>gi|26553513|ref|NP_757447.1| F0F1 ATP synthase subunit gamma [Mycoplasma penetrans HF-2] >gi|81748103|sp|Q8EWY9|ATPG_MYCPE ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|26453519|dbj|BAC43851.1| ATP synthase subunit gamma [Mycoplasma penetrans HF-2] (286 aa)
Score = 1268, Expect = 7.9e-138, Identities = 286/286 (100%), Positives = 286/286 (100%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKGE 286
           MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKGE
  S:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKGE 286
>gi|13357687|ref|NP_077961.1| F0F1 ATP synthase subunit gamma [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|167972137|ref|ZP_02554414.1| ATP synthase F1, gamma subunit [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|168282245|ref|ZP_02689912.1| ATP synthase F1, gamma subunit [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|168308395|ref|ZP_02691070.1| ATP synthase F1, gamma subunit [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|170762393|ref|YP_001752213.1| ATP synthase F1, gamma subunit [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|189081484|sp|B1AIB9|ATPG_UREP2 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|81789070|sp|Q9PR14|ATPG_UREPA ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|11266788|pir||A82929 ATP synthase gamma chain UU130 [imported] - Ureaplasma urealyticum >gi|6899089|gb|AAF30536.1|AE002114_3 ATP synthase gamma chain [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168827970|gb|ACA33232.1| ATP synthase F1, gamma subunit [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171902438|gb|EDT48727.1| ATP synthase F1, gamma subunit [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|182675706|gb|EDT87611.1| ATP synthase F1, gamma subunit [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186700742|gb|EDU19024.1| ATP synthase F1, gamma subunit [Ureaplasma parvum serovar 6 str. ATCC 27818] (286 aa)
Score = 461, Expect = 3.1e-44, Identities = 115/281 (40%), Positives = 183/281 (65%)
  Q:     3 SLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKS-NSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDK-AIEKPRLDKPNNGADFSI--QPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           SL+ +K++I  +++T+KITNAMKLV++AKLK+Q++       Y   +YD+   + S   D E L +  +++ +T+++   S+MGL GS+N N+ K + K +   D  + IGKKG + ++  G   +++  L L+D D+ FD+   IA   L  Y     +  I +IY+KF+N+++F  SV  +LP DK A+ K  L +    A  +I  +PN  ++ + IL  Y+AT ++G+++ESK+ ENASRRNAMD+ATKNA  L +NYKL +N  RQ +IT+EITEIV+G+
  S:     2 SLDAMKRKINSVQTTAKITNAMKLVATAKLKRQRDRLAAIKEYCHDYYDVIGLLLSVVDDVEFLKIPNAKD-RTLYITINSTMGLAGSYNYNVNKLISKIVNETDITFTIGKKGHDFMRLSGRVDQVNTYLNLNDNDLTFDMSLQIAREALELYSQG-EVNKICIIYTKFINAITFEVSVIDVLPFDKTALIKDHLAETIELAKDNIIFKPNKFELVKKILPTYIATVLYGSLIESKISENASRRNAMDAATKNAKALAENYKLIYNTLRQGKITREITEIVAGS 284
>gi|168337485|ref|ZP_02694100.1| ATP synthase F1, gamma subunit [Ureaplasma urealyticum serovar 10] (286 aa)
Score = 448, Expect = 1.1e-42, Identities = 114/281 (40%), Positives = 180/281 (64%)
  Q:     3 SLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSN-SDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAI-------EKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           SL+ IK++I  +++T+KITNAMKLV++AKLK+Q++       Y   +YD+   + S  +D E L +  ++  +T+++   S+MGL GS+N N+ K + K I  +D  + IGKKG + ++      +++  L L+D D+ FD+   IA   L  Y N   +  I +IY+KF+N+++F  +   +LP DK +       E   L K N       QPN  ++ + IL  Y+AT ++G+++ESK+ ENASRRNAMD+ATKNA  L ++YKL +N  RQ +IT+EITEIV+G+
  S:     2 SLDAIKRKISSVQTTAKITNAMKLVATAKLKRQRDRLAAIKEYCHDYYDVIGLLLSVVNDIEFLKIPNAKN-RTLYITINSTMGLAGSYNYNVNKLVSKIINEDDITFTIGKKGHDFMRLSNRLHQVNTYLNLNDNDLTFDMSLQIAREALELYSNG-EVNKICIIYTKFINAITFEVNNIDVLPFDKTVLTKDNLAETIELAKDN----IIFQPNKVELVKKILPTYIATVLYGSLIESKISENASRRNAMDAATKNAKALAEDYKLIYNTLRQGKITREITEIVAGS 284
>gi|167941901|ref|ZP_02528976.1| ATP synthase F1, gamma subunit [Ureaplasma urealyticum serovar 8] >gi|167959556|ref|ZP_02546626.1| ATP synthase F1, gamma subunit [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gi|167972494|ref|ZP_02554771.1| ATP synthase F1, gamma subunit [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|167974533|ref|ZP_02556810.1| ATP synthase F1, gamma subunit [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|167975082|ref|ZP_02557359.1| ATP synthase F1, gamma subunit [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|167988338|ref|ZP_02570009.1| ATP synthase F1, gamma subunit [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|168807708|ref|ZP_02828767.1| ATP synthase F1, gamma subunit [Ureaplasma urealyticum serovar 2] >gi|195867733|ref|ZP_03079734.1| ATP synthase F1, gamma subunit [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|184209342|gb|EDU06385.1| ATP synthase F1, gamma subunit [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188018777|gb|EDU56817.1| ATP synthase F1, gamma subunit [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188997954|gb|EDU67051.1| ATP synthase F1, gamma subunit [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|195660121|gb|EDX53501.1| ATP synthase F1, gamma subunit [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|195660588|gb|EDX53844.1| ATP synthase F1, gamma subunit [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (286 aa)
Score = 445, Expect = 2.1e-42, Identities = 113/281 (40%), Positives = 180/281 (64%)
  Q:     3 SLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSN-SDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAI-------EKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           SL+ +K++I  +++T+KITNAMKLV++AKLK+Q++       Y   +YD+   + S  +D E L +  ++  +T+++   S+MGL GS+N N+ K + K I  +D  + IGKKG + ++      +++  L L+D D+ FD+   IA   L  Y N   +  I +IY+KF+N+++F  +   +LP DK +       E   L K N       QPN  ++ + IL  Y+AT ++G+++ESK+ ENASRRNAMD+ATKNA  L ++YKL +N  RQ +IT+EITEIV+G+
  S:     2 SLDAMKRKISSVQTTAKITNAMKLVATAKLKRQRDRLAAIKEYCHDYYDVIGLLLSVVNDIEFLKIPNAKN-RTLYITINSTMGLAGSYNYNVNKLVSKIINEDDITFTIGKKGHDFMRLSNRLHQVNTYLNLNDNDLTFDMSLQIAREALELYSNG-EVNKICIIYTKFINAITFEVNNIDVLPFDKTVLTKDNLAETIELAKDN----IIFQPNKVELVKKILPTYIATVLYGSLIESKISENASRRNAMDAATKNAKALAEDYKLIYNTLRQGKITREITEIVAGS 284
>gi|168362162|ref|ZP_02695341.1| ATP synthase F1, gamma subunit [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|171903301|gb|EDT49590.1| ATP synthase F1, gamma subunit [Ureaplasma urealyticum serovar 13 str. ATCC 33698] (286 aa)
Score = 439, Expect = 1.2e-41, Identities = 111/281 (39%), Positives = 178/281 (63%)
  Q:     3 SLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSN-SDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAI-------EKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           SL+ +K++I  +++T+KITNAMKLV++AKLK+Q++       Y   +YD+   + S  +D E L +  ++  +T+++   S+MGL GS+N N+ K + K I  +D  + IGKKG + ++      +++  L L+D D+ FD+   IA      Y N   +  I +IY+KF+N+++F  +   + P DK +       E   L K N       QPN  ++ + IL  Y+AT ++G+++ESK+ ENASRRNAMD+ATKNA  L ++YKL +N  RQ +IT+EITEIV+G+
  S:     2 SLDAMKRKISSVQTTAKITNAMKLVATAKLKRQRDRLAAIKEYCHDYYDVIGLLLSVVNDIEFLKIPNAKN-RTLYITINSTMGLAGSYNYNVNKLVSKIINEDDITFTIGKKGHDFMRLSNRLHQVNTYLNLNDNDLTFDMSLQIAREAFELYSNG-EVNKICIIYTKFINAITFEVNNIDVFPFDKTVLTKDNLAETIELAKDN----IIFQPNKVELVKKILPTYIATVLYGSLIESKISENASRRNAMDAATKNAKALAEDYKLIYNTLRQGKITREITEIVAGS 284
>gi|44301|emb|CAA45550.1| adenosinetriphosphatase [Mycoplasma gallisepticum] (289 aa)
Score = 431, Expect = 1.0e-40, Identities = 103/283 (36%), Positives = 178/283 (62%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEI--LSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKY-KNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAI-EKPRLDKPNNG--ADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MAS+ ++K+R++ I  T KIT AMK++S+ KL + K        +Y++FY++   I +N +      ++  ++  K +W+   + +GLCGS+N N+ K L   +  +DEI L+G K  + ++++  E +I     ++DK+I+F+  ++I +++L  + KN Y   SI  +Y+ ++NSL+F      L+P D +I +   LD+ N+    + S +P  + +  ++    L   ++G ++ESKVCE ASRRNAMD+A KNA++L   YKL +N+ RQ++ITQEI EIV+GA
