pumilus ATCC 7061] >gi|194011788|gb|EDW21356.1| ATP synthase F1, alpha subunit [Bacillus pumilus ATCC 7061] (502 aa)
Score = 1387, Expect = 3.5e-151, Identities = 269/507 (53%), Positives = 370/507 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQ-QKTILETIDQTKDISQDLFVQIKNEFNSLITSYIKTIPDYN 507
           MSI  ++ S +IK QI+ YQ++    ++G VI VGDGI +  GL N+M  ELV F NG  GM  NLE +  GIV+LG ++DI+EG  VKRT  +++VPVG+ L+GR+++ +G P+DG G I   K  PIE  APGVM R SV EPL+TG  AID++ PIG+GQRELIIGD+QTGKT++AID I+NQK +++ CIYV IGQK ST+   + TL++ GAL+YT +V +SAS    L YLAP+ G+T+ EE+M  G+ VL++YDDLSK A AYR LSLLLRRPPGREA+PGD+FYLHSRLLER+ K++ E GGGSITALP +ET+AGDISAYIPTNVISITDGQ+F+ ++LF SG RPA++AGLSVSRVG SAQI A+KK +G+L+L+LA YREL+AF+QFGSDLD+ T+  L  G + ++++KQD N P     +  +L+++   Y+  + +  ++ F+ ++  + ++  K + +TI QT ++  D       E+N+ I  + +T    N
  S:     1 MSIKAEEISALIKQQIQNYQSEIEVKDVGTVIQVGDGIARVHGLDNIMAGELVEFSNGVMGMAQNLEESNVGIVILGPYKDIREGDDVKRTGRIMEVPVGEELIGRIVNPLGQPVDGLGPILTSKTRPIESEAPGVMDRKSVHEPLQTGIKAIDALIPIGRGQRELIIGDRQTGKTSVAIDTILNQKDQDMICIYVAIGQKESTVRGVVETLRKHGALDYTIVVTASASQPAPLLYLAPYAGVTMGEEFMYNGKHVLVVYDDLSKQAAAYRELSLLLRRPPGREAFPGDVFYLHSRLLERAAKLSDEKGGGSITALPFVETQAGDISAYIPTNVISITDGQIFLQSDLFFSGVRPAVNAGLSVSRVGGSAQIKAMKKVAGTLRLDLASYRELEAFAQFGSDLDQATQAKLNRGARTVEVLKQDLNKPLKVEKQVAILYALTRGYLDDVAIADVKRFEAELFMYIEENHKGLFDTISQTGNMPAD------EEWNTAIEGFKRTFAPSN 502
>gi|170759167|ref|YP_001785483.1| ATP synthase F1, alpha subunit [Clostridium botulinum A3 str. Loch Maree] >gi|169406156|gb|ACA54567.1| ATP synthase F1, alpha subunit [Clostridium botulinum A3 str. Loch Maree] (504 aa)
Score = 1387, Expect = 3.7e-151, Identities = 275/500 (55%), Positives = 374/500 (74%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQ-----KTILETIDQTKDISQDLFVQIKNEFNSLITSYI 500
           M+I  ++ ++II+ QI+ +       + G +I +GDGI +  GL + M  EL+ F N  YGM LNLE    G V+LG  E IKEG++VKRTK VV+VPVG+ L+GRV++++G PIDG G +   +   +E  APGV+ R SV EPL+TG  AIDSM PIGKGQRELIIGD+QTGKT IA+D I+NQKGK+V CIYV IGQK ST+   +N L + GA++YT +V+S+ASD   L YLAP+ G ++ E +M KG+DVLI+YDDLSKHA+AYRT+SLLLRRPPGREAYPGD+FYLHSRLLERS +++++ GGGS+TALPI+ET AGD++AYIPTNVISITDGQ+F+ + LFN+GQRPA++AG+SVSRVG +AQI A+K+ +G+L+LELAQYREL AFSQFGSDLDKE+ + LE GK++++++KQ +  P     E I+L++    ++  IPV+ I++F++++  +         K ILE    T ++   L   I N+F ++  S I
  S:     1 MNIKPEEITSIIRQQIENFNTNIETIDSGTIIQIGDGIARVYGLEDCMEGELIEFPNDVYGMALNLEQDNVGCVLLGSEEGIKEGNVVKRTKKVVEVPVGEALVGRVVNSLGMPIDGKGPVLTTETRDVEVPAPGVIDRQSVKEPLQTGIKAIDSMIPIGKGQRELIIGDRQTGKTAIAMDTILNQKGKDVICIYVAIGQKQSTVAHIVNDLTKMGAMDYTIVVSSTASDSAPLQYLAPYAGCSMGEYFMHKGKDVLIVYDDLSKHAVAYRTMSLLLRRPPGREAYPGDVFYLHSRLLERSARLSEKLGGGSLTALPIVETLAGDVTAYIPTNVISITDGQIFLESELFNAGQRPAVNAGISVSRVGGNAQIKAMKQVAGTLRLELAQYRELAAFSQFGSDLDKESVKRLEKGKRLVEILKQPQYGPMPVEKEIIILYAAVSNHLIDIPVNKIKEFEKELFNYIDTHYRDIGKDILEHKQLTDELKSKLDKAI-NDFKNVFLSEI 504
>gi|83591196|ref|YP_431205.1| ATP synthase F1, alpha subunit [Moorella thermoacetica ATCC 39073] >gi|115312251|sp|Q2RFX7|ATPA_MOOTA ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|83574110|gb|ABC20662.1| ATP synthase F1, alpha subunit [Moorella thermoacetica ATCC 39073] (507 aa)
Score = 1385, Expect = 5.1e-151, Identities = 267/499 (53%), Positives = 361/499 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWM-SKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQK-TILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           MSI  D+ ++I+KNQI++YQ +   +E+G V  VGDGI +  GL   M  EL+ F    YGM LNLE    G V+LG +  IKEG  VKRT  +V+VPVG+ L+GRV++AMG PIDG G I+ DK  P+E  APGV+ R  V  PL+TG  AIDSM PIG+GQRELIIGD+QTGKT IA+D IINQKG+NV CIYV IGQK ST+   +  L++ GA+EYT +V ++AS+   + Y+AP+ G T+ E +M  +  DVL +YDDLSKHA AYR LSLLLRRPPGREAYPGD+FYLHSRLLER+ ++N   GGGS+TALP+IET+AGD+SAYIPTNVISITDGQ+F+ ++LF +GQRPAI+ GLSVSRVG +AQI A+K+ +G L+L+LAQYREL AF+QFGSDLDK T+  L  G+++M+++KQD+  P     + ++L++    ++  +PV  +  F++  +R  + ++  +L  I + + +  +L  Q+K        S+
  S:     1 MSIRPDEITSILKNQIEQYQLEVEMAEVGTVTQVGDGIARIYGLDRAMAGELLEFPGDIYGMVLNLEEDNVGAVILGPYTHIKEGDQVKRTGRIVEVPVGEALIGRVVNAMGQPIDGKGPIQTDKFRPVESPAPGVVYRQPVNTPLQTGLKAIDSMVPIGRGQRELIIGDRQTGKTAIAVDTIINQKGQNVICIYVAIGQKASTVAGVVQRLEEAGAMEYTIVVMATASEPAPMLYIAPYAGCTMGEYFMYEQHRDVLCVYDDLSKHAAAYRELSLLLRRPPGREAYPGDVFYLHSRLLERAARLNDSLGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLESDLFYAGQRPAINVGLSVSRVGGAAQIKAMKQVAGRLRLDLAQYRELAAFAQFGSDLDKATQARLARGERMMEILKQDQYQPMPVEEQVVVLYAAVNGFLDDLPVARVRAFEKDFLRFLRNERPEVLAGIREKRQLDDNLQEQLKKSIEDFKGSF 501
>gi|19703702|ref|NP_603264.1| F0F1 ATP synthase subunit alpha [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >gi|81590911|sp|Q8RGE0|ATPA_FUSNN ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|19713826|gb|AAL94563.1| ATP synthase alpha chain, sodium ion specific [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] (500 aa)
Score = 1385, Expect = 5.7e-151, Identities = 277/499 (55%), Positives = 358/499 (71%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKTILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           M+I  ++ S+IIK +I  Y+        G V+ VGDGI +  GLSNVM  EL+ F +G  GM LNLE    G V+LG    IKEG  V+ T  VV VP G+ LLGRVI+A+G+PIDG GEI  DK MPIE+ A G++AR  V EPL+TG  +ID M PIG+GQRELIIGD+QTGKT IAID IINQKG++VKCIYV IGQK ST+ Q    L   G ++YT IVA++AS+   L Y+AP++G+ I E +M KGE VLIIYDDLSKHA+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K++ E GGGSITALPIIET+AGD+SAYIPTNVISITDGQ+F+ + LFNSG RPAI+AG+SVSRVG +AQI A+K+ +  +KLELAQY EL  F+QFGSDLDK TK  LE G ++M+++KQ +  PF+   + +  + +   ++  I V  +  F+++++ + K    IL  I   K + +DL  ++K    +   S+
  S:     1 MNIRPEEVSSIIKKEIDNYKKSLEIKTSGTVLEVGDGIARIFGLSNVMSGELLEFPHGVMGMALNLEEDNVGAVILGNASLIKEGDEVRATGKVVSVPAGEDLLGRVINALGDPIDGKGEIHVDKYMPIERKASGIIARQPVSEPLQTGIKSIDGMVPIGRGQRELIIGDRQTGKTAIAIDTIINQKGQDVKCIYVAIGQKRSTVAQIYKKLSDLGCMDYTIIVAATASEAAPLQYMAPYSGVAIGEYFMEKGEHVLIIYDDLSKHAVAYREMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSDELGGGSITALPIIETQAGDVSAYIPTNVISITDGQIFLESQLFNSGFRPAINAGISVSRVGGAAQIKAMKQVASKVKLELAQYTELLTFAQFGSDLDKATKAQLERGHRIMEILKQPQYHPFAVERQVVSFYIVINGHLDDIEVSKVRRFEKELLDYLKANTNILTEIADKKALDKDLEEKLKESIANFKKSF 499
>gi|110801696|ref|YP_699464.1| F0F1 ATP synthase subunit alpha [Clostridium perfringens SM101] >gi|122956534|sp|Q0SQZ3|ATPA_CLOPS ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|110682197|gb|ABG85567.1| ATP synthase F1, alpha subunit [Clostridium perfringens SM101] (502 aa)
Score = 1385, Expect = 5.7e-151, Identities = 274/492 (55%), Positives = 372/492 (75%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIR-----HFKQQKTILETI---DQTKDISQDLFVQIKNEF 492
           M I  ++ ++IIKN+IK Y+ +    + G +I +GDG+ +  GL   M  EL+ F N  +GM LNLE    G V+LG  E IKEG IVKRT  +V+VPVG+ L+GRV++++G PIDG G IK D    IE  APG++ R+SV EPL+TG  AIDSM PIG+GQRELIIGD+QTGKT IAID IINQKGK+V CIYV IGQK ST+   +NTL + GA++Y+ +V +SAS+   L Y+AP++G T+ E +M+KG+ VLIIYDDLSKHA+AYRT+SLL+RRPPGREAYPGD+FY+HSRLLER+ K++KENGGGS+TALPIIET AGD++AYIPTNVISITDGQ+F+ T LFN+GQRPA++ G+SVSRVG +AQI A+K+ SG+L+LELAQYREL +F+QFGSDLDK+T+  LE GK++++++KQD+  P +   + +++++    ++  I V  I+ F+++ +      H +  K IL+     D+ K   +   V+ K  F
  S:     1 MHIKPEEITSIIKNEIKNYEKELETVDSGTIIQIGDGVARVYGLEECMEGELLEFPNQVFGMALNLEQDNVGCVLLGSEEGIKEGDIVKRTGKIVEVPVGEDLIGRVVNSLGQPIDGKGPIKNDGYRAIEVPAPGILERSSVNEPLQTGIKAIDSMIPIGRGQRELIIGDRQTGKTAIAIDTIINQKGKDVICIYVAIGQKQSTVANIVNTLTEEGAMDYSIVVTASASESAPLQYIAPYSGCTMGEYFMNKGKHVLIIYDDLSKHAVAYRTMSLLIRRPPGREAYPGDVFYIHSRLLERAAKLSKENGGGSLTALPIIETLAGDVTAYIPTNVISITDGQIFLETELFNAGQRPAVNPGISVSRVGGNAQIKAMKQVSGTLRLELAQYRELASFAQFGSDLDKDTQARLEKGKRLIEILKQDQYKPMAVEKQIMIIYAAVNNFLLDIKVSDIKKFEKEFLEYMDTHHREIGKAILDKKVLDDELKSALESAIVEFKKIF 500
>gi|18311171|ref|NP_563105.1| F0F1 ATP synthase subunit alpha [Clostridium perfringens str. 13] >gi|110799900|ref|YP_696868.1| F0F1 ATP synthase subunit alpha [Clostridium perfringens ATCC 13124] >gi|168205574|ref|ZP_02631579.1| ATP synthase F1, alpha subunit [Clostridium perfringens E str. JGS1987] >gi|168210119|ref|ZP_02635744.1| ATP synthase F1, alpha subunit [Clostridium perfringens B str. ATCC 3626] >gi|168213707|ref|ZP_02639332.1| ATP synthase F1, alpha subunit [Clostridium perfringens CPE str. F4969] >gi|168215818|ref|ZP_02641443.1| ATP synthase F1, alpha subunit [Clostridium perfringens NCTC 8239] >gi|169344183|ref|ZP_02865165.1| ATP synthase F1, alpha subunit [Clostridium perfringens C str. JGS1495] >gi|123049637|sp|Q0TNC2|ATPA_CLOP1 ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|20137354|sp|Q8XID2|ATPA_CLOPE ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|18145854|dbj|BAB81895.1| ATP synthase alpha subunit [Clostridium perfringens str. 13] >gi|110674547|gb|ABG83534.1| ATP synthase F1, alpha subunit [Clostridium perfringens ATCC 13124] >gi|169297641|gb|EDS79741.1| ATP synthase F1, alpha subunit [Clostridium perfringens C str. JGS1495] >gi|170662849|gb|EDT15532.1| ATP synthase F1, alpha subunit [Clostridium perfringens E str. JGS1987] >gi|170711744|gb|EDT23926.1| ATP synthase F1, alpha subunit [Clostridium perfringens B str. ATCC 3626] >gi|170714802|gb|EDT26984.1| ATP synthase F1, alpha subunit [Clostridium perfringens CPE str. F4969] >gi|182382309|gb|EDT79788.1| ATP synthase F1, alpha subunit [Clostridium perfringens NCTC 8239] (502 aa)
Score = 1384, Expect = 6.7e-151, Identities = 274/492 (55%), Positives = 372/492 (75%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIR-----HFKQQKTILETI---DQTKDISQDLFVQIKNEF 492
           M I  ++ ++IIKN+IK Y+ +    + G +I +GDG+ +  GL   M  EL+ F N  +GM LNLE    G V+LG  E IKEG IVKRT  +V+VPVG+ L+GRV++++G PIDG G IK D    IE  APG++ R+SV EPL+TG  AIDSM PIG+GQRELIIGD+QTGKT IAID IINQKGK+V CIYV IGQK ST+   +NTL + GA++Y+ +V +SAS+   L Y+AP++G T+ E +M+KG+ VLIIYDDLSKHA+AYRT+SLL+RRPPGREAYPGD+FY+HSRLLER+ K++KENGGGS+TALPIIET AGD++AYIPTNVISITDGQ+F+ T LFN+GQRPA++ G+SVSRVG +AQI A+K+ SG+L+LELAQYREL +F+QFGSDLDK+T+  LE GK++++++KQD+  P +   + +++++    ++  I V  I+ F+++ +      H +  K IL+     D+ K   +   V+ K  F
  S:     1 MHIKPEEITSIIKNEIKNYEKELETVDSGTIIQIGDGVARVYGLEECMEGELLEFPNQVFGMALNLEQDNVGCVLLGSEEGIKEGDIVKRTGKIVEVPVGEDLIGRVVNSLGQPIDGKGPIKNDGYRAIEVPAPGILERSSVNEPLQTGIKAIDSMIPIGRGQRELIIGDRQTGKTAIAIDTIINQKGKDVICIYVAIGQKQSTVANIVNTLTEEGAMDYSIVVTASASESAPLQYIAPYSGCTMGEYFMNKGKHVLIIYDDLSKHAVAYRTMSLLIRRPPGREAYPGDVFYIHSRLLERAAKLSKENGGGSLTALPIIETLAGDVTAYIPTNVISITDGQIFLETELFNAGQRPAVNPGISVSRVGGNAQIKAMKQVSGTLRLELAQYRELASFAQFGSDLDKDTQARLEKGKRLIEILKQDQYKPMAVEKQIMIIYAAVNNFLLDIKVSDIKRFEKEFLEYMDTHHREIGKAILDKKVLDDELKSALESAIVEFKKIF 500
>gi|116629875|ref|YP_815047.1| F0F1 ATP synthase subunit alpha [Lactobacillus gasseri ATCC 33323] >gi|122273187|sp|Q042L3|ATPA_LACGA ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|116095457|gb|ABJ60609.1| F0F1-type ATP synthase, alpha subunit [Lactobacillus gasseri ATCC 33323] (506 aa)
Score = 1384, Expect = 7.1e-151, Identities = 264/483 (54%), Positives = 369/483 (76%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQ-KTILETIDQTKDISQD 483
           +SI  ++ S +IK Q+++Y +K   +E+G V  VGDGI +A GL+NV+ +EL+ F NGSYG+  NLEA   GI++LG+F+DI+EG  VKRT  +++VPVGD L+GRV++ +G P+DG GEIK DK  PIE  APGVM R SV +PL+TG  AID++ PIG+GQRELIIGD++TGKT +A+D IINQKG++V CIYV IGQK ST+   + TLK+FGA++YT +V +  S+   + Y+AP+ G  + EE+M  G+DVLI++DDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLERS K+NK+ GGGS+TALP I+T+AGDISAYIPTNVISITDGQ+F+  +LF +G RPAI+AG SVSRVG SAQI A+KK +G+L+++LA YREL++F+QFGSDLD+ T+  L  G++ ++++KQ  + P     E ++L+++   ++  IPV  I+ ++ ++  +F      +L+ I  T D+ ++
  S:     4 LSIKAEEISALIKQQLEKYDDKLNVNEVGTVTYVGDGIARAHGLNNVLSSELLQFSNGSYGIAQNLEANDVGIIILGRFDDIREGDQVKRTGRIMEVPVGDQLIGRVVNPLGQPVDGLGEIKTDKTRPIESKAPGVMDRQSVNQPLQTGIKAIDALVPIGRGQRELIIGDRKTGKTALALDTIINQKGQDVICIYVAIGQKESTVKNSVETLKRFGAMDYTIVVEAGPSEPAPMLYIAPYAGTAMGEEFMYNGKDVLIVFDDLSKQAVAYREISLLLRRPPGREAYPGDVFYLHSRLLERSAKLNKKLGGGSMTALPFIQTQAGDISAYIPTNVISITDGQIFLEADLFFAGTRPAINAGESVSRVGGSAQIKAMKKVAGTLRVDLASYRELESFAQFGSDLDQATQAKLNRGRRTVEVLKQPLHKPLPVEDEVLILYALTHGFLDAIPVPDIQRYELELYDYFASNYNDLLDVIRTTGDLPEE 487
>gi|157694079|ref|YP_001488541.1| F0F1 ATP synthase subunit alpha [Bacillus pumilus SAFR-032] >gi|166990354|sp|A8FIB4|ATPA_BACP2 ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|157682837|gb|ABV63981.1| H(+)-transporting two-sector ATPase, F(1) alpha subunit [Bacillus pumilus SAFR-032] (502 aa)
Score = 1383, Expect = 9.2e-151, Identities = 269/507 (53%), Positives = 369/507 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQ-QKTILETIDQTKDISQDLFVQIKNEFNSLITSYIKTIPDYN 507
           MSI  ++ S +IK QI+ YQ++    ++G VI VGDGI +  GL N+M  ELV F NG  GM  NLE +  GIV+LG ++DI+EG  VKRT  +++VPVG+ L+GR+++ +G P+DG G I   K  PIE  APGVM R SV EPL+TG  AID++ PIG+GQRELIIGD+QTGKT++AID I+NQK +++ CIYV IGQK ST+   + TL++ GAL+YT +V +SAS    L YLAP+ G+T+ EE+M  G+ VL++YDDLSK A AYR LSLLLRRPPGREA+PGD+FYLHSRLLER+ K++   GGGSITALP +ET+AGDISAYIPTNVISITDGQ+F+ ++LF SG RPA++AGLSVSRVG SAQI A+KK +G+L+L+LA YREL+AF+QFGSDLD+ T+  L  G + ++++KQD N P     +  +L+++   Y+  + V  ++ F+ ++  + ++  K + +TI QT ++  D       E+N+ I  + +T    N
  S:     1 MSIKAEEISALIKQQIQNYQSEIEVKDVGTVIQVGDGIARVHGLDNIMAGELVEFSNGVMGMAQNLEESNVGIVILGPYKDIREGDDVKRTGRIMEVPVGEELIGRIVNPLGQPVDGLGPILTSKTRPIESEAPGVMDRKSVHEPLQTGIKAIDALIPIGRGQRELIIGDRQTGKTSVAIDTILNQKDQDMICIYVAIGQKESTVRGVVETLRKHGALDYTIVVTASASQPAPLLYLAPYAGVTMGEEFMYNGKHVLVVYDDLSKQAAAYRELSLLLRRPPGREAFPGDVFYLHSRLLERAAKLSDAKGGGSITALPFVETQAGDISAYIPTNVISITDGQIFLQSDLFFSGVRPAVNAGLSVSRVGGSAQIKAMKKVAGTLRLDLASYRELEAFAQFGSDLDQATQAKLNRGARTVEVLKQDLNKPLKVEKQVAILYALTRGYLDDVAVADVKRFEAELFMYIEENHKGLFDTISQTGNMPAD------EEWNTAIEGFKRTFAPSN 502
>gi|163762347|ref|ZP_02169412.1| Sua5/YciO/YrdC/YwlC family protein [Bacillus selenitireducens MLS10] >gi|160357086|gb|EDP83734.1| Sua5/YciO/YrdC/YwlC family protein [Bacillus selenitireducens MLS10] (501 aa)
Score = 1383, Expect = 9.8e-151, Identities = 268/483 (55%), Positives = 362/483 (74%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKT-ILETIDQTKDISQD 483
           MSI  D+ S+++K QI+ YQ++   +++G VI VGDGI  A GL NVM  EL+ FENG  GM  NLE  T GI++LG F DI+EG+ V+RT  +++VPVG+ LLGRV++ +G P+DG G ++  K  PIE  APGVM R SV EPL+TG  AIDS+ PIG+GQREL+IGD+QTGKT IAID IINQK +++ CIYV IGQK ST+   + TL+Q GAL+YT +V +SAS    L YLAP+ G+++ EE+M  G+ VL+IYDDL+K A AYR LSLLL+RPPGREA+PGD+FY+HSRLLER+ K++ + G GS+TALP IET+AGDISAYIPTNVISITDGQ+F+  NLF SG RPAIDAGLSVSRVG SAQI A+KK +G+L+L+LA YREL+AF+QFGSDLD+ T+  L  G + ++++KQ  + P S   +  +LF++ + ++  I V  I  F++++    +     +L++I +T +++ D
  S:     1 MSIRADEISSLLKQQIENYQSEIEVNDVGTVIRVGDGIAVAHGLENVMAGELLEFENGVMGMAQNLEENTVGIIILGPFTDIREGNEVRRTGRIMEVPVGEELLGRVVNPLGQPLDGMGPVETGKTRPIESPAPGVMDRKSVHEPLQTGVKAIDSLIPIGRGQRELVIGDRQTGKTAIAIDTIINQKDEDMICIYVAIGQKESTVAGVVETLRQHGALDYTIVVTASASQPAPLLYLAPYAGVSMGEEFMYNGKHVLVIYDDLTKQAAAYRELSLLLKRPPGREAFPGDVFYVHSRLLERAAKLSDDKGAGSLTALPFIETQAGDISAYIPTNVISITDGQIFLQANLFFSGVRPAIDAGLSVSRVGGSAQIKAMKKVAGTLRLDLASYRELEAFAQFGSDLDEATQAKLNRGARTVEVLKQGLHQPLSVEKQVFILFALTKGFLDDIEVSDISRFEQEMYTFLEHNNNDLLKSIKETGNLADD 484
>gi|138896937|ref|YP_001127390.1| F0F1 ATP synthase subunit alpha [Geobacillus thermodenitrificans NG80-2] >gi|158513842|sp|A4ITJ1|ATPA_GEOTN ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|134268450|gb|ABO68645.1| ATPase alpha subunit [Geobacillus thermodenitrificans NG80-2] (502 aa)
Score = 1383, Expect = 1.1e-150, Identities = 268/502 (53%), Positives = 366/502 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQ-KTILETIDQTKDISQDLFVQIKNEFNSLITSYIKT 502
           MSI  ++ S +IK QI+ Y+++   S++G VI +GDGI +  GL NVM  ELV F NG  GM LNLE    GIV+LG +  IKEG  V+RT  +++VPVG+ L+GRV++ +G P+DG G ++  +  PIE  APGVM R SV EPL+TG  AID++ PIG+GQRELIIGD+QTGKT +AID I+NQKG+++ CIYV IGQK ST+   + TL++ GAL+YT +V +SAS    L +LAP+ G+++ E +M KG+ VL++YDDLSK A AYR LSLLLRRPPGREAYPGD+FYLHSRLLER+ K++   G GS+TALP +ET+AGDISAYIPTNVISITDGQ+F+ ++LF SG RPAI+AGLSVSRVG +AQI A+KK SG+L+L+LA YREL+AF+QFGSDLDK T+  L  G + ++++KQD + P     +  +++++   ++  IPV+ +  F+++      Q  + +LE I  TKD+  +       +FN  I ++ KT
  S:     1 MSIRAEEISALIKQQIENYESQIQVSDVGTVIQIGDGIARVHGLDNVMSGELVEFANGVMGMALNLEENNVGIVILGPYTGIKEGDEVRRTGRIMEVPVGEALIGRVVNPLGQPVDGLGPVETTETRPIESPAPGVMDRKSVHEPLQTGIKAIDALVPIGRGQRELIIGDRQTGKTAVAIDTILNQKGQDMICIYVAIGQKESTVRTVVETLRKHGALDYTIVVTASASQPAPLLFLAPYAGVSMGEYFMYKGKHVLVVYDDLSKQAAAYRELSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSDAKGAGSLTALPFVETQAGDISAYIPTNVISITDGQIFLQSDLFFSGVRPAINAGLSVSRVGGAAQIKAMKKVSGTLRLDLAAYRELEAFAQFGSDLDKATQAKLARGARTVEVLKQDLHQPIPVEKQVAIIYALTRGFLDDIPVEDVRRFEKEFFLWLDQNGQHLLEHIRTTKDLPNE------EDFNKAIEAFKKT 497
>gi|154687798|ref|YP_001422959.1| F0F1 ATP synthase subunit alpha [Bacillus amyloliquefaciens FZB42] >gi|166201651|sp|A7Z9Q2|ATPA_BACA2 ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|52673268|emb|CAH56507.1| ATP synthase alpha chain [Bacillus amyloliquefaciens FZB42] >gi|154353649|gb|ABS75728.1| AtpA [Bacillus amyloliquefaciens FZB42] (502 aa)
Score = 1383, Expect = 1.1e-150, Identities = 271/507 (53%), Positives = 365/507 (71%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQ-QKTILETIDQTKDISQDLFVQIKNEFNSLITSYIKTIPDYN 507
           MSI  ++ S +IK QI+ YQ++    ++G VI VGDGI +  GL N M  ELV F NG  GM  NLE +  GIV+LG + DI+EG  VKRT  +++VPVG+ L+GR+++ +G P+DG G I   K  PIE  APGVM R SV EPL+TG  AID++ PIG+GQRELIIGD+QTGKT++AID I+NQK +++ C+YV IGQK ST+   + TL++ GAL+YT +V +SAS    L YLAP+ G+T+ EE+M  G+ VL++YDDLSK A AYR LSLLLRRPPGREA+PGD+FYLHSRLLER+ K++   G GSITALP +ET+AGDISAYIPTNVISITDGQ+F+ ++LF SG RPAI+AGLSVSRVG SAQI A+KK +G+L+L+LA YREL+AF+QFGSDLD+ T+  L  G + ++++KQD N P     +  +L+++ + Y+  IPV  I  F+E+   +  Q  K +L+ I +T ++  D       +F + I  + +T    N
  S:     1 MSIKAEEISTLIKQQIQNYQSEIEVHDVGTVIQVGDGIARVHGLDNCMAGELVEFSNGVLGMAQNLEESNVGIVILGPYRDIREGDEVKRTGRIMEVPVGEELIGRIVNPLGQPVDGLGPILTSKTRPIESQAPGVMDRKSVHEPLQTGIKAIDALIPIGRGQRELIIGDRQTGKTSVAIDTILNQKDQDMICVYVAIGQKESTVRGVVETLRKHGALDYTIVVTASASQPAPLLYLAPYAGVTMGEEFMYNGKHVLVVYDDLSKQAAAYRELSLLLRRPPGREAFPGDVFYLHSRLLERAAKLSDAKGAGSITALPFVETQAGDISAYIPTNVISITDGQIFLQSDLFFSGVRPAINAGLSVSRVGGSAQIKAMKKVAGTLRLDLASYRELEAFAQFGSDLDQATQAKLNRGARTVEVLKQDLNKPLPVEKQVAILYALTKGYLDDIPVADIRRFEEEYYMYLDQNHKDLLDGIAKTGNLPAD------EDFKAAIEGFKRTFAPSN 502
>gi|196249754|ref|ZP_03148450.1| ATP synthase F1, alpha subunit [Geobacillus sp. G11MC16] >gi|196210630|gb|EDY05393.1| ATP synthase F1, alpha subunit [Geobacillus sp. G11MC16] (505 aa)
Score = 1382, Expect = 1.2e-150, Identities = 268/502 (53%), Positives = 366/502 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQ-KTILETIDQTKDISQDLFVQIKNEFNSLITSYIKT 502
           MSI  ++ S +IK QI+ Y+++   S++G VI +GDGI +  GL NVM  ELV F NG  GM LNLE    GIV+LG +  IKEG  V+RT  +++VPVG+ L+GRV++ +G P+DG G ++  +  PIE  APGVM R SV EPL+TG  AID++ PIG+GQRELIIGD+QTGKT +AID I+NQKG+++ CIYV IGQK ST+   + TL++ GAL+YT +V +SAS    L +LAP+ G+++ E +M KG+ VL++YDDLSK A AYR LSLLLRRPPGREAYPGD+FYLHSRLLER+ K++   G GS+TALP +ET+AGDISAYIPTNVISITDGQ+F+ ++LF SG RPAI+AGLSVSRVG +AQI A+KK SG+L+L+LA YREL+AF+QFGSDLDK T+  L  G + ++++KQD + P     +  +++++   ++  IPV+ +  F+++      Q  + +LE I  TKD+  +       +FN  I ++ KT
  S:     4 MSIRAEEISALIKQQIENYESQIQVSDVGTVIQIGDGIARVHGLDNVMSGELVEFANGVMGMALNLEENNVGIVILGPYTGIKEGDEVRRTGRIMEVPVGEALIGRVVNPLGQPVDGLGPVETTETRPIESPAPGVMDRKSVHEPLQTGIKAIDALVPIGRGQRELIIGDRQTGKTAVAIDTILNQKGQDMICIYVAIGQKESTVRTVVETLRKHGALDYTIVVTASASQPAPLLFLAPYAGVSMGEYFMYKGKHVLVVYDDLSKQAAAYRELSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSDAKGAGSLTALPFVETQAGDISAYIPTNVISITDGQIFLQSDLFFSGVRPAINAGLSVSRVGGAAQIKAMKKVSGTLRLDLAAYRELEAFAQFGSDLDKATQAKLARGARTVEVLKQDLHQPIPVEKQVAIIYALTRGFLDDIPVEDVRRFEKEFFLWLDQNGQHLLEHIRTTKDLPNE------EDFNKAIEAFKKT 500
>gi|52082215|ref|YP_081006.1| F0F1 ATP synthase subunit alpha [Bacillus licheniformis ATCC 14580] >gi|52787606|ref|YP_093435.1| F0F1 ATP synthase subunit alpha [Bacillus licheniformis ATCC 14580] >gi|81608869|sp|Q65DX2|ATPA_BACLD ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|52005426|gb|AAU25368.1| ATP synthase (subunit alpha) [Bacillus licheniformis ATCC 14580] >gi|52350108|gb|AAU42742.1| AtpA [Bacillus licheniformis DSM 13] (502 aa)
Score = 1382, Expect = 1.3e-150, Identities = 264/483 (54%), Positives = 360/483 (74%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQ-QKTILETIDQTKDISQD 483
           MSI  ++ S +IK QI+ YQ++    ++G VI VGDGI +  GL N M  ELV F NG  G+  NLE +  GIV+LG ++DI+EG  VKRT  +++VPVG+ LLGRV++ +G P+DG G +   K  PIE  APGVM R SV EPL+TG  +ID++ PIG+GQRELIIGD+QTGKT+IAID I+NQK +++ CIYV IGQK ST+   + TL++ GAL+YT +V +SAS    L YLAP+ G+ + EE+M  G+ VL++YDDLSK A AYR LSLLLRRPPGREA+PGD+FYLHSRLLER+ K++   GGGS+TALP +ET+AGDISAYIPTNVISITDGQ+F+ ++LF SG RPA++ GLSVSRVG SAQI A+KK +G+L+L+LA YREL+AF+QFGSDLDK T+  L  G + ++++KQD + P     +  +L+++   ++  +PV+ I+ F+E++  +  Q  K +L++I QT ++  D
  S:     1 MSIKAEEISTLIKQQIENYQSEIEVHDVGTVIQVGDGIARVHGLDNCMAGELVEFSNGVLGLAQNLEESNVGIVILGPYKDIREGDEVKRTGRIMEVPVGEELLGRVVNPLGQPVDGMGPVLTSKTRPIESPAPGVMDRKSVHEPLQTGIKSIDALIPIGRGQRELIIGDRQTGKTSIAIDTILNQKDQDMICIYVAIGQKESTVRGVVETLRKHGALDYTIVVTASASQPAPLLYLAPYAGVAMGEEFMYNGKHVLVVYDDLSKQATAYRELSLLLRRPPGREAFPGDVFYLHSRLLERAAKLSDAKGGGSLTALPFVETQAGDISAYIPTNVISITDGQIFLQSDLFFSGVRPAVNPGLSVSRVGGSAQIKAMKKVAGTLRLDLASYRELEAFAQFGSDLDKATQAKLNRGARTVEVLKQDLHKPLRVEKQVAILYALTRGFLDDVPVEDIKRFEEELFMYLDQNHKDLLDSIAQTGNLPAD 484
>gi|160942707|ref|ZP_02089949.1| hypothetical protein FAEPRAM212_00183 [Faecalibacterium prausnitzii M21/2] >gi|158445981|gb|EDP22984.1| hypothetical protein FAEPRAM212_00183 [Faecalibacterium prausnitzii M21/2] (506 aa)
Score = 1382, Expect = 1.4e-150, Identities = 270/501 (53%), Positives = 364/501 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQ---KTILETIDQTKDISQDLFVQIKNEFNSLITSYIK 501
           M +  ++ S II+ QIK Y+N    SE G VI VGDGI +ASGL   M  EL+ F+NG YGM  NLE  T  IV+LG    IKEGSIVKRT  VV VPVGD ++GRV++A+G PIDG G I+  +   IE  APG++ R  V EPL+TG  AIDSM PIG+GQRELIIGD+QTGKTTIA D IINQKGK+V CIYV IGQK ST+   + +L + GA+ YT +V+++AS+L  L Y+AP++G  + E +M +G+ VLIIYDDLSKHA+AYR LSLL+RRPPGREAYPGD+FYLHSRLLER+ K++ E GGGS+TALPIIET+AGD+SAYIPTNVISITDGQ+F+ T LF+SG  PA++ G+SVSRVG +AQI A+KK +G+LKL  +QYREL +F+QFGSDLD +TK  L  G+++++++KQ+++ P     +  +L++    Y+  + V  + ++++ +  +         +++TI  T ++ +D   Q+K        S++K
  S:     1 MQLKPEEISKIIRAQIKHYENAIEQSETGTVIMVGDGIARASGLEKCMAGELLQFDNGEYGMAQNLEENTVSIVLLGSDAGIKEGSIVKRTGKVVSVPVGDAMIGRVVNALGQPIDGAGPIETTEYRAIESRAPGIIERQPVKEPLQTGIKAIDSMIPIGRGQRELIIGDRQTGKTTIASDTIINQKGKDVICIYVAIGQKRSTVANLVQSLTEAGAMGYTIVVSATASELSPLQYIAPYSGCAMGEYFMQQGKHVLIIYDDLSKHAVAYRALSLLIRRPPGREAYPGDVFYLHSRLLERAAKLSNELGGGSLTALPIIETQAGDVSAYIPTNVISITDGQIFLETELFHSGVMPAVNPGISVSRVGGNAQIKAMKKVAGTLKLIYSQYRELQSFAQFGSDLDADTKARLAQGERIVEVLKQNRSAPVPVEKQVAILYATIHDYLVNVKVPDVAEYEKSLYEYLDNDAAGAAVMDTIRTTGNLDKDTEEQLKAVLTRYTESFVK 504
>gi|187777255|ref|ZP_02993728.1| hypothetical protein CLOSPO_00807 [Clostridium sporogenes ATCC 15579] >gi|187774183|gb|EDU37985.1| hypothetical protein CLOSPO_00807 [Clostridium sporogenes ATCC 15579] (504 aa)
Score = 1380, Expect = 2.0e-150, Identities = 272/498 (54%), Positives = 375/498 (75%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIR----HFKQ-QKTILETIDQTKDISQDLFVQIKNEFNSLITS 498
           M I  ++ ++IIK QI+++       + G +I +GDGI +  GL + M  EL+ F N  YGM LNLE    G V+LG  E IKEG++VKRT  VV+VPVG+ L+GRV++++G  IDG G +  ++   +E  APGV+ R SV EPL+TG  AIDSM PIGKGQRELIIGD+QTGKT IAID I+NQK  +V CIYV IGQK ST+   +N L + GA++YT +V+S+ASD   L YL+P+ G ++ E +M KG+DVLI+YDDLSKHA+AYRT+SLLLRRPPGREAYPGD+FYLHSRLLERS +++++ GGGS+TALPI+ET AGD++AYIPTNVISITDGQ+F+  +LFN+GQRPA++AG+SVSRVG +AQI A+K+ +G+L+L+LAQYREL AFSQFGSDLDKE+ + LE GK++++++KQ +  P     E I+L+++   ++  IPV+ I+ F+E++ +    H+++ +K ILE    T ++   L   I N+F ++  S
  S:     1 MHIKPEEITSIIKQQIEKFNTNVETVDSGTIIQIGDGIARVYGLQDCMEGELIEFPNDVYGMALNLEQDNVGCVLLGSEEGIKEGNVVKRTGKVVEVPVGEALVGRVVNSLGMAIDGKGPVLTNETRAVEVQAPGVIDRQSVKEPLQTGIKAIDSMIPIGKGQRELIIGDRQTGKTAIAIDTILNQKDNDVICIYVAIGQKQSTVAHIVNDLTKMGAMDYTIVVSSTASDSAPLQYLSPYAGCSMGEYFMHKGKDVLIVYDDLSKHAVAYRTMSLLLRRPPGREAYPGDVFYLHSRLLERSARLSEKLGGGSLTALPIVETLAGDVTAYIPTNVISITDGQIFLEADLFNAGQRPAVNAGISVSRVGGNAQIKAMKQVAGTLRLDLAQYRELAAFSQFGSDLDKESVKRLEKGKRLVEILKQPQYRPMPVEKEIIILYAVVNNHLSDIPVNKIKAFEEELFKYMDTHYREIEKEILEKKQLTDELKSKLDKAI-NDFKNVFLS 502
>gi|182623933|ref|ZP_02951721.1| ATP synthase F1, alpha subunit [Clostridium perfringens D str. JGS1721] >gi|177910826|gb|EDT73180.1| ATP synthase F1, alpha subunit [Clostridium perfringens D str. JGS1721] (502 aa)
Score = 1380, Expect = 2.1e-150, Identities = 273/492 (55%), Positives = 372/492 (75%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIR-----HFKQQKTILETI---DQTKDISQDLFVQIKNEF 492
           M I  ++ ++IIKN+IK Y+ +    + G +I +GDG+ +  GL   +  EL+ F N  +GM LNLE    G V+LG  E IKEG IVKRT  +V+VPVG+ L+GRV++++G PIDG G IK D    IE  APG++ R+SV EPL+TG  AIDSM PIG+GQRELIIGD+QTGKT IAID IINQKGK+V CIYV IGQK ST+   +NTL + GA++Y+ +V +SAS+   L Y+AP++G T+ E +M+KG+ VLIIYDDLSKHA+AYRT+SLL+RRPPGREAYPGD+FY+HSRLLER+ K++KENGGGS+TALPIIET AGD++AYIPTNVISITDGQ+F+ T LFN+GQRPA++ G+SVSRVG +AQI A+K+ SG+L+LELAQYREL +F+QFGSDLDK+T+  LE GK++++++KQD+  P +   + +++++    ++  I V  I+ F+++ +      H +  K IL+     D+ K   +   V+ K  F
  S:     1 MHIKPEEITSIIKNEIKNYEKELETVDSGTIIQIGDGVARVYGLEECIEGELLEFPNQVFGMALNLEQDNVGCVLLGSEEGIKEGDIVKRTGKIVEVPVGEDLIGRVVNSLGQPIDGKGPIKNDGYRAIEVPAPGILERSSVNEPLQTGIKAIDSMIPIGRGQRELIIGDRQTGKTAIAIDTIINQKGKDVICIYVAIGQKQSTVANIVNTLTEEGAMDYSIVVTASASESAPLQYIAPYSGCTMGEYFMNKGKHVLIIYDDLSKHAVAYRTMSLLIRRPPGREAYPGDVFYIHSRLLERAAKLSKENGGGSLTALPIIETLAGDVTAYIPTNVISITDGQIFLETELFNAGQRPAVNPGISVSRVGGNAQIKAMKQVSGTLRLELAQYRELASFAQFGSDLDKDTQARLEKGKRLIEILKQDQYKPMAVEKQIMIIYAAVNNFLLDIKVSDIKRFEKEFLEYMDTHHREIGKAILDKKVLDDELKSALESAIVEFKKIF 500
>gi|167768300|ref|ZP_02440353.1| hypothetical protein CLOSS21_02856 [Clostridium sp. SS2/1] >gi|167709824|gb|EDS20403.1| hypothetical protein CLOSS21_02856 [Clostridium sp. SS2/1] (499 aa)
Score = 1380, Expect = 2.2e-150, Identities = 270/500 (54%), Positives = 364/500 (72%)
  Q:     2 SINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQ-KTILETIDQTKDISQDLFVQIKNEFNSLITSYIK 501
           SIN +   +++K+QI+ Y  K    E GR+I + DGI    G+   M  ELV+FE G +G+ LN+E    G V+LG    + EGS V RT    D+PVGD ++GRV++A+G PIDG GEIK D++ PIE  A GV+ R SV +PL+TG LAIDSMFPIG+GQRELIIGD+QTGKT+IA+D I+NQKG++V CIYV IGQK ST+ Q + TL + GA++Y+ +V++SASDL SL Y+AP+ G  IAE +M +G+DVLI+YDDLSKHA+AYR +SLLL RPPGREAYPGD+FYLHSRLLERS +++ E GGGSITALPIIET+AGD+SAYIPTNVISITDGQ+F+ + LF SG RPA++ GLSVSRVG +AQ   +KK +G+L+++LAQYREL+ F+QF SDLD  TK  L +G  +++L+KQ    P +   + +LLF+   K +  +PV  ++   E++   F+Q+    ++ ID+ K ++ D    I  E    I +Y+K
  S:     3 SINPETVVSVLKDQIENYDQKTEVKEEGRIIQIADGIATVYGMDQAMYGELVIFETGVHGLVLNVERNCIGCVLLGSDHGLMEGSKVARTGVQADIPVGDAMIGRVVNAIGEPIDGKGEIKTDERRPIEHEAAGVIDRKSVDQPLQTGILAIDSMFPIGRGQRELIIGDRQTGKTSIAVDTILNQKGQDVICIYVAIGQKASTVSQIVTTLSKHGAMDYSIVVSASASDLASLQYIAPYAGTAIAEHFMHQGKDVLIVYDDLSKHAVAYRAISLLLDRPPGREAYPGDVFYLHSRLLERSCRLSDELGGGSITALPIIETQAGDVSAYIPTNVISITDGQIFLESELFFSGVRPAVNVGLSVSRVGGAAQTKIMKKVAGNLRIDLAQYRELEVFTQFSSDLDDGTKATLNYGSHLIELLKQPLYHPMALHKQILLLFAAGHKMLNDVPVKELKAETEEMTAFFEQKYPETVKKIDEGKVLTDD----IAKEIQEAIEAYLK 499
>gi|187603977|ref|ZP_02990188.1| ATP synthase F1, alpha subunit [Exiguobacterium sp. AT1b] >gi|187484039|gb|EDU22032.1| ATP synthase F1, alpha subunit [Exiguobacterium sp. AT1b] (502 aa)
Score = 1379, Expect = 2.4e-150, Identities = 273/483 (56%), Positives = 360/483 (74%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQ-QKTILETIDQTKDISQD 483
           M+I  ++ S ++K +I  Y ++   SE G VI VGDGI +A GL NVM  ELV F NG  G+  NLE    GI++LG ++ IKEG  VKRT  +++VPVG+ LLGRV++ +G PIDG G I  D   PIE+ A GVMAR SV EPL+TG  AID++ PIG+GQRELIIGD+QTGKT++AID IINQK +N+ CIYV IGQK ST+   + TL+Q GAL+YT +V++SAS    L YLAPF G+++ E +M +G+ VL++YDDLSK A AYR LSLLLRRPPGREAYPGD+FYLHSRLLER+ K+N E GGGS+TALP IET+A DISAYIPTNVISITDGQ+F+ ++LF SG RPAI+AGLSVSRVG SAQ+ A+KK +G+L+L+LA YREL+AF+QFGSDLDK T+  L  G++ ++++KQD N P S   + I+++++ + ++  IPV  I  F+ ++     Q +K +   I QT ++  D
  S:     1 MTIKAEEISALLKERIASYGSEIEVSETGTVIQVGDGIARAHGLDNVMAGELVEFSNGVMGLAQNLEEGNVGIIILGDYKGIKEGDSVKRTGRIMEVPVGEALLGRVVNPLGQPIDGLGPIVTDTYNPIERKAYGVMARKSVHEPLQTGIKAIDALVPIGRGQRELIIGDRQTGKTSVAIDTIINQKEENMICIYVAIGQKESTVRGVVETLRQNGALDYTIVVSASASQPAPLLYLAPFAGVSMGEYFMDRGQHVLVVYDDLSKQAAAYRELSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNDELGGGSLTALPFIETQASDISAYIPTNVISITDGQIFLQSDLFFSGVRPAINAGLSVSRVGGSAQVKAMKKVAGTLRLDLASYRELEAFAQFGSDLDKATQSKLNRGQRTVEVLKQDLNAPLSVDKQVIIIYALTKGHLDDIPVTDIRRFETEMNAWLDQNRKDLCREIRQTGNLPSD 484
>gi|188587436|ref|YP_001918981.1| ATP synthase F1, alpha subunit [Natranaerobius thermophilus JW/NM-WN-LF] >gi|179352123|gb|ACB86393.1| ATP synthase F1, alpha subunit [Natranaerobius thermophilus JW/NM-WN-LF] (508 aa)
Score = 1379, Expect = 2.5e-150, Identities = 262/493 (53%), Positives = 367/493 (74%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKT-ILETIDQTKDISQDLFVQIKNEFN 493
           MSI  D+ S ++K++I  Y+++    E+G V+ +GDGI +  GL NVM NELV F    YGM LNLE    G V+LG++  IKEG  VKRT  +++VPVGD L+GRV++ +G P DG G I+     P+E  APGV+ R  V EPL+TG  AIDSM PIG+GQRELIIGD+ TGK+ I ID I+NQK  +V CIYV IGQK ST+ Q ++ L++ GA++YTT+VA++A +   L YLAP+ G ++ E++M +G+ VL++YDDLSKHA +YR LSLLLRRPPGREAYPGDIFYLHSRLLER+ K+N ENGGGS+TALPIIET+AGD+SAYIPTNVISITDGQ++++++LF++GQRPA+D G+SVSRVG SAQ+  +K+ SG+L+L+LAQYREL+AF+QFG+DLDK T++ L  GK+  +++KQD+  P   + + +++F      +  + V+ I++F++ ++ + K  +  I + ++  + IS +L  Q+K   N
  S:     1 MSIRPDEISTVLKDKIANYESQVDVYEVGTVLYIGDGIARVHGLENVMANELVEFPGEIYGMALNLEEDNVGCVLLGEYSHIKEGDQVKRTGRIIEVPVGDDLVGRVVNPVGEPRDGKGPIEATDFRPVETRAPGVIDRKPVEEPLQTGLKAIDSMIPIGRGQRELIIGDRGTGKSAIGIDTILNQKDSDVYCIYVAIGQKKSTVAQVVDVLERHGAMDYTTVVAATADEPAPLLYLAPYAGCSMGEKFMHEGKHVLVVYDDLSKHAASYRELSLLLRRPPGREAYPGDIFYLHSRLLERAAKLNDENGGGSLTALPIIETQAGDVSAYIPTNVISITDGQIYLISDLFHAGQRPAVDVGISVSRVGGSAQLKGMKQVSGTLRLDLAQYRELEAFAQFGTDLDKSTQQKLARGKRTFEILKQDQYQPMPVADQIVIIFCATHGLLDDLEVEQIKEFEKFLLSYVKDNEPGIYQQVETGEKISDELEDQLKEVIN 494
>gi|78044529|ref|YP_361340.1| F0F1 ATP synthase subunit alpha [Carboxydothermus hydrogenoformans Z-2901] >gi|115312240|sp|Q3A944|ATPA_CARHZ ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|77996644|gb|ABB15543.1| ATP synthase F1, alpha subunit [Carboxydothermus hydrogenoformans Z-2901] (501 aa)
Score = 1379, Expect = 2.5e-150, Identities = 269/502 (53%), Positives = 361/502 (71%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKTILETIDQTKDISQDLFVQIKNEFNSLITSYIKT 502
           M++  ++  +IIK QI+ YQ +   S +G VI VGDGI +  GL + M +EL+ F  G  GM LNLE    G V+LG +  IKEG  VKRT  VV VPVG+ L+GRV++ +G P+DG G I  DK  P+E+IAPGV+ R SV EPL+TG  AIDSM PIG+GQRELIIGD+QTGKT IAID IINQK  +V CIYV IGQK ST+ + + TLK  GA++YT +V+++ASD   L YLAP+ G  + EE+M +G+ VL++YDDLSK A AYR LSLLLRRPPGREAYPGD+FYLHSRLLER+ K++ E GGGS+TALPIIET+AGD+SAYIPTNVISITDGQ+++ ++LF +G RPA++ GLSVSRVG +AQI A+K+ +GSL+L+LAQYREL AF+QFGSDLDK T   L  G+++++L+KQD+  P     + + +F+    Y+  +PV+ +  F+ + ++  +     +    +TK +  D   ++ +   S I  + KT
  S:     1 MNLRPEEIGSIIKQQIENYQVQVEVSSVGTVIQVGDGIARVYGLEDCMASELLEFPGGVLGMALNLEEDNVGCVILGPYTHIKEGDTVKRTGRVVSVPVGEALIGRVVNPLGQPLDGKGPIVTDKFRPVERIAPGVITRKSVHEPLQTGIKAIDSMIPIGRGQRELIIGDRQTGKTAIAIDTIINQKNTDVICIYVAIGQKASTVAKVVQTLKDHGAMDYTIVVSATASDPAPLLYLAPYAGCAMGEEFMEQGKHVLVVYDDLSKQAAAYRELSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSDEYGGGSLTALPIIETQAGDVSAYIPTNVISITDGQIYLESDLFYAGVRPAVNVGLSVSRVGGAAQIKAMKQVAGSLRLDLAQYRELAAFAQFGSDLDKATLARLTRGERLVELLKQDQYKPMPVEEQVMAIFAAVNGYLDDLPVEKVRPFEAEFLKFMRANYPQIGEEIRTKGVLTD---ELTSRLKSAIEEFKKT 499
>gi|164688906|ref|ZP_02212934.1| hypothetical protein CLOBAR_02554 [Clostridium bartlettii DSM 16795] >gi|164602110|gb|EDQ95575.1| hypothetical protein CLOBAR_02554 [Clostridium bartlettii DSM 16795] (500 aa)
Score = 1378, Expect = 3.4e-150, Identities = 273/492 (55%), Positives = 359/492 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKTIL-ETIDQTKDISQDLFVQIKNEF 492
           M++  ++ S+IIK QIK Y NK   ++ G V+ VGDGI    GL NVM +EL+ F    +GM LNLE    G V+ G    IKEG IVKRT  +V+VPVG+ ++GRV+  +G PIDG G I  +K  P+E  APG+MAR SV EPL+TG  +IDSM PIG+GQRELIIGD+QTGKT+IAID I+NQKGK+V CIYV IGQK ST+ Q ++ L+  GA++YT +V+++AS+   L YLAP+ G  + EE+M  G+ VLIIYDDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K++ E GGGS+TALPIIET+AGD+SAYIPTNVISITDGQ+++   LF SG RPA+D G+SVSRVG SAQI ++KK SG+LKL  +QYREL +FSQFGSDLD +TK  L  G+++++++KQ +N P   S + +++F++   ++  IPV  +  F+ ++ +        L E I   KD + DL   I NEF
  S:     1 MNLRPEEISSIIKQQIKNYDNKIELTDTGSVLKVGDGIATVYGLENVMSSELLEFPGEVFGMALNLEEDVVGAVLFGDDSGIKEGDIVKRTGRIVEVPVGEAMIGRVVSPLGLPIDGKGPINTNKTRPVESPAPGIMARRSVYEPLQTGIKSIDSMIPIGRGQRELIIGDRQTGKTSIAIDTILNQKGKDVICIYVAIGQKRSTVAQLVSRLENGGAMDYTIVVSATASESAPLQYLAPYAGAAMGEEFMYNGKHVLIIYDDLSKQAVAYREMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSDELGGGSMTALPIIETQAGDVSAYIPTNVISITDGQIYLQPELFYSGVRPAVDPGISVSRVGGSAQIKSMKKVSGTLKLAYSQYRELASFSQFGSDLDADTKRRLAQGERIVEVLKQGENAPLDVSDQVMIIFAVTNGFVDDIPVSELSRFESELFKFVDANYPELSEKILANKDFTTDLTTAI-NEF 492
>gi|14916960|sp|P22477|ATPA_BACPF ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|12061044|gb|AAG48361.1|AF330160_8 ATP synthase alpha subunit [Bacillus pseudofirmus] (502 aa)
Score = 1378, Expect = 3.5e-150, Identities = 267/483 (55%), Positives = 361/483 (74%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQ-QKTILETIDQTKDISQD 483
           MSI  ++ S++IK QI+ +Q+     ++G VI VGDGI  A GL NVM  EL+ F NG  GM  NLE    GI++LG + DI+EG  VKRT  +++VPVG+ LLGRV++ +G PIDG G I   K  PIE  APGVM R SV EPL+TG  +ID+M PIG+GQRELIIGD+QTGKT IAID I+NQK +++ CIYV IGQK+ST+   + TL+Q GAL+YT +V++SASD   + +LAP+ G+++ EE+M  G+ VL+IYDDLSK A AYR LSLLLRRPPGREA+PGD+FYLHSRLLER+ K++   GGGSITALP IET+AGD+SAYIPTNVISITDGQ+F+ ++LF SG RPA++AGLSVSRVG SAQI A+KK SG+L+L+LA YREL+AF+QFGSDLDK T+  L  G++ ++++KQD + P     +  +++++ + ++  IPV+ ++ F+ +        +K +L+ I  T ++ +D
  S:     1 MSIKPEEISSLIKQQIESFQSDVQVQDVGTVIRVGDGIALAHGLENVMAGELLEFSNGVMGMAQNLEENNIGIIILGPYTDIREGDEVKRTGRIMEVPVGEELLGRVVNPLGQPIDGLGPIATTKSRPIESPAPGVMDRKSVHEPLQTGIKSIDTMIPIGRGQRELIIGDRQTGKTAIAIDTILNQKDEDMICIYVAIGQKDSTVAGVVETLRQRGALDYTIVVSASASDPAPMLFLAPYAGVSMGEEFMYNGKHVLVIYDDLSKQASAYRELSLLLRRPPGREAFPGDVFYLHSRLLERAAKLSDAKGGGSITALPFIETQAGDVSAYIPTNVISITDGQIFLQSDLFYSGIRPAVNAGLSVSRVGGSAQIKAMKKVSGTLRLDLAAYRELEAFAQFGSDLDKATQAKLNRGQRTVEVLKQDLHNPLPVEKQVAIIYALTKGFMDDIPVEDVQRFESEFFTFLDHNKKDLLDHIRTTGNLPED 484
>gi|134300983|ref|YP_001114479.1| ATP synthase F1, alpha subunit [Desulfotomaculum reducens MI-1] >gi|189081298|sp|A4J9A1|ATPA_DESRM ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|134053683|gb|ABO51654.1| ATP synthase F1, alpha subunit [Desulfotomaculum reducens MI-1] (501 aa)
Score = 1378, Expect = 3.6e-150, Identities = 263/483 (54%), Positives = 359/483 (74%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKT-ILETIDQTKDISQD 483
           M++  ++ S+II+ QI +Y+ +   S++G VI VGDGI +  GL + M  EL+ F  G+ GM LNLE    G V++G +  IKEG  VKRT  ++ VPVGD L+GRV++ +G PIDG G IK +K  P E+IAPGV+ R SV  PL+TG  AID+M P+G+GQRELIIGD+QTGKT +A+DAIINQKG++V CIYV +GQK ST+   + TL+  GA+EY+ +VA++AS+   L YLAP++G  + EE+M  G+DVLIIYDDLSK A AYR +SLLLRRPPGREA+PGD+FYLHSRLLER+ ++  E GGGSITALPIIET+AGD+SAYIPTNVISITDGQ+F+ T+LFNSGQRPAI  GLSVSRVG +AQI A+K+ +G L+L+LAQYREL AF+QFGSDLDK T+  L  G + ++++KQ +  P+    + +++++  + ++  + ++ I  F++  I   +  K  IL+ I + K+I  +
  S:     1 MNLRPEEISSIIRQQIDKYEAQVEVSDVGTVIQVGDGIARVYGLEDCMAAELLEFPGGTLGMALNLEEDNIGCVIMGPYTHIKEGDPVKRTGRIISVPVGDALIGRVVNPLGQPIDGKGPIKTEKYRPTERIAPGVITRKSVTVPLQTGLKAIDAMVPVGRGQRELIIGDRQTGKTAVAVDAIINQKGQDVICIYVAVGQKASTVAGVVQTLEAHGAMEYSIVVAANASEPAPLLYLAPYSGCAMGEEFMDNGKDVLIIYDDLSKQATAYREMSLLLRRPPGREAFPGDVFYLHSRLLERAARLAPEFGGGSITALPIIETQAGDVSAYIPTNVISITDGQIFLETDLFNSGQRPAISVGLSVSRVGGAAQIKAMKQVAGQLRLDLAQYRELAAFAQFGSDLDKATQARLNRGARTVQILKQGQYKPYPVEEQVVVIYTAVKGFLDDVELNKIGAFEDGFINFMRSNKADILKAIREQKEIKPE 484
>gi|46908703|ref|YP_015092.1| F0F1 ATP synthase subunit alpha [Listeria monocytogenes str. 4b F2365] >gi|47094110|ref|ZP_00231834.1| ATP synthase F1, alpha subunit [Listeria monocytogenes str. 4b H7858] >gi|153168636|ref|ZP_01928459.1| ATP synthase F1, alpha subunit [Listeria monocytogenes FSL N1-017] >gi|153204117|ref|ZP_01944967.1| ATP synthase F1, alpha subunit [Listeria monocytogenes HPB2262] >gi|167015619|ref|ZP_02278152.1| F0F1 ATP synthase subunit alpha [Listeria monocytogenes FSL J1-194] >gi|167218320|ref|ZP_02287956.1| F0F1 ATP synthase subunit alpha [Listeria monocytogenes FSL J1-175] >gi|81698745|sp|Q71WP7|ATPA2_LISMF ATP synthase subunit alpha 2 (ATPase subunit alpha 2) (ATP synthase F1 sector subunit alpha 2) >gi|46881975|gb|AAT05269.1| ATP synthase F1, alpha subunit [Listeria monocytogenes str. 4b F2365] >gi|47017517|gb|EAL08326.1| ATP synthase F1, alpha subunit [Listeria monocytogenes str. 4b H7858] >gi|133726199|gb|EBA27897.1| ATP synthase F1, alpha subunit [Listeria monocytogenes FSL N1-017] >gi|133734349|gb|EBA36047.1| ATP synthase F1, alpha subunit [Listeria monocytogenes HPB2262] (504 aa)
Score = 1378, Expect = 3.8e-150, Identities = 264/483 (54%), Positives = 357/483 (73%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQ-QKTILETIDQTKDISQD 483
           MSI  ++ S+IIK QI+ YQ++   S++G V  +GDGI +A GL N M  EL+ F NG  GM  NLE    GI++LG + +I+EG  V+RT  +++VPVG+ L+GRV++++G P+DG G I+     PIE +APGVM R SV EPL+TG  AID++ PIG+GQRELIIGD+QTGKT++AID I+NQ  +++ CIYV IGQK ST+   + TL+  GAL+YT +V ++AS    L YLAP+ G+ +AEE+M  G+ VL++YDDLSK A AYR LSLLLRRPPGREAYPGD+FYLHSRLLER+ K+N   GGGSITALP +ET+AGDISAYIPTNVISITDGQ+F+ ++LF SG RPAI+AGLSVSRVG SAQI A+K  +G+L+L+LA YREL++FSQFGSDLD  T+  LE GK+ ++++KQD + P     + ++L+++  KY+  +PV  +  F+ ++   F      +LE I  TK +  +
  S:     1 MSIKAEEISSIIKQQIENYQSELKVSDVGTVTYIGDGIARAHGLDNAMAGELLEFSNGVMGMAQNLETNDVGIIILGPYTEIREGDEVRRTGKIMEVPVGEALIGRVVNSLGQPVDGLGPIETTGTRPIEAVAPGVMQRQSVNEPLQTGIKAIDALVPIGRGQRELIIGDRQTGKTSVAIDTILNQADQDMICIYVAIGQKESTVRNAVETLRHHGALDYTIVVTAAASQPAPLLYLAPYAGVAMAEEFMYNGKHVLVVYDDLSKQAAAYRELSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNDSLGGGSITALPFVETQAGDISAYIPTNVISITDGQIFLQSDLFFSGVRPAINAGLSVSRVGGSAQIKAMKTVAGTLRLDLAAYRELESFSQFGSDLDAATRAKLERGKRTVEVLKQDLHKPLKVEKQVLILYALVHKYLDDVPVHDVLRFESEMNTWFDHNHPELLEEIRTTKKLPDE 484
>gi|16801736|ref|NP_472004.1| F0F1 ATP synthase subunit alpha [Listeria innocua Clip11262] >gi|81595186|sp|Q927W2|ATPA2_LISIN ATP synthase subunit alpha 2 (ATPase subunit alpha 2) (ATP synthase F1 sector subunit alpha 2) >gi|16415211|emb|CAC97901.1| atpA [Listeria innocua] (504 aa)
Score = 1378, Expect = 3.9e-150, Identities = 264/483 (54%), Positives = 357/483 (73%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQ-QKTILETIDQTKDISQD 483
           MSI  ++ S+IIK QI+ YQ++   S++G V  +GDGI +A GL N M  EL+ F NG  GM  NLE    GI++LG + +I+EG  V+RT  +++VPVG+ L+GRV++++G P+DG G I+     PIE +APGVM R SV EPL+TG  AID++ PIG+GQRELIIGD+QTGKT++AID I+NQ  +++ CIYV IGQK ST+   + TL+  GAL+YT +V ++AS    L YLAP+ G+ +AEE+M  G+ VL++YDDLSK A AYR LSLLLRRPPGREAYPGD+FYLHSRLLER+ K+N   GGGSITALP +ET+AGDISAYIPTNVISITDGQ+F+ ++LF SG RPAI+AGLSVSRVG SAQI A+K  +G+L+L+LA YREL++FSQFGSDLD  T+  LE GK+ ++++KQD + P     + ++L+++  KY+  +PV  +  F+ ++   F      +LE I  TK +  +
  S:     1 MSIKAEEISSIIKQQIENYQSELKVSDVGTVTYIGDGIARAHGLDNAMAGELLEFSNGVMGMAQNLETNDVGIIILGPYTEIREGDEVRRTGKIMEVPVGEALIGRVVNSLGQPVDGLGPIETTGTRPIEAVAPGVMQRQSVNEPLQTGIKAIDALVPIGRGQRELIIGDRQTGKTSVAIDTILNQADQDMICIYVAIGQKESTVRNAVETLRHHGALDYTIVVTAAASQPAPLLYLAPYAGVAMAEEFMYSGKHVLVVYDDLSKQAAAYRELSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNDSLGGGSITALPFVETQAGDISAYIPTNVISITDGQIFLQSDLFFSGVRPAINAGLSVSRVGGSAQIKAMKTVAGTLRLDLAAYRELESFSQFGSDLDAATRAKLERGKRTVEVLKQDLHKPLKVEKQVLILYALVHKYLDDVPVHDVLRFESEMNTWFDHNHPELLEEIRTTKKLPDE 484
>gi|187933753|ref|YP_001884709.1| ATP synthase F1, alpha subunit [Clostridium botulinum B str. Eklund 17B] >gi|187721906|gb|ACD23127.1| ATP synthase F1, alpha subunit [Clostridium botulinum B str. Eklund 17B] (504 aa)
Score = 1377, Expect = 4.4e-150, Identities = 263/463 (56%), Positives = 363/463 (78%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRH 463
           M+I  ++ ++IIK +I++Y+ +    + G +I VGDG+ +  GL + M  EL+ F N  YGM LNLE    G V+LG  E IKEG IVK +  +V+VPVG+ L+GRV++++G  +DG G I  ++  PIE  AP ++ R+SV EPL+TG  AIDSM PIGKGQRELIIGD+QTGKT + ID I+NQKGK+V CIYV IGQK ST+   +NTL + GA++Y+ IV+S+A+D   L YLAP+ G +I E +M++G+DVLI+YDDLSKHA+AYRT+SLLLRRPPGREAYPGD+FY+HSRLLER+ K++KENGGGS+TALPIIET AGDI+AYIPTNVISITDGQ+F+ ++LFNSGQRPA++AG+SVSRVG +AQI A+K+ +G+L+LELAQYREL AF+QFGSDLDK++K+ LE GK++++++KQD+  P     + I+L++    ++  I V+ I+ F+++++ +
  S:     1 MNIKPEEITSIIKKEIEKYEKQIKTVDSGTIIQVGDGVSRVYGLDDCMEGELLEFPNDVYGMALNLEQDNVGCVLLGNEEGIKEGDIVKGSGKIVEVPVGEALIGRVVNSLGEELDGKGPINTNQTRPIEVKAPSIIDRSSVNEPLQTGIKAIDSMIPIGKGQRELIIGDRQTGKTALVIDTILNQKGKDVICIYVAIGQKQSTVAHIVNTLTEMGAMDYSIIVSSTAADSAPLQYLAPYAGCSIGEYFMNQGKDVLIVYDDLSKHAVAYRTMSLLLRRPPGREAYPGDVFYIHSRLLERAAKLSKENGGGSLTALPIIETLAGDITAYIPTNVISITDGQIFLESDLFNSGQRPAVNAGISVSRVGGNAQIKAMKQVTGTLRLELAQYRELAAFAQFGSDLDKDSKKRLEKGKRLVEILKQDQYKPLEVEKQVIILYTAVNDFLSDIKVEDIKKFEKELLEY 463
>gi|81428737|ref|YP_395737.1| F0F1 ATP synthase subunit alpha [Lactobacillus sakei subsp. sakei 23K] >gi|115312249|sp|Q38WK3|ATPA_LACSS ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|78610379|emb|CAI55429.1| H(+)-transporting two-sector ATPase (ATP synthase), alpha subunit [Lactobacillus sakei subsp. sakei 23K] (511 aa)
Score = 1377, Expect = 4.8e-150, Identities = 266/480 (55%), Positives = 359/480 (74%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQ-KTILETIDQTKDI 480
           MSI  ++ S +IK Q+  Y  +    E+G V  VGDGI +A GL N + +EL+ F NGSYG+  NLE    GI++LG++E+I+EG  VKRT  +++VPVGD L+GRV++ +G P+DG GEIK DK  PIEK APGVMAR SV EPL+TG  AID++ PIG+GQRELIIGD++TGKT++AID IINQKG+++ CIYV IGQK ST+   + TL+++GA++YT +V +  S    L Y+AP+ G  + EE+M  G+ VLI+YDDLSK A AYR +SLLLRRPPGREAYPGDIFYLHSRLLER+ K++ E GGGS+TALPIIET+AGDISAYIPTNVISITDGQ+F+ ++LF SG RPAIDAG SVSRVG +AQ  A+KK SG+L+L+L+ YREL+AF+QFGSDLD  T+  L  GK+ ++++KQ  + P     + ++L+++   +I  +PVD I  ++  +  + +   K +++ I QT  +
  S:     1 MSIKTEEISALIKQQLANYNEELAVEEVGTVTYVGDGIARAHGLENALSSELLEFSNGSYGVAQNLETNDVGIIILGEYENIREGDQVKRTGRIMEVPVGDALIGRVVNPLGQPVDGRGEIKTDKTRPIEKKAPGVMARQSVSEPLQTGLKAIDALVPIGRGQRELIIGDRKTGKTSVAIDTIINQKGQDMICIYVAIGQKESTVRTQVETLRRYGAMDYTIVVEAGPSQPAPLLYIAPYAGAAMGEEFMYNGKHVLIVYDDLSKQAAAYREISLLLRRPPGREAYPGDIFYLHSRLLERAAKLSDELGGGSMTALPIIETQAGDISAYIPTNVISITDGQIFLESDLFYSGTRPAIDAGSSVSRVGGAAQTKAMKKVSGTLRLDLSSYRELEAFTQFGSDLDAATQAKLNRGKRTVEVLKQPLHKPLPFEQQTVILYALTHGFIDDVPVDDIMRYESGLNDYLESNAKDLMDEIRQTTKL 481
>gi|116873895|ref|YP_850676.1| F0F1 ATP synthase subunit alpha [Listeria welshimeri serovar 6b str. SLCC5334] >gi|123466612|sp|A0ALL5|ATPA2_LISW6 ATP synthase subunit alpha 2 (ATPase subunit alpha 2) (ATP synthase F1 sector subunit alpha 2) >gi|116742773|emb|CAK21897.1| atpA [Listeria welshimeri serovar 6b str. SLCC5334] (504 aa)
Score = 1376, Expect = 5.6e-150, Identities = 263/483 (54%), Positives = 357/483 (73%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQK-TILETIDQTKDISQD 483
           MSI  ++ S+IIK QI+ Y ++   S++G V  +GDGI +A GL N M  EL+ F NG  GM  NLE    GI++LG + +I+EG  V+RT  +++VPVG+ L+GRV++++G P+DG G I+     PIE +APGVM R SV EPL+TG  AID++ PIG+GQRELIIGD+QTGKT++AID I+NQ  +++ CIYV IGQK ST+   + TL+  GAL+YT +V ++AS    L YLAP+ G+ +AEE+M  G+ VL++YDDLSK A AYR LSLLLRRPPGREAYPGD+FYLHSRLLER+ K+N   GGGSITALP +ET+AGDISAYIPTNVISITDGQ+F+ ++LF SG RPAI+AGLSVSRVG SAQI A+K  +G+L+L+LA YREL++FSQFGSDLD  T+  LE GK+ ++++KQD + P     + ++L+++  KY+  +PV  +  F+ ++   F   +  +LE I  TK +  +
  S:     1 MSIKAEEISSIIKQQIENYHSELKVSDVGTVTYIGDGIARAHGLDNAMAGELLEFSNGVMGMAQNLETNDVGIIILGPYTEIREGDEVRRTGKIMEVPVGEALIGRVVNSLGQPVDGLGPIETTGTRPIEAVAPGVMQRQSVNEPLQTGIKAIDALVPIGRGQRELIIGDRQTGKTSVAIDTILNQADQDMICIYVAIGQKESTVRNAVETLRHHGALDYTIVVTAAASQPAPLLYLAPYAGVAMAEEFMYNGKHVLVVYDDLSKQAAAYRELSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNDSLGGGSITALPFVETQAGDISAYIPTNVISITDGQIFLQSDLFFSGVRPAINAGLSVSRVGGSAQIKAMKTVAGTLRLDLAAYRELESFSQFGSDLDAATRAKLERGKRTVEVLKQDLHKPLKVEKQVLILYALVHKYLDDVPVHDVLRFESEMNTWFDHNRPELLEEIRTTKKLPDE 484
>gi|39933255|ref|NP_945531.1| F0F1 ATP synthase subunit alpha [Rhodopseudomonas palustris CGA009] >gi|167367431|ref|ZP_02301573.1| ATP synthase F1, alpha subunit [Rhodopseudomonas palustris TIE-1] >gi|192288606|ref|YP_001989211.1| ATP synthase F1, alpha subunit [Rhodopseudomonas palustris TIE-1] >gi|81698439|sp|Q6NDD0|ATPA_RHOPA ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|39652880|emb|CAE25622.1| putative H+-transporting ATP synthase alpha chain. [Rhodopseudomonas palustris CGA009] >gi|192282355|gb|ACE98735.1| ATP synthase F1, alpha subunit [Rhodopseudomonas palustris TIE-1] (510 aa)
Score = 1376, Expect = 5.8e-150, Identities = 266/502 (52%), Positives = 370/502 (73%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVK---------CIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKT-ILETIDQTKDISQDLFVQIKNEFNSLITSYIKT 502
           M I   + S I+K+QIK +  +A  SE+G+V++VGDGI +  GL NV+  E+V FENG+ GM LNLE    G+V+ G   +IKEG  VKRT+++VD PVG GLLGRV+DA+GNPIDG G I+  ++  ++  APG++ R SV EP+ TG  +ID++ PIG+GQRELIIGD+QTGKT IA+D I+NQK  NV+         C+YV +GQK ST+ QF+  L++ GALEY+ +VA++ASD   + Y+APFTG TI E +   G   +IIYDDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+N E G GS+TALP+IET+A D+SAYIPTNVISITDGQ+F+ T+LF  G RPA++ GLSVSRVGSSAQ  A+KK +G +K ELAQYRE+ AF+QFGSDLD  T+ +L  G ++ +L+KQ + +P     +  ++++    Y+  +P++ +  F++ ++   + +++ ILE I  ++D+S D   ++K    +++ SY KT
  S:     1 MDIRAAEISAILKDQIKNFGQEAEVSEVGQVLSVGDGIARVYGLDNVLAGEMVEFENGTRGMALNLETDNVGVVIFGADREIKEGQTVKRTRSIVDAPVGKGLLGRVVDALGNPIDGKGPIQAVERKRVDVKAPGIIPRKSVHEPMATGLKSIDALIPIGRGQRELIIGDRQTGKTAIALDTILNQKPLNVEGAPESQKLYCVYVAVGQKRSTVAQFVKVLEEQGALEYSVVVAATASDPAPMQYIAPFTGCTIGEYFRDNGMHAVIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNDEQGNGSLTALPVIETQANDVSAYIPTNVISITDGQIFLETDLFFQGIRPAVNVGLSVSRVGSSAQTKAMKKVAGKIKGELAQYREMAAFAQFGSDLDAATQRLLNRGSRLTELLKQPQFSPLKMEEQVCVIWAGTNGYLDALPLNKVRAFEDGLLALLRGKESGILEAIRTSRDLSDDTAAKLK----AVVESYAKT 508
>gi|89095628|ref|ZP_01168522.1| F0F1 ATP synthase subunit alpha [Bacillus sp. NRRL B-14911] >gi|89089374|gb|EAR68481.1| F0F1 ATP synthase subunit alpha [Bacillus sp. NRRL B-14911] (502 aa)
Score = 1376, Expect = 6.8e-150, Identities = 272/502 (54%), Positives = 363/502 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQ-QKTILETIDQTKDISQDLFVQIKNEFNSLITSYIKT 502
           MSI  ++ S +IK QI+ YQ++   S++G VI +GDGI +A GL NVM  ELV F NG  GM  NLE    GI++LG + +I+EG  V+RT  +++VPVG  L+GRV++ +G P+DG G I      PIE  APGVM R SV EPL+TG  AID++ PIG+GQRELIIGD+QTGKT++AID I+NQK +++ CIYV IGQK ST+   + TL++ GALEYT +V +SAS    L +LAP+ G+T+ EE+M  G+ VL++YDDL+K A AYR LSLLLRRPPGREAYPGD+FYLHSRLLER+ K++   G GSITALP IET+AGD+SAYIPTNVISITDGQ+F+ ++LF SG RPAI+AGLSVSRVG SAQI A+KK SG+L+L+LA YREL+AF+QFGSDLDK T+  L  G + ++++KQD N P     +  +L+++   ++  IPV  I  F+ + +      +K +L+ I  TK++  D      ++  S I S+ KT
  S:     1 MSIKAEEISALIKKQIENYQSEIQVSDVGTVIQIGDGIARAHGLDNVMAGELVEFSNGVMGMAQNLEENNVGIIILGPYTEIREGDEVRRTGRIMEVPVGPELIGRVVNPLGQPVDGMGPINTTVTRPIESPAPGVMDRKSVHEPLQTGIKAIDALVPIGRGQRELIIGDRQTGKTSVAIDTILNQKDQDMVCIYVAIGQKESTVRNAVETLRKTGALEYTIVVTASASQPAPLLFLAPYAGVTMGEEFMYNGKHVLVVYDDLTKQAAAYRELSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSDAKGAGSITALPFIETQAGDVSAYIPTNVISITDGQIFLQSDLFFSGVRPAINAGLSVSRVGGSAQIKAMKKVSGTLRLDLASYRELEAFAQFGSDLDKATQAKLNRGARTVEVLKQDLNKPLKVEKQVAILYALTRGFLDDIPVQDIRRFEAEFLTWLDHNKKDLLDHIATTKELPAD------DDMASAINSFKKT 497
>gi|91975037|ref|YP_567696.1| F0F1 ATP synthase subunit alpha [Rhodopseudomonas palustris BisB5] >gi|123722174|sp|Q13DP4|ATPA_RHOPS ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|91681493|gb|ABE37795.1| ATP synthase F1, alpha subunit [Rhodopseudomonas palustris BisB5] (510 aa)
Score = 1376, Expect = 6.9e-150, Identities = 265/502 (52%), Positives = 371/502 (73%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQK---------GKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK-QQKTILETIDQTKDISQDLFVQIKNEFNSLITSYIKT 502
           M I   + S I+K+QIK +  +A  +E+G+V++VGDGI +  GL NV+  E+V FENG+ GM LNLE    GIV+ G   +IKEG  VKRT+++VD PVG GLLGRV+DA+GNPIDG G I+  ++  ++  APG++ R SV EP+ TG  AID++ P+G+GQRELIIGD+QTGKT IA+D I+NQK         G+ + C+YV +GQK ST+ QF+  L++ GALEY+ +VA++ASD   + Y+APFTG T+ E +   G   +IIYDDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+N+++G GS+TALPIIET+A D+SAYIPTNVISITDGQ+F+ T+LF  G RPA++ GLSVSRVGSSAQ  A+KK +G +K ELAQYRE+ AF+QFGSDLD  T+ +L  G ++ +L+KQ + +P     + +++++    Y+  +PV  +  F++ ++   + ++  IL+ I  ++D+S D   ++K    ++I SY KT
  S:     1 MDIRAAEISAILKDQIKNFGQEAEVTEVGQVLSVGDGIARVYGLDNVLAGEMVEFENGTRGMALNLETDNVGIVIFGADREIKEGQTVKRTRSIVDTPVGKGLLGRVVDALGNPIDGKGPIQATERKRVDVKAPGIIPRKSVNEPMATGLKAIDALIPVGRGQRELIIGDRQTGKTAIALDTILNQKPLNVEGAPEGQKLYCVYVAVGQKRSTVAQFVKVLEEQGALEYSIVVAATASDPAPMQYIAPFTGCTMGEYFRDNGMHAVIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNEDHGSGSLTALPIIETQANDVSAYIPTNVISITDGQIFLETDLFFQGIRPAVNVGLSVSRVGSSAQTKAMKKVAGKIKGELAQYREMAAFAQFGSDLDASTQRLLNRGSRLTELLKQPQFSPLKMEEQVVVIYAGVNGYLDALPVAKVRSFEDGLLSLLRGKESAILDAIRTSRDLSDDTAAKLK----AVIESYAKT 508
>gi|167463133|ref|ZP_02328222.1| F0F1 ATP synthase subunit alpha [Paenibacillus larvae subsp. larvae BRL-230010] (505 aa)
Score = 1375, Expect = 7.8e-150, Identities = 276/492 (56%), Positives = 359/492 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKAL-YSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQK-TILETIDQTKDIS-------QDLFVQIKNEF 492
           MSI  D+ S +IK QI  Y++  L   ++G VI +GDGI +  GL N M  EL+ F NG  GM LNLE    GIV+LG + DI+EG  VKRT  +++VPVG+ LLGRV++ +G P+D  G I+  +  PIE  APGV+AR SV EP++TG  AIDSM PIG+GQRELIIGD+QTGKT+IAID IINQKG  +KC+YV IGQK ST+   + TL++ GAL+YT IV +SAS+   L YLAP+ G  + E +M KGE VL++YDDLSK A AYR LSLLLRRPPGREAYPGD+FYLHSRLLER+ K+N E GGGS+TALP IET+A D+SAYIPTNVISITDGQ+F+ ++LF SGQRPA++ G SVSRVG SAQI A+KK +G+L+L+LAQYREL AFSQFGSDLDK T   L  G++ ++++KQ  N P     + + +++  + ++  IPV  +  F+++ +   +  K  +LE I +T D++       QD   Q K  F
  S:     1 MSIRPDEISTLIKQQIVNYKSTDLDVVDVGTVIQIGDGIARVHGLENAMAGELLEFSNGVMGMALNLEENNVGIVILGPYTDIREGDQVKRTGRIMEVPVGEELLGRVVNPLGQPLDERGPIETKQYRPIESPAPGVIARKSVHEPMQTGMKAIDSMVPIGRGQRELIIGDRQTGKTSIAIDTIINQKGNGMKCVYVAIGQKQSTVANVVETLRRHGALDYTIIVTASASEPSPLLYLAPYAGCAMGEYFMYKGEHVLVVYDDLSKQAAAYRELSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNDELGGGSLTALPFIETQANDVSAYIPTNVISITDGQIFLESDLFYSGQRPAVNVGNSVSRVGGSAQIKAMKKVAGTLRLDLAQYRELAAFSQFGSDLDKSTLARLNRGERTLEILKQGVNEPLPVEKQVVSIYTAVKGFLDDIPVVDVMRFEKEFLSFIESNKPEVLENIRETNDLTSENEQVLQDAINQFKKGF 501
>gi|118726892|ref|ZP_01575507.1| ATP synthase F1, alpha subunit [Clostridium cellulolyticum H10] >gi|118663707|gb|EAV70353.1| ATP synthase F1, alpha subunit [Clostridium cellulolyticum H10] (502 aa)
Score = 1375, Expect = 8.0e-150, Identities = 267/500 (53%), Positives = 367/500 (73%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSK-GEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQ-KTILETIDQTKDISQDLFVQIKNEFNSLITSYI 500
           MS+  ++ S+IIK QI+ Y       ++G V+  GD I +  GL + M  EL+ FEN  +GM LNLE    G V+LG    IKEGS VKRT   V VPVG  L+GRV+  +G P+DG G+I  ++  P++  APGV+ R SV +PL+TG +A+D++ PIG+GQRELIIGD+QTGKT IA+D IINQKGK+V C+YV IGQK STI   +NTL++FGA+EY+ +V+S+ASD  S+ YLAP+ G  +AE++M +  +DVLIIYDDLSKHA+AYR +SLLL+RPPGREAYPGD+FYLHSRLLER+ K++ E GGGSITALPIIET AGD+SAYIPTNVISITDGQ+++ + LF+SGQRPA++ GLSVSRVG SAQI A++K +G L++ LAQYREL+AF+QFGSDLDK T++ L  G+++++ +KQ  N       + ++L+     Y+  +PV+ +  F  +++ + KQ+   IL +I +T DIS ++   +K   +   T ++
  S:     1 MSLRPEEISSIIKQQIENYDTAVKTDDVGYVLQSGDNIARIYGLKSCMSGELLQFENNVFGMALNLEEDNVGCVVLGDDRGIKEGSTVKRTGKTVQVPVGQSLVGRVVSPLGKPLDGKGDIAVEEYRPVDFTAPGVVDRKSVNKPLQTGIMALDALIPIGRGQRELIIGDRQTGKTAIAVDTIINQKGKDVICVYVAIGQKASTITGIVNTLEKFGAMEYSIVVSSTASDPSSVQYLAPYAGCAMAEDFMYRYHKDVLIIYDDLSKHAVAYRAMSLLLKRPPGREAYPGDVFYLHSRLLERAAKLSDELGGGSITALPIIETLAGDVSAYIPTNVISITDGQIYLESELFHSGQRPAVNVGLSVSRVGGSAQIKAMRKIAGPLRINLAQYRELEAFAQFGSDLDKSTRDKLTQGERLVETLKQPLNATLPVEEQVLILYGATNNYLMDLPVNKVGKFNRELVAYVKQRYPKILTSIAETGDISDEVSKLMKTAADEFKTQFV 502
>gi|161507274|ref|YP_001577228.1| F0F1 ATP synthase subunit alpha [Lactobacillus helveticus DPC 4571] >gi|172048217|sp|A8YUJ9|ATPA_LACH4 ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|160348263|gb|ABX26937.1| ATP synthase alpha subunit [Lactobacillus helveticus DPC 4571] (503 aa)
Score = 1375, Expect = 9.0e-150, Identities = 262/483 (54%), Positives = 369/483 (76%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHF-KQQKTILETIDQTKDISQD 483
           MSI  ++ S++IK Q++ Y +K   +E+G V  VGDGI +A GL+N +  EL+ F+NGSYG+  NL+++  GI++LG+F++I+EG  V+RT  ++ VPVGD L+GRV++ +G P+DG GEIK DK  PIE+ APGVM R SV +PL+TG  AID++ PIG+GQRELIIGD++TGKT++AID I+NQK ++V CIYV IGQK ST+   + TLK+FGA++YT +V +  S+   + Y+AP+ G  + EE+M  G+DVLI++DDLSK A+AYR LSLLLRRPPGREAYPGD+FYLHSRLLERS K++ + GGGS+TALPII+TEAGDISAYIPTNVISITDGQ+F+ ++LF +G RPAIDAG SVSRVG +AQI A+KK +G+L+ +LA YREL++F+QFGSDLD+ T+  L  G++ ++++KQ  + P     + ++L+++   Y+  IPV+ I  F+ ++  +F      +L+TI +T  +  D
  S:     1 MSIKAEEISSLIKQQLEHYDDKLDINEVGVVTYVGDGIARAHGLNNALAGELLKFDNGSYGIAQNLDSSDVGIIILGQFDNIREGDRVQRTGRIMSVPVGDALIGRVVNPLGQPVDGLGEIKSDKTRPIEEKAPGVMDRQSVNQPLQTGIKAIDALVPIGRGQRELIIGDRKTGKTSLAIDTILNQKNQDVICIYVAIGQKESTVRTQVETLKRFGAMDYTIVVEAGPSEPAPMLYIAPYAGTAMGEEFMYNGKDVLIVFDDLSKQAVAYRELSLLLRRPPGREAYPGDVFYLHSRLLERSAKLSDKLGGGSLTALPIIQTEAGDISAYIPTNVISITDGQIFLQSDLFFAGTRPAIDAGNSVSRVGGNAQIKAMKKVAGTLRTDLAAYRELESFAQFGSDLDQATQAKLNRGQRTVEVLKQPLHDPIPVEKQVLILYALTHGYLDSIPVEDISRFQNELFDNFDSSHADLLKTIRETGKLPDD 484
>gi|16804569|ref|NP_466054.1| F0F1 ATP synthase subunit alpha [Listeria monocytogenes EGD-e] >gi|47096954|ref|ZP_00234530.1| ATP synthase F1, alpha subunit [Listeria monocytogenes str. 1/2a F6854] >gi|153175783|ref|ZP_01931087.1| ATP synthase F1, alpha subunit [Listeria monocytogenes FSL N3-165] >gi|153180621|ref|ZP_01933664.1| ATP synthase F1, alpha subunit [Listeria monocytogenes F6900] >gi|153184893|ref|ZP_01935541.1| ATP synthase F1, alpha subunit [Listeria monocytogenes J0161] >gi|153192187|ref|ZP_01939232.1| ATP synthase F1, alpha subunit [Listeria monocytogenes J2818] >gi|153197163|ref|ZP_01941433.1| ATP synthase F1, alpha subunit [Listeria monocytogenes 10403S] >gi|167405358|ref|ZP_02310115.1| F0F1 ATP synthase subunit alpha [Listeria monocytogenes FSL J2-003] >gi|168266763|ref|ZP_02688728.1| F0F1 ATP synthase subunit alpha [Listeria monocytogenes FSL J2-071] >gi|81768747|sp|Q8Y4C0|ATPA2_LISMO ATP synthase subunit alpha 2 (ATPase subunit alpha 2) (ATP synthase F1 sector subunit alpha 2) >gi|16412019|emb|CAD00609.1| atpA [Listeria monocytogenes] >gi|47014664|gb|EAL05621.1| ATP synthase F1, alpha subunit [Listeria monocytogenes str. 1/2a F6854] >gi|126942405|gb|EBA20144.1| ATP synthase F1, alpha subunit [Listeria monocytogenes J0161] >gi|127633214|gb|EBA22631.1| ATP synthase F1, alpha subunit [Listeria monocytogenes 10403S] >gi|127764515|gb|EBA25047.1| ATP synthase F1, alpha subunit [Listeria monocytogenes J2818] >gi|133729208|gb|EBA30906.1| ATP synthase F1, alpha subunit [Listeria monocytogenes FSL N3-165] >gi|133732014|gb|EBA33712.1| ATP synthase F1, alpha subunit [Listeria monocytogenes F6900] (504 aa)
Score = 1374, Expect = 9.2e-150, Identities = 263/483 (54%), Positives = 356/483 (73%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQ-QKTILETIDQTKDISQD 483
           MSI  ++ S+IIK QI+ Y ++   S++G V  +GDGI +A GL N M  EL+ F NG  GM  NLE    GI++LG + +I+EG  V+RT  +++VPVG+ L+GRV++++G P+DG G I+     PIE +APGVM R SV EPL+TG  AID++ PIG+GQRELIIGD+QTGKT++AID I+NQ  +++ CIYV IGQK ST+   + TL+  GAL+YT +V ++AS    L YLAP+ G+ +AEE+M  G+ VL++YDDLSK A AYR LSLLLRRPPGREAYPGD+FYLHSRLLER+ K+N   GGGSITALP +ET+AGDISAYIPTNVISITDGQ+F+ ++LF SG RPAI+AGLSVSRVG SAQI A+K  +G+L+L+LA YREL++FSQFGSDLD  T+  LE GK+ ++++KQD + P     + ++L+++  KY+  +PV  +  F+ ++   F      +LE I  TK +  +
  S:     1 MSIKAEEISSIIKQQIENYHSELKVSDVGTVTYIGDGIARAHGLDNAMAGELLEFSNGVMGMAQNLETNDVGIIILGPYTEIREGDEVRRTGKIMEVPVGEALIGRVVNSLGQPVDGLGPIETTGTRPIEAVAPGVMQRQSVNEPLQTGIKAIDALVPIGRGQRELIIGDRQTGKTSVAIDTILNQADQDMICIYVAIGQKESTVRNAVETLRHHGALDYTIVVTAAASQPAPLLYLAPYAGVAMAEEFMYNGKHVLVVYDDLSKQAAAYRELSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNDSLGGGSITALPFVETQAGDISAYIPTNVISITDGQIFLQSDLFFSGVRPAINAGLSVSRVGGSAQIKAMKTVAGTLRLDLAAYRELESFSQFGSDLDAATRAKLERGKRTVEVLKQDLHKPLKVEKQVLILYALVHKYLDDVPVHDVLRFESEMNTWFDHNHPELLEEIRTTKKLPDE 484
>gi|109648042|ref|ZP_01371945.1| ATP synthase F1, alpha subunit [Desulfitobacterium hafniense DCB-2] >gi|109641132|gb|EAT50687.1| ATP synthase F1, alpha subunit [Desulfitobacterium hafniense DCB-2] (502 aa)
Score = 1374, Expect = 1.1e-149, Identities = 265/489 (54%), Positives = 366/489 (74%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKT-ILETIDQTKDISQDLFVQIK 489
           M++  ++ S+IIK QI+ Y +     ++G VI VGDGI +  GL   M  EL+ F  G YGM +NLE    G ++LGKF +I+EG  VKRT  +V+VPVG+ ++GRV++A+G PIDG GEIK DK  PIE IAPGV+ R SV EPL+TG  +ID++ PIG+GQRELIIGD+QTGKT +A+D IINQKGK+V CIYV +GQK ST+   + TL   GA++Y+ +V+++AS+   + Y+AP++G  + EE+M  G+ VLIIYDDL+K A AYR LSLLL+RPPGREAYPGD+FYLHSRLLER+ K++ + G GS+TALPIIET+AGD+SAYIPTNVISITDGQ+F+ T+LFN+G RPAI+ G+SVSRVG SAQI A+K+ +G L+L+LAQYREL AF+QFGSDLDK T+  L  G+++M+++KQ +  P     + ++L++  + ++  IPVD I+ F+E+ +R  +  K  +L  I   K ++ +L  +I+
  S:     1 MNLRPEEISSIIKQQIERYDSAVEVVDVGTVIQVGDGIARVHGLEKAMSGELLEFPGGIYGMAMNLEEDNIGCIILGKFTEIREGDQVKRTGRIVEVPVGEAMIGRVVNALGQPIDGKGEIKTDKFRPIENIAPGVVYRKSVHEPLQTGLKSIDAIVPIGRGQRELIIGDRQTGKTAVAVDTIINQKGKDVICIYVAVGQKASTVAGVVKTLADHGAMDYSIVVSATASEPAPMLYIAPYSGCAMGEEFMYNGKHVLIIYDDLTKQAAAYRELSLLLKRPPGREAYPGDVFYLHSRLLERAAKLSPDLGSGSMTALPIIETQAGDVSAYIPTNVISITDGQIFLETDLFNAGFRPAINVGISVSRVGGSAQIKAMKQVAGQLRLDLAQYRELAAFAQFGSDLDKITQMRLTRGERMMEILKQKQYEPMVVEEQVVVLYAAVKGFLDDIPVDKIKSFEEEYLRTMRTTKADLLAKIRTEKALNDELNAEIE 490
>gi|188587639|ref|YP_001919896.1| ATP synthase F1, alpha subunit [Clostridium botulinum E3 str. Alaska E43] >gi|188497920|gb|ACD51056.1| ATP synthase F1, alpha subunit [Clostridium botulinum E3 str. Alaska E43] (504 aa)
Score = 1373, Expect = 1.3e-149, Identities = 262/463 (56%), Positives = 363/463 (78%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRH 463
           M+I  ++ ++IIK +I++Y+ +    + G +I VGDG+ +  GL + M  EL+ F N  YGM LNLE    G V+LG  E IKEG IVK +  +V+VPVG+ L+GRV++++G  +DG G I  ++  PIE  AP ++ R+SV EPL+TG  AIDSM PIGKGQRELIIGD+QTGKT + ID I+NQKGK+V CIYV IGQK ST+   +NTL + GA++Y+ IV+S+A+D   L YLAP+ G +I E +M++G+DVLI+YDDLSKHA+AYRT+SLLLRRPPGREAYPGD+FY+HSRLLER+ K+++ENGGGS+TALPIIET AGDI+AYIPTNVISITDGQ+F+ ++LFNSGQRPA++AG+SVSRVG +AQI A+K+ +G+L+LELAQYREL AF+QFGSDLDK++K+ LE GK++++++KQD+  P     + I+L++    ++  I V+ I+ F+++++ +
  S:     1 MNIKPEEITSIIKKEIEKYEKQIKTVDSGTIIQVGDGVSRVYGLDDCMEGELLEFPNDVYGMALNLEQDNVGCVLLGNEEGIKEGDIVKGSGKIVEVPVGEALIGRVVNSLGEELDGKGPINTNQTRPIEVKAPSIIDRSSVNEPLQTGIKAIDSMIPIGKGQRELIIGDRQTGKTALVIDTILNQKGKDVICIYVAIGQKQSTVAHIVNTLTEMGAMDYSIIVSSTAADSAPLQYLAPYAGCSIGEYFMNQGKDVLIVYDDLSKHAVAYRTMSLLLRRPPGREAYPGDVFYIHSRLLERAAKLSEENGGGSLTALPIIETLAGDITAYIPTNVISITDGQIFLESDLFNSGQRPAVNAGISVSRVGGNAQIKAMKQVTGTLRLELAQYRELAAFAQFGSDLDKDSKKRLEKGKRLVEILKQDQYKPLEVEKQVIILYTAVNDFLSDIKVEDIKKFEKELLEY 463
>gi|124522169|ref|ZP_01696878.1| ATP synthase F1, alpha subunit [Bacillus coagulans 36D1] >gi|124496268|gb|EAY43876.1| ATP synthase F1, alpha subunit [Bacillus coagulans 36D1] (504 aa)
Score = 1373, Expect = 1.3e-149, Identities = 267/483 (55%), Positives = 358/483 (74%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQK-TILETIDQTKDISQD 483
           MSI  ++ S +IK QI+ YQ++   S++G VI VGDGI +A GL   M  EL+ F NG  G+  NLE +  GI++LG + +I EG  V+RT  ++ VPVG+ L+GRV++ +G P+DG G I   K  PIE  APGVM R SV EPL+TG  AID++ PIG+GQRELIIGD+QTGKTTIAID IINQK +++ CIYV IGQK ST+   + TL++FGAL+YT +V +SAS    L YLAP+ G+ + EE+M  G+ VL++YDDLSK A+AYR LSLLLRRPPGREAYPGD+FYLHSRLLER+ K++   GGGS+TALP +ET+AGDISAYIPTNVISITDGQ+F+ ++LF SG RPAI+AGLSVSRVG +AQI A+KK SG+L+L+LA YREL++F+QFGSDLDK T+  L  G++ ++++KQD N P     +  +L+++ +  +  IPV+ I  F+ ++     Q + ++LE I  T ++  D
  S:     1 MSIKAEEISLLIKKQIENYQSEIEVSDVGTVIEVGDGIARAHGLDQAMAGELLEFSNGVMGLAQNLEESNVGIIILGPYREIHEGDEVRRTGRIMQVPVGEELIGRVVNPLGQPVDGLGPINTTKTRPIESRAPGVMDRKSVSEPLQTGIKAIDALVPIGRGQRELIIGDRQTGKTTIAIDTIINQKDQDMICIYVAIGQKESTVRGTVETLRKFGALDYTIVVTASASQPAPLQYLAPYAGVAMGEEFMHNGKHVLVVYDDLSKQAVAYRELSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSDAKGGGSLTALPFVETQAGDISAYIPTNVISITDGQIFLQSDLFFSGVRPAINAGLSVSRVGGAAQIKAMKKVSGTLRLDLASYRELESFAQFGSDLDKATQAKLARGQRTVEVLKQDLNKPIKVEKQVCILYALTKGLLDDIPVEDILRFESELYDWLDQNRASLLEEIRTTGNLPDD 484
>gi|58337088|ref|YP_193673.1| F0F1 ATP synthase subunit alpha [Lactobacillus acidophilus NCFM] >gi|75432973|sp|Q5FKY2|ATPA_LACAC ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|58254405|gb|AAV42642.1| ATP synthase alpha subunit [Lactobacillus acidophilus NCFM] (503 aa)
Score = 1373, Expect = 1.3e-149, Identities = 262/483 (54%), Positives = 368/483 (76%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHF-KQQKTILETIDQTKDISQD 483
           MSI  ++ S++IK Q++ Y +K   +E+G V  VGDGI +A GL +V+  EL+ F+NGS+G+  NLE+   GI++LG+F++I+EG  V+RT  +++VPVGD L+GRV++ +G P+DG GEIK DK  PIE  APGVM R SV +PL+TG  AID++ PIG+GQRELIIGD++TGKT++AID I+NQKG++V CIYV IGQK ST+   + TLK+FGA++YT +V +  S+   + Y+AP+ G  + EE+M  G+DVLI++DDLSK A+AYR LSLLLRRPPGREAYPGD+FYLHSRLLERS K++ + GGGS+TALPII+TEAGDISAYIPTNVISITDGQ+F+ ++LF +G RPAIDAG SVSRVG +AQI A+KK +G+L+ +L  YREL++F+QFGSDLD+ T+  L  G++ ++++KQ  + P     + ++L+++   Y+  IPV+ I  F+ ++  +F      +L+TI +T  +  D
  S:     1 MSIKAEEISSLIKQQLEHYDDKLDINEVGVVTYVGDGIARAHGLDDVLSGELLKFDNGSFGIAQNLESNDVGIIILGQFDNIREGDRVQRTGRIMEVPVGDALIGRVVNPLGQPVDGLGEIKSDKTRPIEAKAPGVMDRQSVNQPLQTGIKAIDALVPIGRGQRELIIGDRKTGKTSLAIDTILNQKGQDVICIYVAIGQKESTVRTQVETLKRFGAMDYTIVVEAGPSEPAPMLYIAPYAGTAMGEEFMYNGKDVLIVFDDLSKQAVAYRELSLLLRRPPGREAYPGDVFYLHSRLLERSAKLSDKLGGGSLTALPIIQTEAGDISAYIPTNVISITDGQIFLQSDLFFAGTRPAIDAGNSVSRVGGNAQIKAMKKVAGTLRTDLTAYRELESFAQFGSDLDQATQAKLNRGQRTVEVLKQPLHDPIPVEKQVLILYALTHGYLDAIPVEDISRFQNELFDNFDSSHADLLKTIRETGKLPDD 484
>gi|27375553|ref|NP_767082.1| F0F1 ATP synthase subunit alpha [Bradyrhizobium japonicum USDA 110] >gi|81740322|sp|Q89X72|ATPA_BRAJA ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|27348690|dbj|BAC45707.1| ATP synthase alpha chain [Bradyrhizobium japonicum USDA 110] (509 aa)
Score = 1372, Expect = 1.7e-149, Identities = 265/499 (53%), Positives = 363/499 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVK--------CIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKT-ILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           M I   + S I+K+QIK +  +A  SE+G+V++VGDGI +  GL NV   E+V FENG+ GM LNLE    G+V+ G   +IKEG  VKRT+ +VD PVG GLLGRV+DA+GNPIDG G I+ DK+M ++  APG++ R SV EP+ TG  AID++ PIG+GQRELIIGD+QTGKT IA+D I+NQK  N +        C+YV +GQK ST+ QF+  L++ GALEY+ IVA++ASD   + Y+APFT  T+ E +   G   +IIYDDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K++K++G GS+TALPIIET+A D+SAYIPTNVISITDGQ+F+ T+LF  G RPA++ GLSVSRVGSSAQ  A KK +G +K ELAQYRE+ AF+QFGSDLD  T+ +L  G ++ +L+KQ + +P     +  ++++    Y+  +PV+ +  F++ ++   + +   IL +I  ++D+S D   ++K+       S+
  S:     1 MDIRAAEISAILKDQIKNFGQEAEVSEVGQVLSVGDGIARVYGLDNVQAGEMVEFENGTRGMALNLETDNVGVVIFGADREIKEGQTVKRTRAIVDAPVGKGLLGRVVDALGNPIDGKGPIQADKRMRVDVKAPGIIPRKSVSEPMATGLKAIDALIPIGRGQRELIIGDRQTGKTAIALDTILNQKPLNAQPDENIKLYCVYVAVGQKRSTVAQFVKVLEEQGALEYSIIVAATASDPAPMQYIAPFTACTMGEFFRDNGMHAVIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSKDHGSGSLTALPIIETQANDVSAYIPTNVISITDGQIFLETDLFFQGIRPAVNVGLSVSRVGSSAQTKATKKVAGKIKGELAQYREMAAFAQFGSDLDASTQRLLNRGSRLTELLKQPQFSPLKMEEQVCVIWAGTNGYLDPLPVNKVRAFEDGLLSLLRGKNVEILNSIRDSRDLSDDTAAKLKSVVEGFAKSF 508
>gi|169826598|ref|YP_001696756.1| ATP synthase subunit alpha [Lysinibacillus sphaericus C3-41] >gi|168991086|gb|ACA38626.1| ATP synthase subunit alpha [Lysinibacillus sphaericus C3-41] (502 aa)
Score = 1371, Expect = 2.1e-149, Identities = 271/492 (55%), Positives = 363/492 (73%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKT-ILETIDQTKDISQDL-FVQIKNEF 492
           M I  ++ S++IK QI+ Y+++   SE+G VI +GDGI  A GL N M  EL+ F NG  GM  NLE    GIV+LG + DIKEG  V+RT  +++VPVG+ L+GRV++ +G P+DG G I   K  PIE  A GVMAR SV EPL+TG  AID++ PIG+GQRELIIGD+Q GKT++AID I+NQ G+N+ CIYV IGQK ST+   + TL++ GAL+YT +V ++AS    L +LAPF G+++AEE+M +G+ VLI+YDDLSK A AYR LSLLLRRPPGREAYPGD+FYLHSRLLER+ K+N+    GSITALP +ET+AGDISAYIPTNVISITDGQ+F+ ++LFNSG RPAI+AGLSVSRVG SAQI A+KK +G+L+L+LA +REL++F+QFGSDLDK T   LE GK+ ++++KQD N P     +  +L+++ + ++  IPV  I  F+ + +       T +L+ +  TK+++ D  +V    EF
  S:     1 MGIKAEEISSLIKQQIENYESELKVSEVGTVIRIGDGIALAHGLDNAMAGELLEFSNGVMGMAQNLEEGNVGIVILGPYTDIKEGDEVRRTGRIMEVPVGEELIGRVVNPLGQPVDGQGPINTTKSRPIESPAFGVMARKSVHEPLQTGIKAIDALVPIGRGQRELIIGDRQVGKTSVAIDTILNQDGENMICIYVAIGQKESTVRGVVETLRKHGALDYTIVVTAAASQPAPLLFLAPFAGVSMAEEFMLQGKHVLIVYDDLSKQASAYRELSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNETYQNGSITALPFVETQAGDISAYIPTNVISITDGQIFLQSDLFNSGVRPAINAGLSVSRVGGSAQIKAMKKVAGTLRLDLAAFRELESFAQFGSDLDKITLAKLERGKRTVEVLKQDLNKPLKVEKQVAILYALTKGHLDDIPVQDIVRFESEFLSWLDSNHTNVLDHVRTTKELAPDADYVAALTEF 494
>gi|116494660|ref|YP_806394.1| F0F1 ATP synthase subunit alpha [Lactobacillus casei ATCC 334] >gi|191638159|ref|YP_001987325.1| ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) [Lactobacillus casei] >gi|122263919|sp|Q03A20|ATPA_LACC3 ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|116104810|gb|ABJ69952.1| F0F1-type ATP synthase, alpha subunit [Lactobacillus casei ATCC 334] >gi|165940487|gb|ABY75188.1| F0F1-type ATP synthase alpha subunit [Lactobacillus casei str. Zhang] >gi|190712461|emb|CAQ66467.1| ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) [Lactobacillus casei BL23] (509 aa)
Score = 1371, Expect = 2.2e-149, Identities = 262/489 (53%), Positives = 366/489 (74%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKT-ILETIDQTKDI--SQDLFVQIK 489
           MSI  ++ S++IK Q++ YQ+     E+G V  +GDGI +A+GL N M NEL+ F NGSYGM LNLE    GI++LG F++I+EG  VKRT  +++VPVGD ++GRV++++G P+DG G IK DK  PIE  APGVM R SV EPL+TG  AID++ PIG+GQRELIIGD++TGKT+IAID I+NQK +N+ C+YV IGQK+ST+   + TLK++GA++YT ++ +  S+   + Y+AP+ G  + EE+M  G+ VLI+YDDLSK A +YR LSLLLRRPPGREAYPGDIFY HSRLLER+ K++ + GGGS+TALP+IET+AGDISAYIPTNVISITDGQ+F+ ++LF +G RPAIDAG SVSRVG  AQ+ A+KK +G+L+L+LA +REL+AF+QFGSDLD  T+  L  G++ ++++KQ  + P     + I+L+++   ++  IP++ I  F++++   F      +L+ I  T ++  +  L  QIK
  S:     1 MSIKTEEISSLIKKQLEGYQDDLAAEEVGTVTYIGDGIARATGLENAMANELLQFSNGSYGMALNLETNDVGIIILGDFDEIREGDQVKRTGRIMEVPVGDAMIGRVVNSLGQPVDGLGAIKTDKTRPIEFKAPGVMQRKSVSEPLQTGLKAIDALVPIGRGQRELIIGDRKTGKTSIAIDTILNQKDQNMICVYVAIGQKDSTVRAQVETLKKYGAMDYTIVLTAGPSEPAPMLYIAPYAGAAMGEEFMYNGKHVLIVYDDLSKQATSYRELSLLLRRPPGREAYPGDIFYTHSRLLERAAKLSDKLGGGSMTALPVIETQAGDISAYIPTNVISITDGQIFLQSDLFYAGTRPAIDAGASVSRVGGDAQVKAMKKVAGTLRLDLASFRELEAFTQFGSDLDAATQAKLNRGRRTVEVLKQPVHKPLPVEKQVIILYALTHGFLDPIPIEDITRFQDELFDFFDSNAADLLKQIRDTGNLPDTDKLDAQIK 492
>gi|153956281|ref|YP_001397046.1| F0F1 ATP synthase subunit alpha [Clostridium kluyveri DSM 555] >gi|189081293|sp|A5N3H9|ATPA_CLOK5 ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|146349139|gb|EDK35675.1| AtpA [Clostridium kluyveri DSM 555] (504 aa)
Score = 1371, Expect = 2.3e-149, Identities = 263/490 (53%), Positives = 370/490 (75%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHF-KQQKTILETIDQTKDISQDLFVQIKN 490
           M++  ++ ++IIK+QI++Y+ K    + G +I +GDGI +  GL+  M  EL+ F N  Y M LNLE    G V+LG  E IKEG+ VKRT  VV+VPVG+ ++GRV++++G+PIDG G I   +   +E +APGV+ R +V +PL+TG  AID+M PIG+GQRELIIGD+QTGKT IA+D IINQKGK+V CIYV IGQK ST+   +N L +  A++YT +V+++AS+   L Y+AP+ G ++ E +M+KG+DVLI+YDDLSKHA+AYR +SLLLRRPP REAYPGD+FYLHSRLLER+ K++ + GGGS+TALPIIET AGD++AYIPTNVISITDGQ+F+ T LF SGQRPAI+AG+SVSRVG +AQI A+K+ +G+L+++LAQYREL +F+QFGSDLDKE+K  LE GK++ +++KQ +  P +   + ++LF+    YI  IPV+ I +F+E+ + +     + I + I + + IS +L  +++N
