>gi|26554059|ref|NP_757993.1| hypothetical protein MYPE6070 [Mycoplasma penetrans HF-2] >gi|26454067|dbj|BAC44397.1| hypothetical protein [Mycoplasma penetrans HF-2] (950 aa)
Score = 3933, Expect = 0.0e+00, Identities = 950/950 (100%), Positives = 950/950 (100%)
  Q:     1 MNFKNKKNIIKMLSLSLVGITIAIPLSSCGYSNNAFNYDANQTPSKDFNNENNNNNNGSSNNSGILDASIVESKKVQNNLSLQQENPNDFGLTQNYLDFANNGSFNKYLGDKSIIYEDILGYLNFLYYKNNKQISFTNSNIKDLKFLEVDASNKLILNKSKISFELVVTVSTNELSEFVIGDKKFNLAKDHSSTLIIKSVDQTLKPTIEKQGEKFYLGWFLDKVSVSFNNQDFEILNFKPTANSFSKAFYFSFNNLSDKQSYFDLKEKYQKDFENQISNESVKKDLEEKINSETALYFDYMDIANNLINEIATDQPVNYLVQKASVYLIDIVTKIGIIPQGIDAILKEAIKIDGSNKSLTLLEVIVNNKEKILSILKSYLGSAYDIVEPLLINLQINMKEDNPSYKLLLEYVNQFVGKDDPIRKLITGDILGVTSSAKSLFDIVWSNIETILNKIKEATQNDKTLTSLINLLTIIFTKDSTSNQFVSIYDSLFKSKETKQKFINSIVSLLPANISEYLNILIIDNSAVNKELMLKITKSFANFFKGLYEHKSDADDTTSFDQRYKNLSFTKTWVTSPTVTKKDVITTTFNYEIKASIINAVDLDIKPIKEIITQDAFNKIVKKLANLTGVVATVAESQIYPELRKHLLNYVPDVFKFGTNGENTNALIFTYSGKDEQIWFNLDKKGIDFYLGLSIGYNLNIFYDDPQLWKNIASSNNFNKEVFETTKTVALIVKVNFKFWYYNFWKSILQNVLMRSYDINSRFYISDYSTKIADYSNYNENYYYTNLSFVNNANQVNVSEIKTLFDLSKTGNFKDQVSTIKNDKVQNPNTLNWGNKATEEVKGITPLTSESNLKTIKEKMFSLTTNNSSFILTKYNLDYSFNTLFNFLAKIEFQVKASVGNVDVHPIISFNISMFKSNLYFPVNFYDETNKKLITNFEKTYSDISFNAQL 950
           MNFKNKKNIIKMLSLSLVGITIAIPLSSCGYSNNAFNYDANQTPSKDFNNENNNNNNGSSNNSGILDASIVESKKVQNNLSLQQENPNDFGLTQNYLDFANNGSFNKYLGDKSIIYEDILGYLNFLYYKNNKQISFTNSNIKDLKFLEVDASNKLILNKSKISFELVVTVSTNELSEFVIGDKKFNLAKDHSSTLIIKSVDQTLKPTIEKQGEKFYLGWFLDKVSVSFNNQDFEILNFKPTANSFSKAFYFSFNNLSDKQSYFDLKEKYQKDFENQISNESVKKDLEEKINSETALYFDYMDIANNLINEIATDQPVNYLVQKASVYLIDIVTKIGIIPQGIDAILKEAIKIDGSNKSLTLLEVIVNNKEKILSILKSYLGSAYDIVEPLLINLQINMKEDNPSYKLLLEYVNQFVGKDDPIRKLITGDILGVTSSAKSLFDIVWSNIETILNKIKEATQNDKTLTSLINLLTIIFTKDSTSNQFVSIYDSLFKSKETKQKFINSIVSLLPANISEYLNILIIDNSAVNKELMLKITKSFANFFKGLYEHKSDADDTTSFDQRYKNLSFTKTWVTSPTVTKKDVITTTFNYEIKASIINAVDLDIKPIKEIITQDAFNKIVKKLANLTGVVATVAESQIYPELRKHLLNYVPDVFKFGTNGENTNALIFTYSGKDEQIWFNLDKKGIDFYLGLSIGYNLNIFYDDPQLWKNIASSNNFNKEVFETTKTVALIVKVNFKFWYYNFWKSILQNVLMRSYDINSRFYISDYSTKIADYSNYNENYYYTNLSFVNNANQVNVSEIKTLFDLSKTGNFKDQVSTIKNDKVQNPNTLNWGNKATEEVKGITPLTSESNLKTIKEKMFSLTTNNSSFILTKYNLDYSFNTLFNFLAKIEFQVKASVGNVDVHPIISFNISMFKSNLYFPVNFYDETNKKLITNFEKTYSDISFNAQL