  S:     1 MASMQDLKRRMESITVTHKITKAMKMLSTVKLNRFKATLGKTKEFYQEFYEVIGAIITNYNKTKPRTTIPTNQSTKRLWIVINTQLGLCGSYNTNVGKLLVNELAKDDEIILVGIKLNSFLRTRNHEDQIIHTYSINDKNIDFESSYMIGKHVLELHEKNQY--ASINCVYTNYINSLNFEAKKIQLIPADPSIFQTDTLDRINDKFPKNISFEPGVDVIIPALEKQLLQVILYGCLIESKVCEYASRRNAMDTAAKNADDLYNKYKLLYNQLRQAKITQEINEIVAGA 287
>gi|31544509|ref|NP_853087.1| hypothetical protein MGA_1174 [Mycoplasma gallisepticum R] >gi|33860135|sp|P33257|ATPG_MYCGA ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|31541354|gb|AAP56655.1| AtpG [Mycoplasma gallisepticum R] (289 aa)
Score = 431, Expect = 1.1e-40, Identities = 102/283 (36%), Positives = 177/283 (62%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKK--SEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKY-KNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAI-EKPRLDKPNNG--ADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MAS+ ++K+R++ I  T KIT AMK++S+ KL + K        +Y++FY++   + +N +          ++  K +W+   + +GLCGS+N N+ K L   +  +DEI L+G K  + ++++  E +I     ++DK+I+F+  ++I +++L  + KN Y+  SI  +Y+ ++NSL+F      L+P D +I +   LD+ N+    + S +P  + +  ++    L   ++G ++ESKVCE ASRRNAMD+A KNA++L   YKL +N+ RQ++ITQEI EIV+GA
  S:     1 MASMQDLKRRMESITVTHKITKAMKMLSTVKLNRFKATLGKTKEFYQEFYEVIGAVITNYNKTKPRTTTPTNQSTKRLWIVINTQLGLCGSYNTNVGKLLVSELAKDDEIILVGTKLNSFLRTRNHEDQIIHTYSINDKNIDFESSYMIGKHVLELHEKNQYD--SIDCVYTNYINSLNFEAKKIQLIPADPSIFQADTLDRINDKFPKNISFEPGVDVIIPALEKQLLQVILYGCLIESKVCEYASRRNAMDTAAKNADDLYNKYKLLYNQLRQAKITQEINEIVAGA 287
>gi|160914779|ref|ZP_02076993.1| hypothetical protein EUBDOL_00786 [Eubacterium dolichum DSM 3991] >gi|158433319|gb|EDP11608.1| hypothetical protein EUBDOL_00786 [Eubacterium dolichum DSM 3991] (283 aa)
Score = 419, Expect = 2.1e-39, Identities = 104/276 (37%), Positives = 161/276 (58%)
  Q:     7 IKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSG 282
           IK RI+ +EST KIT AM+LV+S+KLKKQK+       Y     +    I S  ++       S +GK   + F S MGLCG +N N+ + LQ++   +D+I +IG +G   IK+K  +     D+  D +D  +     IA+ LL KY+N+  I  I+++Y++FVNS++F P V ++LP++K   +      N  A    +P  + +   ++  Y+ + ++   +E+K  E ASRR AM+SAT NA EL +  +L+FN+ RQ+ ITQEITEIV G
  S:     8 IKARIRSVESTQKITKAMQLVASSKLKKQKDYMEQNREYAHYLKETVQSILSTIEAVPHPYLTSRKGKACTIVFTSDMGLCGGYNANVYRLLQEY--RDDDIIMIGSRGYAWIKNKDFQL---FDVHTDLEDECYAELSTIADTLLEKYRNE-EIAKIRILYTRFVNSVTFEPVVVNILPVEK---EASATVTNEKALTEFEPAGDQILNDLVPMYVRSLLYSYFLETKTSEQASRRMAMESATDNAEELKETLELQFNQARQAAITQEITEIVGG 274
>gi|110004065|emb|CAK98404.1| putative atp synthase gamma chain protein [Spiroplasma citri] (285 aa)
Score = 419, Expect = 2.3e-39, Identities = 113/286 (39%), Positives = 167/286 (58%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEE--GKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINF--DLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKGE 286
           MA    +KK+I  I STSKIT AMKLV++AKLKK  +   N   Y+ +   +F  I S +D  I   K   +   +T W+   S++GLCG +N+NI K + + ++ ND I  IG K +     KG E    +     D DINF  D     A+ +L+ + N      IK+ Y+KF+N+++F P++  LLP+ KA +       N   +F  +P+   + E+ +  YL T +  +IVES+V E ASRR AM++AT NAN +++   L +NRKRQ+ ITQEITEIV+GA  +
  S:     1 MAVGTGLKKQITSITSTSKITQAMKLVATAKLKKVGKRISNSKPYFAEVCTVFNDIISKADDSIYQKKDGTKVSERTCWIIVNSNLGLCGGYNININKLVLQQLRKNDCIIAIGSKAETFYAHKGYE----IMQTRKDIDINFSYDDAREFAQEILSGF-NGNTYDEIKIAYTKFINNVTFEPTILQLLPIIKAAQHEEPKHINVITEF--EPDPTTILENAVPMYLNTILFSSIVESQVSEQASRRVAMENATDNANAMLEKLSLLYNRKRQAAITQEITEIVAGAGAQ 283
>gi|12045262|ref|NP_073073.1| F0F1 ATP synthase subunit gamma [Mycoplasma genitalium G37] >gi|1352044|sp|P47640|ATPG_MYCGE ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|3844992|gb|AAC71628.1| ATP synthase F1, gamma subunit [Mycoplasma genitalium G37] >gi|166078856|gb|ABY79474.1| ATP synthase F1, gamma subunit [synthetic Mycoplasma genitalium JCVI-1.0] (279 aa)
Score = 412, Expect = 1.7e-38, Identities = 99/282 (35%), Positives = 166/282 (58%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLK----KSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSG 282
           MA + EIK+R+  ++ST KITNAMK+VS AK  K K+ F   S+++ +FY     +       ++SLK    K +  KT+W+   SS+GLCG  N N+ K L+ + K++D+I+ +G+K ++              +++ D+DINFD    I + ++  +K ++ +  I ++Y+KF NSL     +F + P D    K  L+          +P+   +   I   +    ++G +VE+K+CE+ASR+NAM++ATKNA +L+  Y L+FN+ RQ+ IT+EI E++ G
  S:     1 MAFIQEIKRRMNTVKSTIKITNAMKMVSRAKFIKFKKQFQEISLFFNEFYKAVGQV-------VVSLKEPKKKPDNQKTLWIMMSSSLGLCGQHNSNMNKLLKANFKADDKIFFLGRKNQSFWNKNSQYNPAVGFIDIQDRDINFDYCQTIFDQIMDAFK-EFKLDRICMVYTKFKNSLIQQSQLFQVFPFDVETFKT-LNPVVTDQQLDFEPDQATIINLITPQFFDVALYGGLVETKLCESASRQNAMEAATKNAKDLLDKYTLQFNKLRQNSITEEIIEVIGG 277
>gi|188159056|ref|ZP_02998495.1| F0F1 ATP synthase subunit gamma [Mycoplasma mycoides subsp. mycoides LC str. GM12] (280 aa)
Score = 400, Expect = 3.6e-37, Identities = 108/286 (37%), Positives = 174/286 (60%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKS--EEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINF--DLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKGE 286
           M +L  +K  I  +++ SKITNAM+LV+SAKL+K  +  ++   Y  + Y LF  I S +D  +  LK S  E  KT+W+   S++GLCG +N N+ K + +++K+NDEI+ IG K  +  KSK    +I +  ++ + DINF  +   II+ +LLA Y N      IK++Y+KF+N+++F P++  + P+ K+          +      +P+A+ +  + +  Y+   I+G ++ES+V E ASRR AM++AT N   L     L++NR+RQ  ITQEI+EIVSGA  +
  S:     1 MPNLKGLKTEILSVKNISKITNAMQLVASAKLRKISKKVIDTHNYVSEVYSLFNDIISQADKSVF-LKDSNFETKKTLWIVINSNLGLCGGYNSNVNKLVLQNLKTNDEIFAIGSKAVSFFKSK----KIKIRDQVTNIDINFTNEKAKIISNDLLAMYTNR-EFDEIKIVYTKFINNVTFEPAIIRIFPIVKSELHF-----THKQKIIFEPDADQILNNTISIYINAIIYGTVIESQVSEQASRRTAMENATNNGQNLEHELSLKYNRQRQGAITQEISEIVSGANAQ 279
>gi|78045137|ref|YP_361339.1| F0F1 ATP synthase subunit gamma [Carboxydothermus hydrogenoformans Z-2901] >gi|123575370|sp|Q3A945|ATPG_CARHZ ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|77997252|gb|ABB16151.1| ATP synthase F1, gamma subunit [Carboxydothermus hydrogenoformans Z-2901] (282 aa)
Score = 400, Expect = 3.9e-37, Identities = 95/283 (33%), Positives = 164/283 (57%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLK-KSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIK--SNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           M S+ ++++RIK I++T +IT AMK+V++AKL++ +E+ +    Y K+  D+     + +      L  K E   T ++   +  GLCG FN N++++    +K  SN ++  +G+KG++  K +G E  I  +     + I+FD   +IA  ++ KY  D     + +++S+FVN L   P    LLPL+   E+      + G ++  +P+A+ V  ++L  Y+   ++ A++ESK  E+ +R  AMD+AT+NA E+I    L+ NR RQ+ IT+EI EIV GA
  S:     1 MPSMRDLRRRIKSIKNTQQITKAMKMVAAAKLRRAQEMVVASRPYAKRIKDVLARAAAATTETAHPLLIKREVKATGYVLITADRGLCGGFNANLIRKATVELKEFSNPKLITVGRKGRDFFKKRGYE--IVGEFTNLGESISFDAARVIAGFIMEKYL-DGTFDEVYLVFSEFVNPLVQRPQTLKLLPLEAPAEE------SGGGEYIFEPSADAVLNTLLPKYVEVQVYRALLESKASEHGARMTAMDTATENATEMIAKLTLQLNRARQAAITKEIAEIVGGA 277
>gi|167755039|ref|ZP_02427166.1| hypothetical protein CLORAM_00543 [Clostridium ramosum DSM 1402] >gi|167705089|gb|EDS19668.1| hypothetical protein CLORAM_00543 [Clostridium ramosum DSM 1402] (285 aa)
Score = 396, Expect = 1.0e-36, Identities = 106/283 (37%), Positives = 171/283 (60%)
  Q:     4 LNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYY----KKFYDLFTYIKSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDEIWLIGKKGKN--LIKSKGIEAEISLDLELDDKDINFD---LFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKA-IEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKGE 286
           + EIK+RIK +EST KIT AM+LV+++KL+K +        YY    +   ++    K N+DS  L   K  E K +++   SS+GLCG +N NI KE++  IK  D ++ IG K  +  L   +G+      D + DD +  FD   +  ++AE  L K   +  I  IK++Y++FVN+L+F P + +LLP+D +  +   + K +       +P+  +V +S++  YL   I+G I+ES   ENA+RR +M++A  NA+EL +   L++N+ RQ+ IT EI+EIV+GA  +