  S:     1 MNVKPEEITSIIKSQIEKYEKKIETVDSGTIIQIGDGIARVYGLNGCMAGELLEFPNDVYAMALNLEQDNVGCVLLGSQEGIKEGNTVKRTGKVVEVPVGENIIGRVVNSLGHPIDGKGAISTTETRAVELVAPGVITRQAVKQPLQTGIKAIDAMIPIGRGQRELIIGDRQTGKTAIAMDTIINQKGKDVICIYVAIGQKQSTVAHIVNNLIETNAMDYTIVVSAAASESAPLQYIAPYAGCSMGEYFMNKGKDVLIVYDDLSKHAVAYRAMSLLLRRPPRREAYPGDVFYLHSRLLERAAKLSDKLGGGSLTALPIIETLAGDVTAYIPTNVISITDGQIFLETELFYSGQRPAINAGISVSRVGGNAQIKAMKQVAGTLRIDLAQYRELASFAQFGSDLDKESKRTLEKGKRLTEILKQPQYKPMAVEKQVMILFAASRNYIMDIPVERISEFEEEFLDYMDTHHREIGDEIKEKQVISDELSDKLRN 491
>gi|56965611|ref|YP_177345.1| F0F1 ATP synthase subunit alpha [Bacillus clausii KSM-K16] >gi|81600648|sp|Q5WB76|ATPA_BACSK ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|56911857|dbj|BAD66384.1| F0F1-type ATP synthase alpha chain [Bacillus clausii KSM-K16] (504 aa)
Score = 1371, Expect = 2.5e-149, Identities = 264/482 (54%), Positives = 357/482 (74%)
  Q:     2 SINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKT-ILETIDQTKDISQD 483
           SI   + S++IK QI +++      ++G VI VGDGI  A GL NVM  EL+ F  G  GM  NLE  + GI++LG + DI+EG  VKRT  +++VPVG  LLGRV++ +G P+DG G +   K  PIE  APGVMAR SV EPL+TG  +IDSM PIG+GQRELIIGD+QTGKT IAID IINQK +++ C+YV IGQK ST+   + TL+Q GALEYT +V++SASD   L +LAP+TG+++AEE+M  G+ VL+IYDDLSK A AYR +SLLLRRPPGREA+PGD+FYLHSRLLER+ K+N + GGGSITALP IET+AGD+SAYIPTNVISITDGQ+F+ ++LF+SG RPA++ G+SVSRVG SAQI A+KK +G+L+L+LA YREL+AF+QFGSDLD  T+  L  G++ ++L+KQD + P     +  +++++ + Y+  +PV     F+ ++  + +     +LE I  T ++ ++
  S:     3 SIKATEISSLIKQQIDQFETTVNVQDVGTVIRVGDGIAFAHGLDNVMAGELLEFSTGVMGMAQNLEEDSVGIIILGPYTDIREGDEVKRTGRIMEVPVGSELLGRVVNPLGQPLDGLGPVHTSKTRPIESPAPGVMARKSVHEPLQTGIKSIDSMIPIGRGQRELIIGDRQTGKTAIAIDTIINQKDQDMICVYVAIGQKESTVSGVVETLRQRGALEYTIVVSASASDPAPLLFLAPYTGVSMAEEFMYNGKHVLVIYDDLSKQAAAYREMSLLLRRPPGREAFPGDVFYLHSRLLERAAKLNDDLGGGSITALPFIETQAGDVSAYIPTNVISITDGQVFLQSDLFHSGVRPAVNPGISVSRVGGSAQIKAMKKVAGTLRLDLAAYRELEAFAQFGSDLDAATQARLNRGERTVELLKQDLHQPLPVEKQVAIIYALTKGYLDDVPVADCRRFESELFTYLESNNNELLEHIRTTGNLPEE 485
>gi|169188270|ref|ZP_02848416.1| ATP synthase F1, alpha subunit [Paenibacillus sp. JDR-2] >gi|169004919|gb|EDS51774.1| ATP synthase F1, alpha subunit [Paenibacillus sp. JDR-2] (507 aa)
Score = 1370, Expect = 2.7e-149, Identities = 270/483 (55%), Positives = 353/483 (73%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHF-KQQKTILETIDQTKDISQD 483
           +SI  D+ S +IK QI++Y+++    ++G VINVGDGI +  GL N M  EL+ F NG  GM LNLE +  G+V+LG + DI+EG  VKRT  +++VPVG+ LLGRV++ +G P+DG G I   +   IE  APGV+ R SV EP++TG  AID+M P+G+GQRELIIGD+QTGKT IAIDAIINQKG  VKCIYV +GQK ST+   + TL++ GAL+YT IV + AS+   L +LAP+ G ++ E +M KGE VL+IYDDLSK A AYR LSLLLRRPPGREAYPGD+FYLHSRLLER+ K++   GGGS+TALP IET+A D+SAYIPTNVISITDGQ+F+ ++LF SGQRPA++ G+SVSRVG SAQI A+KK +G+L+L+LA YREL AFSQFGSDLDK T   L  G + M+++KQ  N P     + I ++S  + ++  IPV  I+ F+++ +         I E+I  TKD+  D
  S:     4 LSIRPDEISTLIKQQIEQYKSEIQVVDVGTVINVGDGIARVHGLENAMQGELLEFSNGVVGMALNLEESNVGVVILGPYTDIREGDQVKRTGRIMEVPVGEELLGRVVNPLGQPLDGKGPINTTQFRAIESPAPGVIDRKSVHEPMQTGIKAIDAMVPVGRGQRELIIGDRQTGKTAIAIDAIINQKGNGVKCIYVAVGQKQSTVAGVVETLRKHGALDYTIIVTAGASEPAPLLFLAPYAGCSMGEYFMYKGEHVLVIYDDLSKQAAAYRELSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSDALGGGSLTALPFIETQASDVSAYIPTNVISITDGQIFLESDLFYSGQRPAVNVGISVSRVGGSAQIKAMKKVAGTLRLDLAAYRELQAFSQFGSDLDKGTLARLNRGARTMEILKQGVNQPMPVEKQVISIYSAVKGHLDEIPVADIQRFEKEFLAFLDSNHPEIGESIRTTKDLVAD 487
>gi|75763710|ref|ZP_00743387.1| ATP synthase alpha chain [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|74488802|gb|EAO52341.1| ATP synthase alpha chain [Bacillus thuringiensis serovar israelensis ATCC 35646] (505 aa)
Score = 1370, Expect = 2.7e-149, Identities = 269/483 (55%), Positives = 351/483 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKT-ILETIDQTKDISQD 483
           MSI  ++ S +IK QI+ YQ++   S++G VI VGDGI +A GL NVM  ELV F NG  G+  NLE    GI++LG + +I+EG  V+RT  ++ VPVG  L+GRV++ +G P+DG G I      PIE  APGVM R SV EPL+TG  AID++ PIG+GQRELIIGD+QTGKT +A+D IINQK +++ CIYV IGQK ST+   + TL++ GALEYT +V +SAS    L YLAP+ G+T+ EE+M  G+ VL++YDDLSK A AYR LSLLLRRPPGREAYPGD+FYLHSRLLER+ K++   GGGS+TALP IET+AGD+SAYIPTNVISITDGQ+F+ ++LF SG RPAIDAG SVSRVG SAQI A+ K SG+L+L+LA YREL+AF+QFGSDLDK T+  L  G + ++++KQ  + P     + I+L+++   ++  IPV  I  F+E+         T +LE I  TK ++ D
  S:     4 MSIRAEEISALIKQQIENYQSEIEVSDVGTVIQVGDGIARAHGLDNVMAGELVEFSNGVMGLAQNLEENNVGIIILGPYTEIREGDEVRRTGRIMQVPVGKELIGRVVNPLGQPVDGLGPINTTNTRPIESPAPGVMDRKSVHEPLQTGIKAIDALVPIGRGQRELIIGDRQTGKTAVALDTIINQKDEDMICIYVAIGQKESTVRNVVETLRKHGALEYTIVVTASASQPAPLLYLAPYAGVTMGEEFMYNGKHVLVVYDDLSKQAAAYRELSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSDARGGGSLTALPFIETQAGDVSAYIPTNVISITDGQIFLQSDLFFSGVRPAIDAGTSVSRVGGSAQIKAMSKVSGTLRLDLASYRELEAFAQFGSDLDKATQAKLNRGARTVEVLKQGLHKPLRVEKQVIILYALTRGFLDDIPVVDITRFEEEFHAWLDSNATDLLEEIRTTKKLADD 487
>gi|15616318|ref|NP_244623.1| F0F1 ATP synthase subunit alpha [Bacillus halodurans C-125] >gi|14916532|sp|Q9K6H3|ATPA_BACHD ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|10176380|dbj|BAB07475.1| ATP synthase alpha subunit [Bacillus halodurans C-125] (502 aa)
Score = 1370, Expect = 3.2e-149, Identities = 268/499 (53%), Positives = 365/499 (73%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQ-QKTILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           MSI  ++ S++IK QI+ +Q+     ++G VI VGDGI  A GL +VM  EL+ F NG  GM  NLE    GI++LG + +I+EG  VKRT  +++VPVG+ LLGRV++ +G PIDG G I+  K  PIE  APGVM R SV EPL+TG  +IDSM P+G+GQRELIIGD+QTGKT+IAID IINQK +++ CIYV IGQK ST+   + TL+Q GAL+YT +V++SAS+   L +LAP+ G+++ EE+M  G+ VL++YDDL+K A AYR LSLLLRRPPGREAYPGD+FYLHSRLLER+ K++   GGGSITALP IET+AGD+SAYIPTNVISITDGQ+F+ ++LF SG RPA++AGLSVSRVG SAQI A+KK SG+L+L+LA YREL+AF+QFGSDLDK T+  L  G++ ++++KQ  + P     +  +++++   ++  IPV  +  F+ ++       +K +L+ I  T ++  D      +EF + IT +
  S:     1 MSIKPEEISSLIKQQIENFQSDVQVQDVGTVIRVGDGIALAHGLESVMAGELLEFSNGVMGMAQNLEENNVGIIILGPYSEIREGDEVKRTGRIMEVPVGEELLGRVVNPLGQPIDGRGPIETSKTRPIESPAPGVMDRKSVHEPLQTGIKSIDSMIPVGRGQRELIIGDRQTGKTSIAIDTIINQKDQDMICIYVAIGQKESTVAGVVETLRQHGALDYTIVVSASASEPAPLLFLAPYAGVSMGEEFMYNGKHVLVVYDDLTKQAAAYRELSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSDAKGGGSITALPFIETQAGDVSAYIPTNVISITDGQIFLQSDLFYSGVRPAVNAGLSVSRVGGSAQIKAMKKVSGTLRLDLAAYRELEAFAQFGSDLDKATQAKLNRGQRTVEVLKQGLHEPLPVEKQVAIIYALINGFLDDIPVGDVRRFESELFTFLDHNKKELLDHIRTTGNLPDD------SEFKAAITEF 494
>gi|126653443|ref|ZP_01725539.1| F0F1 ATP synthase subunit alpha [Bacillus sp. B14905] >gi|126589799|gb|EAZ83932.1| F0F1 ATP synthase subunit alpha [Bacillus sp. B14905] (502 aa)
Score = 1370, Expect = 3.5e-149, Identities = 270/492 (54%), Positives = 362/492 (73%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKT-ILETIDQTKDISQDL-FVQIKNEF 492
           M I  ++ S++IK QI+ Y+++   SE+G VI +GDGI  A GL N M  EL+ F NG  GM  NLE    GIV+LG + DIKEG  V+RT  +++VPVG+ L+GRV++ +G P+DG G I   K  PIE  A GVMAR SV EPL+TG  AID++ PIG+GQRELIIGD+Q GKT++AID I+NQ G+N+ CIYV IGQK ST+   + T ++ GAL+YT +V ++AS    L +LAPF G+++AEE+M +G+ VLI+YDDLSK A AYR LSLLLRRPPGREAYPGD+FYLHSRLLER+ K+N+    GSITALP +ET+AGDISAYIPTNVISITDGQ+F+ ++LFNSG RPAI+AGLSVSRVG SAQI A+KK +G+L+L+LA +REL++F+QFGSDLDK T   LE GK+ ++++KQD N P     +  +L+++ + ++  IPV  I  F+ + +       T +L+ +  TK+++ D  +V    EF
  S:     1 MGIKAEEISSLIKQQIENYESELKVSEVGTVIRIGDGIALAHGLDNAMAGELLEFSNGVMGMAQNLEEGNVGIVILGPYTDIKEGDEVRRTGRIMEVPVGEELIGRVVNPLGQPVDGQGPINTTKSRPIESPAFGVMARKSVHEPLQTGIKAIDALVPIGRGQRELIIGDRQVGKTSVAIDTILNQDGENMICIYVAIGQKESTVRGVVETFRKHGALDYTIVVTAAASQPAPLLFLAPFAGVSMAEEFMLQGKHVLIVYDDLSKQASAYRELSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNETYQNGSITALPFVETQAGDISAYIPTNVISITDGQIFLQSDLFNSGVRPAINAGLSVSRVGGSAQIKAMKKVAGTLRLDLAAFRELESFAQFGSDLDKITLAKLERGKRTVEVLKQDLNKPLKVEKQVAILYALTKGHLDDIPVQDIVRFESEFLSWLDSNHTNVLDHVRTTKELAPDADYVAALTEF 494
>gi|81580386|sp|Q814W0|ATPA_BACCR ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|29898900|gb|AAP12171.1| ATP synthase alpha chain [Bacillus cereus ATCC 14579] >gi|118419571|gb|ABK87990.1| ATP synthase F1, alpha subunit [Bacillus thuringiensis str. Al Hakam] (505 aa)
Score = 1369, Expect = 4.3e-149, Identities = 269/483 (55%), Positives = 351/483 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKT-ILETIDQTKDISQD 483
           MSI  ++ S +IK QI+ YQ++   S++G VI VGDGI +A GL NVM  ELV F NG  G+  NLE    GI++LG + +I+EG  V+RT  ++ VPVG  L+GRV++ +G P+DG G I      PIE  APGVM R SV EPL+TG  AID++ PIG+GQRELIIGD+QTGKT +A+D IINQK +++ CIYV IGQK ST+   + TL++ GALEYT +V +SAS    L YLAP+ G+T+ EE+M  G+ VL++YDDLSK A AYR LSLLLRRPPGREAYPGD+FYLHSRLLER+ K++   GGGS+TALP IET+AGD+SAYIPTNVISITDGQ+F+ ++LF SG RPAIDAG SVSRVG SAQI A+ K SG+L+L+LA YREL+AF+QFGSDLDK T+  L  G + ++++KQ  + P     + I+L+++   ++  IPV  I  F+E+         T +LE I  TK ++ D
  S:     4 MSIRAEEISALIKQQIENYQSEIEVSDVGTVIQVGDGIARAHGLDNVMAGELVEFSNGVMGLAQNLEENNVGIIILGPYTEIREGDEVRRTGRIMQVPVGKELIGRVVNPLGQPVDGLGPINTTNTRPIESPAPGVMDRKSVHEPLQTGIKAIDALVPIGRGQRELIIGDRQTGKTAVALDTIINQKDEDMICIYVAIGQKESTVRNVVETLRKHGALEYTIVVTASASQPAPLLYLAPYAGVTMGEEFMYNGKHVLVVYDDLSKQAAAYRELSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSDAKGGGSLTALPFIETQAGDVSAYIPTNVISITDGQIFLQSDLFFSGVRPAIDAGTSVSRVGGSAQIKAMSKVSGTLRLDLASYRELEAFAQFGSDLDKATQAKLNRGARTVEVLKQGLHKPLRVEKQVIILYALTRGFLDDIPVVDITRFEEEFHAWLDSNATDLLEEIRTTKKLADD 487
>gi|94495686|ref|ZP_01302266.1| ATP synthase alpha subunit [Sphingomonas sp. SKA58] >gi|94425074|gb|EAT10095.1| ATP synthase alpha subunit [Sphingomonas sp. SKA58] (509 aa)
Score = 1369, Expect = 4.5e-149, Identities = 267/495 (53%), Positives = 358/495 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKG--------KNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQ-QKTILETIDQTKDISQDLFVQIKNEFNSL 495
           M IN  + S +IK+QI  +  +A  SE+G V+ VGDGI +  GL NV   E+V F NG  GM LNLEA   G+V+ G   +IKEG +VKRT  +VDVPVG GLLGRV+D +GNPIDG G I+Y ++  +E  APG++ R SV EP++TG  AID++ P+G+GQRELIIGD+QTGKT +AID  INQKG        K + CIYV IGQK ST+ Q +  L++ GA++Y+ +VA++AS+   L YLAP+TG+T+ E +   G   +I+YDDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+N  NG GS+TALPIIET+AGD+SAYIPTNVISITDGQ+F+ TNLF  G RPAI+ GLSVSRVGS+AQ  A+KK SGS+KLELAQYRE+ AF+QFGSDLD  T+++L  G ++ +L+KQ + +P     +   +F+    Y+  + V  +  ++E ++ + +     +L  I  +KD+  D   ++K   +S 
  S:     1 MDINAAEISKVIKDQIANFGTEAQVSEVGSVLKVGDGIARVHGLDNVQAGEMVEFANGVQGMALNLEADNVGVVIFGSDAEIKEGDVVKRTGTIVDVPVGKGLLGRVVDGLGNPIDGKGPIQYTERKRVEVKAPGIIPRKSVHEPVQTGLKAIDALVPVGRGQRELIIGDRQTGKTAVAIDTFINQKGINAGDDESKKLYCIYVAIGQKRSTVAQIVKQLEENGAMDYSIVVAATASEPAPLQYLAPYTGVTMGEYFRDNGMHAVIVYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDANGNGSLTALPIIETQAGDVSAYIPTNVISITDGQIFLETNLFYQGIRPAINVGLSVSRVGSAAQTKAMKKVSGSIKLELAQYREMAAFAQFGSDLDASTQKLLNRGARLTELLKQPQFSPLPFEEQTASIFAGTNGYLDNVAVKDVTRYEEMMLAYLRHDHPQVLAAIRDSKDLGDDAKGKLKAALDSF 504
>gi|168142839|ref|ZP_02586068.1| F0F1 ATP synthase subunit alpha [Bacillus cereus G9842] (502 aa)
Score = 1368, Expect = 4.6e-149, Identities = 269/483 (55%), Positives = 351/483 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKT-ILETIDQTKDISQD 483
           MSI  ++ S +IK QI+ YQ++   S++G VI VGDGI +A GL NVM  ELV F NG  G+  NLE    GI++LG + +I+EG  V+RT  ++ VPVG  L+GRV++ +G P+DG G I      PIE  APGVM R SV EPL+TG  AID++ PIG+GQRELIIGD+QTGKT +A+D IINQK +++ CIYV IGQK ST+   + TL++ GALEYT +V +SAS    L YLAP+ G+T+ EE+M  G+ VL++YDDLSK A AYR LSLLLRRPPGREAYPGD+FYLHSRLLER+ K++   GGGS+TALP IET+AGD+SAYIPTNVISITDGQ+F+ ++LF SG RPAIDAG SVSRVG SAQI A+ K SG+L+L+LA YREL+AF+QFGSDLDK T+  L  G + ++++KQ  + P     + I+L+++   ++  IPV  I  F+E+         T +LE I  TK ++ D
  S:     1 MSIRAEEISALIKQQIENYQSEIEVSDVGTVIQVGDGIARAHGLDNVMAGELVEFSNGVMGLAQNLEENNVGIIILGPYTEIREGDEVRRTGRIMQVPVGKELIGRVVNPLGQPVDGLGPINTTNTRPIESPAPGVMDRKSVHEPLQTGIKAIDALVPIGRGQRELIIGDRQTGKTAVALDTIINQKDEDMICIYVAIGQKESTVRNVVETLRKHGALEYTIVVTASASQPAPLLYLAPYAGVTMGEEFMYNGKHVLVVYDDLSKQAAAYRELSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSDARGGGSLTALPFIETQAGDVSAYIPTNVISITDGQIFLQSDLFFSGVRPAIDAGTSVSRVGGSAQIKAMSKVSGTLRLDLASYRELEAFAQFGSDLDKATQAKLNRGARTVEVLKQGLHKPLRVEKQVIILYALTRGFLDDIPVVDITRFEEEFHAWLDSNATDLLEEIRTTKKLADD 484
>gi|158425751|ref|YP_001527043.1| ATP synthase F1 alpha subunit [Azorhizobium caulinodans ORS 571] >gi|172047827|sp|A8HS15|ATPA_AZOC5 ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|158332640|dbj|BAF90125.1| ATP synthase F1 alpha subunit [Azorhizobium caulinodans ORS 571] (510 aa)
Score = 1368, Expect = 5.0e-149, Identities = 262/499 (52%), Positives = 365/499 (73%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVK---------CIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK-QQKTILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           M I   + S I+K QI+ +  +A  SE+G+V++VGDGI +  GL NV   E+V FENG+ GM LNLE    G+V+ G   DIKEG  VKRT  +VDVPVG GLLGRV+DA+GNPIDG G I+  ++  ++  APG++ R SV EP++TG  AID++ PIG+GQRELIIGD+QTGKT +A+DAI+NQK  NV          C+YV +GQK ST+ QF+  L++ GALEY+ +VA++ASD   + +LAPF G  + E +   G   LII+DDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+N ENG GS+TALP+IET+A D+SAYIPTNVISITDGQ+F+ ++LF  G RPA++ GLSVSRVGSSAQI A+K+ +G +K ELAQYREL AF+QFGSDLD  T+++L  G ++ +L+KQ + +P     + +++++    Y+  +P++ + +F+   +   + Q + +L+TI  +K++S+D    +    ++   S+
  S:     1 MDIRAAEISAILKEQIQNFGREAEVSEVGQVLSVGDGIARVYGLDNVQAGEMVEFENGTRGMALNLEIDNVGVVIFGSDRDIKEGQTVKRTGAIVDVPVGRGLLGRVVDALGNPIDGKGPIEATERRRVDVKAPGIIPRKSVHEPMQTGLKAIDALIPIGRGQRELIIGDRQTGKTAVALDAILNQKPLNVAGAPESQKLYCVYVAVGQKRSTVAQFVKVLEEQGALEYSIVVAATASDPAPMQFLAPFAGTAMGEYFRDNGMHALIIHDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNDENGAGSLTALPVIETQANDVSAYIPTNVISITDGQIFLESDLFYQGIRPAVNVGLSVSRVGSSAQIKAMKQVAGKIKGELAQYRELAAFAQFGSDLDASTQKLLNRGARLTELLKQSQFSPLKVEEQVVVIYAGTNGYLDNLPLNKVREFEAGFLLAMRTQHQDLLDTIRTSKELSKDSIANLTKALDAFAKSF 509
>gi|116517209|ref|YP_816799.1| F0F1 ATP synthase subunit alpha [Streptococcus pneumoniae D39] >gi|122277703|sp|Q04HT7|ATPA_STRP2 ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|116077785|gb|ABJ55505.1| ATP synthase F1, alpha subunit [Streptococcus pneumoniae D39] (501 aa)
Score = 1368, Expect = 5.0e-149, Identities = 275/483 (56%), Positives = 363/483 (75%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK-QQKTILETIDQTKDISQD 483
           M+IN  + S +IK QI+ ++     +E G V  +GDGI +A GL NVM  EL+ FENGSYGM  NLE+T  GI++LG F DI+EG  ++RT  +++VPVG+ L+GRV+D +G P+DG GEI  DK  P+E  APGVM R SV EPL+TG  AID++ PIG+GQRELIIGD+QTGKTTIAID I+NQK +++ CIYV IGQK ST+   + TL+Q+GAL+YT +V +SAS    L +LAP+ G+ +AEE+M +G+ VLI+YDDLSK A+AYR L LLLRRPPGREA+PGD+FYLHSRLLERS K++ E GGGSITALP IET+AGDISAYI TNVISITDGQ+F+   LFN+G RPAIDAG SVSRVG SAQI A+KK +G+L+++LA YREL+AF++FGSDLD  T+  L  G++ ++++KQ  + P     +  +L+++   ++  +PVD I  F+E+    F  Q   ILETI  TKD+ ++
  S:     1 MAINAQEISALIKQQIENFKPNFDVTETGVVTYIGDGIARAHGLENVMSGELLNFENGSYGMAQNLESTDVGIIILGDFTDIREGDTIRRTGKIMEVPVGESLIGRVVDPLGRPVDGLGEIHTDKTRPVEAPAPGVMQRKSVSEPLQTGLKAIDALVPIGRGQRELIIGDRQTGKTTIAIDTILNQKDQDMICIYVAIGQKESTVRTQVETLRQYGALDYTIVVTASASQPSPLLFLAPYAGVAMAEEFMYQGKHVLIVYDDLSKQAVAYRELLLLLRRPPGREAFPGDVFYLHSRLLERSAKVSDELGGGSITALPFIETQAGDISAYIATNVISITDGQIFLGDGLFNAGIRPAIDAGSSVSRVGGSAQIKAMKKVAGTLRIDLASYRELEAFTKFGSDLDAATQAKLNRGRRTVEVLKQPVHKPLPVEKQVTILYALTHGFLDTVPVDDIVRFEEEFHAFFDAQHPEILETIRDTKDLPEE 484
>gi|89897660|ref|YP_521147.1| ATP synthase F1 alpha subunit [Desulfitobacterium hafniense Y51] >gi|119367952|sp|Q24MN9|ATPA_DESHY ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|89337108|dbj|BAE86703.1| ATP synthase F1 alpha subunit [Desulfitobacterium hafniense Y51] (502 aa)
Score = 1368, Expect = 5.6e-149, Identities = 264/489 (53%), Positives = 364/489 (74%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKT-ILETIDQTKDISQDLFVQIK 489
           M++  ++ S+IIK QI+ Y +     ++G VI VGDGI +  GL   M  EL+ F  G YGM +NLE    G ++LGKF +I+EG  VKRT  +V+VPVG+ ++GRV++A+G PIDG GEIK DK  PIE  APGV+ R SV EPL+TG  +ID++ PIG+GQRELIIGD+QTGKT +A+D IINQKGK+V CIYV +GQK ST+   + TL   GA++Y+ +V+++AS+   + Y+AP++G  + EE+M  G+ VLIIYDDL+K A AYR LSLLL+RPPGREAYPGD+FYLHSRLLER+ K++ + G GS+TALPIIET+AGD+SAYIPTNVISITDGQ+F+ T+LFN+G RPAI+ G+SVSRVG SAQI A+K+ +G L+L+LAQYREL AF+QFGSDLDK T+  L  G+++M+++KQ +  P     + ++L++  + ++  IPVD I+ F+E  +R  +  K  +L  I   K ++ +L  +I+
  S:     1 MNLRPEEISSIIKQQIERYDSAVEVVDVGTVIQVGDGIARVHGLEKAMSGELLEFPGGIYGMAMNLEEDNIGCIILGKFTEIREGDQVKRTGRIVEVPVGEAMIGRVVNALGQPIDGKGEIKTDKFRPIENTAPGVVYRKSVHEPLQTGLKSIDAIVPIGRGQRELIIGDRQTGKTAVAVDTIINQKGKDVICIYVAVGQKASTVAGVVKTLADHGAMDYSIVVSATASEPAPMLYIAPYSGCAMGEEFMYNGKHVLIIYDDLTKQAAAYRELSLLLKRPPGREAYPGDVFYLHSRLLERAAKLSPDLGSGSMTALPIIETQAGDVSAYIPTNVISITDGQIFLETDLFNAGFRPAINVGISVSRVGGSAQIKAMKQVAGQLRLDLAQYRELAAFAQFGSDLDKITQMRLTRGERMMEILKQKQYEPMVVEEQVVVLYAAVKGFLDDIPVDKIKSFEEDYLRTMRTTKADLLAKIRTEKALNDELNAEIE 490
>gi|170787927|gb|EDT28971.1| ATP synthase F1, alpha subunit [Oligotropha carboxidovorans OM5] (510 aa)
Score = 1368, Expect = 5.8e-149, Identities = 266/502 (52%), Positives = 365/502 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVK---------CIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKT-ILETIDQTKDISQDLFVQIKNEFNSLITSYIKT 502
           M I   + S I+K+QIK +   A  SE+G+V++VGDGI +  GL NV   E+V FENG+ GM LNLE+   GIV+ G   +IKEG  VKRT+ +VD PVG GLLGRV+DA+GNPIDG G I+ D++  ++  APG++ R SV EP+ TG  AID++ PIG+GQRELIIGD+QTGKT +A+D I+NQK  NV          C+YV +GQK ST+ QF+  L++ GALEY+ +VA++ASD   + YLAPFTG T+ E +   G   +IIYDDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLERS K+N   G GS+TALP+IET+A D+SAYIPTNVISITDGQ+F+ T+LF  G RPA++ GLSVSRVGSSAQ  A+KK +G +K ELAQYRE+ AF+QFGSDLD  T+ +L  G ++ +L+KQ + +P     + +++++    Y+  +P++ +  F++ ++   + +   IL  I  ++D+S D   ++K    S++  ++KT
  S:     1 MDIRAAEISAILKDQIKNFGQDAEVSEVGQVLSVGDGIARVYGLDNVQAGEMVEFENGTRGMALNLESDNVGIVIFGADREIKEGQTVKRTRAIVDTPVGKGLLGRVVDALGNPIDGKGPIQSDERKRVDVKAPGIIPRKSVHEPMATGLKAIDALIPIGRGQRELIIGDRQTGKTAVALDTILNQKPLNVAGAPESQKLYCVYVAVGQKRSTVAQFVKVLEEQGALEYSIVVAATASDPAPMQYLAPFTGCTMGEYFRDNGMHAVIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERSAKLNDSLGAGSLTALPVIETQANDVSAYIPTNVISITDGQIFLETDLFFQGIRPAVNVGLSVSRVGSSAQTKAMKKVAGKIKGELAQYREMAAFAQFGSDLDASTQRLLNRGARLTELLKQPQFSPLKMEEQVVVIWAGTNGYLDALPLNKVRAFEDGLLSLLRGKHVDILNAIRDSRDLSDDNAAKLK----SVVDGFVKT 508
>gi|169335791|ref|ZP_02862984.1| hypothetical protein ANASTE_02216 [Anaerofustis stercorihominis DSM 17244] >gi|169258529|gb|EDS72495.1| hypothetical protein ANASTE_02216 [Anaerofustis stercorihominis DSM 17244] (502 aa)
Score = 1368, Expect = 5.9e-149, Identities = 264/498 (53%), Positives = 368/498 (73%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRH-FKQQKTILETIDQTKDISQDLFVQIK---NEFNSLITS 498
           M++  ++ S IIK QIK Y  K   + +G +++VGDGI +  GL   M+ EL+LF    YGM LNLE    G V+LG   DI EG  VK T  ++ VPVGDG++GRV++A+G PIDG G I  ++    +  A GV+ R SV  PL+TG  AIDS+ PIG+GQRELIIGD+QTGKT +A+D I+NQKG++V C+YV IGQK ST+ Q + TL+++GA++YTT+V ++AS++  L YLAP++G  IAE +M KG+DVLI+YDDLSKHA+AYR+++LLLRRPPGREAYPGD+FYLHSRLLER+ ++ K   GGSITALPIIET+AGDISAYIPTNVISITDGQ+F+ T LFN+G RPA++ G+SVSRVG SAQI+ +KK  G L++E AQYREL +F+QFGSDLDK TK  LE GK++++++KQ++ +P     + ++++++   +++ I VD +++F++ +I H      + L+ I   K    +L  +I    N++ S+  S
  S:     1 MNLKPEEISRIIKEQIKNYDKKIETTSVGTILSVGDGIARVHGLDGAMMGELILFPGDVYGMVLNLEEDNVGCVLLGDDTDIVEGDTVKCTGKIMSVPVGDGVIGRVVNALGEPIDGKGSIVAEEYRKADVKASGVIDRKSVTIPLQTGYKAIDSLIPIGRGQRELIIGDRQTGKTALAVDTILNQKGEDVLCVYVAIGQKASTVAQIVGTLEEYGAMDYTTVVCATASEMAPLQYLAPYSGCAIAEYFMDKGKDVLIVYDDLSKHAVAYRSMTLLLRRPPGREAYPGDVFYLHSRLLERAARLEK---GGSITALPIIETQAGDISAYIPTNVISITDGQIFLETELFNAGVRPAVNPGISVSRVGGSAQISTMKKVGGPLRIEYAQYRELASFAQFGSDLDKSTKASLEKGKRIVEMLKQEQYSPMKVEEQVLVIYAVTNNFLKEIEVDEMKEFEKGLIEHAHSNSPSTLDKIKTAKGFDDELVEEISKLINDYKSIFLS 499
>gi|30265330|ref|NP_847707.1| F0F1 ATP synthase subunit alpha [Bacillus anthracis str. Ames] >gi|42784477|ref|NP_981724.1| F0F1 ATP synthase subunit alpha [Bacillus cereus ATCC 10987] >gi|47530869|ref|YP_022218.1| F0F1 ATP synthase subunit alpha [Bacillus anthracis str. 'Ames Ancestor'] >gi|47569802|ref|ZP_00240473.1| ATP synthase F1, alpha subunit [Bacillus cereus G9241] >gi|49188143|ref|YP_031396.1| F0F1 ATP synthase subunit alpha [Bacillus anthracis str. Sterne] >gi|49480407|ref|YP_039299.1| F0F1 ATP synthase subunit alpha [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|52140254|ref|YP_086576.1| F0F1 ATP synthase subunit alpha [Bacillus cereus E33L] >gi|65317284|ref|ZP_00390243.1| COG0056: F0F1-type ATP synthase, alpha subunit [Bacillus anthracis str. A2012] >gi|161511197|ref|NP_834970.2| F0F1 ATP synthase subunit alpha [Bacillus cereus ATCC 14579] >gi|162382767|ref|YP_897497.2| F0F1 ATP synthase subunit alpha [Bacillus thuringiensis str. Al Hakam] >gi|165873333|ref|ZP_02217936.1| ATP synthase F1, alpha subunit [Bacillus anthracis str. A0488] >gi|166984518|ref|ZP_02255859.1| F0F1 ATP synthase subunit alpha [Bacillus cereus AH187] >gi|166996501|ref|ZP_02262961.1| F0F1 ATP synthase subunit alpha [Bacillus cereus AH820] >gi|167636401|ref|ZP_02394701.1| ATP synthase F1, alpha subunit [Bacillus anthracis str. A0442] >gi|167642062|ref|ZP_02400288.1| ATP synthase F1, alpha subunit [Bacillus anthracis str. A0193] >gi|167940243|ref|ZP_02527318.1| F0F1 ATP synthase subunit alpha [Bacillus cereus AH1134] >gi|168162319|ref|ZP_02597552.1| F0F1 ATP synthase subunit alpha [Bacillus cereus H3081.97] >gi|170689702|ref|ZP_02880879.1| ATP synthase F1, alpha subunit [Bacillus anthracis str. A0465] >gi|170709433|ref|ZP_02899841.1| ATP synthase F1, alpha subunit [Bacillus anthracis str. A0389] >gi|177656030|ref|ZP_02937137.1| ATP synthase F1, alpha subunit [Bacillus anthracis str. A0174] >gi|190569418|ref|ZP_03022302.1| ATP synthase F1, alpha subunit [Bacillus anthracis Tsiankovskii-I] >gi|196039534|ref|ZP_03106839.1| ATP synthase F1, alpha subunit [Bacillus cereus NVH0597-99] >gi|196045592|ref|ZP_03112822.1| ATP synthase F1, alpha subunit [Bacillus cereus 03BB108] >gi|158512704|sp|A0RL97|ATPA_BACAH ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|81568735|sp|Q72XE6|ATPA_BACC1 ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|81613473|sp|Q6HAX7|ATPA_BACHK ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|81685357|sp|Q630U1|ATPA_BACCZ ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|81714853|sp|Q81JZ3|ATPA_BACAN ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|30260008|gb|AAP29193.1| ATP synthase F1, alpha subunit [Bacillus anthracis str. Ames] >gi|42740409|gb|AAS44332.1| ATP synthase F1, alpha subunit [Bacillus cereus ATCC 10987] >gi|47506017|gb|AAT34693.1| ATP synthase F1, alpha subunit [Bacillus anthracis str. 'Ames Ancestor'] >gi|47553544|gb|EAL11924.1| ATP synthase F1, alpha subunit [Bacillus cereus G9241] >gi|49182070|gb|AAT57446.1| ATP synthase F1, alpha subunit [Bacillus anthracis str. Sterne] >gi|49331963|gb|AAT62609.1| ATP synthase F1, alpha subunit [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|51973723|gb|AAU15273.1| ATP synthase F1, alpha subunit [Bacillus cereus E33L] >gi|164710930|gb|EDR16504.1| ATP synthase F1, alpha subunit [Bacillus anthracis str. A0488] >gi|167509980|gb|EDR85400.1| ATP synthase F1, alpha subunit [Bacillus anthracis str. A0193] >gi|167528235|gb|EDR91017.1| ATP synthase F1, alpha subunit [Bacillus anthracis str. A0442] >gi|170125666|gb|EDS94585.1| ATP synthase F1, alpha subunit [Bacillus anthracis str. A0389] >gi|170666344|gb|EDT17130.1| ATP synthase F1, alpha subunit [Bacillus anthracis str. A0465] >gi|172079885|gb|EDT64994.1| ATP synthase F1, alpha subunit [Bacillus anthracis str. A0174] >gi|190559473|gb|EDV13474.1| ATP synthase F1, alpha subunit [Bacillus anthracis Tsiankovskii-I] >gi|196023423|gb|EDX62100.1| ATP synthase F1, alpha subunit [Bacillus cereus 03BB108] >gi|196029694|gb|EDX68296.1| ATP synthase F1, alpha subunit [Bacillus cereus NVH0597-99] (502 aa)
Score = 1368, Expect = 5.9e-149, Identities = 269/483 (55%), Positives = 351/483 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKT-ILETIDQTKDISQD 483
           MSI  ++ S +IK QI+ YQ++   S++G VI VGDGI +A GL NVM  ELV F NG  G+  NLE    GI++LG + +I+EG  V+RT  ++ VPVG  L+GRV++ +G P+DG G I      PIE  APGVM R SV EPL+TG  AID++ PIG+GQRELIIGD+QTGKT +A+D IINQK +++ CIYV IGQK ST+   + TL++ GALEYT +V +SAS    L YLAP+ G+T+ EE+M  G+ VL++YDDLSK A AYR LSLLLRRPPGREAYPGD+FYLHSRLLER+ K++   GGGS+TALP IET+AGD+SAYIPTNVISITDGQ+F+ ++LF SG RPAIDAG SVSRVG SAQI A+ K SG+L+L+LA YREL+AF+QFGSDLDK T+  L  G + ++++KQ  + P     + I+L+++   ++  IPV  I  F+E+         T +LE I  TK ++ D
  S:     1 MSIRAEEISALIKQQIENYQSEIEVSDVGTVIQVGDGIARAHGLDNVMAGELVEFSNGVMGLAQNLEENNVGIIILGPYTEIREGDEVRRTGRIMQVPVGKELIGRVVNPLGQPVDGLGPINTTNTRPIESPAPGVMDRKSVHEPLQTGIKAIDALVPIGRGQRELIIGDRQTGKTAVALDTIINQKDEDMICIYVAIGQKESTVRNVVETLRKHGALEYTIVVTASASQPAPLLYLAPYAGVTMGEEFMYNGKHVLVVYDDLSKQAAAYRELSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSDAKGGGSLTALPFIETQAGDVSAYIPTNVISITDGQIFLQSDLFFSGVRPAIDAGTSVSRVGGSAQIKAMSKVSGTLRLDLASYRELEAFAQFGSDLDKATQAKLNRGARTVEVLKQGLHKPLRVEKQVIILYALTRGFLDDIPVVDITRFEEEFHAWLDSNATDLLEEIRTTKKLADD 484
>gi|1168565|sp|P42005|ATPA_BACST ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|534852|dbj|BAA07253.1| ATPase subunit alpha [Geobacillus stearothermophilus] (502 aa)
Score = 1367, Expect = 7.1e-149, Identities = 266/502 (52%), Positives = 364/502 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQ-KTILETIDQTKDISQDLFVQIKNEFNSLITSYIKT 502
           MSI  ++ S +IK QI+ Y+++   S++G VI +GDGI +A GL NVM  ELV F N   GM LNLE    GIV+LG +  IKEG  V+RT  +++VPVG+ L+GRV++ +G P+DG G ++  +  PIE  APGVM R SV EPL+TG  AID++ PIG+GQRELIIGD+QTGKT++AID IINQK +N+ CIYV IGQK ST+   + TL++ GAL+YT +V +SAS    L +LAP+ G+ + E +M KG+ VL++YDDLSK A AYR LSL +RRPPGREAYPGDIFYLHSRLLER+ K++   GGGS+TALP +ET+AGDISAYIPTNVISITDGQ+F+ ++LF S  RPAI+AGLSVSRVG +AQI A+KK +G+L+L+LA YREL+AF+QFGSDLDK T+  L  G + ++++KQD + P     + ++++++   ++  IPV  +  F+++      Q  + +LE I  TKD+  +      ++ N  I ++ KT
  S:     1 MSIRAEEISALIKQQIENYESQIQVSDVGTVIQIGDGIARAHGLDNVMSGELVEFANAVMGMALNLEENNVGIVILGPYTGIKEGDEVRRTGRIMEVPVGEALIGRVVNPLGQPVDGLGPVETTETRPIESPAPGVMDRRSVHEPLQTGIKAIDALVPIGRGQRELIIGDRQTGKTSVAIDTIINQKDQNMICIYVAIGQKESTVRTVVETLRKHGALDYTIVVTASASQPAPLLFLAPYAGVAMGEYFMYKGQHVLVVYDDLSKQAAAYRELSLFVRRPPGREAYPGDIFYLHSRLLERAAKLSDAKGGGSLTALPFVETQAGDISAYIPTNVISITDGQIFLQSDLFFSRVRPAINAGLSVSRVGGAAQIKAMKKVAGTLRLDLAAYRELEAFAQFGSDLDKATQAKLARGARTVEVLKQDLHQPIPVEKQVLIIYALTRGFLDDIPVKDVRRFEKEFYLWLDQNGQHLLEHIRTTKDLPNE------DDLNQAIEAFKKT 497
>gi|152977494|ref|YP_001377011.1| F0F1 ATP synthase subunit alpha [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|189081287|sp|A7GV58|ATPA_BACCN ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|152026246|gb|ABS24016.1| ATP synthase F1, alpha subunit [Bacillus cereus subsp. cytotoxis NVH 391-98] (502 aa)
Score = 1367, Expect = 7.5e-149, Identities = 266/483 (55%), Positives = 352/483 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKT-ILETIDQTKDISQD 483
           MSI  ++ S +IK QI+ YQ++   S++G VI VGDGI +A GL NVM  ELV F NG  G+  NLE    GI++LG + +I+EG  V+RT  ++ VPVG+ L+GRV++ +G P+DG G I   K  PIE  APGVM R SV EPL+TG  AID++ PIG+GQRELIIGD+QTGKT +A+D I+NQK +++ CIYV IGQK ST+   + TL++ GALEYT +V +SAS    L YLAP+ G+++ EE+M  G+ VL++YDDLSK A AYR LSLLLRRPPGREAYPGD+FYLHSRLLER+ K++   GGGS+TALP IET+AGD+SAYIPTNVISITDGQ+F+ ++LF SG RPAIDAG SVSRVG SAQI A+ K SG+L+L+LA YREL+AF+QFGSDLDK T+  L  G + ++++KQ  + P     + ++L+++   ++  IPV  I  F+E+           +LE I  TK ++ D
  S:     1 MSIRAEEISALIKQQIENYQSEIEVSDVGTVIQVGDGIARAHGLDNVMAGELVEFANGVMGLAQNLEENNVGIIILGPYTEIREGDEVRRTGRIMQVPVGEELIGRVVNPLGQPVDGLGPIHTTKTRPIESPAPGVMDRKSVHEPLQTGIKAIDALVPIGRGQRELIIGDRQTGKTAVALDTILNQKDEDMICIYVAIGQKESTVRNVVETLRKHGALEYTIVVTASASQPAPLLYLAPYAGVSMGEEFMYNGKHVLVVYDDLSKQAAAYRELSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSDAKGGGSLTALPFIETQAGDVSAYIPTNVISITDGQIFLQSDLFFSGVRPAIDAGTSVSRVGGSAQIKAMSKVSGTLRLDLASYRELEAFAQFGSDLDKATQAKLNRGARTVEVLKQGLHKPLRVEKQVMILYALTRGFLDDIPVADITRFEEEFYAWLDSNAADLLEEIRTTKKLADD 484
>gi|150015306|ref|YP_001307560.1| F0F1 ATP synthase subunit alpha [Clostridium beijerinckii NCIMB 8052] >gi|189081292|sp|A6LQH4|ATPA_CLOB8 ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|149901771|gb|ABR32604.1| ATP synthase F1, alpha subunit [Clostridium beijerinckii NCIMB 8052] (504 aa)
Score = 1367, Expect = 7.6e-149, Identities = 269/492 (54%), Positives = 372/492 (75%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIR-----HFKQQKTIL---ETIDQTKDISQDLFVQIKNEF 492
           M+I  ++ ++IIK +I++Y+      + G +I +GDG+ +  GL N M  EL+ F N  YGM LNLE    G V+LG+ + IKEG  VK T  VV+VPVG+ ++GRV++A+G PIDG G I   +   IE  A G++ R+SV EPL+TG  AIDSM PIG+GQRELIIGD+QTGKT IAID I+NQKGK+V CIYV IGQK ST+    NTL + GA++Y+ +V+++AS+   L Y+AP++G TI E +M +G+DVLIIYDDLSKHA AYR +SLLL+RPPGREAYPGD+FY+HSRLLER+ K++KE GGGSITALPIIET+AGD++AYIPTNVISITDGQ+F+ ++LFN+GQRPA++AG+SVSRVG SAQI A+K+ SG+L+LELAQYREL+AFSQFGSDLD ++   LE GK++++++KQD+ +P     + I+L++    ++  I V  I+ F+++ +      H + +K+I+      D+ K + ++  V+ K  F
  S:     1 MNIKPEEITSIIKKEIEKYEKDIKTVDSGTIIQIGDGVSRVYGLDNCMQGELLEFPNNVYGMVLNLEQDNVGCVLLGEEKGIKEGDTVKGTGRVVEVPVGEAMIGRVVNALGEPIDGKGPISTSQTRAIEIPAAGIIDRSSVNEPLQTGIKAIDSMIPIGRGQRELIIGDRQTGKTAIAIDTILNQKGKDVICIYVAIGQKQSTVAHIFNTLTEMGAMDYSIVVSATASESAPLQYMAPYSGCTIGEYFMHQGKDVLIIYDDLSKHATAYRAMSLLLKRPPGREAYPGDVFYIHSRLLERAAKLSKELGGGSITALPIIETQAGDVTAYIPTNVISITDGQIFLESDLFNAGQRPAVNAGISVSRVGGSAQIKAMKQVSGTLRLELAQYRELEAFSQFGSDLDADSSRRLEKGKRLVEVLKQDQYSPLEVGKQIIILYAAVNDFLSDIKVSDIKRFEKEFLEYVDTHHREIEKSIITGKTLTDEIKSMLEEAIVEFKKIF 500
>gi|86747393|ref|YP_483889.1| F0F1 ATP synthase subunit alpha [Rhodopseudomonas palustris HaA2] >gi|119367961|sp|Q2J3I2|ATPA_RHOP2 ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|86570421|gb|ABD04978.1| ATP synthase F1, alpha subunit [Rhodopseudomonas palustris HaA2] (510 aa)
Score = 1366, Expect = 8.2e-149, Identities = 262/502 (52%), Positives = 369/502 (73%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQK---------GKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKT-ILETIDQTKDISQDLFVQIKNEFNSLITSYIKT 502
           M I   + S I+K+QIK +  +A  +E+G+V++VGDGI +  GL NV   E+V FENG+ GM LNLE    G+V+ G   +IKEG  VKRT+++VD PVG GLLGRV+DA+GNPIDG G I+  ++  ++  APG++ R SV EP+ TG  AID++ P+G+GQRELIIGD+QTGKT IA+D I+NQK         G+ + C+YV +GQK ST+ QF+  L++ GALEY+ +VA++ASD   + Y+APFTG T+ E +   G   +IIYDDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+N ++G GS+TALP+IET+A D+SAYIPTNVISITDGQ+F+ T+LF  G RPA++ GLSVSRVGSSAQ  A+KK +G +K ELAQYRE+ AF+QFGSDLD  T+ +L  G ++ +L+KQ + +P     + +++++    Y+  +PV  +  F++ ++   + ++  IL+ I  ++D+S D   ++K    +++ SY KT
  S:     1 MDIRAAEISAILKDQIKNFGQEAEVTEVGQVLSVGDGIARVYGLDNVQAGEMVEFENGTRGMALNLETDNVGVVIFGADREIKEGQTVKRTRSIVDTPVGKGLLGRVVDALGNPIDGKGPIQATERKRVDVKAPGIIPRKSVNEPMATGLKAIDALIPVGRGQRELIIGDRQTGKTAIALDTILNQKPLNVEGAPEGQKLYCVYVAVGQKRSTVAQFVKVLEEQGALEYSIVVAATASDPAPMQYIAPFTGCTMGEYFRDNGMHAVIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNDDHGAGSLTALPVIETQANDVSAYIPTNVISITDGQIFLETDLFFQGIRPAVNVGLSVSRVGSSAQTKAMKKVAGKIKGELAQYREMAAFAQFGSDLDASTQRLLNRGARLTELLKQPQFSPLKMEEQVVVIYAGVNGYLDALPVAKVRAFEDGLLSLLRGKEVGILDAIRTSRDLSDDTAAKLK----AVVESYAKT 508
>gi|90421700|ref|YP_530070.1| F0F1 ATP synthase subunit alpha [Rhodopseudomonas palustris BisB18] >gi|119367962|sp|Q21CY5|ATPA_RHOPB ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|90103714|gb|ABD85751.1| ATP synthase F1, alpha subunit [Rhodopseudomonas palustris BisB18] (510 aa)
Score = 1366, Expect = 8.4e-149, Identities = 266/502 (52%), Positives = 367/502 (73%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQK---------GKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKT-ILETIDQTKDISQDLFVQIKNEFNSLITSYIKT 502
           M I   + S I+K+QIK +  +A  +E+G+V++VGDGI +  GL NV   E+V FENG+ GM LNLE    GIV+ G   +IKEG  VKRT+ +VD PVG GLLGRV+DA+GNPIDG G I+  ++  ++  APG++ R SV EP+ TG  AID++ P+G+GQRELIIGD+QTGKT IA+D I+NQK         G+ + C+YV IGQK ST+ QF+  L++ GALEY+ +VA++ASD   + Y+APFTG T+ E +   G   +IIYDDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+N+++G GS+TALPIIET+A D+SAYIPTNVISITDGQ+F+ T+LF  G RPA++ GLSVSRVGSSAQ  A+KK +G +K ELAQYRE+ AF+QFGSDLD  T+ +L  G ++ +L+KQ + +P     + +++++    Y+  +PV  +  F++ ++   + +   IL TI  ++D+S +   Q+K    S++  Y KT
  S:     1 MDIRAAEISAILKDQIKNFGQEAEVTEVGQVLSVGDGIARVYGLDNVQAGEMVEFENGTRGMALNLETDNVGIVIFGADREIKEGQTVKRTRAIVDTPVGKGLLGRVVDALGNPIDGKGPIQSTERKRVDVKAPGIIPRKSVNEPMATGLKAIDALIPVGRGQRELIIGDRQTGKTAIALDTILNQKPLNVEGAPEGQKLYCVYVAIGQKRSTVAQFVKVLEEQGALEYSIVVAATASDPAPMQYIAPFTGCTMGEYFRDNGMHAVIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNEDHGSGSLTALPIIETQANDVSAYIPTNVISITDGQIFLETDLFFQGIRPAVNVGLSVSRVGSSAQTKAMKKVAGKIKGELAQYREMAAFAQFGSDLDASTQRLLNRGSRLTELLKQPQFSPLKMEEQVVVIYAGVNGYLDPLPVSKVRAFEDGLLSLLRGKNVEILNTIRDSRDLSNETAAQLK----SVVEGYAKT 508
>gi|6652831|gb|AAF22496.1|AF098522_6 F1F0-ATPase subunit alpha [Lactobacillus acidophilus] (503 aa)
Score = 1366, Expect = 9.2e-149, Identities = 261/483 (54%), Positives = 367/483 (75%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHF-KQQKTILETIDQTKDISQD 483
           MSI  ++ S++IK Q++ Y +K   +E+G V  VGDGI +A GL +V+  EL+ F+NGS+G+  NLE+   GI++LG+F++I+EG  V+RT  +++VPVGD L+GRV++ +G P+DG GEIK DK  PIE  APGVM R SV +PL+TG  AID++ PIG+GQRELIIGD++TGKT++AID I+NQKG++V CIYV IGQK ST+   + TLK+FGA++YT +V +  S+   + Y+AP+ G  + EE+M  G+DVLI++DDLSK A+AYR LSLLLRRPPGREAYPGD+FYLHSRLLERS K++ + GGGS+TALPII+TEAGDISAYIPTNVISITDGQ+F+ ++LF +G RPAIDAG SVSRVG +AQI A+KK +G+L+ +L  YREL++F+QFGSD D+ T+  L  G++ ++++KQ  + P     + ++L+++   Y+  IPV+ I  F+ ++  +F      +L+TI +T  +  D
  S:     1 MSIKAEEISSLIKQQLEHYDDKLDINEVGVVTYVGDGIARAHGLDDVLSGELLKFDNGSFGIAQNLESNDVGIIILGQFDNIREGDRVQRTGRIMEVPVGDALIGRVVNPLGQPVDGLGEIKSDKTRPIEAKAPGVMDRQSVNQPLQTGIKAIDALVPIGRGQRELIIGDRKTGKTSLAIDTILNQKGQDVICIYVAIGQKESTVRTQVETLKRFGAMDYTIVVEAGPSEPAPMLYIAPYAGTAMGEEFMYNGKDVLIVFDDLSKQAVAYRELSLLLRRPPGREAYPGDVFYLHSRLLERSAKLSDKLGGGSLTALPIIQTEAGDISAYIPTNVISITDGQIFLQSDLFFAGTRPAIDAGNSVSRVGGNAQIKAMKKVAGTLRTDLTAYRELESFAQFGSDPDQATQAKLNRGQRTVEVLKQPLHDPIPVEKQVLILYALTHGYLDAIPVEDISRFQNELFDNFDSSHADLLKTIRETGKLPDD 484
>gi|14715604|gb|AAK72441.1|AF283808_6 ATP synthase alpha subunit [Clostridium pasteurianum] (500 aa)
Score = 1366, Expect = 9.2e-149, Identities = 280/501 (55%), Positives = 367/501 (73%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHF-KQQKTILETIDQTKDISQDLFVQIKNEFNSLITSYIK 501
           M+I  ++ ++IIK QI+ Y NK    + G +I VGDGI +  GL N M  EL+ F N  YGM +NLE    G V+LG  E IKE  IVK T  VV+VPVG+ ++GRV++ +G  IDG G IK  +  P E IA GV+ R SV EPL+TG  AIDSM PIG+GQRELIIGD+QTGKT IAID IINQKGK+V CIYV IGQK ST+    NTL Q GA++Y+ IV++SA+D   L +LAP+TG+TI E +M +G+DVLI+YDDLSKHA+AYRT+SLLLRRPP REAYPGD+FYLHSRLLER+ K++ + GGGSITALPIIET AGD++AYIPTNVISITDGQ+F+ ++L  + QRPA+++G+S SRV  SAQI A+K+ SG+L+LELAQYREL AF+QFGSDLDKE+K+ LE G +++++ KQD+  P     + I++++  E+++  I V  I++F++ ++ +     K I E I  TK +  D   +IK   NS I  Y K
  S:     1 MNIKPEEITSIIKKQIEGYDNKVKTVDSGTIIQVGDGIARVYGLENCMAGELLEFPNNVYGMVMNLEQDNVGCVLLGDEEGIKEEDIVKSTGRVVEVPVGEEMIGRVVNGLGLSIDGKGSIKTSETRPAETIAHGVIERKSVNEPLQTGIKAIDSMIPIGRGQRELIIGDRQTGKTAIAIDTIINQKGKDVICIYVAIGQKQSTVAHIYNTLIQKGAMDYSIIVSASAADSAPLQFLAPYTGVTIGEYFMDQGKDVLIVYDDLSKHAVAYRTMSLLLRRPPAREAYPGDVFYLHSRLLERAAKLSDKLGGGSITALPIIETLAGDVTAYIPTNVISITDGQIFLESDLLYAVQRPAVNSGISASRVSGSAQIKAMKQLSGTLRLELAQYRELAAFAQFGSDLDKESKKRLEKGNRLLEIFKQDQYEPMPVETQVIIIYACVEEFLMDIEVGKIKEFEKGLLEYMDTHHKEIGEAI-LTKKVLDD---EIKKSLNSAIEEYKK 498
>gi|168136015|ref|ZP_02579244.1| F0F1 ATP synthase subunit alpha [Bacillus cereus B4264] (502 aa)
Score = 1364, Expect = 1.5e-148, Identities = 268/483 (55%), Positives = 351/483 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKT-ILETIDQTKDISQD 483
           MSI  ++ S +IK QI+ YQ++   S++G VI VGDGI +A GL NVM  ELV F NG  G+  NLE    GI++LG + +I+EG  V+RT  ++ VPVG  L+GRV++ +G P+DG G I      PIE  APGVM R SV EPL+TG  AID++ PIG+GQRELIIGD+QTGKT +A+D IINQK +++ CIYV IGQK ST+   + TL++ GAL+YT +V +SAS    L YLAP+ G+T+ EE+M  G+ VL++YDDLSK A AYR LSLLLRRPPGREAYPGD+FYLHSRLLER+ K++   GGGS+TALP IET+AGD+SAYIPTNVISITDGQ+F+ ++LF SG RPAIDAG SVSRVG SAQI A+ K SG+L+L+LA YREL+AF+QFGSDLDK T+  L  G + ++++KQ  + P     + I+L+++   ++  IPV  I  F+E+         T +LE I  TK ++ D
  S:     1 MSIRAEEISALIKQQIENYQSEIEVSDVGTVIQVGDGIARAHGLDNVMAGELVEFSNGVMGLAQNLEENNVGIIILGPYTEIREGDEVRRTGRIMQVPVGKELIGRVVNPLGQPVDGLGPINTTNTRPIESPAPGVMDRKSVHEPLQTGIKAIDALVPIGRGQRELIIGDRQTGKTAVALDTIINQKDEDMICIYVAIGQKESTVRNVVETLRKHGALDYTIVVTASASQPAPLLYLAPYAGVTMGEEFMYNGKHVLVVYDDLSKQAAAYRELSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSDAKGGGSLTALPFIETQAGDVSAYIPTNVISITDGQIFLQSDLFFSGVRPAIDAGTSVSRVGGSAQIKAMSKVSGTLRLDLASYRELEAFAQFGSDLDKATQAKLNRGARTVEVLKQGLHKPLRVEKQVIILYALTRGFLDDIPVVDITRFEEEFHAWLDSNATDLLEEIRTTKKLADD 484
>gi|167628984|ref|YP_001679483.1| ATP synthase f1, alpha subunit [Heliobacterium modesticaldum Ice1] >gi|167591724|gb|ABZ83472.1| ATP synthase f1, alpha subunit [Heliobacterium modesticaldum Ice1] (502 aa)
Score = 1364, Expect = 1.5e-148, Identities = 266/500 (53%), Positives = 361/500 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKT-ILETIDQTKDISQDLFVQIKNEFNSLITSYI 500
           MS+  ++ S IIK QI+ Y+     ++ G VI VGDGI +  GL   M  EL+ F    YGM LNLE    G V+LG +  IKEG  VKRT  +V+VPVG  L+GRV++ +G P+DG G I   +  PIE  APGV+ R SV EPL+TG  AID+M PIG+GQRELIIGD+QTGKT +A+D IINQKG+NV CIYV IGQK ST+   + TL++ GA++YT +V+++AS+   L Y+AP+ G  + E ++ KG+  L IYDDLSK A+AYR LSLLLRRPPGREAYPGD+FYLHSRLLER+ K++ E+GGGS+TALPIIET+AGD+SAYIPTNVISITDGQ+F+ ++LF SG RPAI+AG+SVSRVG +AQI A+K+ +G L+LELAQYREL AF+QFGSDLDK T+  L  G+++++++KQD+  P     +  ++F+    Y+  I V  +  F+E  +++ + +K  IL+ I + K +S DL  ++K    +   +++
  S:     1 MSLRPEEISAIIKQQIERYEKPLEAADSGTVIQVGDGIARIYGLEKAMAGELLEFPGQVYGMVLNLEEDNIGCVILGPYTGIKEGDTVKRTGRIVEVPVGPELIGRVVNPLGQPLDGKGPINAKQFRPIESPAPGVIKRKSVHEPLQTGLKAIDAMVPIGRGQRELIIGDRQTGKTAVAVDTIINQKGQNVICIYVAIGQKASTVAGVVKTLEEHGAMDYTIVVSATASEPAPLLYIAPYAGCAMGEYFLYKGQHALCIYDDLSKQAVAYRELSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSDEHGGGSLTALPIIETQAGDVSAYIPTNVISITDGQIFLESDLFFSGIRPAINAGISVSRVGGAAQIKAMKQVAGRLRLELAQYRELAAFAQFGSDLDKATQARLNRGQRLVEILKQDQYKPMVVEEQVAVIFAAVNGYLDDIAVADVLKFEEGFLKYLRTEKAEILKEIREKKALSDDLTARLKEAIGAFKKTFV 501
>gi|15606090|ref|NP_213467.1| F0F1 ATP synthase subunit alpha [Aquifex aeolicus VF5] >gi|3913127|sp|O66907|ATPA_AQUAE ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|2983261|gb|AAC06855.1| ATP synthase F1 alpha subunit [Aquifex aeolicus VF5] (503 aa)
Score = 1363, Expect = 1.8e-148, Identities = 260/490 (53%), Positives = 361/490 (73%)
  Q:    11 IIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQK-TILETIDQTKDISQDLFVQIKNEFNSLITSYI 500
           I++ QIK+++ +A   E+G V  VGDG+ +A GL NVM  E+V F+ G  G+  NLE    GI++LG    I+EG IVKRT  ++D PVG+GL+GRVID +GNP+DG G I+++ + P+EKIAPGV+ R  V EPL+TG  AID+M PIG+GQRELIIGD+ TGKTT+AID I+ QK  +V CIYV +GQK + I + I  L++ GA+EYTT+V +SASD  SL YLAPF G TI E +   G+  LIIYDDLSKHA AYR LSLL+RRPPGREAYPGD+FYLHSRLLER+ K+N + G GS+TALPIIET+AGD++AYIPTNVISITDGQ+++  +LFN G RPAI+ GLSVSRVG +AQI A+K+ +G+L+LELAQ+REL+AF QF S+LDK T++ +  G ++++L+KQ+   P     + +L+++    Y+  IPV+ +  F++++  +   ++  IL+ I + K + ++L  +IK   ++    ++
  S:    12 ILRQQIKDFEPEAKMEEVGVVYYVGDGVARAYGLENVMAMEIVEFQGGQQGIAFNLEEDNVGIIILGSETGIEEGHIVKRTGRILDAPVGEGLVGRVIDPLGNPLDGKGPIQFEYRSPVEKIAPGVVKRKPVHEPLQTGIKAIDAMIPIGRGQRELIIGDRATGKTTVAIDTILAQKNSDVYCIYVAVGQKRAAIARLIELLEREGAMEYTTVVVASASDPASLQYLAPFVGCTIGEYFRDNGKHALIIYDDLSKHAEAYRQLSLLMRRPPGREAYPGDVFYLHSRLLERAAKLNDDLGAGSLTALPIIETKAGDVAAYIPTNVISITDGQIYLEADLFNKGIRPAINVGLSVSRVGGAAQIKAMKQVAGTLRLELAQFRELEAFVQFASELDKATQQQINRGLRLVELLKQEPYNPIPVEKQIVLIYAGTHGYLDDIPVESVRKFEKELYAYLDNERPDILKEISEKKKLDEELEKKIKEALDAFKQKFV 502
>gi|89210205|ref|ZP_01188597.1| ATP synthase F1, alpha subunit [Halothermothrix orenii H 168] >gi|89160278|gb|EAR79934.1| ATP synthase F1, alpha subunit [Halothermothrix orenii H 168] (541 aa)
Score = 1363, Expect = 1.8e-148, Identities = 262/483 (54%), Positives = 363/483 (75%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWM-SKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQ-KTILETIDQTKDISQD 483
           M++  ++ S++IK QI+ Y+++     +G V++VGDGI    GL  VM +EL+ F NG YGM LNLE  + G V+LG    +KEG  VKRT  VV+VPVG+ LLGR+++++G P+DG G+I  DK  P+E  AP V+ R  V  PL+TG  AIDSM PIG+GQRELIIGD+QTGKT IA+D IINQK ++V CIYV IGQK ST+ Q    LK+ GA++YT IV++SAS+   L Y+AP+ G  I E +M  K  DVL++YDDLSKHA+AYR++SLLLRRPPGREAYPGD+FYLHSRLLER+ ++N++ GGGS+TALPIIET+AGD+SAYIPTNVISITDGQ+++ + LF +G RPAI+ G+SVSRVG +AQ  A+KK +G+L+L+L+QYREL+AF+QFGSDLDK T+  LE G+++++++KQ + TP     + ++++++   ++  IPVD IE F+++ + +       I ETI +T D+  +
  S:     1 MNLRPEEISSVIKKQIENYKSELETVSVGTVLDVGDGIAHVYGLDEVMASELLEFPNGVYGMALNLEEDSVGCVLLGDETRVKEGDTVKRTGRVVEVPVGEELLGRIVNSLGQPLDGKGQISVDKYRPVESPAPSVVDRKPVDTPLQTGLKAIDSMIPIGRGQRELIIGDRQTGKTAIAVDTIINQKDQDVICIYVAIGQKASTVAQIAERLKEHGAMDYTVIVSASASEPAPLQYIAPYAGCAIGEYFMYEKNRDVLVVYDDLSKHAVAYRSMSLLLRRPPGREAYPGDVFYLHSRLLERAARLNEDMGGGSLTALPIIETQAGDVSAYIPTNVISITDGQIYLESELFFAGVRPAINVGISVSRVGGAAQTKAMKKVAGTLRLDLSQYRELEAFAQFGSDLDKATQRRLERGERIVEVLKQPQYTPMDMEDQVMIIYTVVNGHLDDIPVDNIERFEDEFLSYIHSNYPEIPETIKKTGDLDDE 485
>gi|87200413|ref|YP_497670.1| F0F1 ATP synthase subunit alpha [Novosphingobium aromaticivorans DSM 12444] >gi|115312259|sp|Q2G5N7|ATPA_NOVAD ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|87136094|gb|ABD26836.1| ATP synthase F1, alpha subunit [Novosphingobium aromaticivorans DSM 12444] (509 aa)
Score = 1363, Expect = 1.9e-148, Identities = 264/483 (54%), Positives = 354/483 (73%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQK--------GKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKT-ILETIDQTKDISQD 483
           M I   + S +IK+QI  +  +A  SE+G V++VGDGI +  GL  V   E+V F NG  GM LNLEA   G+V+ G   +IKEG +VKRT  +VDVPVG GLLGRV+DA+GNPIDG G I    +  +E  APG++ R SV EP++TG  AID++ P+G+GQRELIIGD+QTGKT +AID  INQK        GK + CIYV +GQK ST+ Q +  L++ GA+EY+ +VA++AS+   L YLAP+TG T+ E +   G   +I+YDDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+N ENG GS+TALPIIET+AGD+SAYIPTNVISITDGQ+F+ T LF  G RPAI+ GLSVSRVGSSAQ  A+KK +GS+KLELAQYRE+ AF+QFGSDLD  T+++L  G ++ +L+KQ + +P     +  ++F+  + Y+  +PV+ + +++ +++   + Q   +L  I  TKD+  +
  S:     1 MEIRAAEISKVIKDQIASFGTEAQVSEVGSVLSVGDGIARIHGLDKVQAGEMVEFSNGVKGMALNLEADNVGVVIFGSDSEIKEGDVVKRTGTIVDVPVGKGLLGRVVDALGNPIDGKGPIVDATRQRVEVKAPGIIPRKSVHEPVQTGLKAIDALVPVGRGQRELIIGDRQTGKTAVAIDTFINQKAVNAGTDEGKKLYCIYVAVGQKRSTVAQIVRQLEENGAMEYSIVVAATASEPAPLQYLAPYTGATMGEFFRDNGMHAVIVYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDENGAGSLTALPIIETQAGDVSAYIPTNVISITDGQIFLETGLFYQGIRPAINVGLSVSRVGSSAQTKAMKKVAGSIKLELAQYREMAAFAQFGSDLDASTQKLLNRGARLTELLKQPQFSPLGFEEQTCVIFAGTQGYLDAVPVNRVTEYEAELLSFLRSQHADLLGLIRDTKDLGDE 492
>gi|71082937|ref|YP_265656.1| F0F1 ATP synthase subunit alpha [Candidatus Pelagibacter ubique HTCC1062] >gi|91762639|ref|ZP_01264604.1| ATP synthase subunit A [Candidatus Pelagibacter ubique HTCC1002] >gi|115312260|sp|Q4FP36|ATPA_PELUB ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|71062050|gb|AAZ21053.1| H+-transporting two-sector ATPase (F0F1-type ATP synthase) alpha chain [Candidatus Pelagibacter ubique HTCC1062] >gi|91718441|gb|EAS85091.1| ATP synthase subunit A [Candidatus Pelagibacter ubique HTCC1002] (511 aa)
Score = 1363, Expect = 1.9e-148, Identities = 279/494 (56%), Positives = 370/494 (74%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEI-KYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKN--------VKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQK-TILETI-------DQTKDISQDLFVQIKNEFNS 494
           M IN  + + I+K QIK++ +KA  +E+G+V++VGDGI +  GL NV   E+V F +GS GM LNLE+   G+V+ G    IKEG +VKRT ++VD PVG  LLGRV+D +GNPIDG G + K  K+  +E  APG++ R SV EP++TG  +IDS+ P+G+GQRELIIGD+QTGKT +AIDAIINQK  N        + CIYV IGQK ST+ Q   TL++ GA+EYTTIVA++ASD   L +LAP+TG T+ E +   G   LIIYDDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K++ E+GGGS+TALPIIET+ GD+SA+IPTNVISITDGQ+F+ T LFN G RPAI+ GLSVSRVGS+AQ  A+KK SGS+KLELAQYRE+ AF+QFGSDLD  T+++L  G K+ +L+KQ + +P + + + I +F   + Y+  + +  I +F+ KII   K +K  ILE++       + T+    D  +++K  FNS
  S:     1 MDINPSEVTKILKEQIKKFGDKAEVTEVGQVLSVGDGIARVYGLDNVQAGEMVEFSDGSKGMALNLESENVGVVIFGDDRKIKEGDVVKRTGSIVDTPVGKELLGRVVDGLGNPIDGKGALDKATKRSRVEVKAPGIIPRQSVSEPMQTGLKSIDSLVPVGRGQRELIIGDRQTGKTAVAIDAIINQKKINESGDEKQKLYCIYVAIGQKRSTVRQIQKTLEEAGAMEYTTIVAATASDAAPLQFLAPYTGCTMGEYYRDNGMHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSDEHGGGSLTALPIIETQGGDVSAFIPTNVISITDGQIFLETELFNQGIRPAINVGLSVSRVGSAAQTKAMKKVSGSMKLELAQYREMAAFAQFGSDLDASTQKLLNRGSKLTELLKQKQYSPMTVAEQVISVFCGVKGYLDDVELKDIAEFESKIIEKCKSEKPEILESVLSSGKLEEDTEKSLVDTIMELKKNFNS 511
>gi|51891227|ref|YP_073918.1| F0F1 ATP synthase subunit alpha [Symbiobacterium thermophilum IAM 14863] >gi|81610725|sp|Q67TB9|ATPA_SYMTH ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|51854916|dbj|BAD39074.1| ATP synthase alpha subunit [Symbiobacterium thermophilum IAM 14863] (506 aa)
Score = 1362, Expect = 2.7e-148, Identities = 257/465 (55%), Positives = 348/465 (74%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK 465
           MSI  ++ S+I+K +I+ +  +   S +GRVI VGDGI +  GL + M +EL+ F NG  GM  NLE    G+V+LG  EDIKEG  V+RT  VV+VPVG  L+GRV++A+G P+DG G I+ D  +P+E+ APGV+ R SV EPL+TG  AIDSM PIG+GQRELIIGD+ TGKT IA+D IINQKG+N  CIYV IGQK STI   +  L++ GA+EYT +V+++ASD   L +LAP+ G  + E +   G   LI+YDDLSKHA+AYR +SLL+RRPPGREAYPGD+FYLHSRLLER+ K++ E G GS+TALPIIET+AGD+SAYIPTNVISITDGQ+F+ T+LFN+G RPAI+ G+SVSRVG +AQI+++K+ SG+LKL+LAQYREL AF+QFGSDLDK T+  +  G++  +++KQ +  P    L+ + +F+    Y+  + ++ +  F++++  +FK
  S:     1 MSIRPEEISSILKQEIERFSTEIETSNVGRVIQVGDGIARVYGLQSCMASELLEFPNGIMGMAFNLEEDNIGVVILGPDEDIKEGMEVRRTGRVVEVPVGPALIGRVVNALGEPLDGKGPIETDMYLPVERKAPGVITRKSVHEPLQTGLKAIDSMTPIGRGQRELIIGDRGTGKTAIAVDTIINQKGQNCICIYVGIGQKASTIAGVVKKLQETGAMEYTIVVSATASDPAPLQFLAPYAGCAMGEYFRDNGMHALIVYDDLSKHAVAYREMSLLMRRPPGREAYPGDVFYLHSRLLERAAKMSDEYGAGSLTALPIIETQAGDVSAYIPTNVISITDGQIFLETDLFNAGVRPAINVGISVSRVGGAAQIDSMKRVSGTLKLDLAQYRELAAFAQFGSDLDKATQARIIRGQRTTEILKQPQYHPLPVELQVLSIFAATNGYLDDLELEEVAAFEQELHTYFK 465
>gi|148252013|ref|YP_001236598.1| F0F1 ATP synthase subunit alpha [Bradyrhizobium sp. BTAi1] >gi|158513267|sp|A5E948|ATPA_BRASB ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|146404186|gb|ABQ32692.1| ATP synthase subunit alpha, membrane-bound, F1 sector [Bradyrhizobium sp. BTAi1] (509 aa)
Score = 1362, Expect = 2.9e-148, Identities = 260/489 (53%), Positives = 358/489 (73%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVK--------CIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK-QQKTILETIDQTKDISQDLFVQIK 489
           M I   + S I+K+QIK +  +A  +E+G+V++VGDGI +  GL NV   E+V FENG+ GM LNLE    G+V+ G   +IKEG  VKRT+ +VD PVG GLLGRV+DA+GNPIDG G I++ ++  ++  APG++ R SV EP+ TG  AID++ PIG+GQRELIIGD+QTGKT IA+D I+NQK  N +        C+YV +GQK ST+ QF+  L++ GALEY+ +VA++ASD   + YLAPFTG T+ E +   G   +IIYDDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+N+  G GS+TALP+IET+A D+SAYIPTNVISITDGQ+F+ T+LF  G RPA++ GLSVSRVGSSAQ  A+KK +G +K ELAQYRE+ AF+QFGSDLD  T+ +L  G ++ +L+KQ + +P     +  ++++    Y+  +P+  +  F++ ++   + +   +L TI  T+D+S D   ++K
  S:     1 MDIRAAEISAILKDQIKNFGQEAEVTEVGQVLSVGDGIARVYGLDNVQAGEMVEFENGTRGMALNLETDNVGVVIFGADREIKEGQTVKRTRAIVDAPVGKGLLGRVVDALGNPIDGKGPIQFTERKRVDVKAPGIIPRKSVNEPMATGLKAIDALIPIGRGQRELIIGDRQTGKTAIALDTILNQKPLNAQPDEKIKLYCVYVAVGQKRSTVAQFVKVLEEQGALEYSIVVAATASDPAPMQYLAPFTGCTMGEYFRDNGMHAVIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNETQGAGSLTALPVIETQANDVSAYIPTNVISITDGQIFLETDLFFQGIRPAVNVGLSVSRVGSSAQTKAMKKVAGKIKGELAQYREMAAFAQFGSDLDAATQRLLNRGSRLTELLKQPQFSPLKMEEQVCVIWAGTNGYLDALPLGKVRAFEDGLLSLLRGKHADLLNTIRDTRDLSDDSAAKLK 498
>gi|118474260|ref|YP_892661.1| F0F1 ATP synthase subunit alpha [Campylobacter fetus subsp. fetus 82-40] >gi|158512510|sp|A0RR28|ATPA_CAMFF ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|118413486|gb|ABK81906.1| ATP synthase F1, alpha subunit [Campylobacter fetus subsp. fetus 82-40] (505 aa)
Score = 1361, Expect = 3.6e-148, Identities = 269/499 (53%), Positives = 365/499 (73%)
  Q:     1 MSINL--DKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQ-KTILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           MS+ L  D+ S+IIK +I+ Y       E G+VI+V DG+    GL NVM  E+V FE G  GM LNLE ++ GIV+LGK   IKEGS VKR   ++ VPVGD L+GRV++A+G PID  G I+  +   IE+ A G+MAR SV EPL+TG  AID + PIG+GQRELIIGD+QTGKTT+AID IINQKG++V CIYV IGQK ST+ Q +  L+++GA++YT +V +SASD P+L YLAP+ G+T+ E +       LIIYDDLSKHA+AYR +SL+LRRPPGREAYPGD+FYLHSRLLER+ K++ + G GS+TALPIIET+AGD+SAYIPTNVISITDGQ+F+ ++LFNSG RPAI+ GLSVSRVG SAQI A+KK SG+L+L+LAQYREL AF+QF SDLD+ +++ LE G+++++++KQ   +P     + I++++  + Y+  IPV  +  F+ ++  + + +   I E I   K + +D+   +    N    ++
  S:     1 MSVKLKADEISSIIKERIENYNLSVDIEETGKVISVADGVANVYGLKNVMAGEMVEFETGEKGMALNLEESSVGIVVLGKSSSIKEGSSVKRLGKLLRVPVGDALIGRVVNALGEPIDAKGAIEATETRFIEEKAKGIMARKSVHEPLQTGIKAIDGLVPIGRGQRELIIGDRQTGKTTVAIDTIINQKGQDVICIYVAIGQKQSTVAQVVKKLEEYGAMDYTIVVNASASDAPALQYLAPYAGVTMGEYFRDNSRHALIIYDDLSKHAVAYREMSLILRRPPGREAYPGDVFYLHSRLLERASKLSDKLGAGSLTALPIIETQAGDVSAYIPTNVISITDGQIFLESDLFNSGIRPAINVGLSVSRVGGSAQIKAIKKVSGTLRLDLAQYRELQAFAQFASDLDESSRKQLERGQRMVEVLKQPPYSPLPVENQVIIIYAGSQGYLDDIPVSAVTKFEAELYPYIEAKYPEIFEQIRNKKALDKDIEEALSKALNEFKATF 502
>gi|103487767|ref|YP_617328.1| F0F1 ATP synthase subunit alpha [Sphingopyxis alaskensis RB2256] >gi|118573492|sp|Q1GQS7|ATPA_SPHAL ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|98977844|gb|ABF53995.1| ATP synthase F1, alpha subunit [Sphingopyxis alaskensis RB2256] (509 aa)
Score = 1360, Expect = 3.9e-148, Identities = 264/483 (54%), Positives = 350/483 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKN--------VKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQ-QKTILETIDQTKDISQD 483
           M I   + S +IK+QI  +   A  +EIG V++VGDGI +  GL NV   E+V F NG  GM LNLEA   GIV+ G    IKEG  VKRT  +VDVPVG GLLGRV+D +GNPIDG G IK DK+M +E  APG++ R SV EP++TG  A+D++ P+G+GQRELIIGD+QTGKT +AID  INQK  N        + CIYV +GQK ST+ Q +  L++ GA+EY+ +VA++AS+   L +LAP+TG T+ E +   G   +I+YDDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+N +NG GS+TALPIIET+AGD+SAYIPTNVISITDGQ+F+ TNLFN+G RPAI+ GLSVSRVGS+AQ  A+KK SGS+KLELAQYRE++AF+QFGSDLD  T+++L  G ++ +L+KQ +  P     +   +F+    Y+  +    +  ++  ++ + +     +L  I  +KD+  D
  S:     1 MEIRAAEISKVIKDQIANFGTDATVTEIGSVLSVGDGIARVHGLDNVQAGEMVEFANGVKGMALNLEADNVGIVIFGSDAAIKEGDQVKRTGTIVDVPVGKGLLGRVVDGLGNPIDGKGPIKADKRMRVEVKAPGIIPRTSVHEPVQTGLKALDALVPVGRGQRELIIGDRQTGKTAVAIDTFINQKAANAGDDESKKLYCIYVAVGQKRSTVAQIVRQLEENGAMEYSIVVAATASEPAPLQFLAPYTGCTMGEFFRDNGMHAVIVYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNSDNGSGSLTALPIIETQAGDVSAYIPTNVISITDGQIFLETNLFNAGIRPAINVGLSVSRVGSAAQTKAMKKVSGSIKLELAQYREMEAFAQFGSDLDASTQKLLGRGARLTQLLKQPQFQPMPFEEQTASIFAGTNGYLDTVATTDVSRYEAAMLAYLRSDHPQVLAAIRDSKDLGDD 492
>gi|114510|sp|P17674|ATPA_BACME ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|142559|gb|AAA82524.1| ATP synthase alpha subunit (502 aa)
Score = 1360, Expect = 4.5e-148, Identities = 265/492 (53%), Positives = 365/492 (74%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK-QQKTILETIDQTKDISQ-DLFVQIKNEF 492
           MSI  ++ S +IK QI+ YQ++   S++G VI VGDGI +A GL NVM  ELV F NG  GM  NLE    GI++LG + +I+EG  V+RT  +++VPVG+ L+GRV++++G P+DG G ++  K  PIE  APGVM R SV EPL+TG  AID++ PIG+GQRELIIGD+QTGKT++AID I+NQK +++ CIYV IGQK ST+   + TL++ GAL+YT +V +SAS    L +LAP+ G+T+ EE+M  G+ VL+IYDDL+K A AYR LSLLLRRPPGREAYPGD+FYLHSRLLER+ K++   GGGS+TALP IET+AGD+SAYIPTNVISITDGQ+F+ ++LF SG RPAI+AGLSVSRVG SAQI A+KK +G+L+L+LA YREL++F+QFGSDLD+ T+  L  G + ++++KQ  + P     +  +L+++ + ++  +PV  I  F+++ +   +  +K +LE+I  T  + +  LF     EF
  S:     1 MSIKAEEISALIKQQIENYQSEIKVSDVGTVIQVGDGIARAHGLDNVMAGELVEFSNGVMGMAQNLEENNVGIIILGPYTEIREGDEVRRTGRIMEVPVGEQLIGRVVNSLGQPVDGLGPVETTKTRPIEGAAPGVMDRKSVHEPLQTGIKAIDALVPIGRGQRELIIGDRQTGKTSVAIDTILNQKDQDMVCIYVAIGQKESTVRNVVETLRKHGALDYTIVVTASASQPAPLLFLAPYAGVTMGEEFMYNGKHVLVIYDDLTKQASAYRELSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSDAKGGGSLTALPFIETQAGDVSAYIPTNVISITDGQIFLQSDLFFSGVRPAINAGLSVSRVGGSAQIKAMKKVAGTLRLDLASYRELESFAQFGSDLDQATQAKLNRGARTVEILKQGLHKPLRVEKQVAVLYALTKGFLDDVPVSDITRFEDEYLTWLESNRKEVLESIRTTGGLPEAGLFESALEEF 494
>gi|146337562|ref|YP_001202610.1| F0F1 ATP synthase subunit alpha [Bradyrhizobium sp. ORS278] >gi|158514291|sp|A4YKD8|ATPA_BRASO ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|146190368|emb|CAL74364.1| ATP synthase subunit alpha, membrane-bound, F1 sector [Bradyrhizobium sp. ORS278] (509 aa)
Score = 1360, Expect = 4.7e-148, Identities = 259/489 (52%), Positives = 359/489 (73%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVK--------CIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK-QQKTILETIDQTKDISQDLFVQIK 489
           M I   + S I+K+QIK +  +A  +E+G+V++VGDGI +  GL NV   E+V FENG+ GM LNLE    G+V+ G   +IKEG  VKRT+ +VD PVG GLLGRV+DA+GNPIDG G I++ ++  ++  APG++ R SV EP+ TG  AID++ PIG+GQRELIIGD+QTGKT IA+D I+NQK  N +        C+YV +GQK ST+ QF+  L++ GALEY+ +VA++ASD   + YLAPFTG T+ E +   G   +IIYDDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+N+  G GS+TALP+IET+A D+SAYIPTNVISITDGQ+F+ T+LF  G RPA++ GLSVSRVGSSAQ  A+KK +G +K ELAQYRE+ AF+QFGSDLD  T+ +L  G ++ +L+KQ + +P     +  ++++    ++  +P++ +  F++ ++   + +   +L TI  T+D+S D   ++K
  S:     1 MDIRAAEISAILKDQIKNFGQEAEVTEVGQVLSVGDGIARVYGLDNVQAGEMVEFENGTRGMALNLETDNVGVVIFGADREIKEGQTVKRTRAIVDAPVGKGLLGRVVDALGNPIDGKGPIQFTERKRVDVKAPGIIPRKSVNEPMATGLKAIDALIPIGRGQRELIIGDRQTGKTAIALDTILNQKPLNAQPDEKIKLYCVYVAVGQKRSTVAQFVKVLEEQGALEYSIVVAATASDPAPMQYLAPFTGCTMGEYFRDNGMHAVIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNETQGAGSLTALPVIETQANDVSAYIPTNVISITDGQIFLETDLFFQGIRPAVNVGLSVSRVGSSAQTKAMKKVAGKIKGELAQYREMAAFAQFGSDLDAATQRLLNRGSRLTELLKQPQFSPLKMEEQVCVIWAGTNGFLDGLPLNKVRAFEDGLLSLLRGKHADLLNTIRDTRDLSDDSAAKLK 498
>gi|108804476|ref|YP_644413.1| ATP synthase F1, alpha subunit [Rubrobacter xylanophilus DSM 9941] >gi|118573489|sp|Q1AVH7|ATPA_RUBXD ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|108765719|gb|ABG04601.1| ATP synthase F1, alpha subunit [Rubrobacter xylanophilus DSM 9941] (526 aa)
Score = 1360, Expect = 4.7e-148, Identities = 259/478 (54%), Positives = 357/478 (74%)
  Q:     6 DKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGS----YGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK-QQKTILETIDQTKDISQD 483
           ++ S+I+K  I +Y+++    E+G+V+ VGDGI +  GLSNVM  E+V FE+       G+ LNLE    G+++ G    I EGS V+RT  +  VPVG G+LGRVI+A+G PIDG GEI+ ++  P+E IAPG++ R  V  PL+TG  AIDSM PIG+GQRELIIGD++TGKT +A+D IINQ  +NVKCIYV +GQK+S +   +  L+++GA+EYTT++ +SAS    L YLAP+ G  I E +M +GED L+IYDDLSKHA+AYR + LLLRRPPGREAYPGDIFYLHSRLLER+ ++++E GGGS+TALPIIET+AGDISAYIPTNVISITDGQ+F+  +LFN+ QRPAID GLSVSRVGSSAQI A+KK +G+LKL+L+QYREL +F+QFGSDLDK T+E L  G+++  L+KQ +  P     +  ++F   +  +R +  D + D++ ++  + +   + +L+ I + K+++ +
  S:     7 EEISSILKGAITDYESRVRTEEVGQVLEVGDGIARVHGLSNVMYQEMVEFEDARGEKVIGLALNLEEDNVGVIIAGDDRYILEGSTVRRTGRLASVPVGQGVLGRVINALGQPIDGRGEIQAEETRPVEIIAPGIIRRKDVDTPLQTGIKAIDSMIPIGRGQRELIIGDRKTGKTALAVDTIINQHDQNVKCIYVAVGQKDSAVAGVVAQLEEYGAMEYTTVINASASQPAPLQYLAPYAGCAIGEYFMHRGEDALVIYDDLSKHAVAYRQMMLLLRRPPGREAYPGDIFYLHSRLLERAARMSEEYGGGSLTALPIIETKAGDISAYIPTNVISITDGQIFLDLDLFNANQRPAIDVGLSVSRVGSSAQIKAMKKVAGTLKLDLSQYRELASFAQFGSDLDKATQETLARGERLTALLKQRERDPMPVEEQVAVIFGGTQGLLREVEPDDVPDWEAQLREYLRSSHEDLLKDIREKKELTDE 489
>gi|13473458|ref|NP_105025.1| F0F1 ATP synthase subunit alpha [Mesorhizobium loti MAFF303099] >gi|81779154|sp|Q98EV6|ATPA_RHILO ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|14024207|dbj|BAB50811.1| ATP synthetase alpha [Mesorhizobium loti MAFF303099] (509 aa)
Score = 1360, Expect = 4.7e-148, Identities = 263/499 (52%), Positives = 360/499 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKG--------KNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQ-KTILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           M I   + S I+K+QIK +  +A  SE+G+V++VGDGI +  GL NV   E+V F  G  GM LNLEA   G+V+ G   DIKEG  VKRT  +VDVPVG GLLGRV+DA+GNPIDG G IK  ++  ++  APG++ R SV EP+ TG  AID++ P+G+GQREL+IGD+QTGKT I +D ++NQK         + + C+YV +GQK ST+ QF+  L++ GALEY+ IVA++ASD   + +LAPF G T+ E +   G   LI YDDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+N + G GS+TALP+IET+A D+SAYIPTNVISITDGQ+F+ TNLF  G RPA++ GLSVSRVGSSAQI A+K+ +GS+K ELAQYRE+ AF+QFGSDLD  T+ +L  G ++ +L+KQ + +P     +  ++F+    Y+  +PV+ +  F+  ++ H +   K +L+ I + K +S DL  ++K E ++   ++
  S:     1 MDIRAAEISAILKDQIKNFGREAEVSEVGQVLSVGDGIARVYGLDNVQAGEMVEFPGGIRGMALNLEADNVGVVIFGADRDIKEGDTVKRTGAIVDVPVGPGLLGRVVDALGNPIDGKGPIKATERKRVDVKAPGIIPRKSVHEPMSTGLKAIDALIPVGRGQRELVIGDRQTGKTAIILDTMLNQKSVHDNGPEKEKLYCVYVAVGQKRSTVAQFVKVLEERGALEYSIIVAATASDPAPMQFLAPFAGCTMGEYFRDNGMHALISYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNDDLGNGSLTALPVIETQANDVSAYIPTNVISITDGQIFLETNLFFQGIRPAVNVGLSVSRVGSSAQIKAMKQVAGSIKGELAQYREMAAFAQFGSDLDAATQRLLNRGSRLTELLKQPQFSPLKTEEQVAVIFAGVNGYLDKLPVNQVGKFEHGLLSHMRAAGKDVLDAIRKEKALSDDLRAKLKAEIDAFAKTF 508
>gi|163942995|ref|YP_001647879.1| F0F1 ATP synthase subunit alpha [Bacillus weihenstephanensis KBAB4] >gi|163865192|gb|ABY46251.1| ATP synthase F1, alpha subunit [Bacillus weihenstephanensis KBAB4] (502 aa)
Score = 1360, Expect = 4.9e-148, Identities = 267/483 (55%), Positives = 350/483 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKT-ILETIDQTKDISQD 483
           MSI  ++ S +IK QI+ YQ++   S++G VI VGDGI +A GL NVM  ELV F NG  G+  NLE    GI++LG + +I+EG  V+RT  ++ VPVG  L+GRV++ +G P+DG G I      PIE  APGVM R SV EPL+TG  AID++ PIG+GQRELIIGD+QTGKT +A+D IINQK +++ CIYV IGQK ST+   + TL++ GAL+YT +V +SAS    L YLAP+ G+T+ EE+M  G+ VL++YDDLSK A AYR LSLLLRRPPGREAYPGD+FYLHSRLLER+ K++   GGGS+TALP IET+AGD+SAYIPTNVISITDGQ+F+ ++LF SG RPAIDAG SVSRVG SAQI A+ K SG+L+L+LA YREL+AF+QFGSDLDK T+  L  G + ++++KQ  + P     + I+L+++   ++  IPV  I  F+E+         T +L  I  TK ++ D
  S:     1 MSIRAEEISALIKQQIENYQSEIEVSDVGTVIQVGDGIARAHGLDNVMAGELVEFSNGVMGLAQNLEENNVGIIILGPYTEIREGDEVRRTGRIMQVPVGKELIGRVVNPLGQPVDGLGPINTTNTRPIESPAPGVMDRKSVHEPLQTGIKAIDALVPIGRGQRELIIGDRQTGKTAVALDTIINQKDEDMICIYVAIGQKESTVRNVVETLRKHGALDYTIVVTASASQPAPLLYLAPYAGVTMGEEFMYNGKHVLVVYDDLSKQAAAYRELSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSDARGGGSLTALPFIETQAGDVSAYIPTNVISITDGQIFLQSDLFFSGVRPAIDAGTSVSRVGGSAQIKAMSKVSGTLRLDLASYRELEAFAQFGSDLDKATQAKLNRGARTVEVLKQGLHKPLRVEKQVIILYALTRGFLDDIPVVDITRFEEEFHAWLDSNATDLLSEIRTTKKLADD 484
>gi|126701093|ref|YP_001089990.1| ATP synthase alpha chain [Clostridium difficile 630] >gi|145952624|ref|ZP_01801633.1| hypothetical protein CdifQ_04004000 [Clostridium difficile QCD-32g58] >gi|168697759|ref|ZP_02730036.1| ATP synthase alpha chain [Clostridium difficile QCD-37x79] >gi|168714970|ref|ZP_02747247.1| ATP synthase alpha chain [Clostridium difficile QCD-63q42] >gi|168726394|ref|ZP_02758671.1| ATP synthase alpha chain [Clostridium difficile QCD-76w55] >gi|168730160|ref|ZP_02762437.1| ATP synthase alpha chain [Clostridium difficile QCD-97b34] >gi|196124977|ref|ZP_03116726.1| ATP synthase alpha chain [Clostridium difficile ATCC 43255] >gi|196162323|ref|ZP_03122884.1| ATP synthase alpha chain [Clostridium difficile CIP 107932] >gi|196164029|ref|ZP_03124560.1| ATP synthase alpha chain [Clostridium difficile QCD-23m63] >gi|123066473|sp|Q180W8|ATPA_CLOD6 ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|115252530|emb|CAJ70373.1| ATP synthase alpha chain [Clostridium difficile 630] (500 aa)
Score = 1359, Expect = 5.2e-148, Identities = 260/460 (56%), Positives = 350/460 (76%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKI 460
           M++  ++ S+IIK QIK Y+NK   ++ G V+ VGDGI    GL   M  EL+ F    YGM LNLE    G V+LG   +IKEG IVKRT  +V+VPVG+ L+GRV++++G PIDG G I Y K  P+E  APG++ R SV EPL+TG  +IDSM PIG+GQRELIIGD+QTGKT+I ID I+NQKGK+V CIYV IGQK STI Q +++L++ GAL+YT +V+++AS+   L Y+AP+ G  + EE+M  G+ VLI+YDDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K++ E GGGS+TALPIIET+AGD+SAYIPTNVISITDGQ+++   LF SG RPA+D G+SVSRVG SAQI A+KK +G+LKL  +QYREL AFSQFGSDLD++TK+ L  G+++++++KQ ++ P     + ++++++   ++  IP+D I  F+ ++
  S:     1 MNLKPEEISSIIKQQIKNYENKVELTDTGSVLTVGDGIASVYGLEKAMSGELLEFPGEIYGMALNLEEEVVGAVILGDDSEIKEGDIVKRTGRIVEVPVGEALIGRVVNSLGQPIDGKGPIAYTKTRPVESEAPGIIDRRSVYEPLQTGIKSIDSMIPIGRGQRELIIGDRQTGKTSIVIDTILNQKGKDVICIYVAIGQKRSTIAQLVSSLEKGGALDYTIVVSATASESAPLQYIAPYAGAAMGEEFMYNGKHVLIVYDDLSKQAVAYREMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSDELGGGSMTALPIIETQAGDVSAYIPTNVISITDGQIYLQPELFYSGVRPAVDPGISVSRVGGSAQIKAMKKVAGTLKLAYSQYRELAAFSQFGSDLDEDTKKRLAQGERIVEILKQGEHQPIKVENQVMIIYAVINNHLEDIPIDNIARFESEL 460
>gi|23100432|ref|NP_693899.1| F0F1 ATP synthase subunit alpha [Oceanobacillus iheyensis HTE831] >gi|81745357|sp|Q8EM81|ATPA_OCEIH ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|22778665|dbj|BAC14933.1| H(+)-transporting ATP synthase alpha chain [Oceanobacillus iheyensis HTE831] (503 aa)
Score = 1359, Expect = 5.3e-148, Identities = 270/507 (53%), Positives = 369/507 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKI-IRHFKQQKTILETIDQTKDISQDLFVQIKNEFNSLITSYIKT-IPDYN 507
           MSIN ++ S +IK QI+ + +    S++G VI VGDGI +A GL N M  EL+ F NG  G+  NLE +  GIV+LG + +IKEG  V+RT  ++ VPVG+ LLGRV++ +G PIDG G I+  K  PIE  APGVM R SV EPL+TG  AID++ PIG+GQRELIIGD+QTGKTT+A+D I+NQK +++ CIYV IGQK ST+   + T ++ GALE T +V + ASD   L YL+P+ G+ + EE+M  G+ VL+IYDDLSK A+AYR LSLLLRRPPGREA+PGD+FYLHSRLLER+ K++   GGGS+TALP +ET+AGDI+AYIPTNVISITDGQ+F+ ++LF SG RPAI+ GLSVSRVG SAQI A+KK +G+L+L+LA +REL+AFSQFGSDLDK T+  L  G++ ++++KQ  + P     +  +++S+   ++  IPV+ I+ F+E++ I     +  +L +I +T ++  +      +EFN  I S+ KT +P  N
  S:     1 MSINAEEISTLIKQQIENFDSDIEVSDVGTVIEVGDGIARAHGLDNAMAGELLEFSNGVMGLAQNLEESNVGIVILGPYTEIKEGDEVRRTGRIMQVPVGEELLGRVVNPLGQPIDGKGPIETSKTRPIEAAAPGVMDRKSVDEPLQTGIKAIDALVPIGRGQRELIIGDRQTGKTTVAVDTILNQKDQDMICIYVAIGQKESTVRNTVETFRKHGALENTIVVTAGASDPAPLLYLSPYAGVAMGEEFMYNGKHVLVIYDDLSKQAVAYRELSLLLRRPPGREAFPGDVFYLHSRLLERAAKLSDAKGGGSLTALPFVETQAGDIAAYIPTNVISITDGQIFLQSDLFFSGVRPAINPGLSVSRVGGSAQIKAMKKVAGTLRLDLASFRELEAFSQFGSDLDKSTQAKLNRGQRTVEVLKQGLHKPMVVEKQVAIIYSLTRGFLDDIPVEDIQRFEEELNIWLESNRNELLTSIRETGNLPDE------SEFNDAIDSFKKTFLPSNN 503
>gi|166033114|ref|ZP_02235943.1| hypothetical protein DORFOR_02836 [Dorea formicigenerans ATCC 27755] >gi|166027471|gb|EDR46228.1| hypothetical protein DORFOR_02836 [Dorea formicigenerans ATCC 27755] (502 aa)
Score = 1359, Expect = 6.3e-148, Identities = 270/491 (54%), Positives = 359/491 (73%)
  Q:     2 SINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQ-QKTILETIDQTKDISQDL---FVQIKNEF 492
           SIN D+  +I+K++I+ +   +  SE+G V+ VGDGI    G+ + M  E+V FENG  GM  +++    G ++ G    IKEG+ V RTK    +PVGD  +GRVI+A+G PIDG GEI+ D   PIE  APG++ R SV  P+ETG L+IDSMFPIG+GQRELIIGD+QTGKT+IA D I+NQ G  V CIYV IGQK STI + +NT K  GA+++T ++AS+ASD   L Y+AP+ G  +AE +M KG+DVLI+YDDLSKHA+AYR LSLLL R PGREAYPGD+FYLHSRLLERS ++++E GGGSITALPIIET+AGD+SAYIPTNVISITDGQ+F+ ++LF SG RPA++ GLSVSRVG  AQ  A+KK +GSL+++LAQYRE++ F+QF SDLD  TKE LE+G  +M+L+KQ    P S + + I L + + K +  IP   ++ F+  ++ +F      I   I++TKD+S++L    V+I  EF
  S:     3 SINSDEIISILKSEIENFDEISKDSEVGTVVTVGDGIATIYGIDHAMYGEIVTFENGLKGMVQDIQKDEIGCILFGSDTGIKEGTKVARTKKKAGIPVGDKFIGRVINALGAPIDGAGEIEADDYRPIENEAPGIIDRKSVSVPMETGILSIDSMFPIGRGQRELIIGDRQTGKTSIATDTILNQNGNGVICIYVAIGQKASTISKVVNTFKTSGAMDHTIVLASTASDCAPLQYIAPYAGTALAEYFMYKGKDVLIVYDDLSKHAVAYRALSLLLGRSPGREAYPGDVFYLHSRLLERSSRLSEEKGGGSITALPIIETQAGDVSAYIPTNVISITDGQIFLESSLFFSGMRPAVNVGLSVSRVGGDAQTKAMKKAAGSLRIDLAQYREMEVFTQFSSDLDDATKEQLEYGSGLMELLKQPLGKPMSLADKVITLCAARHKVMLGIPTAKVKGFQMDMLSYFASVHPEIAREIEETKDLSKELSQKIVEIAEEF 497
>gi|86154032|ref|ZP_01072233.1| ATP synthase F1, alpha subunit [Campylobacter jejuni subsp. jejuni HB93-13] >gi|121612946|ref|YP_999829.1| F0F1 ATP synthase subunit alpha [Campylobacter jejuni subsp. jejuni 81-176] >gi|167004800|ref|ZP_02270558.1| F0F1 ATP synthase subunit alpha [Campylobacter jejuni subsp. jejuni 81-176] >gi|158513873|sp|A1VXI8|ATPA_CAMJJ ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|85842446|gb|EAQ59660.1| ATP synthase F1, alpha subunit [Campylobacter jejuni subsp. jejuni HB93-13] >gi|87248980|gb|EAQ71942.1| ATP synthase F1, alpha subunit [Campylobacter jejuni subsp. jejuni 81-176] (501 aa)
Score = 1359, Expect = 6.3e-148, Identities = 265/500 (53%), Positives = 365/500 (73%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK-QQKTILETIDQTKDISQDLFVQIKNEFNSLITSYI 500
           M    D+ S+IIK +I+ +       E G++I+V DG+ +  GL N+M  E+V FENG  GM LNLE ++ GIV+LGK E +KEG+ VKR K ++ VPVG+ L+GRV++A+G PID  G I  ++   +E+ A G+MAR SV EPL TG  AID++ PIG+GQRELIIGD+QTGKTT+A+D II+Q+G+ V CIYV IGQK ST+ Q +  L++ GA+EYT +V + ASD  +L YLAP+TG+T+ E +    +  LI+YDDLSKHA+AYR +SL+LRRPPGREAYPGD+FYLHSRLLER+ K+N E G GS+TALPIIET+AGD+SAYIPTNVISITDGQ+F+ T+LFNSG RPAI+ GLSVSRVG +AQI A K+ SG+L+L+LAQYREL AF+QF SDLD+ +++ LE G+++++L+KQ   +P S   + +L+F+  + ++  I V  IE+F++ I    + +   I E I   K +  DL  ++    N    +++
  S:     1 MKFKADEISSIIKERIENFDLNLEIEETGKIISVADGVAKVYGLKNIMAGEMVEFENGDKGMALNLEESSVGIVILGKGEGLKEGASVKRLKKLLKVPVGEALIGRVVNALGEPIDAKGVINANEYRFVEEKAKGIMARKSVHEPLHTGIKAIDALVPIGRGQRELIIGDRQTGKTTVAVDTIISQRGQGVICIYVAIGQKQSTVAQVVKRLEEHGAMEYTIVVNAGASDPAALQYLAPYTGVTMGEFFRDNAKHALIVYDDLSKHAVAYREMSLILRRPPGREAYPGDVFYLHSRLLERASKLNDELGAGSLTALPIIETQAGDVSAYIPTNVISITDGQIFLETDLFNSGIRPAINVGLSVSRVGGAAQIKATKQVSGTLRLDLAQYRELQAFAQFASDLDEASRKQLERGQRMVELLKQPPYSPLSVEKQVVLIFAGTKGFLDDIAVSRIEEFEDGIYPFIEAKHPDIFEQIRSKKALDSDLEEKLAKAINEFKANHL 501
>gi|75674628|ref|YP_317049.1| F0F1 ATP synthase subunit alpha [Nitrobacter winogradskyi Nb-255] >gi|115312258|sp|Q3SVJ4|ATPA_NITWN ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|74419498|gb|ABA03697.1| ATP synthase F1, alpha subunit [Nitrobacter winogradskyi Nb-255] (510 aa)
Score = 1359, Expect = 6.5e-148, Identities = 266/502 (52%), Positives = 362/502 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVK---------CIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK-QQKTILETIDQTKDISQDLFVQIKNEFNSLITSYIKT 502
           M I   + S I+K+QIK +  +A  SE+G+V++VGDGI +  GL N+   E+V FENG+ GM LNLE    GIV+ G   +IKEG  VKRT+ +VD PVG GLLGRV+DA+GNPIDG G I+  ++  ++  APG++ R SV EP+ TG  AID++ PIG+GQRELIIGD+QTGKT IA+D I+NQK  NV          C+YV +GQK ST+ QF+  L++ GALEY+ +VA++ASD   + YLAPFTG T+ E +       +IIYDDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+N   G GS+TALP+IET+A D+SAYIPTNVISITDGQ+F+ T+LF  G RPA++ GLSVSRVGSSAQ  A+KK +G +K ELAQYRE+ AF+QFGSDLD  T+ +L  G ++ +L+KQ + +P     + +++++    Y+  +P+  +  F++ ++   + Q   IL TI  T+D+S +   ++K    S++  Y KT
  S:     1 MDIRAAEISAILKDQIKNFGKEAEVSEVGQVLSVGDGIARVYGLDNIQAGEMVEFENGTRGMALNLETDNVGIVIFGADREIKEGQTVKRTRAIVDAPVGKGLLGRVVDALGNPIDGKGPIQGAERKRVDVKAPGIIPRKSVHEPMATGLKAIDALIPIGRGQRELIIGDRQTGKTAIALDTILNQKPLNVAGAPESQKLYCVYVAVGQKRSTVAQFVKVLEEQGALEYSIVVAATASDPAPMQYLAPFTGCTMGEYFRDNAMHAVIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNDSQGNGSLTALPVIETQANDVSAYIPTNVISITDGQIFLETDLFFQGIRPAVNVGLSVSRVGSSAQTKAMKKVAGKIKGELAQYREMAAFAQFGSDLDASTQRLLNRGSRLTELLKQPQFSPLKMEEQVVVIWAGTNGYLDPLPLGKVRAFEDGLLSLLRGQHADILNTIRDTRDLSDETAGKLK----SIVEGYAKT 508
>gi|22266797|gb|AAM94911.1|AF522463_6 subunit alpha [Ilyobacter tartaricus] (469 aa)
Score = 1358, Expect = 6.8e-148, Identities = 263/467 (56%), Positives = 345/467 (73%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQ 467