  S:     1 MNFKNKKNIIKMLSLSLVGITIAIPLSSCGYSNNAFNYDANQTPSKDFNNENNNNNNGSSNNSGILDASIVESKKVQNNLSLQQENPNDFGLTQNYLDFANNGSFNKYLGDKSIIYEDILGYLNFLYYKNNKQISFTNSNIKDLKFLEVDASNKLILNKSKISFELVVTVSTNELSEFVIGDKKFNLAKDHSSTLIIKSVDQTLKPTIEKQGEKFYLGWFLDKVSVSFNNQDFEILNFKPTANSFSKAFYFSFNNLSDKQSYFDLKEKYQKDFENQISNESVKKDLEEKINSETALYFDYMDIANNLINEIATDQPVNYLVQKASVYLIDIVTKIGIIPQGIDAILKEAIKIDGSNKSLTLLEVIVNNKEKILSILKSYLGSAYDIVEPLLINLQINMKEDNPSYKLLLEYVNQFVGKDDPIRKLITGDILGVTSSAKSLFDIVWSNIETILNKIKEATQNDKTLTSLINLLTIIFTKDSTSNQFVSIYDSLFKSKETKQKFINSIVSLLPANISEYLNILIIDNSAVNKELMLKITKSFANFFKGLYEHKSDADDTTSFDQRYKNLSFTKTWVTSPTVTKKDVITTTFNYEIKASIINAVDLDIKPIKEIITQDAFNKIVKKLANLTGVVATVAESQIYPELRKHLLNYVPDVFKFGTNGENTNALIFTYSGKDEQIWFNLDKKGIDFYLGLSIGYNLNIFYDDPQLWKNIASSNNFNKEVFETTKTVALIVKVNFKFWYYNFWKSILQNVLMRSYDINSRFYISDYSTKIADYSNYNENYYYTNLSFVNNANQVNVSEIKTLFDLSKTGNFKDQVSTIKNDKVQNPNTLNWGNKATEEVKGITPLTSESNLKTIKEKMFSLTTNNSSFILTKYNLDYSFNTLFNFLAKIEFQVKASVGNVDVHPIISFNISMFKSNLYFPVNFYDETNKKLITNFEKTYSDISFNAQL 950
>gi|26554058|ref|NP_757992.1| integral membrane protein [Mycoplasma penetrans HF-2] >gi|26454066|dbj|BAC44396.1| predicted integral membrane protein [Mycoplasma penetrans HF-2] (953 aa)
Score = 2678, Expect = 0.0e+00, Identities = 633/947 (66%), Positives = 785/947 (82%)
  Q:     1 MNFKNKKNIIKMLSLSLVGITIAIPLSSCGYSNNAFNYDANQTPSKDFNNENNNNNNGSSNNS-GILDASIVESKKVQNNLSLQQENPNDFGLTQNYLDFANNGSFNKYLGDKSIIYEDILGYLNFLYYKNNKQISFTNSNIKDLKFLEVDASNKLILNKSKISFELVVTVSTNELSEFVIGDKKFNLAKDHSSTLIIKSVDQTLKPTIEKQGEKFYLGWFLDKVSVSFNNQDFEILNFKPTANSFSKAFYFSFNNLSDKQSYFDLKEKYQKDFENQISNESVKKDLEEKINSETALYFDYMDIANNLINEIATDQPVNYLVQKASVYLIDIVTKIGIIPQGIDAILKEAIKIDGSNKSLTLLEVIVNNKEKILSILKSYLGSAYDIVEPLLINLQINMKEDNPSYKLLLEYVNQFVGKDDPIRKLITGDILGVTSSAKSLFDIVWSNIETILNKIKEATQNDKTLTSLINLLTIIFTKDSTSNQFVSIYDSLFKSKETKQKFINSIVSLLPANISEYLNILIIDNSAVNKELMLKITKSFANFFKGLYEHKSDADDTTSFDQRYKNLSFTKTWVTSPTVTKK-DVITTTFNYEIKASIINAVDLDIKPIKEIITQDAFNKIVKKLANLTGVVATVAESQIYPELRKHLLNYVPDVFKFGTNGENTNALIFTYSGKDEQIWFNLDKKGIDFYLGLSIGYNLNIFYDDPQLWKNIASSNNFNKEVFETTKTVALIVKVNFKFWYYNFWKSILQNVLMRSYDINSRFYISDYSTKIADYSNYNENYYYTNLSFVNNANQVNVSEIKTLFDLSKTGNFKDQVSTIKNDKVQNPNTLNWGNKATEEVKGITPLTSESNLKTIKEKMFSLTTNNSSFILTKYNLDYSFNTLFNFLAKIEFQVKASVGNVDVHPIISFNISMFKSNLYFPVNFYDETNKKLITNFEKTYSDISFN 947
           M  KNK+++IK+ S+ L G TIAIPLSSC Y+NN F+YDA+QTP KDFN+  N++NN + +NS G LDASIVESKK+++N+ L +E PN++GLTQNY DF  NG F+KYLGDK+ I EDILGYLN LYY NNK +S TNSN+K + F E+D++NKL+ NK+KISFEL   VS+ ELS+FVIGD+KF+L KD S TL IK+ +Q LKPTI+K G+KFYLGW LDKV VSFNN+DFEILNFKPT NSFSKAFYFSFN+LS+KQ+YFDLKEKYQKDF   I++ES+KK LEEKIN ET+LYFDYMD+ANNLINEIA DQPVN L++K+++YLIDI+TKIGIIP GIDAILKEAI  +GS+ S TL++VIVNNK KILSILKSYLGSAYDIV+PLL NL+ NM  DN SYKL++EYV QFVGKDDPIR LITGDILGVTS AKSL DI+W+N++TIL KIKEAT+N+ TLTSLI+LLTIIFTKDS++N++ SIYDS+F S E KQK IN+I +LLPAN+ EY++IL ++N + +K    KI +SFANFFKGL+E+K+++ D TSFDQRYKNLSF KTWV +P V K+ ++ITTTF YE+KASI  AV LD+ P+K II+Q++FN ++ K+ANL+G  A++AES IYP+L+K+L N++PD F FG NG++TNALIFTYSG +E+IWF+ +KKG D+YLG S+GY LNIFYDDP LWK IAS++N+ K VFE +K + LI    FKFWYY+FWKSI QNVLMRSYDINSRFYISDYSTKIADYS+YN NYYYTNLSFVNN N VNV+EIKT+FDLSK  NFK++ S   +++V++ NTL W NK +E V GI P+T+ +NLKT+K+KMF+ +  NS+F   +Y LDYSFNTLFNF  K+EFQV  S+ +VDVHP IS +  +FKSNL+ PVNFYD TNK+L+ NF K YSD  F+
  S:     1 MKLKNKRSLIKLFSVFLAGATIAIPLSSCSYNNNDFSYDASQTPPKDFNDSTNSDNNNNGSNSFGTLDASIVESKKIESNMVLVEEKPNEYGLTQNYNDFGINGDFSKYLGDKAKIPEDILGYLNHLYYVNNKTVSITNSNLKKVSFTELDSNNKLVFNKTKISFELEAKVSSKELSDFVIGDEKFSLPKDTSLTLTIKADEQILKPTIQKHGQKFYLGWVLDKVFVSFNNKDFEILNFKPTENSFSKAFYFSFNDLSEKQTYFDLKEKYQKDFGQSINSESIKKYLEEKINRETSLYFDYMDLANNLINEIAIDQPVNKLIEKSALYLIDIITKIGIIPDGIDAILKEAITANGSSNSNTLIQVIVNNKNKILSILKSYLGSAYDIVQPLLENLETNMTADNSSYKLIMEYVGQFVGKDDPIRNLITGDILGVTSQAKSLLDILWTNLDTILAKIKEATKNNPTLTSLIDLLTIIFTKDSSANEYGSIYDSMFGSDEAKQKVINAIKNLLPANVGEYIDILFVNNKSFDKTNFQKIIQSFANFFKGLFEYKTESTDKTSFDQRYKNLSFAKTWVNNPVVNKQNNLITTTFKYEVKASISTAVTLDMVPLKNIISQESFNTLINKIANLSGTNASLAESNIYPDLKKYLFNFLPDNFVFGGNGKDTNALIFTYSGDNEEIWFSPEKKGSDYYLGFSVGYGLNIFYDDPNLWKTIASNSNYVKGVFEASKRILLIATAKFKFWYYDFWKSIFQNVLMRSYDINSRFYISDYSTKIADYSSYNPNYYYTNLSFVNNVNNVNVNEIKTMFDLSKAENFKEENSRFTDEQVKDSNTLMWANKDSEVVNGIMPVTNLTNLKTMKDKMFTFSDLNSNFKNLEYGLDYSFNTLFNFSTKLEFQVTVSLVSVDVHPTISLSAGLFKSNLFLPVNFYDVTNKRLVNNFSKNYSDFVFS 949
>gi|26553859|ref|NP_757793.1| hypothetical protein MYPE4070 [Mycoplasma penetrans HF-2] >gi|26453866|dbj|BAC44197.1| conserved hypothetical protein [Mycoplasma penetrans HF-2] (978 aa)
Score = 1497, Expect = 1.1e-163, Identities = 411/944 (43%), Positives = 629/944 (66%)
  Q:     4 KNKKN-IIKMLSLSLVGITIAIPLSSCGYSNNAFNYDANQTPSKDFNN-ENNNNNNGSSNNSGILDASIVESKKVQNNLSLQQENPNDFGLTQNYLDFANNGSFNKYLGDKSIIYEDILGYLNFLYYKNNKQISFTNSNIKDLKFLEVDASNKLILNKSKISFELVVTVSTNELSEFVIGDKKFNLAKDHSSTLIIKSVDQTLKPTIEKQGEKFYLGWFLDKVSVSFNNQDFEILNFKPTANSFSKAFYFSFNNLSDKQSYFDLKEKYQKDFENQISNESVKKDLEEKINSETALYFDYMDIANNLINEIATDQPVNYLVQKASVYLIDIVTKIGIIPQGIDAILKEAIKI--DGSNKSLTLLEVIVNNKEKILSILKSYLGSAYDIVEPLLINLQINMKEDNPSYKLLLEYVNQFVGKDDPIRKLITGDILGVTSSAKSLFDIVWSNIETILNKIKEATQNDKTLTSLINLLTIIFTKDSTSNQFVSIYDSLFKSKETKQKFINSIVSLLPANISEYLNILIIDNSAVNKELMLKITKSFANFFKGLYEHKSDADDTTSFDQRYKNLSFTKTWVTSPTVTKKDVITTTFNYEIKASIINAVDLDIKPIKEIITQDAFNKIVKKLA-------------------------NLTGVVATVAESQIYPELRKHLLNYVPDVFKFGTNGENTNALIFTYSGKDEQIWFNLDKKGIDFYLGLSIGYNLNIFYDDPQLWKNIASSNNFNKEVFETTKTVALIVKV------NFKFWYYNFWKSILQNVLMRSYDINSRFYISDYSTKIADYSNYNENYYYTNLSFVNNANQVNVSEIKTLFDLSKTGNFKDQVSTIKNDKVQNPNTLNWGNKATEEVKGITPLTSESNLKTIKEKMFSLTTNNSSFILTKY----------NLDYSFNTLFNFLAKIEFQVKASVGNVD-------VHPIISFNISMFKSNLYFPVNFYDETNKKLITNFEKTYSDISFN 947