  S:     5 MQEIKRRIKSVESTKKITKAMELVATSKLRKTRNQLEQSKPYYTNVAQTVAEILANCKGNNDSIYLVENKDIE-KEVFIVIASSLGLCGGYNANIFKEIKGAIKPGDYVYSIGSKATSYLLKNHQGVT-----DHKFDDLNTTFDFKDVTKLVAE--LTKMYREKEISKIKIVYTEFVNNLTFRPRIVTLLPVDPSDFDHIEISKKST----LFEPSPEEVLDSLIPMYLQAVIYGYIIESATSENAARRTSMENANDNADELTEQLLLKYNQARQTAITNEISEIVAGANAQ 285
>gi|42561404|ref|NP_975855.1| F0F1 ATP synthase subunit gamma [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|81697962|sp|Q6MS93|ATPG_MYCMS ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|42492902|emb|CAE77497.1| ATP SYNTHASE GAMMA CHAIN [Mycoplasma mycoides subsp. mycoides SC str. PG1] (280 aa)
Score = 389, Expect = 7.8e-36, Identities = 105/286 (36%), Positives = 172/286 (60%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKS--EEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINF--DLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKGE 286
           M +L  +K  I  +++ S+ITNAM+LV+ AKL+K  +  ++   Y  + Y LF  I S  D  +  LK S  E  KT+W+   S++GLCG +N N+ K + +++K+NDEI+ IG K  +  +SK    +I +  ++ + DINF  +   II+ +LLA Y N      IK++Y+KF+N+++F P++  + P+ K+          +      +P+A+ +  + +  Y+   I+G ++ES+V E ASRR AM++AT N   L     L++NR+RQ  ITQEI+EIVSGA  +
  S:     1 MPNLKGLKTEILSVKNISRITNAMQLVALAKLRKISKKVIDTHNYVSEVYSLFNDIISQVDKSVF-LKDSNFETKKTLWIVINSNLGLCGGYNSNVNKLVLQNLKTNDEIFAIGSKAVSFFRSK----KIKIKDQVTNIDINFTNEKAKIISNDLLAMYINR-EFDEIKIVYTKFINNVTFEPAIIRIFPIVKSELHF-----THKQKIIFEPDADQILNNTISIYINAIIYGTVIESQVSEQASRRTAMENATNNGQNLEHELSLKYNRQRQGAITQEISEIVSGANAQ 279
>gi|83319574|ref|YP_424078.1| F0F1 ATP synthase subunit gamma [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|123535981|sp|Q2ST35|ATPG_MYCCT ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|83283460|gb|ABC01392.1| ATP synthase F1, gamma subunit [Mycoplasma capricolum subsp. capricolum ATCC 27343] (280 aa)
Score = 388, Expect = 8.3e-36, Identities = 105/286 (36%), Positives = 171/286 (59%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKS--EEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINF--DLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKGE 286
           M +L+ +K  I  + + SKITNAM+LV+SAKL+K  +  ++   Y  + Y LF  I   +D  +  LK+S  +  KT+W+   S++GLCG +N N+ K + +++K  DEI+ IG K  +  +SK    +I +  ++ D DINF       I+ +LL  Y N +    IK++Y+KF+N+++F P++  + P+ K     +     +      +P+A  +  S ++ Y+   I+G I+ES+V E ASRR AM++AT N   L +   L++NR+RQ  ITQEI+EIVSGA  +
  S:     1 MPNLSGLKTEISSVRNISKITNAMQLVASAKLRKISKKVIDTHNYVSEVYSLFNDIIRQTDKSVF-LKESNFKANKTLWVVINSNLGLCGGYNSNVNKLVLQNLKLEDEIFAIGSKAVSFFRSK----KIKIKNQITDIDINFTNKKARSISNDLLDMYIN-HEFDEIKIVYTKFINNVTFEPAIIRIFPIIKLENNFK-----HSQSLVFEPDAEQILSSTILIYINAIIYGTIIESQVSEQASRRTAMENATNNGKNLEQTLSLKYNRQRQGAITQEISEIVSGANNK 279
>gi|160943201|ref|ZP_02090437.1| hypothetical protein FAEPRAM212_00687 [Faecalibacterium prausnitzii M21/2] >gi|158445440|gb|EDP22443.1| hypothetical protein FAEPRAM212_00687 [Faecalibacterium prausnitzii M21/2] (298 aa)
Score = 384, Expect = 2.9e-35, Identities = 93/283 (32%), Positives = 158/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFT----YIKSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPR---LDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           M+S   +K+RI+ I+ T KITNAM L+SS+KL+K ++ + N S Y+ +  D  +    ++    +      +  E  +  +L   +  G+ G++N N++K L++H   ND  ++IG+ G   ++ +  +  +  +               I  + +  +K+   +  I ++Y+K  N+L+  P +  LLPLD+   +P    L  P    +  + P+A  VFE I   Y+   I GA+ ES   E ++R  AMDSATK+AN++I++ +LE+NR RQ  ITQEITEI+ GA
  S:     7 MSSSKLLKERIESIQDTMKITNAMYLISSSKLRKARQNYQNVSPYFNRMRDTISRVVPHLPEEPEHPFFHERNLENPRRAYLVLTADKGMAGAYNQNLLKFLREHADPNDRFYVIGQVGYRALRHR--DPRLVEEFRYSATAPTLQRARDITVDAIDDFKSG-KLDEIYIVYTKIQNALTSEPVMERLLPLDRRFLQPAPKGLGDPK--GEVELVPDAWTVFEQIAPIYMHGMIFGAMTESFCAEQSARMTAMDSATKSANDMIRDLQLEYNRTRQGSITQEITEIIGGA 291
>gi|50364929|ref|YP_053354.1| F0F1 ATP synthase subunit gamma [Mesoplasma florum L1] >gi|81695702|sp|Q6F203|ATPG_MESFL ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|50363485|gb|AAT75470.1| ATP synthase gamma chain [Mesoplasma florum L1] (281 aa)
Score = 384, Expect = 3.1e-35, Identities = 105/283 (37%), Positives = 167/283 (59%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFT-YIKSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHI--IAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA+L+ +K +I   +   KITNAM+LV+SAKL++  +       Y  + Y +F   IK +S+S  L    ++  KT+W+   S++GLCG +N N+ K +  + K  D+I+ IG K  +   SK    +I +  E  D DI+F       I   LL+ Y +      I+++Y+KF+N+++F P+   + P+ K        +  + + +S +P+A +V  + +  YL+T I G IVES+V E ASRR AM++AT N  EL  N  +++NR+RQ+ ITQEI+EIVSGA
  S:     1 MANLSNLKTQISNTQDIGKITNAMQLVASAKLRRIGKKVTETQEYVSEVYAIFNEIIKHSSESIYLKNSANDIKKTLWVVVNSNLGLCGGYNANVNKLVISNFKKEDQIYAIGSKAVSAYNSK----KIKIKNECTDVDIDFSPAQAKQIGNELLSYYSSG-EFDEIQIVYTKFINNVTFEPTKLRVFPIIK-----EETQETSSSYYSFEPSAEEVLNNAVTLYLSTIIFGTIVESQVSEQASRRLAMENATNNGKELEYNLSIQYNRERQASITQEISEIVSGA 276
>gi|15828738|ref|NP_326098.1| F0F1 ATP synthase subunit gamma [Mycoplasma pulmonis UAB CTIP] >gi|75544413|sp|Q98QU4|ATPG_MYCPU ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|14089680|emb|CAC13440.1| ATP SYNTHASE GAMMA CHAIN [Mycoplasma pulmonis] (279 aa)
Score = 382, Expect = 5.0e-35, Identities = 100/283 (35%), Positives = 171/283 (60%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           M SL + K RI +I++  KIT AM+LV+++K+KK ++ FL  + + +   D+F+ I S  D +I      ++  T+++   S +GL GS+N NI K L  +IK+ D++ LIG+K  N   ++  + +I    +     + + +  +I+++ L  + N  ++  IKV+Y+KF+N ++    + ++LP+ K    P   +    A    +P+   VF   +  YLA+ I G + ESKV E A+RR AM+SA+KNA +LI N K+E+N+ RQ++ITQEI+EIV+G+
  S:     1 MPSLQKTKNRIALIDNIKKITKAMELVATSKMKKTQKHFLEVNEFSQSVLDIFSKIVSQIDPQIKLYPDGQKNSTLYIVISSDIGLAGSYNSNIFKILNSNIKNEDKLILIGQKAINFFSNR--QDQIIETFKALPDYVTYKIAKLISDSALNSFLNK-DVNQIKVVYTKFINLINQQEKISTILPIKK---NPMKSEIKENAILEFEPDVESVFHKAIPLYLASIIFGFLTESKVSELAARRTAMESASKNAIDLIGNLKIEYNQTRQAKITQEISEIVAGS 277
>gi|169351552|ref|ZP_02868490.1| hypothetical protein CLOSPI_02332 [Clostridium spiroforme DSM 1552] >gi|169291774|gb|EDS73907.1| hypothetical protein CLOSPI_02332 [Clostridium spiroforme DSM 1552] (285 aa)
Score = 378, Expect = 1.4e-34, Identities = 96/283 (33%), Positives = 172/283 (60%)
  Q:     4 LNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFY----DLFTYIKSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINF-DLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKGE 286
           + EIK+RI+ +EST KIT AM+LV+++KL+K +        YY        ++    K ++DS  L ++ ++  K +++   SS+GLCG +N N+ KE++  IK +D ++ IG K  + + +K  +       E      NF D+ +++ E  L +   +  I+ IK++Y++FVN+L+F P + +LLP+D   +   ++       F  +P++ +V ++++  YL   I+G ++ES   ENA+RR +M++AT NA+EL +   L++N+ RQ+ IT EI+EIV+GA  +
  S:     5 MQEIKRRIRSVESTKKITKAMELVATSKLRKTRNQLEQSKPYYTNVALMTAEILANCKGDNDSVYL-IENNDVKKDVYIVIASSLGLCGGYNANVFKEIKNVIKPDDYVYSIGSKATSYL-TKNHQGITDSKYESLSTTFNFKDIINLVNE--LTRMYREKEIRKIKIVYTEFVNNLTFKPRIVTLLPID-PYDFDHIEISKKATLF--EPSSQEVLDNLIPMYLQAVIYGYVIESSTSENAARRISMENATDNADELTEQLLLKYNQARQTAITNEISEIVAGANAQ 285
>gi|13508338|ref|NP_110288.1| F0F1 ATP synthase subunit gamma [Mycoplasma pneumoniae M129] >gi|2493031|sp|Q50330|ATPG_MYCPN ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|1209765|gb|AAC43658.1| ATP synthase gamma chain >gi|1673911|gb|AAB95891.1| ATP synthase gamma chain [Mycoplasma pneumoniae M129] (279 aa)
Score = 376, Expect = 2.2e-34, Identities = 89/274 (32%), Positives = 158/274 (57%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKS----EEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQ 274