           M I  ++ S+IIK +I+ Y+        G V+ VGDGI +  GLSN    EL+ F NG  GM LNLE    G V+LG    +KEG  V+ T  V  VP G+GLLGRV++A+G PIDG G+ K +K+M +E+ A G++AR  V EPL+TG  +ID M PIG+GQRELIIGD+QTGKT +A+DAIINQKG  VKCIYV IGQ+ ST+ Q +  L+  GA+EYTT+VA++AS+   L Y+AP+ G+++ E +M KGE VLI+YDDLSKHA+AYR +SLLL+RPPGREAYPGD+FYLHSRLLER+ KI+ E GGGSITALPIIET+AGD+SA+IPTNVISITDGQ+F+ + LFNSG RPAI+AG+SVSRVG SAQI A+K+ +  +KLELAQY EL  F+QFGSDLDK T   LE G ++M+++KQD+  P+    + +  F +   Y+  I +  +  F+E+II+  ++Q
  S:     1 MKIRPEEISSIIKTEIENYKKSLDIKTSGSVVEVGDGIARIYGLSNAKAGELLEFPNGIKGMVLNLEENNVGAVLLGDPTGVKEGDEVRATGEVAAVPAGEGLLGRVVNALGEPIDGKGDAKIEKRMMLERKAHGIIARKPVHEPLQTGIKSIDGMVPIGRGQRELIIGDRQTGKTAVALDAIINQKGTGVKCIYVAIGQRRSTVAQIVKKLENAGAMEYTTVVAATASEPAPLQYMAPYCGVSMGEYFMDKGEHVLIVYDDLSKHAVAYREMSLLLKRPPGREAYPGDVFYLHSRLLERAAKISDELGGGSITALPIIETQAGDVSAFIPTNVISITDGQIFLDSELFNSGFRPAINAGISVSRVGGSAQIKAMKQVAAKVKLELAQYSELLTFAQFGSDLDKATMAQLERGHRIMEILKQDQYKPYKVEEQVVSFFMVINGYLDDIAIGDVRRFEEEIIKDLRRQ 467
>gi|92116153|ref|YP_575882.1| F0F1 ATP synthase subunit alpha [Nitrobacter hamburgensis X14] >gi|119367958|sp|Q1QQS5|ATPA_NITHX ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|91799047|gb|ABE61422.1| ATP synthase F1, alpha subunit [Nitrobacter hamburgensis X14] (510 aa)
Score = 1358, Expect = 7.9e-148, Identities = 263/502 (52%), Positives = 365/502 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQK---------GKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKT-ILETIDQTKDISQDLFVQIKNEFNSLITSYIKT 502
           M I   + S I+K+QIK +  +A  SE+G+V++VGDGI +  GL N+   E+V FENG+ GM LNLE    GIV+ G   +IKEG  VKRT+ +VD PVG GLLGRV+DA+GNPIDG G I+  ++  ++  APG++ R SV EP+ TG  +ID++ P+G+GQRELIIGD+QTGKT IA+D I+NQK         G+ + C+YV IGQK ST+ QF+  L++ GALEY+ IVA++ASD   + Y+APFTG T+ E +   G   +IIYDDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+N ++G GS+TALP+IET+A D+SAYIPTNVISITDGQ+F+ T+LF  G RPA++ GLSVSRVGSSAQ  A+KK +G +K ELAQYRE+ AF+QFGSDLD  T+ +L  G ++ +L+KQ + +P     +  ++++    Y+  +P+  +  F++ ++   + +   IL TI +++D+S D   +++    S +  Y KT
  S:     1 MDIRAAEISAILKDQIKNFGQEAEVSEVGQVLSVGDGIARVYGLDNIQAGEMVEFENGTRGMALNLETDNVGIVIFGADREIKEGQTVKRTRAIVDAPVGKGLLGRVVDALGNPIDGKGPIQATERKRVDVKAPGIIPRKSVNEPMATGLKSIDALIPVGRGQRELIIGDRQTGKTAIALDTILNQKPLNVAGAPEGQKLYCVYVAIGQKRSTVAQFVKVLEEQGALEYSIIVAATASDPAPMQYIAPFTGCTMGEYFRDNGMHAVIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNDDHGNGSLTALPVIETQANDVSAYIPTNVISITDGQIFLETDLFFQGIRPAVNVGLSVSRVGSSAQTKAMKKVAGKIKGELAQYREMAAFAQFGSDLDASTQRLLNRGSRLTELLKQPQFSPLKMEEQVCVIWAGTNGYLDKLPLGKVRAFEDGLLSLLRGKNVEILNTIRESRDLSDDTAAKLR----SAVDGYAKT 508
>gi|150020195|ref|YP_001305549.1| F0F1 ATP synthase subunit alpha [Thermosipho melanesiensis BI429] >gi|166201684|sp|A6LJR3|ATPA_THEM4 ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|149792716|gb|ABR30164.1| ATP synthase F1, alpha subunit [Thermosipho melanesiensis BI429] (507 aa)
Score = 1356, Expect = 1.4e-147, Identities = 259/501 (51%), Positives = 375/501 (74%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLF-ENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKT-ILETIDQTKDISQDLFVQIKNEFNSLITSYIK 501
           M IN  +   +++++I+ ++ +   +++G+VI VGDGI +A GL+NVM NE+V F E G+ GM  NLE    GI++LG ++DIKEG  VKR   ++ VPVG+ LLGRV++ +G P+DG G I   +   +E  APGV+ R  V  PL+TG   ID++ PIG+GQRELIIGD+QTGKT IAID IINQKGK V CIYV IGQK S + + ++ LKQ GA+EYTT+V +SA+D  SL Y+AP+ G  + E +M KG+D L+IYDDLSKHA+AYR LSLLLRRPPGREAYPGD+FYLHSRLLER+ +++ + GGGS+TALPIIET+A DISAYIPTNVISITDGQ+++  +LF +GQRPA++ GLSVSRVG +AQ+ A+KK +GSLKL+LAQY+EL+ F+QF ++LD  T+  +  G+++M+L+KQ++ +P     +  +L++    Y+  + V+ + DF+++ +++ K+ K+ +L+ I +TKD++++L  +++N      + ++K
  S:     1 MRINPGEIVKVLESKIEGFKEEINLNDVGKVIQVGDGIARAYGLNNVMANEMVEFVETGTIGMAFNLEEDNVGIIILGDYKDIKEGYTVKRLNRIMQVPVGEALLGRVVNPLGEPLDGLGPIDAKEYRDVEVKAPGVIYRKPVDTPLQTGIKLIDALIPIGRGQRELIIGDRQTGKTAIAIDTIINQKGKGVYCIYVAIGQKASAVARLVDKLKQHGAMEYTTVVVASAADNASLQYIAPYAGCAMGEYFMYKGKDALVIYDDLSKHAVAYRQLSLLLRRPPGREAYPGDVFYLHSRLLERAARLDDKYGGGSLTALPIIETQANDISAYIPTNVISITDGQIYLEPSLFYAGQRPAVNIGLSVSRVGGAAQVKAMKKVAGSLKLDLAQYQELETFAQFATELDPATQAQITRGQRLMELMKQEQYSPLEVEEQVAVLYAGINGYLDDLDVEKVRDFEKRFLQYLKENKSELLKQIRETKDLNEELENELRNAIEDYKSEFVK 503
>gi|86151432|ref|ZP_01069647.1| ATP synthase F1, alpha subunit [Campylobacter jejuni subsp. jejuni 260.94] >gi|85841779|gb|EAQ59026.1| ATP synthase F1, alpha subunit [Campylobacter jejuni subsp. jejuni 260.94] (501 aa)
Score = 1356, Expect = 1.4e-147, Identities = 264/500 (52%), Positives = 366/500 (73%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKT-ILETIDQTKDISQDLFVQIKNEFNSLITSYI 500
           M    D+ S+IIK +I+ +       E G++I+V DG+ +  GL N+M  E+V FENG  GM LNLE ++ GIV+LGK E +KEG+ VKR K ++ VPVG+ L+GRV++A+G PID  G I  ++   +E+ A G+MAR SV EPL TG  AID++ PIG+GQRELIIGD+QTGKTT+A+D II+Q+G+ V CIYV IGQK ST+ Q +  L++ GA+EYT +V + ASD  +L YLAP+TG+T+ E +    +  LI+YDDLSKHA+AYR +SL+LRRPPGREAYPGD+FYLHSRLLER+ K+N E G GS+TALPIIET+AGD+SAYIPTNVISITDGQ+F+ T+LFNSG RPAI+ GLSVSRVG +AQI A K+ SG+L+L+LAQYREL AF+QF SDLD+ +++ LE G+++++L+KQ   +P S   + +L+F+  + ++  I V  I++F++ I    + + + I E I   K +  DL  ++    N    +++
  S:     1 MKFKADEISSIIKERIENFDLNLEIEETGKIISVADGVAKVYGLKNIMAGEMVEFENGDKGMALNLEESSVGIVILGKGEGLKEGASVKRLKKLLKVPVGEALIGRVVNALGEPIDAKGVINANEYRFVEEKAKGIMARKSVHEPLHTGIKAIDALVPIGRGQRELIIGDRQTGKTTVAVDTIISQRGQGVICIYVAIGQKQSTVAQVVKRLEEHGAMEYTIVVNAGASDPAALQYLAPYTGVTMGEFFRDNAKHALIVYDDLSKHAVAYREMSLILRRPPGREAYPGDVFYLHSRLLERASKLNDELGAGSLTALPIIETQAGDVSAYIPTNVISITDGQIFLETDLFNSGIRPAINVGLSVSRVGGAAQIKATKQVSGTLRLDLAQYRELQAFAQFASDLDEASRKQLERGQRMVELLKQPPYSPLSVEKQVVLIFAGTKGFLDDIAVSRIKEFEDGIYPFIEAKHSDIFEQIRSKKALDSDLEEKLAKAINEFKANHL 501
>gi|154246021|ref|YP_001416979.1| ATP synthase F1, alpha subunit [Xanthobacter autotrophicus Py2] >gi|154160106|gb|ABS67322.1| ATP synthase F1, alpha subunit [Xanthobacter autotrophicus Py2] (509 aa)
Score = 1356, Expect = 1.4e-147, Identities = 262/499 (52%), Positives = 363/499 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKN--------VKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK-QQKTILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           M I   + + I+K QI+ +  +A  SE+G+V++VGDGI +  GL NV   E+V FENG+ GM LNLE    GIV+ G   +IKEG  VKRT+ +VD PVG GLLGRV+DA+GNPIDG G I Y ++  ++  APG++ R SV EP++TG  AID++ PIG+GQRELIIGD+QTGKT +A+D+I+NQK  N        + C+YV +GQK ST+ QF+  L++ GALEY+ +VA++ASD   + +LAPFTG  + E +   G   LII+DDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+N   G GS+TALP+IET+A D+SAYIPTNVISITDGQ+F+ ++LF  G RPA++ GLSVSRVGSSAQI A+K+ +G +K ELAQYREL AF+QFGSDLD  T+++L  G ++ +L+KQ + +P     +  ++F+    Y+  +PV  + +F++ ++   + Q   ILE I  +K+IS+D   ++    ++   S+
  S:     1 MDIRAAEITAILKEQIQNFGQEAEVSEVGQVLSVGDGIARVYGLDNVQAGEMVEFENGTRGMALNLEIDNVGIVIFGSDREIKEGQTVKRTRAIVDAPVGKGLLGRVVDALGNPIDGKGPIVYTERRRVDVKAPGIIPRKSVHEPMQTGLKAIDALIPIGRGQRELIIGDRQTGKTAVALDSILNQKPINQGTDEKAKLYCVYVAVGQKRSTVAQFVKVLEEQGALEYSIVVAATASDAAPMQFLAPFTGTAMGEYFRDNGMHALIIHDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNDSLGAGSLTALPVIETQANDVSAYIPTNVISITDGQIFLESDLFYQGIRPAVNVGLSVSRVGSSAQIKAMKQVAGKIKGELAQYRELAAFAQFGSDLDASTQKLLNRGARLTELLKQSQFSPLKVEEQVAVIFAGTNGYLDPLPVSKVREFEQGLLLALRSQHPEILEAIRSSKEISKDTTEKLTKALDAFAKSF 508
>gi|153809939|ref|ZP_01962607.1| hypothetical protein RUMOBE_00320 [Ruminococcus obeum ATCC 29174] >gi|149834117|gb|EDM89197.1| hypothetical protein RUMOBE_00320 [Ruminococcus obeum ATCC 29174] (509 aa)
Score = 1355, Expect = 1.5e-147, Identities = 259/505 (51%), Positives = 364/505 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKT---ILETIDQTKDISQDLFVQIKNEFNSLITSYIKTIPD 505
           M +  ++ S +I++QIK Y+N    +E G ++ VGDGI +ASGL N M  EL+ FE+G++GM  NLE  +  IV+ G  E+I EG  VKRT  VV VPVG+ ++GRV++A+G PIDG G I   +  P+E  APG+  R SV +PL+TG  AIDSM PIG+GQRELIIGD+QTGKTTIA D IINQKGK+V CIYV IGQK ST+   +  L + GA+ YT +VA++AS+   + Y+AP+ G  + E +M++G+DVLIIYDDLSKHA+AYR LSLL+RRPPGREAYPGD+FYLHSRLLER+ K++ E+GGGS+TALPIIET+AGD+SAYIPTNVISITDGQ+F+ T LF+SG  PA++ G+SVSRVG  AQI A+KK +G+LKL  +QYREL +F+QFGSDLD +TK  LE G ++++++KQ +N P     +  +L+++ +  +  + V+ +  ++  +  +         +++ I  T  +  +   ++++   +   +++ T PD
  S:     1 MQLKPEEISKVIRSQIKYYENAIQQNETGTILMVGDGIARASGLVNCMAGELLEFEDGNFGMAQNLEENSVSIVIFGSDENIGEGQTVKRTGKVVSVPVGEAMIGRVVNALGQPIDGAGPIDTKEFRPVETKAPGICERRSVYQPLQTGIKAIDSMIPIGRGQRELIIGDRQTGKTTIATDTIINQKGKDVLCIYVAIGQKRSTVASLVENLTRNGAMNYTIVVAATASESSPMQYIAPYAGCAMGEYFMNQGKDVLIIYDDLSKHAVAYRALSLLIRRPPGREAYPGDVFYLHSRLLERAAKLDDEHGGGSLTALPIIETQAGDVSAYIPTNVISITDGQIFLETELFHSGIMPAVNPGISVSRVGGDAQIKAMKKVAGTLKLIYSQYRELQSFAQFGSDLDADTKARLEQGARIVEVLKQSQNAPVPVEKQVAILYAVTKGILEKVKVEDVNAYEAGLYTYLDADAAGLEVMQLISTTGKLEPETEEKLRHVLEAYTENFLNTRPD 508
>gi|157737831|ref|YP_001490515.1| F0F1 ATP synthase subunit alpha [Arcobacter butzleri RM4018] >gi|166990353|sp|A8EV72|ATPA_ARCB4 ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|157699685|gb|ABV67845.1| ATP synthase F1 sector, alpha subunit [Arcobacter butzleri RM4018] (505 aa)
Score = 1355, Expect = 1.7e-147, Identities = 264/497 (53%), Positives = 366/497 (73%)
  Q:     3 INLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQ-KTILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           I  D+ S+IIK +I  ++     +E G++I+  DGI Q  GL NVM  E+V FENG  G+  NLE ++ G+V+LGK E ++EG+  KR   +++ PVG+ L+GRV++A+G PIDG G I   +   +E+ APG+MAR SV EPL+TG  AID++ PIG+GQRELIIGD+QTGKTT+AID I+NQKG+NV CIYV IGQK+S+I   + TL++ GA++YT +V +SA+D  +L +LAP+TG+TI E +   G+  LIIYDDLSKHA+AYR +SL+LRRPPGREAYPGD+FYLHSRLLER+ K++ E G GS+TALPIIET+AGD++AYIPTNVISITDGQ+F+ TNLFNSG RPAI+ GLSVSRVG +AQI A K+ +G+LKL LAQYREL+AF+QF SDLD+ T+  LE G+++++++KQ  N P     + +++++  + Y+  I V  +  F+ ++   F+Q+   ILE I  ++ I  +   Q+K       T +
  S:     5 IQADEISSIIKERIDNFELNVDVNETGKIISYADGIAQVYGLKNVMAGEIVEFENGEKGLASNLEESSVGVVILGKGEGLREGTSCKRVGKLLETPVGEALVGRVVNALGEPIDGKGAIAATETRFVEEKAPGIMARKSVHEPLQTGIKAIDALVPIGRGQRELIIGDRQTGKTTVAIDTILNQKGENVICIYVAIGQKSSSIASVVRTLEESGAMDYTIVVNASAADSSALQFLAPYTGVTIGEYFRDNGKHALIIYDDLSKHAVAYREMSLILRRPPGREAYPGDVFYLHSRLLERAAKMSDERGAGSMTALPIIETQAGDVAAYIPTNVISITDGQIFLETNLFNSGIRPAINVGLSVSRVGGAAQIKATKQVAGTLKLSLAQYRELEAFAQFASDLDEATRRELELGQRMVEVLKQGVNKPLVIEKQIVIIYAGTKGYLNDIAVKDVVRFEAELHAFFEQKYSNILEAIKASQKIDDNTETQLKAALEEFKTVF 502
>gi|15791493|ref|NP_281316.1| F0F1 ATP synthase subunit alpha [Campylobacter jejuni subsp. jejuni NCTC 11168] >gi|57237112|ref|YP_178124.1| F0F1 ATP synthase subunit alpha [Campylobacter jejuni RM1221] >gi|86149645|ref|ZP_01067875.1| ATP synthase F1, alpha subunit [Campylobacter jejuni subsp. jejuni CF93-6] >gi|88597664|ref|ZP_01100897.1| ATP synthase F1, alpha subunit [Campylobacter jejuni subsp. jejuni 84-25] >gi|148926905|ref|ZP_01810583.1| ATP synthase F1 sector alpha subunit [Campylobacter jejuni subsp. jejuni CG8486] >gi|157414418|ref|YP_001481674.1| F0F1 ATP synthase subunit alpha [Campylobacter jejuni subsp. jejuni 81116] >gi|172046990|sp|A8FJR0|ATPA_CAMJ8 ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|81557622|sp|Q5HX61|ATPA_CAMJR ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|81788945|sp|Q9PJ21|ATPA_CAMJE ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|57165916|gb|AAW34695.1| ATP synthase F1, alpha subunit [Campylobacter jejuni RM1221] >gi|85839913|gb|EAQ57172.1| ATP synthase F1, alpha subunit [Campylobacter jejuni subsp. jejuni CF93-6] >gi|88189968|gb|EAQ93944.1| ATP synthase F1, alpha subunit [Campylobacter jejuni subsp. jejuni 84-25] >gi|112359492|emb|CAL34276.1| ATP synthase F1 sector alpha subunit [Campylobacter jejuni subsp. jejuni NCTC 11168] >gi|145844482|gb|EDK21590.1| ATP synthase F1 sector alpha subunit [Campylobacter jejuni subsp. jejuni CG8486] >gi|157385382|gb|ABV51697.1| ATP synthase F1 sector alpha subunit [Campylobacter jejuni subsp. jejuni 81116] (501 aa)
Score = 1354, Expect = 2.0e-147, Identities = 264/500 (52%), Positives = 365/500 (73%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK-QQKTILETIDQTKDISQDLFVQIKNEFNSLITSYI 500
           M    D+ S+IIK +I+ +       E G++I+V DG+ +  GL N+M  E+V FENG  GM LNLE ++ GIV+LGK E +KEG+ VKR K ++ VPVG+ L+GRV++A+G PID  G I  ++   +E+ A G+MAR SV EPL TG  AID++ PIG+GQRELIIGD+QTGKTT+A+D II+Q+G+ V CIYV IGQK ST+ Q +  L++ GA+EYT +V + ASD  +L YLAP+TG+T+ E +    +  LI+YDDLSKHA+AYR +SL+LRRPPGREAYPGD+FYLHSRLLER+ K+N E G GS+TALPIIET+AGD+SAYIPTNVISITDGQ+F+ T+LFNSG RPAI+ GLSVSRVG +AQI A K+ SG+L+L+LAQYREL AF+QF SDLD+ +++ LE G+++++L+KQ   +P S   + +L+F+  + ++  I V  I++F++ I    + +   I E I   K +  DL  ++    N    +++
  S:     1 MKFKADEISSIIKERIENFDLNLEIEETGKIISVADGVAKVYGLKNIMAGEMVEFENGDKGMALNLEESSVGIVILGKGEGLKEGASVKRLKKLLKVPVGEALIGRVVNALGEPIDAKGVINANEYRFVEEKAKGIMARKSVHEPLHTGIKAIDALVPIGRGQRELIIGDRQTGKTTVAVDTIISQRGQGVICIYVAIGQKQSTVAQVVKRLEEHGAMEYTIVVNAGASDPAALQYLAPYTGVTMGEFFRDNAKHALIVYDDLSKHAVAYREMSLILRRPPGREAYPGDVFYLHSRLLERASKLNDELGAGSLTALPIIETQAGDVSAYIPTNVISITDGQIFLETDLFNSGIRPAINVGLSVSRVGGAAQIKATKQVSGTLRLDLAQYRELQAFAQFASDLDEASRKQLERGQRMVELLKQPPYSPLSVEKQVVLIFAGTKGFLDDIAVSRIKEFEDGIYPFIEAKHPDIFEQIRSKKALDSDLEEKLAKAINEFKANHL 501
>gi|187251921|ref|YP_001876403.1| ATP synthase F1, alpha subunit [Elusimicrobium minutum Pei191] >gi|186972081|gb|ACC99066.1| ATP synthase F1, alpha subunit [Elusimicrobium minutum Pei191] (512 aa)
Score = 1354, Expect = 2.3e-147, Identities = 263/495 (53%), Positives = 369/495 (74%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVK----CIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK-QQKTILETIDQTKDISQDLFVQIKNEFNSL 495
           MS+  ++ ++IIK++I  +  +A  +E G V+ VGDGI +  GL N +  EL+ F N   G+ LNLE    G V++G+   I+EG  VKRT  V++VPVGD LLGRV+D +G P+DG G IK +   P+E +APGV+ R  V +PL+TG  AIDS+ PIGKGQRELIIGD+QTGKT IAIDAI+NQK +       C+YV IGQK ST+ Q + TL +FGA+EYT IV++SA+D  SL Y+AP+ G +IAEE+M    DVLIIYDDLSKHA AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K++ +NGGGSITALPIIET+A D+SAYIPTNVISITDGQ+++ + LF+SG +PA++ GLSVSRVG SAQ   ++  SG+L+L+++QY+EL+AFSQFGSDLDKE+++ L  GK++ +L KQD+ TP     + ++ F+    ++  I V+ +++++++++ +FK ++K + E +    ++S++L  ++K    + 
  S:     1 MSLKAEEITSIIKSKIANFTPQADINETGTVLQVGDGIARIYGLKNAVAGELLEFPNNVKGLALNLETDNIGCVLMGEDSSIQEGDPVKRTGQVINVPVGDALLGRVVDPLGKPLDGKGPIKTNSSRPLEIVAPGVIERQPVKQPLQTGLKAIDSLVPIGKGQRELIIGDRQTGKTAIAIDAILNQKNQPADQRTLCVYVAIGQKQSTVAQVVQTLTEFGAMEYTVIVSASAADPASLLYIAPYAGSSIAEEFMWNKRDVLIIYDDLSKHAQAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERACKLSDKNGGGSITALPIIETQANDMSAYIPTNVISITDGQIYLESGLFHSGMKPAVNVGLSVSRVGGSAQKKIMRSVSGTLRLDMSQYKELEAFSQFGSDLDKESQQQLTRGKRINELFKQDQYTPMPVEEQVLVFFAGTNGFLDNIEVNLVKEYEKQLLTYFKAEKKDLFEELKNAPEMSENLTNKLKEALTAF 500
>gi|182420272|ref|ZP_02951501.1| ATP synthase F1, alpha subunit [Clostridium butyricum 5521] >gi|182375867|gb|EDT73459.1| ATP synthase F1, alpha subunit [Clostridium butyricum 5521] (504 aa)
Score = 1351, Expect = 4.9e-147, Identities = 266/501 (53%), Positives = 365/501 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHF-KQQKTILETIDQTKDISQDLFVQIKNEFNSLITSYIK 501
           M+I  ++ ++IIK +I++Y+ +    + G +I VGDG+ +  GL + M  EL+ F N  YGM LNLE    G V+LG  E IKEG IVK T  +V VPVGD L+GRV++A+G  IDG G I  D+   IE  AP ++ R+SV EPL+TG  AIDSM PIGKGQRELIIGD+QTGKT I ID I+NQKGK+V CIYV IGQK ST+   +NTL + GA++Y+ +V+S+A++   L YLAP+ G +I E +M +G+DVLIIYDDLSKHA+AYR +SLLL+RPPGREAYPGD+FY+HSRLLERS K+++E GGGS+TALPIIET+AGD++AYIPTNVISITDGQ+F+  +LFN+GQRPAI+ G+SVSRVG +AQI A+K+ SG+L+LELAQYREL++F+QFGSDLD ++   L+ GK++M+++KQD+  P     + ++L++    ++  I V  I  F+ + +       + + + I   K ++ D    IK+   + I  + K
  S:     1 MNIKPEEITSIIKKEIEKYEKQIKTVDSGTIIQVGDGVARVYGLDDCMEGELLEFPNDVYGMALNLEQDNVGCVLLGSEEGIKEGDIVKGTGKIVQVPVGDALIGRVVNALGEAIDGKGPILTDETRAIEVPAPSIIDRSSVNEPLQTGIKAIDSMIPIGKGQRELIIGDRQTGKTAIGIDTILNQKGKDVICIYVAIGQKQSTVAHIVNTLTEMGAMDYSVVVSSTAAESAPLQYLAPYAGCSIGEYFMHQGKDVLIIYDDLSKHAVAYRAMSLLLKRPPGREAYPGDVFYIHSRLLERSAKLSQELGGGSLTALPIIETQAGDVTAYIPTNVISITDGQIFLEGDLFNAGQRPAINPGISVSRVGGNAQIKAMKQVSGTLRLELAQYRELESFAQFGSDLDSDSSRRLQKGKRLMEVLKQDQYQPLDVEKQVMMLYATVNDFLSDIKVSDIRKFEREFLEFMDTHHREVGKAIGTEKVLTDD----IKSNLEAAIIEFKK 498
>gi|73662088|ref|YP_300869.1| F0F1 ATP synthase subunit alpha [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|124007217|sp|Q49Z52|ATPA_STAS1 ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|72494603|dbj|BAE17924.1| F0F1-type ATP synthase alpha subunit [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (503 aa)
Score = 1351, Expect = 5.2e-147, Identities = 264/502 (52%), Positives = 374/502 (74%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKT-ILETIDQTKDISQDLFVQIKNEFNSLITSYIKT 502
           M+I  ++ S ++++QI+ Y+++   +++G V+ +GDGI    GL++VM  EL+ F++G  G+  NLE +  G+V+LG + DIKEG  VKRT  +++VPVG+ L+GRV++ +G PIDG G +      P+EK A GVM R SV EPL+TG  AID++ PIG+GQRELIIGD+QTGKTT+AID I+NQ  ++  CIYV IGQK+ST+   +  L+Q GAL+YT +V++SA+D   + Y+AP++G+ +AEE+M  G+DVLI+YDDL+K A AYR LSLLLRRPPGREAYPGD+FYLHSRLLER+ K+N + GGGSITALPIIET+AGDI+AY+PTNVISITDGQ+F+ ++LF SG RPAI+AG SVSRVG SAQI A+KK +G+L+L+LA YREL++F+QFGSDLD+ T + LE GK+ ++++KQDKN P     + ++++++ + Y+  IPV+ I  F+E++    K   T +L  I  +  + +D        F S IT + K+
  S:     1 MAIKAEEISALLRSQIENYESEMAVTDVGTVLQIGDGIALIHGLNDVMAGELIEFKSGVLGLAQNLEESNVGVVILGPYADIKEGDEVKRTGRIMEVPVGNELIGRVVNPLGQPIDGQGPVNTTSTRPVEKKATGVMDRKSVDEPLQTGIKAIDALVPIGRGQRELIIGDRQTGKTTVAIDTILNQADQDTICIYVAIGQKDSTVRANVEKLRQEGALDYTIVVSASAADPAPMLYIAPYSGVAMAEEFMFAGKDVLIVYDDLTKQAAAYRELSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNDDLGGGSITALPIIETQAGDIAAYVPTNVISITDGQIFLQSDLFFSGVRPAINAGQSVSRVGGSAQIKAMKKVAGTLRLDLASYRELESFAQFGSDLDEFTAKKLERGKRTVEILKQDKNKPLPVENQVLIIYALTKGYLDDIPVEDITRFEEELNLWAKSNATELLNEIKTSGALPKD------EAFESAITEFKKS 497
>gi|177676663|ref|ZP_02947077.1| ATP synthase F1, alpha subunit [Methylocella silvestris BL2] >gi|172069230|gb|EDT55340.1| ATP synthase F1, alpha subunit [Methylocella silvestris BL2] (509 aa)
Score = 1351, Expect = 5.4e-147, Identities = 259/481 (53%), Positives = 350/481 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKN--------VKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK-QQKTILETIDQTKDIS 481
           M I   + S I+KN+I  + N+A  +E+G+V++VGDGI +  GL NV   E+V FENG  GM LNLE    G+V+ G   DIKEG  VKRT  +VDVPVG GLLGRV+DA+GNPIDG G I Y+ +  ++  APG++ R SV EP+ TG  AID++ PIG+GQRELIIGD+QTGKT +A+DAI+NQK  N        + C+YV +GQK ST+ QF+  L++ GALEY+ IVA++ASD   + +LAPF+G  + E +       LI+YDDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+   NG GS+TALP+IET+A D+SAYIPTNVISITDGQ+F+ T+LF  G RPA++ GLSVSRVGS+AQ  A+KK +G +K ELAQYRE+ AF+QFGSDLD  T+ +L  G ++ +L+KQ +  P     + +++++    Y+  +PV  +  F++ ++   +     +LETI  +KD+S
  S:     1 MDIRAAEISQILKNEIANFGNEASVTEVGQVLSVGDGIARVYGLDNVEAGEMVEFENGVRGMALNLEVDNVGVVIFGSDRDIKEGQTVKRTGAIVDVPVGRGLLGRVVDALGNPIDGKGPIPYETRSRVDVKAPGIIPRKSVHEPMATGLKAIDALIPIGRGQRELIIGDRQTGKTAVALDAILNQKSANQGTDESAKLYCVYVAVGQKRSTVAQFVKVLEENGALEYSIIVAATASDPAPMQFLAPFSGCAMGEYFRDNAMHALIVYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLRDANGAGSLTALPVIETQANDVSAYIPTNVISITDGQIFLETDLFYQGIRPAVNVGLSVSRVGSAAQTKAMKKVAGKIKGELAQYREMAAFAQFGSDLDATTQRLLARGSRLTELLKQPQFAPLKMEEQVVVIYAGVNGYLDALPVARVRAFEDGLLALVRTSHGDLLETIRSSKDLS 490
>gi|116618947|ref|YP_819318.1| F0F1 ATP synthase subunit alpha [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|122270853|sp|Q03V27|ATPA_LEUMM ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|116097794|gb|ABJ62945.1| F0F1-type ATP synthase, alpha subunit [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (505 aa)
Score = 1350, Expect = 5.8e-147, Identities = 256/483 (53%), Positives = 361/483 (74%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKT-ILETIDQTKDISQD 483
           M+I  ++ S +IK Q++++       E+G V  VGDG+ +A+GL+N +  ELV F NG+YGM  NLE++  GI++LG F+DI+EG  VKRT  +++VPVG+ L+GRV++A+G PIDG GEIK DK  P+E  APGVM R SV EPL+TG  AID++ PIG+GQRELIIGD++TGKT++AID I+NQK +N+  IYV IGQKNST+   + TL+Q GA++YT +V +  S+   + YLAP+ G  + EE+M  G+ VLI+YDDLSK A AYR LSL+LRRPPGREAYPGD+FYLHSRLLER+ K++ E GGGS+TALP IET+AGD+SAYIPTNVISITDGQ+F+  + F +G RPAIDAG SVSRVG  AQI A+KK +G+L+L+LA +REL++F+QFGSDLD  T+  L  G++ ++++KQ  N P     + ++L+++   Y+  + V  I+ F++++I +     + + + I +TK++ ++
  S:     1 MAIQAEEISALIKQQLEKFDTTLTVEEVGTVTYVGDGVARATGLANALAGELVEFANGTYGMAQNLESSEVGIIILGGFDDIREGDTVKRTGRIMEVPVGEQLIGRVVNALGQPIDGLGEIKTDKTRPVEVKAPGVMERKSVSEPLQTGIKAIDALVPIGRGQRELIIGDRKTGKTSLAIDTILNQKDQNMIVIYVAIGQKNSTVRAQVETLRQMGAMDYTIVVNAGPSEPAPMLYLAPYVGAAMGEEFMYNGKHVLIVYDDLSKQATAYRELSLILRRPPGREAYPGDVFYLHSRLLERAAKLSDELGGGSMTALPFIETQAGDVSAYIPTNVISITDGQVFLDADQFYAGVRPAIDAGTSVSRVGGDAQIKAMKKVAGTLRLDLASFRELESFAQFGSDLDSATQAKLARGRRTVEILKQPLNKPMPVQHQVVVLYALTHGYLDDVEVADIQRFQDELIAYVDANASELFKAIVETKNLPEE 484
>gi|184154915|ref|YP_001843255.1| F1F0-ATPase alpha subunit [Lactobacillus fermentum IFO 3956] >gi|183226259|dbj|BAG26775.1| F1F0-ATPase alpha subunit [Lactobacillus fermentum IFO 3956] (512 aa)
Score = 1350, Expect = 6.1e-147, Identities = 263/477 (55%), Positives = 352/477 (73%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK-QQKTILETIDQT 477
           MSI  ++ S++IK Q+  YQ++    E G V  VGDG+ +A GL N M  EL+ FENG YGM  NLE+   GIV+LG    I+EG  VKRT  +++VPVGD LLGRV+D +G  IDG G+IK DK  PIE+ APGVM R SV +PL+TG   ID++ PIG+GQRELIIGD++TGKT+IAID IINQK +++ CIYV IGQK ST+   + TL++FGAL+YT +V++SAS+   L Y+AP+ G  + EE+M  G DVLIIYDDLSK A AYR LSL+LRRPPGREAYPGDIFY HSRLLER+ +++ + GGGS+TALP+I+T+AGD+SAYIPTNVISITDGQ+F+  + F +GQRPAIDAG SVSRVG  AQI A+KK SG+L+L++A Y EL AF+QFGSDLD  TK  L+ G++ M+++KQ  + P     + + L+++   Y+  +PVD +  F+ ++    +   + + ++I Q+
  S:     1 MSIKTEEISSLIKKQLANYQDQISVEETGTVTYVGDGVARADGLENAMAGELLEFENGVYGMAQNLESNDVGIVILGDDTAIREGDTVKRTGRIMEVPVGDALLGRVVDPLGRSIDGLGDIKTDKTRPIERKAPGVMERKSVSQPLQTGIKVIDALVPIGRGQRELIIGDRKTGKTSIAIDTIINQKDQDMICIYVAIGQKESTVRSQVETLRKFGALDYTIVVSASASNPAPLLYIAPYAGAAMGEEFMFGGRDVLIIYDDLSKQADAYRELSLILRRPPGREAYPGDIFYTHSRLLERAARLSDDLGGGSMTALPVIQTQAGDVSAYIPTNVISITDGQIFLDADSFYAGQRPAIDAGTSVSRVGGDAQIKAMKKVSGTLRLDIASYNELAAFAQFGSDLDAATKARLDRGERTMEVLKQGLHAPQPVEQQVVTLYALAHNYLDDVPVDDVLRFESELATFMRSNHQDLYDSIKQS 478
>gi|148553545|ref|YP_001261127.1| F0F1 ATP synthase subunit alpha [Sphingomonas wittichii RW1] >gi|166201681|sp|A5V3X3|ATPA_SPHWW ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|148498735|gb|ABQ66989.1| ATP synthase F1, alpha subunit [Sphingomonas wittichii RW1] (509 aa)
Score = 1350, Expect = 6.4e-147, Identities = 261/499 (52%), Positives = 356/499 (71%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQK--------GKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKT-ILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           M I   + S +I++QI  + ++A  SE+G+V++VGDGI +  GL NV   E++ F NG  GM LNLEA   G V+ G    IKEG +VKRT  +VDVPVG GLLGRV+D +GNPIDG G I  +++  +E  APG++ R SV EP++TG  A+D++ P+G+GQRELIIGD+QTGK+ +AID  INQK         K + C+YV IGQK ST+ Q + TL++ GA+EY+ +VA++ASD   L YLAP+TG+ + E +   G   LI+YDDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+N  NG GS+TALPIIET+AGD+SAYIPTNVISITDGQ+F+ T+LF  G RPAI+ GLSVSRVGS+AQ  A+KK +GS+KLELAQYRE+ AF+QFGSDLD  T+ +L  G ++ +L+KQ +  P     +   +F+    Y+  IP + +  F+   +   + +   +L  I  +KD+S D    +K+   + + ++
  S:     1 MDIRAAEISKVIRDQIASFGSEAQISEVGQVLSVGDGIARIHGLDNVQAGEMIEFSNGIKGMALNLEADNVGAVIFGSDSQIKEGDVVKRTGTIVDVPVGKGLLGRVVDGLGNPIDGKGPIVAEQRSRVEVKAPGIIPRKSVHEPVQTGLKALDALVPVGRGQRELIIGDRQTGKSAVAIDTFINQKTANAGTDESKKLYCVYVAIGQKRSTVAQLVKTLEENGAMEYSIVVAATASDPAPLQYLAPYTGVAMGEYFRDNGMHGLIVYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNDANGNGSLTALPIIETQAGDVSAYIPTNVISITDGQIFLETDLFYQGVRPAINVGLSVSRVGSAAQTKAMKKVAGSIKLELAQYREMAAFAQFGSDLDASTQRLLNRGARLTELLKQPQFQPLPFEEQVASIFAGVNGYLDSIPTNAVTRFEAGFLAEMRSKHADVLAAIRDSKDLSADSTAALKSALEAFVKTF 508
>gi|163782149|ref|ZP_02177148.1| ATP synthase subunit A [Hydrogenivirga sp. 128-5-R1-1] >gi|159882681|gb|EDP76186.1| ATP synthase subunit A [Hydrogenivirga sp. 128-5-R1-1] (503 aa)
Score = 1350, Expect = 6.8e-147, Identities = 255/491 (51%), Positives = 358/491 (72%)
  Q:    10 NIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQK-TILETIDQTKDISQDLFVQIKNEFNSLITSYI 500
           ++++ QIK+++ +A   E+G V  VGDG+ +A GL NVM  E+V FE G  G+  NLE    GI++LG    I+EGSIV+RT  ++  PVG+GL+GRVI+ +G P+DG G ++Y+   P+EKIAPGV+AR  V EPL+TG  AIDSM PIG+GQRELIIGD+ TGKTTI ID I+NQ+  +V CIYV IGQK ST  + I  L++ GA+EYTT+V +SA+D  SL YLAPF G TI E +   G+  L++YDDLSKHA AYR LSLL+RRPPGREAYPGD+FYLHSRLLER+ K+N + G GS+TALPIIET+AGD++AYIPTNVISITDGQ+++  +LFN G RPAI+ GLSVSRVG +AQI A+K+ +G+L+L+LAQ+REL+AF QF S+LDK T++ +  G ++++L+KQ+   P     + + +F+    Y+  +PV+ +  F++++      ++  +L+ I + K +  +L  +IK   ++    ++
  S:    11 DLLRQQIKDFEAEAKMEEVGVVYYVGDGVARAYGLENVMAMEVVEFEGGEKGLAFNLEEDNVGIIILGSETGIREGSIVRRTNQILSTPVGEGLVGRVINPLGEPLDGKGPVEYEYMSPVEKIAPGVVARKPVHEPLQTGIKAIDSMIPIGRGQRELIIGDRATGKTTICIDTILNQRDTDVYCIYVAIGQKRSTTARIIELLEKEGAMEYTTVVVASATDPASLQYLAPFVGCTIGEYFRDNGKHALVVYDDLSKHAEAYRQLSLLMRRPPGREAYPGDVFYLHSRLLERAAKLNDDLGAGSLTALPIIETKAGDVAAYIPTNVISITDGQIYLEPDLFNKGVRPAINVGLSVSRVGGAAQIKAMKQVAGTLRLDLAQFRELEAFVQFASELDKATQQTINRGMRLVELLKQEPYNPLPVEKQIVAIFAGTNGYLDDLPVESVRKFEKELYAFLDNERPDVLQEIKEKKALDDELKQKIKEALDAFKERFV 502
>gi|27468620|ref|NP_765257.1| F0F1 ATP synthase subunit alpha [Staphylococcus epidermidis ATCC 12228] >gi|57867651|ref|YP_189276.1| F0F1 ATP synthase subunit alpha [Staphylococcus epidermidis RP62A] >gi|38604811|sp|Q8CNJ5|ATPA_STAES ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|81170377|sp|Q5HMB7|ATPA_STAEQ ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|27316167|gb|AAO05301.1|AE016749_247 ATP synthase alpha chain [Staphylococcus epidermidis ATCC 12228] >gi|57638309|gb|AAW55097.1| ATP synthase F1, alpha subunit [Staphylococcus epidermidis RP62A] (503 aa)
Score = 1349, Expect = 7.4e-147, Identities = 264/501 (52%), Positives = 372/501 (74%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKT-ILETIDQTKDISQDLFVQIKNEFNSLITSYIK 501
           M+I  ++ S ++++QI+ Y+++   +++G V+ +GDGI    GL++VM  ELV F NG  G+  NLE +  G+V+LG +E+I EG  VKRT  +++VPVG+ ++GRV++ +G PIDG G I   K  P+EK A GVM R SV EPL+TG  AID++ PIG+GQRELIIGD+QTGKTT+AID+I+NQK ++  CIYV IGQK+ST+   +  L+Q GAL+YT +V++SA+D   L Y+AP++G+T+ EE+M  G+ VLI+YDDL+K A AYR LSLLLRRPPGREAYPGD+FYLHSRLLER+ K+N + GGGSITALPIIET+AGDISAY+PTNVISITDGQ+F+ ++LF SG RPAI+AG SVSRVG SAQI A+KK +G+L+L+LA YREL++F+QFGSDLD+ T + L  G++ ++++KQ +N P     + +++F++ + Y+  IPV  I  F+E+     +   T +L  I +T  +         ++F+S IT + K
  S:     1 MAIKAEEISALLRSQIENYESEMSVTDVGTVLQIGDGIALIHGLNDVMAGELVEFHNGVLGLAQNLEESNVGVVILGPYEEISEGDEVKRTGRIMEVPVGEEMIGRVVNPLGQPIDGQGPINATKTRPVEKKATGVMDRKSVDEPLQTGIKAIDALVPIGRGQRELIIGDRQTGKTTVAIDSILNQKDQDTICIYVAIGQKDSTVRANVEKLRQAGALDYTIVVSASAADPAPLLYIAPYSGVTMGEEFMFNGKHVLIVYDDLTKQAAAYRELSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNDDLGGGSITALPIIETQAGDISAYVPTNVISITDGQIFLQSDLFFSGVRPAINAGQSVSRVGGSAQIKAMKKVAGTLRLDLASYRELESFAQFGSDLDEFTAKKLARGERTVEVLKQGQNNPLPVEHQVLIIFALTKGYLDDIPVQDINRFEEEFNHWAESNATELLNEIRETGALPD------ADKFDSAITEFKK 496
>gi|115522310|ref|YP_779221.1| F0F1 ATP synthase subunit alpha [Rhodopseudomonas palustris BisA53] >gi|122297997|sp|Q07UZ3|ATPA_RHOP5 ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|115516257|gb|ABJ04241.1| ATP synthase F1, alpha subunit [Rhodopseudomonas palustris BisA53] (510 aa)
Score = 1349, Expect = 7.4e-147, Identities = 263/502 (52%), Positives = 365/502 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQK---------GKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKT-ILETIDQTKDISQDLFVQIKNEFNSLITSYIKT 502
           M I   + S I+K+QIK +  +A  +E+G+V++VGDGI +  GL NV   E+V FENG+ GM LNLE    GIV+ G   +IKEG  VKRT+++VD PVG GLLGRV+DA+GNPIDG G I   ++  ++  APG++ R SV EP+ TG  +ID++ PIG+GQRELIIGD+QTGKT IA+D I+NQK         G+ + C+YV IGQK ST+ QF+  L++ GALEY+ +VA++ASD   + Y+APFTG T+ E +   G   +IIYDDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+N + G GS+TALP+IET+A D+SAYIPTNVISITDGQ+F+ T+LF  G RPA++ GLSVSRVGSSAQ  A+KK +G +K ELAQYRE+ AF+QFGSDLD  T+ +L  G ++ +L+KQ + +P     + +++++    Y+  +PV  +  F++ ++   + +   IL  I  ++D+S D   ++K    +++ +Y KT
  S:     1 MDIRAAEISAILKDQIKNFGQEAEVTEVGQVLSVGDGIARVYGLDNVQAGEMVEFENGTRGMALNLETDNVGIVIFGADREIKEGQTVKRTRSIVDTPVGKGLLGRVVDALGNPIDGKGPIVATERKRVDVKAPGIIPRKSVHEPMATGLKSIDALIPIGRGQRELIIGDRQTGKTAIALDTILNQKPLNVEGAPEGQKLYCVYVAIGQKRSTVAQFVKVLEEQGALEYSIVVAATASDPAPMQYIAPFTGCTMGEYFRDNGMHAVIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNDDEGNGSLTALPVIETQANDVSAYIPTNVISITDGQIFLETDLFFQGIRPAVNVGLSVSRVGSSAQTKAMKKVAGKIKGELAQYREMAAFAQFGSDLDASTQRLLNRGSRLTELLKQPQFSPLKMEEQVVVIYAGVNGYLDPLPVAKVRAFEDGLLSLLRGKNVEILNAIRDSRDLSDDTAGKLK----AVVEAYAKT 508
>gi|15644360|ref|NP_229412.1| F0F1 ATP synthase subunit alpha [Thermotoga maritima MSB8] >gi|148270309|ref|YP_001244769.1| F0F1 ATP synthase subunit alpha [Thermotoga petrophila RKU-1] >gi|170289064|ref|YP_001739302.1| ATP synthase F1, alpha subunit [Thermotoga sp. RQ2] >gi|166201685|sp|A5ILX0|ATPA_THEP1 ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|81625467|sp|Q9X1U7|ATPA_THEMA ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|4982184|gb|AAD36679.1|AE001805_4 ATP synthase F1, subunit alpha [Thermotoga maritima MSB8] >gi|147735853|gb|ABQ47193.1| ATP synthase F1, alpha subunit [Thermotoga petrophila RKU-1] >gi|170176567|gb|ACB09619.1| ATP synthase F1, alpha subunit [Thermotoga sp. RQ2] (503 aa)
Score = 1349, Expect = 7.7e-147, Identities = 260/499 (52%), Positives = 365/499 (73%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLF-ENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHF-KQQKTILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           M IN  + + +++ +IK ++ K    + G+VI VGDGI +A GL+ VM++ELV F E G  G+  NLE    GI++LG+++DIKEG  V+R K +++VPVG+ LLGRV++ +G P+DG G I      PIE  APGV+ R  V  PL+TG  AIDSM PIG+GQRELIIGD+QTGKT IAID IINQKG+ V CIYV IGQK S I + I+ L+Q+GA+EYTT+V +SASD  SL Y+AP+ G  + E +   G D L++YDDLSKHA+AYR LSLL+RRPPGREAYPGDIFYLHSRLLER+ ++N + GGGS+TALPI+ET+A DISAYIPTNVISITDGQ+++   LF +GQRPAI+ GLSVSRVG SAQI A+K+ +G L+++LAQYREL+ F+QF ++LD  T+  +  G+++M+L+KQ++ +P     + ++LF+    Y+  +PV+ +  F+++ +R   ++ + IL+ I   K+++ +   ++K       T++
  S:     1 MRINPGEITKVLEEKIKSFEEKIDLEDTGKVIQVGDGIARAYGLNKVMVSELVEFVETGVKGVAFNLEEDNVGIIILGEYKDIKEGHTVRRLKRIIEVPVGEELLGRVVNPLGEPLDGKGPINAKNFRPIEIKAPGVIYRKPVDTPLQTGIKAIDSMIPIGRGQRELIIGDRQTGKTAIAIDTIINQKGQGVYCIYVAIGQKKSAIARIIDKLRQYGAMEYTTVVVASASDPASLQYIAPYAGCAMGEYFAYSGRDALVVYDDLSKHAVAYRQLSLLMRRPPGREAYPGDIFYLHSRLLERAVRLNDKLGGGSLTALPIVETQANDISAYIPTNVISITDGQIYLEPGLFYAGQRPAINVGLSVSRVGGSAQIKAMKQVAGMLRIDLAQYRELETFAQFATELDPATRAQIIRGQRLMELLKQEQYSPMPVEEQVVVLFAGVRGYLDDLPVEEVRRFEKEFLRFMHEKHQDILDDIKTKKELTSETEEKLKKAIEEFKTTF 501
>gi|153952146|ref|YP_001397359.1| F0F1 ATP synthase subunit alpha [Campylobacter jejuni subsp. doylei 269.97] >gi|166201658|sp|A7H1H9|ATPA_CAMJD ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|152939592|gb|ABS44333.1| ATP synthase F1, alpha subunit [Campylobacter jejuni subsp. doylei 269.97] (501 aa)
Score = 1349, Expect = 8.3e-147, Identities = 262/500 (52%), Positives = 364/500 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK-QQKTILETIDQTKDISQDLFVQIKNEFNSLITSYI 500
           M    D+ S+IIK +I+ +       E G++I+V DG+ +  GL N+M  E+V FENG  GM LNLE ++ GIV+LGK E +KEG+ VKR K ++ VPVG+ L+GRV++A+G PID  G +  ++   +E+ A G+MAR SV EPL TG  AID++ PIG+GQRELIIGD+QTGKTT+A+D II+Q+G+ V CIYV IGQK ST+ Q +  L++ GA+EYT +V + ASD  +L YLAP+ G+T+ E +    +  LI+YDDLSKHA+AYR +SL+LRRPPGREAYPGD+FYLHSRLLER+ K+N E G GS+TALPIIET+AGD+SAYIPTNVISITDGQ+F+ T+LFNSG RPAI+ GLSVSRVG +AQI A K+ SG+L+L+LAQYREL AF+QF SDLD+ +++ LE G+++++L+KQ   +P S   + +L+F+  + ++  I V  I++F++ I    + +   I E I   K +  DL  ++    N    +++
  S:     1 MKFKADEISSIIKERIENFDLNLEIEETGKIISVADGVAKVYGLKNIMAGEMVEFENGDKGMALNLEESSVGIVILGKGEGLKEGASVKRLKKLLKVPVGEALIGRVVNALGEPIDAKGVVNANEYRFVEEKAKGIMARKSVHEPLHTGIKAIDALVPIGRGQRELIIGDRQTGKTTVAVDTIISQRGQGVICIYVAIGQKQSTVAQVVKRLEEHGAMEYTIVVNAGASDPAALQYLAPYAGVTMGEFFRDNAKHALIVYDDLSKHAVAYREMSLILRRPPGREAYPGDVFYLHSRLLERASKLNDELGAGSLTALPIIETQAGDVSAYIPTNVISITDGQIFLETDLFNSGIRPAINVGLSVSRVGGAAQIKATKQVSGTLRLDLAQYRELQAFTQFASDLDEASRKQLERGQRMVELLKQPPYSPLSVEKQVVLIFAGTKGFLDDIAVSRIKEFEDGIYPFIEAKHPDIFEQIRSKKALDSDLEEKLAKAINEFKANHL 501
>gi|163761387|ref|ZP_02168461.1| F0F1 ATP synthase subunit alpha [Hoeflea phototrophica DFL-43] >gi|162281382|gb|EDQ31679.1| F0F1 ATP synthase subunit alpha [Hoeflea phototrophica DFL-43] (509 aa)
Score = 1349, Expect = 8.5e-147, Identities = 262/499 (52%), Positives = 359/499 (71%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQK--------GKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKT-ILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           M I   + S I+K+QIK +  +A  SE+G+V++VGDGI +  GL NV   E+V F  G  GM LNLEA   G+V+ G   DIKEG IVKRT  +VDVPVG  LLGRV+DA+GNPIDG G IK  K+  ++  APG+M R SV EP+ TG  AID++ P+G+GQREL+IGD+QTGKT I +D  +NQK        G+ + C+YV +GQK ST+ QF+  L+  GALEY+ ++A++ASD   L +LAPF G  + E +   G+  LI YDDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+N++NG GS+TALP+IET+A D+SAYIPTNVISITDGQ+F+ T LF  G RPA++ GLSVSRVGSSAQI A+K+ +GS+K ELAQYRE+ AF+QFGSDLD  T+ +L  G ++ +L+KQ + +P     +  ++F+    Y+  + V  +  F++ ++ H + + + +LE I   K IS D+  ++K+  ++   ++
  S:     1 MDIRAAEISAILKDQIKNFGKEAEVSEVGQVLSVGDGIARVYGLDNVQAGEMVEFPGGIRGMALNLEADNVGVVIFGSDRDIKEGDIVKRTGAIVDVPVGPELLGRVVDALGNPIDGKGPIKAKKRARVDVKAPGIMPRKSVHEPMSTGLKAIDALIPVGRGQRELVIGDRQTGKTAIILDTFLNQKSIHENGPEGEKLYCVYVAVGQKRSTVAQFVKVLEDRGALEYSIVIAATASDSAPLQFLAPFAGCAMGEYFRDNGKHALIAYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNEDNGSGSLTALPVIETQANDVSAYIPTNVISITDGQIFLETELFFQGIRPAVNVGLSVSRVGSSAQIKAMKQVAGSIKGELAQYREMAAFAQFGSDLDAATQRLLNRGARLTELLKQAQFSPLKTEEQVAVIFAGVNGYLDKLAVSDVGRFEQGLLGHMRSEGSDVLEAIRTEKAISDDVKSKLKDTIDTFAKTF 508
>gi|125717634|ref|YP_001034767.1| proton-translocating ATPase, F1 sector, alpha subunit, putative [Streptococcus sanguinis SK36] >gi|125497551|gb|ABN44217.1| Proton-translocating ATPase, F1 sector, alpha subunit, putative [Streptococcus sanguinis SK36] (454 aa)
Score = 1349, Expect = 8.7e-147, Identities = 255/436 (58%), Positives = 340/436 (77%)
  Q:    48 MLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK-QQKTILETIDQTKDISQD 483
           M  EL++FENGSYGM  NLE+T  GI++LG F DI+EG  ++RT  +++VPVG+ L+GRV+D +G P+DG G+I  DK  P+E  APGVM R SV EPL+TG  AID++ PIG+GQRELIIGD+QTGKTTIAIDAI+NQKG+++ CIYV IGQK ST+   + TL+Q+GAL+YT +V +SAS    L +LAP+ G+ +AEE+M  G+ VLI+YDDLSK A+AYR LSLLLRRPPGREA+PGD+FYLHSRLLERS K++ E GGGSITALP IET+AGDISAYI TNVISITDGQ+F+  +LFN+G RPAIDAG SVSRVG SAQI A+KK +G+L+++LA YREL+AF++FGSDLD  T+  L  G++ ++++KQ  + P     + ++L+++   ++  +PVD I  F+ ++  +F   Q++I ETI  TKD+  +
  S:     1 MSGELLIFENGSYGMAQNLESTDVGIIILGDFTDIREGDTIRRTGKIMEVPVGEALIGRVVDPLGRPVDGLGDIVTDKTRPVETPAPGVMQRKSVSEPLQTGLKAIDALVPIGRGQRELIIGDRQTGKTTIAIDAILNQKGQDMICIYVAIGQKESTVRTQVETLRQYGALDYTIVVTASASQPSPLLFLAPYAGVAMAEEFMYNGKHVLIVYDDLSKQAVAYRELSLLLRRPPGREAFPGDVFYLHSRLLERSAKVSDELGGGSITALPFIETQAGDISAYIATNVISITDGQIFLSDSLFNAGVRPAIDAGSSVSRVGGSAQIKAMKKVAGTLRIDLASYRELEAFTKFGSDLDAATQAKLNRGRRTVEVLKQPIHEPLPVEKQVVILYALTHGFLDSVPVDDILRFESELFAYFDAHQESIYETIRTTKDLPSE 437
>gi|70725931|ref|YP_252845.1| F0F1 ATP synthase subunit alpha [Staphylococcus haemolyticus JCSC1435] >gi|124007216|sp|Q4L7Y6|ATPA_STAHJ ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|68446655|dbj|BAE04239.1| ATP synthase alpha chain [Staphylococcus haemolyticus JCSC1435] (502 aa)
Score = 1349, Expect = 8.9e-147, Identities = 265/492 (53%), Positives = 369/492 (75%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKT-ILETIDQTKDI-SQDLFVQIKNEF 492
           M+I  ++ S ++++QI+ Y+++   +++G V+ +GDGI    GL++ M  ELV F NG  G+  NLE +  G+V+LG + +I EG  V+RT  +++VPVG+ L+GRV++ +G PIDG G I   K  P+E+ A GVMAR SV EPL+TG  AID++ PIG+GQRELIIGD+QTGKTTI ID I+NQKG +  CIYV IGQK+ST+   +  L+Q GAL+YT +V++SAS+   L Y+AP++G+T+ EE+M  G+ VLI+YDDL+K A AYR LSLLLRRPPGREAYPGD+FYLHSRLLER+ K+N + GGGSITALPIIET+AGDISAY+PTNVISITDGQ+F+ ++LF SG RPAI+AG SVSRVG SAQI A+KK +G+L+L+LA YREL++F+QFGSDLD+ T   LE GK+ ++++KQD+N P     + ++++++ + Y+  IPV+ I  F++++    K   + +L  I +T  + S D F    NEF
  S:     1 MAIKAEEISALLRSQIENYESEMSVTDVGTVLQIGDGIALIHGLNDCMAGELVEFSNGVLGLAQNLEESNVGVVILGPYTEITEGDEVRRTGRIMEVPVGEELIGRVVNPLGQPIDGQGPINTTKTRPVEQKATGVMARKSVDEPLQTGIKAIDALVPIGRGQRELIIGDRQTGKTTIGIDTILNQKGLDTICIYVAIGQKDSTVRANVEKLRQAGALDYTIVVSASASEPSPLLYIAPYSGVTMGEEFMFNGKHVLIVYDDLTKQAAAYRELSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNDDLGGGSITALPIIETQAGDISAYVPTNVISITDGQIFLQSDLFFSGVRPAINAGQSVSRVGGSAQIKAMKKVAGTLRLDLASYRELESFAQFGSDLDEFTARKLERGKRTVEVLKQDQNKPLPVENQVLIIYALTKGYLDDIPVEDITRFEDELNSWTKSNGSDLLNEIRETGGLPSDDKFEATINEF 494
>gi|85709190|ref|ZP_01040256.1| ATP synthase subunit A [Erythrobacter sp. NAP1] >gi|85690724|gb|EAQ30727.1| ATP synthase subunit A [Erythrobacter sp. NAP1] (509 aa)
Score = 1348, Expect = 1.1e-146, Identities = 261/483 (54%), Positives = 352/483 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKG--------KNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKT-ILETIDQTKDISQD 483
           M I   + S +IK+QI  +  +A  SE+G V++VGDGI +  GL  V   E+V F NG  GM LNLEA   G+V+ G   +IKEG  VKRT+ +VDVPVG  LLGRV+DA+GNPIDG G I+  ++  +E  APG++ R SV EP+++G  AID++ P+G+GQRELIIGD+QTGKT +AID  INQKG        K + C+YV +GQK ST+ Q +  L++ GA+EY+ +VA++AS+   L YLAP+TG  + E +   G   +I+YDDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+NK  GGGS+TALPIIET+AGD+SAYIPTNVISITDGQ+F+ T+LF  G RPAI+ GLSVSRVG +AQ  A+KK SGS+KL+LAQYRE+ AF+QFGSDLD  T+++L  G ++ +L+KQ +  P     + + +F+    +I  I VD + +++E+++  F+ +   +LETI  T     D
  S:     1 MEIRAAEISKVIKDQIANFGTEAQVSEVGTVLSVGDGIARIHGLDKVQAGEMVEFANGVQGMALNLEADNVGVVIFGSDAEIKEGDTVKRTETIVDVPVGKALLGRVVDALGNPIDGKGPIETTERSRVEVKAPGIIPRESVSEPVQSGLKAIDALVPVGRGQRELIIGDRQTGKTAVAIDTFINQKGVNASDDEGKKLYCVYVAVGQKRSTVAQIVKQLEENGAMEYSIVVAATASEPAPLQYLAPYTGCAMGEFFRDNGMHAVIVYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNKAEGGGSLTALPIIETQAGDVSAYIPTNVISITDGQIFLETDLFYQGIRPAINVGLSVSRVGGAAQTKAMKKVSGSMKLDLAQYREMAAFAQFGSDLDAATQKLLNRGARLTELLKQKQFNPMPFEEQTVSIFAGTNGFIDSIAVDRVNEYEEQMLAFFRSEHADVLETIRTTGKFEDD 492
>gi|57652127|ref|YP_186912.1| F0F1 ATP synthase subunit alpha [Staphylococcus aureus subsp. aureus COL] >gi|151222221|ref|YP_001333043.1| F0F1 ATP synthase subunit alpha [Staphylococcus aureus subsp. aureus str. Newman] >gi|172048987|sp|A6QIU9|ATPA_STAAE ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|81170376|sp|Q5HE95|ATPA_STAAC ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|57286313|gb|AAW38407.1| ATP synthase F1, alpha subunit [Staphylococcus aureus subsp. aureus COL] >gi|150375021|dbj|BAF68281.1| ATP synthase F1, alpha subunit [Staphylococcus aureus subsp. aureus str. Newman] (502 aa)
Score = 1347, Expect = 1.2e-146, Identities = 259/460 (56%), Positives = 354/460 (76%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKI 460
           M+I  ++ S ++++QI+ Y+++   +++G V+ +GDGI    GL++VM  ELV F NG  G+  NLE +  G+V+LG +  I EG  VKRT  +++VPVG+ L+GRV++ +G PIDG G I   K  P+EK A GVM R SV EPL+TG  AID++ PIG+GQRELIIGD+QTGKTTIAID I+NQK +   CIYV IGQK+ST+   +  L+Q GAL+YT +VA+SAS+   L Y+AP++G+T+ EE+M  G+ VLI+YDDL+K A AYR LSLLLRRPPGREAYPGD+FYLHSRLLER+ K+N + GGGSITALPIIET+AGDISAY+PTNVISITDGQ+F+ ++LF SG RPAI+AG SVSRVG SAQINA+KK +G+L+L+LA YREL++F+QFGSDLD+ T   LE GK+ ++++KQD+N P     + ++++++ + Y+  IPV  I  F++++
  S:     1 MAIKAEEISALLRSQIENYESEMSVTDVGTVLQIGDGIALIHGLNDVMAGELVEFHNGVLGLAQNLEESNVGVVILGPYTGITEGDEVKRTGRIMEVPVGEELIGRVVNPLGQPIDGQGPINTTKTRPVEKKATGVMDRKSVDEPLQTGIKAIDALVPIGRGQRELIIGDRQTGKTTIAIDTILNQKDQGTICIYVAIGQKDSTVRANVEKLRQAGALDYTIVVAASASEPSPLLYIAPYSGVTMGEEFMFNGKHVLIVYDDLTKQAAAYRELSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNDDLGGGSITALPIIETQAGDISAYVPTNVISITDGQIFLQSDLFFSGVRPAINAGQSVSRVGGSAQINAMKKVAGTLRLDLASYRELESFAQFGSDLDEFTASKLERGKRTVEVLKQDQNKPLPVEHQVLIIYALTKGYLDDIPVVDITRFEDEL 460
>gi|114531|sp|P09219|ATPA_BACP3 ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|77452|pir||S01401 H+-transporting two-sector ATPase (EC 3.6.3.14) alpha chain - thermophilic bacterium PS-3 >gi|2981976|pdb|1SKY|B Chain B, Crystal Structure Of The Nucleotide Free Alpha3beta3 Sub- Complex Of F1-Atpase From The Thermophilic Bacillus Ps3 >gi|45814|emb|CAA30652.1| unnamed protein product [Bacillus sp. PS3] (502 aa)
Score = 1347, Expect = 1.3e-146, Identities = 265/502 (52%), Positives = 362/502 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQ-KTILETIDQTKDISQDLFVQIKNEFNSLITSYIKT 502
           MSI  ++ S +IK QI+ Y+++   S++G VI VGDGI +A GL NVM  E V F N   GM LNLE    GIV+LG +  IKEG  V+RT  +++VPVG+ L+GRV++ +G P+DG G ++  +  PIE  APGVM R SV EPL+TG  AID++ PIG+GQRELIIGD+QTGKT++AID IINQK +N+ CIYV IGQK ST+   + TL + GA +YT +V +SAS    L +LAP+ G+ + E +M  G+ VL++ DDLSK A AYR LSLLLRRPPGREAYPGDIFYLHSRLLER+ K++   GGGS+TALP +ET+AGDISAYIPTNVISITDGQ+F+ ++LF SG RPAI+AGLSVSRVG +AQI A+KK +G+L+L+LA YREL+AF+QFGSDLDK T+  +  G + ++++KQD + P     + ++++++   ++  IPV+ +  F+++      Q  + +LE I  TKD+  +      ++ N  I ++ KT
  S:     1 MSIRAEEISALIKQQIENYESQIQVSDVGTVIQVGDGIARAHGLDNVMSGEAVEFANAVMGMALNLEENNVGIVILGPYTGIKEGDEVRRTGRIMEVPVGETLIGRVVNPLGQPVDGLGPVETTETRPIESRAPGVMDRRSVHEPLQTGIKAIDALVPIGRGQRELIIGDRQTGKTSVAIDTIINQKDQNMICIYVAIGQKESTVATVVETLAKHGAPDYTIVVTASASQPAPLLFLAPYAGVAMGEYFMIMGKHVLVVIDDLSKQAAAYRQLSLLLRRPPGREAYPGDIFYLHSRLLERAAKLSDAKGGGSLTALPFVETQAGDISAYIPTNVISITDGQIFLQSDLFFSGVRPAINAGLSVSRVGGAAQIKAMKKVAGTLRLDLAAYRELEAFAQFGSDLDKATQANVARGARTVEVLKQDLHQPIPVEKQVLIIYALTRGFLDDIPVEDVRRFEKEFYLWLDQNGQHLLEHIRTTKDLPNE------DDLNQAIEAFKKT 497
>gi|116619602|ref|YP_821758.1| F0F1 ATP synthase subunit alpha [Solibacter usitatus Ellin6076] >gi|122255869|sp|Q02BU3|ATPA_SOLUE ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|116222764|gb|ABJ81473.1| ATP synthase F1, alpha subunit [Solibacter usitatus Ellin6076] (512 aa)
Score = 1347, Expect = 1.4e-146, Identities = 257/487 (52%), Positives = 351/487 (72%)
  Q:     3 INLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQ-QKTILETIDQTKDISQDLFVQIK 489
           I  D+ ++I++ +I+ Y+     SE+G VI+VGDGI +  GL  VM  EL+ F +   G+ +NLE    G V+LG +  IKEG  VKRTK ++ VPVG+ L+GRV++A+G PIDG G I   +  PIE++APGV+AR  V EP+ TG  A+D+M PIG+GQRELIIGD+QTGKT IA+DAIINQKG ++ CIYV IGQK ST+ Q + TL+  GA+EY+ +V +SASD   + YLAPF+G  I E +       L IYDDLSKHA AYR +SLLLRRPPGREA+PGD+FYLHSRLLER+ K+N E+G GS+TALP IET+AGD+SAYIPTNVISITDGQ+F+  +LFNS QRPAI+ G+SVSRVG +AQ  A+K  +G L+L+LAQYREL AF+QFGSDLDK ++  L  G+ +++++KQD+  P     + +++++  + Y+  IPV+    F+ ++ R  +   + +L+ I   K +  DL  ++K
  S:     4 IRADEITSILRQEIENYERAIDVSEVGSVISVGDGIARIHGLEKVMAGELIEFPHDVAGIAMNLEEDQVGAVLLGDYTLIKEGDEVKRTKRIMSVPVGEALIGRVVNALGQPIDGKGPINATQFNPIERLAPGVVARQPVKEPMMTGIKAVDAMIPIGRGQRELIIGDRQTGKTAIALDAIINQKGGDMICIYVAIGQKRSTVAQVVKTLEDNGAMEYSIVVVASASDPAPMQYLAPFSGCAIGEYFRDSKRHALCIYDDLSKHAAAYREISLLLRRPPGREAFPGDVFYLHSRLLERAAKLNNEHGAGSLTALPFIETQAGDVSAYIPTNVISITDGQIFLEADLFNSNQRPAINVGISVSRVGGNAQTKAMKSIAGGLRLDLAQYRELAAFAQFGSDLDKSSQAQLNRGRHLVEILKQDQYQPLPLEKQIMIIWAGTKGYLDDIPVELCRKFEAELYRFSENAHRPVLDEIKTKKALDPDLTAKVK 491
>gi|154149226|ref|YP_001406266.1| F0F1 ATP synthase subunit alpha [Campylobacter hominis ATCC BAA-381] >gi|166201657|sp|A7I175|ATPA_CAMHC ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|153805235|gb|ABS52242.1| ATP synthase F1, alpha subunit [Campylobacter hominis ATCC BAA-381] (505 aa)
Score = 1346, Expect = 2.0e-146, Identities = 261/497 (52%), Positives = 360/497 (72%)
  Q:     3 INLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQ-KTILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           I +D+ S+IIK +I+ ++      E G+V+NV DG+    GL NVM NE+V FENG  G+ LNLE  + G+V+LG    I EG+ VKR   ++ VPVGD L+GRV++A+G PID  G I+Y +   +E+ A G+MAR SV EPL+TG  AID++ PIG+GQRELIIGD+QTGKTT+A+D IINQKG++V CIYV IGQK ST+ Q +  L+++GA++YT +V++ AS+  +L YLAP+ G T+ E +       LIIYDDLSKHA+AYR +SL+LRRPPGREAYPGD+FYLHSRLLER+ K++ E G GS+TALPIIET+AGD+SAYIPTNVISITDGQ+F+ + LFNSG RPAI+ GLSVSRVG SAQI A+KK SG+L+L+LAQYREL AF+QF SDLD+ +++ L+ G+++++++KQ   +P     + +++F+    ++  IPV  I  F+ ++    + +   I E I   K I +DL   +    N    ++
  S:     5 IKVDEISSIIKERIENFELNINIEETGKVVNVADGVASVYGLKNVMANEMVEFENGVKGLALNLEENSVGVVILGSISGIVEGTSVKRLGKLLRVPVGDALIGRVVNALGEPIDAKGPIEYSETRFVEEKAKGIMARKSVHEPLQTGLKAIDALVPIGRGQRELIIGDRQTGKTTVAVDTIINQKGQDVICIYVAIGQKQSTVAQVVKKLEEYGAMDYTIVVSAGASEPAALQYLAPYAGCTMGEYFRDNSRHALIIYDDLSKHAVAYREMSLILRRPPGREAYPGDVFYLHSRLLERASKLSDELGAGSLTALPIIETQAGDVSAYIPTNVISITDGQIFLESGLFNSGIRPAINVGLSVSRVGGSAQIKAIKKVSGTLRLDLAQYRELQAFAQFASDLDESSRKQLDRGQRMVEILKQPPYSPLPVENQIVIIFAGSRGFLDDIPVSAIGKFENELYSFIEAKYPNIFEDIRTKKTIEKDLEENLAKALNDFKMTF 502
>gi|153007334|ref|YP_001381659.1| F0F1 ATP synthase subunit alpha [Anaeromyxobacter sp. Fw109-5] >gi|166201650|sp|A7HIX9|ATPA_ANADF ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|152030907|gb|ABS28675.1| ATP synthase F1, alpha subunit [Anaeromyxobacter sp. Fw109-5] (512 aa)
Score = 1346, Expect = 2.1e-146, Identities = 259/472 (54%), Positives = 349/472 (73%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEK------YIRWIPVDYIEDFKEKII-----RHFKQQKTILE 472
           M I  D+ S II+ QIK+Y  K   +E G V++  DG+ +  GL+     EL+ F +G+ G+ LNLE    G  ++G FE I+EG  VKRT  + +V VG+ LLGRV+D +G+PIDG G +       IE  APG++ R SV EP++TG  AID++ PIG+GQRELI+GD+QTGKT +AID I+N KG N+ C YV +GQK ST+ + +  LKQ GA+EYTT++A++ASD   + YLAP+TG+T+AE +   G   LIIYDDLSK A+AYR LSLLLRRPPGREAYPGD+FYLHSRLLER+ K++++ GGGS+TALPIIET+AGD+SAYIPTNVISITDGQ+F+ +NLF  G RPAI+ G+SVSRVG SAQI A+K+ +GSLKLELAQYREL AF+QFGSDLDK T+E L  G+++++L+KQ + +P     + I +++  +K      +IR +PV+ +  +  +++     RH    KTI E
  S:     1 MEIRADEISRIIREQIKDYGKKVDVAETGTVLSQADGVARIYGLAGAAAGELLEFPHGTRGLVLNLEEDNVGAAIMGAFEHIREGDPVKRTGKIAEVAVGEELLGRVVDGLGSPIDGRGPVNAKHTRKIEIKAPGIVQRKSVHEPMQTGLKAIDALVPIGRGQRELILGDRQTGKTAVAIDTILNNKGNNLYCFYVAVGQKQSTVARVVEILKQHGAMEYTTVIAANASDPAPMQYLAPYTGVTMAEYFRDTGRHALIIYDDLSKQAVAYRQLSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSEKEGGGSLTALPIIETQAGDVSAYIPTNVISITDGQIFLESNLFYQGVRPAINVGISVSRVGGSAQIKAMKQVAGSLKLELAQYRELAAFAQFGSDLDKATQETLARGERLVELLKQGQYSPMPVEKQVIQIYAATQKDENGQGWIRQVPVEEVGRYMRELVEFLDARHPGVAKTIAE 483
>gi|85713716|ref|ZP_01044706.1| ATP synthase subunit A [Nitrobacter sp. Nb-311A] >gi|85699620|gb|EAQ37487.1| ATP synthase subunit A [Nitrobacter sp. Nb-311A] (510 aa)
Score = 1345, Expect = 2.2e-146, Identities = 263/502 (52%), Positives = 360/502 (71%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVK---------CIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK-QQKTILETIDQTKDISQDLFVQIKNEFNSLITSYIKT 502
           M I   + S I+K+QIK +  +A  SE+G+V++VGDGI +  GL N+   E+V FENG+ GM LNLE    GIV+ G   +IKEG  VKRT+ +VD PVG GLLGRV+DA+GNPIDG G I+  ++  ++  APG++ R SV EP+ TG  AID++ PIG+GQRELIIGD+QTGKT IA+D I+NQK  N           C+YV +GQK ST+ QF+  L++ GALEY+ +VA++ASD   + YLAPFTG T+ E +       +IIYDDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+N   G GS+TALP+IET+A D+SAYIPTNVISITDGQ+F+ T+LF  G RPA++ GLSVSRVGSSAQ  A+KK +G +K ELAQYRE+ AF+QFGSDLD  T+ +L  G ++ +L+KQ + +P     + +++++    Y+  +P+  +  F++ ++   + +   IL TI  T+D+S +   ++K     ++  Y KT
  S:     1 MDIRAAEISAILKDQIKNFGKEAEVSEVGQVLSVGDGIARVYGLDNIQAGEMVEFENGTRGMALNLETDNVGIVIFGADREIKEGQTVKRTRAIVDTPVGKGLLGRVVDALGNPIDGKGPIQGAERKRVDVKAPGIIPRKSVHEPMATGLKAIDALIPIGRGQRELIIGDRQTGKTAIALDTILNQKPLNAAGAPESQKLYCVYVAVGQKRSTVAQFVKVLEEQGALEYSIVVAATASDPAPMQYLAPFTGCTMGEYFRDNAMHAVIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNDSQGNGSLTALPVIETQANDVSAYIPTNVISITDGQIFLETDLFFQGIRPAVNVGLSVSRVGSSAQTKAMKKVAGKIKGELAQYREMAAFAQFGSDLDASTQRLLNRGSRLTELLKQPQFSPLKMEEQVVVIWAGTNGYLDPLPLGKVRAFEDGLLALLRGKHADILNTIRDTRDLSDETAGKLK----GIVEGYAKT 508
>gi|22297978|ref|NP_681225.1| F0F1 ATP synthase subunit alpha [Thermosynechococcus elongatus BP-1] >gi|81743749|sp|Q8DLP3|ATPA_SYNEL ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|22294156|dbj|BAC07987.1| H+-transporting ATP synthase alpha chain [Thermosynechococcus elongatus BP-1] (503 aa)
Score = 1344, Expect = 2.9e-146, Identities = 257/498 (51%), Positives = 362/498 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQK----TILETIDQTKDISQDLFVQIKNEFNSLITS 498
           +SI  D+ S+II+ QI++Y+       +G V+ VGDGI +  GL  VM +ELV FE+G+ G+ LNLE    G+V++G    I+EGS V+ T  +  +PVG+  +GRV+DA+  PIDG GEI   +   IE  APG++ R SVCEPL+TG  AID+M PIG+GQRELIIGD+QTGKT +AID I+NQKG++V C+YV IGQK S++ Q +N L++ GAL+YT ++A++ASD  +L YLAP+TG T+AE +M +G+  L++YDDLSK A AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+N   GGGS+TALP++ET+AGD+SAYIPTNVISITDGQ+F+ ++LFN+G RPAI+AG+SVSRVGS+AQI A+K+ +G LKLELAQ+ EL AF+QF SDLDK T+  L  G+++ +++KQ + +P     +   +++    Y+  IPV+ +  F   +  + +  K     I+ T  +  + ++ L  +   E+ +  T+
  S:     2 VSIRPDEISSIIRQQIEQYEQSIKVDNVGTVLQVGDGIARVYGLDKVMASELVEFEDGTVGIALNLEEDNVGVVLMGDGLSIEEGSTVRATGKIASIPVGEAAIGRVVDALMRPIDGKGEIHTTQSRLIESPAPGIVQRKSVCEPLQTGITAIDAMIPIGRGQRELIIGDRQTGKTAVAIDTILNQKGQDVICVYVAIGQKASSVAQVVNVLRERGALDYTIVIAANASDPAALQYLAPYTGATVAEYFMYQGKHTLVVYDDLSKQAQAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNDALGGGSMTALPVVETQAGDVSAYIPTNVISITDGQIFLSSDLFNAGLRPAINAGISVSRVGSAAQIKAMKQVAGKLKLELAQFDELQAFAQFASDLDKATQNQLARGQRLREILKQPQYSPIPVEYQVATIYAGTNGYLDDIPVEAVAKFVAGLRDYLRTNKPEYGEIIRTTQKLDEKAEALLKEAIAEYKATFTA 503
>gi|196240814|ref|ZP_03139580.1| ATP synthase F1, alpha subunit [Cyanothece sp. PCC 7425] >gi|196214893|gb|EDY09546.1| ATP synthase F1, alpha subunit [Cyanothece sp. PCC 7425] (505 aa)
Score = 1344, Expect = 3.0e-146, Identities = 255/456 (55%), Positives = 344/456 (75%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDF 456
           +SI  D+ S+II+ QI++Y  +     +G V+ VGDGI +  GL  VM +EL+ FE+G+ G+ LNLE    G+V++G+  D++EGS V+ T  V  VPVG+G +GRV+DA+  PIDG GEI   +   +E  APG++ R SV EP++TG  AID+M PIG+GQRELIIGD+QTGKT +AID I+NQKG  V C+YV IGQK ST+ Q +N L++ GALEYT +VA++ASD  +L YLAP+TG T+AE +M KG+  L++YDDLSK A AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K++ E G GS+TALP++ET+AGD+SAYIPTNVISITDGQ+F+ ++LFN+G RPAI+AG+SVSRVGS+AQI A+K+ +G LKLELAQ+ EL AF+QF SDLDK T+  L  G+++ +L+KQ + +P     +  L+++    Y+  IP D +  F
  S:     2 VSIRPDEISSIIRQQIEQYDQQVKVENVGTVLQVGDGIARVYGLEKVMASELLEFEDGTVGIALNLEEDNVGVVLMGEGRDLEEGSTVRSTGRVAQVPVGEGAIGRVVDALVRPIDGKGEIHSTETRLLESPAPGIVQRKSVYEPMQTGITAIDAMIPIGRGQRELIIGDRQTGKTAVAIDTILNQKGSGVICVYVAIGQKASTVAQVVNVLRERGALEYTIVVAANASDPAALQYLAPYTGATLAEYFMYKGKATLVVYDDLSKQAQAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSPELGEGSMTALPVVETQAGDVSAYIPTNVISITDGQIFLSSDLFNAGLRPAINAGISVSRVGSAAQIKAMKQVAGKLKLELAQFDELQAFAQFASDLDKATQNQLARGQRLRELLKQPQYSPIPVEEQVALIYAGTNGYLDEIPTDKVTSF 457
>gi|113475840|ref|YP_721901.1| F0F1 ATP synthase subunit alpha [Trichodesmium erythraeum IMS101] >gi|123160854|sp|Q112Z6|ATPA_TRIEI ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|110166888|gb|ABG51428.1| ATP synthase F1, alpha subunit [Trichodesmium erythraeum IMS101] (505 aa)
Score = 1344, Expect = 3.1e-146, Identities = 266/483 (55%), Positives = 354/483 (73%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKTILETIDQTKDISQD 483
           +SI  D+ S II++QI++Y+     S +G V+ VGDGI +  GL  VM  ELV F +G+ G+  NLE    G V++G+  +I+EGS V  T  +  VPVGD L+GRV+D +G PIDG GE+K      +E  APG++ R SV EP++TG  AIDSM PIG+GQRELIIGD+QTGKT IAID IINQKG++V C+YV IGQK ST+ Q + TL++ GAL+YT IVA++ASD  +L YLAP+TG TIAE +M KG+  L+IYDDLSK A AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+N + GGGS+TALPIIET+AGD+SAYIPTNVISITDGQ+F+ ++LFN+G RPA++AG+SVSRVGS+AQ  A+KK +G +KLELAQ+ EL+AFSQF SDLDK T+  L  G+++ +++KQ +N+P S   +   ++S    Y+  IP++    F   ++ +    K     I +T+ +  D
  S:     2 VSIRPDEISQIIRDQIEQYEQDVKVSNVGTVLQVGDGIARVYGLDKVMAGELVEFADGTVGIAQNLEEDNVGAVLMGEGREIQEGSAVTATGRIAQVPVGDALVGRVVDGLGRPIDGKGEMKTTDSRLLESPAPGIIDRRSVYEPMQTGITAIDSMIPIGRGQRELIIGDRQTGKTAIAIDTIINQKGEDVICVYVAIGQKASTVAQVVGTLEEKGALDYTVIVAANASDPATLQYLAPYTGATIAEYFMYKGKATLVIYDDLSKQAQAYRQVSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNDKLGGGSMTALPIIETQAGDVSAYIPTNVISITDGQIFLSSDLFNAGFRPAVNAGISVSRVGSAAQTKAIKKVAGKIKLELAQFAELEAFSQFASDLDKATQNQLARGQRLREILKQPQNSPRSLPEQVAAIYSGINGYLDDIPLEKAAKFIAGLLDYLNNSKPKFGEIIKTEKVLTD 484
>gi|150398121|ref|YP_001328588.1| F0F1 ATP synthase subunit alpha [Sinorhizobium medicae WSM419] >gi|166201680|sp|A6UDM3|ATPA_SINMW ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|150029636|gb|ABR61753.1| ATP synthase F1, alpha subunit [Sinorhizobium medicae WSM419] (509 aa)
Score = 1344, Expect = 3.3e-146, Identities = 262/499 (52%), Positives = 358/499 (71%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQK--------GKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQ-KTILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           M I   + S I+K+QIK +  +A  SE+G+V++VGDGI +  GL NV   E+V F  G  GM LNLEA   G+V+ G   DIKEG  VKRT  +VDVPVG  LLGRV+DA+GNPIDG G I   ++  ++  APG++ R SV EP+ TG  AID++ P+G+GQREL+IGD+QTGKT I +D I+NQK        G  + C+YV IGQK ST+ QF+  L++ GAL+Y+ IVA++ASD   + YLAPF G T+ E +   G+  LI YDDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+N +NG GS+TALP+IET+  D+SA+IPTNVISITDGQ+F+ T+LF  G RPA++ GLSVSRVGSSAQI A+K+ +GS+K ELAQYRE+ AF+QFGSDLD  T+ +L  G ++ +L+KQ + +P     +  ++F+    ++  +PV  +  F++ ++ + + + K +L+TI   K IS D   ++K   +S   S+
  S:     1 MDIRAAEISAILKDQIKNFGQEAEVSEVGQVLSVGDGIARVYGLDNVQAGEMVEFPGGIRGMALNLEADNVGVVIFGSDRDIKEGDTVKRTGAIVDVPVGPELLGRVVDALGNPIDGKGPINAKQRARVDVKAPGIIPRKSVHEPMSTGLKAIDALIPVGRGQRELVIGDRQTGKTAIILDTILNQKAIHDNGPEGDKLYCVYVAIGQKRSTVAQFVKVLEERGALQYSIIVAATASDAAPMQYLAPFAGCTMGEYFRDSGKHALIGYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNDDNGAGSLTALPVIETQGNDVSAFIPTNVISITDGQIFLETDLFYQGIRPAVNVGLSVSRVGSSAQIKAMKQVAGSIKGELAQYREMAAFAQFGSDLDAATQRLLNRGARLTELLKQPQFSPLKTEEQVAVIFAGVNGFLDKLPVADVGKFEQGLLSYMRSEGKAVLDTIRTEKAISDDTKAKLKAAIDSFAKSF 508
>gi|119484689|ref|ZP_01619171.1| ATP synthase subunit A [Lyngbya sp. PCC 8106] >gi|119457507|gb|EAW38631.1| ATP synthase subunit A [Lyngbya sp. PCC 8106] (505 aa)
Score = 1343, Expect = 4.3e-146, Identities = 262/480 (54%), Positives = 350/480 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKTILETIDQTKDI 480
           +SI  D+ S+II+ QIK+Y      S +G V+ VGDGI +  GL   M +EL+ FE+G+ G+ LNLE    G V++G    I+EGS V  T  + ++PVGD +LGR++DA+G PIDG GEI+  +   +E  APG++ R SVCEP++TG  AID+M PIG+GQRELIIGD+QTGKT IAID IINQK ++V C+YV IGQK ST+ Q   TL + GA++YT IVA+SAS+  +L YLAP+ G  IAE +M KG+  L+IYDDLSK A AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+N E GGGS+TALPIIET+A D+SAYIPTNVISITDGQ+F+  +LFNSG RPA++AG+SVSRVGS+AQ  A+KK +G +KLELAQY EL AFSQF SDLD+ T++ L  G+++ +L+KQ +N+P     +  ++++    Y+  +PV+ +  F   +  + K  K     I Q++ +
  S:     2 VSIRPDEISSIIEQQIKQYDQDVKVSNVGTVLQVGDGIARIYGLDKAMSSELLEFEDGTIGIALNLEEDNVGAVLMGDGHKIEEGSSVTGTGRIAEIPVGDAMLGRIVDALGRPIDGKGEIQSSEDRLLESPAPGIIDRRSVCEPMQTGITAIDAMIPIGRGQRELIIGDRQTGKTAIAIDTIINQKSEDVICVYVAIGQKASTVAQVAGTLAEKGAMDYTVIVAASASEPATLQYLAPYAGACIAEYFMYKGKHTLVIYDDLSKQAQAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNDELGGGSMTALPIIETQASDVSAYIPTNVISITDGQIFLSADLFNSGLRPAVNAGISVSRVGSAAQTKAIKKVAGKIKLELAQYSELAAFSQFASDLDEATRKQLSRGERLRELLKQPQNSPLQLFEQVAIIYTGINGYLDEVPVEKVVAFAAGLRDYLKNSKPKYGEIIQSEKV 481
>gi|170077357|ref|YP_001733995.1| ATP synthase F1, alpha subunit [Synechococcus sp. PCC 7002] >gi|169885026|gb|ACA98739.1| ATP synthase F1, alpha subunit [Synechococcus sp. PCC 7002] (505 aa)
Score = 1343, Expect = 4.4e-146, Identities = 253/468 (54%), Positives = 351/468 (75%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQK 468
           +SI  D+ S+II+ QI+ Y  K     +G V+ VGDGI +  GL   M  EL+ FE+G+ G+ LNLE    G V++G   DI+EGS VK T  + ++PVG+ ++GRV+DA+  PIDG G+I       IE +APG++AR SV EP++TG  AID+M P+G+GQRELIIGD+QTGKT +A+D IINQKG++V C+YV +GQK ST+ Q ++TL+  GAL+YT +VA++A+D  +L YLAP+TG  IAE +M +G+  L++YDDL+K A AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K++ E GGGS+TALPIIET+AGD+SAYIPTNVISITDGQ+F+ ++LFN+G RPAI+AG+SVSRVGS+AQ  A+KK +G LKLELAQ+ EL+AF+QF SDLD  T+  L  G+++ +++KQ +N+P S + +  ++++    Y+  IPVD + +F   + ++    K
  S:     2 ISIRPDEISSIIRQQIESYDQKVQVDNVGTVLQVGDGIARIYGLEQAMAGELLEFEDGTVGIALNLEEDNVGAVLMGDGRDIQEGSSVKSTGRIAEIPVGEAIVGRVVDALARPIDGKGDIDATDTRLIEFMAPGIIARRSVHEPMQTGITAIDAMIPVGRGQRELIIGDRQTGKTAVAVDTIINQKGEDVICVYVAVGQKASTVAQVVSTLESKGALDYTVVVAANANDPATLQYLAPYTGAAIAEHFMYQGKATLVVYDDLTKQAQAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSDELGGGSMTALPIIETQAGDVSAYIPTNVISITDGQIFLSSDLFNAGFRPAINAGISVSRVGSAAQTKAMKKVAGKLKLELAQFAELEAFAQFASDLDAATQNQLARGQRLRQILKQPQNSPLSVAEQVAIVYAGLNGYLDEIPVDRVVEFTTGLRQYLATSK 469
>gi|154705570|gb|ABS84211.1| ATP synthase F1 alpha subunit [Lactobacillus reuteri] (509 aa)
Score = 1343, Expect = 4.6e-146, Identities = 258/482 (53%), Positives = 355/482 (73%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHF-KQQKTILETIDQTKDISQ 482
           MSI  ++ S++IK Q+  YQ+K    E G V  VGDG+ +A GL N M  EL+ F NG YGM  NLE+   GIV+LG +  I+EG  VKRT  +++VPVGD LLGRV+D++G PIDG GEIK DK  PIE+ APGVM R SV  PL+TG   ID++ PIG+GQRELIIGD++TGKT IA+D IINQK ++V CIYV IGQK ST+   + TL+++GAL+YT +V++SAS+   + Y+AP+ G  + EE+M  G+DVLI+YDDLSK A AYR LSL+LRRPPGREAYPGDIFY HSRLLER+ +++ + GGGS+TALPII+T+AGD+SAYIPTNVISITDGQ+F+ ++ F +GQRPAIDAG SVSRVG  AQI A+KK +G+L+L++A Y EL +F+QFGSDLD  T+  L  G++ M+++KQ  + P     + + LF++   +I  + ++ ++ ++ ++  +     + + +TI +T  + +
  S:     1 MSIKTEEISSLIKKQLANYQDKVSVEETGTVTYVGDGVARADGLDNAMAGELLEFSNGVYGMAQNLESNDVGIVILGDYTGIREGDTVKRTGRIMEVPVGDALLGRVVDSLGRPIDGLGEIKTDKTRPIERKAPGVMERKSVSVPLQTGIKVIDALVPIGRGQRELIIGDRKTGKTAIALDTIINQKNQDVICIYVAIGQKESTVRASVETLRKYGALDYTIVVSASASNPAPMLYIAPYAGAAMGEEFMFNGKDVLIVYDDLSKQADAYRELSLILRRPPGREAYPGDIFYTHSRLLERAARLSDDLGGGSMTALPIIQTQAGDVSAYIPTNVISITDGQIFLDSDEFYAGQRPAIDAGTSVSRVGGDAQIKAMKKVAGTLRLDIASYNELASFAQFGSDLDAATQAKLARGQRTMEVLKQGLHDPLPVEEQVVTLFALSRGFIDKVEIEDVQRYESELAAYMHANHQDLYDTIKKTGKLPE 483
>gi|148543700|ref|YP_001271070.1| ATP synthase F1, alpha subunit [Lactobacillus reuteri F275] >gi|184153110|ref|YP_001841451.1| ATP synthase alpha subunit [Lactobacillus reuteri F275] >gi|194468263|ref|ZP_03074249.1| ATP synthase F1, alpha subunit [Lactobacillus reuteri 100-23] >gi|166990358|sp|A5VIQ9|ATPA_LACRF ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|148530734|gb|ABQ82733.1| ATP synthase F1, alpha subunit [Lactobacillus reuteri F275] >gi|183224454|dbj|BAG24971.1| ATP synthase alpha subunit [Lactobacillus reuteri F275] >gi|194453116|gb|EDX42014.1| ATP synthase F1, alpha subunit [Lactobacillus reuteri 100-23] (509 aa)
Score = 1343, Expect = 4.6e-146, Identities = 258/482 (53%), Positives = 355/482 (73%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHF-KQQKTILETIDQTKDISQ 482
           MSI  ++ S++IK Q+  YQ+K    E G V  VGDG+ +A GL N M  EL+ F NG YGM  NLE+   GIV+LG +  I+EG  VKRT  +++VPVGD LLGRV+D++G PIDG GEIK DK  PIE+ APGVM R SV  PL+TG   ID++ PIG+GQRELIIGD++TGKT IA+D IINQK ++V CIYV IGQK ST+   + TL+++GAL+YT +V++SAS+   + Y+AP+ G  + EE+M  G+DVLI+YDDLSK A AYR LSL+LRRPPGREAYPGDIFY HSRLLER+ +++ + GGGS+TALPII+T+AGD+SAYIPTNVISITDGQ+F+ ++ F +GQRPAIDAG SVSRVG  AQI A+KK +G+L+L++A Y EL +F+QFGSDLD  T+  L  G++ M+++KQ  + P     + + LF++   +I  + ++ ++ ++ ++  +     + + +TI +T  + +
  S:     1 MSIKTEEISSLIKKQLANYQDKVSVEETGTVTYVGDGVARADGLDNAMAGELLEFSNGVYGMAQNLESNDVGIVILGDYTGIREGDTVKRTGRIMEVPVGDALLGRVVDSLGRPIDGLGEIKTDKTRPIERKAPGVMERKSVSVPLQTGIKVIDALVPIGRGQRELIIGDRKTGKTAIALDTIINQKNQDVICIYVAIGQKESTVRASVETLRKYGALDYTIVVSASASNPAPMLYIAPYAGAAMGEEFMFNGKDVLIVYDDLSKQADAYRELSLILRRPPGREAYPGDIFYTHSRLLERAARLSDDLGGGSMTALPIIQTQAGDVSAYIPTNVISITDGQIFLDSDEFYAGQRPAIDAGTSVSRVGGDAQIKAMKKVAGTLRLDIASYNELASFAQFGSDLDAATQAKLARGQRTMEVLKQGLHDPLPVEEQVVTLFALSRGFIDKVEIEDVQRYESELAAYMHANHQDLYDTIKKTGKLPE 483
>gi|163784955|ref|ZP_02179706.1| F0F1 ATP synthase subunit alpha [Hydrogenivirga sp. 128-5-R1-1] >gi|159879775|gb|EDP73528.1| F0F1 ATP synthase subunit alpha [Hydrogenivirga sp. 128-5-R1-1] (475 aa)
Score = 1342, Expect = 4.8e-146, Identities = 253/459 (55%), Positives = 347/459 (75%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIK-YDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEK 459
           M+I  ++    +K Q++E++ KA   E+G VI VGDG+ +  GL   ++ E++ FE+G  G+  NLE    G+V+LG    IKEG+ VKRT  ++++PVG GL+GRV+D +GNPIDG G I+      P+EKIAPGV++R SV EPL+TG  AID+M PIG+GQRELIIGD+ TGKTT+AID I+NQKG+ V C+YV IGQK   +   + TL++ GA+EYTT+VA++ASD  ++ Y+APF G TIAE +   G   L+IYDDL+KHA AYR LSLLLRRPPGREAYPGD+FYLHSRLLER+ K+N E G GS+TALPIIET+AGD++AYIPTNVISITDGQ+F+ T+LFN G RPAI+ GLSVSRVG +AQI A+K+ +G+L+LELAQ+REL+AF QF S+LDK T++ +  G+++++L+KQ  N P     +  ++++    Y+  +PV+ I+ F+++
  S:     1 MTIRSEEIVETLKKQLEEFEVKANLEEVGTVIQVGDGVARVFGLEKAVMGEMLEFESGVTGVVFNLEEDNVGVVLLGDESLIKEGTTVKRTGKILEIPVGKGLVGRVVDGLGNPIDGKGPIEDIAYYSPVEKIAPGVVSRKSVHEPLQTGIKAIDAMIPIGRGQRELIIGDRATGKTTVAIDTILNQKGQGVYCVYVAIGQKRGVVRHIVETLQKHGAMEYTTVVAATASDPATMQYIAPFVGCTIAEYFRDNGMHALVIYDDLTKHAYAYRQLSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNDELGAGSLTALPIIETQAGDVAAYIPTNVISITDGQIFLETDLFNKGIRPAINVGLSVSRVGGAAQIKAMKQVAGTLRLELAQFRELEAFVQFASELDKATQQQIARGQRMVELLKQPPNKPVPVEKQVAIIYAGVNGYLDDVPVESIQKFEQE 460
>gi|28378940|ref|NP_785832.1| F0F1 ATP synthase subunit alpha [Lactobacillus plantarum WCFS1] >gi|81631036|sp|Q88UU1|ATPA_LACPL ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|28271777|emb|CAD64683.1| H(+)-transporting two-sector ATPase, alpha subunit [Lactobacillus plantarum WCFS1] (504 aa)
Score = 1342, Expect = 5.0e-146, Identities = 257/482 (53%), Positives = 354/482 (73%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK-QQKTILETIDQTKDISQ 482
           MSI  ++ S +IK Q++ YQ +   +E G V  VGDGI +A GL N +  EL+ F NG YGM  NLE+   GIV+LG F+ I+EG  VKRT  +++VPVGD ++GRV++ +G P+DG GEIK     PIE  APG+M R SV EPL+TG  AID++ PIG+GQRELIIGD++TGKT++AIDAI+NQK +++ C+YV IGQK+ST+   + TLK+ GA++YT +V +  ++   L YLAP+ G  + EE+M  G+ VLI+YDDLSK A AYR LSL+LRRPPGREAYPGD+FYLHSRLLER+ K++ E GGGS+TALPIIET+AGDISAYIPTNVISITDGQ+F+ ++ F SG RPAIDAG SVSRVG  AQI A+K  +G+L+L+LA YREL++FSQFGSDLD  T+  L  G+++++++KQ  ++P     + ++L+++   Y+  + VD I  ++ ++        + + +TI  TK + +
  S:     1 MSIKSEEISALIKQQLESYQTELSVAETGTVTYVGDGIARAHGLDNALQGELLEFSNGVYGMVQNLESNDVGIVVLGDFDGIREGDTVKRTGRIMEVPVGDAMIGRVVNPLGQPVDGLGEIKTTNTRPIEHKAPGIMQRQSVSEPLQTGIKAIDALVPIGRGQRELIIGDRKTGKTSVAIDAILNQKDQDMICVYVAIGQKDSTVRAQVETLKKLGAMDYTIVVTAGPAEPAPLLYLAPYAGAAMGEEFMMNGKHVLIVYDDLSKQATAYRELSLILRRPPGREAYPGDVFYLHSRLLERAAKLSDELGGGSMTALPIIETQAGDISAYIPTNVISITDGQIFLDSDSFYSGVRPAIDAGASVSRVGGDAQIKAMKSVAGTLRLDLASYRELESFSQFGSDLDAATQAKLNRGQRIVEVLKQPVHSPLKVEEQVMILYALTNGYLDKVAVDDIARYQSELFEFIHASHQDLFDTILATKKLPE 483
>gi|195953388|ref|YP_002121678.1| ATP synthase F1, alpha subunit [Hydrogenobaculum sp. Y04AAS1] >gi|195933000|gb|ACG57700.1| ATP synthase F1, alpha subunit [Hydrogenobaculum sp. Y04AAS1] (502 aa)
Score = 1342, Expect = 5.5e-146, Identities = 264/500 (52%), Positives = 355/500 (71%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQ-KTILETIDQTKDISQDLFVQIKNEFNSLITSYI 500
           M++  D    I+K+Q++ ++      E+G V  VGDG+ +A GL NVM NEL+ F++G  G+  NLE    GI++LG    IKEGSIVKRT  ++D PVG+ L+GRVID +GNP+DG G I    + P+EKIAPG++ R SV EPL+TG  AID+M PIG+GQRELIIGD+ TGKTT+AID I+NQK  +V CIYV IGQK ST  + I  L++ GA++YTT+V +SA+D   L YLAPFTG TI E +   G+  LI+YDDLSKHA AYR LSLL+RRPPGREAYPGD+FYLHSRLLER+ K+  E G GS+TALPIIET+AGD+SAYIPTNVISITDGQ+++  +LFN G RPAI+ GLSVSRVG SAQI A+K+ +G+L+L+LAQ+REL+AF QF SDLDK T++ +  G ++++L+KQ   +P     + I +++    Y+  IPV  +  F+ ++        K +L+ +   K I   +  ++K   +    S+I
  S:     1 MTLAYDDALEILKSQLQSFETDIKMEEVGVVYAVGDGVARAYGLDNVMANELLEFDSGEAGLAFNLEEDNVGIIILGSESGIKEGSIVKRTGRILDAPVGEELVGRVIDPLGNPLDGKGPINAKHRSPVEKIAPGIVKRKSVHEPLQTGIKAIDAMIPIGRGQRELIIGDRATGKTTVAIDTILNQKDTDVYCIYVAIGQKKSTTARIIELLEREGAMKYTTVVVASATDPAPLQYLAPFTGCTIGEYFRDNGKHALIVYDDLSKHAEAYRQLSLLVRRPPGREAYPGDVFYLHSRLLERAAKLYDELGAGSLTALPIIETKAGDVSAYIPTNVISITDGQIYLEPDLFNKGIRPAINVGLSVSRVGGSAQIKAMKQVAGTLRLDLAQFRELEAFMQFASDLDKATQDTINRGLRLVELLKQGPYSPIPVEKQVIAIYAGTNGYLDDIPVSSVRKFEMELYGFLDANFKDLLDELKTKKAIDDSVKSKLKTALDKFKASFI 501
>gi|160902213|ref|YP_001567794.1| ATP synthase F1, alpha subunit [Petrotoga mobilis SJ95] >gi|189081307|sp|A9BFX5|ATPA_PETMO ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|160359857|gb|ABX31471.1| ATP synthase F1, alpha subunit [Petrotoga mobilis SJ95] (504 aa)
Score = 1342, Expect = 6.0e-146, Identities = 266/500 (53%), Positives = 365/500 (73%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGS----YGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQ-KTILETIDQTKDISQDLFVQIKNEFNSLITSYI 500
           M +N D+ + +I+ +IK Y++  +  EIG V+ V DGIV+A GL +VM NELV  E       YG+ +NLE    GI+ LG ++ IKEG  + RT  +++VPVG+ LLGRV++ +G P+DG GEI  D   PIE+ A GV+ R  V  PL+TG   +D++ PIG+GQRELIIGD+QTGKT IA D IINQKGKNV CIYV IGQK+S + + I+ L+++GA++YT +VA+ ASD  SL Y+AP+ G  I E +M  G+D L+IYDDL+KHA AYR +SLLLRRPPGREAYPGDIFYLHSRLLER+ ++N+  G GS+TALPIIET+A DISAYIPTNVISITDGQ+++ T LFN+G RPA++ GLSVSRVG  AQ  A+K+ +GSLKL+LAQYREL++F+QF +DLD+ TK+ L  G+K+ +L+KQ + +P     +  ++++  E Y+  IP D I DF+ + + + K+  +  L  I ++KDI+     +IK E N  I+ ++
  S:     1 MRVNPDELTKVIEERIKSYESGEI-KEIGWVMQVSDGIVRAYGLKDVMTNELVEIETSEGEKIYGIAMNLEEDNVGIITLGDYKGIKEGDKLVRTNRIIEVPVGEKLLGRVVNPLGMPLDGKGEINTDDFYPIERKAMGVVTRKPVDTPLQTGLKVLDALIPIGRGQRELIIGDRQTGKTAIATDTIINQKGKNVFCIYVSIGQKSSGLARTIDNLEKYGAMDYTVVVAADASDPASLQYIAPYAGAAIGEYFMFNGKDALVIYDDLTKHAAAYREISLLLRRPPGREAYPGDIFYLHSRLLERASRLNENYGNGSLTALPIIETQANDISAYIPTNVISITDGQIYLETGLFNAGIRPAVNIGLSVSRVGGDAQTKAMKRVAGSLKLDLAQYRELESFTQFAADLDEATKKQLTKGEKLTELMKQPQYSPMEMEEQVAVIYAANEGYLDQIPTDRISDFERQFLAYLKENYRDTLNKIRESKDIAD----EIKKELNEAISKFL 500
>gi|1929511|gb|AAB51464.1| ATP synthase subunit alpha (507 aa)
Score = 1341, Expect = 6.2e-146, Identities = 260/499 (52%), Positives = 353/499 (70%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWM-SKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQK-TILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           MSI  D+ ++I+KNQI++YQ +   +E+G V  VGDGI +  GL   M  EL+ F    YGM LNLE    G V+LG +  IKEG  VKRT  +V+VPVG+ L+GRV++AMG PIDG G I+ DK  P+E  APGV+ R  V  PL+TG  AIDSM PIG+GQRELIIGD+QTGKT IA+D IINQKG+NV CIYV IGQK ST+   +  L++ GA+EY  +V ++AS+   + Y+AP+ G T+ E +M  +  DVL +YDDLSKHA AYR LSLLLRRPPGRE YPGD+FYLHS LLER  ++    GGGS+TALP+IET+AGD+SAYIPTNVISITDGQ+F+ ++LF +GQRPAI+  LSVSRVG +AQI A+K+ +  L+L+LAQYREL AF+QFGSDLDK T+  L   +++M+++KQD+  P     + ++L++    ++  +PV  +  F++  +R  + ++  +L  I + + +  +L  Q+K        S+
  S:     1 MSIRPDEITSILKNQIEQYQLEVEMAEVGTVTQVGDGIARIYGLDRAMAGELLEFPGDIYGMVLNLEEDNVGAVILGPYTHIKEGDQVKRTGRIVEVPVGEALIGRVVNAMGQPIDGKGPIQTDKFRPVESPAPGVVYRQPVNTPLQTGLKAIDSMVPIGRGQRELIIGDRQTGKTAIAVDTIINQKGQNVICIYVAIGQKASTVAGVVQRLEEAGAMEYIIVVMATASEPAPMLYIAPYAGCTMGEYFMYEQHRDVLCVYDDLSKHAAAYRELSLLLRRPPGREPYPGDVFYLHSGLLERPARLTDSLGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLESDLFYAGQRPAINVALSVSRVGGAAQIKAMKQVAARLRLDLAQYRELAAFAQFGSDLDKATQARLARAERMMEILKQDQYQPMPVEEQVVVLYAAVNGFLDDLPVGRVRAFEKDFLRFLRNERPEVLAGIREKRQLDDNLQEQLKKSIEDFKGSF 501
>gi|82751706|ref|YP_417447.1| F0F1 ATP synthase subunit alpha [Staphylococcus aureus RF122] >gi|124007215|sp|Q2YUJ9|ATPA_STAAB ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|82657237|emb|CAI81678.1| ATP synthase alpha chain [Staphylococcus aureus RF122] (502 aa)
Score = 1341, Expect = 6.4e-146, Identities = 258/460 (56%), Positives = 353/460 (76%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKI 460
           M+I  ++ S ++++QI+ Y+++   +++G V+ +GDGI    GL++VM  ELV F NG  G+  NLE +  G+V+LG +  I EG  VKRT  +++VPVG+ L+GRV++ +G PIDG G I   K  P+EK A GVM R SV EPL+TG  AID++ PIG+GQRELIIGD+QTGKTTIAID I+NQK +   CIYV IGQK+ST+   +  L+Q GAL+YT +VA+SAS+   L Y+AP++G+T+ EE+M  G+ VLI+YDDL+K A AYR LSLLLRRPPGREAYPGD+FYLHSRLLER+ K+N + GGGSITALPIIET+AGDISAY+PTNVISITDGQ+F+ ++LF SG RPAI+AG SVSRVG SAQI A+KK +G+L+L+LA YREL++F+QFGSDLD+ T   LE GK+ ++++KQD+N P     + ++++++ + Y+  IPV  I  F++++