           KNKK+ I K+LS SL+   +AIPL+SC Y++ +FN   ++TPSKDFN+   NN+N+ + NN   LD  +V SKKV ++L +   + N++GL QNYLDFA+NGSFN++ G+ S + +DILGYL+ LYY NN+ +S TN N+ +LK    D  NK++ N+S+ISF L   +S  +L+ F+I ++ F L+++H  +L I+ VDQ +KP+I+K    FYL W ++K +V+FNNQ FEI NF  T NSFS++FY  F+NLSD+Q+YFDLK KY+ +F+  +S  +VK+ +E+KI ++T+ YF  +D+AN L+ EIA D+P+N ++Q A+ YL+DI+ K+ IIP   ++ILKEA+ +  DG+  + TLLEV+  NK +++S+LK YLG+AYDIV P++ NL++NM E+N SYK++L Y+N     +  ++ LITGD+LGVTSSAKSL+ IVW N + I++++K    N+ TL S++NL++IIF KD+T+  F SIYDS+  +   K  F N++V LLP+ +SEY+ IL+ DN+  NKE +LKI  S +N   GL+E+  +A   T + +RYKN++FT++WV   +V   +  TT+F Y++  +  + V LD+  IK ++ Q  FN +V KL                          NL    AT+ ++++   ++K+LL+YVPD  K GT+G   N    TY+  ++QIWFN +KKG ++YLG S+GY+LNI Y+D  +  +I +        +++   V   V        ++   YYNFWK I+QN+  + Y  +SRF++SDYS +IA  +NYNENYYYTNL+F N +N V++ +IK L                K D  +N +    G   TE   GI    SE N K +  KMF ++++N++   + +          +LD+S    FN +A+   ++               V+  ++ + S++ S +YFP+NFYD TNKKL+T++ K Y+  SFN
  S:     3 KNKKDKIFKILSFSLLASMVAIPLASCNYNSTSFNNQVDETPSKDFNDVNQNNSNSSNQNNKEELDIQVVNSKKVDSSLQINLTSSNNYGLEQNYLDFADNGSFNQFNGNSSFVEKDILGYLHSLYYSNNESVSITNVNLSNLKVNAPD--NKIVFNESEISFSLSAEISAKKLTNFIIENQTFTLSQNHHYSLNIEVVDQLIKPSIQKYNNNFYLAWMVEKATVTFNNQSFEISNFVITKNSFSQSFYVQFDNLSDQQTYFDLKNKYETEFKENLSQNNVKELVEQKIENDTSFYFYIVDVANTLVKEIAKDEPINKIIQNATNYLLDILVKLNIIPSEFESILKEALVVNSDGTASNTTLLEVLYKNKSQLMSLLKKYLGTAYDIVYPMIENLELNMDENNASYKVILNYINSI--NNPQLKSLITGDLLGVTSSAKSLWQIVWDNFDFIISQVKGLANNNATLNSVLNLISIIFKKDATNGNFSSIYDSILANDTNKTNFTNALVGLLPSGVSEYIKILVSDNTDFNKENLLKIVTSISNTLNGLFEYADNATIDTPYYERYKNITFTRSWVKDVSVDTTNSPTTSFEYKVSFTFNSEVTLDLAVIKSLVNQTVFNSLVDKLTGINRDALVKLVEDEVSNVKFAGSKVNLVTPAATMIDNEL-ANIKKYLLDYVPDSIKIGTSG---NEFSLTYTADNDQIWFNPNKKGSNYYLGFSVGYDLNISYNDVGMVNSIVNKYAVGDVNYQSKYKVKWTVLTLEAIYFDYTLNYYNFWKPIIQNIFFKDYTYSSRFFLSDYSQEIATTNNYNENYYYTNLTFENKSNSVSIDDIKNLI--------------TKEDNNRNNSVNWNG--TTENTNGINLTLSEDNKKQLFSKMFDVSSDNNNLTNSNFSSYYDFQFDSHLDFSTTLSFNLVARGHVKINYGFSKYTWDKEFQRVNLNVNLSASLYNSKIYFPINFYDSTNKKLVTSYTKNYT--SFN 972
>gi|26553562|ref|NP_757496.1| hypothetical protein MYPE1080 [Mycoplasma penetrans HF-2] >gi|26453568|dbj|BAC43900.1| hypothetical protein [Mycoplasma penetrans HF-2] (957 aa)
Score = 603, Expect = 6.2e-60, Identities = 222/864 (25%), Positives = 409/864 (47%)