           MA + EIK+++  ++ST KITNAMK+VS AK  + K+ F   + ++ +FY     +       +LSLKK     E  KT+W+   SS+GLCG  N N+ K LQ   +  D+I+ +G+K ++       +      +++ D+D++FD    +++ ++ ++ + + +  I +IY++F N L    + F + P D A+ K   +          +P+   + + I   +    ++G +VE+K+CE+ASR+NAMD+A KNA +L + Y ++FN+ RQ+ ITQ
  S:     1 MAFIQEIKRKMTTVQSTIKITNAMKMVSRAKFVRFKKQFKEVNYFFNEFYKAVGQV-------VLSLKKMPKPLENPKTLWVMMSSSLGLCGQHNTNMNKLLQTKFQPGDKIFFLGRKNQSFWNKGDTDNPTVGYVDIQDRDLSFDYCQQVSDQIMEQF-DLHQLDRICIIYTQFKNPLIQHANSFQVFPFDVAMFKA-FNPVKMEQKLDFEPDEETIIKLISPQFFDIALYGGLVETKLCESASRQNAMDAAAKNAKDLYEKYSIQFNKLRQNSITQ 269
>gi|167628983|ref|YP_001679482.1| F0F1 ATP synthase subunit gamma [Heliobacterium modesticaldum Ice1] >gi|167591723|gb|ABZ83471.1| ATP synthase f1, gamma subunit [Heliobacterium modesticaldum Ice1] (290 aa)
Score = 372, Expect = 7.1e-34, Identities = 92/283 (32%), Positives = 160/283 (56%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFT-YIKSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDEIWLI--GKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLD-KAIEKPRLDKPNNGAD--FSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           M  + +IK+RI+ I+ST +IT AMK+V++AKL+K +E  +    Y K+   + +  + + SD     L   E  +  ++   +  GLCG +N NI++++   IK  D++ L+  G+K ++  K  G    I  D     +DI+F +   IA  ++  Y+    +  +++++++F ++L+  P    LLP+  +A E     K + G    ++ +P+   V + +L  Y+   I+ A++ESK  E  +R  AM SAT NA E+I    L FNR RQ+ IT+EI+E+V GA
  S:     1 MPGMRDIKRRIRSIKSTQQITKAMKMVAAAKLRKAQEKVIQARPYAKRIQGVLSRLVAAASDVNHPLLTTREVKRVGYVVITADRGLCGGYNANIIRKVNNEIKGRDDVSLVCVGRKSRDFFKRMG--KRIEADYVGLGEDISFGMAKEIAAKVMELYEQG-TVDQVQLVFTEFYSALTQKPVQMQLLPIPAQAGESANSAKDSKGPQPLYAFEPSPEAVLDELLPKYVENQIYRALLESKASEQGARMTAMGSATDNAKEMINKLTLSFNRARQAAITKEISEVVGGA 286
>gi|71894421|ref|YP_278529.1| F0F1 ATP synthase subunit gamma [Mycoplasma synoviae 53] >gi|82592645|sp|Q4A603|ATPG_MYCS5 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|71851209|gb|AAZ43818.1| ATP synthase gamma chain [Mycoplasma synoviae 53] (289 aa)
Score = 363, Expect = 7.6e-33, Identities = 115/285 (40%), Positives = 168/285 (58%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSL---KKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDEIWLIGKKGKNLI-----KSKGIEAEISLDLELDDK------DINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           M++L  IK RI ++ +T KITNAM+LVS++KL +   L  N   Y       F  I S    E L+     K E   T+++   S +GLCGS+N N++ EL+K IK +D +  +G KG N I     K +  +A ++L+ +LD        ++NF+LF        AK K    I S K+IY+KFVN+L    SV  L P D +  + + +      D   +P+A  + +     Y+++ I+  +  SKV E ASRR AM+SAT NA+E+I +  LE+N KRQS ITQEITEIV+GA+ 
  S:     1 MSNLINIKNRINVVTNTRKITNAMQLVSTSKLHRIINLTKNIKAYQNLVETTFDNIVSKITQEELNEIFPPKQETDATLYIIVTSDIGLCGSYNSNVINELKKVIKPSDLVITLGTKGLNWIRVSKFKDQLYKAYVNLEDKLDYSIATEIGNLNFELF--------AKNK----ISSCKIIYTKFVNNLIQEVSVKQLFPYDSSHLEIKKESEQMEGDIEFEPSAEIILQRAFPLYVSSMIYVLVSLSKVSELASRRVAMESATDNADEIINDLNLEYNSKRQSVITQEITEIVAGAQA 287
>gi|160942706|ref|ZP_02089948.1| hypothetical protein FAEPRAM212_00182 [Faecalibacterium prausnitzii M21/2] >gi|158445980|gb|EDP22983.1| hypothetical protein FAEPRAM212_00182 [Faecalibacterium prausnitzii M21/2] (282 aa)
Score = 362, Expect = 9.1e-33, Identities = 96/283 (33%), Positives = 158/283 (55%)
  Q:     2 ASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKS-NSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPN-NGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAK 284
            S+ +IK RIK +EST +IT AM+LV+S+K+++ KE   +   Y++  Y   T I + +  +    L++SE  +T+ +      GL G +N N++K L      N E+  IGK+          EAE+     L   D++      +A  +   Y+      ++K+ Y++F + ++ T     +LPL  A+E     K     +    +P++ +VF +I+ +Y+A  ++GA+ ES   E A+RR AMD+ATKNA E+I +  L +NR RQ+ ITQEITEIV+GA+
  S:     3 GSMKDIKLRIKSVESTMQITKAMELVASSKMRRAKERVEHSRPYFETLYKTLTEIAAADPRARNPYLRRSEIKRTLLVVIAGDRGLAGGYNANVLK-LAAQESGNVEVLPIGKRSAEYFAHH--EAELFTQEVLLAADVSVGQCFQLARQITEGYRKG-EFDAVKLCYTRFDSMMTQTAVSIEVLPL--AMEPTEQQKAEARRSQILYKPSSEEVFSAIIPEYVAGVVYGAVCESVASELAARRTAMDAATKNAGEMIDHLNLYYNRARQAAITQEITEIVAGAE 281
>gi|134300982|ref|YP_001114478.1| F0F1 ATP synthase subunit gamma [Desulfotomaculum reducens MI-1] >gi|172044348|sp|A4J9A0|ATPG_DESRM ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|134053682|gb|ABO51653.1| ATP synthase F1, gamma subunit [Desulfotomaculum reducens MI-1] (283 aa)
Score = 361, Expect = 1.5e-32, Identities = 96/283 (33%), Positives = 154/283 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEGKTI-WLAFFSSMGLCGSFNLNIVKELQKHIK--SNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MAS  ++++RIK ++ST +IT AMK+V++AKL++ +E       +  K  D+ + + + S      L +  E KTI ++   +  GLCG FN NI++     ++  +N  I  +G K ++    +G +   S  + L +  I F     IA  ++ KY        + +++S+FVN L+  P    LLP    +E P  +K     ++  +P+A  V   +L  Y+ T +  A++E+K  E  +R  AMDSATKNA ELI    L  NR RQ+ IT+EI+EIV GA
  S:     1 MASARDLRRRIKSVKSTQQITKAMKMVAAAKLRRAQEAVEAARPFALKIKDVLSRVAAASGGASHPLLEEREVKTIAYVIITADRGLCGGFNANILRRAASEVRDVNNPAIVAVGTKSRDYFTRRGYDITASY-VRLGEA-IQFSQAKEIARFVIDKYVAG-EFDEVHLVFSEFVNILTQRPVKVKLLP----VETPTEEKKGPQVEYIFEPSAEAVLAELLPTYVETTVFRAMLEAKAGEQGARMTAMDSATKNAKELINKLTLSLNRARQAAITKEISEIVGGA 279
>gi|150388192|ref|YP_001318241.1| ATP synthase F1, gamma subunit [Alkaliphilus metalliredigens QYMF] >gi|172052469|sp|A6TK64|ATPG_ALKMQ ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|149948054|gb|ABR46582.1| ATP synthase F1, gamma subunit [Alkaliphilus metalliredigens QYMF] (289 aa)
Score = 356, Expect = 4.6e-32, Identities = 93/282 (32%), Positives = 160/282 (56%)
  Q:     4 LNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEE-GKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDEIWLI--GKKGKNLIKSKGIEAEISLDLELD--DKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADF-SIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           + +IK+RIK + ST +IT AM+LVSSAKL+K +        Y+K   +    I S++      L    E  KT ++   +  GL G +N N++K    H++  + + +I  GKKG+   + +G +    LD E     ++ +F     I +  +  YK +  +  + ++Y++FV++++  P V  LLPL+        +KP    +F S +P+  +V + ++  Y+ + ++GA+VES   +  + R AM+SAT NA ++I   +L++NR RQ+ ITQEI EIVSGA+ 
  S:     5 MQDIKRRIKSVNSTKQITKAMELVSSAKLRKARLKLEKTRPYFKVVEETINDIVSSTQGIRHDLITPREVKKTAYIVITADRGLSGGYNANVIKAAVNHLQEKERVSIIAIGKKGRGFFRKRGYD----LDGEFTKISENPSFSDAQGIGKLGMELYKQEL-VDELYLVYTEFVSTITHKPRVVKLLPLEPQTGGEGAEKPKERDEFMSYEPSPEEVLDYLIPKYIESMLYGALVESSTSQQGATRVAMESATDNATDMIDGLQLQYNRARQASITQEIAEIVSGAEA 287
>gi|52843176|ref|YP_096975.1| F0F1 ATP synthase subunit gamma [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] >gi|54295821|ref|YP_128236.1| F0F1 ATP synthase subunit gamma [Legionella pneumophila str. Lens] >gi|148361323|ref|YP_001252530.1| F0F1 ATP synthase subunit gamma [Legionella pneumophila str. Corby] >gi|166215103|sp|A5III4|ATPG_LEGPC ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|81679106|sp|Q5WSG7|ATPG_LEGPL ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|81680367|sp|Q5ZRA0|ATPG_LEGPH ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|52630287|gb|AAU29028.1| ATP synthase gamma chain, ATP synthase F1 gamma chain [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] >gi|53755653|emb|CAH17155.1| hypothetical protein [Legionella pneumophila str. Lens] >gi|148283096|gb|ABQ57184.1| ATP synthase gamma chain, ATP synthase F1 gamma chain [Legionella pneumophila str. Corby] (288 aa)
Score = 355, Expect = 6.1e-32, Identities = 98/283 (34%), Positives = 156/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEGKTIWLAFFSS-MGLCGSFNLNIVKELQKHIKSNDE------IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGA--DFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  I  T KIT AM++V+++K++K +E       Y  K Y++  +I   +           E K I +   ++  GLCG  N N+ +E  + I++  E      I +IG+KG+   +  G     S+D   D   IN D   ++   L A Y     I S+ ++Y++F+N+++  P V  LLPL K+ E    DK   G   D+  +P A ++ + IL  Y+   ++ A+VE+  CE A++  AM SAT NA +LIK ++L +N+ RQ+ ITQE+ EIV GA