  S:     1 MAIKAEEISALLRSQIENYESEMSVTDVGTVLQIGDGIALIHGLNDVMAGELVEFHNGVLGLAQNLEESNVGVVILGPYAGITEGDEVKRTGRIMEVPVGEELIGRVVNPLGQPIDGQGPINTTKTRPVEKKATGVMDRKSVDEPLQTGIKAIDALVPIGRGQRELIIGDRQTGKTTIAIDTILNQKDQGTICIYVAIGQKDSTVRANVEKLRQAGALDYTIVVAASASEPSPLLYIAPYSGVTMGEEFMFNGKHVLIVYDDLTKQAAAYRELSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNDDLGGGSITALPIIETQAGDISAYVPTNVISITDGQIFLQSDLFFSGVRPAINAGQSVSRVGGSAQIKAMKKVAGTLRLDLASYRELESFAQFGSDLDEFTASKLERGKRTVEVLKQDQNKPLPVEHQVLIIYALTKGYLDDIPVVDITRFEDEL 460
>gi|56405329|sp|P29706|ATPA_PROMO ATP synthase subunit alpha, sodium ion specific (Na(+)-translocating ATPase subunit alpha) (500 aa)
Score = 1341, Expect = 6.5e-146, Identities = 263/489 (53%), Positives = 353/489 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKTILETIDQTKDISQDLFVQIK 489
           M I  ++ S IIK +I+ Y+        G V+ VGDGI +  GLSN    EL+ F NG  GM LNLE    G V+LG    +KEG  V+ T  +  V  G+ LLGRV++++G PIDG GE+K +K MP+++ A G+++R  V EPL+TG  +ID M PIG+GQRELIIGD+QTGKT +A+DAIINQK   VKCIYV IGQK ST+ Q +  L+  GALEYT +VA++AS+   L Y+AP+TG+++ E +M KGE VLI+YDDLSKHA+AYR +SLLL+RPPGREA+PGD+FYLHSRLLER+ K++ E G GSITALPIIET+AGD+SAYIPTNVISITDGQ+F+ + LFNSG RPAI+AG+SVSRVG +AQI A+K+ +  +KLELAQY EL  F+QFGSDLDK T   LE G ++M+++KQ++  PF    + +  F++   Y+  I +D +  F+++++   K   TIL  I + K I +DL  +++
  S:     1 MKIRPEEISGIIKTEIENYKKSLDVKTSGSVVQVGDGIARIYGLSNAKAGELLEFPNGITGMALNLEENNVGAVILGDPTGVKEGDEVRATGQIAAVGAGEALLGRVVNSLGEPIDGKGELKTEKMMPLDRKAYGIISRKPVHEPLQTGIKSIDGMVPIGRGQRELIIGDRQTGKTAVALDAIINQKDTGVKCIYVAIGQKRSTVAQIVKRLEDAGALEYTIVVAATASESAPLQYMAPYTGVSMGEYFMDKGEHVLIVYDDLSKHAVAYREMSLLLKRPPGREAFPGDVFYLHSRLLERAAKLSDEIGAGSITALPIIETQAGDVSAYIPTNVISITDGQIFLDSQLFNSGFRPAINAGISVSRVGGAAQIKAMKQVAAQVKLELAQYNELLTFAQFGSDLDKATLAQLERGHRIMEILKQEQYKPFVVEEQVVSFFTVINGYLDDIAIDQVRRFEKELLEELKDNTTILAEIVEKKAIKEDLDAKLR 489
>gi|15925095|ref|NP_372629.1| F0F1 ATP synthase subunit alpha [Staphylococcus aureus subsp. aureus Mu50] >gi|15927679|ref|NP_375212.1| F0F1 ATP synthase subunit alpha [Staphylococcus aureus subsp. aureus N315] >gi|21283758|ref|NP_646846.1| F0F1 ATP synthase subunit alpha [Staphylococcus aureus subsp. aureus MW2] >gi|49484329|ref|YP_041553.1| F0F1 ATP synthase subunit alpha [Staphylococcus aureus subsp. aureus MRSA252] >gi|49486898|ref|YP_044119.1| F0F1 ATP synthase subunit alpha [Staphylococcus aureus subsp. aureus MSSA476] >gi|87160882|ref|YP_494706.1| F0F1 ATP synthase subunit alpha [Staphylococcus aureus subsp. aureus USA300] >gi|88196009|ref|YP_500822.1| F0F1 ATP synthase subunit alpha [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|148268556|ref|YP_001247499.1| F0F1 ATP synthase subunit alpha [Staphylococcus aureus subsp. aureus JH9] >gi|150394620|ref|YP_001317295.1| F0F1 ATP synthase subunit alpha [Staphylococcus aureus subsp. aureus JH1] >gi|156980420|ref|YP_001442679.1| F0F1 ATP synthase subunit alpha [Staphylococcus aureus subsp. aureus Mu3] >gi|161510312|ref|YP_001575971.1| F0F1 ATP synthase subunit alpha [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|168728865|ref|ZP_02761142.1| F-ATPase superfamily proton( H+)- or sodium (Na+)-translocating F-type ATPase epsilon alpha subunit [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|166201682|sp|A7X4U5|ATPA_STAA1 ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|189081321|sp|A6U3J0|ATPA_STAA2 ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|189081322|sp|A5IUQ0|ATPA_STAA9 ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|189081323|sp|A8YY72|ATPA_STAAT ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|54036783|sp|P63676|ATPA_STAAW ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|54036793|sp|P99111|ATPA_STAAN ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|54040853|sp|P63675|ATPA_STAAM ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|60389597|sp|Q6G7K5|ATPA_STAAS ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|60389622|sp|Q6GEX0|ATPA_STAAR ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|119367964|sp|Q2FWE8|ATPA_STAA8 ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|124007214|sp|Q2FF22|ATPA_STAA3 ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|13701899|dbj|BAB43191.1| ATP synthase alpha chain [Staphylococcus aureus subsp. aureus N315] >gi|14247878|dbj|BAB58267.1| ATP synthase alpha chain [Staphylococcus aureus subsp. aureus Mu50] >gi|21205200|dbj|BAB95894.1| ATP synthase alpha chain [Staphylococcus aureus subsp. aureus MW2] >gi|49242458|emb|CAG41174.1| ATP synthase alpha chain [Staphylococcus aureus subsp. aureus MRSA252] >gi|49245341|emb|CAG43816.1| ATP synthase alpha chain [Staphylococcus aureus subsp. aureus MSSA476] >gi|87126856|gb|ABD21370.1| ATP synthase F1, alpha subunit [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|87203567|gb|ABD31377.1| ATP synthase F1, alpha subunit [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|147741625|gb|ABQ49923.1| ATP synthase F1, alpha subunit [Staphylococcus aureus subsp. aureus JH9] >gi|149947072|gb|ABR53008.1| ATP synthase F1, alpha subunit [Staphylococcus aureus subsp. aureus JH1] >gi|156722555|dbj|BAF78972.1| ATP synthase alpha chain [Staphylococcus aureus subsp. aureus Mu3] >gi|160369121|gb|ABX30092.1| F-ATPase superfamily proton( H+)- or sodium (Na+)-translocating F-type ATPase epsilon alpha subunit [Staphylococcus aureus subsp. aureus USA300_TCH1516] (502 aa)
Score = 1341, Expect = 6.5e-146, Identities = 258/460 (56%), Positives = 353/460 (76%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKI 460
           M+I  ++ S ++++QI+ Y+++   +++G V+ +GDGI    GL++VM  ELV F NG  G+  NLE +  G+V+LG +  I EG  VKRT  +++VPVG+ L+GRV++ +G PIDG G I   K  P+EK A GVM R SV EPL+TG  AID++ PIG+GQRELIIGD+QTGKTTIAID I+NQK +   CIYV IGQK+ST+   +  L+Q GAL+YT +VA+SAS+   L Y+AP++G+T+ EE+M  G+ VLI+YDDL+K A AYR LSLLLRRPPGREAYPGD+FYLHSRLLER+ K+N + GGGSITALPIIET+AGDISAY+PTNVISITDGQ+F+ ++LF SG RPAI+AG SVSRVG SAQI A+KK +G+L+L+LA YREL++F+QFGSDLD+ T   LE GK+ ++++KQD+N P     + ++++++ + Y+  IPV  I  F++++
  S:     1 MAIKAEEISALLRSQIENYESEMSVTDVGTVLQIGDGIALIHGLNDVMAGELVEFHNGVLGLAQNLEESNVGVVILGPYTGITEGDEVKRTGRIMEVPVGEELIGRVVNPLGQPIDGQGPINTTKTRPVEKKATGVMDRKSVDEPLQTGIKAIDALVPIGRGQRELIIGDRQTGKTTIAIDTILNQKDQGTICIYVAIGQKDSTVRANVEKLRQAGALDYTIVVAASASEPSPLLYIAPYSGVTMGEEFMFNGKHVLIVYDDLTKQAAAYRELSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNDDLGGGSITALPIIETQAGDISAYVPTNVISITDGQIFLQSDLFFSGVRPAINAGQSVSRVGGSAQIKAMKKVAGTLRLDLASYRELESFAQFGSDLDEFTASKLERGKRTVEVLKQDQNKPLPVEHQVLIIYALTKGYLDDIPVVDITRFEDEL 460
>gi|543872|sp|Q05372|ATPA_SYNP1 ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|480492|pir||S36965 H+-transporting two-sector ATPase (EC 3.6.3.14) alpha chain - Synechococcus sp >gi|49219|emb|CAA49875.1| ATP synthase (alpha); H(+)-transporting ATP synthase [Synechococcus sp.] (503 aa)
Score = 1341, Expect = 6.6e-146, Identities = 254/456 (55%), Positives = 344/456 (75%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDF 456
           +SI  D+ S+II+ QI++Y+       +G V+ VGDGI +  GL  VM +ELV FE+G+ G+ LNLE    G+V++G    I+EGS V+ T  +  VPVG+ ++GRV+DA+  PIDG GEI       +E  APG++ R SVCEPL+TG  AID+M PIG+GQRELIIGD+QTGKT +AID I+NQKG++V C+YV IGQK S++ Q +N L++ GAL+YT +VA++ASD  +L YLAP+TG +IAE +M +G+  L+IYDDLSK A AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+N   GGGS+TALPI+ET+AGD+SAYIPTNVISITDGQ+F+ ++LFN+G RPAI+AG+SVSRVGS+AQI A+K+ +G LKLELAQ+ EL AF+QF SDLDK T+  L  G+++ +++KQ + +P     +   +++    Y+  IPV+ +  F
  S:     2 VSIRPDEISSIIRQQIEQYEQSINVDNVGTVLQVGDGIARVYGLDKVMASELVEFEDGTVGIALNLEEDNVGVVLMGAGLGIEEGSTVRATGKIASVPVGEAVIGRVVDALMRPIDGKGEIHATATRLLESPAPGIVQRKSVCEPLQTGITAIDAMIPIGRGQRELIIGDRQTGKTAVAIDTILNQKGQDVICVYVAIGQKASSVAQVVNVLRERGALDYTIVVAANASDPAALQYLAPYTGASIAEYFMYQGKHTLVIYDDLSKQAQAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNDALGGGSMTALPIVETQAGDVSAYIPTNVISITDGQIFLSSDLFNAGLRPAINAGISVSRVGSAAQIKAMKQVAGKLKLELAQFDELQAFAQFASDLDKATQNQLARGQRLREILKQPQYSPIPVEYQVATIYAGTNGYLDDIPVEAVAKF 457
>gi|57504651|ref|ZP_00370729.1| ATP synthase F1, alpha subunit [Campylobacter coli RM2228] >gi|57019420|gb|EAL56115.1| ATP synthase F1, alpha subunit [Campylobacter coli RM2228] (501 aa)
Score = 1341, Expect = 6.6e-146, Identities = 261/500 (52%), Positives = 364/500 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQ-KTILETIDQTKDISQDLFVQIKNEFNSLITSYI 500
           M    D+ S+IIK +I+ +       E G++I+V DG+ +  GL N+M  E+V F+NG  GM LNLE ++ GIV+LGK E +KEG+ VKR K ++ VPVG+ L+GRV++A+G PID  G I  ++   +E+ A G+MAR SV EPL TG  AID++ PIG+GQRELIIGD+QTGKTT+A+D II+QKG+ V CIYV IGQK ST+ Q +  L++ GA++YT +V + ASD  +L YLAP+TG+T+ E +    +  LI+YDDLSKHA+AYR +SL+LRRPPGREAYPGD+FYLHSRLLER+ K+N E G GS+TALPIIET+AGD+SAYIPTNVISITDGQ+F+ T+LFNSG RPAI+ GLSVSRVG +AQI A K+ SG+L+L+LAQYREL AF+QF SDLD+ +++ LE G+++++L+KQ   +P S   + +L+F+  + Y+  + V  I +F++ I    + +   + E I   K +  +L  ++    N    +++
  S:     1 MKFKADEISSIIKERIENFDLNLEIEETGKIISVADGVAKVYGLKNIMAGEMVEFDNGDKGMALNLEESSVGIVILGKGEGLKEGTSVKRLKKLLKVPVGEALIGRVVNALGEPIDAKGVINSNEFRFVEEKAKGIMARKSVHEPLHTGIKAIDALVPIGRGQRELIIGDRQTGKTTVAVDTIISQKGQGVVCIYVAIGQKQSTVAQVVKRLEEHGAMDYTIVVNAGASDPAALQYLAPYTGVTMGEFFRDNAKHALIVYDDLSKHAVAYREMSLILRRPPGREAYPGDVFYLHSRLLERASKLNDELGAGSLTALPIIETQAGDVSAYIPTNVISITDGQIFLETDLFNSGIRPAINVGLSVSRVGGAAQIKATKQVSGTLRLDLAQYRELQAFAQFASDLDEASRKQLERGQRMVELLKQPPYSPLSVEKQVVLIFAGTKGYLDDVAVSKIREFEDGIYPFIEAKYPDLFEQIRSKKALDAELEEKLAKAINEFKANHL 501
>gi|193213548|ref|YP_001999501.1| ATP synthase F1, alpha subunit [Chlorobaculum parvum NCIB 8327] >gi|193087025|gb|ACF12301.1| ATP synthase F1, alpha subunit [Chlorobaculum parvum NCIB 8327] (526 aa)
Score = 1340, Expect = 8.2e-146, Identities = 258/498 (51%), Positives = 363/498 (72%)
  Q:     2 SINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKE------------------NGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQK-TILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           ++  D+ S+I++ Q+  ++++A   ++G V+ VGDGI +  GLSNV   EL+ F N   GM LNLE    G VM  K   +KEG  VKRT  +  +PVG+ +LGRV++ +G PIDG G I  + ++P+E+ APGV+ R SV EPL+TG  AID+M PIG+GQRELIIGD+QTGKT +A+D IINQKGK V+CIYV IG K ST+ Q +NTL++ GA+EYTT+V+++ASD   L ++APF G TI E +   G   L+IYDDLSK A+AYR LSLLLRRPPGREAYPGD+FYLHSRLLER+ KI  +                   GGGS+TALP+IET+AGD+SAYIPTNVISITDGQ+F+ +NLFN+GQRPAI+ G+SVSRVG +AQI A+KK +G+L+L+LAQ+REL+AFS+FGSDLDK TK  L+ G ++++++KQ +  P +   +  ++F   +  +  + + Y+  F+E  +   +Q+   +L +I +T  +  D+  ++ +     + ++
  S:     4 AVRPDEVSSILRKQLAGFESEADVYDVGTVLQVGDGIARIYGLSNVAAGELLEFPNDVMGMALNLEEDNVGAVMFSKASSVKEGDTVKRTNILASIPVGEAMLGRVVNPLGEPIDGKGPINTEIRLPLERRAPGVIFRKSVHEPLQTGLKAIDAMIPIGRGQRELIIGDRQTGKTAVALDTIINQKGKGVQCIYVAIGLKGSTVAQVVNTLEKHGAMEYTTVVSATASDPAPLQFIAPFAGATIGEFFRDTGRHALVIYDDLSKQAVAYRQLSLLLRRPPGREAYPGDVFYLHSRLLERAAKITDDIEVARQMNDLPEPLKPMVKGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLESNLFNAGQRPAINVGISVSRVGGAAQIKAMKKVAGTLRLDLAQFRELEAFSKFGSDLDKATKAQLDRGARLVEILKQGQYIPMAVEKQVAIIFVGTQGLLDTVDIKYVRQFEESFLEMLEQKHPDLLSSIAETGKLESDMASKLTDVAQKYVAAF 520
>gi|154249024|ref|YP_001409849.1| F0F1 ATP synthase subunit alpha [Fervidobacterium nodosum Rt17-B1] >gi|171769322|sp|A7HJV9|ATPA_FERNB ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|154152960|gb|ABS60192.1| ATP synthase F1, alpha subunit [Fervidobacterium nodosum Rt17-B1] (507 aa)
Score = 1340, Expect = 8.3e-146, Identities = 250/483 (51%), Positives = 363/483 (75%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLF-ENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQ-KTILETIDQTKDISQD 483
           M +N  +   +++ +I +Y+ +    + G+VI VGDGI +  GL+NVM NE+V F E G+ G+  NLE    GI++LG ++DIKEG  V+R   +++VPVG+GLLGRV++ +G P+DG G ++Y +  PIE  APGV+ R  V  PL+TG   +DS+ PIG+GQRELIIGD+QTGKT IAID IINQKGK V CIYV IGQK S + + +  L+Q GA+EYTT+V +++SD  +L Y+AP+ G  + E +M  G+D L++YDDLSKHA+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ ++N++ GGGS+TALPIIET+A DISAYIPTNVISITDGQ+++   LF +GQRPA++ GLSVSRVG +AQI A+K+ +GSLKL+LAQ++EL+ F+QF ++LD  T+  +  G+++M+L+KQ + +P     + ++LF+    Y+  +P++ ++ F+E +++  K++  ++L+ I  TK +S++
  S:     1 MRLNPGEIVRVLETKISDYKEEIRLEDTGKVIQVGDGIARVYGLNNVMANEMVEFVETGTKGLAFNLEEDNVGIIILGDYKDIKEGHTVRRLNRIMEVPVGEGLLGRVVNPLGEPLDGLGPVEYKETRPIEFKAPGVIFRKPVDTPLQTGLKVVDSLIPIGRGQRELIIGDRQTGKTAIAIDTIINQKGKGVYCIYVAIGQKASAVARIVEKLRQTGAMEYTTVVVAASSDPATLQYIAPYAGCAMGEYFMFNGKDALVVYDDLSKHAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLERAARLNEKYGGGSLTALPIIETQANDISAYIPTNVISITDGQIYLEPGLFYAGQRPAVNIGLSVSRVGGAAQIKAMKQVAGSLKLDLAQFQELETFAQFATELDPATQAQITRGQRLMELMKQPQYSPMEVEDQVVVLFAGINGYLDDLPINAVKAFEEGLLKFVKEKYSSLLDEIRTTKQLSKE 485
>gi|170017977|ref|YP_001728896.1| ATP synthase F1, alpha subunit [Leuconostoc citreum KM20] >gi|169804834|gb|ACA83452.1| ATP synthase F1, alpha subunit [Leuconostoc citreum KM20] (504 aa)
Score = 1340, Expect = 9.1e-146, Identities = 256/483 (53%), Positives = 360/483 (74%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKT-ILETIDQTKDISQD 483
           M+I  ++ S +IK Q++++       E+G V  +GDG+ +A+GL+N M  EL+ F NG++GM  NLE++  GI++LG F+DI+EG  VKRT  +++VPVG+ L+GRV++A+G PIDG GEIK DK  P+E  APGVM R SV EPL+TG  AID++ PIG+GQRELIIGD++TGKT++AID I+NQK +N+  IYV IGQK+ST+   + TL+Q GA++YT +V +  S+   + YLAP+ G  + EE+M  G+ VLI+YDDLSK A AYR LSL+LRRPPGREAYPGD+FYLHSRLLER+ K++ E GGGS+TALPIIET+AGD+SAYIPTNVISITDGQ+F+  + F +G RPAIDAG SVSRVG  AQI A+KK +G+L+L+LA +REL++F+QFGSDLD  T+  L  G++ ++++KQ  + P     + I+L+++   YI  I V+ I+ F++++I +       + + I  TK + ++
  S:     1 MAIQAEEISALIKQQLEKFDTTLTVEEVGTVTYIGDGVARATGLANAMAGELLEFANGTFGMAQNLESSEVGIIILGGFDDIREGDTVKRTGRIMEVPVGEQLIGRVVNALGQPIDGLGEIKTDKFRPVEVKAPGVMQRKSVFEPLQTGIKAIDALVPIGRGQRELIIGDRKTGKTSLAIDTILNQKDQNMIVIYVAIGQKDSTVRTQVETLRQMGAMDYTIVVNAGPSEPAPMLYLAPYVGAAMGEEFMYNGKHVLIVYDDLSKQATAYRELSLILRRPPGREAYPGDVFYLHSRLLERAAKLSDELGGGSMTALPIIETQAGDVSAYIPTNVISITDGQVFLDADQFYAGVRPAIDAGTSVSRVGGDAQIKAMKKVAGTLRLDLASFRELESFAQFGSDLDAATQAKLARGRRTVEVLKQPLHKPMPVQHQVIVLYALTHGYIDDIAVEDIQRFQDELIAYVDANANDLFKVIIDTKQLPEE 484
>gi|108762039|ref|YP_635141.1| F0F1 ATP synthase subunit alpha [Myxococcus xanthus DK 1622] >gi|108465919|gb|ABF91104.1| ATP synthase F1, alpha subunit [Myxococcus xanthus DK 1622] (552 aa)
Score = 1340, Expect = 9.5e-146, Identities = 266/495 (53%), Positives = 353/495 (71%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSI-------KEKYIRWIP----VDYIEDFKEKII-RHFKQQKTILETIDQTKDISQDLFVQIKNEFNSL 495
           M I  D+ S II+ QIK+Y  K   +E G V++VGDGI +  GL   +  ELV F NG  G+ LNLE    G+ ++G F+ I+EG  VKRT+ +  VPVG  LLGRV+D +G P+DG G I   +   +E  APG+++R SV EPL+TG  A+D++ P+G+GQRELIIGD+QTGKT +AID IINQKG NV CIYV IGQK ST+ Q +  L ++GA+EYTT+VAS+ASD   + + AP+ G+ + E +       LI+YDDLSK A+AYR LSLLLRRPPGREAYPGD+FY+HSRLLER+ K++ E G GS+TALPIIET+AGD+SAYIPTNVISITDGQ+F+ T+LF +G RPAI+ GLSVSRVGS+AQI A+K+ +G++KLELAQYREL AF+QFGSDLDK T+E L  G ++++L+KQ +  P     + + +++        K  +IR IP    V ++ +F E    +H    K +    + T DI   L   I  EFN +
  S:    38 MEIRADEISRIIREQIKDYGKKVTVAETGTVLSVGDGIARIYGLEGALAGELVEFANGVQGLVLNLEEDNVGVAIMGDFQAIREGDTVKRTQQIASVPVGKELLGRVVDPLGKPLDGKGPIAATETRRLEVKAPGIVSRKSVHEPLQTGIKALDALVPVGRGQRELIIGDRQTGKTAVAIDTIINQKGLNVYCIYVAIGQKQSTVAQVVEKLNRYGAMEYTTVVASNASDPAPMQFFAPYAGVAMGEYFRDNKMHALIVYDDLSKQAVAYRQLSLLLRRPPGREAYPGDVFYVHSRLLERAAKLSDEEGAGSLTALPIIETQAGDVSAYIPTNVISITDGQIFLETDLFFAGVRPAINVGLSVSRVGSAAQIKAMKQVAGTMKLELAQYRELAAFAQFGSDLDKATQETLARGARMVELLKQGQYEPMPVEKQVMQIYAATNRDDPKKRGWIRDIPTADVVRWMREFLEFADGKHPNVAKDLASKRELTADIKTALSKAI-TEFNEV 543
>gi|149007585|ref|ZP_01831220.1| F0F1 ATP synthase subunit alpha [Streptococcus pneumoniae SP18-BS74] >gi|147760944|gb|EDK67914.1| F0F1 ATP synthase subunit alpha [Streptococcus pneumoniae SP18-BS74] (454 aa)
Score = 1340, Expect = 9.8e-146, Identities = 256/436 (58%), Positives = 335/436 (76%)
  Q:    48 MLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK-QQKTILETIDQTKDISQD 483
           M  EL+ FENGSYGM  NLE+T  GI++LG F DI+EG  ++RT  +++VPVG+ L+GRV+D +G P+DG GEI  DK  P+E  APGVM R SV EPL+TG  AID++ PIG+GQRELIIGD+QTGKTTIAID I+NQK +++ CIYV IGQK ST+   + TL+Q+GAL+YT +V +SAS    L +LAP+ G+ +AEE+M +G+ VLI+YDDLSK A+AYR LSLLLRRPPGREA+PGD+FYLHSRLLERS K++ E GGGSITALP IET+AGDISAYI TNVISITDGQ+F+   LFN+G RPAIDAG SVSRVG SAQI A+KK +G+L+++LA YREL+AF++FGSDLD  T+  L  G++ ++++KQ  + P     +  +L+++   ++  +PVD I  F+E+    F  Q   ILETI  TKD+ ++
  S:     1 MSGELLNFENGSYGMAQNLESTDVGIIILGDFTDIREGDTIRRTGKIMEVPVGESLIGRVVDPLGRPVDGLGEIHTDKTRPVEAPAPGVMQRKSVSEPLQTGLKAIDALVPIGRGQRELIIGDRQTGKTTIAIDTILNQKDQDMICIYVAIGQKESTVRTQVETLRQYGALDYTIVVTASASQPSPLLFLAPYAGVAMAEEFMYQGKHVLIVYDDLSKQAVAYRELSLLLRRPPGREAFPGDVFYLHSRLLERSAKVSDELGGGSITALPFIETQAGDISAYIATNVISITDGQIFLGDGLFNAGIRPAIDAGSSVSRVGGSAQIKAMKKVAGTLRIDLASYRELEAFTKFGSDLDAATQAKLNRGRRTVEVLKQPVHKPLPVEKQVTILYALTHGFLDTVPVDDIVRFEEEFHAFFDAQHPEILETIRDTKDLPEE 437
>gi|167458489|ref|ZP_02324691.1| ATP synthase F1, alpha subunit [Anaeromyxobacter dehalogenans 2CP-1] >gi|167415246|gb|EDR81978.1| ATP synthase F1, alpha subunit [Anaeromyxobacter dehalogenans 2CP-1] (510 aa)
Score = 1340, Expect = 1.0e-145, Identities = 261/484 (53%), Positives = 351/484 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEK------YIRWIPVDYIEDFKEKII-----RHFKQQKTILETIDQTKDISQDL 484
           M I  D+ S II+ QIK+Y  K   +E G +++  DG+ +  GL+     EL+ F  G  G+ LNLE    G  ++G +E I+EG  VKRT  + +VPVG+ LLGRV+D +GNPIDG G +       IE  APG++ R SV EP++TG  AID++ PIG+GQRELI+GD+QTGKT +AID I+N KG N+ C YV IGQK ST+ + ++TLK++GA+EYTT++++SASD   + YLAP+TG+T+AE +   G   LIIYDDLSK A+AYR LSLLLRRPPGREAYPGD+FYLHSRLLER+ K++ + G GS+TALPIIET+AGD+SAYIPTNVISITDGQ+F+ +NLF  G RPAI+ G+SVSRVG SAQI A+K+ +GSLKL+LAQYREL AF+QFGSDLDK T+E L  G+++++L+KQ +  P S   + I +++  +K      +IR +P + +  +  ++I     RH    K I E       I +DL
  S:     1 MEIRADEISRIIREQIKDYGKKVEVAETGSILSQADGVARIYGLAGAAAGELLEFPGGIRGLVLNLEEDNVGAAIMGPYEHIREGDPVKRTGLIAEVPVGEELLGRVVDGLGNPIDGRGPLNAKHHRKIEIKAPGIVKRKSVHEPMQTGLKAIDALVPIGRGQRELILGDRQTGKTAVAIDTILNNKGNNLYCFYVAIGQKQSTVARVVDTLKKYGAMEYTTVISASASDPAPMQYLAPYTGVTMAEYFRDSGRHALIIYDDLSKQAVAYRQLSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSDKEGAGSLTALPIIETQAGDVSAYIPTNVISITDGQIFLESNLFYQGVRPAINVGISVSRVGGSAQIKAMKQVAGSLKLDLAQYRELAAFAQFGSDLDKATQETLARGERLVELLKQGQYAPLSVEKQVIQIYAGTQKDTDGQNWIRAVPTEQVVRYMRELIEFLDARHPGIAKAIAEKKALDDGIRKDL 495
>gi|196179679|gb|EDX74673.1| ATP synthase F1, alpha subunit [Microcoleus chthonoplastes PCC 7420] (505 aa)
Score = 1339, Expect = 1.1e-145, Identities = 265/483 (54%), Positives = 358/483 (74%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKTIL-ETIDQTKDISQD 483
           +SI  D+ S+II+ QI++Y  +   S +G V+ VGDGI +  GL   M  ELV FE+G+ G+ LNLE    G+V++G+  DI+EGS VK T  +  VPVG+ L+GRV+DA+  PIDG GEI+  +   IE  APG++AR SV EPL+TG  AID+M P+G+GQRELIIGD+QTGKT IAID I+NQK ++V C+YV +GQK ST+VQ ++ L++ GAL+YT IVA++ASD  +L YLAP+TG +IAE +M KG+  L+IYDDLSK A AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+N + GGGS+TALPIIET+AGD+SAYIPTNVISITDGQ+F+  +LFNSG RPAI+ G+SVSRVGS+AQ  A+KK +G LKL+LAQ+ +L AF+QF SDLDK T++ L  G ++ +L+KQ + +P +   +  L+++    Y+  I V+ +  F + +  + K  K    E I   K +++D
  S:     2 VSIRPDEISSIIRQQIEQYDQEVKVSNVGTVLQVGDGIARVYGLDQCMAGELVEFEDGTVGIALNLEEDNVGVVLMGEGLDIQEGSSVKATGKIAQVPVGEALIGRVVDALARPIDGKGEIQSGESRLIESSAPGIIARRSVYEPLQTGITAIDAMIPVGRGQRELIIGDRQTGKTAIAIDTILNQKEEDVICVYVAVGQKASTVVQVVDALEERGALDYTVIVAANASDPATLQYLAPYTGASIAEYFMYKGKATLVIYDDLSKQAQAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNDDLGGGSMTALPIIETQAGDVSAYIPTNVISITDGQIFLSADLFNSGLRPAINPGISVSRVGSAAQTKAIKKVAGKLKLDLAQFDDLQAFAQFASDLDKATQDQLSRGVRLRELLKQPQYSPLAVYEQVALVYAGINGYLDDIEVEKVTAFTKGLRDYLKTSKPQFGEIIKDKKVLTED 485
>gi|154503954|ref|ZP_02041014.1| hypothetical protein RUMGNA_01780 [Ruminococcus gnavus ATCC 29149] >gi|153795381|gb|EDN77801.1| hypothetical protein RUMGNA_01780 [Ruminococcus gnavus ATCC 29149] (505 aa)
Score = 1339, Expect = 1.1e-145, Identities = 263/487 (54%), Positives = 359/487 (73%)
  Q:     2 SINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQ-KTILETIDQTKDISQDLFVQI 488
           SIN D+  +I+K +I+ + + +  SE+G V+ VGDGI    G+ + M  E+V F+ G  GM  +++    G+++ G+  DIKEG+ V RT     VPVG+  +GRV++A+G PIDG GEI+ D   PIE+ APG++ R SV  P+ETG L+ID+MFPIG+GQRELIIGD+QTGKT+IA+D I+NQKGK+V CIYV IGQK ST+ + +NTLK   AL+YT +V+S+ASD   L Y+AP+ G  +AE +M +G+DVLI+YDDLSKHA+AYR LSLLL R PGREAYPGD+FYLHSRLLERS +++ E GGGSITALPIIET+AGD+SAYIPTNVISITDGQ+F+ ++LF +G RPA++ GLSVSRVG +AQ  A+KK SGS++++LAQYRE++ F+QF SDLD  TKE LE+G  +M+L+KQ    P S   + I L +   K +  I    I+ F+  ++RHF      I + I++ K ++++L  +I
  S:     6 SINSDEIISILKEEIENFDSVSKDSEVGTVVAVGDGIATIYGIDHAMYGEIVTFDTGLKGMVQDIQKNEIGVILFGRDTDIKEGTKVTRTGKKAGVPVGNKYVGRVVNALGAPIDGKGEIEADDYRPIEQEAPGIIDRKSVSVPMETGILSIDAMFPIGRGQRELIIGDRQTGKTSIAMDTILNQKGKDVICIYVAIGQKASTVAKVVNTLKNNDALDYTIVVSSTASDCAPLQYIAPYAGTAMAEHFMYQGKDVLIVYDDLSKHAVAYRALSLLLGRSPGREAYPGDVFYLHSRLLERSSRLSDELGGGSITALPIIETQAGDVSAYIPTNVISITDGQIFLESDLFAAGMRPAVNVGLSVSRVGGAAQTKAMKKASGSIRIDLAQYREMEVFTQFSSDLDAATKEQLEYGSGLMELLKQPLYHPLSLHEKVITLCAATHKVMLGIEKAKIKQFQADLLRHFDSDYPEIGQEIEEKKVLTEELIEKI 493
>gi|125624727|ref|YP_001033210.1| F0F1 ATP synthase subunit alpha [Lactococcus lactis subsp. cremoris MG1363] >gi|146286054|sp|A2RMI4|ATPA_LACLM ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|6048351|gb|AAF02206.1|AF059739_6 H+-ATPase cytoplasmic F1-part alpha-subunit [Lactococcus lactis subsp. cremoris] >gi|15963435|dbj|BAB69469.1| H+-ATPase alpha subunit [Lactococcus lactis subsp. lactis] >gi|124493535|emb|CAL98516.1| ATP synthase alpha chain [Lactococcus lactis subsp. cremoris MG1363] (500 aa)
Score = 1339, Expect = 1.1e-145, Identities = 259/483 (53%), Positives = 356/483 (73%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQ-KTILETIDQTKDISQD 483
           M+I  ++ S++IK QI+ +      +E G V  VGDGI +A GL N M  ELV F NG  GM  NL+AT  GI++LG F  I+EG  VKRT  ++++ VG+ L+GRV++ +G P+DG GE+   K  P+E  APGVM R SV EPL+TG  AID++ PIG+GQRELIIGD+QTGKT++AIDAI+NQKG+++ CIYV IGQK ST+   + TL++ GA++YT +V +SAS    L Y+AP+ G  + EE+M  G+ VL++YDDLSK A+AYR LSLLLRRPPGREAYPGD+FYLHSRLLER+ K++ + GGGS+TALP IET+AGDISAYI TNVISITDGQ+F+  +LF SG RPAIDAG SVSRVG +AQI A+KK +G+L+L+LA +REL+AF+QFGSDLD+ T+  L  G++ ++++KQ  + P +   + ++L+++   ++  +PVD + DF+ K+   F      +L  I  TKD+ ++
  S:     1 MAIKANEISSLIKKQIENFTPDFEVAETGVVTYVGDGIARAYGLENAMSGELVEFSNGILGMAQNLDATDVGIIVLGDFLSIREGDTVKRTGKIMEIQVGEELIGRVVNPLGQPVDGLGELNTGKTRPVEAKAPGVMQRKSVSEPLQTGLKAIDALVPIGRGQRELIIGDRQTGKTSVAIDAILNQKGQDMICIYVAIGQKESTVRTQVETLRKLGAMDYTIVVTASASQPSPLLYIAPYAGAAMGEEFMYNGKHVLVVYDDLSKQAVAYRELSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSDDLGGGSMTALPFIETQAGDISAYIATNVISITDGQIFLENDLFYSGVRPAIDAGSSVSRVGGAAQIKAMKKVAGTLRLDLASFRELEAFTQFGSDLDEATQAKLNRGRRTVEVLKQPLHKPLAVEKQVLILYALTHGHLDNVPVDDVLDFETKMFDFFDANYADLLNVITDTKDLPEE 484
>gi|57240726|ref|ZP_00368674.1| ATP synthase F1, alpha subunit [Campylobacter lari RM2100] >gi|57018345|gb|EAL55119.1| ATP synthase F1, alpha subunit [Campylobacter lari RM2100] (501 aa)
Score = 1339, Expect = 1.2e-145, Identities = 265/500 (53%), Positives = 364/500 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQK--TILETIDQTKDISQDLFVQIKNEFNSLITSYI 500
           M    D+ S+IIK +I+++       E G++I+V DG+ +  GL N M  E+V FENG  GM LNLE ++ GIV+LGK   +KEGS VKR K ++ VPVGD L+GRV++A+G PID  G I+  +   +E+ A G+MAR SV EPL TG  AID++ PIG+GQRELIIGD+QTGKTT+AID II+QKGK+V CIYV IGQK ST+ Q +  L+++GA++YT +V + ASD  +L YLAP+ G+T+ E +       LI+YDDLSKHA+AYR +SL+LRRPPGREAYPGD+FYLHSRLLER+ K++ E G GS+TALPIIET+AGD+SAYIPTNVISITDGQ+F+ T+LFNSG RPAI+ GLSVSRVG +AQI A K+ SG+L+L+LAQYREL AF+QF SDLD+ +++ LE G+++++++KQ   +P S   + +++F+  + Y+  + V  I +F E  +  F + K   I E I   K + +DL  ++    +    ++I
  S:     1 MKFKADEISSIIKERIEKFDFNLEIEETGKIISVADGVAKVYGLKNAMAGEMVEFENGEKGMVLNLEESSVGIVILGKGLGLKEGSSVKRLKKLLKVPVGDALIGRVVNALGEPIDAKGVIEASEYRFVEEKAKGIMARKSVHEPLHTGIKAIDALVPIGRGQRELIIGDRQTGKTTVAIDTIISQKGKDVICIYVAIGQKQSTVAQVVKKLEEYGAMDYTIVVNAGASDPAALQYLAPYAGVTMGEYFRDNSRHALIVYDDLSKHAVAYREMSLILRRPPGREAYPGDVFYLHSRLLERASKLSDELGAGSLTALPIIETQAGDVSAYIPTNVISITDGQIFLETDLFNSGIRPAINVGLSVSRVGGAAQIKATKQVSGTLRLDLAQYRELQAFAQFASDLDEASRKQLERGQRMVEVLKQPPYSPLSPENQVVIIFAGTKGYLDDVAVSKIGEF-EAALYPFIEAKYPEIFEQIRTKKALDKDLEEKLAKALSEFKANHI 501
>gi|116493067|ref|YP_804802.1| F0F1 ATP synthase subunit alpha [Pediococcus pentosaceus ATCC 25745] >gi|122265469|sp|Q03EL2|ATPA_PEDPA ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|116103217|gb|ABJ68360.1| F0F1-type ATP synthase, alpha subunit [Pediococcus pentosaceus ATCC 25745] (505 aa)
Score = 1338, Expect = 1.5e-145, Identities = 254/480 (52%), Positives = 356/480 (74%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHF-KQQKTILETIDQTKDI 480
           MSI  ++ S +IK Q++ YQ +    E G V  VGDGI +A GL+N +  EL+ F NG +GM  NLE+   GIV++G ++ I EG +VKRT  +++VPVGD L+GRV++ +G P+DG G I+  K  P+E  APGVM R SV +PL+TG  AID++ PIG+GQRELIIGD++TGKTTIAID I+NQK +++ CIYV IGQK ST+   + TL+++GA++YT +V++  S+   + YLAP+ G  + EE+M  G+ VLI+YDDLSK A AYR LSL+LRRPPGREAYPGDIFY HSRLLER+ K++ + GGGS+TALP +ET+AGD+SAYIPTNVISITDGQ+F+  + FNSG RPAIDAG SVSRVG  AQI A+KK +G+L+L+LA YREL++F+QFGSDLDK T+  L  G++ ++++KQ  + P S   + ++L+++   ++  +PVD I+ F++++  +     K + + I +TK +
  S:     1 MSIKAEEISALIKQQLENYQAELNVEETGTVTYVGDGIARAHGLNNALSGELLEFSNGVFGMVQNLESNDVGIVIMGNYDGIHEGDVVKRTGRIMEVPVGDALIGRVVNPLGEPLDGKGAIQTTKTRPVENKAPGVMQRKSVEQPLQTGIKAIDALVPIGRGQRELIIGDRKTGKTTIAIDTILNQKDQDMICIYVAIGQKESTVRTQVETLRRYGAMDYTIVVSAGPSEPAPMLYLAPYAGAAMGEEFMYNGKHVLIVYDDLSKQADAYRELSLILRRPPGREAYPGDIFYTHSRLLERAAKLSDDLGGGSMTALPFVETKAGDVSAYIPTNVISITDGQVFLDGDYFNSGTRPAIDAGTSVSRVGGDAQIKAMKKVAGTLRLDLASYRELESFAQFGSDLDKATQAKLARGRRTVEVLKQPLHQPLSVENQVMILYALTHGFLDNVPVDDIQRFQDELFDYIASNNKELTDEIRETKQL 481
>gi|57505329|ref|ZP_00371258.1| ATP synthase F1, alpha subunit [Campylobacter upsaliensis RM3195] >gi|57016465|gb|EAL53250.1| ATP synthase F1, alpha subunit [Campylobacter upsaliensis RM3195] (501 aa)
Score = 1338, Expect = 1.7e-145, Identities = 259/484 (53%), Positives = 355/484 (73%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQ-KTILETIDQTKDISQDL 484
           M    D+ S+IIK +I+ +       E G++I++ DG+ +  GL N+M  E+V FENG  GM LNLE ++ GIV+LGK E +KEG  VKR K ++ VPVG+ L+GRV++A+G PID  G I   +   +E+ A G+MAR SV EPL TG  AID++ PIG+GQRELIIGD+QTGKTT+A+D II+Q+G+ V CIYV IGQK ST+ Q +  L++ GA+EYT +V + ASD  +L YLAP+ G+T+ E +    +  LI+YDDLSKHA+AYR +SL+LRRPPGREAYPGD+FYLHSRLLER+ K+N E G GS+TALPIIET+AGD+SAYIPTNVISITDGQ+F+ T+LFNSG RPAI+ GLSVSRVG +AQI A K+ SG+L+L+LAQYREL AF+QF SDLD+ +++ LE G+++++L+KQ   +P S   + +L+F+    ++  + V  I +F++ I    + +   + E I   K + +DL
  S:     1 MKFKADEISSIIKERIENFDLNLEIEETGKIISIADGVAKVYGLKNIMAGEMVEFENGEKGMALNLEESSVGIVVLGKGEGLKEGDSVKRLKKLLKVPVGEALIGRVVNALGEPIDAKGSINASEFRFVEEKAKGIMARKSVHEPLHTGIKAIDALVPIGRGQRELIIGDRQTGKTTVAVDTIISQRGQGVICIYVAIGQKQSTVAQVVKRLEEHGAMEYTIVVNAGASDSAALQYLAPYAGVTMGEYFRDNSKHALIVYDDLSKHAVAYREMSLILRRPPGREAYPGDVFYLHSRLLERASKLNDELGAGSLTALPIIETQAGDVSAYIPTNVISITDGQIFLETDLFNSGIRPAINVGLSVSRVGGAAQIKATKQVSGTLRLDLAQYRELQAFAQFASDLDEASRKQLERGQRMVELLKQPPYSPLSVEKQVVLIFAGTRGFLDDVAVSKIREFEDGIYPFIEAKYPDLFEQIRTKKALDKDL 485
>gi|85374581|ref|YP_458643.1| F0F1 ATP synthase subunit alpha [Erythrobacter litoralis HTCC2594] >gi|123293698|sp|Q2N8Z5|ATPA_ERYLH ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|84787664|gb|ABC63846.1| ATP synthase alpha subunit [Erythrobacter litoralis HTCC2594] (509 aa)
Score = 1338, Expect = 1.7e-145, Identities = 260/483 (53%), Positives = 353/483 (73%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQK--------GKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKT-ILETIDQTKDISQD 483
           M I   + S +IK+QI  +  +A  SE+G V++VGDGI +  GL NV   E+V F NG  GM LNLEA   G+V+ G   +IKEG  VKRT+ +VDVPVG  LLGRV+DA+GNPIDG G I+  ++  +E  APG++ R SV EP+++G  AID++ P+G+GQRELIIGD+QTGKT +AID  INQK         K + C+YV +GQK ST+ Q + +L++ GA+EY+ +VA++AS+   L YLAP+TG  + E +   G   +I+YDDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+N +NGGGS+TALPIIET+AGD+SAYIPTNVISITDGQ+F+ T+LF  G RPAI+ GLSVSRVG +AQ  A+KK SGS+KLELAQYRE+ AF+QFGSDLD  T+++L  G ++ +L+KQ + +P     + + +F+    YI  + VD + +++ +++   + +   IL+TI  T     D
  S:     1 MDIRAAEISKVIKDQIANFGTEAQVSEVGSVLSVGDGIARIHGLDNVQAGEMVEFANGVQGMALNLEADNVGVVIFGSDAEIKEGDNVKRTETIVDVPVGKALLGRVVDALGNPIDGKGPIETTERRRVELKAPGIIPRKSVDEPVQSGLKAIDALVPVGRGQRELIIGDRQTGKTAVAIDTFINQKTVNESDDESKKLYCVYVAVGQKRSTVAQIVKSLEENGAMEYSIVVAATASEPAPLQYLAPYTGCAMGEFFRDNGMHAVIVYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDDNGGGSLTALPIIETQAGDVSAYIPTNVISITDGQIFLETDLFYQGVRPAINVGLSVSRVGGAAQTKAMKKVSGSIKLELAQYREMAAFAQFGSDLDASTQKLLNRGARLTELLKQPQFSPMPFEEQTVSIFAGTNGYIDDVAVDRVTEYESQMLSFMRSEHADILKTIRDTGKFEDD 492
>gi|110635545|ref|YP_675753.1| F0F1 ATP synthase subunit alpha [Mesorhizobium sp. BNC1] >gi|118573481|sp|Q11DD7|ATPA_MESSB ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|110286529|gb|ABG64588.1| ATP synthase F1, alpha subunit [Mesorhizobium sp. BNC1] (509 aa)
Score = 1338, Expect = 1.7e-145, Identities = 259/499 (51%), Positives = 359/499 (71%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKN--------VKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQ-KTILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           M I   + S I+K+QIK +  +A  SE+G+V++VGDGI +  GL NV   E+V F  G  GM LNLE    G+V+ G   DIKEG  VKRT  +V+VPVG GLLGRV+DA+GNPIDG G I+  ++  ++  APG++ R SV EP+ TG  AID++ PIG+GQRELIIGD+QTGKT I +D  +NQK  N        + CIYV +GQK ST+ QF+  L++ GALEY+ +VA++ASD   + +LAPF G  + E +   G+  +I YDDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+N +NG GS+TALP+IET+A D+SAYIPTNVISITDGQ+F+ TNLF  G RPA++ GLSVSRVGS+AQ+ A+K+ +GS+K ELAQYRE+ AF+QFGSDLD  T+ +L  G ++ +L+KQ + +P     + +++F+    Y+  + +  +  F++ ++ H + + K IL+ I   K +S DL  ++K E ++   ++
  S:     1 MDIRAAEISAILKDQIKNFGKEAEVSEVGQVLSVGDGIARVYGLDNVQAGEMVEFPGGIRGMALNLEVDNVGVVIFGADRDIKEGDTVKRTGAIVEVPVGPGLLGRVVDALGNPIDGKGPIQATERRRVDVKAPGIIPRKSVHEPMSTGLKAIDALIPIGRGQRELIIGDRQTGKTAIILDTFLNQKPLNDGDDESQKLYCIYVAVGQKRSTVAQFVKVLEERGALEYSIVVAATASDPAPMQFLAPFAGCAMGEYFRDNGKHAVIAYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDDNGSGSLTALPVIETQANDVSAYIPTNVISITDGQIFLETNLFFQGVRPAVNVGLSVSRVGSAAQVKAMKQVAGSIKGELAQYREMAAFAQFGSDLDAATQRLLNRGARLTELLKQPQFSPLKTEEQVVVIFAGVNGYLDALALRDVGRFEQGLLTHMRSEGKEILDAIRVEKALSDDLRAKLKAEIDAYAKNF 508
>gi|115396612|ref|XP_001213945.1| ATP synthase alpha chain, mitochondrial precursor [Aspergillus terreus NIH2624] >gi|114193514|gb|EAU35214.1| ATP synthase alpha chain, mitochondrial precursor [Aspergillus terreus NIH2624] (556 aa)
Score = 1338, Expect = 1.7e-145, Identities = 260/491 (52%), Positives = 355/491 (72%)
  Q:     9 SNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQK--------GKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK-QQKTILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           S+I++ +I+  Q ++  +E GRV++VGDGI +  G++NV   ELV F +G  GM +NLEA   G+V+ G    +KEG  VKRT  +VDVPVG  LLGRV+DA+GNPIDG G I    K   +  APG++ R SV +P++TG   +DSM PIG+GQRELIIGD+QTGKT +A+DA++NQK         K + CIYV +GQK ST+ Q + TL++  A++Y+ IVA++AS+   L YLAPFTG  + E +   G   +I+YDDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+N+++GGGS+TALP+IET+ GD+SAYIPTNVISITDGQ+F+ + LF  G RPAI+ GLSVSRVGS+AQ+ A+K+ +GSLKL LAQYRE+ AF+QFGSDLD  TK+ L  G+++ +L+KQ + +P + S    L+F+    Y+  IPV  I  ++   + H K     I ETI++   +S+DL  Q+K    +   S+
  S:    55 SSILEQRIRGVQEESGLAETGRVLSVGDGIARVHGMTNVQAEELVEFASGVKGMCMNLEAGQVGVVLFGSDRLVKEGETVKRTGEIVDVPVGPELLGRVVDALGNPIDGKGPINAKAKSRAQLKAPGILPRRSVNQPVQTGMKCVDSMVPIGRGQRELIIGDRQTGKTAVALDAMLNQKRWNNSSDESKKLYCIYVAVGQKRSTVAQLVKTLEENDAMKYSIIVAATASEAAPLQYLAPFTGCAMGEWFRDNGRHAVIVYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNEKHGGGSLTALPVIETQGGDVSAYIPTNVISITDGQIFLESELFYKGIRPAINVGLSVSRVGSAAQVKAMKQVAGSLKLFLAQYREVAAFAQFGSDLDAATKQTLNRGERLTELLKQKQYSPMAVSDMVPLIFAGVNGYLDSIPVAKILQWESDFLAHLKSNHPEIQETIEKEGQVSKDLEAQLKEVIGAFNKSF 554
>gi|15966789|ref|NP_387142.1| F0F1 ATP synthase subunit alpha [Sinorhizobium meliloti 1021] >gi|81633813|sp|Q92LK6|ATPA_RHIME ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|15076061|emb|CAC47615.1| Probable ATP synthase subunit alpha [Sinorhizobium meliloti 1021] (509 aa)
Score = 1337, Expect = 2.1e-145, Identities = 261/499 (52%), Positives = 355/499 (71%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQK--------GKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQ-KTILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           M I   + S I+K+QIK +  +A  SE+G+V++VGDGI +  GL NV   E+V F  G  GM LNLEA   G+V+ G   DIKEG  VKRT  +VDVPVG  LLGRV+DA+GNPIDG G I   ++  ++  APG++ R SV EP+ TG  AID++ P+G+GQREL+IGD+QTGKT I +D I+NQK        G  + C+YV IGQK ST+ QF+  L++ GAL+Y+ IVA++ASD   + YLAPF G  + E +   G+  LI YDDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K++ E G GS+TALP+IET+  D+SA+IPTNVISITDGQ+F+ T+LF  G RPA++ GLSVSRVGSSAQI A+K+ +GS+K ELAQYRE+ AF+QFGSDLD  T+ +L  G ++ +L+KQ + +P     +  ++F+    Y+  +PV  +  F+  ++ + + + K +L+TI   K IS D   ++K   +S   S+
  S:     1 MDIRAAEISAILKDQIKNFGQEAEVSEVGQVLSVGDGIARVYGLDNVQAGEMVEFPGGIRGMALNLEADNVGVVIFGSDRDIKEGDTVKRTGAIVDVPVGPELLGRVVDALGNPIDGKGPINAKQRARVDVKAPGIIPRKSVHEPMSTGLKAIDALIPVGRGQRELVIGDRQTGKTAIILDTILNQKAIHDNGPEGDKLYCVYVAIGQKRSTVAQFVKVLEERGALQYSIIVAATASDPAPMQYLAPFAGCAMGEYFRDNGKHALIGYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSDERGAGSLTALPVIETQGNDVSAFIPTNVISITDGQIFLETDLFYQGIRPAVNVGLSVSRVGSSAQIKAMKQVAGSIKGELAQYREMAAFAQFGSDLDAATQRLLNRGARLTELLKQPQFSPLKTEEQVAVIFAGVNGYLDKLPVSDVGKFEHGLLSYLRSEGKAVLDTIRTEKAISDDTKAKLKGAIDSFAKSF 508
>gi|148266271|ref|YP_001232977.1| F0F1 ATP synthase subunit alpha [Geobacter uraniireducens Rf4] >gi|189081302|sp|A5G9D6|ATPA_GEOUR ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|146399771|gb|ABQ28404.1| ATP synthase F1, alpha subunit [Geobacter uraniireducens Rf4] (502 aa)
Score = 1337, Expect = 2.1e-145, Identities = 262/498 (52%), Positives = 357/498 (71%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKT-ILETIDQTKDISQDL---FVQIKNEFNSLITS 498
           M I  ++ S II+ QIKEY  +   +E G +I++GDGI +  GL   M  EL+ F  G  GM LNLE    G  +LG+F +IKEG  VKRT  +V+VPVG+ L+GRV++A+G PIDG G I  DK   +E  APG++ R SV +P++TG  AIDSM PIG+GQRELIIGD+QTGKT +AID IINQKG +V CIYV IGQK ST+ Q ++ L++ GA++YT IVA++AS+   L +++P+TG+T+ E +   G+  LIIYDDLSK A+AYR LSLLLRRPPGREAYPGD+FYLHSRLLER+ K++   G GS+TALPIIET+AGD+SAYIPTNVISITDGQ+++ ++LF SG RPAI+ GLSVSRVG SAQ+ A+K+ +G+L+L LAQYRE+ AF+QFGSDLDK T+  L  G+++++++KQ +  P     + +++F+    +I   PV  +  ++ ++   F  +K  +L  +   K I  D+    V   NEF    T+
  S:     1 MEIRAEEISEIIRKQIKEYGTEVAVAETGTIISIGDGIARIHGLDKAMAGELLEFPGGISGMVLNLEEDNVGAAILGEFSEIKEGDTVKRTGKIVEVPVGEALIGRVVNALGQPIDGKGPINTDKFGKVEVKAPGIVQRKSVHQPMQTGLKAIDSMVPIGRGQRELIIGDRQTGKTAVAIDTIINQKGGDVVCIYVAIGQKRSTVAQVVSKLQEHGAMDYTIIVAATASEPAPLQFISPYTGVTMGEYFRDSGKHALIIYDDLSKQAVAYRQLSLLLRRPPGREAYPGDVFYLHSRLLERACKVSDACGAGSLTALPIIETQAGDVSAYIPTNVISITDGQIYLESDLFYSGVRPAINVGLSVSRVGGSAQVKAMKQVAGTLRLSLAQYREMAAFAQFGSDLDKATQMQLARGERLVEILKQPQYKPVPNEKQVLIIFAANNGFIDDYPVSALRRYETELYTFFDTRKADVLADLRDKKAIDDDIKGKIVAALNEFKKEFTA 502
>gi|163765118|ref|ZP_02172151.1| ATP synthase F1, alpha subunit [Anaeromyxobacter sp. K] >gi|196174715|gb|ACG75688.1| ATP synthase F1, alpha subunit [Anaeromyxobacter sp. K] (510 aa)
Score = 1337, Expect = 2.2e-145, Identities = 260/484 (53%), Positives = 350/484 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEK------YIRWIPVDYIEDFKEKII-----RHFKQQKTILETIDQTKDISQDL 484
           M I  D+ S II+ QIK+Y  K   +E G +++  DG+ +  GL+     EL+ F  G  G+ LNLE    G  ++G +E I+EG  VKRT  + +VPVG+ LLGRV+D +GNPIDG G +       IE  APG++ R SV EP++TG  AID++ PIG+GQRELI+GD+QTGKT +AID I+N KG N+ C YV IGQK ST+ + ++TLK++GA+EYTT++++SASD   + YLAP+TG+T+AE +   G   LIIYDDLSK A+AYR LSLLLRRPPGREAYPGD+FYLHSRLLER+ K++ + G GS+TALPIIET+AGD+SAYIPTNVISITDGQ+F+ +NLF  G RPAI+ G+SVSRVG SAQI A+K+ +GSLKL+LAQYREL AF+QFGSDLDK T+E L  G+++++L+KQ +  P     + I +++  +K      +IR +P + +  +  ++I     RH    K I E       I +DL
  S:     1 MEIRADEISRIIREQIKDYGKKVEVAETGSILSQADGVARIYGLAGAAAGELLEFPGGVRGLVLNLEEDNVGAAIMGPYEHIREGDPVKRTGLIAEVPVGEELLGRVVDGLGNPIDGRGPLNAKHHRKIEIKAPGIVKRKSVHEPMQTGLKAIDALVPIGRGQRELILGDRQTGKTAVAIDTILNNKGNNLYCFYVAIGQKQSTVARVVDTLKKYGAMEYTTVISASASDPAPMQYLAPYTGVTMAEYFRDSGRHALIIYDDLSKQAVAYRQLSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSDKEGAGSLTALPIIETQAGDVSAYIPTNVISITDGQIFLESNLFYQGVRPAINVGISVSRVGGSAQIKAMKQVAGSLKLDLAQYRELAAFAQFGSDLDKATQETLARGERLVELLKQGQYAPLPVEKQVIQIYAGTQKDTDGQNWIRAVPTEQVVRYMRELIEFLDARHPGIAKAIAEKKALDDGIRKDL 495
>gi|166367757|ref|YP_001660030.1| F0F1 ATP synthase subunit alpha [Microcystis aeruginosa NIES-843] >gi|166090130|dbj|BAG04838.1| ATP synthase CF1 alpha chain [Microcystis aeruginosa NIES-843] (502 aa)
Score = 1337, Expect = 2.3e-145, Identities = 265/492 (53%), Positives = 355/492 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQK----TILETIDQTKDISQDLFVQIKNEF 492
           ++I  D+ S II+ QI+ Y  +   S +G V+ VGDG  +  GL   M  EL+ FE+G+ G+ LNLE    G V++G    IKEG  VK T  +  VPVGD L+GRV+DA+G PIDG GEI   +   +E  APG++AR SVCEP++TG  AID+M P+G+GQRELIIGD++TGKT IAID IINQK ++V C+YV IGQK ST+ Q I+TL Q GA++YT +VA++A+D  +L Y+AP+TG +IAE +M KG+  L+IYDDL+K A AYR LSLL+RRPPGREAYPGD+FYLHSRLLER+ K++   GGGS+TALPIIET+AGD+SAYIPTNVISITDGQ+F+ T+LFN+G RPAI+AG+SVSRVGS+AQ  A+KK +G LKLELAQ+ EL+AF+QF SDLD  T+  L  G+++ +++KQ +N P S   +  ++++    Y+  I  D + DF   +  + K  K     I+ T  Q  D ++ L     NE+
  S:     2 VAIRPDEISTIIRQQIESYNQEVQVSNVGTVLQVGDGTARIYGLQQAMSGELLEFEDGTVGIALNLEEDNVGAVLMGDGFGIKEGGTVKATGKIAQVPVGDALVGRVVDALGRPIDGKGEILASETRLVESPAPGIVARKSVCEPMQTGITAIDAMIPVGRGQRELIIGDRKTGKTAIAIDTIINQKSEDVICVYVAIGQKASTVAQVIDTLTQRGAMDYTVVVAANANDPATLQYIAPYTGASIAEYFMYKGKATLVIYDDLTKQAQAYRQLSLLMRRPPGREAYPGDVFYLHSRLLERAAKLSDALGGGSMTALPIIETQAGDVSAYIPTNVISITDGQIFLSTDLFNAGFRPAINAGISVSRVGSAAQTKAMKKVAGKLKLELAQFDELEAFAQFASDLDAATQAQLARGQRLRQILKQPQNFPLSVWEQVAVVYAGLNGYLDDIATDKVIDFCAGLREYLKTSKPRYVEIVSTEKQLNDEAEGLLKDGINEY 497
>gi|16329327|ref|NP_440055.1| F0F1 ATP synthase subunit alpha [Synechocystis sp. PCC 6803] >gi|114530|sp|P27179|ATPA_SYNY3 ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|47513|emb|CAA41135.1| ATPase subunit alpha [Synechocystis sp. PCC 6803] >gi|1651808|dbj|BAA16735.1| ATP synthase a subunit [Synechocystis sp. PCC 6803] (503 aa)
Score = 1336, Expect = 2.6e-145, Identities = 259/483 (53%), Positives = 354/483 (73%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKT-ILETIDQTKDISQD 483
           +SI  D+ S+II+ QI+ Y      S +G V+ VGDG  +  GL  VM  EL+ FE+G+ G+ LNLE    G V++G    I+EGS VK T  +  +P+GD ++GRV+D++G PIDG G I       +E  APG++ R SVCEP++TG  AID+M PIG+GQRELIIGD++TGKT IAID IINQK ++V C+YV IGQK ST+ Q I+TL + GA+ YT +VA++A+D  +L YLAP+TG T+AE +M +G+  L+IYDDLSK A AYR +SLL+RRPPGREAYPGD+FY+HSRLLER+ K++   GGGS+TALP+IET+AGD+SAYIPTNVISITDGQ+F+ T+LFN+G RPAI+AG+SVSRVGS+AQ  A+KK +G LKLELAQ+ EL+AFSQF SDLD  T+  L  G+++ +L+KQ +N+P S   +  + ++    YI  IPVD + +F + +  + K  K   +E I+ +K ++ +
  S:     2 VSIRPDEISSIIRQQIESYDQSVQVSNVGTVLQVGDGTARIYGLEQVMSQELLEFEDGTIGIALNLEEDNVGAVLMGDGFGIQEGSTVKTTGQIAQIPIGDAMVGRVVDSLGRPIDGKGPISSTATRLLESPAPGIIERKSVCEPMQTGITAIDAMIPIGRGQRELIIGDRKTGKTAIAIDTIINQKSEDVICVYVAIGQKASTVAQIIDTLTEKGAMAYTIVVAANANDPATLQYLAPYTGATLAEHFMYQGKSTLVIYDDLSKQAQAYRQMSLLMRRPPGREAYPGDVFYIHSRLLERAAKLSDALGGGSMTALPVIETQAGDVSAYIPTNVISITDGQIFLSTDLFNAGFRPAINAGISVSRVGSAAQTKAMKKVAGKLKLELAQFAELEAFSQFASDLDAATQAQLARGQRLRQLLKQPENSPLSVWEQVAISYAGLNGYIDTIPVDKVTEFAQGLRDYLKANKAKYVEIINSSKALTDE 485
>gi|149186091|ref|ZP_01864405.1| F0F1 ATP synthase subunit alpha [Erythrobacter sp. SD-21] >gi|148830122|gb|EDL48559.1| F0F1 ATP synthase subunit alpha [Erythrobacter sp. SD-21] (509 aa)
Score = 1335, Expect = 3.2e-145, Identities = 262/492 (53%), Positives = 357/492 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKG--------KNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKT-ILETI-------DQTKDISQDLFVQIKNEF 492
           M I   + S +IK+QI  + + A  SE+G V++VGDGI +  GL  V   E++ F NG+ GM LNLEA   G V+ G   DI EG  VKRT  +VDVPVG GLLGRV+DA+GNPIDG G I+  ++  +E  APG++ R SV EP+++G  AID++ P+G+GQRELIIGD+QTGK+ +AID  INQK         K + CIYV +GQK ST+ Q + +L++ GA+EY+ +VA++AS+   L YLAP+TG  + E +   G   +I+YDDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+N +NGGGS+TALPIIET+AGD+SAYIPTNVISITDGQ+F+ T+LF  G RPAI+ GLSVSRVG +AQ  A+KK SGS+KL+LAQYRE+ AF+QFGSDLD  T+++L  G ++ +L+KQ + +P     + + +F+    Y+  + VD + D++++++   + +   +LETI       D TKD   D       +F
  S:     1 MDIRAAEISKVIKDQIANFGSDAEVSEVGSVLSVGDGIARIHGLDKVQAGEMIEFSNGTQGMALNLEADNVGAVIFGADTDIAEGDTVKRTGTIVDVPVGKGLLGRVVDALGNPIDGKGPIEATERKRVEVKAPGIIPRESVSEPVQSGLKAIDALVPVGRGQRELIIGDRQTGKSAVAIDTFINQKDAHQGDDEKKKLYCIYVAVGQKRSTVAQIVKSLEENGAMEYSIVVAATASEPAPLQYLAPYTGCAMGEFFRDNGMHAVIVYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNGDNGGGSLTALPIIETQAGDVSAYIPTNVISITDGQIFLETDLFYQGIRPAINVGLSVSRVGGAAQTKAMKKVSGSMKLDLAQYREMAAFAQFGSDLDAATQKLLNRGARLTELLKQPQFSPMPFEEQTVSIFAGTNGYLDDVAVDRVTDYEDQMLSFMRSEHADVLETIRTTGKFEDDTKDKVVDALKTFAKQF 508
>gi|90418837|ref|ZP_01226748.1| ATP synthase F1, alpha subunit [Aurantimonas sp. SI85-9A1] >gi|90336917|gb|EAS50622.1| ATP synthase F1, alpha subunit [Aurantimonas sp. SI85-9A1] (509 aa)
Score = 1335, Expect = 3.3e-145, Identities = 257/499 (51%), Positives = 357/499 (71%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQK--------GKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK-QQKTILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           M I   + S I+K+QIK + ++A  SE+G+V++VGDGI +  GL N    E+V F  G  GM LNLEA   G+V+ G    IKEG  VKRT N+V+VPVG GLLGRV+D +GNPIDG G I   ++  ++  APG++ R SV EP+ TG  +ID++ PIG+GQREL+IGD+QTGKT I +D  +NQK           + CIYV +GQK ST+ QF+ TL++ GA+EY+ ++A++ASD   + Y+APFTG  I E +       +I YDDLSK A++YR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+N E G GS+TALP+IET+AGD+SAYIPTNVISITDGQ+F+ T LF  G RPA++ GLSVSRVGSSAQI A+K+ +GS+K ELAQYRE+ AF+QFGSDLD  T+ +L  G ++ +L+KQ + +P     +  ++F+  + Y+  + VD + +F+E ++   + + K +L+ I   K +S DL  ++K+  +S   ++
  S:     1 MDIRAAEISAILKDQIKNFGSEAEVSEVGQVLSVGDGIARVYGLDNCQAGEMVEFPGGIQGMALNLEADNVGVVIFGSDRAIKEGDTVKRTGNIVEVPVGKGLLGRVVDGLGNPIDGKGPIGSTERRRVDVKAPGIIPRKSVHEPMSTGLKSIDALIPIGRGQRELVIGDRQTGKTAIILDTFLNQKPAHDEDREADKLYCIYVAVGQKRSTVAQFVRTLEERGAMEYSVVIAATASDPAPMQYIAPFTGCAIGEFFRDNAMHAVIAYDDLSKQAVSYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNDELGAGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETTLFFQGVRPAVNVGLSVSRVGSSAQIKAMKQVAGSIKGELAQYREMAAFAQFGSDLDAATQRLLNRGARLTELLKQPQFSPLKTEEQVAVIFAGTQGYLDKLRVDQVGEFEEGLLNSLRSEHKAVLDQIATEKALSDDLRAKLKSAIDSFAKNF 508
>gi|62290666|ref|YP_222459.1| F0F1 ATP synthase subunit alpha [Brucella abortus bv. 1 str. 9-941] >gi|82700581|ref|YP_415155.1| F0F1 ATP synthase subunit alpha [Brucella melitensis biovar Abortus 2308] >gi|189024878|ref|YP_001935646.1| ATP synthase subunit A [Brucella abortus S19] >gi|75496277|sp|Q57B86|ATPA_BRUAB ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|115312238|sp|Q2YLI5|ATPA_BRUA2 ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|62196798|gb|AAX75098.1| AtpA, ATP synthase F1, alpha subunit [Brucella abortus biovar 1 str. 9-941] >gi|82616682|emb|CAJ11765.1| H+-transporting two-sector ATPase, alpha/beta subunit, central region:H+-transporting two-sector ATPase, alpha subunit, C-ter... [Brucella melitensis biovar Abortus 2308] >gi|189020450|gb|ACD73172.1| ATP synthase subunit A [Brucella abortus S19] (509 aa)
Score = 1335, Expect = 3.5e-145, Identities = 258/500 (51%), Positives = 356/500 (71%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQK--------GKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK-QQKTILETIDQTKDISQDLFVQIKNEFNSLITSYI 500
           M I   + S I+K QIK +  +A  SE+G+V++VGDGI +  GL NV   E+V F  G  GM LNLE+   G+V+ G   DIKEG +VKRT  +VDVPVG  LLGRV+DA+GNPIDG G IK  ++  ++  APG++ R SV EP+ TG  AID++ P+G+GQREL+IGD+QTGKT I +D  +NQK           + C+YV +GQK ST+ QF+  L++ GALEY+ +VA++ASD   + YLAPF G  + E +   G+  LI YDDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+N ENG GS+TALP+IET+  D+SA+IPTNVISITDGQ+F+ TNLF  G RPA++ GLSVSRVGSSAQI A+K+ +GS+K ELAQYRE+ AF+QFGSDLD  T+ +L  G ++ +L+KQ + +P     +  ++++    Y+  + V+ +  F+E ++   + + K +LE I   K ++ DL  ++K   ++   S++
  S:     1 MDIRAAEISAILKEQIKNFGKEAEVSEVGQVLSVGDGIARVYGLDNVQAGEMVEFPGGIRGMALNLESDNVGVVIFGADRDIKEGDVVKRTGAIVDVPVGPELLGRVVDALGNPIDGKGPIKAKERRRVDVKAPGIIPRKSVHEPMSTGLKAIDALIPVGRGQRELVIGDRQTGKTAIILDTFLNQKPIHDNGPDKDKLYCVYVAVGQKRSTVAQFVKVLEERGALEYSIVVAATASDPAPMQYLAPFAGCAMGEYFRDNGQHALIGYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNDENGAGSLTALPVIETQGNDVSAFIPTNVISITDGQIFLETNLFYQGIRPAVNVGLSVSRVGSSAQIKAMKQVAGSIKGELAQYREMAAFAQFGSDLDAATQRLLNRGARLTELLKQPQFSPLKTEEQVAVIYAGVNGYLDKLAVNQVGKFEEGLLASLRTEHKDVLEGIRNEKALTDDLKAKLKAAIDAFAKSFV 509
>gi|149193993|ref|ZP_01871091.1| F0F1 ATP synthase subunit alpha [Caminibacter mediatlanticus TB-2] >gi|149135946|gb|EDM24424.1| F0F1 ATP synthase subunit alpha [Caminibacter mediatlanticus TB-2] (501 aa)
Score = 1335, Expect = 3.7e-145, Identities = 257/489 (52%), Positives = 363/489 (74%)
  Q:     5 LDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKII--------RHFKQQKTILETIDQTKDISQDLFVQIKNEFN 493
           + + + IIK +I+ ++ K    E+G+VI   DGI +  GL+ VM  E+V FE G  G+  NLE    G+V+LGK  DI EGS VKR   ++ VPVG+ L+GRV++A+G PIDG GEI+  +   +E+ APG+MAR SV EPL+TG  AID++ PIG+GQRELIIGD+QTGKTT+AID I+NQKG++V CIYV IGQK ST+   +  L++ GA++YT +V +SAS+  SL +LAP++G+T+ E +   G   LI+YDDLSKHA AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+N + G GS+TALPIIET+ GD++AYIPTNVISITDGQ+F+ TNLFN G RPAI+ GLSVSRVG +AQI A+K+ +G+L+LELAQYREL+AF+QF SDLD+ +++ LE G+++++++KQ  + P     + +++++    Y+  IPV  +  F+E++         + F+  +T  +  D+T+D+ +    + K +F+
  S:     2 VQEITQIIKERIENFELKVDVEEVGKVIYSADGIAKVYGLTKVMAGEMVEFETGEKGLVFNLETDNVGVVVLGKGTDIVEGSTVKRLGRLISVPVGEALIGRVVNALGEPIDGKGEIEATEYRYVEEKAPGIMARKSVHEPLQTGIKAIDALVPIGRGQRELIIGDRQTGKTTVAIDTILNQKGQDVICIYVAIGQKQSTVANIVRILEEHGAMDYTIVVNASASEAASLKFLAPYSGVTMGEYFRDNGRHALIVYDDLSKHADAYREMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNDKLGAGSLTALPIIETKGGDVAAYIPTNVISITDGQIFLETNLFNKGIRPAINVGLSVSRVGGAAQIKAMKQVAGTLRLELAQYRELEAFAQFASDLDEASRKQLERGQRLVEILKQPAHQPLPVEKQVVIIYAGTRGYLDDIPVKAVRKFEEELYPFIETKYPQIFENIRTKQKIDDETEDLIKKALEEFKAQFS 498
>gi|163814611|ref|ZP_02206000.1| hypothetical protein COPEUT_00762 [Coprococcus eutactus ATCC 27759] >gi|158450246|gb|EDP27241.1| hypothetical protein COPEUT_00762 [Coprococcus eutactus ATCC 27759] (500 aa)
Score = 1335, Expect = 3.7e-145, Identities = 261/473 (55%), Positives = 351/473 (74%)
  Q:    12 IKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQ-QKTILETIDQTKDISQDL 484
           +K +I+ Y   +   E+G+VI VGDGIV   G+ N M  E+V+FENG  GM  ++  T  G ++ G+   IKEG+ V RT     +PVGD  +GR++DA+G PIDG G I+     PIE  AP ++ R SV +PL+TG L+ID+MFPIG+GQRELIIGD+QTGKT+IAID I+NQKGK+V C+YV IGQK STI + +N L ++ A++YT +VAS+ASD   L Y+AP++G  IAE +M KG+DVLI+YDDLSKHA+AYRTLSLLL R PGREAYPGD+FYLHSRLLERS K+  E GGGSITALPIIET+AGD+SAYIPTNVISITDGQ+F+ ++LF SG RPA++ GLSVSRVG +AQ  A+KK +GS++++LAQYRE++ F+QF SDLD+ TKE L++GK +M+L+KQ    P S + E I+L +   K    + V  I+  K +++  F    K I++ I++ + ++ +L
  S:    13 LKEEIENYDFDSRDKEVGKVIYVGDGIVTVYGIDNAMYGEIVVFENGVKGMVQDIRRTEIGCILFGRDTGIKEGTKVSRTGKRAGIPVGDAFVGRIVDALGAPIDGKGSIETTDYRPIENPAPSIVDRKSVNQPLQTGILSIDAMFPIGRGQRELIIGDRQTGKTSIAIDTILNQKGKDVICVYVAIGQKASTIAKVVNNLNKYDAMDYTIVVASTASDSAPLQYIAPYSGTAIAEYFMHKGKDVLIVYDDLSKHAVAYRTLSLLLGRSPGREAYPGDVFYLHSRLLERSSKLKDELGGGSITALPIIETQAGDVSAYIPTNVISITDGQIFLESDLFFSGMRPAVNVGLSVSRVGGAAQTKAMKKAAGSIRIDLAQYREMEVFTQFSSDLDENTKEQLQYGKGLMELLKQPLCNPLSMAEEVIILVAATNKVFLPVEVSEIKKKKLEMLEFFHSAHKDIVDEIEEKQVLTDEL 486
>gi|90961574|ref|YP_535490.1| F0F1 ATP synthase subunit alpha [Lactobacillus salivarius UCC118] >gi|119367956|sp|Q1WUC8|ATPA_LACS1 ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|90820768|gb|ABD99407.1| ATP synthase alpha chain [Lactobacillus salivarius UCC118] (503 aa)
Score = 1335, Expect = 3.8e-145, Identities = 253/482 (52%), Positives = 359/482 (74%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK-QQKTILETIDQTKDISQ 482
           MSI  ++ S +IK Q+  YQ++    E+G V  VGDGI +A+GL N +  ELV F++G+YGM  NLE+   GI++LG F+ I+EG  VKRT  +++VPVG+ L+GRV++ +G PIDG GE+K +K  P+E+ APGVM R SV EPL+TG  AID++ PIG+GQREL+IGD++TGKT++AID IINQK +++ CIYV IGQK+ST+   + TL++FGA++YT +V++  S    L YLAP+ G  + EE+M  G+ VLI+YDDLSK A AYR LSL+LRRPPGREAYPGD+FYLHSRLLER+ K++ E GGGS+TALP IET+AGD+SAYIPTNVISITDGQ+F+ ++ F SG RPAIDAG SVSRVG +AQ+ A+KK +G+L+ +LA Y EL++F+QFGSDLD+ T+  L  G++ ++++KQ  + P     + ++L+++   ++  + VD I  +++ +  +F    K +L+ I  T  + +
  S:     1 MSIKAEEISALIKQQLANYQDELTVDEVGTVTYVGDGIARANGLDNALAGELVEFDDGTYGMAQNLESNDVGIIILGSFKGIREGDTVKRTGRIMEVPVGEELIGRVVNPLGQPIDGLGEVKTNKTRPVERKAPGVMERQSVTEPLQTGLKAIDALVPIGRGQRELVIGDRKTGKTSVAIDTIINQKDQDMICIYVAIGQKDSTVRTSVETLRKFGAMDYTIVVSAGPSSPAPLLYLAPYAGAAMGEEFMFNGKHVLIVYDDLSKQADAYRELSLILRRPPGREAYPGDVFYLHSRLLERAAKLSDELGGGSMTALPFIETKAGDVSAYIPTNVISITDGQIFLDSDRFYSGIRPAIDAGTSVSRVGGNAQVKAMKKVAGTLRTDLASYSELESFAQFGSDLDEATQAKLNRGRRTVEVLKQPLHKPLPVEKQVLILYALTHGFLDPVKVDDILPYQDGLFDYFDANHKDLLDEIANTGKLPE 483
>gi|24298788|dbj|BAC22103.1| F-ATPase alpha-subunit [Thermotoga neapolitana] (503 aa)
Score = 1334, Expect = 4.0e-145, Identities = 256/489 (52%), Positives = 361/489 (73%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLF-ENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHF-KQQKTILETIDQTKDISQDLFVQIK 489
           M IN  + + +++ +IK ++ K    + G+VI VGDGI +  GL+ VM++ELV F E G  G+  NLE    GI++LG+++DIKEG  V+R K +++VPVG+ LLGRV++ +G P+DG G I      PIE  APGV+ R  V  PL+TG  AIDSM PIG+GQRELIIGD+QTGKT IAID IINQKG+ V CIYV IGQK S I + I+ L+Q+GALEYTT+V +SASD  +L Y+AP+ G  + E +   G D L++YDDLSKHA+AYR LSLL+RRPPGREAYPGDIFYLHSRLLER+ ++N + GGGS+TALPI+ T+A DISAYIPTNVISITDGQ+++   LF +GQRPAI+ GLSVSRVG +AQI A+K+ +G L++ELAQYREL+ F+QF ++LD  T+  +  G+++M+L+KQ++ +P     + +++F+    Y+  +PV+ +  F+++ +R   ++ + IL+ I + K+++ +   ++K
  S:     1 MRINPGEITKVLEEKIKSFEEKIDLEDTGKVIQVGDGIARVYGLNKVMVSELVEFVETGVKGVAFNLEEDNVGIIVLGEYKDIKEGHTVRRLKRIIEVPVGEELLGRVVNPLGEPLDGKGPINAKNFRPIEIKAPGVIYRKPVDTPLQTGIKAIDSMIPIGRGQRELIIGDRQTGKTAIAIDTIINQKGQGVYCIYVAIGQKKSAIARIIDKLRQYGALEYTTVVVASASDPATLQYIAPYAGCAMGEYFAYSGRDALVVYDDLSKHAVAYRQLSLLMRRPPGREAYPGDIFYLHSRLLERAVRLNDKLGGGSLTALPIVGTQANDISAYIPTNVISITDGQIYLEPGLFYAGQRPAINVGLSVSRVGGAAQIKAMKQVAGMLRIELAQYRELETFAQFATELDPATRAQIVRGQRLMELLKQEQYSPMPVEEQVVVIFAGVRGYLDDLPVEAVRRFEKEFLRFMHEKHQDILDDIREKKELTPETEEKLK 491
>gi|188997521|ref|YP_001931772.1| ATP synthase F1, alpha subunit [Sulfurihydrogenibium sp. YO3AOP1] >gi|188932588|gb|ACD67218.1| ATP synthase F1, alpha subunit [Sulfurihydrogenibium sp. YO3AOP1] (504 aa)
Score = 1334, Expect = 4.3e-145, Identities = 262/482 (54%), Positives = 352/482 (73%)
  Q:     3 INLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNG---EIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQK-TILETIDQTKDISQDL 484
           I  D+    +  QI+E+Q  A   E+G VI VGDG+ +  GL   M+ E++ FE+G  G+  NLE    G V+LG    ++EGSIVKRT  ++ VPVG GLLGRV+D +GNPIDG G   +I Y    P+EKIAPGV+ R SV EPL+TG  AID+M PIG+GQRELIIGD+ TGKTTIAID I+NQKG+ V CIYV IGQK + +V  + TL++ GA+EYTT+VA+++SD  ++ Y+APF G TI E +   G   L+IYDDL+KHA AYR LSLLLRRPPGREAYPGD+FYLHSRLLER+ K+N E G GS+TALPIIET+AGD++AYIPTNVISITDGQ+F+  +LF  G RPAI+AG+SVSRVG +AQI A+K+ +G+L+L+LAQYREL+AF QF S+LDK T+  +  G+++++L+KQ  N P     +  +++   + Y+  + V+ I+ F+++       +K  ILE I + K ++ D+
  S:     4 IRADEVLESLNKQIEEFQVSANLEEVGTVIQVGDGVARIYGLEKAMMGEMLEFESGIVGVVFNLEEDNVGAVLLGSDVAVREGSIVKRTGKILSVPVGKGLLGRVVDGLGNPIDGKGPLTDIAYYS--PVEKIAPGVVKRKSVHEPLQTGIKAIDAMIPIGRGQRELIIGDRATGKTTIAIDTILNQKGQGVYCIYVAIGQKRANVVHIVETLQKHGAMEYTTVVAATSSDPATMQYIAPFVGCTIGEYFRDNGMHALVIYDDLTKHAYAYRQLSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNDELGAGSLTALPIIETQAGDVAAYIPTNVISITDGQIFLEADLFYKGIRPAINAGISVSRVGGAAQIKAMKQVAGTLRLDLAQYRELEAFVQFASELDKATQAQIARGQRMVELLKQPPNQPVPVEKQVAIIYVAGQGYLDDVSVNAIQKFEKEFYVFLDTEKPDILEAIRREKALTDDI 487
>gi|86160765|ref|YP_467550.1| F0F1 ATP synthase subunit alpha [Anaeromyxobacter dehalogenans 2CP-C] >gi|115312234|sp|Q2IHQ9|ATPA_ANADE ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|85777276|gb|ABC84113.1| ATP synthase F1, alpha subunit [Anaeromyxobacter dehalogenans 2CP-C] (510 aa)
Score = 1334, Expect = 4.6e-145, Identities = 260/484 (53%), Positives = 351/484 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEK------YIRWIPVDYIEDFKEKII-----RHFKQQKTILETIDQTKDISQDL 484
           M I  D+ S II+ QIK+Y  K   +E G +++  DG+ +  GL+     EL+ F  G  G+ LNLE    G  ++G +E I+EG  VKRT  + +VPVG+ LLGRV+D +GNPIDG G +    +  IE  APG++ R SV EP++TG  AID++ PIG+GQRELI+GD+QTGKT +AID I+N KG N+ C YV IGQK ST+ + ++TLK+ GA+EYTT++++SASD   + YLAP+TG+T+AE +   G   LIIYDDLSK A+AYR LSLLLRRPPGREAYPGD+FYLHSRLLER+ K++ + G GS+TALPIIET+AGD+SAYIPTNVISITDGQ+F+ +NLF  G RPAI+ G+SVSRVG SAQI A+K+ +GSLKL+LAQYREL AF+QFGSDLDK T+E L  G+++++L+KQ +  P S   + I +++  +K      +IR +P + +  +  +++     RH    K I E       I +DL
  S:     1 MEIRADEISRIIREQIKDYGKKVEVAETGSILSQADGVARIYGLAGAAAGELLEFPGGIRGLVLNLEEDNVGAAIMGPYEHIREGDPVKRTGLIAEVPVGEELLGRVVDGLGNPIDGRGPLNAKHQRKIEIKAPGIVKRKSVHEPMQTGLKAIDALVPIGRGQRELILGDRQTGKTAVAIDTILNNKGNNLYCFYVAIGQKQSTVARVVDTLKKHGAMEYTTVISASASDPAPMQYLAPYTGVTMAEYFRDSGRHALIIYDDLSKQAVAYRQLSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSDKEGAGSLTALPIIETQAGDVSAYIPTNVISITDGQIFLESNLFFQGVRPAINVGISVSRVGGSAQIKAMKQVAGSLKLDLAQYRELAAFAQFGSDLDKATQETLARGERLVELLKQGQYAPLSVEKQVIQIYAGTQKDAGGHNWIRSVPTEQVVRYMAELLEFLDARHPGIAKAIAEKKALDDGIRKDL 495
>gi|94986845|ref|YP_594778.1| F0F1 ATP synthase subunit alpha [Lawsonia intracellularis PHE/MN1-00] >gi|118573480|sp|Q1MRB9|ATPA_LAWIP ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|94731094|emb|CAJ54457.1| F1F0-ATPase alpha subunit [Lawsonia intracellularis PHE/MN1-00] (506 aa)
Score = 1334, Expect = 4.8e-145, Identities = 256/488 (52%), Positives = 355/488 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQK-TILETIDQTKDISQDLFVQI 488
           M I  D+ S IIK QI+ Y  +   +E+G V++VGDGI +  G+ +VM  EL+ F     GM LNLE    G+ +LG    ++EGS VKRT  +  VPVGD + GRV++ +G P+DG G +   +K P+E  AP ++ R S+ EPL TG  AID+M PIG+GQRELIIGD+QTGKT+I IDAI+ QK   V C YV IGQK ST+    +TL++ GA+EYTTI+A++ASD   L Y++P++G T+AE +   G+  LI+YDDLSK A+AYR +SLLLRRPPGREA+PGD+FYLHSRLLER+ K++ E GGGS+TALPIIET+AGD+SAYIPTNVISITDGQ+++  NLFN+G RPAI+ GLSVSRVG +AQ  A+K+ SG+++L+LAQYREL AF+QF SDLDKET+  LE G ++++L+KQ +  P     + I++F+  + ++  IP+D+I++F + +I + +     ILE I   + ++++L  Q+
  S:     1 MHIKADEISTIIKEQIQNYSQRIETTEVGTVLSVGDGIARVYGVQDVMSMELLEFPGNLLGMVLNLEQDNVGVALLGDDTGVEEGSTVKRTGRIFSVPVGDAVTGRVLNPLGQPLDGLGPLNATEKKPVEVKAPSIIDRKSIYEPLVTGIKAIDAMTPIGRGQRELIIGDRQTGKTSICIDAILAQKESGVHCFYVAIGQKASTVALVADTLRKHGAMEYTTIIAATASDPAPLQYISPYSGCTMAEYYRDHGQHALIVYDDLSKQAVAYRQMSLLLRRPPGREAFPGDVFYLHSRLLERAAKLSDELGGGSLTALPIIETQAGDVSAYIPTNVISITDGQVYLEPNLFNAGVRPAINVGLSVSRVGGAAQTKAMKQVSGTMRLDLAQYRELAAFAQFSSDLDKETQTKLERGARLVELLKQPQYQPMQLPEQVIVMFAATKGFMDDIPIDHIQNFSKTLIEYIQTMNPKILENISTQQALNEELDQQL 489
>gi|110602255|ref|ZP_01390381.1| ATP synthase F1, alpha subunit [Geobacter sp. FRC-32] >gi|110547032|gb|EAT60332.1| ATP synthase F1, alpha subunit [Geobacter sp. FRC-32] (502 aa)
Score = 1334, Expect = 5.0e-145, Identities = 258/488 (52%), Positives = 355/488 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKT-ILETIDQTKDISQDLFVQI 488
           M I  ++ S II+ QIKEY ++   +E G +I++GDGI +  GL   M  EL+ F  G  GM LNLE    G  +LG+F +IKEG  VKRT  +V+VPVG+ L+GRV++A+G PIDG G I  DK   +E  APG++ R SV +P++TG  AID+M PIG+GQRELIIGD+QTGKT +AID IINQKG +V CIYV IGQK ST+ Q ++ L++ GA++YT IVA++AS+   L +++P+TG+T+ E +   G+  LIIYDDLSK A+AYR LSLLLRRPPGREAYPGD+FYLHSRLLER+ K++   G GS+TALPIIET+AGD+SAYIPTNVISITDGQ+++ ++LF SG RPAI+ GLSVSRVG SAQ+ A+K+ +G+L+L LAQYRE+ AF+QFGSDLDK T+  L  G+++++++KQ +  P     + +++F+    YI   PV  +  ++ ++   F  +K+ +L  +   K I  D+  +I
  S:     1 MEIRAEEISEIIRKQIKEYGSEVEVAETGTIISIGDGIARIHGLDKAMAGELLEFPGGISGMALNLEEDNVGAAILGEFSEIKEGDTVKRTNRIVEVPVGEALIGRVVNAIGQPIDGKGPINTDKFGKVEVKAPGIVKRKSVHQPMQTGLKAIDAMVPIGRGQRELIIGDRQTGKTAVAIDTIINQKGGDVVCIYVAIGQKRSTVAQVVSKLQEHGAMDYTIIVAATASEPAPLQFISPYTGVTMGEYFRDNGKHALIIYDDLSKQAVAYRQLSLLLRRPPGREAYPGDVFYLHSRLLERACKVSDACGAGSLTALPIIETQAGDVSAYIPTNVISITDGQIYLESDLFYSGVRPAINVGLSVSRVGGSAQVKAMKQVAGTLRLSLAQYREMAAFAQFGSDLDKATQMQLARGERLVEVLKQPQYRPIPNEKQVLIIFAANNGYIDEYPVASLGRYESELYSFFDARKSDLLAELRDKKAIDDDIKAKI 489
>gi|161619721|ref|YP_001593608.1| F0F1 ATP synthase subunit alpha [Brucella canis ATCC 23365] >gi|163845377|ref|YP_001623032.1| F0F1 ATP synthase subunit alpha [Brucella suis ATCC 23445] >gi|189081289|sp|A9M839|ATPA_BRUC2 ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|189081290|sp|A9WWS4|ATPA_BRUSI ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|161336532|gb|ABX62837.1| ATP synthase F1, alpha subunit [Brucella canis ATCC 23365] >gi|163676100|gb|ABY40210.1| ATP synthase F1, alpha subunit [Brucella suis ATCC 23445] (509 aa)
Score = 1334, Expect = 5.0e-145, Identities = 258/499 (51%), Positives = 355/499 (71%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQK--------GKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK-QQKTILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           M I   + S I+K QIK +  +A  SE+G+V++VGDGI +  GL NV   E+V F  G  GM LNLE+   G+V+ G   DIKEG +VKRT  +VDVPVG  LLGRV+DA+GNPIDG G IK  ++  ++  APG++ R SV EP+ TG  AID++ P+G+GQREL+IGD+QTGKT I +D  +NQK           + C+YV +GQK ST+ QF+  L++ GALEY+ +VA++ASD   + YLAPF G  + E +   G+  LI YDDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+N ENG GS+TALP+IET+  D+SA+IPTNVISITDGQ+F+ TNLF  G RPA++ GLSVSRVGSSAQI A+K+ +GS+K ELAQYRE+ AF+QFGSDLD  T+ +L  G ++ +L+KQ + +P     +  ++++    Y+  + V+ +  F+E ++   + + K +LE I   K ++ DL  ++K   ++   S+
  S:     1 MDIRAAEISAILKEQIKNFGKEAEVSEVGQVLSVGDGIARVYGLDNVQAGEMVEFPGGIRGMALNLESDNVGVVIFGADRDIKEGDVVKRTGAIVDVPVGPELLGRVVDALGNPIDGKGPIKAKERRRVDVKAPGIIPRKSVHEPMSTGLKAIDALIPVGRGQRELVIGDRQTGKTAIILDTFLNQKPIHDNGPDKDKLYCVYVAVGQKRSTVAQFVKVLEERGALEYSIVVAATASDPAPMQYLAPFAGCAMGEYFRDNGQHALIGYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNDENGAGSLTALPVIETQGNDVSAFIPTNVISITDGQIFLETNLFYQGIRPAVNVGLSVSRVGSSAQIKAMKQVAGSIKGELAQYREMAAFAQFGSDLDAATQRLLNRGARLTELLKQPQFSPLKTEEQVAVIYAGVNGYLDKLAVNQVGKFEEGLLASLRTEHKDVLEGIRNEKALTDDLKAKLKAAIDAFAKSF 508
>gi|17986533|ref|NP_539167.1| F0F1 ATP synthase subunit alpha [Brucella melitensis 16M] >gi|81852463|sp|Q8YJ37|ATPA_BRUME ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|17982138|gb|AAL51431.1| ATP SYNTHASE ALPHA CHAIN [Brucella melitensis 16M] (509 aa)
Score = 1333, Expect = 6.2e-145, Identities = 258/499 (51%), Positives = 355/499 (71%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQK--------GKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK-QQKTILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           M I   + S I+K QIK +  +A  SE+G+V++VGDGI +  GL NV   E+V F  G  GM LNLE+   G+V+ G   DIKEG +VKRT  +VDVPVG  LLGRV+DA+GNPIDG G IK  ++  ++  APG++ R SV EP+ TG  AID++ P+G+GQREL+IGD+QTGKT I +D  +NQK           + C+YV +GQK ST+ QF+  L++ GALEY+ +VA++ASD   + YLAPF G  + E +   G+  LI YDDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+N ENG GS+TALP+IET+  D+SA+IPTNVISITDGQ+F+ TNLF  G RPA++ GLSVSRVGSSAQI A+K+ +GS+K ELAQYRE+ AF+QFGSDLD  T+ +L  G ++ +L+KQ + +P     +  ++++    Y+  + V+ +  F+E ++   + + K +LE I   K ++ DL  ++K   ++   S+
  S:     1 MDIRAAEISAILKEQIKNFGKEAEVSEVGQVLSVGDGIARVYGLDNVQAGEMVEFPGGIRGMALNLESDNVGVVIFGADRDIKEGDVVKRTGAIVDVPVGPELLGRVVDALGNPIDGKGPIKAKERRRVDVKAPGIIPRKSVHEPMSTGLKAIDALIPVGRGQRELVIGDRQTGKTAIILDTFLNQKPIHDNGPDKDKLYCVYVAVGQKRSTVAQFVKVLEERGALEYSIVVAATASDPAPMQYLAPFAGCAMGEYFRDNGQHALIGYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNDENGAGSLTALPVIETQGNDVSAFIPTNVISITDGQIFLETNLFYQGIRPAVNVGLSVSRVGSSAQIKAMKQVAGSIKGELAQYREMAAFAQFGSDLDAATQRLLNRGARLTELLKQPQFSPLKTEEQVAVIYAGVNGYLDKLAVNQVGKFEEGLLASLRTEHKDVLEGICNEKALTDDLKAKLKAAIDAFAKSF 508
>gi|121999210|ref|YP_001003997.1| F0F1 ATP synthase subunit alpha [Halorhodospira halophila SL1] >gi|158514023|sp|A1WZT3|ATPA_HALHL ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|121590615|gb|ABM63195.1| ATP synthase F1, alpha subunit [Halorhodospira halophila SL1] (513 aa)
Score = 1332, Expect = 6.8e-145, Identities = 255/495 (51%), Positives = 360/495 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKE------NG-----GGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK-QQKTILETIDQTKDISQDLFVQIKNEFNSL 495
           M +N  + S +IK +I+ +   A     G V++VGDGI +  GL++VM  E++ F + ++GM LNLE  + G V+LG ++ IKEG+ VK T  +++VPVGD +LGRV+DA+G P DG G IK +   PIEK+APGV+ R  V +P++TG  AIDSM PIG+GQRELIIGD+QTGKT +A+DAIINQK   +KCIYV +GQKNST+   +  L++ GA++ T +V + AS+  ++ Y+AP+ G  + E +  +G+D LIIYDDL+K A AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ +IN E      NG      GS+TALPIIET+AGD+SA++PTNVISITDGQ+++ T+LFNSG RPA++AGLSVSRVG SAQ   +KK  G ++L LAQYREL AFSQF SDLD+ T++ LE GK+ M+L+KQ +  P S    A +LF+  E Y+  +  D +  F++ ++ + + +   +L+ I +T D + ++  +++   ++ 
  S:     1 MQVNPSEISELIKRRIENFDAAAEARNEGTVVSVGDGICRIHGLADVMFGEMLEFPDDTFGMALNLERDSVGAVLLGDYQHIKEGATVKCTGRILEVPVGDAMLGRVVDALGRPTDGKGPIKTEGSEPIEKVAPGVITREGVDQPVQTGLKAIDSMVPIGRGQRELIIGDRQTGKTAVAVDAIINQKDSGIKCIYVAVGQKNSTVANVVRKLEEHGAMDNTIVVNAGASESAAMQYIAPYAGCAMGEYFRDRGQDALIIYDDLTKQAWAYRQVSLLLRRPPGREAYPGDVFYLHSRLLERASRINAEEVERRTNGEVKGQTGSLTALPIIETQAGDVSAFVPTNVISITDGQIYLETDLFNSGVRPAVNAGLSVSRVGGSAQTKIIKKLGGGVRLALAQYRELAAFSQFASDLDETTRQQLERGKRTMELMKQGQYEPQSVGEMAFVLFAANEGYVDDVENDQVVRFEKALLDYLRAEHAELLQRITETGDYNDEIHAEMQKAMDAF 507
>gi|172058683|ref|YP_001815143.1| ATP synthase F1, alpha subunit [Exiguobacterium sibiricum 255-15] >gi|171991204|gb|ACB62126.1| ATP synthase F1, alpha subunit [Exiguobacterium sibiricum 255-15] (502 aa)
Score = 1332, Expect = 6.8e-145, Identities = 263/483 (54%), Positives = 356/483 (73%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQ-QKTILETIDQTKDISQD 483
           MSI  ++ S ++K +I +Y +    +E G VI +GDGI +A GL NVM  ELV F NG+ G+  NLE    GI++LG + +IKEG  V+RT  +++VP GD LLGRV++ +G PIDG G I+ +   PIE+ A GVMAR SV EPL+TG  AID++ PIG+GQRELIIGD+QTGKT+IAID IINQK +N+ CIYV IGQK ST+   + TL++ GAL+YT +V+++AS    L YLAPF G+ + E +M  G+ VL+IYDDLSK A AYR LSLLL+RPPGREAYPGD+FYLHSRLLER+ K+N   G GS+TALP IET+A DISAYIPTNVISITDGQ+F+ ++LF SG RPAI+ GLSVSRVG SAQ+ A+KK +G+L+L+LA YREL+AFSQFGSDLDK T+  L  G++ ++++KQD N P +   + I+++++   ++  + V  I  F++++     Q +K + + I +T ++  D
  S:     1 MSIRAEEISALLKARIAQYGSTMEVNETGTVIQIGDGIARAHGLDNVMSGELVEFANGTMGLAQNLEEGNVGIIILGDYLEIKEGDSVRRTGRIMEVPTGDALLGRVVNPLGMPIDGLGPIETEHYNPIERKASGVMARKSVHEPLQTGIKAIDALVPIGRGQRELIIGDRQTGKTSIAIDTIINQKEENMICIYVAIGQKESTVRGVVETLRKNGALDYTIVVSAAASQPAPLLYLAPFAGVAMGEHFMDLGKHVLVIYDDLSKQAAAYRELSLLLKRPPGREAYPGDVFYLHSRLLERAAKLNDGLGAGSLTALPFIETQASDISAYIPTNVISITDGQIFLQSDLFFSGVRPAINPGLSVSRVGGSAQVKAMKKVAGTLRLDLASYRELEAFSQFGSDLDKATQSKLNRGERTVEVLKQDLNQPLTVDKQVIIIYALTRGHLDDVAVSDIRRFEKELNLWLDQNRKQLCDEIRKTGNLPAD 484
>gi|118579043|ref|YP_900293.1| F0F1 ATP synthase subunit alpha [Pelobacter propionicus DSM 2379] >gi|118579928|ref|YP_901178.1| F0F1 ATP synthase subunit alpha [Pelobacter propionicus DSM 2379] >gi|190358192|sp|A1ALL5|ATPA_PELPD ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|118501753|gb|ABK98235.1| ATP synthase F1, alpha subunit [Pelobacter propionicus DSM 2379] >gi|118502638|gb|ABK99120.1| ATP synthase F1, alpha subunit [Pelobacter propionicus DSM 2379] (502 aa)
Score = 1332, Expect = 7.5e-145, Identities = 260/494 (52%), Positives = 357/494 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHF-KQQKTILETIDQTKDISQDL-------FVQIKNEFNS 494
           M I  ++ S IIK QI+EY  +   SE G +I++GDGI +  GLS  M  EL+ F  G  GM LNLE    G  +LG+F  IKEG  VKRT  + +VPVG+ L+GRV++A+G PIDG G IK D    +E  APG++AR SV +P+ +G  A+D+M PIG+GQRELIIGD+QTGKT +A+D IINQKG +V CIYV IGQK ST+ Q +  L   GA++YT +VA+SAS+   L ++AP++G+T+ E +  KG+  LIIYDDLSK A+AYR LSLLLRRPPGREAYPGD+FYLHSRLLER+ K++ E GGGS+TALPIIET+AGD+SAYIPTNVISITDGQ+++ ++LF SG RPAI+ GLSVSRVG  AQ  ++K+ +G+L+L LAQYRE+ AF+QFGSDLDK T+  L  G+++++++KQ +  P S   + +++F+    ++  +PV  +  +++++   F  +Q  +L  +   K I  +L         Q K EF++
  S:     1 MKIRAEEISEIIKKQIREYGKEVEVSETGTIISIGDGIARIHGLSGAMAGELLEFPGGVSGMVLNLEEDNVGAAVLGEFTAIKEGHTVKRTGRIAEVPVGEALIGRVVNAIGEPIDGKGPIKTDTFSKVEIKAPGIVARKSVDQPMASGLKAVDAMVPIGRGQRELIIGDRQTGKTAVAVDTIINQKGGDVICIYVAIGQKRSTVAQVVAKLSDHGAMDYTIVVAASASESAPLQFIAPYSGVTMGEYFRDKGQHALIIYDDLSKQAVAYRQLSLLLRRPPGREAYPGDVFYLHSRLLERACKLSDECGGGSLTALPIIETQAGDVSAYIPTNVISITDGQIYLESDLFFSGVRPAINVGLSVSRVGGKAQTKSMKQVAGTLRLNLAQYREMAAFAQFGSDLDKATQMQLARGERLVEILKQPQYRPLSNEKQVLIIFAANNGFLDELPVSTLRRYEDEMYAFFDNRQADLLSELRDKKAIDDELKKRIVAALEQFKKEFSA 502
>gi|119188523|ref|XP_001244868.1| hypothetical protein CIMG_04309 [Coccidioides immitis RS] >gi|90303654|gb|EAS33285.1| hypothetical protein CIMG_04309 [Coccidioides immitis RS] (555 aa)
Score = 1332, Expect = 7.6e-145, Identities = 257/482 (53%), Positives = 355/482 (73%)
  Q:     9 SNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQK--------GKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK-QQKTILETIDQTKDISQDLFVQIKN 490
           S+I++ +I+  Q +A  +E GRV++VGDGI +  G++NV   ELV F +G  GM +NLEA   G+V+ G    +KEG  VKRT  +VDVPVG  +LGRV+DA+GNPIDG G IK  +K   +  APG++ R SV +P++TG  ++DSM PIG+GQRELIIGD+QTGKT +A+DA++NQK         K + C+YV +GQK ST+ Q + TL++  A++Y  +VA++AS+   L Y+APFTG  + E +   G   LIIYDDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+N ++GGGS+TALP+IET+ GD+SAYIPTNVISITDGQ+F+ + LF  G RPAI+ GLSVSRVGSSAQ+ A+K+ +GSLKL LAQYRE+ AF+QFGSDLD  TK+ L  G+++ +L+KQ + +P + +    L+++    ++  IPV  I  ++   + H K  +  +LE ID+   +S+DL  Q+K+
  S:    55 SSILEQRIRGVQEEAGLAETGRVLSVGDGIARVHGMTNVQAEELVEFASGVKGMCMNLEAGQVGVVLFGSDRLVKEGETVKRTGEIVDVPVGPEMLGRVVDALGNPIDGKGPIKTTEKRRAQLKAPGILPRKSVNQPVQTGLKSVDSMVPIGRGQRELIIGDRQTGKTAVALDAMLNQKRWNNSSDETKKLYCVYVAVGQKRSTVAQLVKTLEENDAMKYCIVVAATASEAAPLQYIAPFTGCAMGEWFRDNGRHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNDKHGGGSLTALPVIETQGGDVSAYIPTNVISITDGQIFLESELFYKGIRPAINVGLSVSRVGSSAQLKAMKQVAGSLKLFLAQYREVAAFAQFGSDLDASTKQTLNRGERLTELLKQKQYSPMAVNEMVPLIYAGVNGHLDSIPVKKILQWEADFLAHLKANEAEVLEKIDKEGQLSKDLEAQLKD 545
>gi|159027205|emb|CAO89299.1| atpA [Microcystis aeruginosa PCC 7806] (502 aa)
Score = 1332, Expect = 8.3e-145, Identities = 264/492 (53%), Positives = 355/492 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQK----TILETIDQTKDISQDLFVQIKNEF 492
           ++I  D+ S II+ QI+ Y  +   S +G V+ VGDG  +  GL   M  EL+ FE+G+ G+ LNLE    G V++G    IKEG  VK T  +  VPVGD L+GRV+DA+G PIDG G+I   +   +E  APG++AR SVCEP++TG  AID+M P+G+GQRELIIGD++TGKT IAID IINQK ++V C+YV IGQK ST+ Q I+TL Q GA++YT +VA++A+D  +L Y+AP+TG +IAE +M KG+  L+IYDDL+K A AYR LSLL+RRPPGREAYPGD+FYLHSRLLER+ K++   GGGS+TALPIIET+AGD+SAYIPTNVISITDGQ+F+ T+LFN+G RPAI+AG+SVSRVGS+AQ  A+KK +G LKLELAQ+ EL+AF+QF SDLD  T+  L  G+++ +++KQ +N P S   +  ++++    Y+  I  D + DF   +  + K  K     I+ T  Q  D ++ L     NE+
  S:     2 VAIRPDEISTIIRQQIESYNQEVQVSNVGTVLQVGDGTARIYGLQQAMSGELLEFEDGTVGIALNLEEDNVGAVLMGDGFGIKEGGTVKATGKIAQVPVGDALVGRVVDALGRPIDGKGDILASETRLVESPAPGIVARKSVCEPMQTGITAIDAMIPVGRGQRELIIGDRKTGKTAIAIDTIINQKTEDVICVYVAIGQKASTVAQVIDTLTQRGAMDYTVVVAANANDPATLQYIAPYTGASIAEYFMYKGKATLVIYDDLTKQAQAYRQLSLLMRRPPGREAYPGDVFYLHSRLLERAAKLSDALGGGSMTALPIIETQAGDVSAYIPTNVISITDGQIFLSTDLFNAGFRPAINAGISVSRVGSAAQTKAMKKVAGKLKLELAQFDELEAFAQFASDLDAATQAQLARGQRLRQILKQPQNFPLSVWEQVAVVYAGLNGYLDDIATDKVIDFCAGLREYLKTSKPRYVEIVSTEKQLNDEAEGLLKDGINEY 497
>gi|119484592|ref|XP_001262075.1| mitochondrial F1 ATPase subunit alpha, putative [Neosartorya fischeri NRRL 181] >gi|119410231|gb|EAW20178.1| mitochondrial F1 ATPase subunit alpha, putative [Neosartorya fischeri NRRL 181] (556 aa)
Score = 1332, Expect = 8.5e-145, Identities = 259/491 (52%), Positives = 355/491 (72%)