  Q:    85 ENPNDFGLTQNYLDFANNGSFNKYLGDKSIIYEDILGYLNFLYYKNNKQISFTNSNIKDLKFLEVDASNKLILNKSKISFELVVTVSTNELSEFVIGDKKFNLAKDHSSTLIIKSVDQTLKPTIEKQGEKFYLGWFLDKVSVSFNNQDFEILNFKPTANSFSKAFYFSFNNLSDKQSYFDLKEKYQKDFENQISNESVKKDLEEKINSETALYFDYMDIANNLINEIATDQPVNYLVQKASVYLIDIVTKIGIIPQGIDAILKEAIKIDGSNKSLTLLEVIVNNKEKILSILKSYLGSAYDIVEPLLINLQINMKEDNPS-YKLLLEYVNQFVGKDDPIRKLITGDILGVTSSAKSLFDIVWSNIETILNKIKEATQNDKTLTSLINLLTIIFTKDSTSNQFVSIYDSLFKSKETKQKFINSIVSLLP-ANISEYLNILIIDNSAVNKELMLKITKSFANFFKGLYEHKSDADDTTSFDQRYKNLSFTKTWVTSPTVTKKDVITTTFNYEIKASIINAVDLDIKPIKEIITQDAFNKIVKKLANLTGVVATVAESQIYPELRKHLLNYVPDVFKFGTNGENTNALIFTYSGKDEQIWFNLDKKGIDFYLGLSIGYNLNIFYDDPQLWKNIASSNNFNKEVFETTKTVALIVKVNFKFWYYNFWKSILQNVLMRSYDINSRFYISDYSTKIADYSNYNENYYYTNLSFVNNANQVNVSEIKTLFDLSKTGNFKDQVSTIKNDKVQNPNTLNWGN--KATEEVKGITPLTSESNLKTIKEKMFSLTTNNSSFILTKYNLDYSFNTLFNFLAKIEFQVKASVGNVDVHPIISFNISMFKSNLYFPVNFYDETNKKLITNFEKTYSDISFNA 948
           +N N+  + Q+Y +F  NG F+ Y  +   + +D+  Y+N ++  N K + FT+ NIK       ++S+   L KS ISFE+ +++   +L+ F IG+  + L+ +   TL IK+ +Q L P I      +YLGW L  VSV  NN+      F P++ S+S AF + F +L +KQ+Y +  +  Q+   + +     K  +++    + +   D++D    +++ I ++  V  L+ K   Y+  +  ++ I+P  ++ IL +    D S     LL+V   NK+ +   L+  L    +I+ PL+  ++  +  D  +  K LL Y+N      D I     G   G  +  KS+++IV  NI+TILN    ++     +T L NL+   FT    + Q   +++ +F++K TK+ FI S+  +   + ++  L+I+  +N  +N   +  I  S  +F  G++E K++ +D   F   YKNL+FT TW T      K   T  F Y I  +I   V L++KPIK +   +    ++    +L+G+   V +  +Y    + +  ++P+    G  G   +    TY+  +  ++ +  + G D+ LG    Y   + + D  L  +I +      + ++    +A        ++Y +FW+ IL+N++ R Y  + R  +      +A    Y+ N Y T  +  +   ++     K ++D  KT  +K+       D+  +   + W N    +E +K +TP   ++    I    +S T N+     T + +    + LFNF   I   VK  VG  +V+  I  ++   +  ++ P  FYD    K+I +   +YS  +  A
  S:   118 KNSNNQKMRQSYSEFETNGDFSNYQANWDALQKDLYLYVNDIWTANGKNVDFTSVNIK-----NNNSSSNFQLGKSTISFEIEISIEAFKLAIFQIGNNSYKLS-EGKHTLTIKAENQALTPDINFSSNTYYLGWKLPNVSVQMNNEKAFDTEFSPSS-SYSYAFQYVFTDLVNKQNYVEFYKANQQKILD-LDVAQAKTKIQDYYLQQYSNDLDFIDYGIKILDSIRSNPDVKSLLAKVVPYVTKMAVQLDILPSFLEPILSKGFATDES-----LLKVFSENKDDVYIYLEDNLWDLSEILIPLINEIKPGISTDKLNDIKGLLMYLNVDNSIIDIIINDFLG---GNGTEPKSIYNIVVDNIDTILNLAMGSSAESSVVTGLSNLIK-QFTTVGPNKQLTKVFNVIFENKTTKKNFIESLGKMFNLSAVTNILDIMFTNNDLINVTNIQNILHSIYDFTNGIFERKANYED---FRTGYKNLTFT-TWFTKVPSVDKSKQTIDFEYRISFNINKKVTLNLKPIKNLFDGNKVWDLINSFYDLSGIGWAVNKDWLY----QGVTGFIPNSISVG--GTYASMTQTTYTANNSSVYVDGIRSGTDYKLGFKFNYTTTVAFKDQTLVSSITNDYKRGSDWYQIAPIIAW-----GDYYYSDFWRGILKNIITRDYTFSFRANVQYSDDTVATTETYDPNLYITGFTIASKNTKLT---DKQVYDKVKT--YKESELYKSRDERYD---IKWSNTDNYSEVLKSLTPTVPKALTDYIAASNYSTTQNDEYIKGTNFAITSHSDVLFNFSLPINIVVKYLVGKTNVN--IKLDVFAMRFQMFLPFMFYDTQTNKMIGSVSDSYSSFNMEA 943