  S:     1 MAGAKEIRSKISSINKTRKITRAMEMVAASKMRKTQERMRASKPYANKIYEVIKHIARAASEYRHPFMSEREIKRIGIIVVTTDRGLCGGLNSNLFRETIRTIRNWQEHGKEVDIAVIGRKGQAFFRRVGGNILGSIDHLGDTPSIN-DFIGVVKIMLDAYYNG--TIDSLHIVYNEFINTMTQKPFVKQLLPLPKSEE----DKKTLGHHWDYIYEPEAKELLDEILERYIELQVYQAVVENIACEQAAKMIAMKSATDNAGDLIKEFQLAYNKARQAAITQELAEIVGGA 285
>gi|54298987|ref|YP_125356.1| F0F1 ATP synthase subunit gamma [Legionella pneumophila str. Paris] >gi|81679357|sp|Q5X0P2|ATPG_LEGPA ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|53752772|emb|CAH14207.1| hypothetical protein [Legionella pneumophila str. Paris] (288 aa)
Score = 354, Expect = 9.0e-32, Identities = 98/283 (34%), Positives = 156/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEGKTIWLAFFSS-MGLCGSFNLNIVKELQKHIKSNDE------IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGA--DFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  I  T KIT AM++V+++K++K +E       Y  K Y++  +I   +           E K I +   ++  GLCG  N N+ +E  + I++  E      I +IG+KG+   +  G     S+D   D   IN D   ++   L A Y     I S+ ++Y++F+N+++  P V  LLPL K+ E    DK   G   D+  +P A ++ + IL  Y+   ++ A+VE+  CE A++  AM SAT NA +LIK ++L +N+ RQ+ ITQE+ EIV GA
  S:     1 MAGAKEIRSKISSINKTRKITRAMEMVAASKMRKTQERMRASKPYANKIYEVIKHIARAASEYRHPFMSEREIKRIGIIVVTTDRGLCGGLNSNLFRETIRTIRNWQEHGKEVDIAVIGRKGQAFFRRVGGNILGSIDHLGDTPSIN-DFIGVVKIMLDAYYNG--AIDSLHIVYNEFINTMTQKPFVKQLLPLPKSEE----DKKTLGHHWDYIYEPEAKELLDEILERYIELQVYQAVVENIACEQAAKMIAMKSATDNAGDLIKEFQLAYNKARQAAITQELAEIVGGA 285
>gi|167768337|ref|ZP_02440390.1| hypothetical protein CLOSS21_02893 [Clostridium sp. SS2/1] >gi|167709861|gb|EDS20440.1| hypothetical protein CLOSS21_02893 [Clostridium sp. SS2/1] (286 aa)
Score = 350, Expect = 2.5e-31, Identities = 97/285 (34%), Positives = 164/285 (57%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDS-EILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDEI--WLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           MAS+ +IK+R   +EST +IT AMKLVS+ KL++ K+       Y+ K Y+  + I + + +     L+++   K   +   S+ GL G +N NIVK ++    + ++I  + +G K  + +K +G E  +S D E+ ++ + +D   I+ E LL  ++ D  I  I + Y+ F N++   P +  LLP++   ++   +K  + A  + +P   +    ++  Y+ + I+GA+V S   EN +R  AMDSAT NA E+I N +L +NR RQ  ITQE+TEI+SGA+ 
  S:     1 MASIIDIKRRKASVESTGQITKAMKLVSTVKLQRAKQRADESKAYFNKMYETISSILAKAGNINHPYLQENGSTKKGIITISSNRGLAGGYNNNIVKLIRDSGMNKEDIMIYAVGHKAMDTLKHRGYEI-VSDDSEMINEPV-YDDARILGEKLLKAFE-DGEIGEIYLAYTDFKNTVVHEPKLVKLLPIEND-QQANEEKSESKAPMNFEPEPEEALSLLIPKYICSMIYGALVTSVASENGARMQAMDSATSNAEEMISNLELAYNRARQGAITQELTEIISGAEA 284
>gi|169832275|ref|YP_001718257.1| ATP synthase F1, gamma subunit [Candidatus Desulforudis audaxviator MP104C] >gi|169639119|gb|ACA60625.1| ATP synthase F1, gamma subunit [Candidatus Desulforudis audaxviator MP104C] (295 aa)
Score = 348, Expect = 4.0e-31, Identities = 91/283 (32%), Positives = 159/283 (56%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNS-DSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDEIWLI--GKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKY-KNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGA--------DFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           M +L + ++RIK ++ST KI  AMK V++AK+ + +   +    Y ++ +++   + S + D +   L   E  +  ++   +  GLCG FN NI++   K +   +E  L+  G+K +N  + +  E +    + L + +I F+    IA  ++ KY   +Y+  ++ ++YSKFVN L   P+V  LLP++   E+         A        D+  +P+A DV + +L  Y+   ++  ++ESK  E ++R  AMD+ATKNA E+I    L+ NR RQ  IT+E+ +IV GA
  S:     1 MPALRDFRRRIKSVKSTQKICKAMKAVATAKMARAQATVVAARPYARQLHEVLGRVASAARDVQNPLLTVREPKRVCYIVITADRGLCGGFNSNILRTAVKELSKWEEFKLVAVGRKCRNFFRFRDWERDAEF-IGLGE-NIRFEQGQQIARFVINKYIAGEYD--AVYMVYSKFVNMLVQQPTVVKLLPVEPPAEEAAEKAGGEEAAAPKKATVDYIFEPSAADVLDYLLPRYVENSVYHGLIESKASEQSARMMAMDAATKNAGEMIDRLTLQMNRLRQEGITKELLDIVGGA 291
>gi|47459044|ref|YP_015906.1| F0F1 ATP synthase subunit gamma [Mycoplasma mobile 163K] >gi|81697071|sp|Q6KI81|ATPG_MYCMO ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|47458373|gb|AAT27695.1| ATP synthase gamma chain [Mycoplasma mobile 163K] (286 aa)
Score = 348, Expect = 4.1e-31, Identities = 105/286 (36%), Positives = 184/286 (64%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEIL--SLKKSEEGKT---IWLAFFSSMGLCGSFNLNIVKELQKHIKSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFS---IQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKGE 286
           MA L ++  R+K ++ T KIT AM+LV+++K+++ KE F +   Y++   D+F  + S ++   L   +K  +E  T   +++   S +GLCG++N +I KE++K IKS D+++LIGKKG  L+     + +I+   ++ +   N+     I+E +L+ +K+  + KSIK++Y+K+VN+ ++ P++   LP+ K+      +K  N A FS    +P+   +F+  +  Y ++ ++  ++ES V E +SRR AM++ATKNA+EL    K+E N  RQS+ITQEITEIV+G++ E
  S:     1 MAELQKLSSRLKSVKVTRKITKAMELVAASKIRRAKESFFSNKEYFQIIQDIFDNLASKTEQIFLKKQMKFDKENNTNSILYIVINSDLGLCGAYNSSIAKEIKKEIKSKDKLFLIGKKG--LLFLGKFKTQITNLDKVKEISTNYKNIKKISEKILSMFKSG-DYKSIKIVYTKYVNAFTYLPTIKHALPILKS------EKNINEATFSNLEFEPDPITIFQKAIPLYFSSLLYSCVLESHVSEVSSRRIAMENATKNADELGDQLKIELNTIRQSKITQEITEIVAGSETE 285
>gi|163814610|ref|ZP_02205999.1| hypothetical protein COPEUT_00761 [Coprococcus eutactus ATCC 27759] >gi|158450245|gb|EDP27240.1| hypothetical protein COPEUT_00761 [Coprococcus eutactus ATCC 27759] (294 aa)
Score = 346, Expect = 7.1e-31, Identities = 94/286 (32%), Positives = 163/286 (56%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLN-ESIYYKKFYDLFTYIKSNSDSEILSLK-----KSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS--NDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGAD-----FSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKGE 286
           MA+  EI+ RIK I+ T KITNAM ++SS+KLKK +    N E  +Y     L   ++   + E L        K E+ +  +L   +  G+ G++N N++K  ++ + +  N E++++G+ G++    KG+   I +  +   ++ +     +IA+ +L  Y+N  +I  + +IY+   +S+   P +  LLP+       R D     AD      +++P+   V + I+ + +   I+GA+VES   E  SR  AMDSATK+A E++ +  +++NR RQ+ ITQEITEI  GA+ +
  S:     1 MANTKEIQNRIKSIKDTQKITNAMYMISSSKLKKARTDLENTEPYFYTLQVALARMLRHVPEMEHLYFDSREGIKEEDRRRGYLVITADKGMAGAYNHNVIKIAEQELAAHPNSELYVVGQVGRHYFAKKGVP--IDIHFQYTAQNPSLHRARVIADKMLENYENG-DIDEVYIIYTNMKSSVVVEPQMIQLLPMK------RTDFAGVPADVFHEEITMEPSPKAVLDRIVPNCVMGYIYGALVESFCSEQNSRMMAMDSATKSAKEMLDDLNIKYNRARQAAITQEITEIAGGARAQ 290
>gi|167768301|ref|ZP_02440354.1| hypothetical protein CLOSS21_02857 [Clostridium sp. SS2/1] >gi|167709825|gb|EDS20404.1| hypothetical protein CLOSS21_02857 [Clostridium sp. SS2/1] (292 aa)
Score = 344, Expect = 1.1e-30, Identities = 94/284 (33%), Positives = 162/284 (57%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFY-DLFTYIKSNSDSE--ILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLD-KAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAK 284
           MA++ EIK R+  IE T KITNAM L+SS+KLKK ++     + Y++     L   +    D +   L+ +K E  K  +L   +  GL G++N NI K  +++I  +D++++IG  G+N    + + A++  D     +D        IAE ++ +Y +   +  + +IY+K + S++  P +  +LPL+    E     K ++  +F  QP+   V + +  +Y+   ++GA+VES   E  +R  AM+ A+K+A E+I++  L +NR RQ+ ITQEITE+ +GAK
  S:     4 MANIREIKTRMNSIEDTLKITNAMYLISSSKLKKARKQLDATTPYFEMLQASLLDIMAHTPDLQHIFLNKRKKEHPKKGYLVMTADRGLAGAYNHNITKMAEENINEDDKLFVIGYMGRNYFGRRNV-AQMDEDFFYTTQDPTIYRARRIAEKMIEEYVSG-ELDEVYIIYTKMITSITSEPKMIRVLPLNPDQYEFAGKGKRSHMTEF--QPSVKAVLDRLAPNYIKGLVYGAMVESFSSELNARMMAMEGASKSAREMIRSLGLMYNRARQAAITQEITEVCAGAK 287
>gi|153007333|ref|YP_001381658.1| ATP synthase F1, gamma subunit [Anaeromyxobacter sp. Fw109-5] >gi|166222517|sp|A7HIX8|ATPG_ANADF ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|152030906|gb|ABS28674.1| ATP synthase F1, gamma subunit [Anaeromyxobacter sp. Fw109-5] (290 aa)