  Q:     9 SNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQK--------GKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK-QQKTILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           S+I++ +I+  Q +A  +E GRV++VGDGI +  G++NV   ELV F +G  GM +NLEA   G+V+ G    +KEG  VKRT  +VDVPVG  LLGRV+DA+GNPIDG G I    K   +  APG++ R SV +P++TG   +DSM PIG+GQRELIIGD+QTGKT +A+DA++NQK         K + CIYV +GQK ST+ Q + TL++  A++Y+ +VA++AS+   L YLAPFTG  + E +   G   +I+YDDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+N ++GGGS+TALP+IET+ GD+SAYIPTNVISITDGQ+F+   LF  G RPAI+ GLSVSRVGS+AQ+ A+K+ +GSLKL LAQYRE+ AF+QFGSDLD  TK+ L  G+++ +L+KQ + +P + S    L+F+    Y+  IPV+ I  ++   +   K  Q  +LETID+   +S++L  Q++    +   S+
  S:    55 SSILEQRIRGVQEEAGLAETGRVLSVGDGIARVHGMTNVQAEELVEFASGVKGMCMNLEAGQVGVVLFGSDRLVKEGETVKRTGEIVDVPVGPELLGRVVDALGNPIDGKGPINTKAKSRAQLKAPGILPRRSVNQPVQTGLKCVDSMVPIGRGQRELIIGDRQTGKTAVALDAMLNQKRWNNSSDESKKLYCIYVAVGQKRSTVAQLVKTLEENDAMKYSIVVAATASEAAPLQYLAPFTGCAMGEWFRDNGRHAVIVYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDKHGGGSLTALPVIETQGGDVSAYIPTNVISITDGQIFLEAELFYKGIRPAINVGLSVSRVGSAAQVKAMKQVAGSLKLFLAQYREVAAFAQFGSDLDASTKQTLARGERLTELLKQKQYSPMAVSEMVPLIFAGVNGYLDGIPVNKILTWESDFLASVKSNQPELLETIDKEGQVSKELEAQLREVIENFNKSF 554
>gi|108563497|ref|YP_627813.1| F0F1 ATP synthase subunit alpha [Helicobacter pylori HPAG1] >gi|118573478|sp|Q1CSD3|ATPA_HELPH ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|107837270|gb|ABF85139.1| ATP synthase F1, subunit alpha [Helicobacter pylori HPAG1] (503 aa)
Score = 1331, Expect = 9.6e-145, Identities = 252/497 (50%), Positives = 369/497 (74%)
  Q:     3 INLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQK--TILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           + L++ S++I+ +IK ++     +E+G+V++  DG+ +  GL+ VM  E++ FE G  G+  NLE  + G+++ G   +IKEG+ VKRTKN++ VPVGD ++GRV++A+G PIDG GEI+ ++   IE+ APG+M R SV EPL+TG  AID++ PIG+GQRELIIGDKQTGKTT+AIDAIINQKG+NV CIYV IGQK ST+ Q +  L+++GA+EY+ ++ +SASD  ++ YLAP++G+ + E +       LI+YDDLSKHA+AYR +SL+LRRPPGREA+PGD+FY+HSRLLER+ K+  E G GS+TALPI+ET+AGD+SAYIPTN+ISITDGQ+F+ T+LF SG RPAI+ GLSVSRVG +AQI A K+ SG+L+L+LAQYREL AF+QF SDLD+ +K+ LE G+++++++KQ   +P     + +++++  + ++  + V  + DF+E+ +  F + K   +LE I   K + +DL   ++        +Y
  S:     4 LKLEEISSVIEEKIKNFELDCDMAEVGKVVSYADGVAKVYGLNGVMSYEVLEFETGDKGVAANLEEDSVGVIVFGFGNNIKEGTSVKRTKNLMKVPVGDAVVGRVLNALGEPIDGKGEIETNEFSLIEQKAPGIMDRKSVHEPLQTGIKAIDALVPIGRGQRELIIGDKQTGKTTVAIDAIINQKGQNVICIYVAIGQKESTVAQVVRKLEEYGAMEYSVVINASASDSAAMQYLAPYSGVAMGEYFRDHARHALIVYDDLSKHAVAYREISLILRRPPGREAFPGDVFYIHSRLLERAAKLCDEKGAGSLTALPIVETQAGDVSAYIPTNIISITDGQIFLETDLFYSGIRPAINVGLSVSRVGGAAQIKATKQVSGTLRLDLAQYRELQAFTQFASDLDEASKKQLERGQRMVEVLKQAPYSPLPIEKQVVIIYAGAKGFLDSVSVKKVVDFEEQ-LHPFLEAKYPQVLEEIHTKKALDKDLEAMLRKVLEEFKLTY 501
>gi|189347805|ref|YP_001944334.1| ATP synthase F1, alpha subunit [Chlorobium limicola DSM 245] >gi|189341952|gb|ACD91355.1| ATP synthase F1, alpha subunit [Chlorobium limicola DSM 245] (526 aa)
Score = 1331, Expect = 9.7e-145, Identities = 259/498 (52%), Positives = 361/498 (72%)
  Q:     2 SINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKE------------------NGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQK-TILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           ++  D+ S+I++ Q+  ++++A   ++G V+ VGDGI +  GLS V   EL+ F N   GM LNLE    G V+ G+   +KEG  V+RT  +  VPVG+ +LGRV+  +G PIDG G I+ + ++P+E+ APGV+ R SV EPL+TG  AIDSM PIG+GQRELIIGD+QTGKT +AID IINQKGK V CIYV IG K ST+ Q +NTL+++GA+EYTT+++++ASD   L ++APF G  + E +   G   L++YDDLSK A+AYR LSLLLRRPPGREAYPGD+FYLHSRLLER+ KI  +                   GGGS+TALP+IET+AGD+SAYIPTNVISITDGQ+F+ +NLFNSGQRPAI+ G+SVSRVG +AQI A+KK +G+L+L+LAQ+REL+AFS+FGSDLDK TK  L+ G ++++++KQ +  P     +  ++F   +  +  + V +I  F+E+ +   + +   IL+TI +   +  D   Q+K      ++S+
  S:     4 TVRPDEVSSILRKQLAGFESEAEVYDVGTVLQVGDGIARVYGLSLVAAGELLEFPNKVMGMALNLEEDNVGCVLFGESNTVKEGDTVRRTNILASVPVGEAMLGRVVTPLGEPIDGKGSIETEIRVPLERRAPGVIFRKSVHEPLQTGLKAIDSMIPIGRGQRELIIGDRQTGKTAVAIDTIINQKGKGVFCIYVAIGLKGSTVAQVVNTLEKYGAMEYTTVISATASDPAPLQFIAPFAGAALGEYFRDTGRHALVVYDDLSKQAVAYRQLSLLLRRPPGREAYPGDVFYLHSRLLERAAKITDDIEVARKMNDLPDALKPLVKGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLESNLFNSGQRPAINVGISVSRVGGAAQIKAMKKVAGTLRLDLAQFRELEAFSKFGSDLDKTTKAQLDRGARLVEILKQGQYIPMPVEKQVAIIFLGTQGLLDAVEVPHIRRFEEEFLSMLEHKHPEILKTIAEKGTLEADTAKQLKEAAERFVSSF 520
>gi|152993356|ref|YP_001359077.1| F0F1 ATP synthase subunit alpha [Sulfurovum sp. NBC37-1] >gi|189081326|sp|A6QB61|ATPA_SULNB ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|151425217|dbj|BAF72720.1| F0F1-type ATP synthase, alpha subunit [Sulfurovum sp. NBC37-1] (504 aa)
Score = 1331, Expect = 1.0e-144, Identities = 258/499 (51%), Positives = 360/499 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQ-KTILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           + +  D+ S+IIK +I+ ++     +EIG+V+ + DGI    GL+NVM  E+V F+NG+ G+ LNLE    G+V+LG    IKEG  VKR+  ++  PVGDGL+GRV++ +G+PIDG G I+  +   IE+ APG+MAR SV EPL+TG  AID++ P+G+GQRELIIGD+QTGKTT+AID IINQKG++V CIYV IGQK ST+   +  L++ GAL+YT IV + ASD  +L +LAP+ G+T+AE +   G   +I YDDLSKHA+AYR +SL+LRRPPGREAYPGD+FYLHSRLLER+ K++ E G GSITA PIIET+AGD++AYIPTNVISITDGQ+F+ T+LFNSG RPAI+ GLSVSRVG +AQI A+K+ SG+L+L+LA +REL AF+QF SDLD  T+  LE G+++++++KQ    P     + +++F+    Y+  I    +  F+ +++   + +  ++L+ I   K IS D   Q++       TS+
  S:     3 VKLQADEISSIIKERIENFEIDVDINEIGKVVGIADGITTVYGLNNVMAGEVVEFDNGAKGLVLNLEEANVGVVVLGTSAGIKEGMSVKRSGALLKTPVGDGLMGRVVNPLGDPIDGKGTIETAEYRFIEEKAPGIMARKSVHEPLQTGIKAIDALVPVGRGQRELIIGDRQTGKTTLAIDTIINQKGQDVVCIYVAIGQKQSTVAATVKKLEEHGALDYTIIVNAGASDSAALQFLAPYAGVTMAEYFRDNGRHAVIFYDDLSKHAVAYREMSLILRRPPGREAYPGDVFYLHSRLLERAAKLSDELGAGSITAFPIIETQAGDVAAYIPTNVISITDGQIFLETDLFNSGIRPAINVGLSVSRVGGAAQIKAIKQVSGTLRLDLASFRELQAFAQFASDLDDYTRSQLERGQRMVEVLKQGPYVPVPVEKQVVIIFAGANGYLDDIAASSVTKFEAELMPFMEAKYASVLDAIRNEKKISDDTDAQLRKAIEDFKTSF 502
>gi|584805|sp|Q07405|ATPA_MYXXA ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|119367957|sp|Q1CWT2|ATPA_MYXXD ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|286117|dbj|BAA03725.1| proton translocating ATPase [Myxococcus xanthus] >gi|741014|prf||2006275A 59kD membrane-associated GTP-binding protein (515 aa)
Score = 1331, Expect = 1.0e-144, Identities = 266/495 (53%), Positives = 353/495 (71%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSI-------KEKYIRWIP----VDYIEDFKEKII-RHFKQQKTILETIDQTKDISQDLFVQIKNEFNSL 495
           M I  D+ S II+ QIK+Y  K   +E G V++VGDGI +  GL   +  ELV F NG  G+ LNLE    G+ ++G F+ I+EG  VKRT+ +  VPVG  LLGRV+D +G P+DG G I   +   +E  APG+++R SV EPL+TG  A+D++ P+G+GQRELIIGD+QTGKT +AID IINQKG NV CIYV IGQK ST+ Q +  L ++GA+EYTT+VAS+ASD   + + AP+ G+ + E +       LI+YDDLSK A+AYR LSLLLRRPPGREAYPGD+FY+HSRLLER+ K++ E G GS+TALPIIET+AGD+SAYIPTNVISITDGQ+F+ T+LF +G RPAI+ GLSVSRVGS+AQI A+K+ +G++KLELAQYREL AF+QFGSDLDK T+E L  G ++++L+KQ +  P     + + +++        K  +IR IP    V ++ +F E    +H    K +    + T DI   L   I  EFN +
  S:     1 MEIRADEISRIIREQIKDYGKKVTVAETGTVLSVGDGIARIYGLEGALAGELVEFANGVQGLVLNLEEDNVGVAIMGDFQAIREGDTVKRTQQIASVPVGKELLGRVVDPLGKPLDGKGPIAATETRRLEVKAPGIVSRKSVHEPLQTGIKALDALVPVGRGQRELIIGDRQTGKTAVAIDTIINQKGLNVYCIYVAIGQKQSTVAQVVEKLNRYGAMEYTTVVASNASDPAPMQFFAPYAGVAMGEYFRDNKMHALIVYDDLSKQAVAYRQLSLLLRRPPGREAYPGDVFYVHSRLLERAAKLSDEEGAGSLTALPIIETQAGDVSAYIPTNVISITDGQIFLETDLFFAGVRPAINVGLSVSRVGSAAQIKAMKQVAGTMKLELAQYRELAAFAQFGSDLDKATQETLARGARMVELLKQGQYEPMPVEKQVMQIYAATNRDDPKKRGWIRDIPTADVVRWMREFLEFADGKHPNVAKDLASKRELTADIKTALSKAI-TEFNEV 506
>gi|163789450|ref|ZP_02183889.1| F0F1 ATP synthase subunit alpha [Carnobacterium sp. AT7] >gi|159875304|gb|EDP69369.1| F0F1 ATP synthase subunit alpha [Carnobacterium sp. AT7] (515 aa)
Score = 1331, Expect = 1.0e-144, Identities = 265/507 (52%), Positives = 368/507 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHF-KQQKTILETIDQTKDISQ-DLFVQIKNEF-NSLITSYIKTIPDYN 507
           M +  ++ S++IK QI  YQ++ +  E+G V  VGDGI +A GL N M  EL+ F +G++GM  NLE    GI++LG+F  I+EG IVKRT  ++ VPVG+ ++GRV++ +G PIDG GEI   K  PIE  APGVM R SV EPL+TG  AID++ PIG+GQREL+IGD++TGKT++AID I+NQKG++  CIYV IGQK ST+   + TLK+ GA++YT ++ +SAS    L Y+AP+ G  I EE+M  G+ VLII+DDL+K A AYR LSLLLRRPPGREAYPGD+FYLHSRLLER+ K++ + GGGS+TA+P +ET+AGDISAYIPTNVISITDGQ+F+ ++LF SG RPAI AGLSVSRVG +AQI A+KK +G+L+L+LA +REL+AF+QFGSDLD  T+  L  G + ++++KQ  +   +   + I+L+++   ++  +PV  +  F++++      Q   IL  I +TKD+ + +    + NEF  +  T+YI +  D N
  S:     1 MGVKAEEISSLIKKQIASYQSELVIDEVGTVSYVGDGIARAYGLENAMSGELLEFADGTFGMAQNLEINDVGIIILGEFTGIREGDIVKRTGRIMQVPVGEAMIGRVVNPLGQPIDGLGEIVTTKTRPIEAEAPGVMDRHSVNEPLQTGIKAIDALVPIGRGQRELVIGDRKTGKTSLAIDTILNQKGQDTICIYVAIGQKESTVRNQVETLKKHGAMDYTIVMTASASQPAPLLYIAPYAGSAIGEEFMYNGKHVLIIFDDLTKQAAAYRELSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSDKLGGGSMTAIPFVETQAGDISAYIPTNVISITDGQIFLESDLFYSGIRPAIAAGLSVSRVGGAAQIKAMKKVAGTLRLDLASFRELEAFTQFGSDLDAATQAKLNRGHRTVEVLKQGLHQTINVEKQVIILYALTHGFLDSVPVSELSRFEDELYDFLDNQHAEILTEIVETKDLPRTEKLDAVINEFITNFFTNYIDSSIDTN 510
>gi|147679149|ref|YP_001213364.1| F0F1 ATP synthase subunit alpha [Pelotomaculum thermopropionicum SI] >gi|189081306|sp|A5CYE4|ATPA_PELTS ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|146275246|dbj|BAF60995.1| F0F1-type ATP synthase, alpha subunit [Pelotomaculum thermopropionicum SI] (506 aa)
Score = 1331, Expect = 1.1e-144, Identities = 259/494 (52%), Positives = 359/494 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKT-ILETIDQT---KDISQDLFVQI---KNEFNS 494
           M++  ++ S+II+ QI +YQ +   +++G VI VGDGI +  GL + M  EL+ F  G  GM LNLE    G V+LG ++ IKEG  VKRT  +V VPVGD L+GRV++ +G P+DG G +  DK  P+E IAPGV+ R  V + L+TG  A+DSM PIG+GQRELI+GD+QTGKT IA+DAIINQ+G +V CIYV +GQK ST+   +  L + GA++YT +V+++ASD   L ++APF G  + EE+M +G  VLI+YDDLSK A AYR LSLLLRRPPGREAYPGD+F LHSRLLER+ K++ + GGGS+TALPIIET+AGD+SAYIPTNVISITDGQ+++  +LF +G RPAI+ G+SVSRVG +AQ+ A+++ +G L+L+LAQYREL AF+QFG+DLDK T+  L  G ++ +L+KQ +  P     + + +F+    Y+  +PV+ +  F+ + +++ K  K  I ETI +T   KD+ Q+L   +   K EF +
  S:     1 MNLRPEEISSIIRQQIDKYQAQIELTDVGTVIQVGDGIARVYGLMDCMSMELLEFPGGVLGMALNLEEDNIGCVILGPYKHIKEGDTVKRTGRIVSVPVGDALIGRVVNPLGQPLDGKGPVNSDKYRPVEVIAPGVIYRKPVHQALQTGIKAVDSMIPIGRGQRELILGDRQTGKTAIAVDAIINQRGGDVICIYVAVGQKQSTVANVVQKLTETGAMDYTIVVSATASDPAPLLFIAPFAGAAMGEEFMWQGRHVLIVYDDLSKQAAAYRELSLLLRRPPGREAYPGDVFNLHSRLLERACKLDDQFGGGSMTALPIIETQAGDVSAYIPTNVISITDGQIYLEPDLFYAGIRPAINVGISVSRVGGAAQVRAMRQVAGRLRLDLAQYRELAAFAQFGADLDKATQARLIRGDRMTELLKQGQYVPMPVEDQVMSIFAGTNGYLDDLPVEKVLPFEAEFLKYMKTNKPHIGETIRRTGQLKDVEQELHAAVEAFKKEFKA 501
>gi|70983614|ref|XP_747334.1| mitochondrial F1 ATPase subunit alpha [Aspergillus fumigatus Af293] >gi|66844960|gb|EAL85296.1| mitochondrial F1 ATPase subunit alpha, putative [Aspergillus fumigatus Af293] >gi|159123660|gb|EDP48779.1| mitochondrial F1 ATPase subunit alpha, putative [Aspergillus fumigatus A1163] (556 aa)
Score = 1331, Expect = 1.1e-144, Identities = 258/481 (53%), Positives = 352/481 (73%)
  Q:     9 SNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQK--------GKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK-QQKTILETIDQTKDISQDLFVQIK 489
           S+I++ +I+    +A  +E GRV++VGDGI +  G++NV   ELV F +G  GM +NLEA   G+V+ G    +KEG  VKRT  +VDVPVG  LLGRV+DA+GNPIDG G I    K   +  APG++ R SV +P++TG   +DSM PIG+GQRELIIGD+QTGKT +A+DA++NQK         K + CIYV +GQK ST+ Q + TL++  A++Y+ +VA++AS+   L YLAPFTG  + E +   G   +I+YDDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+N ++GGGS+TALP+IET+ GD+SAYIPTNVISITDGQ+F+ + LF  G RPAI+ GLSVSRVGS+AQ+ A+K+ +GSLKL LAQYRE+ AF+QFGSDLD  TK+ L  G+++ +L+KQ + +P + S    L+F+    Y+  IPV+ I  ++   +   K  Q  ILETID+   +S++L  Q++
  S:    55 SSILEQRIRGVHEEAGLAETGRVLSVGDGIARVHGMTNVQAEELVEFASGVKGMCMNLEAGQVGVVLFGSDRLVKEGETVKRTGEIVDVPVGPELLGRVVDALGNPIDGKGPINTKAKSRAQLKAPGILPRRSVNQPVQTGLKCVDSMVPIGRGQRELIIGDRQTGKTAVALDAMLNQKRWNNSSDESKKLYCIYVAVGQKRSTVAQLVKTLEENDAMKYSIVVAATASEAAPLQYLAPFTGCAMGEWFRDNGRHAVIVYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDKHGGGSLTALPVIETQGGDVSAYIPTNVISITDGQIFLESELFYKGIRPAINVGLSVSRVGSAAQVKAMKQVAGSLKLFLAQYREVAAFAQFGSDLDASTKQTLARGERLTELLKQKQYSPMAVSEMVPLIFAGVNGYLDGIPVNKILTWESDFLASVKSNQPEILETIDKEGQVSKELEAQLR 544
>gi|148558963|ref|YP_001259640.1| F0F1 ATP synthase subunit alpha [Brucella ovis ATCC 25840] >gi|166201652|sp|A5VSE3|ATPA_BRUO2 ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|148370220|gb|ABQ60199.1| ATP synthase F1, alpha subunit [Brucella ovis ATCC 25840] (509 aa)
Score = 1330, Expect = 1.2e-144, Identities = 258/499 (51%), Positives = 354/499 (70%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQK--------GKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK-QQKTILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           M I   + S I+K QIK +  +A  SE+G+V+ VGDGI +  GL NV   E+V F  G  GM LNLE+   G+V+ G   DIKEG +VKRT  +VDVPVG  LLGRV+DA+GNPIDG G IK  ++  ++  APG++ R SV EP+ TG  AID++ P+G+GQREL+IGD+QTGKT I +D  +NQK           + C+YV +GQK ST+ QF+  L++ GALEY+ +VA++ASD   + YLAPF G  + E +   G+  LI YDDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+N ENG GS+TALP+IET+  D+SA+IPTNVISITDGQ+F+ TNLF  G RPA++ GLSVSRVGSSAQI A+K+ +GS+K ELAQYRE+ AF+QFGSDLD  T+ +L  G ++ +L+KQ + +P     +  ++++    Y+  + V+ +  F+E ++   + + K +LE I   K ++ DL  ++K   ++   S+
  S:     1 MDIRAAEISAILKEQIKNFGKEAEVSEVGQVLFVGDGIARVYGLDNVQAGEMVEFPGGIRGMALNLESDNVGVVIFGADRDIKEGDVVKRTGAIVDVPVGPELLGRVVDALGNPIDGKGPIKAKERRRVDVKAPGIIPRKSVHEPMSTGLKAIDALIPVGRGQRELVIGDRQTGKTAIILDTFLNQKPIHDNGPDKDKLYCVYVAVGQKRSTVAQFVKVLEERGALEYSIVVAATASDPAPMQYLAPFAGCAMGEYFRDNGQHALIGYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNDENGAGSLTALPVIETQGNDVSAFIPTNVISITDGQIFLETNLFYQGIRPAVNVGLSVSRVGSSAQIKAMKQVAGSIKGELAQYREMAAFAQFGSDLDAATQRLLNRGARLTELLKQPQFSPLKTEEQVAVIYAGVNGYLDKLAVNQVGKFEEGLLASLRTEHKDVLEGIRNEKALTDDLKAKLKAAIDAFAKSF 508
>gi|114567890|ref|YP_755044.1| Sodium-transporting two-sector ATPase [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|122317243|sp|Q0AUD1|ATPA_SYNWW ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|114338825|gb|ABI69673.1| Sodium-transporting two-sector ATPase [Syntrophomonas wolfei subsp. wolfei str. Goettingen] (504 aa)
Score = 1329, Expect = 1.5e-144, Identities = 261/494 (52%), Positives = 358/494 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQK-GKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWM-SKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKT-ILETIDQT---KDISQDLFVQIKNEFNS 494
           MSI  ++ S I+K QI+ YQ++   S +G VI VGDGI +  GL   M  EL+ F  G++GM LNLE    G V+LG++  IKEG +VK T  +++VP G  +LGRV++A+G PIDG G I      P+EK+A GV+ R  V  P++TG  AIDSM PIG+GQRELIIGD+Q GKT IA+D+IINQ+  K++ CIYV +GQK ++I       ++ GA++YT IVA++AS+   L Y+AP+ G+ +AEE+M ++G+DVLIIYDDLSKHA+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ ++N ++GGGSITALPIIET+AGD+SAYIPTNVISITDGQ+++  ++FN+GQRPA++AGLSVSRVG SAQ  A+K  +G L+L+LAQYREL AF+QFGSDLDK T   L  G++V +++KQ +  P     + + ++S    Y+  IP D + +F+   ++  +     +L  I  T    D ++   ++  NEF S
  S:     1 MSIRPEEISAILKEQIERYQSEVEVSNVGSVIYVGDGIARVYGLQGAMAGELLEFTGGTFGMVLNLEEDNVGAVLLGEYNHIKEGDVVKATGRIMEVPAGSAMLGRVVNALGQPIDGKGPINTTAFRPLEKVAHGVVTRQPVTTPMQTGLKAIDSMVPIGRGQRELIIGDRQIGKTAIALDSIINQREKKDLICIYVAVGQKQASIAGIAAKFEEMGAMDYTIIVAATASEPAPLLYMAPYAGVAMAEEFMEAEGKDVLIIYDDLSKHAVAYREMSLLLRRPPGREAYPGDVFYLHSRLLERACRLNPDHGGGSITALPIIETQAGDVSAYIPTNVISITDGQIYLEADMFNAGQRPAVNAGLSVSRVGGSAQTKAMKSVAGQLRLDLAQYRELAAFAQFGSDLDKATLARLTRGERVTEILKQGQYQPMPVQEQVVSIYSGVNGYLDDIPRDKVGEFEVDFLKFMRSANADVLNAIKDTGKIDDATEQKLIKAINEFKS 500
>gi|15889879|ref|NP_355560.1| F0F1 ATP synthase subunit alpha [Agrobacterium tumefaciens str. C58] >gi|81591311|sp|Q8UC74|ATPA_AGRT5 ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|15157826|gb|AAK88345.1| ATP synthase alpha chain [Agrobacterium tumefaciens str. C58] (509 aa)
Score = 1329, Expect = 1.6e-144, Identities = 262/499 (52%), Positives = 355/499 (71%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQK--------GKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQ-KTILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           M I   + S I+K+QIK + N+A  SE+G+V++VGDGI +  GL NV   E+V F  G  GM LNLEA   G+V+ G    IKEG  VKRT  +VDVPVG  LLGRV+DA+GNPIDG G I   K+  ++  APG++ R SV EP+ TG  AID++ P+G+GQREL+IGD+QTGKT I +D I+NQK        G  + C+YV IGQK ST+ QF+  L++ GAL+Y+ IVA++ASD   + YLAPF G  + E +   G+  LI YDDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K++ E G GS+TALP+IET+  D+SA+IPTNVISITDGQ+F+ T+LF  G RPA++ GLSVSRVGS+AQI A+K+ +GS+K ELAQYRE+ AF+QFGSDLD  T+ +L  G ++ +L+KQ + +P     +  ++F+    Y+  IPV  +  F++  + + + + K IL+TI   K IS D   ++K   ++   S+
  S:     1 MDIRAAEISAILKDQIKNFGNEAEVSEVGQVLSVGDGIARVYGLDNVQAGEMVEFPGGIRGMALNLEADNVGVVIFGSDRSIKEGDTVKRTGAIVDVPVGPELLGRVVDALGNPIDGKGPINAAKRSRVDVKAPGIIPRKSVHEPMSTGLKAIDALIPVGRGQRELVIGDRQTGKTAIILDTILNQKAIHDNGPDGDKLYCVYVAIGQKRSTVAQFVKVLEERGALQYSIIVAATASDPAPMQYLAPFAGCAMGEYFRDNGKHALIGYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSDEMGAGSLTALPVIETQGNDVSAFIPTNVISITDGQIFLETDLFYQGIRPAVNVGLSVSRVGSAAQIKAMKQVAGSIKGELAQYREMAAFAQFGSDLDASTQRLLNRGARLTELLKQPQFSPLKTEEQVAVIFAGVNGYLDKIPVAQVGKFEQGFLSYLRSEGKAILDTIRTEKAISDDTKGKLKGALDNFAKSF 508
>gi|194333106|ref|YP_002014966.1| ATP synthase F1, alpha subunit [Prosthecochloris aestuarii DSM 271] >gi|194310924|gb|ACF45319.1| ATP synthase F1, alpha subunit [Prosthecochloris aestuarii DSM 271] (526 aa)
Score = 1329, Expect = 1.6e-144, Identities = 262/498 (52%), Positives = 364/498 (73%)
  Q:     2 SINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKE------------------NGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKT-ILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           ++  D+ S+I++ Q+  ++++A   ++G V+ VGDGI +  GLS V   EL+ F     GM LNLE    G VM G  + +KEG  VKRT  +  +PVG+ +LGRVI+ +G PIDG G I  + ++P+E+ APGV+ R SV EPL+TG  AID+M PIG+GQRELIIGD+QTGKT +AID IINQKGK V CIYV  GQK+STI Q ++TL++FGA+EYTT++A+SASD   L Y++P+ G T+ E +   G   L+IYDDLSK A+AYR LSLLLRRPPGREA+PGD+FY+HSRLLER+ KI  +                   GGGS+TALPIIET+AGD+SAYIPTNVISITDGQ+F+ +NLFN+GQRPAI+ G+SVSRVG SAQI A+KK SG+L+L+LAQ+REL+AFS+FGSDLDK TK  L+ G+++++++KQ +  P     +  +++   +  +  +   Y+  F+E+ +   + + + IL TI +T  +  DL  ++K      ++S+
  S:     4 TVRPDEVSSILRKQLAGFESEADVYDVGTVLQVGDGIARIYGLSKVAAGELLEFPGKIMGMALNLEEDNVGAVMFGGADIVKEGDTVKRTGILASIPVGEAMLGRVINPLGEPIDGKGSIATEIRLPLERRAPGVIFRKSVHEPLQTGLKAIDAMIPIGRGQRELIIGDRQTGKTAVAIDTIINQKGKGVYCIYVATGQKSSTIAQVVSTLEKFGAMEYTTVIAASASDPAPLQYISPYAGATLGEYFRDTGRHALVIYDDLSKQAVAYRQLSLLLRRPPGREAFPGDVFYVHSRLLERAAKITDDIDVAKKMNDLPDALKPMVKGGGSLTALPIIETQAGDVSAYIPTNVISITDGQIFLESNLFNAGQRPAINVGISVSRVGGSAQIKAMKKISGTLRLDLAQFRELEAFSKFGSDLDKATKAQLDRGERLVEILKQGQYVPMPVEKQVAIIYVGTQGLLDSLDTKYVRQFEEEFLALLEHKHSDILSTIAETGKMEADLSSRLKEVAEKFMSSF 520
>gi|186900969|ref|ZP_02973924.1| ATP synthase F1, alpha subunit [Cyanothece sp. PCC 7424] >gi|186692091|gb|EDU16712.1| ATP synthase F1, alpha subunit [Cyanothece sp. PCC 7424] (503 aa)
Score = 1329, Expect = 1.6e-144, Identities = 259/498 (52%), Positives = 359/498 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKTILETI----DQTKDISQDLFVQIKNEFNSLITS 498
           +SI  D+ S+II+ QI+ Y  +   S +G V+ VGDG  +  GL   M  EL+ FE+G+ G+ LNLE    G V++G    I+EGS VK T  +  VPVG+ L+ R++DA+G PIDG G I  ++   +E  APG++AR SVCEP++TG  AID+M P+G+GQRELIIGD++TGKT IAID IINQKG++V C+YV IGQK ST+ Q ++TL + GA++YT +V++SA+D  +L YLAP+TG TIAE +M KG+  L+IYDDLSK A AYR +SLL+RRPPGREAYPGD+FYLHSRLLER+ K+N + GGGS+TALPIIET+AGD+SAYIPTNVISITDGQ+F+ ++LFN+G RPAI+AG+SVSRVGS+AQ  A+K+ +G LKLELAQ+ EL+AFSQF SDLD  T+  L  G+++ +++KQ +N+P +   +  ++++    Y+  IP   +  F + +  + +  K     I     +  D ++ L  +   EF    T+
  S:     2 VSIRPDEISSIIRQQIESYDQQVQVSNVGTVLQVGDGTARIYGLQQAMAQELLEFEDGTIGIALNLEEDNVGAVLMGSGYGIQEGSTVKATGRIAQVPVGEALVSRIVDALGRPIDGKGPINTNETRLLESPAPGIVARKSVCEPMQTGITAIDAMIPVGRGQRELIIGDRKTGKTAIAIDTIINQKGEDVICVYVAIGQKASTVAQVVDTLTEKGAMDYTVVVSASANDPATLQYLAPYTGATIAEYFMYKGKATLVIYDDLSKQAQAYRQISLLMRRPPGREAYPGDVFYLHSRLLERAAKLNDQLGGGSMTALPIIETQAGDVSAYIPTNVISITDGQIFLSSDLFNAGFRPAINAGISVSRVGSAAQTKAMKQVAGKLKLELAQFAELEAFSQFASDLDAATQAQLARGQRLREVLKQPQNSPLAVWEQVAIVYAGLNGYLDDIPPAQVTTFTQGLRDYLRNSKPKFPEIVGNEKKLTDEAESLLKEAIGEFKQGFTA 503
>gi|117926734|ref|YP_867351.1| ATP synthase F1, alpha subunit [Magnetococcus sp. MC-1] >gi|158512339|sp|A0LDA2|ATPA_MAGSM ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|117610490|gb|ABK45945.1| ATP synthase F1, alpha subunit [Magnetococcus sp. MC-1] (507 aa)
Score = 1329, Expect = 1.6e-144, Identities = 261/500 (52%), Positives = 358/500 (71%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKN-----VKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKT-ILETIDQTKDISQDLFVQIKNEFNSLITSYI 500
           M +++ + S I+K QI EY  +A  SE+G VI VGDGI +A GL NVM  E+V FE+G+ GM LNLE    GIV+ G+   IKEG+ VKRT  +VDVPVG GLLGRV D +GNPID  G ++  ++   E  APG++ R SV EPL TG  A+D + PIG+GQRELIIGD+QTGKT +AID IINQK  +     V CIYV IGQK ST+ Q + TL++ GA+ YTT+VA++ASD   + +L+ +TG  + E +   G   LI+YDDLSK A AYR +SL+LRRPPGREAYPGD+FY+HSRLLER+ K+N E+GGGS+TALPIIET+ GD+SAYIPTNVISITDGQ+F+ T+LF SG RPAI  GLSVSRVG SAQ+ A K+ +G+L+L+LAQYRE+ AF+QFGSDLD  T+++L  GK++M+L+KQ +  P S   + + +F+    ++  +  D +   + ++++    + + +L+TI  +  +  D   ++     ++I  ++
  S:     1 MQVSVAEISGILKKQIAEYGKEAEVSEVGEVIAVGDGIARAYGLDNVMAGEMVEFEDGTQGMALNLEEDNVGIVIFGEGLAIKEGTTVKRTGRIVDVPVGKGLLGRVTDGLGNPIDDKGPLETTERRLAEVKAPGIIPRKSVHEPLHTGIKALDGLVPIGRGQRELIIGDRQTGKTAVAIDTIINQKRTHETDSPVYCIYVAIGQKRSTVAQVVQTLEENGAMAYTTVVAATASDPAPMQFLSAYTGCAMGEYYRDNGMHALIVYDDLSKQATAYRQMSLILRRPPGREAYPGDVFYIHSRLLERAAKMNDEHGGGSLTALPIIETQDGDVSAYIPTNVISITDGQIFLETDLFYSGIRPAISVGLSVSRVGGSAQVKATKQVAGTLRLDLAQYREMAAFAQFGSDLDATTQKLLHRGKRLMELLKQAQYAPLSMEEQVVSIFAGTRGFLDVVDADAVVKAELELLKQMHAKHSDLLDTIRTSGKLDADTETKLGVAITAIIKEFL 506
>gi|85119497|ref|XP_965645.1| ATP synthase alpha chain, mitochondrial precursor [Neurospora crassa OR74A] >gi|584806|sp|P37211|ATPA_NEUCR ATP synthase subunit alpha, mitochondrial precursor >gi|168759|gb|AAA33560.1| mitochondrial ATPase alpha-subunit >gi|28927457|gb|EAA36409.1| ATP synthase alpha chain, mitochondrial precursor [Neurospora crassa OR74A] (551 aa)
Score = 1329, Expect = 1.7e-144, Identities = 255/492 (51%), Positives = 360/492 (73%)
  Q:     9 SNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQK--------GKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK-QQKTILETIDQTKDISQDLFVQIKNEFNSLITSYI 500
           S+I++ +I+  Q ++  +E GRV++VGDGI +  G++NV   ELV F +G  GM +NLEA   G+V+ G    +KEG  VKRT  +VDVPVG  LLGRVIDA+GNPIDG G I   +K   +  APG++ R SV +P++TG  ++D+M PIG+GQRELIIGD+QTGKT +A+DAI+NQK         K + C+YV +GQK ST+ Q + TL++  A++Y+ +VA++AS+   L YLAPFTG  + E +   G+  L+I+DDL+K A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+NK +GGGS+TALP+IET+ GD+SAYIPTNVISITDGQ+F+ + LF  G RPAI+ GLSVSRVGS+AQ+ A+K+ +GSLKL LAQYRE+ AF+QFGSDLD  TK+ L  G+++ +L+KQ + +P + +    L+F+    ++  +PV  I  ++   + H K  +  I+ TID+   IS+DL  ++++   +   S++
  S:    50 SSILEQRIRGVQEESNLAETGRVLSVGDGIARVHGMANVQAEELVEFASGVKGMCMNLEAGQVGVVLFGSDRLVKEGETVKRTGEIVDVPVGPELLGRVIDALGNPIDGKGPINCKEKRRAQLKAPGILPRQSVNQPVQTGLKSVDAMVPIGRGQRELIIGDRQTGKTAVALDAILNQKRWNSGSDEDKKLYCVYVAVGQKRSTVAQLVKTLEENDAMKYSIVVAATASEAAPLQYLAPFTGACVGEYFRDNGKHSLVIFDDLTKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNKTHGGGSMTALPVIETQGGDVSAYIPTNVISITDGQIFLESELFYKGVRPAINVGLSVSRVGSAAQLKAMKQVAGSLKLFLAQYREVAAFAQFGSDLDAATKQTLNRGERLTELLKQKQYSPMAVNEMVPLIFAGVNGFLDSVPVAKILQWEADFLAHLKTNEPEIMATIDKEGAISKDLEAKLRDVIQTFTKSFL 550
>gi|23502654|ref|NP_698781.1| F0F1 ATP synthase subunit alpha [Brucella suis 1330] >gi|81752065|sp|Q8FYR3|ATPA_BRUSU ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|23348662|gb|AAN30696.1| ATP synthase F1, alpha subunit [Brucella suis 1330] (509 aa)
Score = 1329, Expect = 1.7e-144, Identities = 257/499 (51%), Positives = 355/499 (71%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQK--------GKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK-QQKTILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           M I   + S I+K QIK +  +A  SE+G+V++VGDGI +  GL NV   E+V F  G  GM LNLE+   G+V+ G   DIKEG +VKRT  +VDVPVG  LLGRV+DA+GNPIDG G IK  ++  ++  APG++ R SV EP+ TG  AID++ P+G+GQREL+IGD+QTGKT I +D  +NQK           + C+YV +GQK ST+ QF+  L++ GALEY+ +VA++ASD   + YLAPF G  + E +   G+  LI YDDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+N ENG GS+TALP+IET+  D+SA+IPTNVISITDGQ+F+ TNLF  G RPA++ GLSVSRVGSSAQI A+K+ +GS+K ELAQ+RE+ AF+QFGSDLD  T+ +L  G ++ +L+KQ + +P     +  ++++    Y+  + V+ +  F+E ++   + + K +LE I   K ++ DL  ++K   ++   S+
  S:     1 MDIRAAEISAILKEQIKNFGKEAEVSEVGQVLSVGDGIARVYGLDNVQAGEMVEFPGGIRGMALNLESDNVGVVIFGADRDIKEGDVVKRTGAIVDVPVGPELLGRVVDALGNPIDGKGPIKAKERRRVDVKAPGIIPRKSVHEPMSTGLKAIDALIPVGRGQRELVIGDRQTGKTAIILDTFLNQKPIHDNGPDKDKLYCVYVAVGQKRSTVAQFVKVLEERGALEYSIVVAATASDPAPMQYLAPFAGCAMGEYFRDNGQHALIGYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNDENGAGSLTALPVIETQGNDVSAFIPTNVISITDGQIFLETNLFYQGIRPAVNVGLSVSRVGSSAQIKAMKQVAGSIKGELAQHREMAAFAQFGSDLDAATQRLLNRGARLTELLKQPQFSPLKTEEQVAVIYAGVNGYLDKLAVNQVGKFEEGLLASLRTEHKDVLEGIRNEKALTDDLKAKLKAAIDAFAKSF 508
>gi|189499277|ref|YP_001958747.1| ATP synthase F1, alpha subunit [Chlorobium phaeobacteroides BS1] >gi|189494718|gb|ACE03266.1| ATP synthase F1, alpha subunit [Chlorobium phaeobacteroides BS1] (526 aa)
Score = 1329, Expect = 1.8e-144, Identities = 260/502 (51%), Positives = 366/502 (72%)
  Q:     2 SINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKE------------------NGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKT-ILETIDQTKDISQDLFVQIKNEFNSLITSYIKTI 503
           ++  D+ S I++  +  ++++A   ++G V+ VGDGI +  GLS V   EL+ F +   GM LNLE    G VM GK   +KEG  VKRT  +  +PVG+ +LGRVI+ +G PIDG G I+   ++P+E+ APGV+ R SV +PL+TG  AID+M PIG+GQRELIIGD+QTGKT +AID IINQKGK+V CIYV IGQK STI Q ++TL+++GA+EYTT++ASSASD   + ++AP+ G  I E +   G   L+IYDDLSK A+AYR LSLLLRRPPGREAYPGD+FYLHSRLLER+ KI  +                    GGS+TALP+IET+AGD+SAYIPTNVISITDGQ+F+  NLFN+GQRPAI+ G+SVSRVG SAQI A+KK +G+L+L+LAQ+REL+AFS+FGSDLDK TK  L+ G ++++++KQD+  P +   +  ++F+  +  +  + + YI  F+E+ +   + + + IL +I +T  +  D+  ++K      ++++ + +
  S:     4 TVRPDEVSAILRKHLAGFESEADVYDVGTVLQVGDGIARIYGLSKVAAGELLEFPDNVMGMALNLEEDNVGAVMFGKSTAVKEGDTVKRTGILASIPVGEAMLGRVINPLGEPIDGKGPIETSIRLPLERKAPGVIFRKSVNQPLQTGLKAIDAMIPIGRGQRELIIGDRQTGKTAVAIDTIINQKGKDVFCIYVAIGQKGSTIAQVVSTLEKYGAMEYTTVIASSASDPAPMQFIAPYAGAAIGEFFRDTGRHALVIYDDLSKQAVAYRQLSLLLRRPPGREAYPGDVFYLHSRLLERAAKITDDLETAKKMNDLPEPLKPMVKAGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLEPNLFNAGQRPAINVGISVSRVGGSAQIKAMKKITGTLRLDLAQFRELEAFSKFGSDLDKATKAQLDRGARLVEILKQDQYVPMAVEKQVAIIFAGTQGVLDQLDLQYIRRFEEEFLSLLEHKHSDILNSIAETGQMDVDVAKRLKEVAEQFMSTFKQKV 524
>gi|190358286|sp|B0RED6|ATPA_CLAMS ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) (545 aa)
Score = 1329, Expect = 1.9e-144, Identities = 258/484 (53%), Positives = 350/484 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQ-NKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKG--------KNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKTILETIDQTKDISQDL 484
           +SI+ D+  + +K+ ++ Y+  KA  +E+G V++ GDGI    GL  VM NEL+ F +G+ G+  NLE +  G+++LG+F  I+EG  V+RT  V+ VPVGDG LGRV+D +GNPIDG GEI  + +  +E  APGVM R SV EP++TG  AID+M PIG+GQR+LIIGD+QTGKT IAID IINQK         K V+CIYV IGQK STI      L++ GA+EYTTIVAS ASD     YLAP+TG  I + WM  G+ VLII+DDLSK A AYR +SLLLRRPPGREAYPGD+FYLHSRLLER  K++ E G GS+T LPIIET+A D+SAYIPTNVISITDGQ+F+ ++LFN+ QRPA+D G+SVSRVG  AQ+ ++KK SG+LKLELAQYR L+AF+ F SDLD  ++  L  G ++ +L+KQ + +PF    + + +++  +  +  +PV+ I  F+ +++ H  +   +L  + +   ++ D+
  S:     4 LSISPDEIRDALKDFVQSYEPGKASTTEVGYVLDAGDGIAHVQGLPGVMANELITFADGTLGLAQNLEESEIGVIVLGEFAGIEEGMEVRRTGEVLSVPVGDGYLGRVVDPLGNPIDGQGEIANEGRRALELQAPGVMQRKSVHEPMQTGIKAIDAMIPIGRGQRQLIIGDRQTGKTAIAIDTIINQKANWESGDTNKQVRCIYVAIGQKGSTIASVRGALEEAGAMEYTTIVASPASDPAGFKYLAPYTGSAIGQHWMYGGKHVLIIFDDLSKQAEAYRAVSLLLRRPPGREAYPGDVFYLHSRLLERCAKLSDELGAGSMTGLPIIETKANDVSAYIPTNVISITDGQIFLQSDLFNANQRPAVDVGISVSRVGGDAQVKSIKKVSGTLKLELAQYRSLEAFAIFASDLDAASRRQLARGARLTELLKQPQYSPFPIEEQVVSIWAGTKGKLDEVPVEDILRFERELLDHLHRNTEVLSQLKEKNVLTDDI 496
>gi|19115831|ref|NP_594919.1| F1-ATPase alpha subunit [Schizosaccharomyces pombe] >gi|114526|sp|P24487|ATPA_SCHPO ATP synthase subunit alpha, mitochondrial precursor >gi|173347|gb|AAA35286.1| ATP-synthase alpha-subunit >gi|2330687|emb|CAB11207.1| F1-ATPase alpha subunit [Schizosaccharomyces pombe] (536 aa)
Score = 1328, Expect = 2.2e-144, Identities = 254/490 (51%), Positives = 358/490 (73%)
  Q:    10 NIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQK--------GKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQ-KTILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           +I++ +I+   N+A   E GRV+++GDGI + SGLSNV   ELV F +G  GM LNLEA T G V+ G    ++EG +VKRT+++VDVPVG+ LLGRV+DA+GNPIDG G IK  ++  ++  APG++ R SVCEP++TG  AIDSM PIG+GQRELIIGD+QTGKT IA+D I+N K         K + C+YV +GQK ST+ Q +  L++  +L+Y+ IVA++AS+   L YLAPF+G  + E +   G+  L++YDDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K++ ++GGGS+TALP+IET+ GD+SAYIPTNVISITDGQ+F+ + LF  G RPAI+ GLSVSRVGS+AQ+ A+K+ +G +KL LAQYRE+ +F+QFGSDLD  T+  L+ G ++ +L+KQ + +P +   +  L++   + Y+  IPVD + +F+ K I + +     I+E I +   +S+     +K      ++S+
  S:    38 SILEERIRGAYNQAQMMESGRVLSIGDGIARISGLSNVQAEELVEFSSGIKGMALNLEADTVGCVLFGNDRLVREGEVVKRTRHIVDVPVGEALLGRVVDALGNPIDGKGPIKTTERRRVQLKAPGILPRTSVCEPMQTGLKAIDSMVPIGRGQRELIIGDRQTGKTAIALDTILNHKRWNNSSDESKKLYCVYVAVGQKRSTVAQLVQKLEENDSLKYSIIVAATASESAPLQYLAPFSGCAMGEWFRDNGKHGLVVYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSPKHGGGSLTALPVIETQGGDVSAYIPTNVISITDGQIFLESELFFKGIRPAINVGLSVSRVGSAAQVKAMKQVAGQIKLFLAQYREVASFAQFGSDLDAGTRATLDRGLRLTELLKQPQYSPLAVEEQVPLIYCGVKGYLDKIPVDRVVEFEHKFIPYLRSSGAEIMEAIRKEGVLSKTTEDSLKAVIKEFLSSF 536
>gi|149918545|ref|ZP_01907034.1| F0F1 ATP synthase subunit alpha [Plesiocystis pacifica SIR-1] >gi|149820621|gb|EDM80033.1| F0F1 ATP synthase subunit alpha [Plesiocystis pacifica SIR-1] (510 aa)
Score = 1328, Expect = 2.2e-144, Identities = 259/502 (51%), Positives = 358/502 (71%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQK-TILETIDQTKDISQDLFVQIKNEFNSLITSYIKT 502
           M I  D+ S II+ QI+ +       E G V+ VGDGI +  GLS  M  E++ F +G  GM LNLE    G+ +LG    IKEG IVKR+  ++ VPVGD +LGRVI+A+G  IDG G I+  ++ P+E  APG++AR SV EP+ TG  +IDSM PIG+GQRELIIGD+QTGKT IA+DAIINQKG+N+ C+YV IGQK ST+   +  L++ GA++YT +V + AS+   L +LAP+TG+TI E +  KG   L+IYDDLSK A+AYR LSLLLRRPPGREAYPGD+FYLHSRLLER+ K++ + GGGS+TALPIIET+ GD+SAYIPTNVISITDGQ+F+ ++LFN G RPAI+ GLSVSRVG SAQI  +++ +G L++ LAQYREL+AF+QF SDLD  T+  L+ G+++++L+KQ +  P   +L+ + +F+  + ++  I V ++  F++ +    K ++ ++L+ I + K    DL V+   E  + I  + +T
  S:     1 MEIRADEISRIIREQIQGHDTSTSVEETGTVLTVGDGIARVYGLSKAMAGEMLDFPHGVRGMVLNLEEGNVGVALLGNDHLIKEGDIVKRSATIMSVPVGDAMLGRVINALGEAIDGQGSIESSERRPVEVKAPGIIARKSVHEPMLTGLKSIDSMVPIGRGQRELIIGDRQTGKTAIAVDAIINQKGQNMVCVYVAIGQKQSTVASVVERLRREGAMDYTIVVCAGASESAPLQFLAPYTGVTIGEYFRDKGGHALLIYDDLSKQAVAYRQLSLLLRRPPGREAYPGDVFYLHSRLLERACKLSDKEGGGSLTALPIIETQGGDVSAYIPTNVISITDGQIFLESDLFNRGIRPAINVGLSVSRVGGSAQIKMMRRHAGPLRITLAQYRELEAFAQFASDLDATTRAQLDRGQRLVELLKQPQYKPLDVALQVVSVFAGTKGHLDDIAVKHVRAFEDDLHSWMKAERASLLDDIRKAKK-KPDL-VKADEEITAAIKKFKET 501
>gi|114706545|ref|ZP_01439446.1| F0F1 ATP synthase subunit alpha [Fulvimarina pelagi HTCC2506] >gi|114537937|gb|EAU41060.1| F0F1 ATP synthase subunit alpha [Fulvimarina pelagi HTCC2506] (509 aa)
Score = 1328, Expect = 2.2e-144, Identities = 258/501 (51%), Positives = 363/501 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQK--------GKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQ-QKTILETIDQTKDISQDLFVQIKNEFNSLITSYIK 501
           M I   + S+I+KNQIK +  +A  SE+G+V+++GDGI +  GL N    E+V F +G  GM LNLEA   G+V+ G   +IKEG  VKRT  +V+VPVG GLLGRV+D +GNPIDG G I+  +   ++  APG++ R SV EP+ TG  AID++ PIG+GQREL+IGD+QTGK+ I +D I+NQK           + CIYV +GQK ST+ QF+ TL++ GAL+Y+ +VA++ASD   + Y+APF G TI E +   G   +I YDDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K++ ++G GS+TALP+IET+AGD+SAYIPTNVISITDGQ+F+ T LF  G RPA++ GLSVSRVGSSAQI A+K+ +GS+K ELAQYRE++AF+QFGSDLD  T+ +L+ G+++ +L+KQ + +P     + +++++    Y+  + VD + DF+E ++   +   K +L+ I + K +S     +IK++  S +  + K
  S:     1 MDIRPAEISDILKNQIKNFGAEAEVSEVGQVLSIGDGIARVYGLDNCQAGEMVEFSDGIQGMVLNLEADNVGVVVFGSDRNIKEGDTVKRTGAIVEVPVGKGLLGRVVDGLGNPIDGKGPIESSENRRVDVKAPGIIPRKSVHEPMSTGLKAIDALIPIGRGQRELVIGDRQTGKSAILLDTILNQKPAHDEGRENDKLFCIYVAVGQKRSTVAQFVRTLEERGALQYSIVVAATASDPAPMQYIAPFVGCTIGEYFRDNGMHAMIGYDDLSKQAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLERAAKLSDDHGAGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETTLFYQGVRPAVNVGLSVSRVGSSAQIKAMKQVAGSIKGELAQYREMEAFAQFGSDLDASTQRLLKRGQRLTELLKQPQFSPLKTEEQVVVIYAGTNGYLDDLKVDQVGDFEEGLLNAMRNDHKDVLDAIAEKKALSD----EIKDKLKSAVDKFKK 506
>gi|154251916|ref|YP_001412740.1| ATP synthase F1, alpha subunit [Parvibaculum lavamentivorans DS-1] >gi|171769589|sp|A7HT50|ATPA_PARL1 ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|154155866|gb|ABS63083.1| ATP synthase F1, alpha subunit [Parvibaculum lavamentivorans DS-1] (509 aa)
Score = 1328, Expect = 2.3e-144, Identities = 265/499 (53%), Positives = 358/499 (71%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKN--------VKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKT-ILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           M I   + S I+K QIK++  +A  SEIG+V++VGDGI +  GL NV   E+V F  G  GM LNLE    G+V+ G   +IKEG  VKRT  +VD+PVG GLLGRV+D +GNP+DG G I+  ++  ++  APG++ R SV EP++TG  AID++ PIG+GQRELIIGD+QTGKT IAIDAI+NQK  N        + CIYV IGQK ST+ Q   TL++ GALEYT IVA++ASD   L +LAPF G T+ E +       L++YDDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+N ENG GS+TALPIIET+A D+SAYIPTNVISITDGQ+F+ T+LF  G RPA++ GLSVSRVGSSAQI A+K+ +G +K ELAQYRE+ AF+QFGSDLD  T+ +L  G ++ +L+KQ + +P     + +++++    Y+  +PV  +  +++ ++R+ +     IL+ I   K IS D   ++K+   +   ++
  S:     1 MDIQAAEISAILKQQIKDFGAEAQVSEIGQVLSVGDGIARVYGLDNVEAGEMVEFPGGVRGMALNLEEDNVGVVIFGSDRNIKEGDTVKRTGAIVDIPVGKGLLGRVVDPLGNPLDGKGPIEGVERRRVDVKAPGIIPRKSVHEPMQTGLKAIDALIPIGRGQRELIIGDRQTGKTAIAIDAILNQKPLNQGDDENQKLYCIYVAIGQKRSTVAQIAKTLEENGALEYTIIVAATASDPAPLQFLAPFAGCTLGEYFRDNAMHGLVVYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNDENGNGSLTALPIIETQANDVSAYIPTNVISITDGQIFLETDLFYQGVRPAVNVGLSVSRVGSSAQIKAMKQVAGKIKGELAQYREMAAFAQFGSDLDAATQRLLNRGARLTELLKQGQFSPLKVEEQVVVIYAGVNGYLDKLPVADVGRYEQDLLRNIRSSHPGILDAIRSEKQISADTEAKLKSAVENFSKAF 508
>gi|149200615|ref|ZP_01877619.1| ATP synthase subunit A [Lentisphaera araneosa HTCC2155] >gi|149136289|gb|EDM24738.1| ATP synthase subunit A [Lentisphaera araneosa HTCC2155] (521 aa)
Score = 1328, Expect = 2.5e-144, Identities = 267/501 (53%), Positives = 352/501 (70%)
  Q:     3 INLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGE------------DVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVD----YIEDFKEKIIRHFKQQKTILETIDQTKDISQDLFVQIKNEFNSLITSYIKTI 503
           I  ++ S I+K Q   ++  A   E G+V++VGDGI +  GL NVM  ELV F  G  G+ +NLE    G+ + G+ + I EG  VKRT  +  VP GD LLGRV+DA+GNPIDG G I  +   PIE  APG+M R SV EPL+TG   ID++ P+G+GQRELIIGD++TGKTT+A+D IINQKGK V+C YV IGQK ST+VQ   TLKQ GALEYTTI+A++ASD   + +LAP++G  +AE +   G               LI+YDDL+K + AYR LSLLLRRPPGREA+PGD+FY HSRLLERS K+++  G GSITALPIIET+A D+SAYIPTNVISITDGQ+F+ ++LFN+GQRPAI+AGLSVSRVG +AQ  ++KKT+G+L+L+LAQYREL AFSQF SDLD  T+  LE G+++M++ KQ  N P S + +  L+++    Y+  IPVD    Y  +  E +   +K             D S+DL  ++ +   S   S+  ++
  S:     5 IKPEEVSAILKEQFAAFEAGAQTYETGKVLSVGDGIARVYGLENVMAGELVEFACGLQGLAMNLEEDNVGVAIFGEDKSICEGMEVKRTNTIASVPTGDALLGRVVDALGNPIDGKGPISTENSRPIEFKAPGIMERKSVHEPLQTGVKVIDALTPVGRGQRELIIGDRKTGKTTLAVDTIINQKGKGVQCFYVAIGQKRSTVVQIAETLKQHGALEYTTIIAATASDPAPMQFLAPYSGTAMAEHYCYLGSPTFGGTEGVAGGHALIVYDDLTKQSQAYRQLSLLLRRPPGREAFPGDVFYTHSRLLERSVKLSESEGAGSITALPIIETQANDVSAYIPTNVISITDGQIFLESDLFNAGQRPAINAGLSVSRVGGAAQTKSMKKTAGTLRLDLAQYRELAAFSQFASDLDPATRAQLEKGQRLMEVCKQGINEPQSVAEQVCLIYAGTNGYLNDIPVDKVVSYTAELNEALSTRYKDFSDKFAVEVTNDDFSKDLIAEMTDIVKSTTESFSSSL 521
>gi|148272347|ref|YP_001221908.1| F0F1 ATP synthase subunit alpha [Clavibacter michiganensis subsp. michiganensis NCPPB 382] >gi|166201660|sp|A5CQ58|ATPA_CLAM3 ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|147830277|emb|CAN01211.1| ATP synthase alpha chain [Clavibacter michiganensis subsp. michiganensis NCPPB 382] (545 aa)
Score = 1328, Expect = 2.5e-144, Identities = 258/484 (53%), Positives = 350/484 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQ-NKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKG--------KNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKTILETIDQTKDISQDL 484
           +SI+ D+  + +K+ ++ Y+  KA  +E+G V++ GDGI    GL  VM NEL+ F +G+ G+  NLE +  G+++LG+F  I+EG  V+RT  V+ VPVGDG LGRV+D +GNPIDG GEI  + +  +E  APGVM R SV EP++TG  AID+M PIG+GQR+LIIGD+QTGKT IAID IINQK         K V+CIYV IGQK STI      L++ GA+EYTTIVAS ASD     YLAP+TG  I + WM  G+ VLII+DDLSK A AYR +SLLLRRPPGREAYPGD+FYLHSRLLER  K++ E G GS+T LPIIET+A D+SAYIPTNVISITDGQ+F+ ++LFN+ QRPA+D G+SVSRVG  AQ+ ++KK SG+LKLELAQYR L+AF+ F SDLD  ++  L  G ++ +L+KQ + +PF    + + +++  +  +  +PV+ I  F+ +++ H  +   +L  + +   ++ D+
  S:     4 LSISPDEIRDALKDFVQSYEPGKASTTEVGYVLDAGDGIAHVQGLPGVMANELITFADGTLGLAQNLEESEIGVIVLGEFAGIEEGMEVRRTGEVLSVPVGDGYLGRVVDPLGNPIDGQGEIATEGRRALELQAPGVMQRKSVHEPMQTGIKAIDAMIPIGRGQRQLIIGDRQTGKTAIAIDTIINQKANWESGDTNKQVRCIYVAIGQKGSTIASVKGALEEAGAMEYTTIVASPASDPAGFKYLAPYTGSAIGQHWMYGGKHVLIIFDDLSKQAEAYRAVSLLLRRPPGREAYPGDVFYLHSRLLERCAKLSDELGAGSMTGLPIIETKANDVSAYIPTNVISITDGQIFLQSDLFNANQRPAVDVGISVSRVGGDAQVKSIKKVSGTLKLELAQYRSLEAFAIFASDLDAASRRQLARGARLTELLKQPQYSPFPIEEQVVSIWAGTKGKLDEVPVEDILRFERELLDHLHRNTEVLSQLKEKNVLTDDI 496
>gi|18075720|emb|CAD11277.1| ATP synthase F1, subunit alpha [Helicobacter pylori] (503 aa)
Score = 1328, Expect = 2.5e-144, Identities = 250/497 (50%), Positives = 367/497 (73%)
  Q:     3 INLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQ-KTILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           + L++ S++I+ +IK ++     +E+G+V++  DG+ +  GL+ VM  E++ FE G  G+  NLE  + G+++ G   +IKEG+ VKRTK+++ VPVGD ++GRV++A+G PIDG GEI+ ++   IE+ APG+M R SV EPL+TG  AID++ PIG+GQRELIIGDKQTGKTT+AIDAIINQKG+NV CIYV IGQK ST+ Q +  L+++GA+EY+ ++ +SASD  ++ YLAP+ G+ + E +       LI+YDDLSKHA+AYR +SL+LRRPPGREA+PGD+FY+HSRLLER+ K+  E G GS+TALPI+ET+AGD+SAYIPTN+ISITDGQ+F+ T+LF SG RPAI+ GLSVSRVG +AQI A K+ SG+L+L+LAQYREL AF+QF SDLD+ +K+ LE G+++++++KQ   +P     + +++++  + ++  + V  + DF+E++    + +   +LE I   K + +DL   +K        +Y
  S:     4 LKLEEISSVIEEKIKNFELDCDMAEVGKVVSYADGVAKVYGLNGVMSYEVLEFETGDKGVAANLEEDSVGVIVFGFGNNIKEGTSVKRTKSLMKVPVGDAVVGRVLNALGEPIDGKGEIETNEFSLIEQKAPGIMDRKSVHEPLQTGIKAIDALVPIGRGQRELIIGDKQTGKTTVAIDAIINQKGQNVICIYVAIGQKESTVAQVVRKLEEYGAMEYSVVINASASDSAAMQYLAPYAGVAMGEYFRDHARHALIVYDDLSKHAVAYREISLILRRPPGREAFPGDVFYIHSRLLERAAKLCDEKGAGSLTALPIVETQAGDVSAYIPTNIISITDGQIFLETDLFYSGIRPAINVGLSVSRVGGAAQIKATKQVSGTLRLDLAQYRELQAFTQFASDLDEASKKQLERGQRMVEVLKQAPYSPLPIEKQVVIIYAGAKGFLDSVSVKKVVDFEEQLYPFLEAKYPQVLEEIHTKKALDKDLEAMLKKVLEEFKLTY 501
>gi|126655520|ref|ZP_01726959.1| ATP synthase subunit A [Cyanothece sp. CCY0110] >gi|126622999|gb|EAZ93704.1| ATP synthase subunit A [Cyanothece sp. CCY0110] (503 aa)
Score = 1327, Expect = 2.7e-144, Identities = 261/498 (52%), Positives = 363/498 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDF----KEKIIRHFKQQKTILETIDQTKDISQDLFVQIKNEFNSLITS 498
           +SI  D+ S+II++QI+ Y      S +G V+ VGDG  +  GL   M  EL+ FE+G+ G+ LNLE    G V++G   DI+EGS V+ T  +  VPVGD ++GRV+D++G PIDG G+I   +   IE  APG++AR SVCEP++TG  AID+M PIG+GQRELIIGD++TGKT IAID IINQK ++V C+YV IGQK ST+ Q I TL++ GA++YT +VA++A+D  +L YLAP+TG T+AE +M KG+  L+IYDDLSK A AYR LSLLL+RPPGREAYPGD+FY+HSRLLER+ K++   GGGS+TALPIIET+AGD+SAYIPTNVISITDGQ+F+ ++LFN+G RPAI+AG+SVSRVGS+AQ  A+K+ +G LKLELAQ+ EL+AFSQF SDLD  T+  L  G+++ +++KQ +N+P +   +  + ++    YI  +PVD   +F    +E I     +   I+++  +  D ++ L  +  +E+    ++
  S:     2 VSIRPDEISSIIRDQIESYDQSVQVSNVGTVLQVGDGTARIYGLEQCMAGELLEFEDGTIGIALNLEEDNVGAVLMGTGLDIQEGSTVQATGKIAQVPVGDAMVGRVVDSLGRPIDGKGDINTSESRLIESPAPGIIARKSVCEPMQTGITAIDAMIPIGRGQRELIIGDRKTGKTAIAIDTIINQKSEDVICVYVAIGQKASTVAQVIGTLEEKGAMDYTIVVAANANDPATLQYLAPYTGATLAEYFMYKGKATLVIYDDLSKQAQAYRQLSLLLKRPPGREAYPGDVFYIHSRLLERAAKLSDALGGGSMTALPIIETQAGDVSAYIPTNVISITDGQIFLSSDLFNAGFRPAINAGISVSRVGSAAQTKAMKQVAGKLKLELAQFAELEAFSQFASDLDAATQAQLARGQRLRQILKQPENSPLAVWEQVAVAYAGLNGYIDDVPVDKATEFATGLREYIATSKPKYPEIIKSEKKLTDEAESLLKEAISEYKQAFSA 503
>gi|177664416|ref|ZP_02940218.1| ATP synthase F1, alpha subunit [Cyanothece sp. PCC 8801] >gi|196244744|ref|ZP_03143470.1| ATP synthase F1, alpha subunit [Cyanothece sp. PCC 8802] >gi|172076252|gb|EDT61664.1| ATP synthase F1, alpha subunit [Cyanothece sp. PCC 8801] >gi|196207488|gb|EDY02281.1| ATP synthase F1, alpha subunit [Cyanothece sp. PCC 8802] (503 aa)
Score = 1327, Expect = 2.8e-144, Identities = 256/468 (54%), Positives = 347/468 (74%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQK 468
           +SI  D+ S+II+ QI+ Y      S +G V+ VGDG  +  GL   M  EL+ FE+G+ G+ LNLE    G V++G   DI+EGS VK T  +  VPVG+ L+GRV+DA+G PIDG G+I   +   IE +APG++AR SVCEP++TG  AID+M P+G+GQRELIIGD++TGKT IAID IINQK ++V C+YV IGQK ST+ Q I TL++ GA+ YT +VA++A+D  +L YLAP+TG ++AE +M KG+  L+IYDDLSK A AYR LSLLL+RPPGREAYPGD+FY+HSRLLER+ K++   GGGS+TALP+IET+AGD+SAYIPTNVISITDGQ+F+ ++LFNSG RPAI+AG+SVSRVGS+AQ  A+K+ +G LKLELAQ+ EL+AFSQF SDLD  T+  L  G+++ +++KQ +N+P +   +  + ++    Y+  IPV  + +F   +  + K  K
  S:     2 VSIRPDEISSIIRQQIESYDQTVTVSNVGTVLQVGDGTARIYGLEQAMAGELLEFEDGTVGIALNLEEDNVGAVLMGTGLDIQEGSTVKATGKIAQVPVGEALIGRVVDALGRPIDGKGDINTTETRLIESMAPGIVARKSVCEPMQTGITAIDAMIPVGRGQRELIIGDRKTGKTAIAIDTIINQKSEDVICVYVAIGQKASTVAQVIGTLEEKGAMAYTIVVAANANDPATLQYLAPYTGASMAEYFMYKGKATLVIYDDLSKQAQAYRQLSLLLKRPPGREAYPGDVFYIHSRLLERAAKLSDALGGGSMTALPVIETQAGDVSAYIPTNVISITDGQIFLSSDLFNSGFRPAINAGISVSRVGSAAQTKAMKQVAGKLKLELAQFAELEAFSQFASDLDAATQSQLARGQRLREVLKQPENSPLAVWEQVAIAYAGLNGYLDEIPVPKVSEFAAGLRDYIKTSK 469
>gi|78777602|ref|YP_393917.1| F0F1 ATP synthase subunit alpha [Sulfurimonas denitrificans DSM 1251] >gi|124007225|sp|Q30QP9|ATPA_THIDN ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|78498142|gb|ABB44682.1| ATP synthase F1, alpha subunit [Sulfurimonas denitrificans DSM 1251] (505 aa)
Score = 1327, Expect = 2.8e-144, Identities = 256/498 (51%), Positives = 356/498 (71%)
  Q:     3 INLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQ-KTILETIDQTKDISQDLFVQIKNEFNSLITSYI 500
           I  D+ S+IIK +I  ++     +E G++++  DG+ Q  GLSNVM  E+V FE G+ G+ +NLE +T G+V+LG    +KEG  VKR   ++ VPVGD LLGRV++A+G PIDG G I+  +   +E+ APG+MAR SV EPL TG  AID++ PIG+GQRELIIGD+QTGKTT+A+DAIINQKG  V CIYV +GQK ST+ Q I  L+  GA+EYT +V+S+A++  +L +LAP+TG+T+ E +       LI+YDDLSKHA+AYR +SL+LRRPPGREAYPGD+FY+HSRLLER+ K++ E G GS+TALPIIET+AGD+SAYIPTNVISITDGQ+F+ T LFNSG RPAI+ GLSVSRVG +AQI A K+ +G+L+L+LAQYREL AF+QF SDLD+ +++ LE G+++++++KQ   +P S   + +++F+  E +   +    +  F+ ++    +     I E I  T  +  +    +K        S+I
  S:     5 IQADEISSIIKERIDNFELSVDINETGKIVSYADGVAQVYGLSNVMAGEMVEFEEGTRGLVMNLEESTVGVVILGPGPLLKEGMSVKRLGRLLRVPVGDALLGRVVNALGEPIDGKGPIETTETRFVEEKAPGIMARKSVHEPLATGIKAIDALVPIGRGQRELIIGDRQTGKTTVALDAIINQKGNGVVCIYVAVGQKESTVAQIIRRLEDHGAMEYTIVVSSTAAEAAALQFLAPYTGVTMGEYFRDNARHGLIVYDDLSKHAVAYREMSLILRRPPGREAYPGDVFYIHSRLLERAAKVSDERGAGSLTALPIIETQAGDVSAYIPTNVISITDGQIFLETELFNSGVRPAINVGLSVSRVGGAAQIKATKQVAGTLRLDLAQYRELQAFAQFASDLDETSRKQLERGQRMVEVLKQPPFSPLSVEKQVLIIFAGNEGFFDDMAPSNVVRFEAELYPFIEASYPQIFENIRSTSKVDDNTNALMKKALEEFKASFI 503
>gi|170782291|ref|YP_001710624.1| ATP synthase alpha chain [Clavibacter michiganensis subsp. sepedonicus] >gi|169156860|emb|CAQ02028.1| ATP synthase alpha chain [Clavibacter michiganensis subsp. sepedonicus] (552 aa)
Score = 1327, Expect = 3.2e-144, Identities = 258/484 (53%), Positives = 350/484 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQ-NKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKG--------KNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKTILETIDQTKDISQDL 484
           +SI+ D+  + +K+ ++ Y+  KA  +E+G V++ GDGI    GL  VM NEL+ F +G+ G+  NLE +  G+++LG+F  I+EG  V+RT  V+ VPVGDG LGRV+D +GNPIDG GEI  + +  +E  APGVM R SV EP++TG  AID+M PIG+GQR+LIIGD+QTGKT IAID IINQK         K V+CIYV IGQK STI      L++ GA+EYTTIVAS ASD     YLAP+TG  I + WM  G+ VLII+DDLSK A AYR +SLLLRRPPGREAYPGD+FYLHSRLLER  K++ E G GS+T LPIIET+A D+SAYIPTNVISITDGQ+F+ ++LFN+ QRPA+D G+SVSRVG  AQ+ ++KK SG+LKLELAQYR L+AF+ F SDLD  ++  L  G ++ +L+KQ + +PF    + + +++  +  +  +PV+ I  F+ +++ H  +   +L  + +   ++ D+
  S:    11 LSISPDEIRDALKDFVQSYEPGKASTTEVGYVLDAGDGIAHVQGLPGVMANELITFADGTLGLAQNLEESEIGVIVLGEFAGIEEGMEVRRTGEVLSVPVGDGYLGRVVDPLGNPIDGQGEIANEGRRALELQAPGVMQRKSVHEPMQTGIKAIDAMIPIGRGQRQLIIGDRQTGKTAIAIDTIINQKANWESGDTNKQVRCIYVAIGQKGSTIASVRGALEEAGAMEYTTIVASPASDPAGFKYLAPYTGSAIGQHWMYGGKHVLIIFDDLSKQAEAYRAVSLLLRRPPGREAYPGDVFYLHSRLLERCAKLSDELGAGSMTGLPIIETKANDVSAYIPTNVISITDGQIFLQSDLFNANQRPAVDVGISVSRVGGDAQVKSIKKVSGTLKLELAQYRSLEAFAIFASDLDAASRRQLARGARLTELLKQPQYSPFPIEEQVVSIWAGTKGKLDEVPVEDILRFERELLDHLHRNTEVLSQLKEKNVLTDDI 503
>gi|93007315|gb|ABE97162.1| AtpA [Pasteuria ramosa] (504 aa)
Score = 1327, Expect = 3.3e-144, Identities = 261/483 (54%), Positives = 353/483 (73%)
  Q:     7 KFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHF-----KQQKTILETIDQTKDISQDLFVQIK 489
           +   +++++I+ Y      ++IG VI VGDGI +  GL  VM  ELV F NG  GM  NLE    G+V+LG  E IKEG   KRT  +++VPVG+ LLGR+++ +G P+DG G IK +   PIE  APGV+ R SV +PL+TG  AID+M PIG+GQRELIIGD+QTGKTTIAID IINQK  NVKCIYV IGQK ST+   +  L++  AL YTT+V +SASD   L +LAP+ G ++ E  M  G  VL +YDDLSK A +YR LSLLLRRPPGREAYPGD+FYLHSRLLER+ +++ E GGGS+TALP+IET+AGDISAYIPTNVISITDGQ+F+ ++LF+SG RPA++ G SVSRVG +AQI A+ K +G+L+L+L+QY+EL AF+QFGSDLD  T+  L  G++VM+++KQD+N P S +++ + L+ + + Y+  I V+ ++DF+++   +      K  + I+++   T+ I +DL   IK
  S:     9 RLVQLLESKIENYNLDIQVADIGTVIQVGDGIARMHGLGEVMAGELVEFSNGIMGMVANLELENVGVVILGSCETIKEGDTAKRTGRLMEVPVGEQLLGRIVNPLGQPLDGLGPIKTEHFRPIEANAPGVIDRRSVHQPLQTGIKAIDAMVPIGRGQRELIIGDRQTGKTTIAIDTIINQKNTNVKCIYVAIGQKQSTVAHVVEKLRKHDALSYTTVVVASASDPFPLLFLAPYAGCSMGEHIMYNGGHVLCVYDDLSKQAASYRELSLLLRRPPGREAYPGDVFYLHSRLLERAAQLSDECGGGSLTALPLIETQAGDISAYIPTNVISITDGQIFLESSLFHSGIRPAVNVGFSVSRVGGAAQIKAMSKIAGTLRLDLSQYQELAAFAQFGSDLDASTRAKLARGERVMEILKQDENQPLSVAIQVVSLYLVTKGYLDDIDVNRVKDFEKEFHAYLIEECPKLPQDIIKSGKLTESIDKDLDNAIK 496
>gi|86606753|ref|YP_475516.1| F0F1 ATP synthase subunit alpha [Synechococcus sp. JA-3-3Ab] >gi|110832068|sp|Q2JSW1|ATPA_SYNJA ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|86555295|gb|ABD00253.1| ATP synthase F1, alpha subunit [Synechococcus sp. JA-3-3Ab] (506 aa)
Score = 1326, Expect = 3.6e-144, Identities = 257/491 (52%), Positives = 359/491 (73%)
  Q:     2 SINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIR-----HFKQQKTILET---IDQTKDISQDLFVQIKNEF 492
           +I  D+ S IIK QI++Y  +   S +G V+ VGDGI +  GL  VM +EL+ FE+G+ G+ LNLE    G V++G   +I+EGSIVK T  +  +PVG+ LLGRV+D + NPIDG G I   +   IE  APG++ R SV EPL+TG  AID++ PIG+GQRELIIGD+QTGKTT+A+D I+NQKG++V CIYV IGQK S I Q +N L + GA++Y+ +VA+ A     L +LAP+ G TIAE +M +G+  L++YDDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+N   G GS+TALPI+ET+A D+SAYIPTNVISITDGQ+F+ ++LFN+G RPAI+ G+SVSRVGS+AQ  A+KK +GS+K+ELAQYR+L+AF+QF SDLD+ T++ L  G+++ +++KQ + +P S   +  ++++    Y+  IPV+ +  FK+ ++      H K  + +L T    D+ ++I +    + K  F
  S:     3 TIRPDEISTIIKQQIEQYNQEMQISNVGTVLQVGDGIARIYGLEKVMASELLEFEDGTVGIALNLEEDNVGAVLIGSGRNIQEGSIVKATGRIASIPVGEALLGRVVDPLCNPIDGKGPIHCTETRLIESPAPGIVDRRSVYEPLQTGITAIDALIPIGRGQRELIIGDRQTGKTTLAVDTILNQKGQDVICIYVAIGQKQSNIAQVVNILSERGAMDYSIVVAAGADSPAPLQWLAPYCGATIAEYFMYQGKHTLVVYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNSRLGEGSMTALPIVETQANDVSAYIPTNVISITDGQIFLESDLFNAGIRPAINVGISVSRVGSAAQTKAMKKVAGSIKVELAQYRDLEAFAQFASDLDEATQKQLARGQRLQEILKQPQYSPLSLDQQVAIIYAGTRGYLDDIPVEKVSSFKQGLLSYLGTAHPKYGEIVLSTKQLTDEAEEILKTAIAEFKQSF 501
>gi|145253056|ref|XP_001398041.1| hypothetical protein An16g07410 [Aspergillus niger] >gi|134083599|emb|CAL00514.1| unnamed protein product [Aspergillus niger] (556 aa)
Score = 1326, Expect = 3.8e-144, Identities = 261/502 (51%), Positives = 358/502 (71%)
  Q:     9 SNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQK--------GKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK-QQKTILETIDQTKDISQDLFVQIKNEFNSLITSYIKTIPDYNLDF 510
           S+I++ +I+  Q +A  +E GRV++VGDGI +  G++NV   ELV F +G  GM +NLEA   G+V+ G    +KEG  VKRT  +VDVPVG  +LGRV+DA+GNPIDG G I    K   +  APG++ R SV +P++TG   +DSM PIG+GQRELIIGD+QTGKT +A+DA++NQK         K + CIYV +GQK ST+ Q + TL++  A++Y+ +VA++AS+   L YLAPFTG  + E +   G   +IIYDDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+N+++GGGS+TALP+IET+ GD+SAYIPTNVISITDGQ+F+ + LF  G RPAI+ GLSVSRVGS+AQ+ A+K+ +GSLKL LAQYRE+ AF+QFGSDLD  TK+ L  G+++ +L+KQ + +P + S    L+F+    ++  IPV  I  ++   + H K     I ETI++   +S++L  Q+K           + IP +N  F
  S:    55 SSILEQRIRGVQEEAGLAETGRVLSVGDGIARVHGMTNVQAEELVEFASGVKGMCMNLEAGQVGVVLFGSDRLVKEGETVKRTGEIVDVPVGPEMLGRVVDALGNPIDGKGPIPTKVKSRAQLKAPGILPRRSVNQPVQTGLKCVDSMVPIGRGQRELIIGDRQTGKTAVALDAMLNQKRWNNTSDESKKLYCIYVAVGQKRSTVAQLVKTLEENDAMKYSIVVAATASEAAPLQYLAPFTGCAMGEWFRDNGRHAVIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNEKHGGGSLTALPVIETQGGDVSAYIPTNVISITDGQIFLESELFYKGIRPAINVGLSVSRVGSAAQVKAMKQVAGSLKLFLAQYREVAAFAQFGSDLDASTKQTLNRGERLTELLKQKQYSPMAVSDMVPLIFAGVNGFLDSIPVAKILQWESDFLAHLKSNHPEIQETIEKEGQVSKELEAQLK-----------EIIPTFNKSF 554
>gi|15645748|ref|NP_207925.1| F0F1 ATP synthase subunit alpha [Helicobacter pylori 26695] >gi|2493018|sp|P55987|ATPA_HELPY ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|2314285|gb|AAD08176.1| ATP synthase F1, subunit alpha (atpA) [Helicobacter pylori 26695] (503 aa)
Score = 1326, Expect = 3.8e-144, Identities = 252/497 (50%), Positives = 369/497 (74%)
  Q:     3 INLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQK--TILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           + L++ S++I+ +IK ++     +E+G+V++  DG+ +  GL+ VM  E++ FE G  G+  NLE  + G+++ G   +IKEG+ VKRTK+++ VPVGD ++GRV++A+G PIDG GEI+ ++   IE+ APG+M R SV EPL+TG  AID++ PIG+GQRELIIGDKQTGKTT+AIDAIINQKG+NV CIYV IGQK ST+ Q +  L+++GA+EY+ ++ +SASD  ++ YLAP++G+ + E +       LIIYDDLSKHA+AYR +SL+LRRPPGREA+PGD+FY+HSRLLER+ K+  E G GS+TALPI+ET+AGD+SAYIPTN+ISITDGQ+F+ T+LF SG RPAI+ GLSVSRVG +AQI A K+ SG+L+L+LAQYREL AF+QF SDLD+ +K+ LE G+++++++KQ   +P     + +++++  + ++  + V  + DF+E+ +  F + K   +LE I   K + +DL   ++        +Y
  S:     4 LKLEEISSVIEEKIKNFELDCDMAEVGKVVSYADGVAKVYGLNGVMSYEVLEFETGDKGVAANLEEDSVGVIVFGFGNNIKEGTSVKRTKSLMKVPVGDAVVGRVLNALGEPIDGKGEIETNEFSLIEQKAPGIMDRKSVHEPLQTGIKAIDALVPIGRGQRELIIGDKQTGKTTVAIDAIINQKGQNVICIYVAIGQKESTVAQVVRKLEEYGAMEYSVVINASASDSAAMQYLAPYSGVAMGEYFRDHARHALIIYDDLSKHAVAYREISLILRRPPGREAFPGDVFYIHSRLLERAAKLCDEKGAGSLTALPIVETQAGDVSAYIPTNIISITDGQIFLETDLFYSGIRPAINVGLSVSRVGGAAQIKATKQVSGTLRLDLAQYRELQAFTQFASDLDEASKKQLERGQRMVEVLKQAPYSPLPIEKQVVIIYAGAKGFLDSVSVKKVVDFEEQ-LHPFLEAKYPQVLEEIHTKKALDKDLEAMLRKVLEEFKLTY 501
>gi|116490721|ref|YP_810265.1| F0F1 ATP synthase subunit alpha [Oenococcus oeni PSU-1] >gi|122277095|sp|Q04G22|ATPA_OENOB ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|116091446|gb|ABJ56600.1| F0F1-type ATP synthase, alpha subunit [Oenococcus oeni PSU-1] (520 aa)
Score = 1326, Expect = 3.8e-144, Identities = 264/501 (52%), Positives = 361/501 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHF---KQQKTILETIDQTKDISQDLFVQIKNEFNSLITSYIK 501
           M+I  D+ S++IK Q+++Y +     E+G V  VGDG+ +ASGL+NVM  ELV FENG YGM  NLE +  GI++LG F+ I +G  VKRT  V++VPVGD ++GRV++A+G PIDGNG IK     P+E  APGVM R SV EPL+TG   ID++ PIG+GQRELIIGD++TGKT++AID I+NQK +++  +YV IGQK+ST+   + TL++ GAL+YT +V+++ S+   + YLAP+ G  + E +M  G+ VLI+YDDLSK A AYR LSL+LRRPPGREAYPGD+FYLHSRLLER+ K++ E GGGS+TALPIIET+AGD+SAYIPTNVISITDGQ+F+  + F SG RPAIDAG SVSRVG  AQI A+KK SG+L+L+LA Y EL+AF+QFGSDLD  T+  L  G++ ++++ Q  + P     + I+L+++   Y+  I V  I+ F++++I      K  K I   I +T ++  +       + NS I  + K
  S:     1 MAIKSDQISSLIKQQLEKYDSTLKIDEVGTVTYVGDGVARASGLANVMSGELVEFENGVYGMAQNLEESEVGIIVLGDFDGISQGDTVKRTGKVMEVPVGDEMIGRVVNALGQPIDGNGAIKTKHTRPVEFKAPGVMQRKSVFEPLQTGIKVIDALVPIGRGQRELIIGDRKTGKTSLAIDTILNQKDQDMIVVYVAIGQKDSTVRTQVETLREMGALDYTIVVSAAPSEPAPMLYLAPYVGAALGEYFMYNGKHVLIVYDDLSKQATAYRELSLILRRPPGREAYPGDVFYLHSRLLERAAKLSDELGGGSMTALPIIETQAGDVSAYIPTNVISITDGQIFLDADQFYSGNRPAIDAGTSVSRVGGDAQIKAMKKVSGTLRLDLASYHELEAFAQFGSDLDAPTQAKLARGRRTVEVLNQPLHQPMPVEHQVIVLYALTHGYLDDIDVSDIQRFQKELIDFVSGDKSYKKIFAAIKKTGNLPDE------KDINSAIDDFKK 498
>gi|85704180|ref|ZP_01035283.1| ATP synthase subunit A [Roseovarius sp. 217] >gi|85671500|gb|EAQ26358.1| ATP synthase subunit A [Roseovarius sp. 217] (512 aa)
Score = 1326, Expect = 4.0e-144, Identities = 251/465 (53%), Positives = 344/465 (73%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQK----------GKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK 465
           M I   + S I+K+QIK +   A  +EIGRV++VGDGI +  GL NV   ELV F     GM LNLE+   G+V+ G   DIKEG  VKRTK++VDVP+GD LLGRV+D +GNP+DG G IK   +   +  APG++ R SV EP+ TG  ++D+M PIG+GQRELIIGD+QTGKT +A+DAI+NQK           K + C+YV IGQK ST+ Q +  L++ GA++Y+ +VA++ASD   + +LAP++   +AE +   G   LI+YDDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLERS K+N++NG GS+TALPIIET+ GD+SA+IPTNVISITDGQ+F+ T LF  G RPA++ GLSVSRVGSSAQ NA+K  +G +KLELAQYRE+ AF+QFGSDLD  T+++L  G ++ +L+KQ + +P + +    ++++  + Y+  IPV  +  +++ +++H +
  S:     1 MGIQAAEISAILKDQIKNFGKDAEVAEIGRVLSVGDGIARVHGLDNVQAGELVEFPGSIMGMALNLESDNVGVVIFGSDRDIKEGDTVKRTKSIVDVPIGDELLGRVVDGLGNPLDGKGPIKTKTRGLADVKAPGIIPRKSVHEPMATGLKSVDAMIPIGRGQRELIIGDRQTGKTAVALDAILNQKIYNEAAGDDESKKLYCVYVAIGQKRSTVAQLVKKLEESGAIKYSIVVAATASDPAPMQFLAPYSATAMAEHFRDNGRHALIVYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERSAKLNEDNGSGSLTALPIIETQGGDVSAFIPTNVISITDGQIFLETELFYQGVRPAVNTGLSVSRVGSSAQTNAMKSVAGPVKLELAQYREMAAFAQFGSDLDAATQQLLNRGARLTELMKQAQYSPLTNAEIVCVIYAGTKGYLDKIPVKQVGPYEQGLLKHLR 475
>gi|72080393|ref|YP_287451.1| F0F1 ATP synthase subunit alpha [Mycoplasma hyopneumoniae 7448] (508 aa)
Score = 1326, Expect = 4.1e-144, Identities = 268/466 (57%), Positives = 345/466 (74%)
  Q:    11 IIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKTILETIDQ 476
           IIKN+I+ ++ K    +IG+VI VGDG+   SG+  V   ELV FEN   G+ LNLE    G+V++     + +GSIV+RTK+V+ + VGD LLGRV++A+G PIDG  E+    K  I   AP +M R SV   L+TG LAIDS+ PIGKGQRELIIGD+QTGKTTIAIDAI+NQKGKNV C+YV IGQKNS++ Q ++ L++ GALEYTT++ + AS+L  L YLAP++G  IAE WM+K +DVLIIYDDLSKHAIAYRTLSLLLRRPPGREA+PGDIFY HS LLERS +++ + GGGSITALPIIET+AGDISAYIPTNVISITDGQ+F+  +LFNSGQ+PAID GLSVSRVGS+AQ N +K  S SLKL LAQY EL AF+QFGSDL   ++ +L+ G K+ +++KQ+   P ++  + +LL  I+E  I  +    I  FK   +++   +    + I++
  S:    11 IIKNEIENFEGKIQNHDIGKVIIVGDGVALVSGIEKVKFGELVEFENNVLGIALNLEQDLIGVVIMASENSVFQGSIVRRTKSVISITVGDQLLGRVVNALGIPIDGKAELDNSLKSAIFTNAPSIMDRKSVDRGLKTGILAIDSLVPIGKGQRELIIGDRQTGKTTIAIDAILNQKGKNVYCVYVAIGQKNSSVAQIVSLLEKKGALEYTTVILAGASELSPLQYLAPYSGAAIAEYWMNKKKDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAFPGDIFYQHSYLLERSAQLSNDKGGGSITALPIIETQAGDISAYIPTNVISITDGQIFLRDSLFNSGQKPAIDIGLSVSRVGSAAQTNLMKWASSSLKLNLAQYNELKAFAQFGSDLGPSSQLILDRGNKIYEILKQENQYPLTERQQIMLLILIRENLIDSLEQKSIPLFKSAFLKYCDSEPKFRDKIEK 476
>gi|18075732|emb|CAD11286.1| ATP synthase F1, subunit alpha [Helicobacter pylori] (503 aa)
Score = 1325, Expect = 4.4e-144, Identities = 250/497 (50%), Positives = 368/497 (74%)
  Q:     3 INLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQ-KTILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           + L++ S++I+ +IK ++     +E+G+V++  DG+ +  GL+ VM  E++ FE G  G+  NLE  + G+++ G   +IKEG+ VKRTK+++ VPVGD ++GRV++A+G PIDG GEI+ ++   IE+ APG+M R SV EPL+TG  AID++ PIG+GQRELIIGDKQTGKTT+AIDAIINQKG+NV CIYV IGQK ST+ Q +  L+++GA+EY+ ++ +SASD  ++ YLAP++G+ + E +       LI+YDDLSKHA+AYR +SL+LRRPPGREA+PGD+FY+HSRLLER+ K+  E G GS+TALPI+ET+AGD+SAYIPTN+ISITDGQ+F+ T+LF SG RPAI+ GLSVSRVG +AQI A K+ SG+L+L+LAQYREL AF+QF SDLD+ +K+ LE G+++++++KQ   +P     + +++++  + ++  + V  + DF+E++    + +   +LE I   K + +DL   +K        +Y
  S:     4 LKLEEISSVIEEKIKNFELDCDMAEVGKVVSYADGVAKVYGLNGVMSYEVLEFETGDKGVAANLEEDSVGVIVFGFGNNIKEGTSVKRTKSLMKVPVGDAVVGRVLNALGEPIDGKGEIETNEFSLIEQKAPGIMDRKSVHEPLQTGIKAIDALVPIGRGQRELIIGDKQTGKTTVAIDAIINQKGQNVICIYVAIGQKESTVAQVVRKLEEYGAMEYSVVINASASDSAAMQYLAPYSGVAMGEYFRDHARHALIVYDDLSKHAVAYREISLILRRPPGREAFPGDVFYIHSRLLERAAKLCDEKGAGSLTALPIVETQAGDVSAYIPTNIISITDGQIFLETDLFYSGIRPAINVGLSVSRVGGAAQIKATKQVSGTLRLDLAQYRELQAFTQFASDLDEASKKQLERGQRMVEVLKQAPYSPLPIEKQVVIIYAGAKGFLDSVSVKKVVDFEEQLYPFLEAKYPQVLEEIHTKKALDKDLEAMLKKVLEEFKLTY 501
>gi|148886604|sp|Q4A8W1|ATPA_MYCH7 ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|144575260|gb|AAZ53428.2| ATP synthase alpha chain [Mycoplasma hyopneumoniae 7448] (507 aa)
Score = 1325, Expect = 4.8e-144, Identities = 268/466 (57%), Positives = 345/466 (74%)
  Q:    11 IIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKTILETIDQ 476
           IIKN+I+ ++ K    +IG+VI VGDG+   SG+  V   ELV FEN   G+ LNLE    G+V++     + +GSIV+RTK+V+ + VGD LLGRV++A+G PIDG  E+    K  I   AP +M R SV   L+TG LAIDS+ PIGKGQRELIIGD+QTGKTTIAIDAI+NQKGKNV C+YV IGQKNS++ Q ++ L++ GALEYTT++ + AS+L  L YLAP++G  IAE WM+K +DVLIIYDDLSKHAIAYRTLSLLLRRPPGREA+PGDIFY HS LLERS +++ + GGGSITALPIIET+AGDISAYIPTNVISITDGQ+F+  +LFNSGQ+PAID GLSVSRVGS+AQ N +K  S SLKL LAQY EL AF+QFGSDL   ++ +L+ G K+ +++KQ+   P ++  + +LL  I+E  I  +    I  FK   +++   +    + I++
  S:    10 IIKNEIENFEGKIQNHDIGKVIIVGDGVALVSGIEKVKFGELVEFENNVLGIALNLEQDLIGVVIMASENSVFQGSIVRRTKSVISITVGDQLLGRVVNALGIPIDGKAELDNSLKSAIFTNAPSIMDRKSVDRGLKTGILAIDSLVPIGKGQRELIIGDRQTGKTTIAIDAILNQKGKNVYCVYVAIGQKNSSVAQIVSLLEKKGALEYTTVILAGASELSPLQYLAPYSGAAIAEYWMNKKKDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAFPGDIFYQHSYLLERSAQLSNDKGGGSITALPIIETQAGDISAYIPTNVISITDGQIFLRDSLFNSGQKPAIDIGLSVSRVGSAAQTNLMKWASSSLKLNLAQYNELKAFAQFGSDLGPSSQLILDRGNKIYEILKQENQYPLTERQQIMLLILIRENLIDSLEQKSIPLFKSAFLKYCDSEPKFRDKIEK 475
>gi|152990966|ref|YP_001356688.1| F0F1 ATP synthase subunit alpha [Nitratiruptor sp. SB155-2] >gi|166201670|sp|A6Q4C2|ATPA_NITSB ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|151422827|dbj|BAF70331.1| F0F1-type ATP synthase, alpha subunit [Nitratiruptor sp. SB155-2] (505 aa)
Score = 1325, Expect = 5.0e-144, Identities = 257/497 (51%), Positives = 367/497 (73%)
  Q:     3 INLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQ-KTILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           +  D+ S+IIK +I++++ K    E G+VI+ GDG+ +  GL+NVM  E++ F+NG  GM LNLE T  G+V+LG+ E I+EGS VKR   ++  PVG+ L+GRVI+A+G PIDG G I+  +   +E+ APG+MAR SV EPL+TG  AID++ PIG+GQRELIIGD+QTGKTT+AID IINQKG++V CIYV +GQK ST+ Q +  L++ GA++YT +V + AS+  +L +LAP+TG+TI E +   G+  LI+YDDLSKHA+AYR +SL+LRRPPGREAYPGD+FYLHSRLLER+ K+N + G GS+TALPIIET+AGD+SAYIPTNVISITDGQ+F+ ++LFN+G RPAI+ G+SVSRVG +AQI A+K+ +G+L+L+LAQYREL+AF+QF SDLD+ +++ LE G ++++++KQ   +P     + +++++    ++  I V  I  F+ ++    + +   I E I + K +      +IK   N  I  +
  S:     5 LQADEISSIIKERIEDFELKIDVEETGKVISFGDGVAKVFGLNNVMAGEMLEFDNGDKGMALNLEETNVGVVVLGRGEGIREGSSVKRLGQLLKAPVGEALVGRVINAIGEPIDGKGPIEATEYRYVEEKAPGIMARKSVHEPLQTGIKAIDALVPIGRGQRELIIGDRQTGKTTVAIDTIINQKGQDVVCIYVAVGQKQSTVAQVVKKLEEHGAMDYTIVVNAGASEPAALQFLAPYTGVTIGEYFRDNGKHALIVYDDLSKHAVAYREMSLILRRPPGREAYPGDVFYLHSRLLERAAKLNDKLGAGSLTALPIIETQAGDVSAYIPTNVISITDGQIFLESDLFNAGIRPAINVGISVSRVGGAAQIKAMKQVAGTLRLDLAQYRELEAFAQFASDLDEASRKQLERGMRMVEILKQPPYSPLPVEKQVVIIYAGANGFLDDIEVSAIGKFEYELYSFIEAKYPQIFELIRERKALDD----EIKELLNKAIEEF 498
>gi|118586238|ref|ZP_01543698.1| ATP synthase, alpha subunit [Oenococcus oeni ATCC BAA-1163] >gi|118433322|gb|EAV40028.1| ATP synthase, alpha subunit [Oenococcus oeni ATCC BAA-1163] (520 aa)
Score = 1325, Expect = 5.3e-144, Identities = 264/501 (52%), Positives = 360/501 (71%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHF---KQQKTILETIDQTKDISQDLFVQIKNEFNSLITSYIK 501
           M+I  D+ S++IK Q+++Y +     E+G V  VGDG+ +ASGL+NVM  ELV FENG YGM  NLE +  GI++LG F+ I +G  VKRT  V++VPVGD ++GRV++A+G PIDGNG IK     P+E  APGVM R SV EPL+TG   ID++ PIG+GQRELIIGD++TGKT++AID I+NQK +++  +YV IGQK+ST+   + TL++ GAL+YT +V++  S+   + YLAP+ G  + E +M  G+ VLI+YDDLSK A AYR LSL+LRRPPGREAYPGD+FYLHSRLLER+ K++ E GGGS+TALPIIET+AGD+SAYIPTNVISITDGQ+F+  + F SG RPAIDAG SVSRVG  AQI A+KK SG+L+L+LA Y EL+AF+QFGSDLD  T+  L  G++ ++++ Q  + P     + I+L+++   Y+  I V  I+ F++++I      K  K I   I +T ++  +       + NS I  + K
  S:     1 MAIKSDQISSLIKQQLEKYDSTLKIDEVGTVTYVGDGVARASGLANVMSGELVEFENGVYGMAQNLEESEVGIIVLGDFDGISQGDTVKRTGKVMEVPVGDEMIGRVVNALGQPIDGNGAIKTKHTRPVEFKAPGVMQRKSVFEPLQTGIKVIDALVPIGRGQRELIIGDRKTGKTSLAIDTILNQKDQDMIVVYVAIGQKDSTVRTQVETLREMGALDYTIVVSAGPSEPAPMLYLAPYVGAALGEYFMYNGKHVLIVYDDLSKQATAYRELSLILRRPPGREAYPGDVFYLHSRLLERAAKLSDELGGGSMTALPIIETQAGDVSAYIPTNVISITDGQIFLDADQFYSGNRPAIDAGTSVSRVGGDAQIKAMKKVSGTLRLDLASYHELEAFAQFGSDLDAPTQAKLARGRRTVEVLNQPLHQPMPVEHQVIVLYALTHGYLDDIDVSDIQRFQKELIDFVSGDKSYKKIFAAIKKTGNLPDE------KDINSAIDDFKK 498
>gi|188527917|ref|YP_001910604.1| F0F1 ATP synthase subunit alpha [Helicobacter pylori Shi470] >gi|188144157|gb|ACD48574.1| F0F1 ATP synthase subunit alpha [Helicobacter pylori Shi470] (503 aa)
Score = 1325, Expect = 5.3e-144, Identities = 252/497 (50%), Positives = 369/497 (74%)
  Q:     3 INLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQK--TILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           + L++ S++I+ +IK ++     +E+G+V++  DG+ +  GL+ VM  E++ FE G  G+  NLE  + G+++ G   +IKEG+ VKRTK+++ VPVGD ++GRV++A+G PIDG GEI+ ++   IE+ APG+M R SV EPL+TG  AID++ PIG+GQRELIIGDKQTGKTT+AIDAIINQKG+NV CIYV IGQK ST+ Q +  L+++GA+EY+ ++ +SASD  ++ YLAP++G+ + E +       LIIYDDLSKHA+AYR +SL+LRRPPGREA+PGD+FY+HSRLLER+ K+  E G GS+TALPI+ET+AGD+SAYIPTN+ISITDGQ+F+ T+LF SG RPAI+ GLSVSRVG +AQI A K+ SG+L+L+LAQYREL AF+QF SDLD+ +K+ LE G+++++++KQ   +P     + +++++  + ++  + V  + DF+E+ +  F + K   +LE I   K + +DL   ++        +Y
  S:     4 LKLEEISSVIEEKIKNFELDCDMAEVGKVVSYADGVAKVYGLNGVMSYEVLEFETGDKGVAANLEEDSVGVIVFGFGNNIKEGTSVKRTKSLMKVPVGDAVVGRVLNALGEPIDGKGEIETNEFSLIEQKAPGIMDRKSVHEPLQTGIKAIDALVPIGRGQRELIIGDKQTGKTTVAIDAIINQKGQNVICIYVAIGQKESTVAQVVRKLEEYGAMEYSVVINASASDSAAMQYLAPYSGVAMGEYFRDHARHALIIYDDLSKHAVAYREISLILRRPPGREAFPGDVFYIHSRLLERAAKLCDEKGAGSLTALPIVETQAGDVSAYIPTNIISITDGQIFLETDLFYSGIRPAINVGLSVSRVGGAAQIKATKQVSGTLRLDLAQYRELQAFTQFASDLDEASKKQLERGQRMVEVLKQAPYSPLPIEKQVVIIYAGAKGFLDSVSVKKVVDFEEQ-LHPFLEAKYPQVLEEIHTKKVLDKDLEAMLRKVLEEFKLTY 501
>gi|33241053|ref|NP_875995.1| F0F1 ATP synthase subunit alpha [Prochlorococcus marinus subsp. marinus str. CCMP1375] >gi|81664009|sp|Q7VA63|ATPA_PROMA ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|33238582|gb|AAQ00648.1| ATP synthase alpha chain [Prochlorococcus marinus subsp. marinus str. CCMP1375] (505 aa)
Score = 1325, Expect = 5.5e-144, Identities = 258/500 (51%), Positives = 358/500 (71%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQK-TILETIDQTKDISQDLFVQIKNEFNSLITSYI 500
           +SI  D+ S+I+K QI +Y      S +G V+ +GDGI +  GL   M  ELV FE+G+ G+ LNLE    G V++G+   I+EGS VK T  +  VPVGD +LGRV++ +G P+DGNGEI       IE +APG++ R SV EP++TG  +ID+M PIG+GQRELIIGD+QTGKT IAID IINQKG++V C+YV +GQK++++ Q +  L++ GALEYT +V +SAS+  +L YLAP+TG  IAE +M +G+  L+IYDDL+K A AYR +SLLLRRPPGREAYPGD+FY HSRLLER+ K++   G GS+TALPIIET+AGD+SAYIPTNVISITDGQ+F+  +LFNSG RPAI+ G+SVSRVG +AQ  A+KK +G+LKLELAQ+ EL AFSQF SDLD+ T++ LE GK++ +L+KQ +  P + + +  ++++  +  I  +PV+ +  F  ++  + K  K   +  +   K +S D+   +K   N + +S +
  S:     2 VSIRPDEISSILKKQIADYDKSVSVSNVGTVLQIGDGIARVYGLEKAMAGELVEFEDGTEGIALNLEDDNVGAVLMGEGLGIQEGSTVKATGKIASVPVGDAMLGRVVNPLGQPVDGNGEIATSDSRLIESLAPGIIKRKSVHEPMQTGITSIDAMIPIGRGQRELIIGDRQTGKTAIAIDTIINQKGQDVVCVYVAVGQKSASVAQVVEVLREKGALEYTIVVNASASEAAALQYLAPYTGAAIAEHFMYQGKATLVIYDDLTKQAQAYRQMSLLLRRPPGREAYPGDVFYCHSRLLERAAKLSDAMGSGSMTALPIIETQAGDVSAYIPTNVISITDGQIFLSADLFNSGLRPAINVGISVSRVGGAAQTKAIKKIAGTLKLELAQFDELAAFSQFASDLDEATQQQLERGKRLRELLKQAQFAPLNLAEQVAVVYAGVKGLIDEVPVEQVTQFAAELREYLKTSKPDYINQVLTEKKLSDDIEAVLKESINEVKSSML 502
>gi|119358312|ref|YP_912956.1| F0F1 ATP synthase subunit alpha [Chlorobium phaeobacteroides DSM 266] >gi|158512400|sp|A1BJF5|ATPA_CHLPD ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|119355661|gb|ABL66532.1| ATP synthase F1, alpha subunit [Chlorobium phaeobacteroides DSM 266] (526 aa)
Score = 1325, Expect = 5.7e-144, Identities = 262/498 (52%), Positives = 359/498 (72%)
  Q:     2 SINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKE------------------NGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQK-TILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           ++  D+ S+I++ Q+  ++++A   ++G V+ VGDGI +  GLS     EL+ F N   GM LNLE    G V+ G+   +KEG  VKRT  +  +PVG+ +LGRVI+ +G PIDG G I+   ++P+E+ APGV+ R SV EPL+TG  AIDSM PIG+GQRELIIGD+QTGKT +AID IINQKGK V CIYV IG K ST+ Q +NTL++FGA+EYTT++ ++ASD   L ++APF G T+ E +   G   L++YDDLSK A+AYR LSLLLRRPPGREAYPGD+FYLHSRLLER+ KI  +                   GGGS+TALP+IET+AGD+SAYIPTNVISITDGQ+F+ +NLFNSGQRPAI+ G+SVSRVG SAQI A+KK +G+L+L+LAQ+REL+AFS+FGSDLDK TK  L+ G ++++++KQ +  P +   +  ++F   +  +  + V  I  F+E+ +   + +   +L+ I +T  +  D   +IK      I S+
  S:     4 TVRPDEVSSILRKQLAGFESEADVYDVGTVLQVGDGIARVYGLSKAAAGELLEFPNKVMGMALNLEEDNVGAVLFGESNLVKEGDTVKRTGILASIPVGEAMLGRVINPLGEPIDGKGPIETQIRLPLERRAPGVIYRKSVHEPLQTGLKAIDSMIPIGRGQRELIIGDRQTGKTAVAIDTIINQKGKGVFCIYVAIGLKGSTVAQVVNTLEKFGAMEYTTVITATASDPAPLQFIAPFAGATLGEYFRDTGRHALVVYDDLSKQAVAYRQLSLLLRRPPGREAYPGDVFYLHSRLLERAAKITDDIEVARKMNDLPDALKSMVKGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLESNLFNSGQRPAINVGISVSRVGGSAQIKAMKKVAGTLRLDLAQFRELEAFSKFGSDLDKTTKAQLDRGARLVEILKQGQYIPMAVEKQVAIIFLGTQGLLDAVDVTRIRKFEEEFLGLLEHKHPEVLKAIAETGTLETDTANKIKEAAQKFIASF 520
>gi|95929973|ref|ZP_01312713.1| ATP synthase F1, alpha subunit [Desulfuromonas acetoxidans DSM 684] >gi|95133942|gb|EAT15601.1| ATP synthase F1, alpha subunit [Desulfuromonas acetoxidans DSM 684] (502 aa)
Score = 1324, Expect = 5.8e-144, Identities = 258/489 (52%), Positives = 353/489 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHF-KQQKTILETIDQTKDISQDLFVQIK 489
           M I  ++ S IIK QI+ +  +   SE G +I+VGDGI +  GL   M  EL+ F  G+ GM LNLE    G  +LG  E IKEG  VKRT+ +V VPVG+ L+GRV++ +G  IDG GEIK D    +E  APG++AR SV EP++TG  AIDSM PIG+GQRELIIGD+QTGKT +A+D IINQKG++V CIYV IGQK ST+ Q ++ LKQ GA++YT +VA++ASD   L ++AP+TG+T+ E +   G+  LIIYDDLSK A+AYR LSLLLRRPPGREA+PGD+FYLHSRLLER+ K+N + G GS+TALPIIET+AGD+SAYIPTNVISITDGQ+F+ T+LF SG RPAI+ GLSVSRVG SAQ+ A+K+ +G+L+L LAQYRE+ AF+QFGSDLD  T++ L+ G+++++++KQ +  P   + + + +++    Y+   P   +  ++ +++     +   ++  +   K I  DL  ++K
  S:     1 MEIKAEEISAIIKKQIENFGREVEVSETGSIISVGDGIARIHGLDKAMSGELLEFPGGTMGMILNLEEDNVGAAILGDSEHIKEGDTVKRTEQIVRVPVGESLIGRVVNGIGIAIDGQGEIKSDNYGQVEVKAPGIVARKSVHEPMQTGLKAIDSMVPIGRGQRELIIGDRQTGKTAVAVDTIINQKGQDVVCIYVAIGQKRSTVAQVVDKLKQHGAMDYTIVVAATASDPAPLQFIAPYTGVTMGEYFRDNGKHALIIYDDLSKQAVAYRQLSLLLRRPPGREAFPGDVFYLHSRLLERAAKVNDDLGAGSLTALPIIETQAGDVSAYIPTNVISITDGQIFLETDLFYSGVRPAINVGLSVSRVGGSAQVKAMKQVAGTLRLALAQYREMAAFAQFGSDLDAATQKQLQRGERLVEILKQGQYQPLPVAKQVVAIYAANNGYVDDYPATAVGRYESELLAFIDSKHADLINDLTNKKAIDADLEGRLK 490
>gi|149202399|ref|ZP_01879372.1| F0F1 ATP synthase subunit alpha [Roseovarius sp. TM1035] >gi|149144497|gb|EDM32528.1| F0F1 ATP synthase subunit alpha [Roseovarius sp. TM1035] (512 aa)
Score = 1324, Expect = 5.9e-144, Identities = 250/465 (53%), Positives = 343/465 (73%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQK----------GKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK 465