>gi|26554294|ref|NP_758228.1| hypothetical protein MYPE8400 [Mycoplasma penetrans HF-2] >gi|26454303|dbj|BAC44632.1| conserved hypothetical protein [Mycoplasma penetrans HF-2] (959 aa)
Score = 585, Expect = 7.3e-58, Identities = 242/940 (25%), Positives = 455/940 (48%)
  Q:     5 NKKNIIKMLSLSLVGITIAIPLSSCGYSNNAFNYDANQTPSKDFNNENNNNNNGSSNNSGILDASIVESKKVQNNLSLQQEN---PNDFGLTQNYLDFANNGSFNKYLGDKSIIYEDILGYLNFLYYKNNKQISFTNSNIKDLKFLEVDASN-KLILNKSKISFELVVTVSTNELSEFVIGDKKFNLAKDHSSTLIIKSVDQTLKPTIEKQGEKFYLGWFLDKVSVSFNNQDFEILNFKPTANSFSKAFYFSFNNLSDKQSYFDLKEKYQKDFENQISNESVKKDLEEKINSETALYFDYMDIANNLINEIATDQPVNYLVQKASVYLIDIVTKIGIIPQGIDAILKEAIKIDGSNKSLTLLEVIVNNKEKILSILKSYLGSAYDIVEPLLINLQINMKEDNPSYKLLLEYVNQFVGKDDPIRKLITGDILGVTSSAK-SLFDIVWSNIETILNKIKEATQNDKTLTS-------------------LINLLTIIFTKDSTSNQFVSIYDSLFKSKETKQKFINSIVSLL---PANISEYLNILIIDNSAVNKELMLKITKSFANFFKGLYEHKSDADDTTSFDQRYKNLSFTKTWVTSPTVTKKDVITTTFNYEIKASIINAVDLD--IKPIKEIITQDAFNKIVKKL--ANLTGVVATVAESQIYPELR--KHLLNYVPDVFKFGTNGENT----NALIFTYSGKDEQIWFNLDKKGIDFYLGLSIGYNLNIFYDDPQLWKNIASSNNFNKEVFE------TTKTVALIVKVNFKFWYYNFWKSILQNVLMRSYDINSRFYISDYSTK-IADYSNYNENYYYTNLSFVNNANQVNVSEIKTLFDLSKTGNFKDQVSTIKNDKVQNPNTLNWGN-KATEEVKGITPLTSESNLKTIKEKMFSLTTNNSSFILTKYNLDYSFNTLFNFLAKIEFQVKASVGNVDVHPIISFNISMFKSNLYFPVNFYDETNKKLITNFEKTYSDI 944
           NKK++IK+  L  + + IAI +++              T +KD  N N++ N    N +     SI  S    N+ ++   N    N++G+ QN+ DF+ N +   + G +S +  DI  Y  +L +  N + SFT S+I+   +   D  N K++ +K+K+SF+L V +   + +   + +K +NL+ +++  L +   DQ LK  +    ++F +GW +D  ++SFNN  + +  F PT +SFS +F +    L+ KQ+Y  L  K++ +  N +S   +K  L+ K NSE     DY++    ++  +A++  V  L+ K+  Y   I+     +P  +  ++ +A  +  SNK    LEVI   K  IL  L+  +GS   +    +   + N+  D+  YK +  +       +D I+  I  DI+GV  S   SL D +++N++ +L KI + T   +T T+                   ++ +L ++ +K++T+NQ+   +D L  S   K +F N+I+ L+    + IS+ L ++   N+    + ++K   S     + ++    +  +    D  YKNL+F  ++   P + K    T +F+Y+I  ++   +D    I   K ++T D  + ++K+    +L  +V ++     + + R  K L+ Y+PD    G N        N    ++S     IWF   + G ++ LG    +N N+  DDP   ++I S+ N             +  + +L   +   F++ +FWK+ L+NV++R YD    F     + + IA    Y+ + Y T  +  N  + +   ++   F++ K        + + +D +       W +   +  + G  P  S++   ++  KM+ L  N  SF     N + S +   + +      +K    +  V   I   ++    N+Y P+ FYD T+K L+  F +  S I