Score = 342, Expect = 2.0e-30, Identities = 89/285 (31%), Positives = 161/285 (56%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSE------ILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSND------EIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDY---NIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           M SL +I+ RI  ++ST +IT AMK+VS+AKL++ ++  L    Y +        I + + ++      +L+ +     + + +   S  GL G FN NI +  Q+ +  N       ++  IG+KG++  +++       L++  D   ++ +L +  AE + A+Y   Y    + ++ + Y++F +++S  P VF LLP    IE P         DF  +P+   +   +L  ++A  +  A++ES   E+ +R +AM+SATKNA E+I +  L++NR RQ+ +T+E+ EIVSGA+ 
  S:     1 MPSLRDIRNRIGSVKSTRQITKAMKMVSAAKLRRAQDAILKTRPYAQLLEQTLGRIAARAAADEVVAHPLLAPRAQRTAEVVVIT--SDRGLAGGFNANIARRTQRFLVENADRYERVQLATIGRKGRDYFRAR------RLEIRKDFTGVHANLAYEKAEAIAAEYTERYLSGEVDAVFLAYNEFKSAISQKPVVFQLLP----IETPPDAGDGASIDFKYEPSREALLRDLLPRHVAMQVWRALLESAASEHGARMSAMESATKNAEEMIASLTLQYNRARQAYVTKELMEIVSGAEA 288
>gi|77918556|ref|YP_356371.1| F0F1 ATP synthase subunit gamma [Pelobacter carbinolicus DSM 2380] >gi|77920722|ref|YP_358537.1| F0F1 ATP synthase subunit gamma [Pelobacter carbinolicus DSM 2380] >gi|77544639|gb|ABA88201.1| ATP synthase F1, gamma subunit [Pelobacter carbinolicus DSM 2380] >gi|77546805|gb|ABA90367.1| ATP synthase F1, gamma subunit [Pelobacter carbinolicus DSM 2380] (288 aa)
Score = 340, Expect = 3.1e-30, Identities = 91/283 (32%), Positives = 154/283 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEE--GKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSND------EIWLIGKKGKNLIKSKGIEAE-ISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA+L +IKKRI  ++ST +IT AMK+V++A+ +K +   +    Y  K   +   +    D  +  L +  E  G+ + L   S  GLCG FNLN+ K   + +  N       E+ +IG+KG+  +K +G+ A+ +  D+  D       L   I + ++  Y+      ++ ++Y+ F +++    S+  LLP+  A      D          +P   +V  SIL  ++   I+ A++ES   E+ +R +AMDS++KNA E+I N  L++NR RQ+ IT E+ EI+SGA
  S:     1 MANLKDIKKRISSVKSTQQITKAMKMVAAARFRKAQAAIMAARPYAAKMQQVLASLALREDPAVHPLLQKHERRGRALVLVVSSDRGLCGGFNLNVAKSTAQLVTDNRDGFDSYELLVIGRKGREQLKMRGLIADKVYEDITADATYATAAL---IGQEVVEGYEQG-RFDAVYLVYNAFYSAIRQEVSIDRLLPITPA----EADDQTPPVQPLYEPARGEVLASILPKHVEVQIYRALLESAASEHGARMSAMDSSSKNAGEMIDNLTLQYNRVRQAVITTELVEIISGA 284
>gi|167747405|ref|ZP_02419532.1| hypothetical protein ANACAC_02125 [Anaerostipes caccae DSM 14662] >gi|167652767|gb|EDR96896.1| hypothetical protein ANACAC_02125 [Anaerostipes caccae DSM 14662] (285 aa)
Score = 340, Expect = 3.6e-30, Identities = 97/285 (34%), Positives = 157/285 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDS-EILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDEIWL--IGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           MAS+ +IK+R   IEST +IT AMKLVS+ KL++ +        Y+ K Y   + I + SD+ +   LK +   K   +A  S+ GL G +N NIVK ++    + +++ +  +G K  + + ++G    ++ D E+ D+    D  ++   N + K   D  I  I + Y+ F N++   P++  LLP++  I+    D  ++    + +P   +    ++  Y+ + I GA+V S   EN +R  AMDSAT NA ELI N  L +NR RQ  ITQE+TEI+SGA+ 
  S:     1 MASIVDIKRRKASIESTGQITKAMKLVSTVKLQRARARAEESRTYFDKMYRTVSSILAQSDNIDHPYLKSNGSQKKAVIAVSSNRGLAGGYNNNIVKMIRDSGLAREDVMIYGVGHKAMDSLANRGYHI-VADDSEMIDEPEYEDAVNL--GNRVLKAFEDGEIGEIYLAYTNFKNTVVHEPTMIKLLPVE--IDSKEKDGEDSKTLMNYEPEPEEALSMLIPKYVCSLIFGALVTSVASENGARMQAMDSATTNAEELIDNLSLAYNRARQGAITQELTEIISGAEA 283
>gi|182420245|ref|ZP_02951474.1| ATP synthase F1, gamma subunit [Clostridium butyricum 5521] >gi|182375840|gb|EDT73432.1| ATP synthase F1, gamma subunit [Clostridium butyricum 5521] (282 aa)
Score = 339, Expect = 4.3e-30, Identities = 106/285 (37%), Positives = 155/285 (54%)
  Q:     2 ASLNEIKKRIKIIESTSKITNAMKLVSSAKLKK-QKELFLNESIYYKKFYDLFTYIKSN-----SDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHI---KSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDI-NFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKGE 286
           A L +IK+RIK +EST KITNAM LV+++KL++ +KEL +N+     KF D    I  N     +D+E +    +     +++   S  GLCG FN  +V  L+K I   + N  + ++GK+G + ++  G E        +D  D+       II E  L  YK D  I  + VIY  F + +   P+   +LP+D      R D    G    I+PN   V    L  YL   I   ++ SK  E ++R  AMD AT NAN+L+++  L+FNR RQ  ITQEI+EIV GA+ +
  S:     4 AGLIDIKRRIKSVESTRKITNAMGLVATSKLRRSRKELLVNQ-----KFIDSIETIIKNLAATVTDNESIYFTGNNSEDKLYIVITSESGLCGGFNGGVVSYLEKVIGKERGNARVIVVGKRGLSYVRRYGFEPIAEF---VDISDLPTIKEAKIIFEKALKLYK-DKEISEVNVIYCDFASPVKQIPTSVKILPID------RNDGEAEGC--IIEPNVETVLNDSLEIYLKAKIRNILLSSKCSEQSARMTAMDGATSNANDLLESLNLKFNRIRQGMITQEISEIVGGAEAQ 281
>gi|153809938|ref|ZP_01962606.1| hypothetical protein RUMOBE_00319 [Ruminococcus obeum ATCC 29174] >gi|149834116|gb|EDM89196.1| hypothetical protein RUMOBE_00319 [Ruminococcus obeum ATCC 29174] (285 aa)
Score = 339, Expect = 4.5e-30, Identities = 103/284 (36%), Positives = 158/284 (55%)
  Q:     2 ASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDEIWL-IGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKP--RLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
            ++  +K RIK ++ST +IT AM+LV+S+KL+K KE       Y+ + ++    I + N D   +  ++S   +  ++A     GL G +N N+ K L+   +  D + L IGKK     + +GIE       E+ D  +  D F I   NLL +         I++ Y+ F + LS  P VFS+LP+    E+   R+   N       +PNA  VF++++ +YLA  ++G + ES   E A+RR AMD+AT NA E+I    L +NR RQ+ ITQEITEIV+GA+G
  S:     3 GNMKAVKLRIKSVQSTMQITKAMELVASSKLRKAKERAETCRPYFTELHETLKDIARENIDFSSVYARESSNPRYCYVAIAGDRGLAGGYNANLFKCLEAAAEGKDYVALPIGKKAVEYFRQRGIECLTDKFAEIADISVA-DCFEI--ANLLCEEFRKGTFGHIELCYTVFASMLSQQPEVFSVLPMTDIREESGGRVATRNL---ILYEPNAEVVFDAVVPEYLAGLVYGGVCESTASELAARRMAMDAATSNAEEMIDKLNLYYNRARQASITQEITEIVAGAEG 284
>gi|23100431|ref|NP_693898.1| F0F1 ATP synthase subunit gamma [Oceanobacillus iheyensis HTE831] >gi|81745358|sp|Q8EM82|ATPG_OCEIH ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|22778664|dbj|BAC14932.1| H(+)-transporting ATP synthase gamma chain [Oceanobacillus iheyensis HTE831] (286 aa)
Score = 339, Expect = 5.0e-30, Identities = 99/282 (35%), Positives = 163/282 (57%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKEL----QKHIKSNDE--IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNG-ADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSG 282
           MASL E+K RI+  + T +IT AM+LVS++K+ K ++       Y  K  ++ + I  +N+D++   L K E  KT +L   S  GL G++N +I+K L    +K+  S DE  I ++G+KG +  + +G+    S+ L + D     D+  + +E +  +   D +I  + +IY+ +V+++S   +   LLP+D       LD+     +D+   PN   + E +L  Y  + I GA+++ K  E+A+   AM SAT NA++LI +  L +NR RQ+ ITQEITEIV G
  S:     1 MASLRELKGRIESTKKTKQITGAMQLVSASKMSKAEQNARGFVPYADKLQEVVSSIANANTDAQHPMLMKREVKKTGYLIITSDRGLVGAYNSHILKNLVNTIEKNHTSKDEYTIIVLGRKGYDYCRKRGLPVSKSV-LGVPDHPTFADVKELASETV--QMYADGDIDELNIIYNHYVSAISQVVTNKQLLPIDN------LDESGAATSDYEFDPNQEQILEVLLPQYAESLIFGALLDGKASEHAASMTAMRSATDNASDLIDDLSLSYNRARQAAITQEITEIVGG 281
>gi|88797168|ref|ZP_01112758.1| ATP synthase subunit C [Reinekea sp. MED297] >gi|88780037|gb|EAR11222.1| ATP synthase subunit C [Reinekea sp. MED297] (288 aa)
Score = 338, Expect = 5.5e-30, Identities = 90/283 (31%), Positives = 156/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGA--DFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  I +T KIT+AM+LV+++K++K ++  L    Y +K   +  ++  +N + +   L++ E  +  ++   +  GLCG  N+N+ K +  H           ++  IG KG    K++G +   S+   + ++    DL  I    ++        I  + V+Y++FVN++   P +  +LPL     KP  D+ N     D+  +P+A  +   +L  +L   ++  +VE+  CE ASR  AM +AT+NA ++I N KLE+N+ RQ+ ITQEI+EIV GA
  S:     1 MAVGKEIRTQINSINNTRKITSAMELVAASKMRKAQDRMLVSQPYAQKVRAVIGHLANANVEFKHSYLQEREVKRVGYIVVSTDRGLCGGLNVNLFKAVSLHAAELEQQGIQTQVCAIGSKGTGFFKARGFDVVASIT-HVGEQPAVADL--IGGVKVMIDDFESGKIDQLHVVYNQFVNTMVQKPKIDQILPL-----KPADDESNRSYAWDYLYEPDAESLLNGLLSRFLEAQVYQGVVENGACEQASRMMAMKNATENAGDMIDNLKLEYNKARQAAITQEISEIVGGA 284
>gi|168333943|ref|ZP_02692175.1| ATP synthase F1, gamma subunit [Epulopiscium sp. 'N.t. morphotype B'] (287 aa)