           M I   + S I+K+QIK +   A  +EIGRV++VGDGI +  GL NV   ELV F     GM LNLE+   G+V+ G   DIKEG  VKRTK++VDVP+GD LLGRV+D +GNP+DG G IK   +   +  APG++ R SV EP+ TG  ++D+M PIG+GQRELIIGD+QTGKT +A+DAI+NQK           K + C+YV +GQK ST+ Q +  L++ GA++Y+ +VA++ASD   + +LAP++   +AE +   G   LI+YDDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLERS K+N +NG GS+TALPIIET+ GD+SA+IPTNVISITDGQ+F+ T LF  G RPA++ GLSVSRVGSSAQ NA+K  +G +KLELAQYRE+ AF+QFGSDLD  T+++L  G ++ +L+KQ + +P + +    ++++  + Y+  IPV  +  +++ +++H +
  S:     1 MGIQAAEISAILKDQIKNFGQDAEVAEIGRVLSVGDGIARVHGLDNVQAGELVEFPGSIMGMALNLESDNVGVVIFGSDRDIKEGDTVKRTKSIVDVPIGDELLGRVVDGLGNPLDGKGPIKTKTRGLADVKAPGIIPRKSVHEPMATGLKSVDAMIPIGRGQRELIIGDRQTGKTAVALDAILNQKIYNEAAGDDESKKLYCVYVAVGQKRSTVAQLVKKLEESGAIKYSIVVAATASDPAPMQFLAPYSATAMAEHFRDNGRHALIVYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERSAKLNSDNGSGSLTALPIIETQGGDVSAFIPTNVISITDGQIFLETELFYQGIRPAVNTGLSVSRVGSSAQTNAMKSVAGPVKLELAQYREMAAFAQFGSDLDAATQQLLNRGARLTELMKQPQYSPLTNAEIVCVIYAGTKGYLDKIPVSQVGRYEQGLLKHLR 475
>gi|126725127|ref|ZP_01740970.1| F0F1 ATP synthase subunit alpha [Rhodobacterales bacterium HTCC2150] >gi|126706291|gb|EBA05381.1| F0F1 ATP synthase subunit alpha [Rhodobacterales bacterium HTCC2150] (512 aa)
Score = 1324, Expect = 6.0e-144, Identities = 259/499 (51%), Positives = 356/499 (71%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKG----------KNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKTILETIDQTKD--ISQDLFVQIKNEFNSLITSY 499
           M I   + S I+K+QIK +   A  +E+GRV++VGDGI +  GL NV   E+V F  G  GM LNLEA   G+V+ G   DIKEG  VKRT ++VDVPVGD LLGRV+D +GNP+DG G IK   +   ++ APG++ R SV EP+ TG  ++D+M PIG+GQRELIIGD+QTGKT +A+DAI+NQK           K + CIYV IGQK ST+ Q +  L++ GA+EY+ +VA++ASD   + +LAP+   ++AE +   G   LIIYDDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLERS K+N++NG GS+TALPIIET+ GD+SA+IPTNVISITDGQ+F+ T LF  G RPA++ GLSVSRVGSSAQ N++K  +G +KLELAQYRE+ AF+QFGSDLD  T+++L  G ++ +L+KQ + +P + +    ++++  + Y+  I V  +  +++ ++ H + +   L     T+D  I  D   +IK+  +     +
  S:     1 MGIQAAEISAILKDQIKNFGKDAEVAEVGRVLSVGDGIARVYGLDNVQAGEMVEFPGGIQGMALNLEADNVGVVIFGSDRDIKEGDTVKRTNSIVDVPVGDALLGRVVDGLGNPLDGKGPIKTKTRSIADQKAPGIIPRKSVHEPMATGLKSVDAMIPIGRGQRELIIGDRQTGKTAVALDAILNQKSYNAAAGDDENKKLYCIYVAIGQKRSTVAQLVKKLEETGAIEYSIVVAATASDPAPMQFLAPYAATSMAEHFRDNGRHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERSSKLNEDNGSGSLTALPIIETQGGDVSAFIPTNVISITDGQIFLETELFYQGIRPAVNTGLSVSRVGSSAQTNSMKSVAGPVKLELAQYREMAAFAQFGSDLDAATQQLLNRGARLTELMKQAQYSPLTNAEIVCVIYAGTKGYLDKIEVSDVGRYEKGLLAHLRGKNADLLDFITTEDPKIKGDAEAKIKSALDEFAADF 511
>gi|109947167|ref|YP_664395.1| F0F1 ATP synthase subunit alpha [Helicobacter acinonychis str. Sheeba] >gi|123173495|sp|Q17Y80|ATPA_HELAH ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|109714388|emb|CAJ99396.1| ATP synthase F1 alpha subunit [Helicobacter acinonychis str. Sheeba] (503 aa)
Score = 1324, Expect = 6.2e-144, Identities = 251/497 (50%), Positives = 366/497 (73%)
  Q:     3 INLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQ-KTILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           + L++ S++I+ +IK ++     +E+G+V++  DG+ +  GL+ VM  E++ FE G  G+  NLE  + G+++ G   +IKEG+ VKRTK+++ VPVGD ++GRV++A+G PIDG GEI+ ++   IE+ APG+M R SV EPL+TG  AID++ PIG+GQRELIIGDKQTGKTT+AID IINQKG+NV CIYV IGQK ST+ Q +  L+++GA+EY+ +V +SASD  ++ YLAP+ G+ + E +       LIIYDDLSKHA+AYR +SL+LRRPPGREA+PGD+FY+HSRLLER+ K+  E G GS+TALPI+ET+AGD+SAYIPTN+ISITDGQ+F+ T+LF SG RPAI+ GLSVSRVG +AQI A K+ SG+L+L+LAQYREL AF+QF SDLD+ +K+ LE G+++++++KQ   +P     + +++++  + ++  + V  + DF+E++    + +   +LE I   K + +DL   +K        +Y
  S:     4 LKLEEISSVIEEKIKNFELDCDMAEVGKVVSYADGVAKIYGLNGVMSYEVLEFETGDKGVAANLEEDSVGVIVFGFGNNIKEGTSVKRTKSLMKVPVGDAVVGRVLNALGEPIDGKGEIETNEFSLIEQKAPGIMDRKSVHEPLQTGIKAIDALVPIGRGQRELIIGDKQTGKTTVAIDTIINQKGQNVICIYVAIGQKESTVAQVVRKLEEYGAMEYSVVVNASASDSAAMQYLAPYAGVAMGEYFRDHARHALIIYDDLSKHAVAYREISLILRRPPGREAFPGDVFYIHSRLLERAAKVCDEKGAGSLTALPIVETQAGDVSAYIPTNIISITDGQIFLETDLFYSGIRPAINVGLSVSRVGGAAQIKATKQVSGTLRLDLAQYRELQAFTQFASDLDEASKKQLERGQRMVEVLKQAPYSPLPIEKQVVIIYAGAKGFLDSVSVKKVVDFEERLYPFLEAKYPQVLEEIHIKKALDKDLEAMLKKALEEFKLTY 501
>gi|53802693|ref|YP_112551.1| F0F1 ATP synthase subunit alpha [Methylococcus capsulatus str. Bath] >gi|81683270|sp|Q60CR6|ATPA1_METCA ATP synthase subunit alpha 1 (ATPase subunit alpha 1) (ATP synthase F1 sector subunit alpha 1) >gi|53756454|gb|AAU90745.1| ATP synthase F1, alpha subunit [Methylococcus capsulatus str. Bath] (513 aa)
Score = 1324, Expect = 6.5e-144, Identities = 260/479 (54%), Positives = 355/479 (74%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKEN-----------GGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQ-KTILETIDQTKD 479
           M +N  + S++IK +I ++         G ++++ DGIV+  GL +VM  E+V F   +YGM LNLE  + G V+LG +E + EG   K T  +++VPVG+ LLGRV+DA+GNPIDG G I      PIEKIAPGV++R SV +PL+TG  AIDSM P+G+GQRELIIGD+QTGKT IAIDAIINQKG  VKCIYV +GQK S+I   +  L++ GA+E+T +V++SAS+  +L ++AP+ G  + E +  +GED LI+YDDL+K A AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ +IN E              GS+TALPIIET+AGD+SA++PTNVISITDGQ+F+ TNLFN+G RPA++AGLSVSRVG +AQ   +KK  G ++L+LAQYREL AF+QF SDLD+ T++ +E G++V +L+KQ++ +P S +  A+ LF+  E Y+  I V  + DF++ +  + K Q   +L++ID T D
  S:     1 MQLNASEISDLIKQRIGKFDLGVESRSEGTIVSLTDGIVRIHGLQDVMQGEMVEFPGNTYGMALNLERDSVGAVVLGSYEHLSEGDTAKCTGRILEVPVGEALLGRVVDALGNPIDGAGPIDAKLFSPIEKIAPGVISRQSVSQPLQTGLKAIDSMIPVGRGQRELIIGDRQTGKTAIAIDAIINQKGTGVKCIYVAVGQKQSSIANVVRKLQEHGAMEHTIVVSASASESAALQFIAPYAGCAMGEYFRDRGEDALIVYDDLTKQAWAYRQISLLLRRPPGREAYPGDVFYLHSRLLERASRINAEEVERLTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETNLFNAGIRPAVNAGLSVSRVGGAAQTKVIKKLGGGIRLDLAQYRELAAFAQFASDLDEATRKQIERGQRVTELMKQNQYSPMSIAQMAVSLFAANEGYLDDIEVSKVRDFEDALQEYMKSQCAELLKSIDATGD 491
>gi|157165459|ref|YP_001466343.1| F0F1 ATP synthase subunit alpha [Campylobacter concisus 13826] >gi|166201655|sp|A7ZC35|ATPA_CAMC1 ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|112800110|gb|EAT97454.1| ATP synthase F1, alpha subunit [Campylobacter concisus 13826] (505 aa)
Score = 1324, Expect = 6.7e-144, Identities = 258/482 (53%), Positives = 354/482 (73%)
  Q:     3 INLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQ-KTILETIDQTKDISQDL 484
           I  D+ S IIK +I+ +       E G+VI+V DG+    GL NVM  E+V FE+G  GM LNLE ++ GIV+LGK   I EGS VKR K ++ VPVGD L+GRV++++G PID  G I+  +   +E+ A G+MAR SV EPL+TG  AID++ PIG+GQRELIIGD+QTGKTT+AID IINQKG++V CIYV IGQK ST+ Q +  L+++GA++YT +V + ASD  +L YLAP+ G+T+ E +       LIIYDDLSKHA+AYR +SL+LRRPPGREAYPGD+FYLHSRLLER+ K+N   G GS+TALPIIET+AGD+SAYIPTNVISITDGQ+F+ ++LFNSG RPAI+ GLSVSRVG +AQI A+K+ SG+L+L+LAQYREL AF+QF SDLD+ +++ LE G+K+++++KQ   +P     + +++F+  + Y+  +    +  F+ ++  + + +   I E I   K I +++
  S:     5 IKADEISTIIKERIENFDLSVDVEETGKVISVADGVANVYGLKNVMAGEMVEFESGEKGMALNLEESSVGIVILGKTSGITEGSSVKRLKKLLRVPVGDALIGRVVNSLGEPIDAKGPIEATESRFVEEKAKGIMARKSVHEPLQTGIKAIDALVPIGRGQRELIIGDRQTGKTTVAIDTIINQKGQDVICIYVAIGQKQSTVAQVVKKLEEYGAMDYTIVVNAGASDAAALQYLAPYAGVTMGEYFRDNSRHALIIYDDLSKHAVAYREMSLILRRPPGREAYPGDVFYLHSRLLERASKLNDALGAGSLTALPIIETQAGDVSAYIPTNVISITDGQIFLESDLFNSGIRPAINVGLSVSRVGGAAQIKAIKQVSGTLRLDLAQYRELQAFAQFASDLDESSRKQLERGQKMVEVLKQPPYSPLPVENQVVIIFAGAKGYLDDVATANVTKFEAELYPYIEAKYPEIFEQIRTKKVIDKEV 487
>gi|54020004|ref|YP_115568.1| F0F1 ATP synthase subunit alpha [Mycoplasma hyopneumoniae 232] >gi|81603676|sp|Q601Z7|ATPA_MYCH2 ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|53987177|gb|AAV27378.1| ATP synthase alpha chain [Mycoplasma hyopneumoniae 232] (507 aa)
Score = 1323, Expect = 8.2e-144, Identities = 267/466 (57%), Positives = 344/466 (73%)
  Q:    11 IIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKTILETIDQ 476
           IIKN+I+ ++ K    +IG+VI VGDG+   SG+  V   ELV FEN   G+ LNLE    G+V++     + +GSIV+RTK+V+ + VGD LLGRV++A+G PIDG  E+    K  I   AP +M R SV   L+TG LAIDS+ PIGKGQRELIIGD+QTGKTTIAIDAI+NQKGKNV C+YV IGQKNS++ Q ++ L++ GA EYTT++ + AS+L  L YLAP++G  IAE WM+K +DVLIIYDDLSKHAIAYRTLSLLLRRPPGREA+PGDIFY HS LLERS +++ + GGGSITALPIIET+AGDISAYIPTNVISITDGQ+F+  +LFNSGQ+PAID GLSVSRVGS+AQ N +K  S SLKL LAQY EL AF+QFGSDL   ++ +L+ G K+ +++KQ+   P ++  + +LL  I+E  I  +    I  FK   +++   +    + I++
  S:    10 IIKNEIENFEGKIQNHDIGKVIIVGDGVALVSGIEKVKFGELVEFENNVLGIALNLEQDLIGVVIMASENSVFQGSIVRRTKSVISITVGDQLLGRVVNALGIPIDGKAELDNSLKSAIFTNAPSIMDRKSVDRGLKTGILAIDSLVPIGKGQRELIIGDRQTGKTTIAIDAILNQKGKNVYCVYVAIGQKNSSVAQIVSLLEKKGAFEYTTVILAGASELSPLQYLAPYSGAAIAEYWMNKKKDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAFPGDIFYQHSYLLERSAQLSNDKGGGSITALPIIETQAGDISAYIPTNVISITDGQIFLRDSLFNSGQKPAIDIGLSVSRVGSAAQTNLMKWASSSLKLNLAQYNELKAFAQFGSDLGPSSQLILDRGNKIYEILKQENQYPLTERQQIMLLILIRENLIDSLEQKSIPLFKSAFLKYCDSEPKFRDKIEK 475
>gi|121282044|gb|ABM53598.1| putative ATP synthase alpha chain [uncultured bacterium CBNPD1 BAC clone 2089] (530 aa)
Score = 1323, Expect = 8.5e-144, Identities = 253/472 (53%), Positives = 339/472 (71%)
  Q:    28 IGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKTILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           +GRV  VGDGI + SGL +  +NEL+ FE+G+ G+ LNL+  + G V+LG  + I+EG  VK T  ++ +PVGD LLGRVI+A+G PIDG G+I       +E  APG+M R  V EPL+TG  AID+M PIG+GQRELIIGD++TGKTT+AID IINQ+G  VKCIYV IGQK ST+ Q + TL+Q GALEYT +VA+ ASD     YLAP+ G  + + WM   E  L++YDDLSK A AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K++  NG GS+TALP+IET+AGD+SAYIPTNVISITDGQ+++  NLF SG RPA+D G+SVSRVGS+AQI A+K  SG+LKL+LAQ+REL+AF+ FGS+LD  +K  LE G ++++L+KQ  N+P     + + +F+  + Y+  IPV  +  F+ +++ H K +   +        I QD    +  +   ++T++
  S:    31 VGRVAEVGDGIARVSGLPDCAVNELLEFEDGTVGLALNLDEDSIGAVVLGDADSIEEGQAVKATGRILSLPVGDALLGRVINALGQPIDGKGDIVGATIRRVEVQAPGIMGRKPVHEPLQTGIKAIDAMIPIGRGQRELIIGDRKTGKTTVAIDTIINQRGLGVKCIYVAIGQKGSTVAQTVETLRQAGALEYTVVVAAPASDPAPFKYLAPYAGCALGQHWMENSEHALVVYDDLSKQAEAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSDANGAGSLTALPVIETKAGDVSAYIPTNVISITDGQVYLQDNLFKSGVRPAVDVGISVSRVGSAAQIKAMKSVSGTLKLDLAQFRELEAFATFGSELDAVSKAQLERGYRLVELLKQSLNSPMPVEEQVVSIFAGTKGYLDDIPVADVRRFESELLAHVKSRHGAM-----IAGIRQDPKADVPKDLADIVTAF 497
>gi|89070094|ref|ZP_01157424.1| ATP synthase subunit A [Oceanicola granulosus HTCC2516] >gi|89044315|gb|EAR50458.1| ATP synthase subunit A [Oceanicola granulosus HTCC2516] (512 aa)
Score = 1323, Expect = 8.8e-144, Identities = 246/468 (52%), Positives = 346/468 (73%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKG----------KNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQK 468
           M+I   + S I+K+QIK +   A  +E+GRV++VGDGI +  GL N+   E+V F  G  GM LNLE    G+V+ G   DIKEG  VKRT ++VDVP G+GLLGRV+D +GNP+DG GE+++ ++   +  APG++ R SV EP+ TG  ++D+M PIG+GQRELIIGD+QTGKT +A+D I+NQK           K + CIYV +GQK ST+ Q +  L++ GA++Y+ +VA++ASD   + +LAP+    +AE +   G+  LIIYDDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLERS K+N+E+G GS+TALPIIET+ GD+SA+IPTNVISITDGQ+F+ T LF  G RPA++ GLSVSRVGS+AQ NA+K  +G +KLELAQYRE+ AF+QFGSDLD  T+++L  G ++ +L+KQ + +P + +    ++++    ++  IPV+ +  F+  +++H +  +
  S:     1 MAIQAAEISAILKDQIKNFGQGAEVAEVGRVLSVGDGIARVYGLDNIQAGEMVEFPGGIMGMALNLETDNVGVVIFGSDRDIKEGDTVKRTNSIVDVPAGEGLLGRVLDGLGNPLDGKGEVQFSERRVADVKAPGIIPRKSVHEPMATGLKSVDAMIPIGRGQRELIIGDRQTGKTAVAMDTILNQKSYNDAAGDDESKKLYCIYVAVGQKRSTVAQLVKRLEESGAIDYSIVVAATASDPAPMQFLAPYAACAMAEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERSAKLNEEHGAGSLTALPIIETQGGDVSAFIPTNVISITDGQIFLETELFYQGVRPAVNTGLSVSRVGSAAQTNAMKSVAGPVKLELAQYREMAAFAQFGSDLDAATQQLLNRGARLTELMKQPQYSPLTNAEIVCVIYAGVNGFLDKIPVNKVGAFEAGLLKHLRTNR 478
>gi|163869187|ref|YP_001610439.1| F0F1 ATP synthase subunit alpha [Bartonella tribocorum CIP 105476] >gi|189081288|sp|A9IYX0|ATPA_BART1 ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|161018886|emb|CAK02444.1| ATP synthase alpha chain [Bartonella tribocorum CIP 105476] (511 aa)
Score = 1323, Expect = 9.7e-144, Identities = 261/501 (52%), Positives = 354/501 (70%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQK----------GKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQ-KTILETIDQTKDISQDLFVQIKNEFNSLITSYIK 501
           M I   + S I+K QIK +  KA  SEIG V++VGDGI +  GL NV   E+V F NG  GM LNLE    G+V+ G   DI+EG  VKR   +VDVPVG  LLGRV+DA+GNPIDG G +K  ++  ++  APG++ R SV EP+ TG  AID++ PIG+GQREL+IGD+QTGKT I +D  +NQK             V CIYV IGQK ST+ QF+  L++ GALEY+ IVA++ASD   L ++AP  G  + E +   G+  LI YDDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+N ENG GS+TALP+IET+A D+SAYIPTNVISITDGQ+F+ TNLF  G RPA++ GLSVSRVGS+AQI A+K+ +GS+K ELAQYRE+ AF+QFGSDLD  T+ +L  G ++ +L+KQ + +P     + +++F+    Y+  + V  +  F++ ++   +   + +L+ I + K I+ +L    K++  +++ +Y K
  S:     1 MDIRPSEISKILKEQIKNFDQKAEVSEIGWVLSVGDGIARVYGLDNVQAGEMVAFPNGVRGMALNLEVDNVGVVIFGSDRDIREGDCVKRLGAIVDVPVGPALLGRVVDALGNPIDGKGPLKETERRRVDVKAPGIIPRQSVHEPMSTGLKAIDALIPIGRGQRELVIGDRQTGKTAILLDTFLNQKPFHEKGAGREQDKVYCIYVAIGQKRSTVAQFVKVLEERGALEYSIIVAATASDPAPLQFIAPLAGCAMGEYFRDNGQHALIGYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNAENGSGSLTALPVIETQANDVSAYIPTNVISITDGQIFLETNLFYQGIRPAVNVGLSVSRVGSAAQIKAMKQVAGSIKGELAQYREMAAFAQFGSDLDASTQRLLNRGARLTELLKQPQFSPLKTEEQVVVIFAGVNGYLDSLAVSDVARFEQGLLVLLRSDYQDLLQAIAEQKQITDEL----KDKLITVLNTYAK 508
>gi|110225671|ref|YP_665677.1| ATP synthase F1 subunit alpha [Nephroselmis olivacea] >gi|6066186|gb|AAF03204.1|AF110138_36 ATP synthase F1 subunit alpha [Nephroselmis olivacea] (508 aa)
Score = 1322, Expect = 1.0e-143, Identities = 261/500 (52%), Positives = 354/500 (70%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKG--------KNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKTILETIDQTKDISQDLFVQIKNEFNSLITSYI 500
           MS++  + S +++ +I+ Y  K    EIGRV++VGDGI +  GL+ +   E+V F +G  GM LNLE    GIV+ G    I EG IVKRT  +VDVPVG GLLGRV+DA+G PIDG G +    +  +E  APG++ R SV EP++TG  A+DS+ PIG+GQRELIIGD+QTGKT+IAID IINQK         K + CIYV +GQK ST+ Q +  L + GA+ YT +VA++ASD   L +LAP++   + E +   G   LIIYDDLSK ++AYR +SLLLRRPPGREA+PGD+FYLHSRLLERS K +   G GS+T LP+IET+AGD+SAYIPTNVISITDGQ+F+ T LFN G RPAI+ GLSVSRVGS+AQI A+K+ +G+LKLELAQYRE+ AF+QFGSDLD  T+ +L  G+++ +++KQ    P    L+ ++++S    Y+  IPV  I  F++ +++       ILETI + + +S      +K+ FN  +T+++
  S:     1 MSLSAGEISTLLEQRIQNYYMKVNVDEIGRVLSVGDGIARVYGLNKIRAGEMVEFASGVQGMALNLEYDNVGIVLFGADYLINEGDIVKRTGAIVDVPVGRGLLGRVVDALGKPIDGKGALTDVTRARVETKAPGIIERKSVHEPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKSVNAGNDESKKLYCIYVAVGQKRSTVAQLVRILSEAGAMSYTIVVAATASDAAPLQFLAPYSASAMGEYFRDNGMHALIIYDDLSKQSVAYRQMSLLLRRPPGREAFPGDVFYLHSRLLERSCKRSDATGAGSMTGLPVIETQAGDVSAYIPTNVISITDGQIFLETELFNKGNRPAINVGLSVSRVGSAAQIKAMKQVAGTLKLELAQYREVAAFAQFGSDLDAATQYLLNRGQRLTEILKQGLYVPIPVELQVVIIYSATRGYLDRIPVSSIASFEQGLVKEVP--PAILETIRKERVLSPSTDAALKDFFNKFMTNFV 506
>gi|194702226|gb|ACF85197.1| unknown [Zea mays] (552 aa)
Score = 1322, Expect = 1.0e-143, Identities = 257/492 (52%), Positives = 358/492 (72%)
  Q:     9 SNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQK--------GKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKT-ILETIDQTKDISQDLFVQIKNEFNSLITSYI 500
           S+I++ +I+  Q ++  +E GRV++VGDGI +  G++NV   ELV F +G  GM +NLEA   G+V+ G    +KEG  VKRT  +VDVPVG  +LGRV+DA+GNPIDG G I   +K   +  APG++ R SV EP++TG  +ID+M PIG+GQRELIIGD+QTGKT + +D I+NQK         K + CIYV +GQK ST+ Q + TL++  A++Y+ +VA++AS+   L YLAPFTG +I E +   G+  L+IYDDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+N + GGGS+TALP+IET+ GD+SAYIPTNVISITDGQ+F+   LF  G RPAI+ GLSVSRVGS+AQ+ A+K+ +GSLKL LAQYRE+ AF+QFGSDLD  TK+ L  G+++ +L+KQ +  P+  +    L+F+    Y+  +PV+ +  ++   I H K  ++ +L TID+   IS+D   ++++   S + S++
  S:    51 SSILEQRIRGVQEESGLAETGRVLSVGDGIARVHGMANVQAEELVEFASGVKGMCMNLEAGQVGVVLFGSDRLVKEGETVKRTGEIVDVPVGPEMLGRVVDALGNPIDGKGPINTKEKRRAQLKAPGILPRKSVNEPVQTGLKSIDAMVPIGRGQRELIIGDRQTGKTAVGLDTILNQKRWNDGQDEKKKLYCIYVAVGQKRSTVAQLVKTLEENDAMKYSIVVAATASEAAPLQYLAPFTGASIGEWFRDNGKHSLVIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDKLGGGSMTALPVIETQGGDVSAYIPTNVISITDGQIFLEAELFYKGIRPAINVGLSVSRVGSAAQVKAMKQVAGSLKLFLAQYREVAAFAQFGSDLDAATKQTLNRGERLTELLKQTQYNPYPVNHMVPLIFAGVNGYLDSVPVNKVLQWEADFIAHLKTNESELLATIDKEGAISKDTEAKLRDVTQSFVKSFL 551
>gi|163792318|ref|ZP_02186295.1| primosome assembly protein PriA [alpha proteobacterium BAL199] >gi|159182023|gb|EDP66532.1| primosome assembly protein PriA [alpha proteobacterium BAL199] (511 aa)
Score = 1322, Expect = 1.0e-143, Identities = 264/499 (52%), Positives = 353/499 (70%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKG----------KNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKT-ILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           M I   + S I+K QI  +  +A  +E+G+V++VGDGI +  GL  V   E+V F  G  GM LNLE    GIV+ G    IKEG  VKRT  +VD PVG GLLGRV+D +GNPIDG G ++  K+M +E  APG+M R SV EP++TG  AIDS+ PIG+GQRELIIGD+QTGKT IAIDA INQK           K + CIYV IGQK ST+ Q + TL+ +GALEY+ ++A++ASD   L +LAP+TG  + E +   G   +I+YDDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+N  NG GS+TALP+IET+AGD+SAYIPTNVISITDGQ+F+ T+LF  G RPA++ GLSVSRVGS+AQI A+K+ +G +KLELAQYRE+ AF+QF SDLD  T+ +L  G ++ +L+KQ + +P     + + +F+    Y+  I V  I  F+++++   K +   IL+ I   K +S +   ++K   +S   ++
  S:     1 MDIRAAEISGILKEQIANFGAEAEVAEVGQVLSVGDGIARVYGLDQVQAGEMVEFPGGVRGMALNLETDNVGIVIFGDDRYIKEGDTVKRTGAIVDAPVGRGLLGRVVDGLGNPIDGKGPLQDVKRMRVEVKAPGIMPRKSVHEPMQTGLKAIDSLIPIGRGQRELIIGDRQTGKTAIAIDAFINQKSVNDAAGDDDSKKLFCIYVAIGQKRSTVAQIVKTLEDYGALEYSIVIAATASDPAPLQFLAPYTGCAMGEFFRDNGMHAVIVYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDANGAGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETDLFYRGIRPAVNVGLSVSRVGSAAQIKAMKQVAGRIKLELAQYREMAAFAQFASDLDASTQRLLARGSRLTELLKQPQFSPMPVEEQVVSIFAGVRGYLDKIAVADIGRFEQQLLSDIKSKAPGILDAIRAEKALSDETEGKLKEFMDSFAKTF 510
>gi|84515108|ref|ZP_01002471.1| ATP synthase subunit A [Loktanella vestfoldensis SKA53] >gi|84511267|gb|EAQ07721.1| ATP synthase subunit A [Loktanella vestfoldensis SKA53] (511 aa)
Score = 1322, Expect = 1.0e-143, Identities = 257/499 (51%), Positives = 357/499 (71%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKN---------VKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQ-KTILETI-DQTKDISQDLFVQIKNEFNSLITSY 499
           M+I   + S I+K+QIK +   A  +E+GRV++VGDGI +  GL NV   E+V F  G  GM LNLE    G+V+ G   +IKEG +VKRTK++VDVP+GD LLGRV+D +GNP+DG G IK  K+   +  APG++ R SV EP+ TG  ++D+M PIG+GQRELIIGD+QTGKT +A+D I+NQK  N         + C+YV IGQK ST+ Q +  L++ GA+EYT +VA++ASD   + +LAP+    +AE +   G   LIIYDDLSK A++YR +SLLLRRPPGREAYPGD+FYLHSRLLERS K+N++NG GS+TALPIIET+ GD+SA+IPTNVISITDGQ+F+ T LF  G RPA++ GLSVSRVGSSAQ NA+K  +G +KLELAQYRE+ AF+QFGSDLD  T+++L  G ++ +L+KQ + +P + +    ++++  + Y+  I V  +  F+  ++++ +   K +L+ I  +   I  D   +IK   ++    +
  S:     1 MAIQASEISAILKDQIKNFGQDAEVAEVGRVLSVGDGIARVYGLDNVQAGEMVEFPGGIRGMALNLETDNVGVVIFGSDREIKEGDVVKRTKSIVDVPIGDELLGRVVDGLGNPLDGKGPIKTTKRAVADSKAPGIIPRKSVHEPMATGLKSVDAMIPIGRGQRELIIGDRQTGKTAVALDTILNQKSYNDAATNEYDKLYCVYVAIGQKRSTVAQLVKKLEESGAIEYTIVVAATASDPAPMQFLAPYAATAMAEHFRDNGRHALIIYDDLSKQAVSYRQMSLLLRRPPGREAYPGDVFYLHSRLLERSAKLNEDNGAGSLTALPIIETQGGDVSAFIPTNVISITDGQIFLETELFYQGIRPAVNTGLSVSRVGSSAQTNAMKSVAGPVKLELAQYREMAAFAQFGSDLDAATQQLLNRGARLTELMKQPQYSPLTNAEIVCVIYAGTKGYLDKISVKDVGRFEAGLLKYLRTTGKDVLDMITKEDPKIKGDAEAKIKAALDAYAADF 510
>gi|78187827|ref|YP_375870.1| F0F1 ATP synthase subunit alpha [Pelodictyon luteolum DSM 273] >gi|115312233|sp|Q3B1F4|ATPA2_PELLD ATP synthase subunit alpha 2 (ATPase subunit alpha 2) (ATP synthase F1 sector subunit alpha 2) >gi|78167729|gb|ABB24827.1| ATP synthase F1, alpha subunit [Pelodictyon luteolum DSM 273] (526 aa)
Score = 1322, Expect = 1.2e-143, Identities = 256/498 (51%), Positives = 360/498 (72%)
  Q:     2 SINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKE------------------NGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK-QQKTILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           ++  D+ S+I++ Q+  ++++A   ++G V+ VGDGI +  GLS     EL+ F N   GM LNLE    G V+ G   ++KEG  VKRT  +  VPVG+ +LGRV++ +G PIDG G I  D ++P+E+ APGV+ R SV EPL+TG  AIDSM PIG+GQRELIIGD+QTGKT +A+D IINQKGK V CIYV IG K ST+ Q +NTL++ GA+EYTT++ ++ASD   L ++APF G  + E +   G   L++YDDLSK A+AYR LSLLLRRPPGREAYPGD+F+LHSRLLER+ KI  +                   GGGS+TALP+IET+AGD+SAYIPTNVISITDGQ+F+ +NLFNSGQRPAI+ G+SVSRVG +AQI A+KK +G+L+L+LAQ+REL+AFS+FGSDLDK TK  L+ G ++++++KQ +  P     +  ++F   +  +  + V +++ F+E+ +     +   IL++I +T  +  D+  ++K      +T++
  S:     4 TVRPDEVSSILRKQLAGFESEAEVYDVGTVLQVGDGIARVYGLSKAAAGELLEFPNKVMGMALNLEEDNVGAVLFGDSTEVKEGDTVKRTGILASVPVGEAMLGRVVNPLGVPIDGKGIIDTDIRLPLERRAPGVIYRKSVHEPLQTGLKAIDSMIPIGRGQRELIIGDRQTGKTAVALDTIINQKGKGVYCIYVAIGLKGSTVAQVVNTLEKHGAMEYTTVITATASDPAPLQFIAPFAGAALGEYFRDTGRHALVVYDDLSKQAVAYRQLSLLLRRPPGREAYPGDVFFLHSRLLERAAKITDDIEVAKKMNDLPDALRPMVQGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLESNLFNSGQRPAINVGISVSRVGGAAQIKAMKKVAGTLRLDLAQFRELEAFSKFGSDLDKTTKAQLDRGARLVEILKQGQYVPMPVERQVAIIFLGTQGLLDLVAVQHVKKFEEEFLAMLDLKHSDILKSIAETGALEADVAGRLKEAAQKFVTTF 520
>gi|71893406|ref|YP_278852.1| F0F1 ATP synthase subunit alpha [Mycoplasma hyopneumoniae J] (508 aa)
Score = 1322, Expect = 1.3e-143, Identities = 267/466 (57%), Positives = 345/466 (74%)
  Q:    11 IIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKTILETIDQ 476
           IIKN+I+ ++ K    +IG+VI VGDG+   SG+  V   ELV FEN   G+ LNLE    G+V++     + +GSIV+RTK+V+ + VGD LLGRV++A+G PIDG  E+    K  I   AP +M R SV   L+TG LAIDS+ PIGKGQRELIIGD+QTGKTTIAIDAI+NQKGK+V C+YV IGQKNS++ Q ++ L++ GALEYTT++ + AS+L  L YLAP++G  IAE WM+K +DVLIIYDDLSKHAIAYRTLSLLLRRPPGREA+PGDIFY HS LLERS +++ + GGGSITALPIIET+AGDISAYIPTNVISITDGQ+F+  +LFNSGQ+PAID GLSVSRVGS+AQ N +K  S SLKL LAQY EL AF+QFGSDL   ++ +L+ G K+ +++KQ+   P ++  + +LL  I+E  I  +    I  FK   +++   +    + I++
  S:    11 IIKNEIENFEGKIQNHDIGKVIIVGDGVALVSGIEKVKFGELVEFENNVLGIALNLEQDLIGVVIMASENSVFQGSIVRRTKSVISITVGDQLLGRVVNALGIPIDGKAELDNSLKSAIFTNAPSIMDRKSVDRGLKTGILAIDSLVPIGKGQRELIIGDRQTGKTTIAIDAILNQKGKDVYCVYVAIGQKNSSVAQIVSLLEKKGALEYTTVILAGASELSPLQYLAPYSGAAIAEYWMNKKKDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAFPGDIFYQHSYLLERSAQLSNDKGGGSITALPIIETQAGDISAYIPTNVISITDGQIFLRDSLFNSGQKPAIDIGLSVSRVGSAAQTNLMKWASSSLKLNLAQYNELKAFAQFGSDLGPSSQLILDRGNKIYEILKQENQYPLTERQQIMLLILIRENLIDSLEQKSIPLFKSAFLKYCDSEPKFRDKIEK 476
>gi|170744670|ref|YP_001773325.1| ATP synthase F1, alpha subunit [Methylobacterium sp. 4-46] >gi|168198944|gb|ACA20891.1| ATP synthase F1, alpha subunit [Methylobacterium sp. 4-46] (509 aa)
Score = 1321, Expect = 1.3e-143, Identities = 257/499 (51%), Positives = 355/499 (71%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQK----GKNVK----CIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK-QQKTILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           M I   + S I+K QIK +  +A  +E+G+V++VGDGI +  GL NV   E+V FE+G  GM LNLE    G+V+ G   DIKEG  VKRT  +VDVPVG GLLGRV+DA+GNPIDG G I   ++  ++  APG++ R SV EP+ TG  ++D++ PIG+GQRELIIGD+QTGKT IA+D I+NQK    G + K    C+YV +GQK ST+ QF+  L+  GAL+Y+ ++A++ASD   + +LAPF+G  + E +   G   +IIYDDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+    G GS+TALP+IET+A D+SAYIPTNVISITDGQ+F+ T+LF  G RPA++ GLSVSRVGS+AQ  A+KK +G +K ELAQYRE+ AF+QFGSDLD  T+ +L  G ++ +L+KQ + +P     +  ++++    Y+  IPV+ +  F++ ++   + +   +LETI  +KD+  D   ++K    S   S+
  S:     1 MDIRAAEISAILKEQIKNFGQEAEVTEVGQVLSVGDGIARVYGLDNVQAGEMVEFESGVRGMALNLEQDNVGVVIFGVDRDIKEGQTVKRTGAIVDVPVGKGLLGRVVDALGNPIDGKGPIVSTERRRVDVKAPGIIPRKSVHEPMATGLKSVDALIPIGRGQRELIIGDRQTGKTAIALDTILNQKPAHEGTDEKAKLYCVYVAVGQKRSTVAQFVKVLEDNGALDYSIVIAATASDPAPMQFLAPFSGCAMGEFFRDNGMHAVIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMGDAAGAGSLTALPVIETQANDVSAYIPTNVISITDGQIFLETDLFYQGVRPAVNVGLSVSRVGSAAQTKAMKKVAGKIKGELAQYREMAAFAQFGSDLDAATQRLLNRGSRLTELLKQPQFSPLKMEEQVAVIYAGVNGYLDAIPVNRVRAFEDGLLSTLRGRHADLLETIRTSKDLGDDAAAKLKGVVESFAKSF 508
>gi|67537828|ref|XP_662688.1| hypothetical protein AN5084.2 [Aspergillus nidulans FGSC A4] >gi|40740989|gb|EAA60179.1| hypothetical protein AN5084.2 [Aspergillus nidulans FGSC A4] (668 aa)
Score = 1321, Expect = 1.3e-143, Identities = 253/483 (52%), Positives = 351/483 (72%)
  Q:     7 KFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQK--------GKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQ-QKTILETIDQTKDISQDLFVQIK 489
           + S++++ +I+  +     +E G V++V DGIV+A GL+NV   ELV FE+G  GM +NLE+   GIV+ G    +K+   V RT  +VDVPVG  +LGRV+DA+GNPIDG G I+  ++   +  APG++ R SV +P++TG  AID+M PIG+GQRELIIGD+QTGKT IA+D I+NQK         K + C+YV +GQK ST+ Q + TL++  A++Y+ +VA++AS+   L Y+APF G  + E +   G   +IIYDDLSKHA+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+N ++GGGS+TALPIIET+ GD+SAYIPTNVISITDGQ+++ + LFN G RPAI+ GLSVSRVGS+AQ+ A+K+ +GSLKL LAQYRE+ AFSQFGSDLD  TK+ L  G+ + +L+KQ +  P + +    LL++     I  IP+  I+ ++  ++ HFK  +  +L  I++   +S DL  +IK
  S:   166 EISSLLEQRIRGLKGSPNLAESGHVLSVCDGIVRARGLTNVQAEELVEFESGVKGMCMNLESNHVGIVLFGSDRLVKQSEPVWRTGEIVDVPVGPKMLGRVVDALGNPIDGKGPIETTERSRAQIKAPGILPRRSVNQPVQTGLKAIDAMVPIGRGQRELIIGDRQTGKTAIALDTILNQKIWNKSDDESKKLYCVYVAVGQKRSTVAQLVKTLEENDAMKYSIVVAATASEAAPLQYIAPFAGCAMGEWFRDHGRHAIIIYDDLSKHAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNDKHGGGSLTALPIIETQGGDVSAYIPTNVISITDGQIYLESELFNRGIRPAINVGLSVSRVGSAAQVRAMKQVAGSLKLYLAQYREIAAFSQFGSDLDAATKQTLRRGEHLTELLKQKQYAPMAVNEMVPLLYAGINGLIDRIPIGQIQSWEADVLAHFKSYEPEVLAQIEKDGKLSHDLEARIK 657
>gi|148886605|sp|Q4AAV9|ATPA_MYCHJ ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|144227444|gb|AAZ44141.2| ATP synthase alpha chain [Mycoplasma hyopneumoniae J] (507 aa)
Score = 1321, Expect = 1.3e-143, Identities = 267/466 (57%), Positives = 345/466 (74%)
  Q:    11 IIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKTILETIDQ 476
           IIKN+I+ ++ K    +IG+VI VGDG+   SG+  V   ELV FEN   G+ LNLE    G+V++     + +GSIV+RTK+V+ + VGD LLGRV++A+G PIDG  E+    K  I   AP +M R SV   L+TG LAIDS+ PIGKGQRELIIGD+QTGKTTIAIDAI+NQKGK+V C+YV IGQKNS++ Q ++ L++ GALEYTT++ + AS+L  L YLAP++G  IAE WM+K +DVLIIYDDLSKHAIAYRTLSLLLRRPPGREA+PGDIFY HS LLERS +++ + GGGSITALPIIET+AGDISAYIPTNVISITDGQ+F+  +LFNSGQ+PAID GLSVSRVGS+AQ N +K  S SLKL LAQY EL AF+QFGSDL   ++ +L+ G K+ +++KQ+   P ++  + +LL  I+E  I  +    I  FK   +++   +    + I++
  S:    10 IIKNEIENFEGKIQNHDIGKVIIVGDGVALVSGIEKVKFGELVEFENNVLGIALNLEQDLIGVVIMASENSVFQGSIVRRTKSVISITVGDQLLGRVVNALGIPIDGKAELDNSLKSAIFTNAPSIMDRKSVDRGLKTGILAIDSLVPIGKGQRELIIGDRQTGKTTIAIDAILNQKGKDVYCVYVAIGQKNSSVAQIVSLLEKKGALEYTTVILAGASELSPLQYLAPYSGAAIAEYWMNKKKDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAFPGDIFYQHSYLLERSAQLSNDKGGGSITALPIIETQAGDISAYIPTNVISITDGQIFLRDSLFNSGQKPAIDIGLSVSRVGSAAQTNLMKWASSSLKLNLAQYNELKAFAQFGSDLGPSSQLILDRGNKIYEILKQENQYPLTERQQIMLLILIRENLIDSLEQKSIPLFKSAFLKYCDSEPKFRDKIEK 475
>gi|186684957|ref|YP_001868153.1| ATP synthase F1, alpha subunit [Nostoc punctiforme PCC 73102] >gi|186467409|gb|ACC83210.1| ATP synthase F1, alpha subunit [Nostoc punctiforme PCC 73102] (506 aa)
Score = 1321, Expect = 1.4e-143, Identities = 257/469 (54%), Positives = 351/469 (74%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKT 469
           +SI  D+ S+II+ QI++Y  +   + +G V+ VGDGI +  GL   M  EL+ FE+G+ G+  NLE    G V++G+  +I+EGS V  T  +  +PVG+ L+GRV+DA+G PIDG G+IK  +   IE  APG++AR SV EP++TG  AIDSM PIG+GQRELIIGD+QTGKT IAID IINQK ++V C+YV IGQK ST+   + TL++ GA++YT +VA+SAS+  +L YLAP+TG TIAE +M KG+  L+IYDDLSK A AYR +SLLLRRPPGREAYPGD+FY+HSRLLER+ K++ E G GS+TALPIIET+AGD+SAYIPTNVISITDGQ+F+ ++LFN+G RPA++ G+SVSRVGS+AQ  A+KK +G +KLELAQ+ +L AF+QF SDLDK T++ L  G+++ +L+KQ +N+P S   +  +L++    Y+  +PVD +  F + +  + K  KT
  S:     3 ISIRPDEISSIIQQQIEQYDQEVKVANVGTVLQVGDGIARIYGLEKAMAGELLEFEDGTIGIAQNLEEDNVGAVLMGEGLEIQEGSSVTATGRIAQIPVGEALIGRVVDALGRPIDGKGDIKSSESRLIESPAPGIIARRSVHEPMQTGITAIDSMIPIGRGQRELIIGDRQTGKTAIAIDTIINQKEEDVICVYVAIGQKASTVANVVQTLQEKGAMDYTIVVAASASEPATLQYLAPYTGATIAEYFMYKGKATLVIYDDLSKQAQAYRQMSLLLRRPPGREAYPGDVFYIHSRLLERAAKLSDELGKGSMTALPIIETQAGDVSAYIPTNVISITDGQIFLSSDLFNAGIRPAVNPGISVSRVGSAAQTKAMKKVAGKIKLELAQFDDLQAFAQFASDLDKATQDQLARGQRLRELLKQPQNSPLSVYEQVAILYAGINGYLDDVPVDKVTSFTQGLREYLKTGKT 471
>gi|157363031|ref|YP_001469798.1| F0F1 ATP synthase subunit alpha [Thermotoga lettingae TMO] >gi|166990364|sp|A8F3K0|ATPA_THELT ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|157313635|gb|ABV32734.1| ATP synthase F1, alpha subunit [Thermotoga lettingae TMO] (503 aa)
Score = 1321, Expect = 1.4e-143, Identities = 248/499 (49%), Positives = 362/499 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLF-ENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQK-TILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           M I+  + + +++++IKE++ +    E GRV+ +GDGI +  GL++VM +ELV F E G  G+  NLE    G+++LG +  IKEG IVKR K +++VPVG+ LLGRV++ +G P+DG G ++      IE  APGV+ R  V  PL+TG  AID+M PIG+GQRELIIGD+QTGKT IAID IINQKGK V CIYV IGQK + + + ++ L++FGA+EYTT+V +SASD   + Y+AP+ G  + E +M   +D L++YDDLSKHA AYR LSLLLRRPPGREAYPGDIFYLHSRLLER+ +++ + GGGS+TALPI+ET+A D+SAYIPTNVISITDGQ+++   LF SG RPAI+ GLSVSRVG SAQI A+K+ +G L+++LAQ+REL+ F+QF S+LD  T+  +  G+ + +L+KQD+ +P     + ++L++    Y+  +PV+ +  F+++ + + +  K ++L+ I + K+++Q++  ++K      +  +
  S:     1 MRISPGEITKVLEDRIKEFKEEIDLQETGRVVQIGDGIARVYGLNSVMADELVEFVETGVKGLAFNLEEDNVGVILLGPYSQIKEGHIVKRLKKIIEVPVGEELLGRVVNPLGEPLDGLGPVEAKHTRKIEIKAPGVIYRRPVNTPLQTGIKAIDAMIPIGRGQRELIIGDRQTGKTAIAIDTIINQKGKGVYCIYVAIGQKTAAVARIVDKLREFGAMEYTTVVVASASDPAPIQYIAPYAGCAMGEYFMYNSKDALVVYDDLSKHAAAYRQLSLLLRRPPGREAYPGDIFYLHSRLLERAARLDDKMGGGSLTALPIVETQANDVSAYIPTNVISITDGQIYLEPGLFYSGFRPAINVGLSVSRVGGSAQIRAMKQVAGMLRIDLAQFRELETFAQFASELDPATRAQIVRGQHLQELLKQDQYSPLPVEEQVVVLYAGVRGYLDELPVESVRKFEKEFLDYMRTSKSSLLKLISEKKELTQEVEDELKKSIQEFLEGW 501
>gi|149913694|ref|ZP_01902227.1| F0F1 ATP synthase subunit alpha [Roseobacter sp. AzwK-3b] >gi|149812814|gb|EDM72643.1| F0F1 ATP synthase subunit alpha [Roseobacter sp. AzwK-3b] (512 aa)
Score = 1321, Expect = 1.4e-143, Identities = 251/467 (53%), Positives = 342/467 (73%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKG----------KNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQ 467
           M I   + S I+K+QIK +  +A  +E+GRV++VGDGI +  GL NV   ELV F  G  GM LNLE    GIV+ G   +I EG  VKRTK++VDVP+GD LLGRV+D +GNP+DG G IK   +   +  APG++ R SV EP+ TG  ++D+M PIG+GQRELIIGD+QTGKT +A+D I+NQK           K + C+YV IGQK ST+ Q +  L++ GA++Y+ IVA++ASD   + +LAP+    +AE +   G   LI+YDDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLERS K+N++NG GS+TALPIIET+ GD+SA+IPTNVISITDGQ+F+ T LF  G RPA++ GLSVSRVGSSAQ NA+K  +G +KLELAQYRE+ AF+QFGSDLD  T+++L  G ++ +L+KQ + +P + +    ++++  + Y+  I VD +  F++ ++ H + +
  S:     1 MGIQAAEISAILKDQIKNFGQEAEVAEVGRVLSVGDGIARVHGLDNVQAGELVEFPGGVMGMALNLETDNVGIVIFGSDREIGEGDTVKRTKSIVDVPIGDELLGRVVDGLGNPLDGKGPIKTKNRGIADSKAPGIIPRKSVHEPMATGLKSVDAMIPIGRGQRELIIGDRQTGKTAVALDTILNQKSYNDAAGDDESKKLYCVYVAIGQKRSTVAQLVKKLEESGAIDYSIIVAATASDPAPMQFLAPYAATAMAEHFRDNGRHALIVYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERSAKLNEDNGSGSLTALPIIETQGGDVSAFIPTNVISITDGQIFLETELFYQGIRPAVNTGLSVSRVGSSAQTNAMKSVAGPVKLELAQYREMAAFAQFGSDLDAATQQLLNRGARLTELMKQPQYSPLTNAEIVCVIYAGTKGYLDKIAVDQVGRFEQGLLNHLRSK 477
>gi|18075724|emb|CAD11280.1| ATP synthase F1, subunit alpha [Helicobacter pylori] (503 aa)
Score = 1321, Expect = 1.5e-143, Identities = 251/497 (50%), Positives = 369/497 (74%)
  Q:     3 INLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQK--TILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           + L++ S++I+ +IK ++     +E+G+V++  DG+ +  GL+ V+  E++ FE G  G+  NLE  + G+++ G   +IKEG+ VKRTK+++ VPVGD ++GRV++A+G PIDG GEI+ ++   IE+ APG+M R SV EPL+TG  AID++ PIG+GQRELIIGDKQTGKTT+AIDAIINQKG+NV CIYV IGQK ST+ Q +  L+++GA+EY+ ++ +SASD  ++ YLAP++G+ + E +       LIIYDDLSKHA+AYR +SL+LRRPPGREA+PGD+FY+HSRLLER+ K+  E G GS+TALPI+ET+AGD+SAYIPTN+ISITDGQ+F+ T+LF SG RPAI+ GLSVSRVG +AQI A K+ SG+L+L+LAQYREL AF+QF SDLD+ +K+ LE G+++++++KQ   +P     + +++++  + ++  + V  + DF+E+ +  F + K   +LE I   K + +DL   ++        +Y
  S:     4 LKLEEISSVIEEKIKNFELDCDMAEVGKVVSYADGVAKVYGLNGVISYEVLEFETGDKGVAANLEEDSVGVIVFGFGNNIKEGTSVKRTKSLMKVPVGDAVVGRVLNALGEPIDGKGEIETNEFSLIEQKAPGIMDRKSVHEPLQTGIKAIDALVPIGRGQRELIIGDKQTGKTTVAIDAIINQKGQNVICIYVAIGQKESTVAQVVRKLEEYGAMEYSVVINASASDSAAMQYLAPYSGVAMGEYFRDHARHALIIYDDLSKHAVAYREISLVLRRPPGREAFPGDVFYIHSRLLERAAKLCDEKGAGSLTALPIVETQAGDVSAYIPTNIISITDGQIFLETDLFYSGIRPAINVGLSVSRVGGAAQIKATKQVSGTLRLDLAQYRELQAFTQFASDLDEASKKQLERGQRMVEVLKQAPYSPLPIEKQVVIIYAGAKGFLDSVSVKKVVDFEEQ-LHPFLEAKYPQVLEEIHTKKALDKDLEAMLRKVLEEFKLTY 501
>gi|171696284|ref|XP_001913066.1| unnamed protein product [Podospora anserina] >gi|170948384|emb|CAP60548.1| unnamed protein product [Podospora anserina] (549 aa)
Score = 1320, Expect = 1.7e-143, Identities = 255/492 (51%), Positives = 360/492 (73%)
  Q:     9 SNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQK--------GKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK-QQKTILETIDQTKDISQDLFVQIKNEFNSLITSYI 500
           S+I++ +I+  Q ++  +E GRV++VGDGI +  G++NV   ELV F +G  GM +NLEA   G+V+ G    +KEG  VKRT  +VDVPVG  LLGRV+DA+GNPIDG G I   +K   +  APG++ R SV +P++TG  +ID+M PIG+GQRELIIGD+QTGKT +A+DA++NQK         K + CIYV +GQK ST+ Q + TL++  A++Y+ +VA++AS+   L YLAPFTG +I E +   G+  L+I+DDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+N ++GGGS+TALP+IET+ GD+SAYIPTNVISITDGQ+F+   LF  G RPAI+ GLSVSRVGS+AQ+ A+K+ +GSLKL LAQYRE+ AF+QFGSDLD  TK+ L  G+++ +L+KQ + +P + +    L+F+    ++  +PV  I  ++   + H K  +  +L TI++   IS+DL  ++K+  ++    ++
  S:    48 SSILEQRIRGVQEESNLAETGRVLSVGDGIARVHGMANVQAEELVEFASGVKGMCMNLEAGQVGVVLFGSDRLVKEGETVKRTGEIVDVPVGPELLGRVVDALGNPIDGKGPINTKEKRRAQLKAPGILPRKSVNQPVQTGLKSIDAMVPIGRGQRELIIGDRQTGKTAVALDAMLNQKRWNSGNDETKKLYCIYVAVGQKRSTVAQLVKTLEENDAMKYSIVVAATASEAAPLQYLAPFTGASIGEWFRDNGKHSLVIFDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDKHGGGSMTALPVIETQGGDVSAYIPTNVISITDGQIFLEAELFYKGIRPAINVGLSVSRVGSAAQLKAMKQVAGSLKLFLAQYREVAAFAQFGSDLDAATKQTLNRGERLTELLKQKQYSPMAVNEMVPLIFAGVNGFLDQVPVAKILQWEADFLSHLKTNEADLLATIEKEGAISKDLEARLKDVISTFTKGFL 548
>gi|156849119|ref|XP_001647440.1| hypothetical protein Kpol_1018p115 [Vanderwaltozyma polyspora DSM 70294] >gi|156118126|gb|EDO19582.1| hypothetical protein Kpol_1018p115 [Vanderwaltozyma polyspora DSM 70294] (546 aa)
Score = 1320, Expect = 1.8e-143, Identities = 258/491 (52%), Positives = 352/491 (71%)
  Q:     9 SNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQK--------GKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK-QQKTILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           S+I++ +I+    +A   E GRV+ VGDGI +  GL+N+   ELV F +G  GM LNLE    GIV+ G    +KEG IVKRT  +VDVPVG GLLGRV+DA+GNPIDG G IK       +  APG++ R SV EP++TG  A+D++ PIG+GQRELIIGD+QTGKT +A+DAI+NQK         K + C+YV IGQK ST+ Q + TL+Q  AL+Y+ IVA++AS+   L YLAPFT  +I E +   G   LI+YDDLSK A+AYR LSLLLRRPPGREAYPGD+FYLHSRLLER+ K++ + GGGS+TALP+IET+ GD+SAYIPTNVISITDGQ+F+   LF  G RPAI+ GLSVSRVGS+AQ+ A+K+ +GSLKL LAQYRE+ AF+QFGSDLD  TK+ L  G+++ +L+KQ + +P +   +  L+++    Y+  + +  + +F+   + + K   + IL TI    +++++L   +K    S ++++
  S:    47 SSILEERIRGVSEEANLDETGRVLAVGDGIARVFGLNNIQAEELVEFSSGVKGMALNLEPGQVGIVLFGSDRLVKEGEIVKRTGKIVDVPVGPGLLGRVVDALGNPIDGKGPIKAAGYTRAQVKAPGILPRRSVHEPVQTGLKAVDALVPIGRGQRELIIGDRQTGKTAVALDAILNQKRWNSGSDEKKKLYCVYVAIGQKRSTVAQLVQTLEQHDALKYSIIVAATASEAAPLQYLAPFTAASIGEWFRDNGRHSLIVYDDLSKQAVAYRQLSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDKEGGGSMTALPVIETQGGDVSAYIPTNVISITDGQIFLEAELFYKGIRPAINVGLSVSRVGSAAQVKALKQVAGSLKLFLAQYREVAAFAQFGSDLDASTKQTLVRGERLTQLLKQSQYSPLAAEEQVPLIYAGVNGYLDNVELSRVGEFEAAFLAYLKSNHQEILNTIRDKGELNKELLASLKTATESFVSTF 546
>gi|114524|sp|P05439|ATPA_RHOBL ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|45977|emb|CAA77313.1| ATPase alpha subunit [Rhodobacter blasticus] (512 aa)
Score = 1320, Expect = 2.0e-143, Identities = 260/499 (52%), Positives = 354/499 (70%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQK----------GKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQ-KTILETIDQT-KDISQDLFVQIKNEFNSLITSY 499
           M I   + S I+K QIK +   A  +E+GRV++VGDGI +  GL NV   E+V F  G  GM LNLE    GIV+ G   DIKEG  VKRTK++VDVP G+GLLGRV+DA+GNPIDG G I   ++   +  APG++ R  V EP+ TG  A+D+M PIG+GQRELIIGD+QTGKT +A+D I+NQK           K + C+YV IGQK ST+ Q +  L++ GA+ YT +VA++ASD   + +LAPF+G  I E +   G   L+IYDDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLERS K+N + G GS+TALPIIET+AGDISAYIPTNVISITDGQ+F+ + LF  G RPA++ GLSVSRVGSSAQ +A+K  +G +KLELAQYRE+ AF+QFGSDLD  T+ +L  G ++ +L+KQ + +P + +    ++F+    Y+  + V  +  F+  +++H + + K +L+ + +  + ++ DL   I+ E ++    +
  S:     1 MGIQAAEISAILKEQIKNFGKDAEVAEVGRVLSVGDGIARVYGLDNVQAGEMVEFPGGIRGMALNLEVDNVGIVIFGDDRDIKEGDTVKRTKSIVDVPAGNGLLGRVVDALGNPIDGKGPIVASERRIADVKAPGIIPRKGVHEPMATGLKAVDAMIPIGRGQRELIIGDRQTGKTAVALDTILNQKVYNDAAGDDESKKLYCVYVAIGQKRSTVAQLVKKLEETGAMAYTVVVAATASDPAPMQFLAPFSGTAIGEFFRDNGRHALMIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERSAKMNGDFGAGSLTALPIIETQAGDISAYIPTNVISITDGQIFLESELFYQGIRPAVNTGLSVSRVGSSAQTSAMKSVAGKVKLELAQYREMAAFAQFGSDLDASTQALLNRGARLTELMKQPQYSPLTNAEIVCIIFAGTNGYLDKVAVRDVGRFEAGLLKHLRTKGKALLDDMTKNDRKVAGDLEKAIRAELDAFAKDF 511
>gi|85858475|ref|YP_460677.1| F0F1 ATP synthase subunit alpha [Syntrophus aciditrophicus SB] >gi|124007204|sp|Q2LQZ7|ATPA1_SYNAS ATP synthase subunit alpha 1 (ATPase subunit alpha 1) (ATP synthase F1 sector subunit alpha 1) >gi|85721566|gb|ABC76509.1| ATP synthase alpha chain [Syntrophus aciditrophicus SB] (504 aa)
Score = 1320, Expect = 2.2e-143, Identities = 264/499 (52%), Positives = 356/499 (71%)
  Q:     2 SINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK-QQKTILETIDQTKDISQDLFVQIKNEFNSLITSYI 500
           +I  ++ S II  QI++Y+ K   SE G V++VGDGI +  G+ N M  EL+ F  G  GM LNLEA   G+ +LG    IKEG IVKRT  +  +PVG+ LLGRVIDA G PIDG G +   +   IE IAPGV+ R  V EP+ TG  AID+M PIG+GQRELIIGD+Q GKT I IDAII QK   VKCIYV IGQK ST+ Q +  L++  A+ YT +VA  ASD  +L Y+A + G +I E +  +G+D LIIYDDLSK A+AYR +SLLLRRPPGREAYPGDIFY HSRLLERS +++ + GGGS+TALPIIET+AGD+SAYIPTNVISITDGQ+++  +LF SG RPAI+ GLSVSRVG +AQ+ A+K+ +G+LKL+LAQYREL +F+QFGSDLDK T+  L+ G ++++++KQ +  P S + E I+LF+    ++    V+ I++++ +++ + K + + I++ ID  K IS +L  +IK    +  + ++
  S:     3 TIKAEEISQIISKQIRDYEKKLDVSETGTVLSVGDGIARIYGVENAMAMELLEFPGGIMGMVLNLEADNVGVAVLGDVTHIKEGDIVKRTGKIAQIPVGEALLGRVIDATGEPIDGKGPLGATEFSRIEMIAPGVIKRQPVNEPMYTGLKAIDAMTPIGRGQRELIIGDRQIGKTAIGIDAIIRQKDTGVKCIYVAIGQKKSTVSQIVENLRKHDAMSYTCVVAGCASDPATLQYIAAYAGCSIGEYFRDRGQDALIIYDDLSKQAVAYRQISLLLRRPPGREAYPGDIFYNHSRLLERSARVSADLGGGSLTALPIIETQAGDVSAYIPTNVISITDGQVYLEPSLFFSGIRPAINVGLSVSRVGGAAQVKAMKQVAGTLKLDLAQYRELASFAQFGSDLDKATQAQLDRGVRLVEILKQPQFQPMSLAEEVIVLFAGTRGFLDKYEVEKIKEYEPQVLAYMKSKHQDIMQEIDDKKVISPELEQKIKEALTAFDSVFV 502
>gi|42525220|ref|NP_970600.1| F0F1 ATP synthase subunit alpha [Bdellovibrio bacteriovorus HD100] >gi|81697715|sp|Q6MGM5|ATPA_BDEBA ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|39577431|emb|CAE81254.1| ATP synthase F1, alpha subunit [Bdellovibrio bacteriovorus HD100] (507 aa)
Score = 1319, Expect = 2.3e-143, Identities = 257/481 (53%), Positives = 346/481 (71%)
  Q:     3 INLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKT-ILETIDQTKDISQD 483
           I  D+ S ++K QI +Y  K   SE G V++VGDG+ +  GL N M  ELV F    +GM LNLE    G V+ G+   IKEG +VKRTK +V VPVG+ LLGRV+DA+GNPIDG G I       +E  APG++ R  V EPL+TG  AID++ PIG+GQRELIIGD+QTGKTTIA+D IINQKG NV+C YV IGQK ST+   +  L+  GALEYTT++A++ASD   L YLA ++G  +AE +   G   LI+YDDL+K A AYR LSLLLRRPPGREAYPGD+FY HSRLLER+ K++ + GGGS+TALPIIET+AGDISAYIPTNVISITDGQ+F+ ++LF  G RPAI  G SVSRVG +AQI A+K+ +GSLKLELAQ+R ++AF+ F SDLDK +++ L  G+++++++KQ + +P     + I++F+    ++   P   ++ +++++I   K + + I++TI + K I+ D
  S:     5 IRADEISRVLKEQINQYNKKIEVSETGSVLSVGDGVARIYGLENAMAGELVEFPGEVFGMVLNLEEGYVGAVLFGEDRHIKEGDVVKRTKKIVSVPVGEALLGRVVDALGNPIDGRGAINTPHSRIVETKAPGIVYRHPVEEPLQTGIKAIDALVPIGRGQRELIIGDRQTGKTTIAVDTIINQKGLNVQCFYVAIGQKQSTVALVVEKLRAAGALEYTTVIAANASDPAPLQYLAAYSGTAMAEYFRDTGRHALIVYDDLTKQAQAYRQLSLLLRRPPGREAYPGDVFYCHSRLLERASKLSADKGGGSLTALPIIETQAGDISAYIPTNVISITDGQIFLESDLFYKGVRPAISVGKSVSRVGGAAQIKAMKQVAGSLKLELAQFRSMEAFAAFASDLDKASQQQLARGRRLIEVLKQPQYSPVKVEEQIIMIFAAGNAFVDQYPETDVKRYEKEMIEFLKNKHSDIIKTISEKKAIADD 486
>gi|121719882|ref|XP_001276639.1| mitochondrial F1 ATPase subunit alpha, putative [Aspergillus clavatus NRRL 1] >gi|119404851|gb|EAW15213.1| mitochondrial F1 ATPase subunit alpha, putative [Aspergillus clavatus NRRL 1] (557 aa)
Score = 1319, Expect = 2.5e-143, Identities = 257/491 (52%), Positives = 352/491 (71%)
  Q:     9 SNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQK---------GKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK-QQKTILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           S+I++ +I+    +A  +E GRV++VGDGI +  G++NV   ELV F +G  GM +NLEA   G+V+ G    +KEG  VKRT  +VDVPVG  LLGRV+DA+GNPIDG G I    K   +  APG++ R SV +P++TG   +D+M PIG+GQRELIIGD+QTGKT +A+D ++NQK          K + CIYV +GQK ST+ Q + TL++  A++Y+ +VA++AS+   L YLAPFTG  + E +   G   +I YDDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+N ++GGGS+TALP+IET+ GD+SAYIPTNVISITDGQ+F+   LF  G RPAI+ GLSVSRVGS+AQ+ A+K+ +GSLKL LAQYRE+ AF+QFGSDLD  TK+ L  G+++ +L+KQ + +P + S    L+F+    Y+  IPV+ I  ++   +   K  Q  IL+TID+   IS++L  +I+    +   S+
  S:    55 SSILEQRIRGVHEEAGLAETGRVLSVGDGIARVHGMTNVQAEELVEFASGVKGMCMNLEAGQVGVVLFGSDRLVKEGETVKRTGEIVDVPVGPELLGRVVDALGNPIDGKGPINTKAKSRAQLKAPGILPRRSVNQPVQTGLKCVDAMVPIGRGQRELIIGDRQTGKTAVALDTMLNQKRWNDSAVDESKKLYCIYVAVGQKRSTVAQLVQTLEENDAMKYSIVVAATASEAAPLQYLAPFTGCAMGEWFRDNGRHAVITYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDKHGGGSLTALPVIETQGGDVSAYIPTNVISITDGQIFLEAELFYKGIRPAINVGLSVSRVGSAAQVKAMKQVAGSLKLFLAQYREVAAFAQFGSDLDASTKQTLARGERLTELLKQKQYSPMAVSDMVPLIFAGVNGYLDGIPVNKILQWESDFLASLKTNQPEILQTIDKEGQISKELETKIRETIEAFNASF 555
>gi|156845989|ref|XP_001645883.1| hypothetical protein Kpol_1045p9 [Vanderwaltozyma polyspora DSM 70294] >gi|156116553|gb|EDO18025.1| hypothetical protein Kpol_1045p9 [Vanderwaltozyma polyspora DSM 70294] (544 aa)
Score = 1319, Expect = 2.6e-143, Identities = 258/491 (52%), Positives = 351/491 (71%)
  Q:     9 SNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQK--------GKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQK-TILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           S+I++ +I+    +A   E GRV+ VGDGI +  GL+N+   ELV F +G  GM LNLE    GIV+ G    +KEG IVKRT  +VDVPVG GLLGRV+DA+GNPIDG G IK       +  APG++ R SV EP++TG  A+D++ PIG+GQRELIIGD+QTGKT +A+DAI+NQK         K + C+YV IGQK ST+ Q + TL+Q  AL+Y+ IVA++AS+   L YLAPFT  +I E +   G   LI+YDDLSK A+AYR LSLLLRRPPGREAYPGD+FYLHSRLLER+ K++ + GGGS+TALP+IET+ GD+SAYIPTNVISITDGQ+F+   LF  G RPAI+ GLSVSRVGS+AQ+ A+K+ +GSLKL LAQYRE+ AF+QFGSDLD  TK+ L  G+++ +L+KQ + +P +   +  L+++    Y+  + +  + +F+   + + K     IL TI    +++++L   +K+   S + ++
  S:    45 SSILEERIRGVSEEANLDETGRVLAVGDGIARVFGLNNIQAEELVEFSSGVKGMALNLEPGQVGIVLFGSDRLVKEGEIVKRTGKIVDVPVGPGLLGRVVDALGNPIDGKGPIKAAGYTRAQVKAPGILPRRSVHEPVQTGLKAVDALVPIGRGQRELIIGDRQTGKTAVALDAILNQKRWNSGSDEKKKLYCVYVAIGQKRSTVAQLVQTLEQHDALKYSIIVAATASEAAPLQYLAPFTAASIGEWFRDNGRHSLIVYDDLSKQAVAYRQLSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDKEGGGSMTALPVIETQGGDVSAYIPTNVISITDGQIFLEAELFYKGIRPAINVGLSVSRVGSAAQVKALKQVAGSLKLFLAQYREVAAFAQFGSDLDASTKQTLVRGERLTQLLKQSQYSPLAAEEQVPLIYAGVNGYLDNVELSRVGEFEAAFLAYLKSNHLEILNTIRDKGELTKELLASLKSATESFVATF 544
>gi|170747039|ref|YP_001753299.1| ATP synthase F1, alpha subunit [Methylobacterium radiotolerans JCM 2831] >gi|170653561|gb|ACB22616.1| ATP synthase F1, alpha subunit [Methylobacterium radiotolerans JCM 2831] (510 aa)
Score = 1319, Expect = 2.7e-143, Identities = 260/498 (52%), Positives = 359/498 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQK-----GKNVK----CIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK-QQKTILETIDQTKDISQDLFVQIKNEFNSLITS 498
           M I   + S I+K+QIK +  +A  SE+G+V++VGDGI +A GL NV   E+V FE+G  GM LNLE    GIV+ G   +IKEG  VKRT  +VDVPVG GLLGRV+DA+GNPIDG G I+  ++  ++  APG++ R SV EP+ TG  AID++ P+G+GQRELIIGD+QTGKT IA+D I+NQK     G + K    CIYV IGQK ST+ QF+  L+  GALEY+ ++A++ASD   + ++APF G  + E +   G   +I+YDDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+    G GS+TALP+IET+A D+SAYIPTNVISITDGQ+F+ T+LF  G RPA++ GLSVSRVGSSAQ  A+KK +G +K ELAQYRE+ AF+QFGSDLD  T+ +L  G ++ +L+KQ + +P     +  ++++    Y+  +PV  +  F++ ++   + + K +L++I  +KD+S +   ++K+   S+  S
  S:     1 MDIRAAEISAILKDQIKNFGEEAEVSEVGQVLSVGDGIARAYGLDNVQAGEMVEFESGVRGMALNLEQDNVGIVIFGSDREIKEGQTVKRTGAIVDVPVGKGLLGRVVDALGNPIDGKGPIQSTERRRVDVKAPGIIPRKSVHEPMATGLKAIDALIPVGRGQRELIIGDRQTGKTAIALDTILNQKPGHTAGGDEKAKLYCIYVAIGQKRSTVAQFVKVLEDQGALEYSIVIAATASDAAPMQFIAPFAGCAMGEYFRDNGMHAVIVYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMGDAAGAGSLTALPVIETQANDVSAYIPTNVISITDGQIFLETDLFYQGVRPAVNVGLSVSRVGSSAQTKAMKKVAGKIKGELAQYREMAAFAQFGSDLDASTQALLNRGSRLTELLKQPQFSPLKMEEQVAVIYAGVNGYLDKLPVTKVRAFEDSLLSTLRSKHKDLLDSIAASKDLSDENAGKLKSVVESVAKS 508
>gi|21674843|ref|NP_662908.1| F0F1 ATP synthase subunit alpha [Chlorobium tepidum TLS] >gi|81790591|sp|Q8KAW8|ATPA_CHLTE ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|21648064|gb|AAM73250.1| ATP synthase F1, alpha subunit [Chlorobium tepidum TLS] (526 aa)
Score = 1318, Expect = 2.9e-143, Identities = 257/498 (51%), Positives = 362/498 (72%)
  Q:     2 SINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKE------------------NGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQK-TILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           ++  D+ S+I++ Q+  ++++A   ++G V+ VGDGI +  GLS V   EL+ F +   GM LNLE    G V+ G+   +KEG  VKRT  +  +PVG+ +LGRVI+ +G PIDG G I  D ++P+E+ APGV+ R SV EPL+TG  AID+M PIG+GQRELIIGD+QTGKT +A+D IINQKGK V+CIYV IG K ST+ Q +NTL+++GA+EYTT+V+++ASD   L ++APF G TI E +   G   L++YDDLSK A+AYR LSLLLRRPPGREAYPGD+FYLHSRLLER+ KI  +                   GGGS+TALP+IET+AGD+SAYIPTNVISITDGQ+F+ +NLFN+GQRPAI+ G+SVSRVG +AQI A+KK +G+L+L+LAQ+REL+AFS+FGSDLDK TK  L+ G ++++++KQ +  P     +  ++F   +  +  + +  +  F+E+ +   +Q+   IL +I +   +  D+  ++K      + S+
  S:     4 AVRPDEVSSILRKQLAGFESEADVYDVGTVLQVGDGIARIYGLSKVAAGELLEFPHNVMGMALNLEEDNVGAVLFGESNAVKEGDTVKRTNILASIPVGEAMLGRVINPLGEPIDGKGPINTDIRLPLERRAPGVIFRKSVHEPLQTGLKAIDAMIPIGRGQRELIIGDRQTGKTAVALDTIINQKGKGVQCIYVAIGLKGSTVAQVVNTLEKYGAMEYTTVVSATASDPAPLQFIAPFAGATIGEFFRDTGRHALVVYDDLSKQAVAYRQLSLLLRRPPGREAYPGDVFYLHSRLLERAAKITDDIEVAKKMNDLPEPLKPLVKGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLESNLFNAGQRPAINVGISVSRVGGAAQIKAMKKVAGTLRLDLAQFRELEAFSKFGSDLDKSTKAQLDRGARLVEILKQGQYIPMPVEKQVAIIFIGTQGLLDSVDLKQVRRFEEEFLAMLEQKHPEILSSIAEKGTLESDIASKLKELGEKYVASF 520
>gi|134102718|ref|YP_001108379.1| F0F1 ATP synthase subunit alpha [Saccharopolyspora erythraea NRRL 2338] >gi|158513552|sp|A4FN29|ATPA_SACEN ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|133915341|emb|CAM05454.1| ATP synthase alpha chain [Saccharopolyspora erythraea NRRL 2338] (548 aa)
Score = 1318, Expect = 3.0e-143, Identities = 258/483 (53%), Positives = 349/483 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKG--------KNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQ-QKTILETIDQTKDISQD 483
           ++I+ D+  + I+  +  Y  +    E+G V + GDGI    GL +VM  EL+ F  G YG+ +NLEA   G V+LG+ + I+EG  V+RT  V+ VPVGD  LGRV++ +G PIDG GEI  ++   +E  A  V+ R  V EP++TG  AIDSM PIG+GQR+L+IGD++TGKTT+A+D IINQKG        K V+CIYV IGQK STI     +L++ GALEYTTIVA+ ASD P L +LAP+ G  I + WM +G+ VLI++DDL+K A AYR +SLLLRRPPGREAYPGD+FYLHSRLLER  K++ E G GS+T LPIIET+A D+SAYIPTNVISITDGQ F+ ++LFNSGQRPAID G+SVSRVG SAQINA++K +GSLK++LAQ+REL+AFS F SDLD  +K  L+ G ++M+++KQ +  P     E + LF   + ++  +PV+ +  F+ + + H ++   T+L+ I +TK +S D
  S:     4 LTISSDEIRSAIEKYVSSYSPEVSREEVGVVTDTGDGIAHVEGLPSVMTEELLEFPGGIYGVAMNLEAQEVGAVILGESDKIEEGQEVRRTGKVLSVPVGDDFLGRVVNPLGEPIDGLGEITAEENRALELQAATVVQRQGVSEPMQTGIKAIDSMTPIGRGQRQLLIGDRKTGKTTVAVDTIINQKGNWESGDPQKQVRCIYVAIGQKGSTIAGVKRSLEEAGALEYTTIVAAPASDSPGLKWLAPYAGSAIGQHWMYQGKHVLIVFDDLTKQAEAYRAISLLLRRPPGREAYPGDVFYLHSRLLERCAKLSDEMGAGSMTGLPIIETKANDVSAYIPTNVISITDGQCFLQSDLFNSGQRPAIDVGISVSRVGGSAQINAIRKVTGSLKIDLAQFRELEAFSAFASDLDATSKAQLDRGARLMEVLKQGQGEPLPVEEEVVSLFLGTKGHLDSVPVEDVRRFESEFLAHMRRTHDTVLKDIVETKKLSDD 495
>gi|172039401|ref|YP_001805902.1| ATP synthase F1, alpha subunit [Cyanothece sp. ATCC 51142] >gi|171700855|gb|ACB53836.1| ATP synthase F1, alpha subunit [Cyanothece sp. ATCC 51142] (503 aa)
Score = 1318, Expect = 3.2e-143, Identities = 260/498 (52%), Positives = 360/498 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDF----KEKIIRHFKQQKTILETIDQTKDISQDLFVQIKNEFNSLITS 498
           +SI  D+ S+II+ QI+ Y      S +G V+ VGDG  +  GL   M  EL+ FE+G+ G+ LNLE    G V++G    I+EGS V+ T  +  VPVGD ++GRV+D++G PIDG G+I   +   IE  APG++AR SVCEP++TG  AID+M PIG+GQRELIIGD++TGKT IAID IINQK ++V C+YV IGQK ST+ Q I TL++ GA++YT +VA++A+D  +L YLAP+TG T+AE +M  G+  L+IYDDLSK A AYR LSLLLRRPPGREAYPGD+FY+HSRLLER+ K++   GGGS+TALPIIET+AGD+SAYIPTNVISITDGQ+F+ ++LFN+G RPAI+AG+SVSRVGS+AQ  A+K+ +G LKLELAQ+ EL+AFSQF SDLD  T+  L  G+++ +++KQ +N+P +   +  + ++    YI  +PVD   +F    +E I     +   I+++  +  D ++ L  +  +E+    ++
  S:     2 VSIRPDEISSIIREQIESYDQSVQVSNVGTVLQVGDGTARIYGLEQCMAGELLEFEDGTIGIALNLEEDNVGAVLMGTGFGIQEGSSVQATGKIAQVPVGDAMIGRVVDSLGRPIDGKGDINTSESRLIESPAPGIIARKSVCEPMQTGITAIDAMIPIGRGQRELIIGDRKTGKTAIAIDTIINQKSEDVICVYVAIGQKASTVAQVIGTLEEKGAMDYTIVVAANANDPATLQYLAPYTGATLAEYFMYNGKATLVIYDDLSKQAQAYRQLSLLLRRPPGREAYPGDVFYIHSRLLERAAKLSDALGGGSMTALPIIETQAGDVSAYIPTNVISITDGQIFLSSDLFNAGFRPAINAGISVSRVGSAAQTKAMKQVAGKLKLELAQFAELEAFSQFASDLDAATQAQLARGQRLRQILKQPENSPLAVWEQVAVAYAGLNGYIDDVPVDKATEFAAGLREYIATSKPKYPEIIKSEKKLTDEAESLLKEAISEYKQAFSA 503
>gi|114328722|ref|YP_745879.1| F0F1 ATP synthase subunit alpha [Granulibacter bethesdensis CGDNIH1] >gi|122326326|sp|Q0BQE6|ATPA_GRABC ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|114316896|gb|ABI62956.1| ATP synthase alpha chain [Granulibacter bethesdensis CGDNIH1] (511 aa)
Score = 1318, Expect = 3.6e-143, Identities = 253/499 (50%), Positives = 359/499 (71%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFEN-GSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQK--------GKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK-QQKTILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           M I   + S I+K+QI  + ++A  +E G+V++VGDGI +  GL NVM  ELV F + G  GM LNLE    G+V+ G    I+EG  V RT+ +VDVPVG GLLGRV+DA+GNPIDG G +    +  +E  APG++ R SV EP++TG  ++D++ PIG+GQREL+IGD+QTGKTT+ +D  INQK         K + CIYV +GQK ST+ Q + TL++ GA+EY+ +VA++ASD   + +LAP+TG  + E +       +I YDDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+N  +G GS+TALP+IET+AGD+SAYIPTNVISITDGQ+F+ T LF  G RPA++ GLSVSRVGSSAQI A+K+ +GS+KLELAQYRE+ AF+QF SDLD  T+++L  G ++ +L+KQ + TP+   L+  ++F+  + Y+  IP D + +F+ +++   +  QK IL+ I   +++  +   ++++     + ++
  S:     1 MDIRPAEISEILKSQIASFDSEANVAETGQVLSVGDGIARVYGLQNVMAGELVEFPSAGLKGMALNLENDNVGVVIFGDDRQIREGDTVARTREIVDVPVGRGLLGRVVDALGNPIDGKGPLTDVTRTRVEVKAPGIIPRKSVHEPMQTGLKSVDALIPIGRGQRELVIGDRQTGKTTVILDTFINQKPINQGTDESKKLYCIYVAVGQKRSTVAQIVRTLEEQGAMEYSIVVAATASDPAPMQFLAPYTGCAMGEFFRDNAMHAVIAYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDAHGAGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFFKGIRPAVNVGLSVSRVGSSAQIKAMKQVAGSIKLELAQYREMAAFAQFASDLDASTQKLLARGARLTELLKQPQFTPYPVELQVAVIFAGVKGYLDAIPTDKVVEFERRLVAELRGAQKDILDAIRNDREVKSETEAKLRSFLEGFVKNF 509
>gi|15612127|ref|NP_223779.1| F0F1 ATP synthase subunit alpha [Helicobacter pylori J99] >gi|9910636|sp|Q9ZK79|ATPA_HELPJ ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|4155639|gb|AAD06627.1| ATP synthase F1, subunit alpha [Helicobacter pylori J99] (503 aa)
Score = 1318, Expect = 3.6e-143, Identities = 250/497 (50%), Positives = 367/497 (73%)
  Q:     3 INLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQK--TILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           + L++ S++I+ +IK ++     +E+G+V++  DG+ +  GL+ VM  E++ FE G  G+  NLE  + G+++ G   +IKEG+ VKRTK+++ VPVGD ++GRV++A+G PIDG GEI+ ++   IE+ APG+M R SV EPL+TG  AID++ PIG+GQRELIIGDKQTGKTT+AIDAIINQKG+NV CIYV IGQK ST+ Q +  L+++GA+EY+ ++ +SASD  ++ YLAP+ G+ + E +       LI+YDDLSKHA+AYR +S +LRRPPGREA+PGD+FY+HSRLLER+ K+  E G GS+TALPI+ET+AGD+SAYIPTN+ISITDGQ+F+ T+LF SG RPAI+ GLSVSRVG +AQI A K+ SG+L+L+LAQYREL AF+QF SDLD+ +K+ LE G+++++++KQ   +P     + +++++  + ++  + V  + DF+E+ +  F + K   +LE I   K + +DL   ++        +Y
  S:     4 LKLEEISSVIEEKIKNFELDCDMAEVGKVVSYADGVAKIYGLNGVMSYEVLEFETGDKGVAANLEEDSVGVIVFGFGNNIKEGTSVKRTKSLMKVPVGDAVVGRVLNALGEPIDGKGEIETNEFSLIEQKAPGIMDRKSVHEPLQTGIKAIDALVPIGRGQRELIIGDKQTGKTTVAIDAIINQKGQNVICIYVAIGQKESTVAQVVRKLEEYGAMEYSVVINASASDSAAMQYLAPYAGVAMGEYFRDHARHALIVYDDLSKHAVAYREISWILRRPPGREAFPGDVFYIHSRLLERAAKLCDEKGAGSLTALPIVETQAGDVSAYIPTNIISITDGQIFLETDLFYSGIRPAINVGLSVSRVGGAAQIKATKQVSGTLRLDLAQYRELQAFTQFASDLDEASKKQLERGQRMVEVLKQAPYSPLPIEKQVVIIYAGAKGFLDSVSVKKVVDFEEQ-LHPFLEAKYPQVLEEIHTKKVLDKDLEAMLRKVLEEFKLTY 501
>gi|86610100|ref|YP_478862.1| F0F1 ATP synthase subunit alpha [Synechococcus sp. JA-2-3B'a(2-13)] >gi|110832069|sp|Q2JIG0|ATPA_SYNJB ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|86558642|gb|ABD03599.1| ATP synthase F1, alpha subunit [Synechococcus sp. JA-2-3B'a(2-13)] (506 aa)
Score = 1318, Expect = 3.6e-143, Identities = 255/491 (51%), Positives = 360/491 (73%)
  Q:     2 SINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKII-----RHFKQQKTILET---IDQTKDISQDLFVQIKNEF 492
           +I  D+ S IIK QI++Y  +   S +G V+ VGDGI +  GL  VM +EL+ FE+G+ G+ LNLE    G V++G   +I+EGS VK T  +  +PVG+ LLGRV+D + NP+DG G I+  +   IE  APG++ R SV EPL+TG  AID++ PIG+GQRELIIGD+QTGKTT+A+D I+NQKG++V CIYV IGQK STI Q +  L + GA++Y+ +VA+ A     L +LAP+ G TIAE +M +G+  L++YDDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K++ + G GS+TALPI+ET+A D+SAYIPTNVISITDGQ+F+ ++LFN+G RPAI+ G+SVSRVGS+AQ  A+KK +GS+K+ELAQYR+L+AF+QF SDLD+ T++ L  G+++ +L+KQ + +P S   +  ++++    Y+  IPV+ +  FK+ ++      H K  + +L T    D+ ++I +    + K  F
  S:     3 TIRPDEISTIIKQQIEQYNQEMQVSNVGTVLQVGDGIARIYGLDKVMASELLEFEDGTTGIALNLEEDNIGAVLIGSGRNIQEGSTVKSTGKIASIPVGEALLGRVVDPLCNPLDGKGPIQCTESRLIESPAPGIVDRRSVYEPLQTGITAIDALIPIGRGQRELIIGDRQTGKTTVAVDTILNQKGQDVICIYVAIGQKQSTIAQVVGILTERGAMDYSIVVAAGADSPAPLQWLAPYCGATIAEYFMYQGKHTLVVYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSSQLGEGSMTALPIVETQANDVSAYIPTNVISITDGQIFLESDLFNAGIRPAINVGISVSRVGSAAQTKAMKKVAGSIKVELAQYRDLEAFAQFASDLDEATQKQLARGQRLQELLKQPQYSPLSLDQQVAIIYAGTRGYLDDIPVEKVSSFKQGLLAYLGTTHPKYGEIVLSTKQLTDEAEEILKTAITEFKQSF 501
>gi|191163785|ref|ZP_03025657.1| ATP synthase F1, alpha subunit [Geobacter sp. M21] >gi|190995230|gb|EDV70686.1| ATP synthase F1, alpha subunit [Geobacter sp. M21] (502 aa)
Score = 1318, Expect = 3.7e-143, Identities = 252/471 (53%), Positives = 343/471 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKTIL 471
           M I  ++ S II+ QIKEY  +   +E G +I++GDGI +  GL   M  EL+ F  G  GM LNLE    G  +LG+F +IKEG  VK T  +V+VPVG  L+GRV+DA+GNPIDG G I  D    +E  APG++ R SV +P++TG  AIDSM PIG+GQRELIIGD+QTGKT +AID IINQKG +V CIYV IGQK ST+ Q ++ LK+ GA++YT +VA++AS+   L ++AP+TG+T+ E +   G+  LIIYDDLSK A+AYR LSLLLRRPPGREAYPGD+FYLHSRLLER+ K++ + G GS+TALP+IET+AGD+SAYIPTNVISITDGQ+++ ++LF SG RPAI+ GLSVSRVG SAQ+ A+K+ +G+L+L LAQYRE+ AF+QFGSDLDK T+  L  G ++++++KQ +  P     + +++F+    ++   P+  +  ++ ++   F  +K  L
  S:     1 MEIKAEEISEIIRKQIKEYGTEVAVAETGTIISIGDGIARIHGLDKAMAGELLEFPGGITGMVLNLEEDNVGAAILGEFSEIKEGDSVKLTGKIVEVPVGPALIGRVVDAIGNPIDGLGPINTDTFGKVEVKAPGIVKRKSVHQPMQTGLKAIDSMVPIGRGQRELIIGDRQTGKTAVAIDTIINQKGGDVVCIYVAIGQKRSTVAQVVSKLKEHGAMDYTIVVAATASEPAPLQFIAPYTGVTMGEFFRDSGKHALIIYDDLSKQAVAYRQLSLLLRRPPGREAYPGDVFYLHSRLLERACKVSDDCGAGSLTALPVIETQAGDVSAYIPTNVISITDGQIYLESDLFYSGVRPAINVGLSVSRVGGSAQVKAMKQVAGTLRLALAQYREMAAFAQFGSDLDKATQMQLARGARLVEILKQPQYRPIPNEKQVLIIFAANNGFVDEYPIGSLGRYETELYAFFDSRKATL 471
>gi|45200825|ref|NP_986395.1| AGL272Cp [Ashbya gossypii ATCC 10895] >gi|44985523|gb|AAS54219.1| AGL272Cp [Ashbya gossypii ATCC 10895] (547 aa)
Score = 1317, Expect = 3.8e-143, Identities = 254/491 (51%), Positives = 356/491 (72%)
  Q:     9 SNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQK--------GKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK-QQKTILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           S+I++ +I+    +A  +E GRV++VGDGI +  GL+NV   ELV F +G  GM LNLE    GIV+ G    +KEG +VKRT  +VDVPVG  +LGRV+DA+GNPIDG G IK       +  APG++ R SV EP++TG  A+D++ PIG+GQRELIIGD+QTGKT +A+D I+NQK         K + C+YV +GQK ST+ Q + TL+Q  A++Y+ IVA++AS+   L Y+APFT   I E +   G+  LI+YDDLSK A+AYR LSLLLRRPPGREAYPGD+FYLHSRLLER+ K++++NGGGS+TALP+IET+ GD+SAYIPTNVISITDGQ+F+   LF  G RPAI+ GLSVSRVGS+AQ+ A+K+ +GSLKL LAQYRE+ AF+QFGSDLD  TK+ L  G+++ +L+ Q + +P +   +  L+++    Y+  I +  I +F+++ + + K   + I+  I +  ++S+DL  ++K+   S + ++
  S:    48 SSILEERIRGVSEEANLNETGRVLSVGDGIARVFGLNNVQAEELVEFSSGVKGMALNLEPGQVGIVLFGSDRLVKEGEVVKRTGKIVDVPVGPEMLGRVVDALGNPIDGKGAIKASGTSRAQVKAPGILPRRSVHEPVQTGLKAVDALVPIGRGQRELIIGDRQTGKTAVALDTILNQKRWNSSNDESKKLYCVYVAVGQKRSTVAQLVQTLEQHDAMKYSVIVAATASEAAPLQYIAPFTAAAIGEWFRDNGKHALIVYDDLSKQAVAYRQLSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSEKNGGGSLTALPVIETQGGDVSAYIPTNVISITDGQIFLEAELFYKGIRPAINVGLSVSRVGSAAQVKALKQVAGSLKLFLAQYREVAAFAQFGSDLDASTKQTLARGERLTQLLTQSQYSPLAAEEQVPLIYAGVNGYLDNIELSRIGEFEKEFLAYLKASHEEIVSAIREKGELSKDLLAKLKSATESFVATF 547
>gi|59802944|gb|AAX07676.1| ATP synthase alpha chain-like protein [Magnaporthe grisea] (551 aa)
Score = 1317, Expect = 3.9e-143, Identities = 254/492 (51%), Positives = 361/492 (73%)
  Q:     9 SNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQK--------GKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKI-NKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKT-ILETIDQTKDISQDLFVQIKNEFNSLITSYI 500
           S+I++ +I+  Q +A  +E GRV++VGDGI +  G++NV   ELV F +G  GM +NLEA   G+V+ G    +KEG  VKRT  +VD+PVG  +LGRV+DA+GNPIDG G I   ++   +  APG++ R SV +P++TG  ++D+M PIG+GQRELIIGD+QTGKT +A+DA++NQK         K + C+YV +GQK ST+ Q + TL++  A+ Y+ +VA++AS+   L YLAPFTG +I E +   G+  L+I+DDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+ N+ +GGGS+TALPIIET+ GD+SAYIPTNVISITDGQ+F+   LF  G RPAI+ GLSVSRVGS+AQ+ A+K+ +GSLKL LAQYRE+ AF+QFGSDLD  TK+ L  G+++ +L+KQ + +P + +    L+F+    ++ ++PV  I  ++   + H K  ++ +L TI++   IS+DL  ++++   S   S+I
  S:    49 SSILEQRIRGVQEEAGLAETGRVLSVGDGIARVHGMANVQAEELVEFASGVKGMCMNLEAGQVGVVLFGSDRLVKEGETVKRTGEIVDIPVGPEMLGRVVDALGNPIDGKGPINTKERSRAQLKAPGILPRQSVNQPVQTGLKSVDAMVPIGRGQRELIIGDRQTGKTAVALDAMLNQKRWNNSNDETKKLYCVYVAVGQKRSTVAQLVKTLEENDAMRYSVVVAATASEAAPLQYLAPFTGASIGEWFRDNGKHSLVIFDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNNRTHGGGSMTALPIIETQGGDVSAYIPTNVISITDGQIFLEAELFYKGIRPAINVGLSVSRVGSAAQLKAMKQVAGSLKLFLAQYREVAAFAQFGSDLDAATKQTLNRGERLTELLKQKQYSPMAVNEMVPLIFAGVNGFLDYVPVAKILQWEADFLSHLKTNESDLLATIEKEGAISKDLEARLRDVVGSFTKSFI 550
>gi|154174815|ref|YP_001408811.1| F0F1 ATP synthase subunit alpha [Campylobacter curvus 525.92] >gi|166201656|sp|A7H019|ATPA_CAMC5 ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|112803676|gb|EAU01020.1| ATP synthase F1, alpha subunit [Campylobacter curvus 525.92] (505 aa)
Score = 1317, Expect = 4.7e-143, Identities = 257/482 (53%), Positives = 352/482 (73%)
  Q:     3 INLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQ-KTILETIDQTKDISQDL 484
           I  D+ S IIK +I+ +       E G+VI+V DG+    GL N+M  E+V FE G  GM LNLE ++ GIV+LGK   I EGS VKR K ++ VPVGD L+GRV++++G PID  G I+  +   +E+ A G+MAR SV EPL+TG  AID++ PIG+GQRELIIGD+QTGKTT+AID IINQKG++V CIYV IGQK ST+ Q +  L+++GA++YT +V + ASD  +L YLAP+ G+T+ E +       LIIYDDLSKHA+AYR +SL+LRRPPGREAYPGD+FYLHSRLLER+ K+N   G GS+TALPIIET+AGD+SAYIPTNVISITDGQ+F+ ++LFNSG RPAI+ GLSVSRVG +AQI A K+ SG+L+L+LAQYREL AF+QF SDLD+ +++ LE G+K+++++KQ   +P     + +++F+  + Y+  I    +  F+ ++  + + +   I E I   K + +++
  S:     5 IKADEISAIIKERIENFDLSVDVEETGKVISVADGVANVYGLKNIMAGEMVEFEGGEKGMALNLEESSVGIVILGKTSGITEGSSVKRLKKLLRVPVGDALIGRVVNSLGEPIDAKGPIEATETRFVEEKAKGIMARKSVHEPLQTGIKAIDALVPIGRGQRELIIGDRQTGKTTVAIDTIINQKGQDVICIYVAIGQKQSTVAQVVKKLEEYGAMDYTIVVNAGASDTAALQYLAPYAGVTMGEYFRDNSRHALIIYDDLSKHAVAYREMSLILRRPPGREAYPGDVFYLHSRLLERASKLNDALGAGSLTALPIIETQAGDVSAYIPTNVISITDGQIFLESDLFNSGIRPAINVGLSVSRVGGAAQIKATKQVSGNLRLDLAQYRELQAFAQFASDLDESSRKQLERGQKMVEVLKQPPYSPLPVENQVVIIFAGSKGYLDDIAAASVTKFEAELYPYIEAKYPEIFEQIRTKKVLDKEI 487
>gi|160938927|ref|ZP_02086278.1| hypothetical protein CLOBOL_03821 [Clostridium bolteae ATCC BAA-613] >gi|158437890|gb|EDP15650.1| hypothetical protein CLOBOL_03821 [Clostridium bolteae ATCC BAA-613] (507 aa)
Score = 1317, Expect = 4.7e-143, Identities = 257/475 (54%), Positives = 349/475 (73%)
  Q:    27 EIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQK-TILETIDQTKDISQDLFVQIKNEFNSLITSYIK 501
           E G VI VGDGI    G+ + M  E+V+FENG  GM  ++     G ++ GK   + +G+ V RT+    VPVG G LGRV++A+G PIDG G +K +  +P+E+ APG++ R SV  P+ETG LAIDSMFPIG+GQRELIIGD+QTGKT+IA+D I+NQKGK+V CIYV IGQK ST+ + ++TLK+  A++YT +++S+AS+   L Y+AP+ G  +AE +M +G+DVLIIYDDLSKHA+AYR LSLLL R PGREAYPGD+FYLHSRLLERS ++  E GGGSITALPIIET+AGD+SAYIPTNVISITDGQ+F+ ++LF SG RPA++ GLSVSRVG +AQ  A+KK SGS++++LAQYRE++ F+QF SDLD+ TKE L +GK++M+L+KQ    P S   + I L +   K +  + V  I++F+  ++  F ++   I + I++TK +  DL  +I +  N   T+  K
  S:    29 ETGSVIWVGDGIAIVYGIEHAMYGEIVIFENGVKGMVQDIRRNEIGCILFGKDTGVGQGTKVVRTRKRAGVPVGSGFLGRVVNALGEPIDGLGSVKEEDYLPVEEEAPGIVDRKSVGVPMETGILAIDSMFPIGRGQRELIIGDRQTGKTSIAMDTILNQKGKDVVCIYVAIGQKASTVAKLVSTLKKNDAMDYTIVMSSTASEAAPLQYIAPYAGTAMAEYFMHQGKDVLIIYDDLSKHAVAYRALSLLLERSPGREAYPGDVFYLHSRLLERSSRLCDEKGGGSITALPIIETQAGDVSAYIPTNVISITDGQIFLESDLFFSGMRPAVNVGLSVSRVGGAAQTKAMKKASGSIRIDLAQYREMEVFTQFSSDLDEATKEQLAYGKRLMELLKQPLGRPLSLHEQVITLCAATHKVMLSVEVSDIKEFQMNMLAWFDEKHPEIGKEIEETKVLGDDLINRIVDAANQYKTNQYK 504
>gi|153008437|ref|YP_001369652.1| F0F1 ATP synthase subunit alpha [Ochrobactrum anthropi ATCC 49188] >gi|166201671|sp|A6WXW9|ATPA_OCHA4 ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|151560325|gb|ABS13823.1| ATP synthase F1, alpha subunit [Ochrobactrum anthropi ATCC 49188] (509 aa)
Score = 1317, Expect = 4.8e-143, Identities = 254/499 (50%), Positives = 353/499 (70%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQK--------GKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK-QQKTILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           M I   + S I+K QIK +  +A  SE+G+V++VGDGI +  GL NV   E+V F  G  GM LNLE+   G+V+ G   DIKEG IVKRT  +VDVPVG GLLGRV+DA+GNPIDG G I   ++  ++  APG++ R SV EP+ TG  A+D++ P+G+GQREL+IGD+QTGKT I +D  +NQK         + + C+YV IGQK ST+ QF+  L++ GALEY+ ++A++ASD   + YLAPF G  + E +       LI YDDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+N ENG GS+TALP+IET+  D+SA+IPTNVISITDGQ+F+ TNLF  G RPA++ GLSVSRVGSSAQ+ A+K+ +GS+K ELAQYRE+ AF+QFGSDLD  T+ +L  G ++ +L+KQ + +P     +  ++F+    Y+  I V+ +  F+  ++   + + K +L+ I   K ++ ++  ++K   ++   S+
  S:     1 MDIRAAEISAILKEQIKNFGKEAEVSEVGQVLSVGDGIARVYGLDNVQAGEMVEFPGGIRGMALNLESDNVGVVIFGADRDIKEGDIVKRTGAIVDVPVGPGLLGRVVDALGNPIDGKGPIVATERRRVDVKAPGIIPRKSVHEPMSTGLKAVDALIPVGRGQRELVIGDRQTGKTAIILDTFLNQKPIHDNGPDSEKLYCVYVAIGQKRSTVAQFVKVLEERGALEYSIVIAATASDPAPMQYLAPFAGCAMGEYFRDNSMHALIGYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNDENGAGSLTALPVIETQGNDVSAFIPTNVISITDGQIFLETNLFYQGIRPAVNVGLSVSRVGSSAQVKAMKQVAGSIKGELAQYREMAAFAQFGSDLDASTQRLLNRGARLTELLKQPQFSPLKTEEQVAVIFAGVNGYLDKIAVNQVGKFEAGLLSSLRTEHKDVLDAIRDEKALTDNIKAKLKAAVDAFAKSF 508
>gi|126736544|ref|ZP_01752284.1| ATP synthase F1, alpha subunit [Roseobacter sp. CCS2] >gi|126713857|gb|EBA10728.1| ATP synthase F1, alpha subunit [Roseobacter sp. CCS2] (511 aa)
Score = 1316, Expect = 5.2e-143, Identities = 246/465 (52%), Positives = 343/465 (73%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQK---------GKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK 465
           M+I   + S I+K+QIK +  +A  +E+GRV++VGDGI +  GL NV   E+V F  G  GM LNLEA   G+V+ G   DIKEG  VKRTK++VDVP+GD LLGRV+D +GNP+DG G I   K+   +  APG++ R SV EP+ TG  ++D+M PIG+GQRELIIGD+QTGKT +A+D ++NQK         G+ + C+YV +GQK ST+ Q +  L++ GA++Y+ +VA++ASD   + +LAP+    +AE +   G   LIIYDDLSK A++YR +SLLLRRPPGREAYPGD+FYLHSRLLERS K+N++NG GS+TALPIIET+ GD+SA+IPTNVISITDGQ+F+ T LF  G RPA++ GLSVSRVGS+AQ NA+K  +G +KLELAQYRE+ AF+QFGSDLD  T+++L  G ++ +L+KQ + +P + +    ++++    Y+  + V  +  F+  +++H +
  S:     1 MAIQASEISAILKDQIKNFGQEAEVAEVGRVLSVGDGIARVYGLDNVQAGEMVEFPGGIRGMALNLEADNVGVVIFGSDRDIKEGDTVKRTKSIVDVPIGDELLGRVVDGLGNPLDGKGPINAKKRAVADSKAPGIIPRKSVHEPMATGLKSVDAMIPIGRGQRELIIGDRQTGKTAVALDTMLNQKSYNDAATEEGQKLYCVYVAVGQKRSTVAQLVKKLEESGAIDYSIVVAATASDPAPMQFLAPYAATAMAEHFRDNGRHALIIYDDLSKQAVSYRQMSLLLRRPPGREAYPGDVFYLHSRLLERSSKLNEDNGSGSLTALPIIETQGGDVSAFIPTNVISITDGQIFLETELFYQGIRPAVNTGLSVSRVGSAAQTNAMKSVAGPVKLELAQYREMAAFAQFGSDLDAATQQLLNRGARLTELMKQPQYSPLTNAEIVCVIYAGTHGYLDKVDVKEVGRFEAGLLKHMR 474
>gi|145621085|ref|ZP_01777085.1| ATP synthase F1, alpha subunit [Geobacter bemidjiensis Bem] >gi|144942617|gb|EDJ77742.1| ATP synthase F1, alpha subunit [Geobacter bemidjiensis Bem] >gi|197089673|gb|ACH40944.1| ATP synthase F1, alpha subunit [Geobacter bemidjiensis Bem] (502 aa)
Score = 1316, Expect = 5.4e-143, Identities = 252/471 (53%), Positives = 343/471 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKTIL 471
           M I  ++ S II+ QIKEY  +   +E G +I++GDGI +  GL   M  EL+ F  G  GM LNLE    G  +LG+F +IKEG  VK T  +V+VPVG  L+GRV+DA+GNPIDG G I  D    +E  APG++ R SV +P++TG  AIDSM PIG+GQRELIIGD+QTGKT +AID IINQKG +V CIYV IGQK ST+ Q ++ LK+ GA++YT +VA++AS+   L ++AP+TG+T+ E +   G+  LIIYDDLSK A+AYR LSLLLRRPPGREAYPGD+FYLHSRLLER+ K++ + G GS+TALP+IET+AGD+SAYIPTNVISITDGQ+++ ++LF SG RPAI+ GLSVSRVG SAQ+ A+K+ +G+L+L LAQYRE+ AF+QFGSDLDK T+  L  G ++++++KQ +  P     + +++F+    ++   P+  +  ++ ++   F  +K  L
  S:     1 MEIKAEEISEIIRKQIKEYGTEVAVAETGTIISIGDGIARIHGLDKAMAGELLEFPGGITGMVLNLEEDNVGAAILGEFSEIKEGDSVKLTGKIVEVPVGPALIGRVVDAIGNPIDGLGPINTDTFGKVEVKAPGIVKRKSVHQPMQTGLKAIDSMVPIGRGQRELIIGDRQTGKTAVAIDTIINQKGGDVVCIYVAIGQKRSTVAQVVSKLKEHGAMDYTIVVAATASEPAPLQFIAPYTGVTMGEFFRDSGKHALIIYDDLSKQAVAYRQLSLLLRRPPGREAYPGDVFYLHSRLLERACKVSDDCGAGSLTALPVIETQAGDVSAYIPTNVISITDGQIYLESDLFYSGVRPAINVGLSVSRVGGSAQVKAMKQVAGTLRLALAQYREMAAFAQFGSDLDKATQMQLARGARLVEILKQPQYRPIPNEKQVLIIFAANNGFVDDYPIGSLGRYETELYAFFDSRKATL 471
>gi|49474712|ref|YP_032754.1| F0F1 ATP synthase subunit alpha [Bartonella quintana str. Toulouse] >gi|81695985|sp|Q6FYM1|ATPA_BARQU ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|49240216|emb|CAF26684.1| ATP synthase alpha chain [Bartonella quintana str. Toulouse] (511 aa)
Score = 1316, Expect = 5.6e-143, Identities = 258/501 (51%), Positives = 353/501 (70%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQK----------GKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQ-QKTILETIDQTKDISQDLFVQIKNEFNSLITSYIK 501
           M I   + S I+K QI+++  KA  SEIG V++VGDGI +  GL N+   E+V F NG +GM LNLE    G+V+ G   DI+EG  VKR   +VDVPVG  LLGRV+DA+GNPIDG G +K  ++  ++  APG++ R SV EP+ TG  AID++ PIG+GQREL+IGD+QTGKT I +D  +NQK             V CIYV IGQK ST+ QF+  L++ GALEY+ IVA++ASD   + ++AP  G  + E +   G+  LI YDDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+N ENG GS+TALP+IET+A D+SAYIPTNVISITDGQ+F+ TNLF  G RPA++ GLSVSRVGS+AQI A+K+ +GS+K ELAQYRE+ AF+QFGSDLD  T+ +L  G ++ +L+KQ + +P     + +++F+    Y+  + V  +  F++ ++   +     +L+ I   K I+ D    +K++   ++ +Y K
  S:     1 MDIRPSEISKILKEQIRDFDQKAEVSEIGWVLSVGDGIARVYGLDNIQAGEMVSFSNGVHGMALNLEIDNVGVVIFGSDRDIREGDSVKRLGAIVDVPVGPALLGRVVDALGNPIDGKGPLKATERRRVDVKAPGIIPRQSVHEPMPTGLKAIDALIPIGRGQRELVIGDRQTGKTAILLDTFLNQKPFHEKGAGNEQDKVYCIYVAIGQKRSTVAQFVKVLEERGALEYSIIVAATASDPAPMQFIAPLAGCAMGEYFRDNGQHALIGYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNAENGSGSLTALPVIETQANDVSAYIPTNVISITDGQIFLETNLFYQGIRPAVNVGLSVSRVGSAAQIKAMKQVAGSIKGELAQYREMAAFAQFGSDLDASTQRLLNRGARLTELLKQPQFSPLKTEEQVVVIFAGVNGYLDALAVSDVGRFEQGLLTLLRSDHPDLLQAIAHQKQITDD----VKDKLIVVLNTYAK 508
>gi|161897608|ref|YP_948317.2| F0F1 ATP synthase subunit alpha [Arthrobacter aurescens TC1] >gi|190358292|sp|A1R7V5|ATPA_ARTAT ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) (545 aa)
Score = 1316, Expect = 6.3e-143, Identities = 255/495 (51%), Positives = 342/495 (69%)