  S:     8 NKKHLIKISYLFTLAVPIAISVAAA-------------TTTKDVVNNNSSTNTTYPNFNNNKKGSIPSSLASLNSNAITDFNYISSNEYGIQQNFDDFSQNYNLATHTGSESGVKNDI-NYFGYLIWNQNSR-SFTISSIEVNNYQISDLENSKVVFDKTKVSFDLTVNILGIQDASINVLNKTYNLSANNTYQLKVSVKDQVLKSCVNNLTDEFLVGWQVDNATISFNNDSY-VGTFTPTLHSFSFSFPYKVKGLTGKQNYLQLYSKHESEILN-LSKNDLKNHLKTKFNSEYQNTMDYIENGIQILGILASNPTVKDLIYKSIPYATKILVAANFLPSYLSPLINDA--LGDSNKP--FLEVIKEYKSVILQFLEEMVGSVASVAGTYIDLFKPNITSDSAEYKSIKSFFTTLALSED-IQNAIFKDIIGVDGSKPLSLVDFLYNNLDLVL-KIVDPTYTPETNTNTKDTSDNSSDSSTSTTTSPIVTILKLLLSKNTTTNQYNKFFDVL--SGPEKTEFYNAIIQLVGSTDSQISQILGLITQSNANFTTDNIVKFVSSLHAAIQEMFARNENYKNFYDKDA-YKNLTFHTSFAKDPEIDKTKK-TISFDYKIYYTLNKKIDFSPVIAAFKNLLTVDTISALIKQFTSTDLDSIVGSIPAVGDFAKARVIKALMQYIPDNIWIGANSNEAFYKQNKTTVSFSSSGSNIWFYPIRVGTNYKLGYQFEFNKNVKMDDPSFTQSITSNYNSKTNSVSLISVDISNSSWSLSTDIAIDFYFRDFWKNFLKNVVLRDYDFAEIFTSDQVNDQNIATIETYSPDLYTTGFALENTMSSIVTDDVLKEFEVDK------NTTQVVSDYMSTGALYKWKDGNDSSSLYGAKPKLSDALKTSLTSKMYKL-VNQESFNKMSDNTNLSVSATIDPIMNFNLPLKVYQADYGVDVDIKIRMTTVSFNVYSPIKFYDTTSKTLVNGFSRLISHI 958
>gi|26553851|ref|NP_757785.1| hypothetical protein MYPE3990 [Mycoplasma penetrans HF-2] >gi|26453858|dbj|BAC44189.1| hypothetical protein [Mycoplasma penetrans HF-2] (885 aa)
Score = 131, Expect = 2.9e-05, Identities = 171/759 (22%), Positives = 316/759 (41%)
  Q:   113 SIIYEDILGYLNFLYYKNNKQISFTNSNIKDLKFLEVDASNKLILNKSKISFELVVTVSTNE--LSEFVIGDKKFNLAKDHSSTLIIKSVDQTLKPTIEKQGEKFYLGWFLDKVSVSFNNQDFEILNFKPTANSFSKAFYFSFNNLSDKQSYFDLKEKYQKDFENQISNESVKKDLEEKINSETALYFDYMDIANNLINEIATDQPVNYLVQKASVYLIDIVTKIGIIPQGIDAILKEAIKI--DGSNKSLTLLEVIVNNKEKILSILKSYLGS---AYDIVEPLLINLQINMKEDNPSYKLLLEYVNQFVGKDDPIRKLITGDILGVTSSAKSLFDIVWSNIETILNKIKEATQNDKTL--TSLINLLTIIFTKDSTSNQFVSIYD--SLFKSKETKQKFINSIVSLLPANISEYLNILI----IDNSAVNKELMLKITKSFANFFKGLYEHKSDADDTTSFDQRYKNLSFTKTWVTSPTVT----KKDVITTTFNYEIKASIINAVDLDIKPIKEIITQDAFNKIVKKLANLTGVVATVAESQIYPELRKHLLNYVPDVFKFGTNGENTNALIFTYSGKDEQIWFNLDKKGIDFYLGLSIGYNLNIFYDDPQLWKNIASSNNFNKEVFETTKTVALIVKVNFKFWYYNFWKSILQNVLMRSYDINSRFYISDYSTKIADYSNYNENYYYTNLSFVNNANQVNVSEIKTLFDLSKTGNFKDQVSTIKNDKVQNPNTLNWGNKATEEVKGITPLTSESNLKTIKEKMFSLTTNNSSFI 871
           S + +DIL +L  +Y K N ++S     I+   F   D         S +SFE +V ++ N    + F I ++ F +    S TL IK+ +Q     I K    +YL  +   V+  F++Q++   +F  T N +S A   S N ++   SY ++    Q+ + N +S +S+K +++  ++S   L    +     ++ ++ T+  +N L+ K S  +  +V K+  I +  +A     +K+  D    + +LL VI NN   I +++   +     + D++   + N+  N+ ++            Q V + + I+ LI+  +  + SS+    + V   IET+ NK          L   S  +L+ ++ T +ST   +   +    L  +  TK  F   + S     +S+ LN ++    +     N  ++  + +  +     L         T       K LS +  +  + T       ++    ++NYEIK    N    +I            N ++  L +   + +T     I   + K       D         + + ++FT++G +EQI  +       +    +I Y L + +D P L+ +I S        F  T T   I          N  K  L+  L+R Y+      I D ST I+D   Y+ N Y+ N       N  +  + ++ F      N     S   + K+ N NT    +   E V G  P+ S+   KTI+EK+    ++ +  I
  S:   118 SDLNKDILYFLKNIYNKLNGKVSLV---IEKSDFSATD---------STVSFEYLVKLTNNSSTTTSFNINNQSFYIPAGKSKTLEIKADNQNFYFGITKNYNNYYLN-WNTNVTFKFDDQEYLFESFSFTNNDYSIAIQTSVNGITSSNSYKEIST--QEAYFNNLSEDSLKTNIDSYLSSNLELSLSMLGYLTPIVADLNTNTNLNALLTKQSENIAKLVLKLLAIEE-TNANYNSYVKLFSDLLGSTDSLLTVIGNNNIAISNLIALLIDDPTISSDVIYTYIKNINGNLSDE------------QLVEQKESIKGLISFFVTSMGSSSTIDLNFVNKLIETVFNKSTTTLSLVSYLFTNSADDLINMLTTNESTKQTYQMYFKFVGLLVNDPTKLIFDQLLSSEGKQLLSDILNSMMGMNAVQGDNSNSLILSLVQQIVSPSNSNLNPSNLQTLLTDLVVPLLKFLSDSNNYTLNKTFNSISYNQEAKKVSYNYEIKFEFKNNFSFNI------------NSVLNILPDSLKMGSTSVPKSILEYMLKQ------DNKAMQMTITSGDKIVFTFTGNNEQINLSPVSSNGSYIANFNIMYKLVMRFDMPGLFNSITS--------FYKTGTWHSIGNS-----IVNVLKDFLKYFLIRDYEFYGMISIKDSSTIISD---YDPNVYFEN-------NYFSWKQPESSFFTELKNNITSVDSNSYSLKLNNYNTWGQSSPKYETVTGSKPVISDEYQKTIQEKVMEYYSDITPII 826
>gi|26554069|ref|NP_758003.1| hypothetical protein MYPE6175 [Mycoplasma penetrans HF-2] >gi|26454077|dbj|BAC44407.1| hypothetical protein [Mycoplasma penetrans HF-2] (74 aa)
Score = 97, Expect = 2.9e-01, Identities = 29/60 (48%), Positives = 38/60 (63%)
  Q:   328 LIDIVTKIGIIPQGIDAILKEAIKIDG---SNKSLTLLEVIVNNKEKILSILKSYLGSAYDIV 387
            I  + ++GII      ILK+   ID    +N S  L+ +I  NK KILS+LKSYLGS YD+V
  S:     6 FIYFIFELGIISNEFSEILKQVFYIDSNASTNNSKNLINIIYENKNKILSLLKSYLGSGYDMV 68
>gi|148986157|ref|ZP_01819143.1| unknown phage protein [Streptococcus pneumoniae SP3-BS71] >gi|147921871|gb|EDK72998.1| unknown phage protein [Streptococcus pneumoniae SP3-BS71] (1031 aa)
Score = 94, Expect = 6.6e-01, Identities = 38/157 (24%), Positives = 81/157 (51%)
  Q:   363 EVIVNNKEKILSILKSYLGSAYDIVEPLLI----NLQINMKEDNPSYKLLLEY-VNQFVGKDDPIRKLITGDILGVTSSAKSLFDIVWSNIETILNKIKEATQNDKTLTSLINLLTIIFTKDSTSNQFVSIYDSLFKSKETKQKFINSIVSLLPANISEYLN 519
           E+I  + E + + + + + +  DI+ PLL     N+Q+ +       K+++E  +N  +G    + ++ITGD  G   + K +F  VW  I++I+  I  A Q+   +++++N ++      + SN + SI D++          ++S+   + + IS  +N
  S:   725 ELIRTSAETVWNAIYTVISTILDILGPLLQAGWDNIQLIITTTWEIIKIVVETAINVVLGVIQAVMQIITGDWSGAWETIKGVFSTVWQAIQSIVQTIFSAIQS--YISNILNGIS-----GTVSNIWNSIKDTVSNVLNAISSTVSSVWEGIKSTISSAIN 879