Score = 337, Expect = 7.3e-30, Identities = 100/285 (35%), Positives = 158/285 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSL-KKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDE--IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIK----SIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNG-ADFSI-QPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           MASL +IK RIK I ST +ITNAM LV++AKL K KE  +    ++ K  +    I +N+    + L K ++     ++   S  GL G +N NI K + K I S +E  I  +GKK ++  K+KG     ++ + + +K              +A Y  D  +K     + + Y+ F +++   P++  LLPL+  +E+ +   P +   D  + +P+  DV   ++  YLA    GA++E+   E  +R  AMDSAT NA E+I+   + +NR RQ+ ITQE+TEIVSGA+ 
  S:     1 MASLQDIKGRIKSINSTKQITNAMNLVATAKLTKSKEAAIKSRPFFHKMQETIRSIANNAGPINMPLIKGNDSPNKAYIVLASDRGLAGGYNANICKLVMKDIASKEESQIIAVGKKSRDNFKTKGYNVAKAI-VGMSEKP------GYSHAKEIADYVTDIFVKGEVGEVYLAYTAFKSTIQQEPTMIRLLPLE--LEEIKEVSPEDTLPDLLVYEPSPEDVLAYVIPRYLADVTFGALIEASASEQGARMTAMDSATDNAEEMIQKLGIIYNRARQAAITQELTEIVSGAEA 285
>gi|118603006|ref|YP_904221.1| ATP synthase F1, gamma subunit [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)] >gi|166224099|sp|A1AXU3|ATPG_RUTMC ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|118567945|gb|ABL02750.1| ATP synthase F1, gamma subunit [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)] (287 aa)
Score = 337, Expect = 7.3e-30, Identities = 96/283 (33%), Positives = 171/283 (60%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIK-SNSDSEILSLKKSEEGKTIWLAFFSS-MGLCGSFNLNIVKELQKHI-----KSND-EIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA+  EI+ +I  I++T KIT+AM++V+++K+KK ++  L    Y +K  ++  ++  ++S+ E   +  SE+ + I +   SS  GLCG  N N+ + + K +     KS + +I  IGKK  +  K+ G+  + S+  +L D     DL   I + +L ++  D  I+ + V Y+KF N ++ TP++  L+P+         +  N+  D+  +P+A +V  ++L+ Y+   ++  ++E+  CE +SR  AM SAT NA++++K  KL +N+ RQ+ ITQEI+EIVSGA
  S:     1 MAAGKEIRTQISSIKNTQKITSAMEMVAASKMKKAQDRMLASRPYCEKISNVIGHLAYAHSEFEYSYMNSSEKLQRIGVIIISSDRGLCGGLNTNLFRHILKQVVEYQAKSIEVDICTIGKKATSFFKNLGLNVK-SVLTDLGDTPHFDDLLGTI-KVMLDEFDAD-EIQQLSVAYNKFENIITQTPTIMQLVPMVAG----ESNNINHYWDYIYEPDAQEVLSALLVRYIEALVYQGLIENIACEQSSRMIAMKSATDNASDMVKELKLIYNKARQAAITQEISEIVSGA 284
>gi|167463134|ref|ZP_02328223.1| F0F1 ATP synthase subunit gamma [Paenibacillus larvae subsp. larvae BRL-230010] (285 aa)
Score = 337, Expect = 7.3e-30, Identities = 95/281 (33%), Positives = 159/281 (56%)
  Q:     3 SLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDS-EILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQ-----KHIKSNDE--IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           S+ +IK++IK I++T +IT AM++V+++ L+K +E   +   Y +K  +  + I + +   +   L K    KT +L   S  GL G FN N++++L      KH  S DE  ++++G+KG++ +K +GI   I  ++     ++NF     IA   +  +  +     + ++Y++F+N++S  P     LPLD   E            +  +P+   V E +L  Y  T I+ A++ESK  E  +R  AM SATKNA ++I N  L +NR RQ+ ITQEI+EIV+GA
  S:     4 SMRDIKRQIKSIQNTKQITKAMEMVAASNLRKAQEAAQSSRPYVEKIKEFVSGIAAGTSGFKHPMLDKRPIKKTGYLVITSDRGLAGGFNSNLLRKLMNTFNTKH-ASKDEYAVFVVGRKGRDFLKRRGIP--IVEEVTGLPDNVNFSDIKSIANAAVTMFA-EGEFDELYLVYNQFINAISQVPVEKRFLPLDDVTEDA------TTISYEYEPSPEGVLEILLPRYAETLIYSAVLESKASEFGARMTAMGSATKNATKMISNLTLTYNRARQAAITQEISEIVAGA 282
>gi|83591195|ref|YP_431204.1| F0F1 ATP synthase subunit gamma [Moorella thermoacetica ATCC 39073] >gi|90110009|sp|O05432|ATPG_MOOTA ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|83574109|gb|ABC20661.1| ATP synthase F1, gamma subunit [Moorella thermoacetica ATCC 39073] (282 aa)
Score = 336, Expect = 1.2e-29, Identities = 88/283 (31%), Positives = 154/283 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEGKTI-WLAFFSSMGLCGSFNLNIVKELQKHIKSNDE---IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHI--IAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA + ++K+RI+ ++ST  IT AMK+V++AKL+K +        Y  K  ++   + +  D E   L  + E K   ++   +  GL G +N N+++  ++ ++       +  +G+KG++  + + +E   S      D   N +L     +A  L+  Y  +  +  + +IY++F +++   P V  LLP    I  PR +K + G D+  +P+   V   +L  Y    ++ A++E+K  E+ +R  AMD+ATKNA E+I  + L FNR RQ+ IT EI EIV+GA
  S:     1 MAHMRDLKRRIRSVQSTQHITRAMKMVAAAKLRKAQAQVTAARPYAAKLEEVVGRLMAAVDPETQPLAATREVKKAGYVLITADRGLAGGYNANLIRLTEERLREEGRPAALVAVGRKGRDFFRRRPVEIVKSFT----DIGDNPELIQARELARQLVTMYL-EGTLDEVNLIYTRFYSAIRQVPMVERLLP----IATPR-EKKDTG-DYIYEPSPEAVLRVLLPRYCEIKVYRALLEAKASEHGARMTAMDNATKNAAEMIDKFTLSFNRARQAAITNEIVEIVAGA 278
>gi|114567889|ref|YP_755043.1| F0F1 ATP synthase subunit gamma [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|114338824|gb|ABI69672.1| Sodium-transporting two-sector ATPase [Syntrophomonas wolfei subsp. wolfei str. Goettingen] (298 aa)
Score = 335, Expect = 1.3e-29, Identities = 88/284 (30%), Positives = 160/284 (56%)
  Q:     2 ASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDS--EILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDE-----IWLIGKKGKNLIKSKG-IEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLD--KPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           A + E K+RI+ +++T +IT AMK+V++AKL++ +E   +   Y +        + + S      L +K+ E  K  ++   +  GLCG +N NI++     I  ++      I  +G+K ++  + +G  +AE    + L D +I++     IA+ +   Y+N+  +  + ++Y++FVN L   P+V  LLP++   ++      K     D+  +P+A D+  ++L  Y+ + I+ A++E K  E  +R  AM +AT+NA E+I N  LE N+ RQ+ IT EI +IV GA+ 
  S:     4 AGVREFKRRIRSVQNTQQITKAMKMVAAAKLRRAQEAAESSRPYNETLKGTLARLAAVSFDVRHPLLVKREEVRKVGYIVVTADRGLCGGYNTNIIRAANHAIAEDERKVETGIIAVGRKSRDFYRKRGGFDAEF---INLGD-NISYADAREIAQYVTNAYENE-EVDEVYLVYARFVNVLRQVPTVTKLLPIETPTQEADSSDIKETRQVDYIYEPSAEDILLALLPRYVGSQIYNAMLEGKASEQGARMTAMGNATENAKEIISNLTLEMNKVRQAAITDEILDIVGGAEA 292
>gi|147679148|ref|YP_001213363.1| F0F1 ATP synthase subunit gamma [Pelotomaculum thermopropionicum SI] >gi|189081464|sp|A5CYE3|ATPG_PELTS ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|146275245|dbj|BAF60994.1| F0F1-type ATP synthase, gamma subunit [Pelotomaculum thermopropionicum SI] (284 aa)
Score = 334, Expect = 1.7e-29, Identities = 97/283 (34%), Positives = 162/283 (57%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLF--TYIKSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSND-EIWLI--GKKGKNLIKSKGIE-AEISLDLELDDKDINFDLFHIIAENLLAKYK-NDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           M SL ++++RIK I+ST +IT AMK VS+AK++K +E  L+   Y K+   +     + S   S  L L   E  K  ++   +  GLCG FN N+++   + ++    E+ LI  G+K ++  + +G   A+  + L    ++I +     IA  ++ KY   +Y++  + ++YS+FVN L   P V  LLP +   E+    K     ++  +P+A  V   +L  Y+   I+  ++ESK  E+++R  AMD+ATKNA+++I    L  NR RQ++IT+EI+EIV GA
  S:     1 MPSLRDLRRRIKSIKSTQQITKAMKAVSAAKMRKAQEAVLSARPYSKRLKSVLGRVAVASGGVSHPL-LAVREPKKVAYIVITADRGLCGGFNSNVIRRATQEMREQSAELSLITVGRKSRDFFRRRGYNIAQQYVGL---GEEIKYGTAKEIASFVIEKYSAGEYDV--VYLVYSQFVNILVQKPVVVKLLPAEPPEEEGEARK----VEYIFEPSAAAVLTELLPKYIENAIYQGLLESKAGEHSARMTAMDNATKNASDMIDRLTLSMNRARQAQITKEISEIVGGA 280
>gi|108757970|ref|YP_635039.1| ATP synthase F1, gamma subunit [Myxococcus xanthus DK 1622] >gi|123247176|sp|Q1CX34|ATPG_MYXXD ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|108461850|gb|ABF87035.1| ATP synthase F1, gamma subunit [Myxococcus xanthus DK 1622] (294 aa)
Score = 334, Expect = 1.9e-29, Identities = 90/285 (31%), Positives = 160/285 (56%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILS--LKKSEEGKTIWLAFFSS-MGLCGSFNLNIVKELQKHIKSND-----EIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDK--AIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           MASL +I+KRI+ +++T +IT AMK+VS+AKL+K ++  L    Y      +   + + +  E LS  L  +   K + L   +S  GL G FN N+++   + +  N       +  +G+KG +  +++G    I  D     + +N+     +AE L+A Y N   + ++ ++Y++FV ++S T  V  LLPL      ++       +  DF  +P+   V + ++   +   ++ A++ES   E+ +R +AM++AT NA ++I N  L +NR RQ+ IT+E+ EIVSGA+ 
  S:     1 MASLRDIRKRIRSVKNTRQITKAMKMVSAAKLRKAQDGILAARPYATMLDQIIADLSARAGDESLSHPLLTARPVKRVELVLLTSDRGLAGGFNSNVIRRANRFLYENTNLESIRLSTVGRKGNDFFRNRG--QNIRKDFGGLYQRLNYRAAADVAEELVASYLNG-EVDAVHIVYNEFVTAISQTVKVAQLLPLQTLGTPDQASTAGSTSLVDFKYEPDRQSVLDRLVPQAVNIKLYRALLESVASEHGARMSAMENATSNATDMIGNLTLTYNRTRQAVITKELMEIVSGAEA 292