  Q:     1 MSINLDKFSNIIKNQIKEYQ-NKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKG--------KNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKTILETIDQTKDISQDLFVQIKNEFNSL 495
           ++IN D   N +      Y+   A   E+GRV    DGI +  GL +VM NEL+ FE+G+ G+  NL+    G+++LG F  I+EG  V RT  ++ VPVGD  LGRV+D +G PID  GEIK +    +E  APGV  R SV EP++TG  AID+M PIG+GQR+LIIGD+QTGKT IA+D IINQK         K V+C+YV +GQK STI     TL+  GALEYTTIVAS ASD     YLAP+ G  I + WM  G+ VL+I+DDLSK A AYR +SLLLRRPPGREAYPGD+FYLHSRLLER  K++ E G GS+T LPI+ET+A D+SAYIPTNVISITDGQ+F+ ++LFN+ QRPA+D G+SVSRVG +AQ+ ++KK SG+LKL+LAQYR++ AF+ F SDLD  +++ L  G ++M+L+KQ + +PF    + + +++    Y+  +PV+ I  F+ + + H   + +IL T+ QT  +  D    +K    S 
  S:     4 LTINADDVRNALNEFAASYEPGNAERVEVGRVTTASDGIARVEGLPSVMANELLRFEDGTLGLAQNLDVREIGVIILGDFTGIEEGQEVHRTGEILSVPVGDAFLGRVVDPLGQPIDDLGEIKAEATRALELQAPGVTERKSVHEPMQTGLKAIDAMIPIGRGQRQLIIGDRQTGKTAIAVDTIINQKANWASGDVTKQVRCVYVGVGQKASTIAAVRQTLEDHGALEYTTIVASPASDPAGFKYLAPYAGSAIGQHWMYGGKHVLVIFDDLSKQAEAYRAVSLLLRRPPGREAYPGDVFYLHSRLLERCAKLSDELGAGSMTGLPIVETKANDVSAYIPTNVISITDGQIFLQSDLFNANQRPAVDVGVSVSRVGGAAQVKSMKKVSGTLKLDLAQYRDMQAFAMFASDLDAASRQQLTRGARLMELLKQGQYSPFPVENQVVSIWAGTNGYLDDVPVEDISRFESEFLEHLTHKSSILTTLAQTNVLDDDTAAALKEAIVSF 507
>gi|159045476|ref|YP_001534270.1| F0F1 ATP synthase subunit alpha [Dinoroseobacter shibae DFL 12] >gi|190358154|sp|A8LJR6|ATPA2_DINSH ATP synthase subunit alpha 2 (ATPase subunit alpha 2) (ATP synthase F1 sector subunit alpha 2) >gi|157913236|gb|ABV94669.1| ATP synthase F1, alpha subunit [Dinoroseobacter shibae DFL 12] (512 aa)
Score = 1315, Expect = 6.6e-143, Identities = 252/476 (52%), Positives = 349/476 (73%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKG----------KNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK-QQKTILETIDQ 476
           M I   + S I+K QIK +  +A  +E+GRV++VGDGI +  GL NV   E+V F  G  GM LNLE    G+V+ G   DIKEG IVKRTK++VDVPVGD LLGRV+D +GNP+DG G I+  ++   +  APG++ R SV EP+ TG  ++D+M PIG+GQRELIIGD+QTGKT +A+D I+NQK           K + C+YV +GQK ST+ Q +  L++ GA+EY+ +VA++ASD   + +LAP+   ++AE +   G   LIIYDDLSK A++YR +SLLLRRPPGREAYPGD+FYLHSRLLERS K+  ++G GS+TALPIIET+ GD+SA+IPTNVISITDGQ+F+ T LF  G RPA++ GLSVSRVGSSAQ NA+K  +G +KLELAQYRE+ AF+QFGSDLD  T+++L  G ++ +L+KQ + +P + +    ++F+  + Y+  IPV  +  +++ ++ H + + K +L+ I +
  S:     1 MGIQAAEISAILKEQIKNFGQEAEVAEVGRVLSVGDGIARVHGLDNVQAGEMVEFPGGIRGMALNLEIDNVGVVIFGSDRDIKEGDIVKRTKSIVDVPVGDALLGRVVDGLGNPLDGKGPIETTERSIADVKAPGIIPRKSVHEPMATGLKSVDAMIPIGRGQRELIIGDRQTGKTAVALDTILNQKAYNDAAGDDESKKLYCVYVAVGQKRSTVAQLVKKLEETGAIEYSIVVAATASDPAPMQFLAPYAATSMAEFFRDNGRHALIIYDDLSKQAVSYRQMSLLLRRPPGREAYPGDVFYLHSRLLERSAKLGDDHGNGSLTALPIIETQGGDVSAFIPTNVISITDGQIFLETELFYQGIRPAVNTGLSVSRVGSSAQTNAMKSVAGPVKLELAQYREMAAFAQFGSDLDAATQQLLNRGARLTELMKQPQYSPLTNAEIVCVIFAGTKGYLDKIPVGDVGRYEKGLLAHLRGKHKGLLDYITK 487
>gi|50294700|ref|XP_449761.1| hypothetical protein CAGL0M09581g [Candida glabrata CBS138] >gi|49529075|emb|CAG62739.1| unnamed protein product [Candida glabrata] (543 aa)
Score = 1315, Expect = 7.3e-143, Identities = 257/491 (52%), Positives = 352/491 (71%)
  Q:     9 SNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQK--------GKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK-QQKTILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           S+I++ +I+   ++A  +E GRV+ VGDGI +  GL+N+   ELV F +G  GM LNLE    GIV+ G    +KEG IVKRT  +VDVPVG GLLGRV+DA+GNPIDG G I+       +  APG++ R SV EP++TG  A+D++ PIG+GQRELIIGD+QTGKT +A+D I+NQK         K + C+YV IGQK ST+ Q + TL+Q  AL+Y+ IVA++AS+   L YLAPFT  +I E +   G+  LI+YDDLSK A+AYR LSLLLRRPPGREAYPGD+FYLHSRLLER+ K++ + G GS+TALP+IET+ GD+SAYIPTNVISITDGQ+F+   LF  G RPAI+ GLSVSRVGS+AQ+ A+K+ +GSLKL LAQYRE+ AF+QFGSDLD  TK+ L  G+++ +L+KQ + +P +   +  L+++    Y+  I +  I +F+   + + K   + IL  I    ++++DL   +K+   S + ++
  S:    44 SSILEEKIRGVSDEAQLNETGRVLAVGDGIARVFGLNNIQAEELVEFASGVKGMALNLEPGQVGIVLFGSDRLVKEGEIVKRTGKIVDVPVGPGLLGRVVDALGNPIDGKGPIESVGTARAQVKAPGILPRRSVHEPVQTGLKAVDALVPIGRGQRELIIGDRQTGKTAVALDTILNQKRWNDGNDESKKLYCVYVAIGQKRSTVAQLVQTLEQHDALKYSIIVAATASEAAPLQYLAPFTAASIGEWFRDNGKHALIVYDDLSKQAVAYRQLSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDKEGAGSLTALPVIETQGGDVSAYIPTNVISITDGQIFLEAELFYKGIRPAINVGLSVSRVGSAAQVKALKQVAGSLKLFLAQYREVAAFAQFGSDLDASTKQTLVRGERLTQLLKQSQYSPLAAEEQVPLIYAGVNGYLDNIDLGRIAEFESSFLAYLKSNHENILNDIRDKGELTKDLLATLKSATESFVATF 543
>gi|83952823|ref|ZP_00961553.1| ATP synthase subunit A [Roseovarius nubinhibens ISM] >gi|83835958|gb|EAP75257.1| ATP synthase subunit A [Roseovarius nubinhibens ISM] (512 aa)
Score = 1315, Expect = 7.5e-143, Identities = 250/474 (52%), Positives = 346/474 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKG----------KNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK-QQKTILETI 474
           M I   + S I+K+QIK +   A  +E+GRV++VGDGI +  GL NV   ELV F     GM LNLE    G+V+ G    IKEG +VKRTK++VDVP+GD LLGRV+DA+GNP+DG G I   K+   +  APG++ R SV EP+ TG  ++D+M P+G+GQRELIIGD+QTGKT IA+D ++NQK           K + C+YV +GQK ST+ Q +  L++ GA+EY+ +VA++ASD   + +LAP++   +AE +   G   LI+YDDLSK A++YR +SLLLRRPPGREAYPGD+FYLHSRLLERS K+N++NG GS+TALPIIET+ GD+SA+IPTNVISITDGQ+F+ T LF  G RPA++ GLSVSRVGSSAQ NA+K  +G +KL LAQYRE+ AF+QFGSDLD  T+++L  G ++ +L+KQ +  P + +    ++++    Y+  I V+ +  F+E ++ H + ++K +L+ I
  S:     1 MGIQAAEISAILKDQIKNFGKDAEVAEVGRVLSVGDGIARVHGLDNVQAGELVEFPGAVMGMALNLETDNVGVVIFGSDRQIKEGDVVKRTKSIVDVPIGDELLGRVVDALGNPLDGKGPIGAAKRGLADVKAPGIIPRKSVHEPMATGLKSVDAMIPVGRGQRELIIGDRQTGKTAIALDTMLNQKSYNEAAGDDESKKLYCVYVAVGQKRSTVAQLVKKLEENGAMEYSIVVAATASDPAPMQFLAPYSATAMAEHFRDNGRHALIVYDDLSKQAVSYRQMSLLLRRPPGREAYPGDVFYLHSRLLERSAKLNEDNGAGSLTALPIIETQGGDVSAFIPTNVISITDGQIFLETELFYQGIRPAVNTGLSVSRVGSSAQTNAMKSVAGPVKLSLAQYREMAAFAQFGSDLDAATQQLLNRGARLTELMKQPQYAPLTNAEIVCVIYAGTNGYLDKIAVNQVGRFEEGLLNHMRTKRKDVLDWI 485
>gi|110597217|ref|ZP_01385505.1| ATP synthase F1, alpha subunit [Chlorobium ferrooxidans DSM 13031] >gi|110341053|gb|EAT59521.1| ATP synthase F1, alpha subunit [Chlorobium ferrooxidans DSM 13031] (526 aa)
Score = 1315, Expect = 7.8e-143, Identities = 257/488 (52%), Positives = 357/488 (73%)
  Q:     2 SINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKE------------------NGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK-QQKTILETIDQTKDISQDLFVQIK 489
           ++  D+ S+I++ Q+  ++++A   ++G V+ VGDGI +  GLS     EL+ F N   GM LNLE    G V+ G+   +KEG  VKRT  +  +PVG+ +LGRVI+ +G PIDG G I+ + ++P+E+ APGV+ R SV EPL+TG  AIDSM PIG+GQRELIIGD+QTGKT +AID IINQKGK V CIYV IG K ST+ Q +NTL+++GA+EYTT+++++ASD   L ++APF G T+ E +   G   L++YDDLSK A+AYR LSLLLRRPPGREAYPGD+FYLHSRLLER+ KI  +                   GGGS+TALP+IET+AGD+SAYIPTNVISITDGQ+F+ +NLFNSGQRPAI+ G+SVSRVG +AQI A+KK +G+L+L+LAQ+REL+AFS+FGSDLDK TK  L+ G ++++++KQ +  P     +  ++F   +  +  + + +I  F+E+ +   + +Q  IL  I  +  +  D   ++K
  S:     4 TVRPDEVSSILRKQLAGFESEAEVYDVGTVLQVGDGIARVYGLSKAAAGELLEFPNNVMGMALNLEEDNVGAVLFGESTLVKEGDTVKRTSILASIPVGEAMLGRVINPLGEPIDGKGSIETELRLPLERRAPGVIYRKSVHEPLQTGLKAIDSMIPIGRGQRELIIGDRQTGKTAVAIDTIINQKGKGVFCIYVAIGLKGSTVAQVVNTLEKYGAMEYTTVISATASDPAPLQFIAPFAGATLGEFFRDTGRHALVVYDDLSKQAVAYRQLSLLLRRPPGREAYPGDVFYLHSRLLERAAKITDDIEVARKMNDLPDALKPIVKGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLESNLFNSGQRPAINVGISVSRVGGAAQIKAMKKVAGTLRLDLAQFRELEAFSKFGSDLDKTTKAQLDRGARLVEILKQGQYIPMPVEKQVAIIFLGTQGLLDTVDLRFIRKFEEEFLSALEIKQSDILSAIATSGALESDTANKLK 510
>gi|7524779|ref|NP_045781.1| ATP synthase CF1 alpha subunit [Chlorella vulgaris] >gi|3023328|sp|P56294|ATPA_CHLVU ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|2224372|dbj|BAA57856.1| ATP synthase CF1 alpha chain [Chlorella vulgaris] (506 aa)
Score = 1315, Expect = 7.8e-143, Identities = 255/492 (51%), Positives = 354/492 (71%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKT----ILETIDQTKDISQDLFVQIKNEF 492
           + I  D+ S+IIK QI++YQ +     +G V  VGDGI +  GL  VM  ELV FE+G+ G+ LNLEA   G V++G+   ++EGS V+ T  +  +PVGDG LGRV++++  PIDG GEI   +   IE  APG+++R SV EPL+TG +AID+M PIG+GQRELIIGD+QTGKT IA+D I+NQKGK+V C+YV IGQK S+I Q +NTL++ GA++YT IVA++A    +L YL+P+TG  +AE +M  G   L+IYDDL+K A AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+N + G GS+TALP++ET+ GD+SAYIPTNVISITDGQ+F+  ++FN+G RPAI+ G+SVSRVGS+AQ  A+K+ +G LKLELAQ+ EL+AFSQF SDLD+ T+  L  G+++ +L+KQ +++P S   +   +++    Y+  +P D +  F   + ++    K     IL + +   D +Q L  +   E+
  S:     2 VKIRPDEISSIIKQQIEQYQQEVKAVNVGTVFQVGDGIARIYGLDKVMAGELVEFEDGTVGIALNLEAKNVGAVLMGEGTRVQEGSSVRATGKIAQIPVGDGYLGRVVNSLARPIDGKGEIATKENRLIESPAPGIISRRSVHEPLQTGIVAIDAMIPIGRGQRELIIGDRQTGKTAIAVDTILNQKGKDVVCVYVAIGQKASSIAQVVNTLQERGAMDYTIIVAATADSPATLQYLSPYTGAALAEYFMYTGRHTLVIYDDLTKQAQAYREMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNDKLGSGSMTALPVVETQEGDVSAYIPTNVISITDGQIFLSADIFNAGIRPAINVGISVSRVGSAAQPKAMKQVAGKLKLELAQFAELEAFSQFASDLDQATQNQLARGQRLRELLKQSQSSPLSLEDQVASIYAGTNGYLDVLPADRVRAFLVGLRQYLATNKAKYGEILRSTNALTDEAQTLLKEALKEY 497
>gi|51209988|ref|YP_063652.1| ATP synthase CF1 alpha subunit [Gracilaria tenuistipitata var. liui] >gi|75289852|sp|Q6B8Q8|ATPA_GRATL ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|50657742|gb|AAT79727.1| ATP synthase CF1 alpha subunit [Gracilaria tenuistipitata var. liui] (503 aa)
Score = 1315, Expect = 8.0e-143, Identities = 258/483 (53%), Positives = 351/483 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKTIL-ETIDQTKDISQD 483
           ++I  D+ SN+I+ QI +Y+ +   + IG V+ VGDGI +  GL  VM  EL+ FE+ + G+ LNLE+   G+V++G+  +I EGS VK T  +  +PVGD  LGRV+D +  PID  G         IE  APG++ R SVCEPL+TG  AIDSM PIG+GQRELIIGD+QTGKT +A+D IINQKG++V CIYV IGQK S++ Q ++TL+   AL+YT +VAS+A D  +L Y+AP+TG  +AE +M KG+  L++YDDL+K A AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+N E GGGS+TALPIIET+AGD+SAYIPTNVISITDGQ+F+  +LFNSG RPAI+ G+SVSRVGS+AQI A+K+ +G LKLELAQ+ EL+AFSQF SDLDK T+  L  G+++ +++KQ +N+P     +  ++++    Y+  I +  +++F E +    +  K    E+I  TK +S +
  S:     2 LNIRPDEISNVIRQQIDKYEQEIQVANIGTVLQVGDGIARVYGLDEVMAGELLEFEDQTIGIALNLESDNVGVVLMGEGRNILEGSSVKATGKIAQIPVGDAFLGRVVDPLARPIDAKGLPNSSGTRLIESYAPGIIGRQSVCEPLQTGITAIDSMIPIGRGQRELIIGDRQTGKTAVALDTIINQKGQDVVCIYVAIGQKASSVAQVVSTLQDESALDYTIVVASNADDPATLQYIAPYTGAALAEYFMYKGKATLVVYDDLTKQAQAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNSELGGGSMTALPIIETQAGDVSAYIPTNVISITDGQIFLSGDLFNSGIRPAINVGISVSRVGSAAQIKAMKQVAGKLKLELAQFAELEAFSQFASDLDKATQNQLSRGQRLREILKQAQNSPIPVEEQTAIIYTGINGYLDDINLSQVQEFIEALREDLRNSKPEFGESIRTTKKLSAE 485
>gi|119948355|gb|ABM07266.1| ATP synthase F1, alpha subunit [Arthrobacter aurescens TC1] (556 aa)
Score = 1314, Expect = 9.0e-143, Identities = 255/495 (51%), Positives = 342/495 (69%)
  Q:     1 MSINLDKFSNIIKNQIKEYQ-NKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKG--------KNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKTILETIDQTKDISQDLFVQIKNEFNSL 495
           ++IN D   N +      Y+   A   E+GRV    DGI +  GL +VM NEL+ FE+G+ G+  NL+    G+++LG F  I+EG  V RT  ++ VPVGD  LGRV+D +G PID  GEIK +    +E  APGV  R SV EP++TG  AID+M PIG+GQR+LIIGD+QTGKT IA+D IINQK         K V+C+YV +GQK STI     TL+  GALEYTTIVAS ASD     YLAP+ G  I + WM  G+ VL+I+DDLSK A AYR +SLLLRRPPGREAYPGD+FYLHSRLLER  K++ E G GS+T LPI+ET+A D+SAYIPTNVISITDGQ+F+ ++LFN+ QRPA+D G+SVSRVG +AQ+ ++KK SG+LKL+LAQYR++ AF+ F SDLD  +++ L  G ++M+L+KQ + +PF    + + +++    Y+  +PV+ I  F+ + + H   + +IL T+ QT  +  D    +K    S 
  S:    15 LTINADDVRNALNEFAASYEPGNAERVEVGRVTTASDGIARVEGLPSVMANELLRFEDGTLGLAQNLDVREIGVIILGDFTGIEEGQEVHRTGEILSVPVGDAFLGRVVDPLGQPIDDLGEIKAEATRALELQAPGVTERKSVHEPMQTGLKAIDAMIPIGRGQRQLIIGDRQTGKTAIAVDTIINQKANWASGDVTKQVRCVYVGVGQKASTIAAVRQTLEDHGALEYTTIVASPASDPAGFKYLAPYAGSAIGQHWMYGGKHVLVIFDDLSKQAEAYRAVSLLLRRPPGREAYPGDVFYLHSRLLERCAKLSDELGAGSMTGLPIVETKANDVSAYIPTNVISITDGQIFLQSDLFNANQRPAVDVGVSVSRVGGAAQVKSMKKVSGTLKLDLAQYRDMQAFAMFASDLDAASRQQLTRGARLMELLKQGQYSPFPVENQVVSIWAGTNGYLDDVPVEDISRFESEFLEHLTHKSSILTTLAQTNVLDDDTAAALKEAIVSF 518
>gi|50555055|ref|XP_504936.1| hypothetical protein [Yarrowia lipolytica] >gi|49650806|emb|CAG77741.1| unnamed protein product [Yarrowia lipolytica CLIB122] (536 aa)
Score = 1314, Expect = 9.0e-143, Identities = 258/493 (52%), Positives = 358/493 (72%)
  Q:     9 SNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQK--------GKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKT-ILETIDQTKDISQDLFVQIKNEFNSLITSYIK 501
           ++I++ +I+    +A  +E GRV++VGDGI +  GL+N+   ELV F +G  GM LNLEA   GIV+ G    +KEG  VKR+ ++VDVPVG  LLGRV+DA+GNPIDG G I+ + ++  +  APG++ R SV EP++TG  A+D++ PIG+GQRELIIGD+QTGKT IAID I+NQK         K + C+YV +GQK ST+ Q + TL+   AL+Y+ IVA++AS+   L YLAPFTG  + E +   G+  LI++DDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+N+  GGGS+TALPIIET+ GD+SAYIPTNVISITDGQ+F+   LF  G RPAI+ GLSVSRVGS+AQ+ A+K+ +GSLKL LAQYRE+ AF+QFGSDLD  TK+ L  G+++  L+KQ + +P S      L+++    YI  IPV  +E F+ + + +    ++ +L+ I  T ++S++   ++K+   + + S+ K
  S:    35 TSILEERIRGVSGEANLNETGRVLSVGDGIARVFGLNNIQAEELVEFASGVKGMALNLEAGQVGIVLFGSDRLVKEGETVKRSGSIVDVPVGPALLGRVVDALGNPIDGKGPIETEFRIRAQVKAPGILPRTSVNEPMQTGLKAVDALVPIGRGQRELIIGDRQTGKTQIAIDTILNQKRWNYGQDEKKKLYCVYVAVGQKRSTVAQLVQTLEHHDALKYSIIVAATASEAAPLQYLAPFTGTAMGEWFRDNGKGALIVFDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNEREGGGSLTALPIIETQGGDVSAYIPTNVISITDGQIFLEAELFYKGIRPAINVGLSVSRVGSAAQVKAMKQVAGSLKLFLAQYREVAAFAQFGSDLDASTKQTLTRGERLTLLLKQKQASPMSSEEMVPLIYAGVNGYIDNIPVKQVEKFEAEFVSYLHANESDLLKDIAATGELSKENLEKLKSITENFVGSFAK 536
>gi|189426221|ref|YP_001953398.1| ATP synthase F1, alpha subunit [Geobacter lovleyi SZ] >gi|189422480|gb|ACD96878.1| ATP synthase F1, alpha subunit [Geobacter lovleyi SZ] (502 aa)
Score = 1314, Expect = 9.5e-143, Identities = 258/494 (52%), Positives = 353/494 (71%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHF-KQQKTILETIDQTKDISQDL-------FVQIKNEFNS 494
           M +  ++ S IIK QI EY  +   SE G +I++GDGI +  GL+  M  EL+ F  G  GM LNLE    G  +LG+F +IKEG  VKRT  + +VPVGD L+GRV++A+G PIDG G I       +E  APG++AR SV +P+ TG  AIDSM PIG+GQRELIIGD+QTGKT +A+D IINQKG +V CIYV IGQK ST+ Q ++ L + GA++YT +VA++AS+   L ++AP+TG+T+ E +    +  LIIYDDLSK A+AYR LSLLLRRPPGREAYPGD+FYLHSRLLER+ K++ E G GS+TALPIIET+AGD+SAYIPTNVISITDGQ+++ ++LF SG RPAI+ GLSVSRVG SAQ  ++K+ +G+L+L LAQYRE+ AF+QFGSDLDK T+  L  G+++++++KQ +  P     + +++F+    Y+   PV  ++ ++ ++   F  +Q  +L  + + + I  DL         Q K EF +
  S:     1 MELRAEEISEIIKKQINEYGKEVEVSETGTIISIGDGIARIHGLAGAMAGELLEFPGGVSGMVLNLEEDNVGAAILGEFAEIKEGDTVKRTGRITEVPVGDALVGRVVNAIGQPIDGKGPINSSTFSKVEIKAPGIVARKSVHQPMATGLKAIDSMVPIGRGQRELIIGDRQTGKTAVAVDTIINQKGGDVICIYVAIGQKRSTVAQVVSKLTEHGAMDYTIVVAATASESAPLQFIAPYTGVTMGEYFRDNKKHALIIYDDLSKQAVAYRQLSLLLRRPPGREAYPGDVFYLHSRLLERACKLSDECGAGSLTALPIIETQAGDVSAYIPTNVISITDGQIYLESDLFFSGVRPAINVGLSVSRVGGSAQTKSMKQVAGTLRLNLAQYREMAAFAQFGSDLDKATQMQLARGERLVEILKQPQYRPIPNEKQVLVIFAANNGYLDDYPVSALKKYETELYAFFDNRQADVLTELREKQAIGDDLKAKLVSALDQFKKEFTA 502
>gi|18075728|emb|CAD11283.1| ATP synthase F1, subunit alpha [Helicobacter pylori] (503 aa)
Score = 1314, Expect = 9.7e-143, Identities = 250/497 (50%), Positives = 368/497 (74%)
  Q:     3 INLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQK--TILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           + L++ S++I+ +IK ++     +++G+V++  DG+ +  GL+ VM  E++ FE G  G+  NLE  + G+++ G   +IKE + VKRTK+++ VPVGD ++GRV++A+G PIDG GEI+ ++   IE+ APG+M R SV EPL+TG  AID++ PIG+GQRELIIGDKQTGKTT+AIDAIINQKG+NV CIYV IGQK ST+ Q +  L+++GA+EY+ ++ +SASD  ++ YLAP++G+ + E +       LIIYDDLSKHA+AYR +SL+LRRPPGREA+PGD+FY+HSRLLER+ K+  E G GS+TALPI+ET+AGD+SAYIPTN+ISITDGQ+F+ T+LF SG RPAI+ GLSVSRVG +AQI A K+ SG+L+L+LAQYREL AF+QF SDLD+ +K+ LE G+++++++KQ   +P     + +++++  + ++  + V  + DF+E+ +  F + K   +LE I   K + +DL   ++        +Y
  S:     4 LKLEEISSVIEEKIKNFELDCDMAQVGKVVSYADGVAKVYGLNGVMSYEVLEFETGDKGVAANLEEDSVGVIVFGFGNNIKERTSVKRTKSLMKVPVGDAVVGRVLNALGEPIDGKGEIETNEFSLIEQKAPGIMDRKSVHEPLQTGIKAIDALVPIGRGQRELIIGDKQTGKTTVAIDAIINQKGQNVICIYVAIGQKESTVAQVVRKLEEYGAMEYSVVINASASDSAAMQYLAPYSGVAMGEYFRDHARHALIIYDDLSKHAVAYREISLILRRPPGREAFPGDVFYIHSRLLERAAKLCDEKGAGSLTALPIVETQAGDVSAYIPTNIISITDGQIFLETDLFYSGIRPAINVGLSVSRVGGAAQIKATKQVSGTLRLDLAQYRELQAFTQFASDLDEASKKQLERGQRMVEVLKQAPYSPLPIEKQVVIIYAGAKGFLDSVSVKKVVDFEEQ-LHPFLEAKYPQVLEEIHTKKVLDKDLEAMLRKVLEEFKLTY 501
>gi|11467680|ref|NP_050732.1| ATP synthase CF1 alpha subunit [Guillardia theta] >gi|5915723|sp|O78475|ATPA_GUITH ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|3603005|gb|AAC35666.1| ATP synthase CF1 subunit a [Guillardia theta] (502 aa)
Score = 1314, Expect = 1.1e-142, Identities = 257/483 (53%), Positives = 353/483 (73%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQK-TILETIDQTKDISQD 483
           ++I  D+ S+II+ QI +Y      S +G V+ +GDGI +  GL  VM  EL+ FE+ + G+ LNLE+   G+V++G+   I EGS VK T  +  VPVG   LGRV++A+G PIDG G+I   +   IE IAPG+++R SVCEP++TG  AIDSM PIG+GQRELIIGD+QTGK+++AID IINQKG++V C+YV +GQK +T+   + TL++ GAL+YT IVA++A D  +L Y+AP+TG  IAE +M  G+  L+IYDDLSK A AYR +SLLLRRPPGREA+PGD+FYLHSRLLER+ K++ + GGGS+TALP+IET+AGD+SAYIPTNVISITDGQ+F+  +LFN+G RPAI+ G+SVSRVGS+AQI A+K+ +G LKLELAQ+ EL+AFSQF SDLD+ T+  L  G+++ +++KQ +N+P S   +  ++++    Y+  I VD +  F   +  + K  K    E I  TK  + D
  S:     2 VNIRPDEISSIIRQQIDKYDQAIQVSNVGTVLQIGDGIARVYGLDQVMAGELLEFEDKTIGIALNLESDNVGVVLMGEGRGILEGSSVKATGKIAQVPVGKSYLGRVVNALGTPIDGKGDINCSETRLIESIAPGIISRKSVCEPIQTGITAIDSMIPIGRGQRELIIGDRQTGKSSVAIDTIINQKGEDVVCVYVAVGQKAATVASIVTTLEEKGALDYTCIVAANADDPATLQYIAPYTGAAIAEYFMYNGQATLVIYDDLSKQASAYREMSLLLRRPPGREAFPGDVFYLHSRLLERAAKLSDKLGGGSMTALPVIETQAGDVSAYIPTNVISITDGQIFLSGDLFNAGIRPAINVGISVSRVGSAAQIKAMKQVAGKLKLELAQFAELEAFSQFASDLDQATRNQLARGQRLREILKQPQNSPISVEEQVAIIYTGINGYLDDIAVDKVRRFVTNLRTNLKNSKPQYAEIIRNTKTFNSD 485
>gi|161986640|ref|YP_832086.2| F0F1 ATP synthase subunit alpha [Arthrobacter sp. FB24] >gi|190358293|sp|A0JY66|ATPA_ARTS2 ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) (545 aa)
Score = 1313, Expect = 1.2e-142, Identities = 258/483 (53%), Positives = 340/483 (70%)
  Q:     1 MSINLDKFSNIIKNQIKEYQ-NKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKG--------KNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKTILETIDQTKDISQD 483
           ++IN D     +      Y+   A   E+GRV   GDGI +  GL +VM NEL+ FE+G+ G+  NL+    G+++LG F  I+EG  V RT  V+ VPVGD  LGRV+D +G PID  GEIK +    +E  APGV  R SV EP++TG  AID+M PIG+GQR+LIIGD+QTGK+ IAID IINQK         K V+CIYV IGQK STI     TL+  GALEYTTIVAS ASD     YLAP+ G  I + WM  G+ VLI++DDLSK A AYR +SLLLRRPPGREAYPGD+FYLHSRLLER  K++ E G GS+T LP+IET+A D+SAYIPTNVISITDGQ+F+ ++LFN+ QRPA+D G+SVSRVG +AQ+ ++KK SG+LKLELAQYR++ AF+ F SDLD  +++ L  G ++M+L+KQ + +PF    + + +++    Y+  +PV+ I  F+ + + H K + +IL T+ QT  +  D
  S:     4 LTINADDVRIALNEFAASYEPGNAERVEVGRVTTAGDGIARVEGLPSVMANELLRFEDGTLGLAQNLDVREIGVIVLGDFTGIEEGQEVHRTGQVLSVPVGDAFLGRVVDPLGQPIDDLGEIKAETTRALELQAPGVTQRKSVHEPMQTGLKAIDAMIPIGRGQRQLIIGDRQTGKSAIAIDTIINQKANWASGDVTKQVRCIYVAIGQKASTIAAVRQTLEDNGALEYTTIVASPASDPAGFKYLAPYAGSAIGQHWMYGGKHVLIVFDDLSKQAEAYRAVSLLLRRPPGREAYPGDVFYLHSRLLERCAKLSDELGAGSMTGLPLIETKANDVSAYIPTNVISITDGQIFLQSDLFNANQRPAVDVGVSVSRVGGAAQVKSMKKVSGTLKLELAQYRDMQAFAMFASDLDAASRQQLTRGARLMELLKQGQYSPFPVENQVVSIWAGTNGYLDDVPVEDISRFETEFLEHLKHKSSILTTLAQTNVMDDD 495
>gi|39995222|ref|NP_951173.1| F0F1 ATP synthase subunit alpha [Geobacter sulfurreducens PCA] >gi|81703673|sp|Q74GY2|ATPA_GEOSL ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|39981984|gb|AAR33446.1| ATP synthase F1, alpha subunit [Geobacter sulfurreducens PCA] (503 aa)
Score = 1313, Expect = 1.2e-142, Identities = 259/494 (52%), Positives = 358/494 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGK-FEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKT-ILETIDQTKDISQDL-------FVQIKNEFNS 494
           M I  ++ S II+ QIKEY  +   +E G +I+VGDGI +  GL   M  EL+ F  G  GM LNLE    G  +LG+  E+IKEG+ VKRT  +V+VPVG+ L+GRV++A+G PIDG G I       +E  APG++ R SV +P++TG  AIDSM PIG+GQRELIIGD+QTGKT +AID IINQKG ++ CIYV IGQK ST+ Q ++ L+++GA++YT +V++SAS+   L ++AP+TG+T+ E +   G+  LIIYDDLSK A+AYR LSLLLRRPPGREAYPGD+FYLHSRLLER+ K++ + G GS+TALPIIET+AGD+SAYIPTNVISITDGQ+++ ++LF SG RPAI+ GLSVSRVG SAQ+ A+K+ +G+L+L LAQYRE+ AF+QFGSDLDK T+  L  G+++++++KQ +  P     + +++F+    ++   PV  +  ++ ++   F  +K  IL  +   K I  DL         ++K EF +
  S:     1 MEIRAEEISEIIRKQIKEYGKEVEVAETGTIISVGDGIARIHGLDKAMAGELLEFPGGVSGMVLNLEEDNVGAAILGEDNENIKEGTTVKRTGRIVEVPVGEALIGRVVNAIGQPIDGKGPINTTTFGKVEVKAPGIVKRKSVHQPMQTGLKAIDSMVPIGRGQRELIIGDRQTGKTAVAIDTIINQKGGDLICIYVAIGQKRSTVAQVVSKLQEYGAMDYTIVVSASASEPAPLQFIAPYTGVTMGEYFRDNGKHALIIYDDLSKQAVAYRQLSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSDDCGAGSLTALPIIETQAGDVSAYIPTNVISITDGQIYLESDLFYSGVRPAINVGLSVSRVGGSAQVKAMKQVAGTLRLNLAQYREMAAFAQFGSDLDKATQMQLARGERLVEILKQPQYRPIPNEKQVLVIFAANNGFVDEYPVSSLRRYESELYSFFDSRKADILAELRDKKAIDDDLKAKMIAALEELKKEFTA 503
>gi|77462848|ref|YP_352352.1| F0F1 ATP synthase subunit alpha [Rhodobacter sphaeroides 2.4.1] >gi|126461741|ref|YP_001042855.1| F0F1 ATP synthase subunit alpha [Rhodobacter sphaeroides ATCC 17029] >gi|190358147|sp|A3PIB7|ATPA1_RHOS1 ATP synthase subunit alpha 1 (ATPase subunit alpha 1) (ATP synthase F1 sector subunit alpha 1) >gi|124007208|sp|Q3J433|ATPA_RHOS4 ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|77387266|gb|ABA78451.1| F0F1-type ATP synthase alpha subunit [Rhodobacter sphaeroides 2.4.1] >gi|126103405|gb|ABN76083.1| ATP synthase F1, alpha subunit [Rhodobacter sphaeroides ATCC 17029] (512 aa)
Score = 1313, Expect = 1.3e-142, Identities = 250/465 (53%), Positives = 338/465 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKG----------KNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK 465
           M I   + S I+K QIK +  +A  +E+GRV++VGDGI +  GL NV   E+V F  G  GM LNLE    G+V+ G    IKEG  VKRTK++VDVP GD LLGRV+D +GNPIDG G I   ++   +  APG++ R  V EP+ TG  ++D+M PIG+GQRELIIGD+QTGKT IA+D I+NQK           K + CIYV IGQK ST+ Q +  L++ GA++YT +VA++ASD   + +LAP+    +AE +   G   LIIYDDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLERS K+NK++G GS+TALPIIET+ GD+SA+IPTNVISITDGQ+F+ T LF  G RPA++ GLSVSRVGSSAQ +A+K  +G +KLELAQYRE+ AF+QFGSDLD  T+++L  G ++ +L+KQ +  P + +    ++F+  + Y+  +PV  +  +++ +++H +
  S:     1 MGIQAAEISAILKEQIKNFGQQAEVAEVGRVLSVGDGIARVHGLDNVQAGEMVEFPGGIRGMALNLEVDNVGVVIFGDDRSIKEGDTVKRTKSIVDVPAGDALLGRVVDGLGNPIDGKGPIAATERRVADVKAPGIIPRKGVHEPMATGLKSVDAMIPIGRGQRELIIGDRQTGKTAIALDTILNQKSYNEAAGDDESKKLYCIYVAIGQKRSTVAQLVKKLEETGAIDYTLVVAATASDPAPMQFLAPYAATAMAEYFRDNGRHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERSAKLNKDHGAGSLTALPIIETQGGDVSAFIPTNVISITDGQIFLETELFYQGIRPAVNTGLSVSRVGSSAQTDAMKSVAGPVKLELAQYREMAAFAQFGSDLDAATQQLLNRGARLTELMKQPQYAPLTNAEIVCVIFAGTKGYLDKVPVKDVGRWEQGLLKHLR 475
>gi|91777094|ref|YP_546850.1| ATP synthase F1, alpha subunit [Methylobacillus flagellatus KT] >gi|118573482|sp|Q1GXM8|ATPA_METFK ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|91711081|gb|ABE51009.1| ATP synthase F1, alpha subunit [Methylobacillus flagellatus KT] (513 aa)
Score = 1313, Expect = 1.4e-142, Identities = 260/483 (53%), Positives = 353/483 (73%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKE------NG-----GGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQ-KTILETIDQTKDISQD 483
           M ++  + S +IK++++ +   A     G VI+V DGIV+  GLSNVM  E++ F    YG+ LNLE  + G V+LG +E+I EG  VK T  +++VPVG  L+GRV++A+G PIDG G I       IEK+APGV+AR SV +P++TG  AIDSM P+G+GQRELIIGD+QTGKT +A+DAIINQKG+N+ CIYV IGQK STI   +  L++ GA+EYT +VA+SASD  +L +LAP+ G T+ E +  +G+D LI+YDDL+K A AYR +SLLLRRPPGREAYPGD+FY+HSRLLER+ ++N+E      NG      GS+TALPIIET AGD+SA++PTNVISITDGQ+F+ T+LFN+G RPAI+AG+SVSRVG +AQ   +KK  G ++L LAQYREL AF+QF SDLD+ T++ L+ G+ V +L+KQ +  P S S  A+ L +  + +   +PV     F+  +    K + K+IL+ ID T D+  D
  S:     1 MQLSTSEISELIKSRLENFSTSAEARTQGTVISVTDGIVRIHGLSNVMAGEMIEFPGNVYGLALNLERDSVGAVILGDYENISEGDTVKCTGRILEVPVGPELVGRVVNALGQPIDGKGPINAKLTDKIEKVAPGVIARKSVSQPVQTGIKAIDSMVPVGRGQRELIIGDRQTGKTAVAVDAIINQKGQNMTCIYVAIGQKASTIANVVRKLEEHGAMEYTIVVAASASDPAALQFLAPYAGCTMGEYFRDRGQDALIVYDDLTKQAWAYRQISLLLRRPPGREAYPGDVFYIHSRLLERAARVNEEYVEKFTNGEVKGKTGSLTALPIIETAAGDVSAFVPTNVISITDGQIFLETDLFNAGIRPAINAGISVSRVGGAAQTKVIKKLGGGVRLALAQYRELAAFAQFASDLDEVTRKQLDRGRLVTELMKQAQYAPLSTSEMAVTLLAANKGFFDDVPVARALAFESALHSFLKSKYKSILDKIDSTNDLGGD 495
>gi|146278239|ref|YP_001168398.1| F0F1 ATP synthase subunit alpha [Rhodobacter sphaeroides ATCC 17025] >gi|166201672|sp|A4WUM9|ATPA_RHOS5 ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|145556480|gb|ABP71093.1| ATP synthase F1, alpha subunit [Rhodobacter sphaeroides ATCC 17025] (512 aa)
Score = 1312, Expect = 1.5e-142, Identities = 251/465 (53%), Positives = 336/465 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKG----------KNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK 465
           M I   + S I+K QIK +   A  +E+GRV++VGDGI +  GL NV   E+V F  G  GM LNLE    G+V+ G    IKEG  VKRTK++VDVP GD LLGRV+D +GNPIDG G I   ++   +  APG++ R  V EP+ TG  ++D+M PIG+GQRELIIGD+QTGKT IA+D I+NQK           K + CIYV IGQK ST+ Q +  L++ GA+ YT +VA++ASD   + +LAP+    +AE +   G   LIIYDDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLERS K+NKE+G GS+TALPIIET+ GD+SA+IPTNVISITDGQ+F+ T LF  G RPA++ GLSVSRVGSSAQ +A+K  +G +KLELAQYRE+ AF+QFGSDLD  T+++L  G ++ +L+KQ +  P + +    ++F+  + Y+  +PV  +  +++ +++H +
  S:     1 MGIQAAEISAILKEQIKNFGQAAEVAEVGRVLSVGDGIARVHGLDNVQAGEMVEFPGGIRGMALNLEVDNVGVVIFGDDRSIKEGDTVKRTKSIVDVPAGDALLGRVVDGLGNPIDGKGPIAATERRVADVKAPGIIPRKGVHEPMATGLKSVDAMIPIGRGQRELIIGDRQTGKTAIALDTILNQKSYNEAAGDDESKKLYCIYVAIGQKRSTVAQLVKKLEETGAIAYTLVVAATASDPAPMQFLAPYAATAMAEYFRDNGRHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERSAKLNKEHGSGSLTALPIIETQGGDVSAFIPTNVISITDGQIFLETELFYQGIRPAVNTGLSVSRVGSSAQTDAMKSVAGPVKLELAQYREMAAFAQFGSDLDAATQQLLNRGARLTELMKQPQYAPLTNAEIVCVIFAGTKGYLDKVPVKDVGRWEQGLLKHLR 475
>gi|118594199|ref|ZP_01551546.1| F0F1 ATP synthase subunit alpha [Methylophilales bacterium HTCC2181] >gi|118439977|gb|EAV46604.1| F0F1 ATP synthase subunit alpha [Methylophilales bacterium HTCC2181] (513 aa)
Score = 1312, Expect = 1.5e-142, Identities = 262/483 (54%), Positives = 361/483 (74%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKE-----------NGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHF--KQQKTILETIDQTKDISQD 483
           M ++  + S +IKN+IK++   +     G V++V DGIV+  GLSNVM  E++ F   ++G+ LNLE  + G V+LG +E I EG + K T  +++VPVG  L+GRV+DA+GNPIDG G +K  +   +EK+APGV+AR SV +P++TG  AIDSM PIG+GQRELIIGD+QTGKT +AIDAIINQKG+N+KCIYV IGQK STI+  +  L++ GA+EYTT+V++SASD  +L +LAP+ G T+ E +  +GED LI+YDDL+K AIAYR +SLLLRRPPGREAYPGD+FY+HSRLLER+ ++N+E              GS+TALPIIET AGD+SA++PTNVISITDGQ+F+ ++LFN+G RPAI+AG+SVSRVG +AQ   +KK  G ++L LAQYREL AF+QF SDLD+ T++ LE GK   +L+KQ +  P + S  AI LF+    Y+  +P D +  F E  +  F   + K ++++I+++  +S D
  S:     1 MQLSTSEISELIKNRIKDFSVSSEARTQGTVVSVTDGIVRVHGLSNVMSGEMIEFPGNTFGLALNLERDSVGAVILGDYEHISEGDVCKCTGKILEVPVGPELIGRVVDALGNPIDGKGPVKTKETDKLEKVAPGVIARKSVSQPVQTGLKAIDSMVPIGRGQRELIIGDRQTGKTAVAIDAIINQKGQNMKCIYVAIGQKASTIMNVVRKLEENGAMEYTTVVSASASDSAALQFLAPYAGCTMGEYFRDRGEDALIVYDDLTKQAIAYRQISLLLRRPPGREAYPGDVFYIHSRLLERAARVNEEYVENFTKGKVKGKTGSLTALPIIETAAGDVSAFVPTNVISITDGQIFLESDLFNAGVRPAINAGISVSRVGGAAQTKVIKKLGGGVRLALAQYRELAAFAQFASDLDEATRKQLERGKMFTELMKQAQYAPLTVSNMAITLFAANNGYLDDVPTDKVLSF-ENALHGFVASKYKAVVDSIEKSLALSDD 495
>gi|167358072|ref|ZP_02292732.1| ATP synthase F1, alpha subunit [Rhizobium leguminosarum bv. trifolii WSM1325] >gi|167075063|gb|EDR78879.1| ATP synthase F1, alpha subunit [Rhizobium leguminosarum bv. trifolii WSM1325] (509 aa)
Score = 1312, Expect = 1.5e-142, Identities = 257/502 (51%), Positives = 356/502 (70%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQK--------GKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKT-ILETIDQTKDISQDLFVQIKNEFNSLITSYIKT 502
           M I   + S I+K+QIK +  +A  SE+G+V++VGDGI +  GL NV   E+V F  G  GM LNLE+   G+V+ G   DIKEG  VKRT  +VDVPVG  LLGRV+DA+GNPIDG G I   ++  ++  APG++ R SV EP+ TG  AID++ P+G+GQREL+IGD+QTGKT I +DA +NQK        G+ + C+YV +GQK ST+ QF+  L++ GAL+Y+ IVA++ASD   + +LAPF G  + E +   G   LI YDDLSK A++YR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+N + G GS+TALP+IET+  D+SA+IPTNVISITDGQ+F+ T+LF  G RPA++ GLSVSRVGSSAQI A+K+ +GS+K ELAQYRE+ AF+QFGSDLD  T+ +L  G ++ +L+KQ + +P     +  ++F+    Y+  +PV  +  F++  + + + + + IL+ I   K IS D     K + N+ + S+ K+
  S:     1 MDIRAAEISAILKDQIKNFGKEAEVSEVGQVLSVGDGIARVYGLDNVQAGEMVEFPGGIRGMALNLESDNVGVVIFGSDRDIKEGDTVKRTGAIVDVPVGPELLGRVVDALGNPIDGKGPINATRRSRVDVKAPGIIPRKSVHEPMSTGLKAIDALIPVGRGQRELVIGDRQTGKTAILLDAFLNQKAIHDNGPEGEKLYCVYVAVGQKRSTVAQFVKVLEERGALKYSIIVAATASDPAPMQFLAPFAGCAMGEYFRDNGMHALIGYDDLSKQAVSYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDDKGAGSLTALPVIETQGNDVSAFIPTNVISITDGQIFLETDLFYQGIRPAVNVGLSVSRVGSSAQIKAMKQVAGSIKGELAQYREMAAFAQFGSDLDAATQRLLNRGARLTELLKQPQFSPLKTEEQVAVIFAGVNGYLDKLPVASVGKFEQGFLSYLRSEGSAILDAIRTEKAISDD----TKGKLNAALDSFAKS 507
>gi|84702330|ref|ZP_01016905.1| ATP synthase subunit A [Parvularcula bermudensis HTCC2503] >gi|84691576|gb|EAQ17416.1| ATP synthase subunit A [Parvularcula bermudensis HTCC2503] (510 aa)
Score = 1312, Expect = 1.6e-142, Identities = 259/501 (51%), Positives = 356/501 (71%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKN---------VKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQK-TILETIDQTKDISQDLFVQIKNEFNSLITSYIK 501
           M +N  + S+I+K QIK++   A  SEIG+V++VGDGI +  GL NV   E+V F+ G  GM LNLEA   G+V+ G    IKEG  V+R+  +VDVPVG GLLGRV+D +GNPIDG G I+  ++  ++  APG++ R SV EP++TG  AID+M P+G+GQREL+IGD+QTGKT I IDA++NQK  N         + CIYV IGQK ST+ Q + TL+  GAL+YT +VA++AS+   L +LAPF G  + E +   G   +I+YDDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+N++ G GS+TALPIIET+A D+SAYIPTNVISITDGQ+F+ T+LF  G RPA++ GLSVSRVGS+AQI A+K+ +G +K ELAQYREL AF+QFGSDLD  T+  L  G ++ +L+KQ + +P     +  ++F+    Y+  + V  + DF+ + +RH +     +L  I   K +S     +I+ E   ++  +++
  S:     1 MELNASEISSILKQQIKDFGKDAEVSEIGQVLSVGDGIARVFGLDNVQAGEMVDFDGGIKGMALNLEADNVGVVIFGDDTGIKEGDTVRRSNAIVDVPVGKGLLGRVVDPLGNPIDGKGPIEATERRVVDVKAPGILPRKSVHEPVQTGIKAIDAMIPVGRGQRELVIGDRQTGKTAICIDAMLNQKQVNDAATDDSDKLFCIYVAIGQKRSTVAQIVKTLEDRGALDYTIVVAATASEPAPLQFLAPFAGCAMGEYFRDNGMHAVIVYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNEDFGLGSLTALPIIETQANDVSAYIPTNVISITDGQIFLETDLFYQGIRPAVNVGLSVSRVGSAAQIKAMKQVAGKIKGELAQYRELAAFAQFGSDLDAATQATLNRGARLTELLKQPQYSPLQVEEQVAVIFAGTRGYLDKVSVSKVTDFEAEFLRHMRNNHGGLLAKIRDEKKMSD----EIEKELAGILDKFVQ 507
>gi|158334080|ref|YP_001515252.1| F0F1 ATP synthase subunit alpha [Acaryochloris marina MBIC11017] >gi|190358137|sp|B0BZL2|ATPA1_ACAM1 ATP synthase subunit alpha 1 (ATPase subunit alpha 1) (ATP synthase F1 sector subunit alpha 1) >gi|158304321|gb|ABW25938.1| ATP synthase F1, alpha subunit [Acaryochloris marina MBIC11017] (505 aa)
Score = 1312, Expect = 1.8e-142, Identities = 248/456 (54%), Positives = 338/456 (74%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDF 456
           +SI  D+ SNII+ QI++Y  +     +G V+ VGDGI +  GL   M  EL+ FE+G+ G+ LNLE    G V++G   D++EGS V+ T  +  +PVGD L+GRV+DA+  PIDG G+I   +   IE  APG++ R SV EP++TG  AIDSM PIG+GQRELIIGD+QTGKT +AID I+NQK ++V C+YV IGQK ST+ Q +  L++ GAL+YT +VA++A+D  +L YLAP+TG  IAE +M  G+  L+IYDDLSK A AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K++ E G GS+TALPI+ET+AGD+SAYIPTNVISITDGQ+F+ ++LFN+G RPAI+AG+SVSRVGS+AQI A+K+ +G LKLELAQ+ EL+AF+QF SDLD+ T+  L  G ++ +++KQ + +P        ++++    Y+  +P D + +F
  S:     2 VSIRPDEISNIIRQQIEQYDQQVKVDNVGTVLQVGDGIARVYGLEQAMAGELLDFEDGTVGIALNLEEDNVGAVLMGDGRDLQEGSTVRSTGKIAQIPVGDALIGRVLDALARPIDGKGDINTSETRLIESPAPGIIERKSVYEPMQTGITAIDSMVPIGRGQRELIIGDRQTGKTAVAIDTILNQKSEDVICVYVAIGQKASTVAQVVEVLRERGALDYTVVVAANANDPATLQYLAPYTGAAIAEYFMYNGKHTLVIYDDLSKQAQAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSPELGEGSMTALPIVETQAGDVSAYIPTNVISITDGQIFLSSDLFNAGLRPAINAGISVSRVGSAAQIKAMKQVAGKLKLELAQFAELEAFAQFASDLDQATQNQLARGARLREILKQPQYSPLPVEEMVAVIYAGTNGYLDDVPTDKVTEF 457
>gi|2493020|sp|P72245|ATPA_RHOCA ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|1524322|emb|CAA67908.1| FoF1 ATP synthase [Rhodobacter capsulatus] (509 aa)
Score = 1312, Expect = 1.8e-142, Identities = 253/472 (53%), Positives = 342/472 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQK-------GKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQ-QKTILE 472
           M I   + S I+K QIK +   A  +E+GRV++VGDGI +  GL NV   E+V F  G  GM LNLE    GIV+ G   DIKEG  VKRT  +VDVP G+GLLGRV+D +GNPIDG G I   ++   +  APG++ R SV EP+ TG  ++D+M PIG+GQRELIIGD+QTGKT IA+D I+NQK       G  + C YV IGQK ST+ Q +  L++ GA+EYTT+VA++ASD   + +LAP++   +AE +   G   LIIYDDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLERS K+N++ G GS+TALP+IET+ GD+SA+IPTNVISITDGQ+F+ T LF  G RPA++ GLSVSRVGSSAQ N++K  +G +KLELAQYRE+ AF+QFGSDLD  T+++L  G ++ +L+KQ + +P + +    ++F+    ++  +PV  +  F++ ++ + +  +K +LE
  S:     1 MGIQAAEISAILKEQIKNFGQDAQVAEVGRVLSVGDGIARVHGLDNVQAGEMVEFPGGIRGMALNLEVDNVGIVIFGSDRDIKEGDTVKRTNAIVDVPAGEGLLGRVVDGLGNPIDGKGPIVAKERRIADVKAPGIIPRKSVHEPMATGLKSVDAMIPIGRGQRELIIGDRQTGKTAIALDTILNQKSYNDANPGNKLHCFYVAIGQKRSTVAQLVKKLEEAGAMEYTTVVAATASDPAPMQFLAPYSATAMAEYFRDNGMHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERSAKLNEDFGSGSLTALPVIETQGGDVSAFIPTNVISITDGQIFLETELFYQGIRPAVNTGLSVSRVGSSAQTNSMKSVAGPVKLELAQYREMAAFAQFGSDLDAATQKLLNRGARLTELMKQPQYSPLTNAEIVAVIFAGTNGFLDAVPVKEVGRFEKGLLAYLRSTRKDVLE 480
>gi|158430724|pdb|2R9V|A Chain A, Crystal Structure Of Atp Synthase Subunit Alpha (Tm1612) From Thermotoga Maritima At 2.10 A Resolution (515 aa)
Score = 1311, Expect = 1.9e-142, Identities = 259/499 (51%), Positives = 358/499 (71%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLF-ENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIR--HFKQQKTILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           + IN  + + +++ +IK ++ K    + G+VI VGDGI +A GL+ V ++ELV F E G  G+  NLE    GI++LG+++DIKEG  V+R K +++VPVG+ LLGRV++ +G P+DG G I      PIE  APGV+ R  V  PL+TG  AIDS  PIG+GQRELIIGD+QTGKT IAID IINQKG+ V CIYV IGQK S I + I+ L+Q+GA EYTT+V +SASD  SL Y+AP+ G    E +   G D L++YDDLSKHA+AYR LSLL RRPPGREAYPGDIFYLHSRLLER+ ++N + GGGS+TALPI+ET+A DISAYIPTNVISITDGQ+++   LF +GQRPAI+ GLSVSRVG SAQI A K+ +G L+++LAQYREL+ F+QF ++LD  T+  +  G+++ +L+KQ++ +P     + ++LF+    Y+  +PV+ +  F+++ +R  H K Q  IL+ I   K+++ +   ++K       T++
  S:    13 LRINPGEITKVLEEKIKSFEEKIDLEDTGKVIQVGDGIARAYGLNKVXVSELVEFVETGVKGVAFNLEEDNVGIIILGEYKDIKEGHTVRRLKRIIEVPVGEELLGRVVNPLGEPLDGKGPINAKNFRPIEIKAPGVIYRKPVDTPLQTGIKAIDSXIPIGRGQRELIIGDRQTGKTAIAIDTIINQKGQGVYCIYVAIGQKKSAIARIIDKLRQYGAXEYTTVVVASASDPASLQYIAPYAGCAXGEYFAYSGRDALVVYDDLSKHAVAYRQLSLLXRRPPGREAYPGDIFYLHSRLLERAVRLNDKLGGGSLTALPIVETQANDISAYIPTNVISITDGQIYLEPGLFYAGQRPAINVGLSVSRVGGSAQIKAXKQVAGXLRIDLAQYRELETFAQFATELDPATRAQIIRGQRLXELLKQEQYSPXPVEEQVVVLFAGVRGYLDDLPVEEVRRFEKEFLRFXHEKHQD-ILDDIKTKKELTSETEEKLKKAIEEFKTTF 513
>gi|126274595|ref|XP_001387600.1| F1F0-ATPase complex, F1 alpha subunit [Pichia stipitis CBS 6054] >gi|126213470|gb|EAZ63577.1| F1F0-ATPase complex, F1 alpha subunit [Pichia stipitis CBS 6054] (545 aa)
Score = 1311, Expect = 2.0e-142, Identities = 251/491 (51%), Positives = 354/491 (72%)
  Q:     9 SNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQK--------GKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKT-ILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           S+I++ +I+   + A  +E GRV++VGDGI +  GL+N+   ELV F +G  GM LNLE    G+V+ G    +KEG  VKRT  +VDVP G  LLGRV+D +GNPIDG G +        +  APG++ R SV EP++TG  ++D++ P+G+GQRELIIGD+QTGKT +A+D I+NQK         K + C+YV +GQK ST+ Q + TL+Q  AL+Y+ IVA++AS+   L Y+APFT   I E +   G+  LI+YDDLSK A+AYR LSLLLRRPPGREAYPGD+FYLHSRLLER+ K++  +GGGS+TALP+IET+ GD+SAYIPTNVISITDGQ+F+   LF  G RPAI+ GLSVSRVGS+AQ+ A+K+ +GSLKL LAQYRE+ AF+QFGSDLD  TK+ L  G+++ +L+KQ + +P +   +  L+F+    ++  IP++ I +F+E  + H K  +T ILE I    ++S++L  ++++   + ++++
  S:    46 SSILEERIRGVSDAANLNETGRVLSVGDGIARIFGLNNIQAEELVEFASGVKGMALNLEPDQVGVVLFGSDRLVKEGETVKRTGKIVDVPTGPELLGRVVDGLGNPIDGKGPLNASSSSRAQVKAPGILPRTSVFEPMQTGLKSVDALVPVGRGQRELIIGDRQTGKTAVALDTILNQKRWNNGADESKKLYCVYVAVGQKRSTVAQLVQTLEQNDALKYSIIVAATASEAAPLQYIAPFTACAIGEWFRDNGKHALIVYDDLSKQAVAYRQLSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSPVHGGGSLTALPVIETQGGDVSAYIPTNVISITDGQIFLEAELFYKGIRPAINVGLSVSRVGSAAQVKAMKQVAGSLKLFLAQYREVAAFAQFGSDLDASTKQTLNRGERLTQLLKQKQYSPLAAEEQVPLIFAGVNGFLDEIPLERIGEFEESFLAHLKANETEILEAIQVKGELSKELLEKLRSTTETFVSTF 545
>gi|116611262|gb|ABK03986.1| ATP synthase F1, alpha subunit [Arthrobacter sp. FB24] (556 aa)
Score = 1311, Expect = 2.1e-142, Identities = 258/483 (53%), Positives = 340/483 (70%)
  Q:     1 MSINLDKFSNIIKNQIKEYQ-NKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKG--------KNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKTILETIDQTKDISQD 483
           ++IN D     +      Y+   A   E+GRV   GDGI +  GL +VM NEL+ FE+G+ G+  NL+    G+++LG F  I+EG  V RT  V+ VPVGD  LGRV+D +G PID  GEIK +    +E  APGV  R SV EP++TG  AID+M PIG+GQR+LIIGD+QTGK+ IAID IINQK         K V+CIYV IGQK STI     TL+  GALEYTTIVAS ASD     YLAP+ G  I + WM  G+ VLI++DDLSK A AYR +SLLLRRPPGREAYPGD+FYLHSRLLER  K++ E G GS+T LP+IET+A D+SAYIPTNVISITDGQ+F+ ++LFN+ QRPA+D G+SVSRVG +AQ+ ++KK SG+LKLELAQYR++ AF+ F SDLD  +++ L  G ++M+L+KQ + +PF    + + +++    Y+  +PV+ I  F+ + + H K + +IL T+ QT  +  D
  S:    15 LTINADDVRIALNEFAASYEPGNAERVEVGRVTTAGDGIARVEGLPSVMANELLRFEDGTLGLAQNLDVREIGVIVLGDFTGIEEGQEVHRTGQVLSVPVGDAFLGRVVDPLGQPIDDLGEIKAETTRALELQAPGVTQRKSVHEPMQTGLKAIDAMIPIGRGQRQLIIGDRQTGKSAIAIDTIINQKANWASGDVTKQVRCIYVAIGQKASTIAAVRQTLEDNGALEYTTIVASPASDPAGFKYLAPYAGSAIGQHWMYGGKHVLIVFDDLSKQAEAYRAVSLLLRRPPGREAYPGDVFYLHSRLLERCAKLSDELGAGSMTGLPLIETKANDVSAYIPTNVISITDGQIFLQSDLFNANQRPAVDVGVSVSRVGGAAQVKSMKKVSGTLKLELAQYRDMQAFAMFASDLDAASRQQLTRGARLMELLKQGQYSPFPVENQVVSIWAGTNGYLDDVPVEDISRFETEFLEHLKHKSSILTTLAQTNVMDDD 506
>gi|169766380|ref|XP_001817661.1| hypothetical protein [Aspergillus oryzae RIB40] >gi|83765516|dbj|BAE55659.1| unnamed protein product [Aspergillus oryzae] (556 aa)
Score = 1311, Expect = 2.1e-142, Identities = 257/491 (52%), Positives = 350/491 (71%)
  Q:     9 SNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQK--------GKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQK-TILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           S+I++ +I+  Q +A  +E GRV++VGDGI +  G++NV   ELV F +G  GM +NLEA   G+V+ G    +KEG  VKRT  +VDVPVG  LLGRV+DA+GNPIDG G +    K   +  APG++ R SV +P++TG   +DSM PIG+GQRELIIGD+QTGKT +A+DA++NQK         K + CIYV +GQK ST+ Q + TL++  A++Y+ +VA++AS+   L YLAPFTG  + E +   G   +IIYDDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+N  +GGGS+TALP+IET+ GD+SAYIPTNVISITDGQ+F+ + LF  G RPAI+ GLSVSRVGS+AQ+ A+K+ +GSLKL LAQYRE+ AF+QFGSDLD  TK+ L  G+++ +L+KQ + +P S S    L+F+    ++  IPV  I  ++   + H K     I E I++   +S++    +K    S   S+
  S:    55 SSILEQRIRGVQEEAGLAETGRVLSVGDGIARVHGMTNVQAEELVEFASGVKGMCMNLEAGQVGVVLFGSDRLVKEGETVKRTGEIVDVPVGPELLGRVVDALGNPIDGKGPLNTKAKSRAQLKAPGILPRRSVNQPVQTGLKCVDSMVPIGRGQRELIIGDRQTGKTAVALDAMLNQKRWNNTSDESKKLYCIYVAVGQKRSTVAQLVKTLEENDAMKYSIVVAATASEAAPLQYLAPFTGCAMGEWFRDNGRHAVIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDTHGGGSLTALPVIETQGGDVSAYIPTNVISITDGQIFLESELFYKGIRPAINVGLSVSRVGSAAQVKAMKQVAGSLKLFLAQYREVAAFAQFGSDLDAATKQTLNRGERLTELLKQKQYSPMSVSDMVPLIFAGVNGHLDNIPVAKILQWESDFLAHLKSNNPEIQEAIEKEGQVSKETEASLKEIIQSFNKSF 554
>gi|160871653|ref|ZP_02061785.1| ATP synthase F1, alpha subunit [Rickettsiella grylli] >gi|159120452|gb|EDP45790.1| ATP synthase F1, alpha subunit [Rickettsiella grylli] (514 aa)
Score = 1311, Expect = 2.2e-142, Identities = 265/496 (53%), Positives = 367/496 (73%)
  Q:     7 KFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINK------ENG-----GGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHF-KQQKTILETIDQTKDISQDLFVQIKNEFNSLITSYIKT 502
           + + IIK +I+++         G ++++ DGIV+  GL++VML E++ F +  YG+ LNLE  + G V+LG +E + EG  VK T  +++VPVG+ LLGRV++A+G+PIDG G I+ +KK PIE+IAPGV+ R SV +PL+TG LAIDSM PIG+GQRELIIGD+QTGKT +AIDAIINQK   VKCIYV IGQK S+I   +  L++  AL++T I++++A+D  +L ++AP+ G  + E +  +GED LIIYDDL+K A AYR +SLLLRRPPGREAYPGDIFYLHSRLLER+ ++N+       NG      GS+TALPIIET+AGD+SA++PTNVISITDGQ+F+ T+LFNSG RPAI+AGLSVSRVGS+AQ   +KK  G ++L LAQYREL AFSQF SDLD+ T++ LE G++V +++KQ + +P S +  A+LLF++ + Y+  I +  I  F E ++ +   ++   LE I+Q  D ++     I N  N  IT++  T
  S:     8 EINEIIKERIQKFDISTETRTEGTIVSLRDGIVRIYGLNDVMLGEMIEFSSQCYGLALNLERDSVGAVVLGDYEGLSEGQTVKCTGRILEVPVGEALLGRVVNALGHPIDGRGTIETEKKSPIEQIAPGVIWRQSVSQPLQTGILAIDSMVPIGRGQRELIIGDRQTGKTALAIDAIINQKDTGVKCIYVAIGQKASSIAAVVRKLEEQDALKHTIIISANAADSAALQFIAPYAGCAMGEYFRDQGEDALIIYDDLTKQAWAYRQISLLLRRPPGREAYPGDIFYLHSRLLERAARVNEAFVEKATNGRVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETDLFNSGIRPAINAGLSVSRVGSAAQTKIIKKLGGGVRLSLAQYRELAAFSQFMSDLDEVTRKQLERGQRVTEILKQKQYSPLSVAEMAVLLFAVDKGYLDDIELTKIVAFSEGLLAYMHSEEMACLEQINQKDDYNE----TIVNALNRAITAFKTT 511
>gi|116750010|ref|YP_846697.1| F0F1 ATP synthase subunit alpha [Syntrophobacter fumaroxidans MPOB] >gi|158512352|sp|A0LLG0|ATPA_SYNFM ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|116699074|gb|ABK18262.1| ATP synthase F1, alpha subunit [Syntrophobacter fumaroxidans MPOB] (505 aa)
Score = 1311, Expect = 2.2e-142, Identities = 261/489 (53%), Positives = 356/489 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLF--ENGS-YGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHF-KQQKTILETIDQTKDISQDLFVQIK 489
           M I  ++ S II+ QIK+Y+ +   SE GRV++VGDGI +  G+   M  EL+ F  E+G  YG+ LNLE    G+ ++G+   IKEGS VKRT  +  VPVGD +LGR+ID++GNP+DG G I+  +   +E IAPGV+AR SV EP+ TG  AID+M P+G+GQRELIIGD+Q GKT IA+D IINQK   + CIYV +GQK ST+ Q + TL++ GA++YT +VA++ASD  +L Y+AP+ G  + E +  KG   LIIYDDLSK A AYR +SLLLRRPP REAYPGDIFY HSRLLER+ K+N E GGGS+TALPIIET+AGD+SAYIPTNVISITDGQ+++  NLF +G RPAI+ GLSVSRVG +AQ  A+K+ +G L+L+LAQYREL+AF++FGSDLDK T+  L  G ++ +L+KQ +  P     E + L++    ++  IPV+ + +F+++++    ++   IL  I + K IS++L  ++K
  S:     1 MEIRAEEISQIIREQIKDYEKQVELSETGRVLSVGDGIARVYGVEKCMSMELLEFPTEHGVVYGLALNLEEDNVGVAIMGEDIHIKEGSEVKRTGRIASVPVGDAVLGRIIDSVGNPVDGKGPIEAKEFSRVEVIAPGVIARQSVNEPMYTGLKAIDAMTPVGRGQRELIIGDRQIGKTAIAVDTIINQKDSGIICIYVAVGQKKSTVAQVVETLRKHGAMDYTIVVAANASDPAALQYIAPYAGCAMGEYYRDKGRHALIIYDDLSKQAAAYRQVSLLLRRPPAREAYPGDIFYNHSRLLERAAKLNAELGGGSLTALPIIETQAGDVSAYIPTNVISITDGQIYLEPNLFFAGVRPAINVGLSVSRVGGAAQTKAMKQVAGRLRLDLAQYRELEAFAKFGSDLDKATQAQLNRGMRMTELLKQPQYQPMPAEREVMSLYAGTRGHLDNIPVEKVLEFEKEMLSFVDRKYPEILSEIKEKKIISEELDGKMK 493
>gi|49476189|ref|YP_034230.1| F0F1 ATP synthase subunit alpha [Bartonella henselae str. Houston-1] >gi|81696108|sp|Q6G1W7|ATPA_BARHE ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|49238997|emb|CAF28297.1| ATP synthase alpha chain [Bartonella henselae str. Houston-1] (511 aa)
Score = 1311, Expect = 2.2e-142, Identities = 260/501 (51%), Positives = 352/501 (70%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQK----------GKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKT-ILETIDQTKDISQDLFVQIKNEFNSLITSYIK 501
           M I   + S I+K QIK +  KA  SEIG V++VGDGI +  GL NV   E+V F NG  GM LNLE    G+V+ G   DI+EG  VKR   +V+VPVG  LLGRV+DA+GNPIDG G +K  +   ++  APG++ R SV EP+ TG  AID++ PIG+GQREL+IGD+QTGKT I +DA +NQK             V CIYV IGQK ST+ QF+  L++ GALEY+ IVA++ASD   + ++AP  G  + E +   G+  LI YDDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+N ENG GS+TALP+IET+A D+SAYIPTNVISITDGQ+F+ TNLF  G RPA++ GLSVSRVGS+AQI A+K+ +GS+K ELAQYRE+ AF+QFGSDLD  T+ +L  G ++ +L+KQ + +P     + +++F+    Y+  + V  +  F++ ++   +   + +L+ I   K ++ D    IK++   ++ +Y K
  S:     1 MDIRPSEISKILKEQIKNFDQKAEVSEIGWVLSVGDGIARVYGLDNVQAGEMVSFSNGVRGMALNLEIDNVGVVIFGSDRDIREGDCVKRLGAIVEVPVGPALLGRVVDALGNPIDGKGPLKATEYRRVDVKAPGIIPRQSVHEPMSTGLKAIDALIPIGRGQRELVIGDRQTGKTAILLDAFLNQKPFHEKDAGNEKDKVYCIYVAIGQKRSTVAQFVKVLEERGALEYSIIVAATASDPAPMQFIAPLAGCAMGEYFRDNGQHALIGYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNAENGSGSLTALPVIETQANDVSAYIPTNVISITDGQIFLETNLFYQGIRPAVNVGLSVSRVGSAAQIKAMKQVAGSIKGELAQYREMAAFAQFGSDLDASTQRLLNRGARLTELLKQPQFSPLKTEEQVVVIFAGVNGYLDALAVADVGRFEQGLLTLLRSDHSDLLQAIADQKQLTDD----IKDKLIVVLNTYAK 508
>gi|39972915|ref|XP_367848.1| mitochondrial F1 ATPase subunit alpha [Magnaporthe grisea 70-15] >gi|145012523|gb|EDJ97177.1| mitochondrial F1 ATPase subunit alpha [Magnaporthe grisea 70-15] (551 aa)
Score = 1311, Expect = 2.4e-142, Identities = 254/492 (51%), Positives = 360/492 (73%)
  Q:     9 SNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQK--------GKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKI-NKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKT-ILETIDQTKDISQDLFVQIKNEFNSLITSYI 500
           S+I++ +I+  Q +A  +E GRV++VGDGI +  G++NV   ELV F +G  GM +NLEA   G+V+ G    +KEG  VKRT  +VD+PVG  +LGRV+DA+GNPIDG G I   ++   +  APG++ R SV +P++TG  ++D+M PIG+GQRELIIGD+QTGKT +A+DA++NQK         K + C+YV +GQK ST+ Q + TL++  A+ Y+ +VA++AS+   L YLAPFTG +I E +   G+  L+I+DDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+ N+ +GGGS+TALPIIET+ GD+SAYIPTNVISITDGQ+F+   LF  G RPAI+ GLSVSRVGS+AQ+ A+K+ +GSLKL LAQYRE+ AF+QFGSDLD  TK+ L  G+++ +L+KQ + +P + +    L+F+    ++  +PV  I  ++   + H K  ++ +L TI++   IS+DL  ++++   S   S+I
  S:    49 SSILEQRIRGVQEEAGLAETGRVLSVGDGIARVHGMANVQAEELVEFASGVKGMCMNLEAGQVGVVLFGSDRLVKEGETVKRTGEIVDIPVGPEMLGRVVDALGNPIDGKGPINTKERSRAQLKAPGILPRQSVNQPVQTGLKSVDAMVPIGRGQRELIIGDRQTGKTAVALDAMLNQKRWNNSNDETKKLYCVYVAVGQKRSTVAQLVKTLEENDAMRYSVVVAATASEAAPLQYLAPFTGASIGEWFRDNGKHSLVIFDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNNRTHGGGSMTALPIIETQGGDVSAYIPTNVISITDGQIFLEAELFYKGIRPAINVGLSVSRVGSAAQLKAMKQVAGSLKLFLAQYREVAAFAQFGSDLDAATKQTLNRGERLTELLKQKQYSPMAVNEMVPLIFAGVNGFLDNVPVAKILQWEADFLSHLKTNESDLLATIEKEGAISKDLEARLRDVVGSFTKSFI 550
>gi|15673748|ref|NP_267922.1| F0F1 ATP synthase subunit alpha [Lactococcus lactis subsp. lactis Il1403] >gi|22653660|sp|Q9CER8|ATPA_LACLA ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|12724788|gb|AAK05864.1|AE006406_8 ATP synthase alpha subunit (EC 3.6.1.34) [Lactococcus lactis subsp. lactis Il1403] (500 aa)
Score = 1310, Expect = 2.4e-142, Identities = 259/483 (53%), Positives = 357/483 (73%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQ-KTILETIDQTKDISQD 483
           M+I  ++ S++IK QI+ +      +E G V  VGDGI +A GL N M  ELV F NG  GM  NL+AT  GI++LG F  I+EG  VKRT  ++++ VG+ L+GRV++ +G P+DG GE+   K  P+E  APGVM R SV EPL+TG  AID++ PIG+GQRELIIGD+QTGKT++AIDAI+NQKG+++ CIYV IGQK ST+   + TL++ GA++YT +V +SAS    L Y+AP+ G  + EE+M  G+ VL++YDDLSK A+AYR LSLLLRRPPGREAYPGD+FYLHSRLLER+ K++ + GGGS+TALP IET+AGDISAYI TNVISITDGQ+F+  +LF SG RPAIDAG SVSRVG +AQI A+KK +G+L+L+LA +REL+AF+QFGSDLD+ T+  L  G++ ++++KQ  + P +   + ++L+++   ++  +PVD + DF+ K+   F      +L  I +TKD+ ++
  S:     1 MAIKANEISSLIKKQIENFTPDFEVAETGVVTYVGDGIARAYGLENAMSGELVEFSNGVLGMAQNLDATDVGIIVLGDFLSIREGDTVKRTGKIMEIQVGEELIGRVVNPLGQPVDGLGELNTGKTRPVEAKAPGVMQRKSVSEPLQTGLKAIDALVPIGRGQRELIIGDRQTGKTSVAIDAILNQKGQDMICIYVAIGQKESTVRTQVETLRKLGAMDYTIVVTASASQPSPLLYIAPYAGAAMGEEFMYNGKHVLVVYDDLSKQAVAYRELSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSDDLGGGSMTALPFIETQAGDISAYIATNVISITDGQIFLENDLFYSGVRPAIDAGSSVSRVGGAAQIKAMKKVAGTLRLDLASFRELEAFTQFGSDLDEATQAKLNRGRRTVEVLKQPLHKPLAVEKQVLILYALTHGHLDDVPVDDVLDFETKMFDFFDANYAELLNVITETKDLPEE 484
>gi|148652007|ref|YP_001279100.1| F0F1 ATP synthase subunit alpha [Psychrobacter sp. PRwf-1] >gi|172048448|sp|A5WBV9|ATPA_PSYWF ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|148571091|gb|ABQ93150.1| ATP synthase F1, alpha subunit [Psychrobacter sp. PRwf-1] (514 aa)
Score = 1310, Expect = 2.5e-142, Identities = 258/497 (51%), Positives = 360/497 (72%)
  Q:     3 INLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINK------ENG-----GGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRH-FKQQKTILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           +N  + S +IK +I++    A     G ++ V DGIVQ  GL + M  E++ FE   YGM LNLE  + G V+LG +  ++EG     T  +++VPVG  LLGRV+DA+GNPIDG G I       +EKIAPGV+AR SV EP+ TG  A+D+M PIG+GQRELIIGD+QTGKT +AIDAII QK   +KC+YV IGQK STI   +  L++ GAL YTT+V +SAS+  +L Y+AP++G T+ E +  +GED LI+YDDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ ++N        NG      GS+TALPIIET+AGD+SA++PTNVISITDGQ+F+ ++LFNSG RPA++AG+SVSRVG +AQ   +KK SG ++  LAQYREL AF+QF SDLD  TK+ L+HG++V +L+KQ +  P S + +A ++F+  E Y+  IPV+ I  ++E  +R+ + +Q  +++ I+ T + + D+  ++K+   + + ++
  S:     4 LNPAEISQLIKQRIQDLDTSATAKNEGTIVKVSDGIVQIHGLEDAMYGEMIEFEGDVYGMALNLEQDSVGAVVLGDYLGLQEGQKAYCTGRILEVPVGPELLGRVVDALGNPIDGKGPINAKLTDKVEKIAPGVIARQSVDEPVMTGYKAVDTMIPIGRGQRELIIGDRQTGKTAMAIDAIIAQKNSGIKCVYVAIGQKRSTIANVVRKLEETGALAYTTVVVASASEPAALQYIAPYSGCTMGEYFRDRGEDALIVYDDLSKQAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLERASRVNAAYVEEFTNGEVKGQTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLESSLFNSGIRPAVNAGISVSRVGGAAQTKIIKKLSGGIRTALAQYRELAAFAQFASDLDDATKQQLDHGERVTELMKQKQYQPMSIAEQAAVIFASNEGYLSAIPVEKIGAWEEAYLRYMYDEQADLMQEINDTANYNDDIAGRLKSSVETFLQNH 512
>gi|69936533|ref|ZP_00631317.1| ATP synthase F1, alpha subunit [Paracoccus denitrificans PD1222] >gi|119386523|ref|YP_917578.1| F0F1 ATP synthase subunit alpha [Paracoccus denitrificans PD1222] >gi|158512595|sp|A1B8N8|ATPA_PARDP ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|119377118|gb|ABL71882.1| ATP synthase F1, alpha subunit [Paracoccus denitrificans PD1222] (511 aa)
Score = 1310, Expect = 2.7e-142, Identities = 258/502 (51%), Positives = 357/502 (71%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKG---------KNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKT-ILETIDQTKDISQDLFVQIKNEFNSLITSYIKT 502
           M I   + S I+K+QIK +   A  +E+G+V++VGDGI +  GL  V   E+V F  G  GM LNLE    G+V+ G   DIKEG  VKRT  +V+VP G  LLGRV+DA+GNPIDG G +   ++   +  APG+M R SV EP+ TG  ++D+M P+G+GQRELIIGD+QTGKT IA+D I+NQ           K + CIYV +GQK ST+ Q +  L++ GA+ YTT+VA++ASD   + YLAP++   + E +   G D LIIYDDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLERS K+N+ NG GS+TALPIIET+AGD+SAYIPTNVISITDGQ+F+ T LF  G RPA++ GLSVSRVGS+AQ  A+K  +G +KLELAQYRE+ AF+QFGSDLD  T+++L  G ++ +L+KQ + +P + +   I++++  + Y+  IPV  +  ++  ++++ + QK  +LE  D TK+  + +  ++++   + +  Y KT
  S:     1 MGIQAAEISAILKDQIKNFGQDAEVAEVGQVLSVGDGIARVYGLDKVQAGEMVEFPGGIRGMVLNLETDNVGVVIFGDDRDIKEGDTVKRTGAIVEVPAGKELLGRVVDALGNPIDGKGPLNASERRIADVKAPGIMPRKSVHEPMATGLKSVDAMIPVGRGQRELIIGDRQTGKTAIALDTILNQANYNGREADGMKTLHCIYVAVGQKRSTVAQLVKKLEETGAMAYTTVVAATASDPAPMQYLAPYSATAMGEYFRDNGMDALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERSAKLNEANGAGSLTALPIIETQAGDVSAYIPTNVISITDGQIFLETELFFQGIRPAVNTGLSVSRVGSAAQTKAMKSVAGPVKLELAQYREMAAFAQFGSDLDAATQKLLNRGARLTELMKQPQYSPLTNAEIVIVIYAGTKGYLDGIPVRDVTKWEHGLLQYLRNQKADLLE--DMTKN-DRKVAGELEDAIKAALDGYAKT 509
>gi|116254141|ref|YP_769979.1| F0F1 ATP synthase subunit alpha [Rhizobium leguminosarum bv. viciae 3841] >gi|118573486|sp|Q1MAZ0|ATPA_RHIL3 ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|115258789|emb|CAK09895.1| putative ATP synthase alpha chain [Rhizobium leguminosarum bv. viciae 3841] (509 aa)
Score = 1309, Expect = 3.2e-142, Identities = 256/499 (51%), Positives = 353/499 (70%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQK--------GKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKT-ILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           M I   + S I+K+QIK +  +A  SE+G+V++VGDGI +  GL NV   E+V F  G  GM LNLE+   G+V+ G   DIKEG  VKRT  +VDVPVG  LLGRV+DA+GNPIDG G I   ++  ++  APG++ R SV EP+ TG  AID++ P+G+GQREL+IGD+QTGKT I +DA +NQK        G+ + C+YV IGQK ST+ QF+  L++ GAL+Y+ IVA++ASD   + YLAPF G  + E +   G   LI YDDLSK A++YR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+N + G GS+TALP+IET+  D+SA+IPTNVISITDGQ+F+ T+LF  G RPA++ GLSVSRVGS+AQI A+K+ +GS+K ELAQYRE+ AF+QFGSDLD  T+ +L  G ++ +L+KQ + +P     +  ++F+    Y+  +PV  +  F++  + + + + + IL+ I   K IS D   ++    +S   S+
  S:     1 MDIRAAEISAILKDQIKNFGKEAEVSEVGQVLSVGDGIARVYGLDNVQAGEMVEFPGGIRGMALNLESDNVGVVIFGSDRDIKEGDTVKRTGAIVDVPVGPELLGRVVDALGNPIDGKGPINATRRSRVDIKAPGIIPRKSVHEPMSTGLKAIDALIPVGRGQRELVIGDRQTGKTAILLDAFLNQKAIHDNGPEGEKLYCVYVAIGQKRSTVAQFVKVLEERGALKYSIIVAATASDPAPMQYLAPFAGCAMGEYFRDNGMHALIGYDDLSKQAVSYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDDMGAGSLTALPVIETQGNDVSAFIPTNVISITDGQIFLETDLFYQGIRPAVNVGLSVSRVGSAAQIKAMKQVAGSIKGELAQYREMAAFAQFGSDLDAATQRLLNRGARLTELLKQPQFSPLKTEEQVAVIFAGVNGYLDKLPVASVGKFEQGFLSYLRSEGSAILDAIRTEKAISDDTRGKLTAALDSFAKSF 508
>gi|163700376|ref|ZP_02119231.1| T-plasminogen activator [Methylobacterium nodulans ORS 2060] >gi|162433477|gb|EDQ44066.1| T-plasminogen activator [Methylobacterium nodulans ORS 2060] (509 aa)
Score = 1309, Expect = 3.5e-142, Identities = 255/499 (51%), Positives = 354/499 (70%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQK----GKNVK----CIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK-QQKTILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           M I   + S I+K QIK +  +A  +E+G+V++VGDGI +  GL  V   E+V FE+G  GM LNLE    G+V+ G   DIKEG  VKRT  +VDVPVG GLLGRV+DA+GNPIDG G I   ++  ++  APG++ R SV EP+ TG  ++D++ PIG+GQRELIIGD+QTGKT IA+D I+NQK    G + K    C+YV +GQK ST+ QF+  L+  GALEY+ ++A++ASD   + +LAPF+G  + E +   G   +IIYDDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+    G GS+TALP+IET+A D+SAYIPTNVISITDGQ+F+ T+LF  G RPA++ GLSVSRVGS+AQ  A+KK +G +K ELAQYRE+ AF+QFGSDLD  T+ +L  G ++ +L+KQ + +P     +  ++++    Y+  IPV+ +  F++ ++   + +   +LE I  +KD+S +   ++K    +   S+
  S:     1 MDIRAAEISAILKEQIKNFGQEAEVTEVGQVLSVGDGIARVYGLDKVQAGEMVEFESGVRGMALNLEQDNVGVVIFGVDRDIKEGQTVKRTGAIVDVPVGKGLLGRVVDALGNPIDGKGPIVASERRRVDVKAPGIIPRKSVHEPMATGLKSVDALIPIGRGQRELIIGDRQTGKTAIALDTILNQKPAHEGSDEKAKLYCVYVAVGQKRSTVAQFVKVLEDNGALEYSIVIAATASDPAPMQFLAPFSGCAMGEFFRDNGMHAVIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMGDAAGAGSLTALPVIETQANDVSAYIPTNVISITDGQIFLETDLFYQGVRPAVNVGLSVSRVGSAAQTKAMKKVAGKIKGELAQYREMAAFAQFGSDLDAATQRLLNRGSRLTELLKQPQFSPLKMEEQVAVIYAGVNGYLDPIPVNRVRAFEDGLLATLRGKHADLLEAIRASKDLSDESAAKLKGVVEAFAKSF 508
>gi|160893775|ref|ZP_02074559.1| hypothetical protein CLOL250_01329 [Clostridium sp. L2-50] >gi|156864760|gb|EDO58191.1| hypothetical protein CLOL250_01329 [Clostridium sp. L2-50] (502 aa)
Score = 1309, Expect = 3.5e-142, Identities = 259/473 (54%), Positives = 350/473 (73%)
  Q:    12 IKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQ-QKTILETIDQTKDISQDL 484
           +K++I+ +       E+G VI VGDGIV   G+ N M  E+V+FENG  GM  ++  T  G ++ GK   IKEG+ V RT     VPVG+  LGR+I+A+G PIDG G IK    MP+E+ AP +  R SV EPL+TG L+IDSMFPIGKGQRELIIGD+QTGKT+IA+D IINQ+GK+V CIYV IGQK ST+ + ++TL++  A++YT IVAS+ASD   L Y+AP+ G ++AE +M KG+DVLI+YDDLSKHA+AYRTLSLLL R PGREAYPGD+FYLHSRLLERS K+    GGGSITALPIIET+AGD+SAYIPTNVISITDGQ+F+ ++LF SG RPA++ GLSVSRVG +AQ  A+KK +G+++++LAQ+RE++ F+QF SDLD+ TKE L +GK +M+L+KQ    P S + + I L +   K    + +  ++  +  ++ +FK  +  +++ I++ K ++ DL
  S:    13 LKSEIENFDFDTRDKEVGTVIWVGDGIVTIYGIDNAMYGEIVVFENGIKGMVQDIRRTEIGCILFGKDTGIKEGTKVTRTGKRAGVPVGEEFLGRIINALGAPIDGKGAIKEADYMPVEQEAPSIADRQSVNEPLQTGILSIDSMFPIGKGQRELIIGDRQTGKTSIALDTIINQRGKDVVCIYVAIGQKASTVAKIVSTLEKNDAMDYTIIVASTASDPAPLQYIAPYAGTSMAEYFMHKGKDVLIVYDDLSKHAVAYRTLSLLLGRSPGREAYPGDVFYLHSRLLERSSKLKDSLGGGSITALPIIETQAGDVSAYIPTNVISITDGQIFLESDLFFSGMRPAVNVGLSVSRVGGAAQTKAMKKATGTVRIDLAQFREMEVFTQFSSDLDENTKEQLTYGKGLMELLKQPLCHPLSMAEQVITLVAATNKLFLNVDIKKVKQTQMDMLAYFKDAEPDVIKEIEEGKVLTDDL 486
>gi|91208868|ref|YP_539029.1| ATP synthase F1 subunit alpha [Physcomitrella patens] >gi|90991408|dbj|BAE93100.1| ATP synthase F1 subunit alpha [Physcomitrella patens] (518 aa)
Score = 1309, Expect = 3.5e-142, Identities = 258/496 (52%), Positives = 353/496 (71%)
  Q:     7 KFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVK---------CIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKTILETIDQTKDISQDLFVQIKNEFNSLITSYIKT 502
           + S +++ +I  Y  K    EIGRV++VGDGI +  GL+ +   E+V F +G  GM LNLE    GIV+ G    IKEG IVKRT ++VDVPVG GLLGRV+DA+G PIDG G +   ++  +E  APG++AR SV EP++TG  A+DS+ PIG+GQRELIIGD+QTGKT IAID I+NQK  N +         C+YV IGQK ST+ Q +  L + GALEY  IVA++ASD   L +LAP++G  + E +   G   LIIYDDLSK ++AYR +SLLLRRPPGREA+PGD+FYLHSRLLER+ K++ + G GS+TALP+IET+AGD+SAYIPTNVISITDGQ+F+ T LF  G RPAI+ GLSVSRVGS+AQ+ A+K+  GSLKLELAQYRE+ AF+QFGSDLD  T+ +L  G ++ +++KQ + +P S   + +++++  + Y+  IP+  I  ++ ++++       IL  I Q K+I++ +  Q+         S++ T
  S:    13 ELSTLLEQRITNYYTKLQVDEIGRVVSVGDGIARVYGLNKIQAGEMVEFASGVKGMALNLENENVGIVIFGSDTAIKEGDIVKRTGSIVDVPVGKGLLGRVVDALGVPIDGKGALSAAERRRVEVKAPGIIARKSVHEPMQTGLKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTILNQKQINTQGTSDSEKLYCVYVAIGQKRSTVAQLVKILSEAGALEYCIIVAATASDPAPLQFLAPYSGCAMGEYFRDNGMHALIIYDDLSKQSVAYRQMSLLLRRPPGREAFPGDVFYLHSRLLERAAKMSDQTGAGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYRGIRPAINVGLSVSRVGSAAQLKAMKQVCGSLKLELAQYREVAAFAQFGSDLDAATQYLLNRGARLTEVLKQPQYSPISIEKQIVVIYAAVKGYLDQIPISSINQYEHELLKSIDPD--ILSAIVQQKNITEQINSQLATFCQKFTQSFLAT 515
>gi|16127679|ref|NP_422243.1| F0F1 ATP synthase subunit alpha [Caulobacter crescentus CB15] >gi|81620921|sp|Q9A2V7|ATPA_CAUCR ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|13425167|gb|AAK25411.1| ATP synthase F1, alpha subunit [Caulobacter crescentus CB15] (510 aa)
Score = 1309, Expect = 3.5e-142, Identities = 258/499 (51%), Positives = 359/499 (71%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLF-ENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKN--------VKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFK-EKIIRHFKQQKTILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           M I   + S I+K+QI  +  +A  S++G+V++VGDGI +  GL NV   E++ F + G  GM LNLE    G V+ G+ ++IKEG  V+R   +VDVPVG GLLGRV++ +G PIDG G I+Y ++  ++  APG++ R SV EP++TG  +ID++ P+G+GQRELIIGD+QTGKT +AID I+NQK  N        + C+YV IGQK ST+ Q + TL++ GALEYTT+V +SAS+   L YLAPF G  + E +   G   LIIYDDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+N++NG GS+TALPIIET+A D+SAYIPTNVISITDGQ+F+ T+LF  G RPA++ G+SVSRVGSSAQI A+K+ +G +K ELAQYRE+ AF++FGSDLD  T+++L  G+++ +L+KQ +  P S   +  ++++    Y+  IP   +  F+ E + R   Q   +LE I   K + +DL   +K+  +S  +++
  S:     1 MDIRAAEISAILKSQIANFGEEAAVSDVGQVLSVGDGIARIYGLDNVQAGEMLEFPKAGVKGMALNLERDNVGAVIFGQDQEIKEGDEVRRLGEIVDVPVGRGLLGRVVNPLGEPIDGKGPIQYTERRRVDVKAPGIIPRKSVHEPVQTGLKSIDTLIPVGRGQRELIIGDRQTGKTAVAIDTILNQKAVNAGKDESAKLYCVYVAIGQKRSTVAQIVKTLEEHGALEYTTVVVASASEPAPLQYLAPFAGCAMGEWFRDNGLHGLIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNEDNGSGSLTALPIIETQANDVSAYIPTNVISITDGQIFLETDLFYQGIRPAVNVGISVSRVGSSAQIKAMKQVAGPIKGELAQYREMAAFAKFGSDLDASTQKMLARGERLTELLKQPQYAPLSVEEQVCVIYAGTRGYLDGIPTSSVRRFEAEFLARLHSQHADLLEGIRTKKALDKDLENTLKSALDSFSSTF 509
>gi|94971360|ref|YP_593408.1| F0F1 ATP synthase subunit alpha [Acidobacteria bacterium Ellin345] >gi|118573471|sp|Q1IIG6|ATPA_ACIBL ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|94553410|gb|ABF43334.1| ATP synthase F1, alpha subunit [Acidobacteria bacterium Ellin345] (512 aa)
Score = 1309, Expect = 3.5e-142, Identities = 261/480 (54%), Positives = 354/480 (73%)
  Q:     3 INLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQD--KNTPFSQSLEAI------LLFSIKEKYIRWIP---VDYIEDFKEKIIRHFKQQKTILETI--DQTKDISQ 482
           I  D+ + +I++QI+ Y+ K    E+G V+++GDGI +  G+  VM  EL+ F +G  G+ +NL+    G V+LG++  IKEG  VKRTK ++ VPVG+ ++GRV++A+G PID  G I  DK  P+E+IAPGV+ R  V EP+ TG  AID+M P+G+GQRELIIGD+QTGKT +A+D IIN KGKN+ C+YV IGQK S++ Q +  L+  GA+EY+ +V +SASD   + Y+AP++G  IAE +   G   L IYDDLSK A AYR +SLLLRRPPGREAYPGD+FYLHSRLLERS K++ + GGGSITALPIIET+AGD+SAYIPTNVISITDGQ+++ T+LFNSG RPA++ GLSVSRVG SA I A+K+   SLKLELAQYREL AFSQFGSDLDK T+  L  G+++++++KQD  +  PFS+ +  I      LL  ++ K +R       +Y+E    ++ R  +++K + + I  D TK I +
  S:     4 IKADEITKLIRSQIENYETKIAVDEVGTVMSIGDGIARVYGIDKVMAGELLAFPHGVAGIAMNLDEDQVGAVLLGEYTAIKEGDEVKRTKRIMSVPVGEAMIGRVVNALGQPIDDKGPIVTDKFNPVERIAPGVIDRQPVREPMATGLKAIDAMIPVGRGQRELIIGDRQTGKTAVALDTIINSKGKNLICVYVAIGQKRSSVAQVVKMLEDNGAMEYSIVVVASASDPAPMQYIAPYSGTAIAEYFRDSGRHALCIYDDLSKQAAAYREISLLLRRPPGREAYPGDVFYLHSRLLERSSKLSDKLGGGSITALPIIETQAGDVSAYIPTNVISITDGQIYLETDLFNSGVRPAVNVGLSVSRVGFSAAIKAMKQVGASLKLELAQYRELAAFSQFGSDLDKATQAQLNRGQRLVEILKQDQFQPLPFSKQITIIFAGTNGLLDDLEVKDVRPFEKALYEYVESANPQLFRTIEEKKALDDAIKADMTKTIKE 496
>gi|171909871|ref|ZP_02925341.1| ATP synthase F1, alpha subunit [Verrucomicrobium spinosum DSM 4136] (510 aa)
Score = 1309, Expect = 3.5e-142, Identities = 257/488 (52%), Positives = 357/488 (73%)
  Q:    12 IKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKN-------------VKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQK-TILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           I+ +I   +     S +G V  +GDG+ +  GLS+VMLNE++ F  G YG+ LNLE T  G ++LG   ++KEG  VK T  +++VPVG+G+LGRV++++G P+DG G+IK D   P+EKIAPG++ R SV  PL+TG +++D+M PIG+GQRELIIGD+ TGKTTIA+D II+Q  +N             V CIYV +GQK + I + I TL+  GAL YT IV++SA+D  +  YLAP+ G  + E +M KGEDVLII+DDLSKHA+AYR +SL+LRRP GREAYPGD+FYLHSRLLERS +++   GGGS+TALPIIET+AGD+SAYIPTNVISITDGQ+F+ T+LF  G RPAI  GLSVSRVGS+AQ  A+KK SG+ KL+LAQ+REL AF+QFGSDLD  TK  L+ G+++++L KQ +  P S  + A +L++++      +PVD +++F+ K     + +K + L+ +   K++ +D+  ++K        S+
  S:     8 IETEIAGLKTSVTRSNVGVVREIGDGVAKIEGLSDVMLNEMIEFPGGLYGLALNLEETEVGAILLGDGLNVKEGDEVKTTGRLLEVPVGNGVLGRVVNSLGQPLDGKGDIKGDAFYPVEKIAPGIVKRKSVSVPLQTGIMSVDAMIPIGRGQRELIIGDRSTGKTTIAVDTIISQARQNKAAEEGQLQGHKRVICIYVAVGQKQANIARVIKTLEDAGALPYTIIVSASAADSATNQYLAPYAGCAMGEYFMDKGEDVLIIFDDLSKHAVAYRQVSLVLRRPSGREAYPGDVFYLHSRLLERSARLSDAAGGGSMTALPIIETQAGDVSAYIPTNVISITDGQIFLETDLFYQGVRPAISVGLSVSRVGSAAQTKAIKKVSGTTKLDLAQFRELAAFAQFGSDLDAATKAKLDRGQRIVELFKQGQYNPKSLEIMASILWAMQNGGFDDVPVDRVKEFQAKFEEFLETRKSSYLDKLRNAKELKEDIVAELKTALADFKASW 509
>gi|149925406|ref|ZP_01913670.1| F0F1 ATP synthase subunit alpha [Limnobacter sp. MED105] >gi|149825523|gb|EDM84731.1| F0F1 ATP synthase subunit alpha [Limnobacter sp. MED105] (513 aa)
Score = 1309, Expect = 3.5e-142, Identities = 258/483 (53%), Positives = 355/483 (73%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKE-----------NGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQ--QKTILETIDQTKDISQD 483
           M IN  + S +IK++I+   + A     G V++V DGI +  GLS+VM  E++ F   ++G+ LNLE  + G+V+LG +E I EG +VK T  +++VPVG  L GRV++A+G PIDG G +       IEK+APGV+ R SV +PL+TG  AID+M P+G+GQRELIIGD+QTGKT +AIDAIINQKG  V C+YV +GQK S+IV  +  L++ GALEYT +V +SAS+  ++ YLAP++G T+ E +  +GED LI+YDDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ ++N E              GS+TALPIIET+AGD++A++PTNVISITDGQ+F+ T+LFN+G RPAI+AG+SVSRVG +AQ   VKK SG ++ +LAQYREL AF+QF SDLD+ T+  LE G++V++L+KQ +  P      A+ LF+I   Y+  + V  +  F E  +R F Q   K +++ I+QT ++S+D
  S:     1 MQINPSEISELIKSRIEGLGSSADIRTQGTVVSVSDGICRVHGLSDVMQGEMLEFPGNTFGLALNLERDSVGVVILGSYEHISEGDMVKCTGRILEVPVGPELRGRVVNALGVPIDGKGPVNAKMTDVIEKVAPGVIERKSVDQPLQTGVKAIDAMVPVGRGQRELIIGDRQTGKTAVAIDAIINQKGTGVTCVYVAVGQKASSIVNVLRKLEEHGALEYTIVVVASASESAAMQYLAPYSGCTMGEYFRDRGEDALIVYDDLSKQAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLERASRVNAEYVEKFTKGEVKGKTGSLTALPIIETQAGDVTAFVPTNVISITDGQIFLETDLFNAGIRPAINAGISVSRVGGAAQTKVVKKLSGGIRTDLAQYRELAAFAQFASDLDEATRRQLERGRRVVELLKQPQYAPLKTWEMALALFAINNGYLDDVEVSNVLPF-EVSLRQFMQTSHKDLIDRIEQTYELSKD 495
>gi|81299147|ref|YP_399355.1| F0F1 ATP synthase subunit alpha [Synechococcus elongatus PCC 7942] >gi|124007219|sp|Q31RF1|ATPA_SYNP7 ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|81168028|gb|ABB56368.1| ATP synthase F1, alpha subunit [Synechococcus elongatus PCC 7942] (505 aa)
Score = 1309, Expect = 3.7e-142, Identities = 256/480 (53%), Positives = 351/480 (73%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQK-TILETIDQTKDI 480
           +SI  D+ S+II+ QI++Y        +G V+ VGDGI +  GL  VM  ELV FE+G+ G+ LNLE    G V++G+  +I+EGS VK T  +  +PVGD L+GRV+  +G P+DG GEI   +   IE  APG++AR SV EP++TG  AID+M PIG+GQRELIIGD+QTGKT IAID I+NQKG++V C+YV IGQK S++   I  L++ GAL+YT +VA++AS+  +L YLAP+ G  IAE +M KG+  L+IYDDL+K A AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K++   GGGS+TALP+IET+AGD+SAYIPTNVISITDGQ+F+ ++LFNSG RPAI+ G+SVSRVGS+AQ  A+KK +G+LKLELAQ+ EL AF+QF SDLDK T+  L  G+++ +L+KQ + +P   + +  ++++  +  I  IPV+ +  F  ++  + K  K   +E +  +K +
  S:     2 VSIRPDEISSIIRQQIEQYSQDVKVENVGTVLQVGDGIARIYGLQQVMSGELVEFEDGTTGIALNLEEDNVGAVLMGEGRNIQEGSTVKATGKIAQIPVGDALVGRVVSPLGAPLDGKGEIAATENRLIESPAPGIIARRSVHEPMQTGITAIDAMIPIGRGQRELIIGDRQTGKTAIAIDTILNQKGEDVICVYVAIGQKASSVANIIEVLRERGALDYTVVVAANASEPATLQYLAPYAGAAIAEYFMCKGKATLVIYDDLTKQAQAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSDALGGGSMTALPVIETQAGDVSAYIPTNVISITDGQIFLSSDLFNSGLRPAINVGISVSRVGSAAQTKAIKKIAGTLKLELAQFDELAAFAQFASDLDKATQNQLARGQRLRELLKQPQFSPLILAEQVAVVYAGVKGLIDEIPVNQVTAFVSELRSYLKTSKPEFIEKVQSSKQL 482
>gi|153815543|ref|ZP_01968211.1| hypothetical protein RUMTOR_01779 [Ruminococcus torques ATCC 27756] >gi|145847185|gb|EDK24103.1| hypothetical protein RUMTOR_01779 [Ruminococcus torques ATCC 27756] (480 aa)
Score = 1309, Expect = 4.0e-142, Identities = 260/463 (56%), Positives = 335/463 (72%)
  Q:    26 SEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQ-KTILETIDQTKDISQDLFVQI 488
           SE+G VI VGDGI    G+ + M  E+V FENG  GM  ++     G ++ G    I EG+ V RT     VPVGD  +GRV++A+G PIDG G I+ D   PIE+ APG++ R SV  P+ETG L+IDSMFPIG+GQRELIIGD+QTGKT+IA+D I+NQK K+V C+YV IGQK ST+ + +NTLK  GAL+YT +V+S+ASD   L Y+AP+ G  +AE +M KG+DVLI+YDDLSKHA+AYR LSLLL R PGREAYPGD+FYLHSRLLERS +++ ENGGGSITALPIIET+AGD+SAYIPTNVISITDGQ+F+ + LF +G RPA++ GLSVSRVG +AQ  A+KK SGS++++LAQYRE++ F+QF SDLD  TKE LE+G  +M+L+KQ    P S   + I L +   K    I    I  F+  ++  F  +   I E I++ K +S +L  QI
  S:     6 SEVGTVITVGDGIASIYGIDHAMYGEIVTFENGLKGMVQDIRRNEIGCILFGSDTRISEGTKVTRTGKRAGVPVGDAYIGRVVNALGEPIDGKGSIEADGYRPIEQEAPGIVDRKSVSVPMETGILSIDSMFPIGRGQRELIIGDRQTGKTSIALDTILNQKDKDVICVYVAIGQKASTVAKVVNTLKTNGALDYTIVVSSTASDCAPLQYIAPYAGTAMAEYFMYKGKDVLIVYDDLSKHAVAYRALSLLLGRSPGREAYPGDVFYLHSRLLERSSRLSDENGGGSITALPIIETQAGDVSAYIPTNVISITDGQIFLESGLFAAGMRPAVNVGLSVSRVGGAAQTKAMKKASGSIRIDLAQYREMEVFTQFSSDLDPATKEQLEYGSGLMELLKQPLYHPMSLHEKVITLCAATHKIFLGIDKKEIRQFRLDLMTWFDTKYPNIGEEIEEKKVLSDELIDQI 469
>gi|119389904|pdb|2HLD|A Chain A, Crystal Structure Of Yeast Mitochondrial F1-Atpase >gi|119389905|pdb|2HLD|B Chain B, Crystal Structure Of Yeast Mitochondrial F1-Atpase >gi|119389906|pdb|2HLD|C Chain C, Crystal Structure Of Yeast Mitochondrial F1-Atpase >gi|119389913|pdb|2HLD|J Chain J, Crystal Structure Of Yeast Mitochondrial F1-Atpase >gi|119389914|pdb|2HLD|K Chain K, Crystal Structure Of Yeast Mitochondrial F1-Atpase >gi|119389915|pdb|2HLD|L Chain L, Crystal Structure Of Yeast Mitochondrial F1-Atpase >gi|119389922|pdb|2HLD|S Chain S, Crystal Structure Of Yeast Mitochondrial F1-Atpase >gi|119389923|pdb|2HLD|T Chain T, Crystal Structure Of Yeast Mitochondrial F1-Atpase >gi|119389924|pdb|2HLD|U Chain U, Crystal Structure Of Yeast Mitochondrial F1-Atpase (510 aa)
Score = 1308, Expect = 4.1e-142, Identities = 254/491 (51%), Positives = 355/491 (72%)
  Q:     9 SNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQK--------GKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK-QQKTILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           S+I++ +IK   ++A  +E GRV+ VGDGI +  GL+N+   ELV F +G  GM LNLE    GIV+ G    +KEG +VKRT N+VDVPVG GLLGRV+DA+GNPIDG G I    +   +  APG++ R SV EP++TG  A+D++ PIG+GQRELIIGD+QTGKT +A+D I+NQK         K + C+YV +GQK ST+ Q + TL+Q  A++Y+ IVA++AS+   L YLAPFT  +I E +   G+  LI+YDDLSK A+AYR LSLLLRRPPGREAYPGD+FYLHSRLLER+ K++++ G GS+TALP+IET+ GD+SAYIPTNVISITDGQ+F+   LF  G RPAI+ GLSVSRVGS+AQ+ A+K+ +GSLKL LAQYRE+ AF+QFGSDLD  TK+ L  G+++ +L+KQ++ +P +   +  L+++    ++  I +  I +F+   + + K     +L  I +  ++S++L   +K+   S + ++
  S:    11 SSILEERIKGVSDEANLNETGRVLAVGDGIARVFGLNNIQAEELVEFSSGVKGMALNLEPGQVGIVLFGSDRLVKEGELVKRTGNIVDVPVGPGLLGRVVDALGNPIDGKGPIDAAGRSRAQVKAPGILPRRSVHEPVQTGLKAVDALVPIGRGQRELIIGDRQTGKTAVALDTILNQKRWNNGSDESKKLYCVYVAVGQKRSTVAQLVQTLEQHDAMKYSIIVAATASEAAPLQYLAPFTAASIGEWFRDNGKHALIVYDDLSKQAVAYRQLSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSEKEGSGSLTALPVIETQGGDVSAYIPTNVISITDGQIFLEAELFYKGIRPAINVGLSVSRVGSAAQVKALKQVAGSLKLFLAQYREVAAFAQFGSDLDASTKQTLVRGERLTQLLKQNQYSPLATEEQVPLIYAGVNGHLDGIELSRIGEFESSFLSYLKSNHNELLTEIREKGELSKELLASLKSATESFVATF 510
>gi|56404985|sp|P07251|ATPA_YEAST ATP synthase subunit alpha, mitochondrial precursor >gi|2447011|dbj|BAA22508.1| F1F0-ATPase alpha subunit precursor [Saccharomyces cerevisiae] >gi|51013389|gb|AAT92988.1| YBL099W [Saccharomyces cerevisiae] >gi|151946302|gb|EDN64524.1| F1F0 ATP synthase alpha subunit [Saccharomyces cerevisiae YJM789] >gi|190408917|gb|EDV12182.1| F1F0-ATPase alpha subunit [Saccharomyces cerevisiae RM11-1a] (545 aa)
Score = 1308, Expect = 4.1e-142, Identities = 254/491 (51%), Positives = 355/491 (72%)
  Q:     9 SNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQK--------GKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK-QQKTILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           S+I++ +IK   ++A  +E GRV+ VGDGI +  GL+N+   ELV F +G  GM LNLE    GIV+ G    +KEG +VKRT N+VDVPVG GLLGRV+DA+GNPIDG G I    +   +  APG++ R SV EP++TG  A+D++ PIG+GQRELIIGD+QTGKT +A+D I+NQK         K + C+YV +GQK ST+ Q + TL+Q  A++Y+ IVA++AS+   L YLAPFT  +I E +   G+  LI+YDDLSK A+AYR LSLLLRRPPGREAYPGD+FYLHSRLLER+ K++++ G GS+TALP+IET+ GD+SAYIPTNVISITDGQ+F+   LF  G RPAI+ GLSVSRVGS+AQ+ A+K+ +GSLKL LAQYRE+ AF+QFGSDLD  TK+ L  G+++ +L+KQ++ +P +   +  L+++    ++  I +  I +F+   + + K     +L  I +  ++S++L   +K+   S + ++
  S:    46 SSILEERIKGVSDEANLNETGRVLAVGDGIARVFGLNNIQAEELVEFSSGVKGMALNLEPGQVGIVLFGSDRLVKEGELVKRTGNIVDVPVGPGLLGRVVDALGNPIDGKGPIDAAGRSRAQVKAPGILPRRSVHEPVQTGLKAVDALVPIGRGQRELIIGDRQTGKTAVALDTILNQKRWNNGSDESKKLYCVYVAVGQKRSTVAQLVQTLEQHDAMKYSIIVAATASEAAPLQYLAPFTAASIGEWFRDNGKHALIVYDDLSKQAVAYRQLSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSEKEGSGSLTALPVIETQGGDVSAYIPTNVISITDGQIFLEAELFYKGIRPAINVGLSVSRVGSAAQVKALKQVAGSLKLFLAQYREVAAFAQFGSDLDASTKQTLVRGERLTQLLKQNQYSPLATEEQVPLIYAGVNGHLDGIELSRIGEFESSFLSYLKSNHNELLTEIREKGELSKELLASLKSATESFVATF 545
>gi|157827765|ref|YP_001496829.1| F0F1 ATP synthase subunit alpha [Rickettsia bellii OSU 85-389] >gi|166201674|sp|A8GY42|ATPA_RICB8 ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|157803069|gb|ABV79792.1| F0F1 ATP synthase subunit alpha [Rickettsia bellii OSU 85-389] (512 aa)
Score = 1308, Expect = 4.4e-142, Identities = 263/501 (52%), Positives = 371/501 (74%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKN--------VKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQ-QKTILETIDQTKDISQDLFVQIKNEFNSLITSYIK 501
           M +   + ++I++ +I      +   E+G+VINVGDGI +  GL+NV   E+V FE+G  G+ LNLE  +   V++G    +++G  VKRTK V++V VG  LLGRV+DA+GNPIDG G+IK  +   IE  APG++ RASV EP++TG   ID + PIG+GQRELIIGD+QTGKT IAID IINQK  +        + CIYV IGQK S++ Q +  L+  GA++YT IV+++AS+  +L ++AP+   ++ E +   G+  LIIYDDLSKHA+AYR +SLLLRRPPGREAYPGD+FYLHSRLLE + K+++E GGGS+TALPIIET+AGD+SAYIPTNVISITDGQ+F+ + LF  G RPA++ G+SVSRVGS+AQI A+K+ +GS+KLELAQ+REL++F QFGSDLD  TK  +EHGK++++++KQ +  PFS   + I +++  +KY+  IPV+ I++F+EK++   KQ QK ILE+I   K I+++   ++K    + +  ++K
  S:     1 MKLKPIEVADILQKEIANINCLSELEEVGQVINVGDGIAKIYGLANVQSGEVVEFESGVKGLVLNLENDSVDAVIMGDDNQVQQGDKVKRTKEVLEVLVGTALLGRVVDALGNPIDGKGDIKSKEYRHIEMKAPGIIDRASVSEPVQTGIKVIDLLIPIGRGQRELIIGDRQTGKTAIAIDTIINQKKAHSLNDEKDKIYCIYVAIGQKRSSVAQIVKKLEDAGAMDYTIIVSATASEAAALQFVAPYAACSMGEYFRDNGKHALIIYDDLSKHAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLECAAKMSEEKGGGSLTALPIIETQAGDVSAYIPTNVISITDGQIFLESELFYKGIRPAVNVGISVSRVGSAAQIKAMKQVAGSIKLELAQFRELESFLQFGSDLDSATKAQIEHGKRLVEILKQAQYHPFSVEEQIISIYAGTKKYLINIPVERIKEFEEKMLSEIKQNQKDILESIKSEKRITEENEQKLKTFLENFVKDFVK 510
>gi|78224598|ref|YP_386345.1| F0F1 ATP synthase subunit alpha [Geobacter metallireducens GS-15] >gi|115312248|sp|Q39Q54|ATPA_GEOMG ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|78195853|gb|ABB33620.1| ATP synthase F1, alpha subunit [Geobacter metallireducens GS-15] (503 aa)
Score = 1308, Expect = 4.5e-142, Identities = 260/498 (52%), Positives = 357/498 (71%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGK-FEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKT-ILETIDQTKDISQDL---FVQIKNEFNSLITS 498
           M I  ++ S II+ QIKEY  +   +E G +I+VGDGI +  GL   M  EL+ F  G  GM LNLE    G  +LG+  E+IKEG+ VKRT  +V+VPVG+ L+GRV++A+G PIDG G I       +E  APG++ R SV +P++TG  AID+M P+G+GQRELIIGD+QTGKT +AID IINQKG ++ CIYV IGQK ST+ Q ++ L++ GA++YT IV++SAS+   L ++AP+TG+T+ E +   G+  LIIYDDLSK A+AYR LSLLLRRPPGREAYPGD+FYLHSRLLER+ K++ + G GS+TALPIIET+AGD+SAYIPTNVISITDGQ+++ ++LF SG RPAI+ GLSVSRVG SAQ+ A+K+ +G+L+L LAQYRE+ AF+QFGSDLDK T+  L  G+++++++KQ +  P     + +++F+    Y+   PV  +  ++ ++   F  +K  IL  +   K I  DL    V   +EF    T+
  S:     1 MEIRAEEISEIIRKQIKEYGKEVEVAETGTIISVGDGIARIHGLDKAMAGELLEFPGGVSGMVLNLEEDNVGAAILGEDNENIKEGTTVKRTGRIVEVPVGEALIGRVVNAIGQPIDGKGPINTSTFGKVEVKAPGIVKRKSVHQPMQTGLKAIDAMVPVGRGQRELIIGDRQTGKTAVAIDTIINQKGGDLICIYVAIGQKRSTVAQVVSKLQEHGAMDYTIIVSASASEPAPLQFIAPYTGVTMGEYFRDNGKHALIIYDDLSKQAVAYRQLSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSDDCGAGSLTALPIIETQAGDVSAYIPTNVISITDGQIYLESDLFYSGVRPAINVGLSVSRVGGSAQVKAMKQVAGTLRLNLAQYREMAAFAQFGSDLDKATQMQLARGERLVEILKQPQYRPIPNEKQVLIIFAANNGYVDDYPVASLRRYESELYSFFDGRKADILAELRDKKAIDDDLKGKIVAALDEFKKEFTA 503
>gi|75702550|gb|ABA22226.1| ATP synthase F1, alpha subunit [Anabaena variabilis ATCC 29413] (529 aa)
Score = 1308, Expect = 4.6e-142, Identities = 253/465 (54%), Positives = 347/465 (74%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK 465
           +SI  D+ S+II+ QI++Y  +   + +G V+ VGDGI +  GL   M  EL+ FE+G+ G+  NLE    G V++G+  +I+EGS V  T  +  + VG+ L+GRV+DA+G  IDG G+IK  +   IE  APG++AR SV EP++TG  AIDSM PIG+GQRELIIGD+QTGKT IAID IINQKG++V C+YV IGQK ST+   + TL++ GA++YT +VA+ AS+  +L +LAP+TG TIAE +M KG+  L+IYDDLSK A AYR +SLLLRRPPGREAYPGD+FY+HSRLLER+ K++ E G GS+TALPIIET+AGD+SAYIPTNVISITDGQ+F+ ++LFN+G RPA++ G+SVSRVGS+AQ  A+KK +G +KLELAQ+ +L AF+QF SDLDK T++ L  G+++ +L+KQ +N P S + +  +L++    Y+  IPVD +  F + +  + K
  S:    26 ISIRPDEISSIIQQQIEQYDQEVKVANVGTVLQVGDGIARIYGLEKAMAGELLEFEDGTVGIAQNLEEDNVGAVLMGEGREIQEGSTVTATGRIAQIGVGEALIGRVVDALGRAIDGKGDIKASESRLIESPAPGIIARRSVHEPMQTGITAIDSMIPIGRGQRELIIGDRQTGKTAIAIDTIINQKGEDVVCVYVAIGQKASTVANVVQTLQEKGAMDYTVVVAAGASEPATLQFLAPYTGATIAEYFMYKGKATLVIYDDLSKQAQAYRQMSLLLRRPPGREAYPGDVFYIHSRLLERAAKLSDELGKGSMTALPIIETQAGDVSAYIPTNVISITDGQIFLSSDLFNAGIRPAVNPGISVSRVGSAAQTKAMKKVAGKIKLELAQFDDLQAFAQFASDLDKATQDQLARGQRLRELLKQSQNQPLSVAEQVAILYAGINGYLDDIPVDKVTTFTKGLRDYLK 490
>gi|114322018|ref|YP_743701.1| F0F1 ATP synthase subunit alpha [Alkalilimnicola ehrlichei MLHE-1] >gi|122310604|sp|Q0A4M6|ATPA_ALHEH ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|114228412|gb|ABI58211.1| ATP synthase F1, alpha subunit [Alkalilimnicola ehrlichei MLHE-1] (513 aa)
Score = 1308, Expect = 4.8e-142, Identities = 257/498 (51%), Positives = 367/498 (73%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKE------NG-----GGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK-QQKTILETIDQTKDISQDLFVQIKNEFNSLITS 498
           M +N  + S +IK +I+ ++  A     G +++VGDGI +  GL++ M  E++ F N ++GM LNLE  + G V+LG +E + EG  VK T  +++VPVG+ LLGRV+DA+GNP+D  GEIK +   P+EK+APGV++R SV +P++TG  A+D+M PIG+GQRELIIGD+QTGKT +AIDAIINQK   +KCIYV IGQK S+I   +  LK+  AL++T +VA+SAS+  ++ YLA + G  + E +  +GED LI+YDDL+K A AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ +IN E      NG      GS+TALPIIET+AGD+SA++PTNVISITDGQ+++ T+LFNSG RPAI+AGLSVSRVG SAQ   +KK  G ++L LAQYREL AF+QF SDLD+ T++ LE G++VM+L+KQ + TP + +   I L++    Y+  + V+ + DF+  ++ + + ++K +L+ ++ T D + ++  ++K    +  +S
  S:     1 MQLNPSEISELIKRRIENFEAVAEARNQGTIVSVGDGICRIHGLADAMQGEMLEFPNDTFGMALNLERDSVGAVILGDYEHLSEGDTVKCTGRILEVPVGESLLGRVVDALGNPVDAKGEIKAEGSSPVEKVAPGVISRQSVDQPVQTGLKAVDAMVPIGRGQRELIIGDRQTGKTAVAIDAIINQKNSGIKCIYVAIGQKASSIASVVEKLKEHDALDHTIVVAASASESAAMQYLAAYAGCAMGEYFRDRGEDALIVYDDLTKQAWAYRQVSLLLRRPPGREAYPGDVFYLHSRLLERAARINAEEVEKLTNGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIYLETDLFNSGIRPAINAGLSVSRVGGSAQTKLIKKLGGGIRLALAQYRELAAFAQFASDLDEATRKQLERGQRVMELMKQPQYTPMTVAEMGISLYAADAGYLDDVEVNKVVDFQAALLDYLRSEEKGLLDELNSTPDYNDEVVGKMKKAVEAFKSS 510
>gi|86359453|ref|YP_471345.1| F0F1 ATP synthase subunit alpha [Rhizobium etli CFN 42] >gi|119367960|sp|Q2K3G8|ATPA_RHIEC ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|86283555|gb|ABC92618.1| H(+)-transporting ATP synthase protein, alpha subunit [Rhizobium etli CFN 42] (509 aa)
Score = 1308, Expect = 4.9e-142, Identities = 254/499 (50%), Positives = 354/499 (70%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQK--------GKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKT-ILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           M I   + S I+K+QIK +  +A  SE+G+V++VGDGI +  GL NV   E+V F  G  GM LNLE+   G+V+ G   DIKEG  VKRT  +VDVPVG  LLGRV+DA+GNPIDG G I   ++  ++  APG++ R SV EP+ TG  AID++ P+G+GQREL+IGD+QTGKT I +DA +NQK        G+ + C+YV +GQK ST+ QF+  L++ GAL+Y+ I+A++ASD   + +LAPF G  + E +   G   LI YDDLSK A++YR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+N + G GS+TALP+IET+  D+SA+IPTNVISITDGQ+F+ T+LF  G RPA++ GLSVSRVGSSAQI A+K+ +GS+K ELAQYRE+ AF+QFGSDLD  T+ +L  G ++ +L+KQ + +P     +  ++F+    Y+  +PV  +  F++ ++ + + + + IL+ I   K IS D   ++    +S   S+
  S:     1 MDIRAAEISAILKDQIKNFGKEAEVSEVGQVLSVGDGIARVYGLDNVQAGEMVEFPGGIRGMALNLESDNVGVVIFGSDRDIKEGDTVKRTGAIVDVPVGPELLGRVVDALGNPIDGKGPINATRRSRVDVKAPGIIPRKSVHEPMSTGLKAIDALIPVGRGQRELVIGDRQTGKTAILLDAFLNQKAIHDNGPEGEKLYCVYVAVGQKRSTVAQFVKVLEERGALKYSIIIAATASDPAPMQFLAPFAGCAMGEYFRDNGMHALIGYDDLSKQAVSYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDDKGAGSLTALPVIETQGNDVSAFIPTNVISITDGQIFLETDLFYQGIRPAVNVGLSVSRVGSSAQIKAMKQVAGSIKGELAQYREMAAFAQFGSDLDAATQRLLNRGARLTELLKQPQFSPLKTEEQVAVIFAGVNGYLDKLPVAQVGKFEQGLLSYLRSEGSAILDAIRTEKAISDDTKGKLTAALDSFAKSF 508
>gi|169198980|ref|ZP_02858265.1| ATP synthase F1, alpha subunit [Rhizobium leguminosarum bv. trifolii WSM2304] >gi|169086355|gb|EDS67071.1| ATP synthase F1, alpha subunit [Rhizobium leguminosarum bv. trifolii WSM2304] (509 aa)
Score = 1308, Expect = 5.0e-142, Identities = 255/499 (51%), Positives = 353/499 (70%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQK--------GKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKT-ILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           M I   + S I+K+QIK +  +A  SE+G+V++VGDGI +  GL NV   E+V F  G  GM LNLE+   G+V+ G   DIKEG  VKRT  +VDVPVG  LLGRV+DA+GNPIDG G I   ++  ++  APG++ R SV EP+ TG  AID++ P+G+GQREL+IGD+QTGKT I +DA +NQK        G+ + C+YV +GQK ST+ QF+  L++ GAL+Y+ IVA++ASD   + +LAPF G  + E +   G   LI YDDLSK A++YR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+N + G GS+TALP+IET+  D+SA+IPTNVISITDGQ+F+ T+LF  G RPA++ GLSVSRVGSSAQI A+K+ +GS+K ELAQYRE+ AF+QFGSDLD  T+ +L  G ++ +L+KQ + +P     +  ++F+    Y+  +PV  +  F++  + + + + + IL+ I   K IS D   ++    +S   S+
  S:     1 MDIRAAEISAILKDQIKNFGKEAEVSEVGQVLSVGDGIARVYGLDNVQAGEMVEFPGGIRGMALNLESDNVGVVIFGSDRDIKEGDTVKRTGAIVDVPVGPELLGRVVDALGNPIDGKGPINATRRSRVDVKAPGIIPRKSVHEPMSTGLKAIDALIPVGRGQRELVIGDRQTGKTAILLDAFLNQKAIHDNGPEGEKLYCVYVAVGQKRSTVAQFVKVLEERGALKYSIIVAATASDPAPMQFLAPFAGCAMGEYFRDNGMHALIGYDDLSKQAVSYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDDKGAGSLTALPVIETQGNDVSAFIPTNVISITDGQIFLETDLFYQGIRPAVNVGLSVSRVGSSAQIKAMKQVAGSIKGELAQYREMAAFAQFGSDLDAATQRLLNRGARLTELLKQPQFSPLKTEEQVAVIFAGVNGYLDKLPVASVGKFEQGFLSYLRSEGSAILDAIRTEKAISDDTKGKLTAALDSFAKSF 508
>gi|56751186|ref|YP_171887.1| F0F1 ATP synthase subunit alpha [Synechococcus elongatus PCC 6301] >gi|114529|sp|P08449|ATPA_SYNP6 ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|48017|emb|CAA28928.1| unnamed protein product [Synechococcus elongatus PCC 6301] >gi|56686145|dbj|BAD79367.1| ATP synthase A subunit [Synechococcus elongatus PCC 6301] (505 aa)
Score = 1308, Expect = 5.2e-142, Identities = 256/480 (53%), Positives = 351/480 (73%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQK-TILETIDQTKDI 480
           +SI  D+ S+II+ QI++Y        +G V+ VGDGI +  GL  VM  ELV FE+G+ G+ LNLE    G V++G+  +I+EGS VK T  +  +PVGD L+GRV+  +G P+DG GEI   +   IE  APG++AR SV EP++TG  AID+M PIG+GQRELIIGD+QTGKT IAID I+NQKG++V C+YV IGQK S++   I  L++ GAL+YT +VA++AS+  +L YLAP+ G  IAE +M KG+  L+IYDDL+K A AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K++   GGGS+TALP+IET+AGD+SAYIPTNVISITDGQ+F+ ++LFNSG RPAI+ G+SVSRVGS+AQ  A+KK +G+LKLELAQ+ EL AF+QF SDLDK T+  L  G+++ +L+KQ + +P   + +  ++++  +  I  IPV+ +  F  ++  + K  K   +E +  +K +
  S:     2 VSIRPDEISSIIRQQIEQYSQDVKVENVGTVLQVGDGIARIYGLQQVMSGELVEFEDGTTGIALNLEEDNVGAVLMGEGRNIQEGSTVKATGKIAQIPVGDALVGRVVSPLGAPLDGKGEIAATENRLIESPAPGIIARRSVHEPMQTGITAIDAMIPIGRGQRELIIGDRQTGKTAIAIDTILNQKGEDVICVYVAIGQKASSVANIIEVLRERGALDYTVVVAANASEPATLQYLAPYAGAAIAEYFMYKGKATLVIYDDLTKQAQAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSDALGGGSMTALPVIETQAGDVSAYIPTNVISITDGQIFLSSDLFNSGLRPAINVGISVSRVGSAAQTKAIKKIAGTLKLELAQFDELAAFAQFASDLDKATQNQLARGQRLRELLKQPQFSPLILAEQVAVVYAGVKGLIDEIPVNQVTAFVSELRSYLKTSKPEFIEKVQSSKQL 482
>gi|88811295|ref|ZP_01126551.1| ATP synthase subunit A [Nitrococcus mobilis Nb-231] >gi|88791834|gb|EAR22945.1| ATP synthase subunit A [Nitrococcus mobilis Nb-231] (514 aa)
Score = 1308, Expect = 5.3e-142, Identities = 248/493 (50%), Positives = 358/493 (72%)
  Q:     7 KFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKEN-----------GGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKT-ILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           + S++IK +I+ +         G V+ + DGI +  GLS VM  E++ F   +YG+ LNLE  + G V+LG +E IKEG +VK T  +++VPVG GLLGRV++A+G PIDG GEI++D   PIEK+APGV++R SV +P++TG  AID+M PIG+GQRELIIGD+QTGKT +A+DAIINQK   +KCIYV +GQK S+I   +  L++  AL++T +VA++AS+  ++ Y+AP+ G ++ E +  +GED LII+DDL+K A AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ +IN +              GS+TALPIIET+AGD+SA++PTNVISITDGQ+F+ ++LFN+G RPAI+AGLSVSRVG +AQ   +KK  G ++L LAQYREL AF+QF SDLD+ T+  LEHG++V +L+KQ + +P S +  A+ LF++   Y+  + +  + DF+  +  +   ++T ++  I++    ++ +  ++K    +    Y
  S:     8 EISDLIKKKIERFDIGVEARSEGAVLTLTDGIARLHGLSQVMQGEMIEFPGATYGLALNLERDSVGAVILGDYEHIKEGDVVKCTGRIIEVPVGSGLLGRVVNALGQPIDGKGEIEHDGTSPIEKVAPGVISRQSVSQPVQTGLKAIDAMVPIGRGQRELIIGDRQTGKTAVAVDAIINQKNTGIKCIYVAVGQKASSIAAVVRKLEEHDALDHTIVVAATASESAAMQYIAPYAGCSMGEYFRDRGEDALIIFDDLTKQAWAYRQVSLLLRRPPGREAYPGDVFYLHSRLLERAARINADEVEKLTKGKVKGRTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLESDLFNAGIRPAINAGLSVSRVGGAAQTGIIKKLGGGVRLALAQYRELAAFAQFASDLDETTRRQLEHGQRVTELMKQKQYSPMSVAAMAVSLFAVDRGYLEDVDLSKVGDFEAALQAYMDSEQTELMREINENPQFNEQIEAKLKAALENFKQRY 512
>gi|187763104|ref|YP_001876579.1| ATP synthase CF1 alpha subunit [Welwitschia mirabilis] >gi|163311634|gb|ABY26792.1| ATP synthase CF1 alpha subunit [Welwitschia mirabilis] (507 aa)
Score = 1307, Expect = 5.7e-142, Identities = 255/483 (52%), Positives = 352/483 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKTIL-ETIDQTKDISQD 483
           ++I  D+ S+II+ QI++Y ++     +G V+ VGDGI +  GL  VM  ELV FE+G+ G+ LNLEA   G+V++G    IKEGS VK T  +  +PV D  LGR+++A+  P+DG G I   +   IE  APG+++R SV EPL+TG +AIDSM PIG+GQRELIIGD+QTGKT +A D IINQKG+NV C+YV IGQK S+I Q + TL++ GA+EYT +V   A    +L YLAP+TG  +AE +M K +  LIIYDDLSK A AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+N + G GS+TALPI+ET+AGD+SAYIPTNVISITDGQ+F+ ++LFN+G RPAID GLSVSRVGS+AQI A+K+ +G LKLELAQ  EL++F++F SDLDK T++ L  G+++ +++KQ +++P +   +   +F+    Y+  I V  ++ F +++ ++ K+ K    E I  T+  +++
  S:     2 ITIRPDEISSIIREQIEQYNSEVQVVNMGTVLQVGDGIARIHGLREVMAGELVEFEDGTVGIALNLEAQNVGVVLMGDGLTIKEGSSVKTTGKIAQIPVSDAFLGRIVNALAQPVDGRGPISASEFRLIESPAPGIVSRRSVYEPLQTGLIAIDSMIPIGRGQRELIIGDRQTGKTAVATDTIINQKGQNVICVYVAIGQKASSIAQIVKTLRECGAMEYTIVVVEPADSPATLQYLAPYTGAALAEYFMYKKQHTLIIYDDLSKQAQAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNSQLGEGSLTALPIVETQAGDVSAYIPTNVISITDGQIFLSSDLFNAGIRPAIDVGLSVSRVGSAAQIKAMKQVAGKLKLELAQIAELESFARFASDLDKGTRDNLARGQRLREMLKQSQSSPLAVEEQIATIFTGTNGYLDKIEVKQVKTFLDQLRKYLKKNKPQFGEIIRTTRTFTEE 485
>gi|165933795|ref|YP_001650584.1| F0F1 ATP synthase subunit alpha [Rickettsia rickettsii str. Iowa] >gi|165908882|gb|ABY73178.1| ATP synthase alpha chain [Rickettsia rickettsii str. Iowa] (560 aa)
Score = 1307, Expect = 5.8e-142, Identities = 253/501 (50%), Positives = 368/501 (73%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQK--------GKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK-QQKTILETIDQTKDISQDLFVQIKNEFNSLITSYIK 501
           M +   + + I++ +I      +   E+G+VI VGDGI Q  GL+NV   E+V F++G  G+ LNLE  + G+V++G    +++G  VKRTK V++VPVG  LLGRV+DA+GNPIDG G+I   +   IE  APG++ R SV EP++TG  AIDS+ PIG+GQRELIIGD+QTGKT IA+D IINQK           + CIYV IGQK S++ Q +  L+  GA++YT IV+++AS+  +L ++AP++  ++ E +   G   LIIYDDLSKHA+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+++E G GS+TALPIIET+AGD+SAYIPTNVISITDGQ+F+ + LF  G RPA++ G+SVSRVGS+AQI A+K+ +GS+KLELAQ+REL++FSQFGSDLD  TK  ++HGK++++++KQ +  PF    + + ++   +KY+  +P+  +++F++K++   +  +K ILE+I   + I+++   ++K    + +  ++K
  S:    51 MKLKPIEVAEILQKEIANINCLSELEEVGQVITVGDGIAQIYGLANVKSGEVVEFKSGVKGLVLNLENDSVGVVIMGDDNQVQQGDNVKRTKEVLEVPVGKALLGRVVDALGNPIDGKGDIASKEYRHIEMKAPGIIERTSVSEPVQTGIKAIDSLIPIGRGQRELIIGDRQTGKTAIAVDTIINQKQAHSLTNESDKIYCIYVAIGQKRSSVAQIVKKLEDAGAMDYTLIVSATASEAAALQFIAPYSACSMGEYFRDNGMHALIIYDDLSKHAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLERAAKMSEEKGSGSLTALPIIETQAGDVSAYIPTNVISITDGQIFLESELFYKGVRPAVNVGISVSRVGSAAQIKAMKQVAGSVKLELAQFRELESFSQFGSDLDPATKAQIDHGKRLVEILKQAQYNPFPVEEQIVSIYVGTKKYLNDVPLQKVKEFEDKMLTEIRLNKKDILESIKNEQCITEETEQKLKAFLENFVKEFVK 560
>gi|154308715|ref|XP_001553693.1| hypothetical protein BC1G_07780 [Botryotinia fuckeliana B05.10] >gi|150852731|gb|EDN27923.1| hypothetical protein BC1G_07780 [Botryotinia fuckeliana B05.10] (561 aa)
Score = 1307, Expect = 6.4e-142, Identities = 258/492 (52%), Positives = 362/492 (73%)
  Q:     9 SNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVV-------DVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQK--------GKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKT-ILETIDQTKDISQDLFVQIKNEFNSLITSYI 500
           S+I++ +I+  Q ++  +E GRV++VGDGI +  G+SNV   ELV F +G  GM +NLEA   G+V+ G    +KEG  VKRT  +V       DVPVG  +LGRVIDA+GNPIDG G IK  +K   +  APG++ R SV +P++TG  ++D+M PIG+GQRELIIGD+QTGKT +A+DA++NQK         K + C+YV +GQK ST+ Q + TL++  A++Y+ +VA++AS+   L Y+APFTG +I E +   G+  LII+DDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+N + GGGS+TALPIIET+ GD+SAYIPTNVISITDGQ+F+   LF  G RPAI+ GLSVSRVGS+AQ+ A+K+ +GSLKL LAQYRE+ AF+QFGSDLD  TK+ L  G+++ +L+KQ + +P + +    L+++    ++  +PV+ I  ++   I H K  ++ +L TID+   +S+DL  ++K+   S   S++
  S:    54 SSILEQRIRGVQEESGLAETGRVLSVGDGIARVHGMSNVQAEELVEFASGVKGMCMNLEAGQVGVVLFGSDRLVKEGETVKRTGEIVSFINFHVDVPVGMEMLGRVIDALGNPIDGKGPIKTTEKRRAQLKAPGILPRQSVNQPVQTGLKSVDAMVPIGRGQRELIIGDRQTGKTAVALDAMLNQKRWNDGNDETKKLYCVYVAVGQKRSTVAQLVKTLEENDAMKYSIVVAATASEAAPLQYIAPFTGTSIGEYFRDNGKHALIIFDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDKLGGGSLTALPIIETQGGDVSAYIPTNVISITDGQIFLEAELFYKGIRPAINVGLSVSRVGSAAQLKAMKQVAGSLKLFLAQYREVAAFAQFGSDLDAATKQTLNRGERLTELLKQKQYSPMAVNEMVPLIYAGVNGHLDSVPVNKILQWEADFISHLKTNESDLLATIDKEGALSKDLEAKLKDVVTSFTKSFV 561
>gi|114762053|ref|ZP_01441521.1| F0F1 ATP synthase subunit alpha [Roseovarius sp. HTCC2601] >gi|114545077|gb|EAU48080.1| F0F1 ATP synthase subunit alpha [Roseovarius sp. HTCC2601] (512 aa)
Score = 1307, Expect = 6.5e-142, Identities = 252/475 (53%), Positives = 346/475 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKG----------KNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK-QQKTILETID 475
           M I   + S I+K+QIK +  +A  +E+GRV++VGDGI +  GL +V   E+V F  G  GM LNLE    GIV+ G   DIKEG +VKRT ++VDVP G GLLGRV+DA+GNPIDG G I+  ++   +  APG++ R SV EP+ TG  ++D+M PIG+GQRELIIGD+QTGKT IA+DAI+NQK           K + C+YV +GQK ST+ Q +  L+  GA++Y+ +VA++ASD   + +LAP+    +AE +   G+  LIIYDDLSK A++YR +SLLLRRPPGREAYPGD+FYLHSRLLERS K+N+++G GS+TALPIIET+ GD+SA+IPTNVISITDGQ+F+ T LF  G RPA++ GLSVSRVGSSAQ  A+   +G +KL LAQYRE+ AF+QFGSDLD  T+++L  G ++ +L+KQ + +P + +    ++F+    Y+  +PV  +  F+  ++   + Q+K ILE I+
  S:     1 MGIQAAEISAILKDQIKNFGQEAEVAEVGRVLSVGDGIARVHGLDSVKAGEMVEFPGGIMGMALNLERDNVGIVIFGSDRDIKEGDVVKRTNSIVDVPAGPGLLGRVVDALGNPIDGKGPIEAAERRVADVKAPGIIPRKSVHEPMATGLKSVDAMIPIGRGQRELIIGDRQTGKTAIALDAILNQKSYNDAAGDDDSKKLYCVYVAVGQKRSTVAQLVKRLEASGAIDYSIVVAATASDPAPMQFLAPYAATAMAEHFRDNGKHALIIYDDLSKQAVSYRQMSLLLRRPPGREAYPGDVFYLHSRLLERSAKLNEDHGAGSLTALPIIETQGGDVSAFIPTNVISITDGQIFLETELFFQGIRPAVNTGLSVSRVGSSAQTKAMSSVAGPVKLSLAQYREMAAFAQFGSDLDAATQKLLNRGARLTELMKQPQYSPLTNAEIVCIIFAGTNGYLDDVPVREVGKFESALLSFLRGQRKDILEWIE 486
>gi|32265926|ref|NP_859958.1| F0F1 ATP synthase subunit alpha [Helicobacter hepaticus ATCC 51449] >gi|81666299|sp|Q7VJ23|ATPA_HELHP ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|32261975|gb|AAP77024.1| FoF1-type ATP synthase [Helicobacter hepaticus ATCC 51449] (504 aa)
Score = 1307, Expect = 6.7e-142, Identities = 253/481 (52%), Positives = 355/481 (73%)
  Q:     3 INLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQ-KTILETIDQTKDISQD 483
           I  ++ S+IIK +I+ +      SE G+VI   DG+ +  GL+NVM  E+V F+ G  G+  NLE ++ G+V+LG    IKEG+ VKR K ++ VPVGD ++GRVI+ +G PIDG G I+ ++   +E+ APG+MAR SV +PL+TG  AID++ PIG+GQRELIIGD+QTGKTT+AID IINQKG++V CIYV +GQK ST+ Q +  L++ GA++YT +V + AS   ++ +LAP+TG+TI E +       LIIYDDLSKHA+AYR +SL+LRRPPGREA+PGD+FYLHSRLLER+ K+N E G GS+TALPIIET+AGD++AYIPTNVISITDGQ+F+ T+LFNSG RPAI+ GLSVSRVG +AQI A K+ +G+L+L+LAQYREL AFSQF SDLD+ +++ LE G+++++++KQ   +P S   + I++++    Y+  IP + +  F+ ++    + +   I E I   K I ++
  S:     5 IKSEEISSIIKERIENFNINIDISETGKVIAYADGVAKVYGLNNVMYYEMVEFDTGDTGIAFNLEESSVGVVVLGSGRTIKEGTSVKRLKKLMKVPVGDAIVGRVINTLGEPIDGKGAIEANEYRFVEEKAPGIMARKSVHQPLQTGLKAIDALVPIGRGQRELIIGDRQTGKTTVAIDTIINQKGQDVICIYVAVGQKESTVAQVVRKLEEHGAMDYTVVVNAPASFSAAMQFLAPYTGVTIGEYFRDNARHALIIYDDLSKHAVAYREMSLILRRPPGREAFPGDVFYLHSRLLERAAKLNDELGAGSLTALPIIETQAGDVAAYIPTNVISITDGQIFLETDLFNSGIRPAINVGLSVSRVGGAAQIKATKQVAGTLRLDLAQYRELQAFSQFASDLDESSRKQLERGQRMVEILKQPPYSPLSIEKQVIIIYAGANGYLDNIPANKVIKFESELYPFLEAKYPKIFEDISVKKAIDKE 486
>gi|2447013|dbj|BAA22509.1| defective F1F0-ATPase alpha subunit precursor [Saccharomyces cerevisiae] (545 aa)
Score = 1306, Expect = 7.1e-142, Identities = 254/491 (51%), Positives = 355/491 (72%)
  Q:     9 SNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQK--------GKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK-QQKTILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           S+I++ +IK   ++A  +E GRV+ VGDGI +  GL+N+   ELV F +G  GM LNLE    GIV+ G    +KEG +VKRT N+VDVPVG GLLGRV+DA+GNPIDG G I    +   +  APG++ R SV EP++TG  A+D++ PIG+GQRELIIGD+QTGKT +A+D I+NQK         K + C+YV +GQK ST+ Q + TL+Q  A++Y+ IVA++AS+   L YLAPFT  +I E +   G+  LI+YDDLSK A+AYR LSLLLRRPPGREAYPGD+FYLHSRLLER+ K++++ G GS+TALP+IET+ GD+SAYIPTNVISITDGQ+F+   LF  G RPAI+ GLSVSRVGS+AQ+ A+K+ +GSLKL LAQYRE+ AF+QFGSDLD  TK+ L  G+++ +L+KQ++ +P +   +  L+++    ++  I +  I +F+   + + K     +L  I +  ++S++L   +K+   S + ++
  S:    46 SSILEERIKGVSDEANLNETGRVLAVGDGIARVFGLNNIQAEELVEFSSGVKGMALNLEPGQVGIVLFGSDRLVKEGELVKRTGNIVDVPVGPGLLGRVVDALGNPIDGKGPIDAAGRSRAQVKAPGILPRRSVHEPVQTGLKAVDALVPIGRGQRELIIGDRQTGKTAVALDTILNQKRWNNGSDESKKLYCVYVAVGQKRSTVAQLVQTLEQHDAMKYSIIVAATASEAAPLQYLAPFTAASIDEWFRDNGKHALIVYDDLSKQAVAYRQLSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSEKEGSGSLTALPVIETQGGDVSAYIPTNVISITDGQIFLEAELFYKGIRPAINVGLSVSRVGSAAQVKALKQVAGSLKLFLAQYREVAAFAQFGSDLDASTKQTLVRGERLTQLLKQNQYSPLATEEQVPLIYAGVNGHLDGIELSRIGEFESSFLSYLKSNHNELLTEIREKGELSKELLASLKSATESFVATF 545
>gi|11465708|ref|NP_053852.1| ATP synthase CF1 alpha subunit [Porphyra purpurea] >gi|1703661|sp|P51242|ATPA_PORPU ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|1276708|gb|AAC08128.1| ATP synthase CF1 alpha chain [Porphyra purpurea] (504 aa)
Score = 1306, Expect = 7.1e-142, Identities = 254/468 (54%), Positives = 344/468 (73%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQK 468
           ++I  D+ S+II+ QI++Y      + IG V+ VGDGI +  GL  VM  EL+ FE+ + G+ LNLE+   G+V++G   DI EGS VK T  +  +PVGD  LGRV+D +  PID  GE   +    IE +APG++ R SVCEP++TG  AIDSM PIG+GQRELIIGD+QTGKT +A+D IINQKG++V C+YV IGQK S++ Q +++L++ GAL+YT IV ++A    +L Y+AP+TG  +AE +M KG+  L+IYDDL+K A AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+N + GGGS+TALPIIET+AGD+SAYIPTNVISITDGQ+F+  +LFNSG RPAI+ G+SVSRVGS+AQI A+K+ +G LKLELAQ+ EL+AFSQF SDLDK T+  L  G+++ +++KQ +N+P     +  ++++    Y+  I V+ + DF  K+    K  K
  S:     2 VNIRPDEISSIIRQQIEKYDQDVEVANIGTVLQVGDGIARVYGLDEVMAGELLEFEDKTIGVALNLESDNVGVVLMGDGRDILEGSSVKGTGKIAQIPVGDAFLGRVVDPLARPIDNKGEPASNGTRLIESMAPGIIGRQSVCEPMQTGITAIDSMIPIGRGQRELIIGDRQTGKTAVALDTIINQKGQDVVCVYVAIGQKASSVAQVVSSLQEKGALDYTIIVTANADSPATLQYIAPYTGAALAEYFMYKGKATLVIYDDLTKQAQAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNSDLGGGSMTALPIIETQAGDVSAYIPTNVISITDGQIFLSGDLFNSGIRPAINVGISVSRVGSAAQIKAMKQVAGKLKLELAQFAELEAFSQFASDLDKATQNQLARGQRLREILKQAQNSPIPVEEQTAIIYTGINGYLDDIAVNKVPDFIIKLREDLKNSK 469
>gi|11467148|ref|NP_054447.1| ATP synthase F1 subunit alpha [Marchantia polymorpha] >gi|416672|sp|P26854|ATPAM_MARPO ATP synthase subunit alpha, mitochondrial >gi|786232|gb|AAC09446.1| atpA [Marchantia polymorpha] (513 aa)
Score = 1306, Expect = 7.3e-142, Identities = 256/496 (51%), Positives = 354/496 (71%)
  Q:     7 KFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVK---------CIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKTILETIDQTKDISQDLFVQIKNEFNSLITSYIKT 502
           + S +++ +I  Y  K    EIGRV++VGDGI +  GL+ +   E+V F +G  GM LNLE    GIV+ G    IKEG IVKRT ++VDVPVG G+LGRV+DA+G PIDG G +   ++  +E  APG++AR SV EP++TG  A+DS+ PIG+GQRELIIGD+QTGKT IAID I+NQK  N +         C+YV IGQK ST+ Q +  L + GALEY+ IVA++ASD   L +LAP++G  + E +   G   LIIYDDLSK ++AYR +SLLLRRPPGREA+PGD+FYLHSRLLER+ K++ + G GS+TALP+IET+AGD+SAYIPTNVISITDGQ+F+ T LF  G RPAI+ GLSVSRVGS+AQ+ A+K+  GSLKLELAQYRE+ AF+QFGSDLD  T+ +L  G ++ +++KQ + +P     + +++++  + Y+  IPV  I  +++++++       +L  I Q K+I++ +  Q+         S++ T
  S:     8 ELSTLLEQRITNYYTKLQVDEIGRVVSVGDGIARVYGLNKIQAGEMVEFASGVKGMALNLENENVGIVIFGSDTAIKEGDIVKRTGSIVDVPVGKGMLGRVVDALGVPIDGKGALSAVERRRVEVKAPGIIARKSVHEPMQTGLKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTILNQKQINAQGTSDSEKLYCVYVAIGQKRSTVAQLVKILSEAGALEYSIIVAATASDPAPLQFLAPYSGCAMGEYFRDNGMHALIIYDDLSKQSVAYRQMSLLLRRPPGREAFPGDVFYLHSRLLERAAKMSDQTGAGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYRGSRPAINVGLSVSRVGSAAQLKAMKQVCGSLKLELAQYREVAAFAQFGSDLDAATQYLLNRGARLTEILKQAQYSPIPIEKQIVVIYAAVKGYLDQIPVALITHYEQELLKSI--DPGLLSAIVQQKNITEQISSQLATFCQKFTQSFLAT 510
>gi|71066580|ref|YP_265307.1| F0F1 ATP synthase subunit alpha [Psychrobacter arcticus 273-4] >gi|115312268|sp|Q4FQ35|ATPA_PSYA2 ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|71039565|gb|AAZ19873.1| ATP synthase F1, alpha subunit [Psychrobacter arcticus 273-4] (514 aa)
Score = 1306, Expect = 7.6e-142, Identities = 258/487 (52%), Positives = 355/487 (72%)
  Q:     3 INLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINK------ENG-----GGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHF-KQQKTILETIDQTKDISQDLFVQIK 489
           +N  + SN+IK +I++    A     G ++ V DGIVQ  GL + M  E++ FE   YGM LNLE  + G V+LG F  ++EG     T  +++VPVG  LLGRV+DA+GNPIDG G I       +EKIAPGV+ R SV +P+ TG  ++D+M PIG+GQRELIIGD+QTGKT +AIDAII QK   +KC+YV IGQK STI   +  L+Q GALEYTT+V +SAS+  +L Y+AP++G T+ E +  +GED LI++DDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ ++N        NG      GS+TALPIIET+AGD+SA++PTNVISITDGQ+F+ ++LFNSG RPA++AG+SVSRVG +AQ   +KK SG ++  LAQYREL AF+QF SDLD  T+E L+HG++V +L+KQ +  P S S +A ++++  E ++  +PV+ I  F+E  +R+   +Q  +++ ID T + + D+  ++K
  S:     4 LNPAEISNLIKQRIQDLDAGATAKNEGTIVKVSDGIVQIHGLEDAMYGEMIEFEGEVYGMALNLERDSVGAVVLGDFLKLQEGQKAYCTGRILEVPVGPELLGRVVDALGNPIDGKGPINAKMTDKVEKIAPGVIDRQSVDQPVMTGYKSVDTMIPIGRGQRELIIGDRQTGKTAMAIDAIIAQKASGIKCVYVAIGQKRSTIANVVRKLEQTGALEYTTVVVASASEPAALQYIAPYSGCTMGEYFRDRGEDALIVFDDLSKQAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLERASRVNAAYVEKFTNGEVVGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLESSLFNSGIRPAVNAGISVSRVGGAAQTKIIKKLSGGIRTALAQYRELAAFAQFASDLDDATREQLDHGERVTELMKQKQYQPMSISEQAAVIYASNEGFLADVPVEKIGSFEEAYLRYMHDEQADLMKEIDDTANYNDDIAGRLK 502
>gi|50954452|ref|YP_061740.1| F0F1 ATP synthase subunit alpha [Leifsonia xyli subsp. xyli str. CTCB07] >gi|81612770|sp|Q6AG60|ATPA_LEIXX ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|50950934|gb|AAT88635.1| ATP synthase, alpha chain [Leifsonia xyli subsp. xyli str. CTCB07] (545 aa)
Score = 1306, Expect = 8.0e-142, Identities = 256/495 (51%), Positives = 350/495 (70%)
  Q:     1 MSINLDKFSNIIKNQIKEYQ-NKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKG--------KNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKTILETIDQTKDISQDLFVQIKNEFNSL 495
           +SI+ D+  + +K+ + +Y+  KA  +E+G V++  DGI    GL  VM NEL+ F +G+ G+  NL+    G+V+LG+FE I EG  V RT  V+ VPVGDG LGRV+D +GNPIDG GEI  + +  +E  APGVM R SV EPL+TG  AID+M P+G+GQR+LIIGD+QTGKT IAID IINQK         K V+CIYV +GQK STI      L+  GA+EYTTIVA+ ASD     YLAP+TG  I + WM  G+ VLII+DDLSK A AYR +SLLLRRPPGREAYPGD+FYLHSRLLER  K++ E G GS+T LPIIET+A D+SAYIPTNVISITDGQ+F+ ++LFN+ QRPA+D G+SVSRVG  AQ+ ++KK SG+LKLELAQYR L+AF+ F SDLD  ++  L  G ++ +L+KQ + +P+    + + +++     +  + V+ +  F+ +++ H ++   IL T+  T  +  +   ++ +E ++ 
  S:     4 ISISPDEIRDALKDFVSKYEPAKAATAEVGHVLDASDGIAHVEGLPGVMANELIRFADGTLGLAQNLDENEIGVVVLGEFEGIVEGMEVTRTGEVLSVPVGDGYLGRVVDPLGNPIDGLGEIATEGRRELELQAPGVMHRKSVHEPLQTGIKAIDAMIPVGRGQRQLIIGDRQTGKTAIAIDTIINQKANWESGDVTKQVRCIYVAVGQKGSTIAAVKGALEDAGAMEYTTIVAAPASDPAGFKYLAPYTGSAIGQHWMYGGKHVLIIFDDLSKQAEAYRAVSLLLRRPPGREAYPGDVFYLHSRLLERCAKLSDELGAGSMTGLPIIETKANDVSAYIPTNVISITDGQIFLQSDLFNANQRPAVDVGISVSRVGGDAQVKSIKKVSGTLKLELAQYRSLEAFAMFASDLDAASRRQLARGARLTELLKQPQYSPYPVEEQVVSIWAGINGKLDEVAVEDVLRFESELLDHLRRNTGILTTLRDTNVLDDETVEKLSSEVDAF 507
>gi|90994433|ref|YP_536923.1| ATP synthase CF1 alpha chain [Porphyra yezoensis] >gi|110832066|sp|Q1XDP5|ATPA_PORYE ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|90818997|dbj|BAE92366.1| ATP synthase CF1 alpha chain [Porphyra yezoensis] (504 aa)
Score = 1306, Expect = 8.0e-142, Identities = 257/480 (53%), Positives = 348/480 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKTIL-ETIDQTKDI 480
           ++I  D+ S+II+ QI++Y      + IG V+ VGDGI +  GL  VM  EL+ FE+ + G+ LNLE+   G+V++G   DI EGS VK T  +  +PVGD  LGRV+D +  PID  GE   +    IE +APG++ R SVCEP++TG  AIDSM PIG+GQRELIIGD+QTGKT +A+D IINQKG++V C+YV IGQK S++ Q +++L+  GAL+YT IVA++A    +L Y+AP+TG  +AE +M KG+  L+IYDDL+K A AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+N E GGGS+TALPIIET+AGD+SAYIPTNVISITDGQ+F+  +LFNSG RPAI+ G+SVSRVGS+AQI A+K+ +G LKLELAQ+ EL+AFSQF SDLDK T+  L  G+++ +++KQ +N+P     +  ++++    Y+  I V  + +F  ++    K  K    E +  TK +
  S:     2 VNIRPDEISSIIRQQIEKYDQDVEVANIGTVLQVGDGIARVYGLDEVMAGELLEFEDKTIGVALNLESDNVGVVLMGDGRDILEGSSVKGTGRIAQIPVGDAFLGRVVDPLARPIDDKGEPASNGTRLIESMAPGIIGRQSVCEPMQTGITAIDSMIPIGRGQRELIIGDRQTGKTAVALDTIINQKGQDVVCVYVAIGQKASSVAQVVSSLQDKGALDYTIIVAANADSPATLQYIAPYTGAALAEYFMYKGKATLVIYDDLTKQAQAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNAELGGGSMTALPIIETQAGDVSAYIPTNVISITDGQIFLSGDLFNSGIRPAINVGISVSRVGSAAQIKAMKQVAGKLKLELAQFAELEAFSQFASDLDKATQNQLARGQRLREILKQAQNSPIPVEEQTAIIYTGINGYLDDIEVSKVAEFIRELREDLKNSKPEFGENVRSTKKL 482
>gi|84683665|ref|ZP_01011568.1| ATP synthase subunit A [Rhodobacterales bacterium HTCC2654] >gi|84668408|gb|EAQ14875.1| ATP synthase subunit A [Rhodobacterales bacterium HTCC2654] (513 aa)
Score = 1306, Expect = 8.5e-142, Identities = 251/489 (51%), Positives = 347/489 (70%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKG----------KNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKTIL--ETIDQTKDISQDLFVQIK 489
           M I   + S I+K+QIK +  +A  +E+G V++VGDGI +  GL NV   E+V F  G  GM LNLEA   G+V+ G   DIKEG  VKRT ++VDVPVGD LLGRV+D +GNPIDG G I+  ++   +  APG++ R SV EP+ TG  ++D+M PIG+GQRELIIGD+QTGKT +A+D I+NQK           K + C+YV +GQK ST+ Q +  L++ GA+EY+ IVA++ASD   + YLAP+T   + E +   G   L+IYDDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLERS K+N++ G GS+TALPIIET+ GD+SA+IPTNVISITDGQ+F+ T LF  G RPA++ GLSVSRVGSSAQ  A+   +G +KL LAQYRE+ AF+QFGSDLD  T+++L  G ++ +L+KQ + +P + +    ++++    ++  +PV  +  F+  ++ H + +   L  +  +  + +  DL  +IK
  S:     1 MGIQASEISAILKDQIKNFGQEAEVAEVGHVLSVGDGIARVYGLDNVQAGEMVEFPGGIRGMALNLEADNVGVVIFGSDRDIKEGDTVKRTNSIVDVPVGDALLGRVVDGLGNPIDGKGPIEAKERAVADVKAPGIIPRKSVHEPMATGLKSVDAMIPIGRGQRELIIGDRQTGKTAVALDTILNQKSYNDAAGDDESKKLYCVYVAVGQKRSTVAQLVKKLEETGAIEYSIIVAATASDPAPMQYLAPYTATAMGEYFRDNGRHALMIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERSAKLNEDFGAGSLTALPIIETQGGDVSAFIPTNVISITDGQIFLETELFYQGIRPAVNTGLSVSRVGSSAQTKAMSSVAGPVKLSLAQYREMAAFAQFGSDLDAATQQLLARGARLTELMKQPQYSPLTNAEIVCVIYAGTNGFLDKLPVSAVAKFESGLLNHLRSKHADLLKDITENDRKVKDDLADKIK 501
>gi|67920483|ref|ZP_00514003.1| ATP synthase F1, alpha subunit [Crocosphaera watsonii WH 8501] >gi|67857967|gb|EAM53206.1| ATP synthase F1, alpha subunit [Crocosphaera watsonii WH 8501] (503 aa)
Score = 1306, Expect = 8.7e-142, Identities = 259/494 (52%), Positives = 356/494 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVD-----------YIEDFKEKIIRHFKQQKTILETIDQTKDISQDLFVQIKNEFNS 494
           +SI  D+ S+II+ QI+ Y      S +G V+ VGDG  +  GL   M  EL+ FE+G+ G+ LNLE    G V++G    I+EGS VK T  +  VP+G+ ++GRV+D++G PIDG G+I   +   IE  APG++AR SVCEP++TG  AID+M PIG+GQRELIIGD++TGKT IAID IINQK ++V C+YV IGQK ST+ Q I TL++ GA++YT +VA++A+D  +L YLAP+TG T+AE +M  G+  L+IYDDLSK A AYR LSLLL+RPPGREAYPGD+FY+HSRLLER+ K++   G GS+TALP+IET+AGD+SAYIPTNVISITDGQ+F+ ++LFN+G RPAI+AG+SVSRVGS+AQ  A+K+ +G LKLELAQ+ EL+AFSQF SDLD  T+  L  G+++ +++KQ +N+P +   +  + ++    YI  +PVD           YI   K K     K +K +    D+ + + +D   + K  F +
  S:     2 VSIRPDEISSIIRQQIESYDQTVTVSNVGTVLQVGDGTARIYGLEQCMAGELLEFEDGTIGIALNLEEDNVGAVLMGTGFGIQEGSTVKATGKIAQVPIGEAMIGRVVDSLGRPIDGKGDIATTESRLIESPAPGIIARKSVCEPMQTGITAIDAMIPIGRGQRELIIGDRKTGKTAIAIDTIINQKTEDVICVYVAIGQKASTVAQVIGTLEEKGAMDYTIVVAANANDPATLQYLAPYTGATLAEYFMYNGKATLVIYDDLSKQAQAYRQLSLLLKRPPGREAYPGDVFYIHSRLLERAAKLSDALGAGSMTALPVIETQAGDVSAYIPTNVISITDGQIFLSSDLFNAGFRPAINAGISVSRVGSAAQTKAMKQVAGKLKLELAQFAELEAFSQFASDLDAATQAQLARGQRLRQILKQPENSPLAVWEQVAISYAGLNGYIDEVPVDKATEFAAGLREYIAASKPKYTEIIKSEKKL---TDEAESLLKDAITEYKQAFGA 503
>gi|93007153|ref|YP_581590.1| F0F1 ATP synthase subunit alpha [Psychrobacter cryohalolentis K5] >gi|119367959|sp|Q1Q897|ATPA_PSYCK ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|92394831|gb|ABE76106.1| ATP synthase F1, alpha subunit [Psychrobacter cryohalolentis K5] (514 aa)
Score = 1305, Expect = 9.6e-142, Identities = 258/493 (52%), Positives = 357/493 (72%)
  Q:     3 INLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINK------ENG-----GGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHF-KQQKTILETIDQTKDISQDLFVQIKNEFNSL 495
           +N  + SN+IK +I++    A     G ++ V DGIVQ  GL + M  E++ FE   YGM LNLE  + G V+LG F  ++EG     T  +++VPVG  LLGRV+DA+GNPIDG G I       +EKIAPGV+ R SV +P+ TG  ++D+M PIG+GQRELIIGD+QTGKT +AIDAII QK   +KC+YV IGQK STI   +  L+Q GALEYTT+V +SAS+  +L Y+AP++G T+ E +  +GED LI++DDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ ++N        NG      GS+TALPIIET+AGD+SA++PTNVISITDGQ+F+ ++LFNSG RPA++AG+SVSRVG +AQ   +KK SG ++  LAQYREL AF+QF SDLD  T+E L+HG++V +L+KQ +  P S S +A ++++  E ++  +PV+ I  F+E  +R+   +Q  +++ ID T + + D+  ++K+   + 
  S:     4 LNPAEISNLIKQRIQDLDAGATAKNEGTIVKVSDGIVQIHGLEDAMYGEMIEFEGEVYGMALNLERDSVGAVVLGDFLKLQEGQKAYCTGRILEVPVGPELLGRVVDALGNPIDGKGPINAKMTDKVEKIAPGVIDRQSVDQPVMTGYKSVDTMIPIGRGQRELIIGDRQTGKTAMAIDAIIAQKSSGIKCVYVAIGQKRSTIANVVRKLEQTGALEYTTVVVASASEPAALQYIAPYSGCTMGEYFRDRGEDALIVFDDLSKQAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLERASRVNAAYVEKFTNGEVVGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLESSLFNSGIRPAVNAGISVSRVGGAAQTKIIKKLSGGIRTALAQYRELAAFAQFASDLDDVTREQLDHGERVTELMKQKQYQPMSISEQAAVIYASNEGFLADVPVEKIGSFEEAYLRYMHDEQADLMKEIDDTANYNDDIAGRLKSSLETF 508
>gi|33862007|ref|NP_893568.1| F0F1 ATP synthase subunit alpha [Prochlorococcus marinus subsp. pastoris str. CCMP1986] >gi|81712582|sp|Q7V037|ATPA_PROMP ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|33640375|emb|CAE19910.1| H+-transporting ATP synthase alpha-subunit [Prochlorococcus marinus subsp. pastoris str. CCMP1986] (505 aa)
Score = 1305, Expect = 9.7e-142, Identities = 255/503 (50%), Positives = 363/503 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKT-ILETIDQTKDISQDLFVQIKNEFNSLITSYIKTI 503
           +SI  D+ S+I+K QI +Y      S +G V+ +GDGI +  GL  VM  EL+ FE+G+ G+ LNLE    G V++G+   ++EGS VK T  +  VPVG+ + GRV++ +G PIDG GEI       IE++APG++ R SV EP++TG  +ID+M P+G+GQRELIIGD+QTGKT IAID IINQKG++V C+YV IGQK++++   +  L++ GALEYT +V++ AS+  +L YLAP+TG  IAE +M +G+  L+IYDDL+K A AYR +SLLLRRPPGREAYPGD+FY HSRLLER+ K++ + GGGS+TALPIIET+AGD+SAYIPTNVISITDGQ+F+  +LFNSG RPAI+ G+SVSRVG +AQ  A+KK +G+LKLELAQ+ EL AFSQF SDLD+ T++ LE GK++ +L+KQ + +P + + +  ++++  +  I  +PV+ +  F  ++  + K  K   +E I + K +++ L   +K     + +S + T+
  S:     2 VSIRPDEISSILKQQITDYDQSVNVSNVGTVLQIGDGIARIYGLDQVMAGELLEFEDGTEGIALNLEDDNVGAVLMGEALGVQEGSNVKSTGKIASVPVGEAMKGRVVNPLGQPIDGKGEIPTSDNRLIEEMAPGIIKRRSVHEPMQTGITSIDAMIPVGRGQRELIIGDRQTGKTAIAIDTIINQKGQDVVCVYVAIGQKSASVANVVEVLREKGALEYTVVVSAGASEAAALQYLAPYTGAAIAEHFMYQGKATLVIYDDLTKQAQAYRQMSLLLRRPPGREAYPGDVFYCHSRLLERAAKLSDDMGGGSMTALPIIETQAGDVSAYIPTNVISITDGQIFLSADLFNSGLRPAINVGISVSRVGGAAQTKAIKKIAGTLKLELAQFDELAAFSQFASDLDEATQQQLERGKRLRELLKQAQFSPLNLAEQVAVVYAGVKGLIDEVPVEDVTKFAAELREYLKLNKAEFIEEILKEKKLNEGLETTLKEVIKEVKSSMLATV 505
>gi|83944758|ref|ZP_00957124.1| ATP synthase subunit A [Oceanicaulis alexandrii HTCC2633] >gi|83851540|gb|EAP89395.1| ATP synthase subunit A [Oceanicaulis alexandrii HTCC2633] (509 aa)
Score = 1305, Expect = 1.0e-141, Identities = 258/499 (51%), Positives = 350/499 (70%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKN--------VKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKT-ILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           M I   + S I+K QIK +  +A  S++G+V++VGDGI +  GL  V   ELV F  G  GM LNLE    G V+ G    IKEG  VKR  ++VD PVG GLLGRV++A+G PIDG G I   ++  ++  APG++ R SV EP+ TG  AIDSM P+G+GQRELIIGD+QTGKT IAID I+NQK  N        + C+YV +GQK ST+ Q + TL++ GA+EY+ +VA++ASD   + +LAPFTG  + E +   G   LIIYDDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+N+ +G GS+TALPIIET+A D+SAYIPTNVISITDGQ+F+ T+LF  G RPA++ GLSVSRVGS+AQ  A K  +G +K ELAQYRE+ AF+QFGSDLD  T+++L  G+++ +L+KQ + +P S   +  ++++    Y+  I V  I  ++E+++RH   +K  +L  I  TK +S +    +K    +   ++
  S:     1 MDIRAAEISAILKEQIKNFGAEADVSDVGQVLSVGDGIARVYGLDEVQAGELVEFPGGVKGMALNLERDNVGCVIFGDDRGIKEGDTVKRLGSIVDAPVGKGLLGRVVNALGEPIDGKGPIDAAERRVVDVKAPGILPRKSVHEPMATGIKAIDSMIPVGRGQRELIIGDRQTGKTAIAIDTILNQKQLNQGDDESQKLYCVYVVVGQKRSTVAQVVKTLEENGAMEYSIVVAATASDPAPMQFLAPFTGCAMGEYFRDNGMHGLIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNETHGSGSLTALPIIETQANDVSAYIPTNVISITDGQIFLETDLFYQGIRPAVNVGLSVSRVGSAAQTKATKTAAGKIKGELAQYREMAAFAQFGSDLDAATQKLLSRGERLTELLKQPQFSPLSMEEQVCVMYAGTRGYLDKIEVSAIGRYEEELLRHLHAEKADLLAAIRDTKKLSDESEAALKATLETFTANF 508
>gi|149072066|ref|YP_001293543.1| ATP synthase CF1 subunit a [Rhodomonas salina] >gi|190358196|sp|A6MVW4|ATPA_RHDSA ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|134303017|gb|ABO70821.1| ATP synthase CF1 subunit a [Rhodomonas salina] (502 aa)
Score = 1305, Expect = 1.1e-141, Identities = 254/483 (52%), Positives = 356/483 (73%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQK-TILETIDQTKDISQD 483
           ++I  D+ S+II+ QI +Y      + +G V+ +GDGI +  GL  VM  EL+ FE+ + G+ LNLE+   G+V++G+   I EGS VK T  +  VPVGDG LGRV++++G PIDG G+I       IE  APG+++R SVCEP++TG  AIDSM PIG+GQRELIIGD+QTGKT++AID IINQK ++V C+YV IGQK +++   +  L++ GAL+YT IVA++A +  +L Y+AP+TG  IAE +M KG+  LIIYDDLSK A AYR +SLLLRRPPGREA+PGD+FYLHSRLLER+ K++   GGGS+TALPIIET+AGD+SAYIPTNVISITDGQ+F+  +LFN+G RPAI+ G+SVSRVGS+AQI A+K+ +G LKLELAQ+ EL+AFSQF SDLD+ T+  L  G+++ +++KQ  ++P S   +  ++++    ++  +PV+ +++F  ++  + K  K    E+I +TK +  D
  S:     2 VNIRPDEISSIIRQQIDKYDQGVQVANVGTVLQIGDGIARVYGLDQVMAGELLEFEDETIGIALNLESDNVGVVLMGEGRAILEGSSVKATGKIAQVPVGDGYLGRVVNSLGAPIDGKGDISSSDTRLIESAAPGIISRKSVCEPIQTGITAIDSMIPIGRGQRELIIGDRQTGKTSVAIDTIINQKTEDVVCVYVAIGQKAASVASIVTQLEEKGALDYTVIVAANADEPATLQYIAPYTGAAIAEYFMYKGKATLIIYDDLSKQASAYRQMSLLLRRPPGREAFPGDVFYLHSRLLERAAKLSDALGGGSMTALPIIETQAGDVSAYIPTNVISITDGQIFLSGDLFNAGIRPAINVGISVSRVGSAAQIKAMKQVAGKLKLELAQFAELEAFSQFASDLDQATRNQLARGQRLREILKQPASSPISVEEQVAIIYTGINGFLDEVPVNKVKEFVSQLRTNLKNSKPKFAESIRETKALGSD 485
>gi|50308493|ref|XP_454248.1| ATPA_KLULA [Kluyveromyces lactis] >gi|1352026|sp|P49375|ATPA_KLULA ATP synthase subunit alpha, mitochondrial precursor >gi|899311|emb|CAA55723.1| alpha-subunit of mitochondrial ATP synthase [Kluyveromyces lactis] >gi|49643383|emb|CAG99335.1| ATPA_KLULA [Kluyveromyces lactis NRRL Y-1140] (548 aa)
Score = 1305, Expect = 1.1e-141, Identities = 254/491 (51%), Positives = 352/491 (71%)
  Q:     9 SNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQK--------GKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK-QQKTILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           S+I++ +I+    ++  +E GRV+ VGDGI +  GL+NV   ELV F +G  GM LNLE    GIV+ G    +KEG +VKRT  +VDV VG  LLGRV+DA+GNPIDG G I    +   +  APG++ R SV EP++TG  ++D++ PIG+GQRELIIGD+QTGKT +A+D I+NQK         K + C+YV +GQK ST+ Q + TL+Q  AL+Y+ IVA++AS+   L Y+APFT   I E +   G   LIIYDDLSK A+AYR LSLLLRRPPGREAYPGD+FYLHSRLLER+ K++++NGGGS+TALP+IET+ GD+SAYIPTNVISITDGQ+F+   LF  G RPAI+ GLSVSRVGS+AQ+ A+K+ +GSLKL LAQYRE+ AF+QFGSDLD  TK+ L  G+++ +L+KQ++ +P +   +  L+++    Y+  I +  I +F+ K + + K     I+  I +  ++S++L   +K+   S + ++
  S:    49 SSILEERIRGVSEESNLNETGRVLAVGDGIARVFGLNNVQAEELVEFSSGVKGMALNLEPGQVGIVLFGSDRLVKEGEVVKRTGKIVDVGVGPELLGRVVDALGNPIDGKGPINASGRSRAQVKAPGILPRRSVHEPVQTGLKSVDALVPIGRGQRELIIGDRQTGKTAVALDTILNQKRWNNGTDESKKLYCVYVAVGQKRSTVAQLVQTLEQHDALKYSIIVAATASEAAPLQYIAPFTAAAIGEWFRDNGRHALIIYDDLSKQAVAYRQLSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSEKNGGGSLTALPVIETQGGDVSAYIPTNVISITDGQIFLEAELFYKGIRPAINVGLSVSRVGSAAQVKALKQVAGSLKLFLAQYREVAAFAQFGSDLDASTKQTLARGERLTQLLKQNQYSPLAAEEQVPLIYAGVNGYLDNIDISRIAEFETKFLAYLKANHDEIVSAIREKGELSKELLATLKSATESFVATF 548
>gi|121534925|ref|ZP_01666744.1| ATP synthase F1, alpha subunit [Thermosinus carboxydivorans Nor1] >gi|121306524|gb|EAX47447.1| ATP synthase F1, alpha subunit [Thermosinus carboxydivorans Nor1] (513 aa)
Score = 1305, Expect = 1.1e-141, Identities = 259/495 (52%), Positives = 354/495 (71%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQ-----KTILE--TID-QTKDISQDLFVQIKNEFNSL 495
           M +  ++ + IIK QI+ YQ      ++G VI VGDGI +  GL   M  EL+ F +G YGM LNLE  + G V+LG    IKEG  V+RT  +++VPVG+ L+GRV++ +G P+DG G I      P+E  APG+  R SV EPL+TG  AID+M PIG+GQRELIIGD+ TGKT IA+D IINQKG+ V CIYV IGQK ST+ + + TL++ GA++YT +VA++A+D   L YLAP+ G+ + E +M KG  VL +YDDLSKHA AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K++   GGGSITALPIIET AGD+SAYIPTNVISITDGQ+F+ + LF SG RPAI+AG+SVSRVG +AQI A+K+ +G L+L++AQYREL AF+QFGSDLDK TK +++ G++ ++++KQ +  P     + +++++    ++  + V  +  F++  ++  +       KTI E   ID +T+   Q    + K+ F S+
  S:     1 MKMRPEEITAIIKQQIERYQVDLNVDDVGTVIEVGDGIARIHGLEKAMAGELLEFPHGVYGMVLNLEEDSVGGVLLGGETLIKEGDTVRRTGRIMEVPVGEALIGRVVNPLGQPLDGKGPINVTTHRPVEYPAPGIADRQSVKEPLQTGIKAIDAMIPIGRGQRELIIGDRGTGKTAIAVDTIINQKGQGVICIYVAIGQKASTVARVVRTLEEAGAMDYTIVVAATAADSAPLQYLAPYAGVAMGEYFMYKGGHVLCVYDDLSKHAQAYRAMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSDALGGGSITALPIIETLAGDVSAYIPTNVISITDGQIFLESELFYSGIRPAINAGISVSRVGGAAQIKAMKQVAGRLRLDMAQYRELAAFAQFGSDLDKATKALIDRGQRTLEILKQPQYAPMPVEEQVMVIYTAVNGFLDDVAVADVTKFEQDFLKFMRANYAEIGKTIREKKVIDSETEAALQKAIKEFKDTFVSI 503
>gi|90023608|ref|YP_529435.1| Sodium-transporting two-sector ATPase [Saccharophagus degradans 2-40] >gi|119367963|sp|Q21DK6|ATPA_SACD2 ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|89953208|gb|ABD83223.1| ATP synthase F1, alpha subunit [Saccharophagus degradans 2-40] (513 aa)
Score = 1305, Expect = 1.1e-141, Identities = 256/493 (51%), Positives = 353/493 (71%)
  Q:     3 INLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKE------NG-----GGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKTILETIDQTKDISQDLFVQIKNEFNSL 495
           +N  + S IIK +I            G V++V DGI++  GL++VM  E++ FE G YG+ LNLE  + G V+LG ++ + EG   K T  +++VPVG+ L GRV+DA+GNPIDG G I   K   IEKIAPGV+AR SV +P++ G  A+D+M PIG+GQRELIIGD+QTGKT +A+DAIINQKG  +KCIYV IGQK S++   +  L++ GA+++T +VA++ASD  S+ +LAPF G T+ E +  +GED LIIYDDL+K A AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ ++N +      NG      GS+TALPIIET+AGD+SA++PTNVISITDGQ+F+ T+LFN+G RPA++AG+SVSRVG SAQ   +KK SG ++  LAQYREL AFSQF SDLD+ TK  LEHG++V +L+KQ + +P S    A+++++  E Y++ + V  I DF+  ++ +       L         S ++  Q+K+  ++ 
  S:     4 LNPSEISEIIKQRIDNLAVSTEAQNEGTVVSVTDGIIRIHGLADVMYGEMIEFEGGVYGIALNLERDSVGAVVLGDYQGVAEGQSCKCTGRILEVPVGEELCGRVVDALGNPIDGKGPINAKKTDAIEKIAPGVIARQSVDQPVQIGLKAVDTMVPIGRGQRELIIGDRQTGKTAVAVDAIINQKGTGIKCIYVAIGQKASSVASVVRKLEEHGAMDHTIVVAATASDPASMQFLAPFAGCTMGEYFRDRGEDALIIYDDLTKQAWAYRQISLLLRRPPGREAYPGDVFYLHSRLLERAARVNADYVEQLTNGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETDLFNAGIRPAMNAGISVSRVGGSAQTKVIKKLSGGIRTALAQYRELAAFSQFASDLDEATKAQLEHGERVTELMKQKQYSPQSVGEMAVVVYAANEGYLKDVEVSKIGDFESALLSYMNSSHADLMNTMNGGSYSDEIAGQLKSALDTF 507
>gi|6319370|ref|NP_009453.1| Alpha subunit of the F1 sector of mitochondrial F1F0 ATP synthase, which is a large, evolutionarily conserved enzyme complex required for ATP synthesis; phosphorylated; Atp1p [Saccharomyces cerevisiae] >gi|496674|emb|CAA56001.1| C-545 protein; ROX3 [Saccharomyces cerevisiae] >gi|536167|emb|CAA84924.1| ATP1 [Saccharomyces cerevisiae] (545 aa)
Score = 1305, Expect = 1.2e-141, Identities = 253/491 (51%), Positives = 354/491 (72%)
  Q:     9 SNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQK--------GKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK-QQKTILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           S+I++ +IK   ++A  +E GRV+ VGDGI +  GL+N+   ELV F +G  GM LNLE    GIV+ G    +KEG +VKRT N+VDVPVG GLLGRV+DA+GNPIDG G I    +   +  APG++ R SV EP++TG  A+D++ PIG+GQRELIIGD+QTGKT +A+D I+NQK         K + C+YV +GQK ST+ Q + TL+Q  A++Y+ IVA++AS+   L YLAPFT  +I E +   G+  LI+YDDLSK A+AYR LSLLLRRPPGREAYPGD+FYLH RLLER+ K++++ G GS+TALP+IET+ GD+SAYIPTNVISITDGQ+F+   LF  G RPAI+ GLSVSRVGS+AQ+ A+K+ +GSLKL LAQYRE+ AF+QFGSDLD  TK+ L  G+++ +L+KQ++ +P +   +  L+++    ++  I +  I +F+   + + K     +L  I +  ++S++L   +K+   S + ++
  S:    46 SSILEERIKGVSDEANLNETGRVLAVGDGIARVFGLNNIQAEELVEFSSGVKGMALNLEPGQVGIVLFGSDRLVKEGELVKRTGNIVDVPVGPGLLGRVVDALGNPIDGKGPIDAAGRSRAQVKAPGILPRRSVHEPVQTGLKAVDALVPIGRGQRELIIGDRQTGKTAVALDTILNQKRWNNGSDESKKLYCVYVAVGQKRSTVAQLVQTLEQHDAMKYSIIVAATASEAAPLQYLAPFTAASIGEWFRDNGKHALIVYDDLSKQAVAYRQLSLLLRRPPGREAYPGDVFYLHPRLLERAAKLSEKEGSGSLTALPVIETQGGDVSAYIPTNVISITDGQIFLEAELFYKGIRPAINVGLSVSRVGSAAQVKALKQVAGSLKLFLAQYREVAAFAQFGSDLDASTKQTLVRGERLTQLLKQNQYSPLATEEQVPLIYAGVNGHLDGIELSRIGEFESSFLSYLKSNHNELLTEIREKGELSKELLASLKSATESFVATF 545
>gi|194476686|ref|YP_002048865.1| ATP synthase subunit A [Paulinella chromatophora] >gi|171191693|gb|ACB42655.1| ATP synthase subunit A [Paulinella chromatophora] (505 aa)
Score = 1304, Expect = 1.3e-141, Identities = 253/468 (54%), Positives = 346/468 (73%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQK 468
           +SI  D+ S I+K QI++Y      S +G V+ VGDGI +  GL   M  ELV FE+G+ G+ LNLE    G V++G+   I+EGS+VK T  +  VPVGD +LGRV++A+G PIDG G+I  D+   IE +APG++ R SV EP++TG  AID+M PIG+GQRELIIGD+QTGKT IAID I+NQKG++V C+Y+ IGQK +++   +  +++ GAL+YT IVA+SAS+  +L YLAP+TG  IAE +M KG+  L++YDDL+K A AYR ++LLLRRPPGREAYPGDIFY HSRLLER+ K++   G GS+TALPIIET+AGD+SAYIPTNVISITDGQ+F+ ++LFNSG RPAI+ G+SVSRVG +AQ  A+KK +G+LKLELAQ+ EL AFSQF SDLD  T++ L  GK++ +L+KQ + +P + + +  ++++  +  I  +PVD +  F  ++  + K  K
  S:     2 VSIRPDEISAILKQQIEDYDKSISISNVGTVLQVGDGIARIYGLQQCMAGELVEFEDGTEGLALNLEDDNVGAVLMGEGLGIQEGSMVKATGKIAAVPVGDAMLGRVVNALGQPIDGKGDIITDQTRLIESMAPGIIQRKSVHEPMQTGITAIDAMIPIGRGQRELIIGDRQTGKTAIAIDTILNQKGQDVVCVYIAIGQKAASVANVVEVMRERGALDYTIIVAASASEPAALQYLAPYTGAAIAEYFMYKGKATLVVYDDLTKQAQAYRQMALLLRRPPGREAYPGDIFYCHSRLLERAAKLSDAMGKGSMTALPIIETQAGDVSAYIPTNVISITDGQVFLSSDLFNSGLRPAINVGISVSRVGGAAQTKAIKKIAGTLKLELAQFDELAAFSQFASDLDAATQKQLGRGKRLRELLKQSQFSPLNLAEQVAIVYAGVKGLIDDVPVDKVVQFASELREYLKSNK 469
>gi|87301252|ref|ZP_01084093.1| ATP synthase subunit A [Synechococcus sp. WH 5701] >gi|87284220|gb|EAQ76173.1| ATP synthase subunit A [Synechococcus sp. WH 5701] (505 aa)
Score = 1304, Expect = 1.5e-141, Identities = 258/483 (53%), Positives = 349/483 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKTILETIDQTKDISQD 483
           +SI  D+ S I+K QI++Y      S +G V++VGDGI +  GL  VM  ELV F++GS G+ LNLE    G V+L     I+EGS VK T  + +VPVG+ +LGRVI+ +G PIDG GEI       IE +APG++ R SV EP++TG  AID+M PIG+GQRELIIGD+QTGKT IAID I+NQKG++V C+YV IGQK++++   +  L++ GAL+YT +VA+SAS+  +L YLAP+TG  IAE +M +G+  L++YDDL+K A AYR +SLLLRRPPGREAYPGD+FY HSRLLER+ K++ E G GS+TALPIIET+AGD+SAYIPTNVISITDGQ+F+ ++LFNSG RPAI+ G+SVSRVG +AQ  A+KK +G+LKLELAQ+ EL AFSQF SDLD  T+  L  GK++ +L+KQ + +P   + +  ++++  +  I  +PVD +  F  ++  + K  K    T  QT+ +  D
  S:     2 VSIRPDEISAILKQQIEDYDKSVSVSNVGTVLSVGDGIARIYGLQQVMSGELVQFDDGSEGIALNLEDDNVGAVLLTDGIGIREGSTVKATTRIAEVPVGEAMLGRVINPLGVPIDGKGEIATTSTRLIESMAPGIIQRKSVHEPMQTGITAIDAMIPIGRGQRELIIGDRQTGKTAIAIDTILNQKGEDVVCVYVAIGQKSASVANVVEVLRERGALDYTVVVAASASEPAALQYLAPYTGAAIAESFMYEGKATLVVYDDLTKQAQAYRQMSLLLRRPPGREAYPGDVFYCHSRLLERAAKLSDEMGKGSMTALPIIETQAGDVSAYIPTNVISITDGQVFLSSDLFNSGLRPAINVGISVSRVGGAAQTKAIKKIAGTLKLELAQFDELAAFSQFASDLDAATQAQLGRGKRLRELLKQPQYSPLLLAEQVAVVYAGVKGLIDEVPVDQVVQFCRELRDYLKTNKPEFITKVQTEKVLSD 484
>gi|78356034|ref|YP_387483.1| F0F1 ATP synthase subunit alpha [Desulfovibrio desulfuricans subsp. desulfuricans str. G20] >gi|115312246|sp|Q313V8|ATPA_DESDG ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|78218439|gb|ABB37788.1| ATP synthase F1, alpha subunit [Desulfovibrio desulfuricans G20] (502 aa)
Score = 1304, Expect = 1.5e-141, Identities = 251/489 (51%), Positives = 346/489 (70%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQK-TILETIDQTKDISQDLFVQIK 489
           M I  ++ S II++QI+ Y+ +   SE G V+ VGDGI +  G+ N M  EL+ F  G  GM LNLE    G+ +LG   DIKEG  VKRT  +  VPVGD ++GRV++ +G PIDG G +   +  P+E  APG++AR SV EP+ TG  AID+M PIG+GQREL+IGD+QTGKT + IDAI+ QK  ++ C YV IGQK ST+    +TLK+ GA+EYTTI++++AS+   L ++A + G  +AE +   G+  LI+YDDLSK A AYR +SLLLRRPPGREA+PGD+FYLHSRLLER+ K+N   G GS+TALPIIET+AGD+SAYIPTNVISITDGQ+++  NLFN+G RPAI+ GLSVSRVG +AQI A+K+ +G+++L+LAQYREL AF+QFGSDLDK T+  L  G ++++L+KQ +  P   + +   +++    ++  +PV  I  F+ + I   +  K  IL+ +D+ K I  D+  ++K
  S:     1 MQIKTEEISQIIESQIQNYEQRVEMSETGTVLYVGDGIARVYGVRNAMAMELLEFPGGLMGMVLNLEEDNVGVALLGPDTDIKEGDPVKRTGKIFSVPVGDAVMGRVLNPLGQPIDGEGPVDSKEFRPVELKAPGIIARKSVHEPMPTGIKAIDAMTPIGRGQRELVIGDRQTGKTAVCIDAILAQKNTDIHCFYVAIGQKRSTVALVADTLKKHGAMEYTTIISATASEPAPLQFIAAYAGCAMAEYYRDSGKHALIVYDDLSKQATAYRQMSLLLRRPPGREAFPGDVFYLHSRLLERAAKVNDSLGAGSLTALPIIETQAGDVSAYIPTNVISITDGQVYLEPNLFNAGIRPAINVGLSVSRVGGAAQIKAMKQVAGTMRLDLAQYRELAAFAQFGSDLDKATQAKLNRGARLVELLKQPQYQPMPFNEQVASMYAATRGFMDDVPVASIRKFEAEYIEFLRDAKGDILKDLDEKKAIDNDIEGRMK 490
>gi|150406456|ref|YP_001315101.1| ATP synthase F1 subunit alpha [Chlorokybus atmophyticus] >gi|126507693|gb|ABO15090.1| ATP synthase F1 subunit alpha [Chlorokybus atmophyticus] (510 aa)
Score = 1303, Expect = 1.7e-141, Identities = 257/482 (53%), Positives = 350/482 (72%)
  Q:     3 INLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQK--------GKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKTILETIDQTKDISQDL 484
           +N  + S I++ +I  Y  +     IGRVI+VGDGI +  GL+ +   E+V F +G  GM LNLE    G+V+ G    IKEG IVKRT ++VDVPVG G+LGRV+DA+GNPIDG G +    +  +E  APG++AR SV EP++TG  A+DS+ PIG+GQRELIIGD+QTGKT IAID IINQK         K + C+YV +GQK ST+ Q + TL + GALEY+ IVA++ASD   L +LAP+ G  + E +       LIIYDDLSK ++AYR +SLLLRRPPGREA+PGD+FYLHSRLLER+ K++ + G GS+TALP+IET+AGD+SAYIPTNVISITDGQ+F+ T LF  G RPAI+ GLSVSRVGS+AQ+ A+K+ SGSLKLELAQYRE+ AF+QFGSDLD  T+ +L  G ++ +++KQD+ +P     + +++++  + Y+  I V  I  F++++++    +  I +TI + K I+ +L
  S:     4 LNPGELSTILEEEITNYYKRLKVDGIGRVISVGDGIARVYGLNKIQAGEMVEFSSGVKGMALNLENDNVGVVLFGSDTGIKEGDIVKRTGSIVDVPVGKGMLGRVVDALGNPIDGKGRLTDVSRSRVEVKAPGIIARKSVHEPMQTGLKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKEVNSGTDSTKKLYCVYVAVGQKRSTVAQLVKTLSEKGALEYSIIVAATASDPAPLQFLAPYAGCAMGEYFRDNKMHSLIIYDDLSKQSVAYRQMSLLLRRPPGREAFPGDVFYLHSRLLERAAKLSDQKGAGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYRGIRPAINVGLSVSRVGSAAQLKAMKQVSGSLKLELAQYREVAAFAQFGSDLDAATQYLLNRGARLTEVLKQDQYSPIPIEKQVVVIYAAVKGYLDKISVSQISTFEQELLQRCPPE--IFKTIREEKQITPEL 491
>gi|1660995|dbj|BAA13613.1| defective F1F0-ATPase alpha subunit precursor [Saccharomyces cerevisiae] (545 aa)
Score = 1303, Expect = 1.8e-141, Identities = 253/491 (51%), Positives = 354/491 (72%)
  Q:     9 SNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQK--------GKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK-QQKTILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           S+I++ +IK   ++A  +E GRV+ VGDGI +  GL+N+   ELV F +G  GM LNLE    GIV+ G    +KEG +VKRT N+VDVPVG GLLGRV+DA+GNPIDG G I    +   +  APG++ R SV EP++TG  A+D++ PIG+GQRELIIGD+QTGKT +A+D I+NQK         K + C+YV +GQK ST+ Q + TL+Q  A++Y+ IVA++AS+   L YLAPFT  +I E +   G+  LI+YDDLSK A+AYR LSLLLRRPPGREAYPGD+FYLHSRLLER+ K++++ G GS+TALP+IET+ GD+SAYIPTNVISI DGQ+F+   LF  G RPAI+ GLSVSRVGS+AQ+ A+K+ +GSLKL LAQYRE+ AF+QFGSDLD  TK+ L  G+++ +L+KQ++ +P +   +  L+++    ++  I +  I +F+   + + K     +L  I +  ++S++L   +K+   S + ++
  S:    46 SSILEERIKGVSDEANLNETGRVLAVGDGIARVFGLNNIQAEELVEFSSGVKGMALNLEPGQVGIVLFGSDRLVKEGELVKRTGNIVDVPVGPGLLGRVVDALGNPIDGKGPIDAAGRSRAQVKAPGILPRRSVHEPVQTGLKAVDALVPIGRGQRELIIGDRQTGKTAVALDTILNQKRWNNGSDESKKLYCVYVAVGQKRSTVAQLVQTLEQHDAMKYSIIVAATASEAAPLQYLAPFTAASIGEWFRDNGKHALIVYDDLSKQAVAYRQLSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSEKEGSGSLTALPVIETQGGDVSAYIPTNVISIIDGQIFLEAELFYKGIRPAINVGLSVSRVGSAAQVKALKQVAGSLKLFLAQYREVAAFAQFGSDLDASTKQTLVRGERLTQLLKQNQYSPLATEEQVPLIYAGVNGHLDGIELSRIGEFESSFLSYLKSNHNELLTEIREKGELSKELLASLKSATESFVATF 545
>gi|145523559|ref|XP_001447616.1| hypothetical protein GSPATT00039376001 [Paramecium tetraurelia strain d4-2] >gi|124415131|emb|CAK80219.1| unnamed protein product [Paramecium tetraurelia] (536 aa)
Score = 1303, Expect = 2.0e-141, Identities = 266/499 (53%), Positives = 349/499 (69%)
  Q:     2 SINLDKFSNIIK-NQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQK--------GKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQ-KTILETIDQTKDISQDLFVQIKNEFNSLITSYI 500
           S+  DK  NI + N IKEY         G VI++GDGI +  GL+ V   E+V F +G  GM LNLE    GIV+LG   +I+EG IVKRT  +VDVP+G  +LGRV DA+GNPIDG+G +K + +  +E  APG++ R SV EP++TG  A+D + PIG+GQRELIIGD+QTGKT IAID IINQK         K + CIYV IGQK ST+   +  L Q GA++YT +VA++AS+   L YLAP++G  I E +   G   LIIYDDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+N ENG GS+TALP+IET+AGD+SAYIPTNVISITDGQ+F+ T LF  G RPAI+ GLSVSRVGS+AQI A+K  +G LKLELAQYRE+ AF+QFGSDLD  T+++L  G ++ +L+KQ +  P     +  ++++    ++  +    I  F+EK + H +     +LE I  T ++S+    Q   E  S++  +I
  S:    32 SVLEDKIKNISQLNDIKEY---------GTVISIGDGIARVFGLTQVQAGEMVEFSSGVRGMALNLETDNVGIVVLGNDREIQEGDIVKRTGAIVDVPIGMEMLGRVFDALGNPIDGHGPVKTNTRRRVELKAPGIIPRKSVHEPMQTGLKAVDCLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKPNFDSGDKNKQLYCIYVAIGQKRSTVANLVKILTQAGAMKYTIVVAATASEAAPLQYLAPYSGCAIGEYFRDNGMHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNAENGNGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFFKGIRPAINVGLSVSRVGSAAQIKAMKTVAGRLKLELAQYREVAAFAQFGSDLDAATQQLLNRGAQLTELLKQKQYVPMCAEEQVCVIYAGVRGFLDKVQTSEIAKFEEKFLTHLRTNYPAMLERIRSTGELSK----QDDAELKSILEVFI 527
>gi|188580724|ref|YP_001924169.1| ATP synthase F1, alpha subunit [Methylobacterium populi BJ001] >gi|179344222|gb|ACB79634.1| ATP synthase F1, alpha subunit [Methylobacterium populi BJ001] (509 aa)
Score = 1303, Expect = 2.0e-141, Identities = 253/499 (50%), Positives = 355/499 (71%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQK------GKNVK--CIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK-QQKTILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           M I   + S I+K QIK +  +A  +E+G+V+ VGDGI +  GL NV   E+V FE+G  GM LNLE    G+V+ G   +IKEG  VKRT  +VDVPVG GLLGRV+D +GNPIDG G I+  ++  ++  APG++ R SV EP+ TG  AID++ P+G+GQRELIIGD+QTGKT IA+D I+NQK       +N K  C+YV IGQK ST+ QF+  L+  GALEY+ ++A++ASD   + ++APF G  + E +   G   +I+YDDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+    G GS+TALP+IET+A D+SAYIPTNVISITDGQ+F+ T+LF  G RPA++ GLSVSRVGSSAQ  A+KK +G +K ELAQYRE+ AF+QFGSDLD  T+ +L  G ++ +L+KQ + +P     +  ++++    Y+  +PV+ + +F+++++   + + +  L+++  +KD+S      +K    S+  S+
  S:     1 MDIRAAEISAILKEQIKNFGQEAEVTEVGQVLAVGDGIARVYGLDNVQAGEMVEFESGVRGMALNLEQDNVGVVIFGSDREIKEGQTVKRTGAIVDVPVGKGLLGRVVDGLGNPIDGKGPIQSTERRRVDVKAPGIIPRKSVHEPMATGLKAIDALIPVGRGQRELIIGDRQTGKTAIALDTILNQKPAHSGTDENAKLYCVYVAIGQKRSTVAQFVKVLEDQGALEYSIVIAATASDAAPMQFIAPFAGCAMGEYFRDNGMHAVIVYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMGDAAGKGSLTALPVIETQANDVSAYIPTNVISITDGQIFLETDLFYQGVRPAVNVGLSVSRVGSSAQTKAMKKVAGKIKGELAQYREMAAFAQFGSDLDASTQRLLNRGARLTELLKQPQFSPLKMEEQVAVIYAGVNGYLDKLPVNKVREFEDQLLGTLRSKHQDWLDSVRDSKDLSDANANTLKGVVESIAKSF 508
>gi|177670762|ref|ZP_02943852.1| ATP synthase F1, alpha subunit [Micrococcus luteus NCTC 2665] >gi|172072190|gb|EDT58227.1| ATP synthase F1, alpha subunit [Micrococcus luteus NCTC 2665] (555 aa)
Score = 1302, Expect = 2.1e-141, Identities = 252/477 (52%), Positives = 340/477 (71%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKAL-YSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKG--------KNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKTILETIDQT 477
           ++IN D   N +      Y+      +E+GRVI+  DGI +  GL +VM NEL+ FENG  G+  NL+    G+V+LG+F++I+EG  V+RT  ++ VPVGD  LGRV+D +G PID  G I+ + +  +E  AP V  R SV EPL+TG  AID+M PIG+GQR+LIIGD+QTGKT IA+D I+NQK         K V+C+YV +GQK STI     TL++ GALEYTTIVAS ASD     YLAP+ G  I + WM  G+ VLII+DDLSK A AYR +SLLLRRPPGREAYPGD+FYLHSRLLER  K++ E G GS+T LPIIET+A D+SAYIPTNVISITDGQ+F+ ++LFN+ QRPA+D G+SVSRVG +AQ+ A+KK SG+LKL+LAQYR+  AFS F SDLD  T+  L  G+++M+L+KQ + +P+    + + +++  + ++  +PV  +  F+ + I H ++  ++L  I  T
  S:    15 LTINADDVRNALNEFAASYEPSGTDRTEVGRVISAADGIARVEGLPSVMANELLRFENGIQGLAQNLDTREIGVVVLGEFQEIREGMEVQRTGEILSVPVGDAFLGRVVDPLGQPIDDLGPIEAEGRRALELQAPTVTERKSVHEPLQTGMKAIDAMIPIGRGQRQLIIGDRQTGKTAIAVDTILNQKANWESGDVEKQVRCVYVAVGQKASTIAGVRATLEEHGALEYTTIVASPASDPAGFKYLAPYAGSAIGQHWMYGGKHVLIIFDDLSKQAEAYRAVSLLLRRPPGREAYPGDVFYLHSRLLERCAKLSDEMGAGSMTGLPIIETKANDVSAYIPTNVISITDGQIFLQSDLFNANQRPAVDVGISVSRVGGAAQVKAMKKVSGTLKLDLAQYRDQQAFSMFASDLDPATRRQLARGERLMELLKQPQYSPYPVEEQVVSIWAGSKGHLDEVPVQDVLRFEREFIDHLRRHTSVLTDIAST 500
>gi|169177775|ref|ZP_02839289.1| ATP synthase F1, alpha subunit [Arthrobacter chlorophenolicus A6] >gi|169014287|gb|EDS60848.1| ATP synthase F1, alpha subunit [Arthrobacter chlorophenolicus A6] (494 aa)
Score = 1302, Expect = 2.1e-141, Identities = 252/471 (53%), Positives = 335/471 (71%)
  Q:     1 MSINLDKFSNIIKNQIKEYQ-NKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKG--------KNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKTIL 471
           ++IN D   N +      Y+   A   E+GRV    DGI +  GL +VM NEL+ FE+G+ G+  NL+    G+++LG F  I+EG  V RT  V+ VPVGD  LGRV+D +G PID  GEIK +    +E  APGV  R SV EP++TG  AID+M PIG+GQR+LIIGD+QTGK+ IAID IINQK         K V+CIYV IGQK STI     TL++ GALEYTTIVAS ASD     YLAP+ G  I + WM  G+ VLI++DDLSK A AYR +SLLLRRPPGREAYPGD+FYLHSRLLER  K++ E G GS+T LP+IET+A D+SAYIPTNVISITDGQ+F+ ++LFN+ QRPA+D G+SVSRVG +AQ+ ++KK SG+LKLELAQYR++ AF+ F SDLD  +++ L  G ++M+L+KQ + +PF    + + +++    ++  +PV+ +  F+ + + H K + +IL
  S:     4 LTINADDVRNALNEFAASYEPGNAERVEVGRVTTASDGIARVEGLPSVMANELLRFEDGTLGLAQNLDVREIGVIILGDFTGIEEGQEVHRTGQVLSVPVGDAFLGRVVDPLGVPIDDLGEIKAETTRALELQAPGVTQRKSVHEPMQTGLKAIDAMIPIGRGQRQLIIGDRQTGKSAIAIDTIINQKANWASGDVTKQVRCIYVAIGQKASTIAAVRQTLEENGALEYTTIVASPASDPAGFKYLAPYAGSAIGQHWMYGGKHVLIVFDDLSKQAEAYRAVSLLLRRPPGREAYPGDVFYLHSRLLERCAKLSDELGAGSMTGLPLIETKANDVSAYIPTNVISITDGQIFLQSDLFNANQRPAVDVGVSVSRVGGAAQVKSMKKVSGTLKLELAQYRDMQAFAMFASDLDAASRQQLTRGARLMELLKQGQYSPFPVEDQVVSIWAGTNGHLDDVPVEDVNRFETEFLEHLKHKSSIL 483
>gi|190893718|ref|YP_001980260.1| H(+)-transporting ATP synthase protein, alpha subunit [Rhizobium etli CIAT 652] >gi|190698997|gb|ACE93082.1| H(+)-transporting ATP synthase protein, alpha subunit [Rhizobium etli CIAT 652] (509 aa)
Score = 1302, Expect = 2.4e-141, Identities = 254/499 (50%), Positives = 353/499 (70%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQK--------GKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFKQQKT-ILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           M I   + S I+K+QIK +  +A  SE+G+V++VGDGI +  GL NV   E+V F  G  GM LNLE+   G+V+ G   DIKEG  VKRT  +VDVPVG  LLGRV+DA+GNPIDG G I   ++  ++  APG++ R SV EP+ TG  AID++ P+G+GQREL+IGD+QTGKT I +DA +NQK        G+ + C+YV +GQK ST+ QF+  L++ GAL+Y+ IVA++ASD   + +LAPF G  + E +   G   LI YDDLSK A++YR +SLLLRRPPGREAYPGD+FYLHSRLLER+ K+N + G GS+TALP+IET+  D+SA+IPTNVISITDGQ+F+ T+LF  G RPA++ GLSVSRVGSSAQI A+K+ +GS+K ELAQYRE+ AF+QFGSDLD  T+ +L  G ++ +L+KQ + +P     +  ++F+    Y+  +PV  +  F++ ++ + + + + IL+ I   K IS     ++    +S   S+
  S:     1 MDIRAAEISAILKDQIKNFGKEAEVSEVGQVLSVGDGIARVYGLDNVQAGEMVEFPGGIRGMALNLESDNVGVVIFGSDRDIKEGDTVKRTGAIVDVPVGPELLGRVVDALGNPIDGKGPINATRRSRVDVKAPGIIPRKSVHEPMSTGLKAIDALIPVGRGQRELVIGDRQTGKTAILLDAFLNQKAIHESGPEGEKLYCVYVAVGQKRSTVAQFVKVLEERGALKYSIIVAATASDPAPMQFLAPFAGCAMGEYFRDNGMHALIGYDDLSKQAVSYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDDKGAGSLTALPVIETQGNDVSAFIPTNVISITDGQIFLETDLFYQGIRPAVNVGLSVSRVGSSAQIKAMKQVAGSIKGELAQYREMAAFAQFGSDLDAATQRLLNRGARLTELLKQPQFSPLKTEEQVAVIFAGVNGYLDKLPVASVGKFEQGLLSYLRSEGSAILDAIRTEKAISDGTKGKLTAALDSFAKSF 508
>gi|196189136|gb|EDX84100.1| ATP synthase F1, alpha subunit [Synechococcus sp. PCC 7335] (504 aa)
Score = 1302, Expect = 2.5e-141, Identities = 258/483 (53%), Positives = 352/483 (72%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK-QQKTILETIDQTKDISQD 483
           +SI  D+ S+II+ QI++Y        +G V+ VGDGI +  GL N M  EL+ F++G+ G+ LNLE    G VM+G    + EGS VK T  +  VPVG+ +LGRVID +G PIDG G+I   +   IE +APG++ R SV EPL+TG  AID+M PIG+GQRELIIGD+QTGKT IAID I+NQ  ++V C+YV IGQK S++ Q I  L++ GAL+YT +VA++A+D  +L YLAP+TG  IAE +M KG+  LIIYDDL+K A AYR +SLLLRRPPGREAYPGD+F+LHSRLLER+ K++ E G GS+TALPIIET+AGD+SAYIPTNVISITDGQ+F+ ++LFNSG RPAI+AG+SVSRVGS+AQ  A+KK +G +KLELAQ+ EL AF+QF SDLD  T+  L  G+++ +++KQ + +P S + +  ++++     +  IPVD + D+  ++I +    +K  ++ I  TK ++ D
  S:     2 VSIRPDEISSIIQQQIEQYDQDVKADSVGTVLQVGDGIARIYGLDNTMAGELLEFDDGTIGIALNLEEDNVGAVMMGTGRQVLEGSTVKSTGKIASVPVGESMLGRVIDTLGRPIDGKGDINTSESRLIESMAPGIIERKSVYEPLQTGITAIDAMIPIGRGQRELIIGDRQTGKTAIAIDTILNQADQDVICVYVAIGQKASSVAQVIGVLEERGALDYTVVVAANANDPAALQYLAPYTGAAIAEYFMYKGKATLIIYDDLTKQAQAYRQMSLLLRRPPGREAYPGDVFFLHSRLLERAAKLSPELGEGSMTALPIIETQAGDVSAYIPTNVISITDGQIFLSSDLFNSGLRPAINAGISVSRVGSAAQTKAIKKVAGKVKLELAQFDELQAFAQFASDLDPATQAQLAKGQRLREILKQPQYSPRSLAEQVAVIYAGVNDKLNDIPVDKVADYVSELIAYVNTSKKAYVDEIMNTKKLTDD 485
>gi|161567476|ref|YP_323121.2| F0F1 ATP synthase subunit alpha [Anabaena variabilis ATCC 29413] >gi|115312236|sp|Q3M9W0|ATPA_ANAVT ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) (506 aa)
Score = 1302, Expect = 2.6e-141, Identities = 253/465 (54%), Positives = 347/465 (74%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK 465
           +SI  D+ S+II+ QI++Y  +   + +G V+ VGDGI +  GL   M  EL+ FE+G+ G+  NLE    G V++G+  +I+EGS V  T  +  + VG+ L+GRV+DA+G  IDG G+IK  +   IE  APG++AR SV EP++TG  AIDSM PIG+GQRELIIGD+QTGKT IAID IINQKG++V C+YV IGQK ST+   + TL++ GA++YT +VA+ AS+  +L +LAP+TG TIAE +M KG+  L+IYDDLSK A AYR +SLLLRRPPGREAYPGD+FY+HSRLLER+ K++ E G GS+TALPIIET+AGD+SAYIPTNVISITDGQ+F+ ++LFN+G RPA++ G+SVSRVGS+AQ  A+KK +G +KLELAQ+ +L AF+QF SDLDK T++ L  G+++ +L+KQ +N P S + +  +L++    Y+  IPVD +  F + +  + K
  S:     3 ISIRPDEISSIIQQQIEQYDQEVKVANVGTVLQVGDGIARIYGLEKAMAGELLEFEDGTVGIAQNLEEDNVGAVLMGEGREIQEGSTVTATGRIAQIGVGEALIGRVVDALGRAIDGKGDIKASESRLIESPAPGIIARRSVHEPMQTGITAIDSMIPIGRGQRELIIGDRQTGKTAIAIDTIINQKGEDVVCVYVAIGQKASTVANVVQTLQEKGAMDYTVVVAAGASEPATLQFLAPYTGATIAEYFMYKGKATLVIYDDLSKQAQAYRQMSLLLRRPPGREAYPGDVFYIHSRLLERAAKLSDELGKGSMTALPIIETQAGDVSAYIPTNVISITDGQIFLSSDLFNAGIRPAVNPGISVSRVGSAAQTKAMKKVAGKIKLELAQFDDLQAFAQFASDLDKATQDQLARGQRLRELLKQSQNQPLSVAEQVAILYAGINGYLDDIPVDKVTTFTKGLRDYLK 467
>gi|17227501|ref|NP_484049.1| F0F1 ATP synthase subunit alpha [Nostoc sp. PCC 7120] >gi|20141206|sp|P12405|ATPA_ANASP ATP synthase subunit alpha (ATPase subunit alpha) (ATP synthase F1 sector subunit alpha) >gi|17134983|dbj|BAB77529.1| ATP synthase subunit alpha [Nostoc sp. PCC 7120] (506 aa)
Score = 1302, Expect = 2.6e-141, Identities = 253/465 (54%), Positives = 347/465 (74%)
  Q:     1 MSINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKENGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK 465
           +SI  D+ S+II+ QI++Y  +   + +G V+ VGDGI +  GL   M  EL+ FE+G+ G+  NLE    G V++G+  +I+EGS V  T  +  + VG+ L+GRV+DA+G  IDG G+IK  +   IE  APG++AR SV EP++TG  AIDSM PIG+GQRELIIGD+QTGKT IAID IINQKG++V C+YV IGQK ST+   + TL++ GA++YT +VA+ AS+  +L +LAP+TG TIAE +M KG+  L+IYDDLSK A AYR +SLLLRRPPGREAYPGD+FY+HSRLLER+ K++ E G GS+TALPIIET+AGD+SAYIPTNVISITDGQ+F+ ++LFN+G RPA++ G+SVSRVGS+AQ  A+KK +G +KLELAQ+ +L AF+QF SDLDK T++ L  G+++ +L+KQ +N P S + +  +L++    Y+  IPVD +  F + +  + K
  S:     3 ISIRPDEISSIIQQQIEQYDQEVKVANVGTVLQVGDGIARIYGLEKAMAGELLEFEDGTVGIAQNLEEDNVGAVLMGEGREIQEGSTVTATGRIAQIGVGEALIGRVVDALGRAIDGKGDIKASESRLIESPAPGIIARRSVHEPMQTGITAIDSMIPIGRGQRELIIGDRQTGKTAIAIDTIINQKGEDVVCVYVAIGQKASTVANVVQTLQEKGAMDYTVVVAAGASEPATLQFLAPYTGATIAEYFMYKGKATLVIYDDLSKQAQAYRQMSLLLRRPPGREAYPGDVFYIHSRLLERAAKLSDELGKGSMTALPIIETQAGDVSAYIPTNVISITDGQIFLSSDLFNAGIRPAVNPGISVSRVGSAAQTKAMKKVAGKIKLELAQFDDLQAFAQFASDLDKATQDQLARGQRLRELLKQSQNQPLSVAEQVAILYAGINGYLDDIPVDKVTTFTKGLRDYLK 467
>gi|194337686|ref|YP_002019480.1| ATP synthase F1, alpha subunit [Pelodictyon phaeoclathratiforme BU-1] >gi|194310163|gb|ACF44863.1| ATP synthase F1, alpha subunit [Pelodictyon phaeoclathratiforme BU-1] (526 aa)
Score = 1302, Expect = 2.6e-141, Identities = 256/498 (51%), Positives = 358/498 (71%)
  Q:     2 SINLDKFSNIIKNQIKEYQNKALYSEIGRVINVGDGIVQASGLSNVMLNELVLFENGSYGMTLNLEATTCGIVMLGKFEDIKEGSIVKRTKNVVDVPVGDGLLGRVIDAMGNPIDGNGEIKYDKKMPIEKIAPGVMARASVCEPLETGTLAIDSMFPIGKGQRELIIGDKQTGKTTIAIDAIINQKGKNVKCIYVFIGQKNSTIVQFINTLKQFGALEYTTIVASSASDLPSLNYLAPFTGITIAEEWMSKGEDVLIIYDDLSKHAIAYRTLSLLLRRPPGREAYPGDIFYLHSRLLERSGKINKE------------------NGGGSITALPIIETEAGDISAYIPTNVISITDGQLFMLTNLFNSGQRPAIDAGLSVSRVGSSAQINAVKKTSGSLKLELAQYRELDAFSQFGSDLDKETKEVLEHGKKVMKLIKQDKNTPFSQSLEAILLFSIKEKYIRWIPVDYIEDFKEKIIRHFK-QQKTILETIDQTKDISQDLFVQIKNEFNSLITSY 499
           ++  D+ S+I++ Q+  ++++A   ++G V+ VGDGI +  GLS V   EL+ F N   GM LNLE    G V+ G+   +KEG  VKRT  +  +PVG+ +LGRVI+ +G PIDG G I    ++P+E+ APGV+ R SV EPL+TG  AIDSM PIG+GQRELIIGD+QTGKT +AID IINQKGK V CIYV IG K ST+ Q +NTL+++ A+EYTT+++++ASD   L ++APF G T+ E +   G   L++YDDLSK A+AYR +SLLLRRPPGREAYPGD+FYLHSRLLER+ KI  +                   GGGS+TALP+IET+AGD+SAYIPTNVISITDGQ+F+ +NLFNSGQRPAI+ G+SVSRVG SAQI A+KK +G+L+L+LAQ+REL+AFS+FGSDLDK TK  L+ G ++++++KQ +  P     +  ++F   +  +  + + +I  F+E+ +   + +   +L  I  +  +  D   ++K+     +T +
  S:     4 TVRPDEVSSILRKQLAGFESEAEVYDVGTVLQVGDGIARVYGLSKVAAGELLEFPNNVMGMALNLEEDNVGAVLFGESNLVKEGDTVKRTSILASIPVGEAMLGRVINPLGEPIDGKGTIDTQIRLPLERRAPGVIYRKSVHEPLQTGLKAIDSMIPIGRGQRELIIGDR