>gi|187603976|ref|ZP_02990187.1| ATP synthase F1, gamma subunit [Exiguobacterium sp. AT1b] >gi|187484038|gb|EDU22031.1| ATP synthase F1, gamma subunit [Exiguobacterium sp. AT1b] (285 aa)
Score = 334, Expect = 1.9e-29, Identities = 93/283 (32%), Positives = 163/283 (57%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI---KSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIK----SNDE--IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MASL EI+ RI   +ST +IT AM +VS++KL + +    N   Y  K  ++ + I    S +   +L ++  +  +T ++   S  GL G +N ++++++ + +K    S DE  +++IGK G    KS+ I    ++   L+D+    ++  I+ + + A  + +  I  +K+ Y+ F++ +S    +  LLPL        +++  +   +  +P    +  ++L  Y    I+GA++++KV E+A+R  AM SAT NA+ELI+  KL+FNR RQ+ ITQEITEIV GA
  S:     1 MASLREIQMRITSTQSTKQITKAMNMVSASKLNRAQGNNANFKPYMDKLQEVISSIAGGTSGATHPMLQVRPVK--RTGYIVITSDRGLAGGYNASVLRDVYRELKDKHTSTDEYRLYVIGKVGVQFFKSRNIPVYSAMT-GLNDQPTFVEVAEIVKQTVGAFSEGE--IDELKLCYNSFISVISQEVKIQQLLPLGD------IEQSASNVMYEYEPEEETILAALLPRYAEGLIYGALLDAKVSEHAARMTAMSSATDNADELIRGLKLKFNRARQAAITQEITEIVGGA 281
>gi|73662089|ref|YP_300870.1| F0F1 ATP synthase subunit gamma [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|82592651|sp|Q49Z51|ATPG_STAS1 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|72494604|dbj|BAE17925.1| F0F1-type ATP synthase gamma subunit [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (288 aa)
Score = 333, Expect = 2.4e-29, Identities = 95/283 (33%), Positives = 164/283 (57%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIK-SNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKEL-----QKHIKSND-EIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNG--ADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           M SL EI  RIK  +   +IT AM +VSS+KL++ +        Y +K  D  T +  S+ +S    L++ E  K+ +L   S  GL G++N N++K L     +KH   +D  I ++G+ G + +K+KG +   SL +++ D+  +F     IA+  +  Y ++  +  +K+ +S FV+ L  TPS  ++LPL      P      +G  + +  +P+   +   IL  Y+ + I+G I+++K  E+A+R  AM +A+ NA+E+I +  +++NR RQ+ ITQ+ITEIV G+
  S:     1 MGSLKEIDTRIKSTKKMKQITKAMNMVSSSKLRRAESNAKQFRPYMEKMQDAITAVAGSDKNSRHPMLQQREVKKSAYLVITSDKGLAGAYNANVLKHLIKDIEEKHASKDDYSIVVLGQTGVDFLKNKGYDIHDSL-IDVPDQP-SFKEVQAIAKKAIGLY-SEGEVDEVKIYFSHFVSVLENTPSTKTVLPL-----SPEDSSLGHGQMSSYEFEPDKEAILSVILPQYVESLIYGTILDAKASEHATRMTAMKNASDNASEIIDDLSIQYNRARQAAITQQITEIVGGS 284
>gi|83649674|ref|YP_438109.1| F0F1 ATP synthase subunit gamma [Hahella chejuensis KCTC 2396] >gi|123529927|sp|Q2S6P0|ATPG_HAHCH ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|83637717|gb|ABC33684.1| F0F1-type ATP synthase, gamma subunit [Hahella chejuensis KCTC 2396] (287 aa)
Score = 333, Expect = 2.5e-29, Identities = 85/283 (30%), Positives = 161/283 (56%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKS-NSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIK------SNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EIK +I  I+ST KIT+AM+LV+++K++K ++       Y  +   + ++I + N +   L L++ E  +  ++   +  GLCG  N+N  +E+ + +K      +  ++  +G+K  +  ++ G     +L    DD  +   +  +  + +L  Y  +  I  + +++++FVN+++  P+V  LLPL  A +   + +     D+  +P+A  + + +L  ++ + ++ A+VE+  CE A+R  AM SAT NA  +I   +L +N+ RQ+ ITQEI+EIVSGA
  S:     1 MAVGKEIKTQIASIKSTQKITSAMQLVAASKMRKAQQRMAAGRPYADRIRSVISHIATANPEYRHLYLQEREAKRVGYIVVSTDRGLCGGLNVNAFREMMRSMKEWRDKGAEVDLCAVGQKAISFFRNYGGNVVAALSHLGDDPSLTKIVGSV--KVMLDAYA-EGKIDRLYLVHNRFVNTMTQKPTVAQLLPLPPAEDDEMIRR---HWDYIYEPDAKGLLDGLLTRFIESQVYQAVVENNACEQAARMIAMKSATDNAGGIINELELAYNKARQAAITQEISEIVSGA 284
>gi|95929972|ref|ZP_01312712.1| ATP synthase F1, gamma subunit [Desulfuromonas acetoxidans DSM 684] >gi|95133941|gb|EAT15600.1| ATP synthase F1, gamma subunit [Desulfuromonas acetoxidans DSM 684] (290 aa)
Score = 333, Expect = 2.5e-29, Identities = 89/284 (31%), Positives = 171/284 (60%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDE------IWLIGKKGKNLIKSKGIEAEISLDLELDD--KDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAK 284
           MASL +IKKRI  +++T +IT AMK+VS+AKL++ ++  +    Y  K  D+ + + + N+++    L++ E+ + + +   +  GLCG FN +IVK  +  I++  E      + +IG+KG   +K +     + +D   ++   +I +    +I   ++  Y  D     + ++Y++F++++S   +   LLP+   I +   ++P+  AD+  +P++ +V  SIL  ++   +  A++ES   E+ +R ++MDSA+KNA+E+I    L++NR RQ+ IT E+ EI+SGA+
  S:     1 MASLKDIKKRIGSVKNTQQITKAMKMVSAAKLRRAQDAVVAARPYADKMQDVLSSMAQRNAEASHPLLEEREKKRALIVIMTADRGLCGGFNSSIVKAAEAFIRNQAEGYEEYTLRIIGRKGNEGLKRR---PGLVIDKVYENLTGNITYATASLIGSEIVDDYLED-KYDGVFMMYNRFISAISQEVTTTQLLPIVPEISED--EEPSYVADYIYEPSSVEVLSSILPKHIEVQLFRAMLESVASEHGARMSSMDSASKNASEMINKLTLQYNRARQAAITTELMEIISGAE 287
>gi|110602256|ref|ZP_01390382.1| ATP synthase F1, gamma subunit [Geobacter sp. FRC-32] >gi|110547033|gb|EAT60333.1| ATP synthase F1, gamma subunit [Geobacter sp. FRC-32] (287 aa)
Score = 332, Expect = 3.0e-29, Identities = 89/284 (31%), Positives = 157/284 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLK-KSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIK------SNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAK 284
           MASL  IKKRI  +++T +IT AMK+VS+AKL++ +E  +    Y  K  ++   +  N D++   L  K   GK + +   S  GLCG FN N+ K  ++ +K      ++  I  IG+KG   +K++    +I  +      ++N+    ++A+ ++  Y  D     + +IY+ F + +S   ++  LLP    +  P         ++  +P+ +++   +L  ++   I  +++ES   E+ +R  AMDSA+KNANE+I    L++NR RQ+ IT E+ EI+SGA+
  S:     1 MASLKSIKKRIVSVKNTGQITKAMKMVSAAKLRRAQENVVAARPYAAKLGEVLGRLSRNQDADSSPLMIKRTTGKALLIVVTSDRGLCGGFNANLCKAAERFVKERGAEFTDLSIMTIGRKGYEFLKNR---QKIRKNFGTVFSNLNYQTAALLAQEVIQGYL-DEEFDEVFIIYNAFRSVMSQDITLEQLLP----VTPPEAADEEYAPEYIYEPSKSELLGELLPKHIEVQIFKSLLESVASEHGARMTAMDSASKNANEMIGKLTLQYNRARQAAITTELMEIISGAE 283
>gi|83944757|ref|ZP_00957123.1| ATP synthase subunit C [Oceanicaulis alexandrii HTCC2633] >gi|83851539|gb|EAP89394.1| ATP synthase subunit C [Oceanicaulis alexandrii HTCC2633] (294 aa)
Score = 332, Expect = 3.2e-29, Identities = 98/285 (34%), Positives = 167/285 (58%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKS---NSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKG----KNLIKSKGIEAEISLDLELDD-KDINFDLFHIIAENLLAKYK-NDYNIKSIKVIYSKFVNSLSFTPSVFSLLP----LDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           MASL E+K RI  +EST KIT AM++V++AKL+K +E       Y ++   +   + S     D+  L +   ++   + +   +  GLCG FN NI +  ++ + +        +I  +GKKG    K L K K ++      +EL D K I+     +I + +   ++  ++++   +V+ S+FV+ +S  P   +L+P    +D+ +E+P L     GA +S +P+   + E +L  Y+ T I  A++E+   E  ++  AMDSAT+NA ELI    LE+NR RQ++IT+E+ EI+SGA+ 
  S:     1 MASLKELKNRINSVESTKKITKAMQMVAAAKLRKAQEAAEAARPYAERMAAVMANLSSAMEGPDAPRLLVGTGKDDVHLLVVATADRGLCGGFNTNIARLARERVAALVGAGKTVKILTVGKKGYEALKRLHKDKIVDT-----VELKDVKSIDGSTAAMIGDKIRTLFEAGEFDV--CEVVSSEFVSVISQKPRAQTLIPARDAIDETVERPDL----KGAIYSYEPDEESILEVLLPRYVDTVILSALLENAAGEMGAKMAAMDSATRNAGELIDKLNLEYNRSRQAKITKELIEIISGAEA 293
>gi|164688907|ref|ZP_02212935.1| hypothetical protein CLOBAR_02555 [Clostridium bartlettii DSM 16795] >gi|164602111|gb|EDQ95576.1| hypothetical protein CLOBAR_02555 [Clostridium bartlettii DSM 16795] (288 aa)
Score = 331, Expect = 3.6e-29, Identities = 90/284 (31%), Positives = 154/284 (54%)
  Q:     2 ASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDS-EILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDE-IWLIGKKGKNLIKSKG---IEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQ--PNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           A + EIK RI  ++ST ++T AM+LVSS+K++K K+  L    Y+   Y+    I +N+       LK+ E     ++      GL G +N NI K    H+    E +  +GKK     + +G   + AE S++        ++D    +A   +  YK    I  + + Y++F++ L+ TP +  +LPL    E+ +  K N+G+   +Q  P+   V   ++  Y++  ++  ++ES   E ++RRNAM SA+ NA+E++   +L +NR RQ+ +TQEITEIV G + 
  S:     4 AGIKEIKNRIGSVQSTKQVTKAMELVSSSKMRKAKDRALASRPYFNTMYNTVKDIATNTRGVRDPFLKQREVKNKCYIVIAGDRGLAGGYNSNIFKLTTAHMDGKQEKVMTVGKKATEFFQKRGYNIVAAEESVE------KCDYDRTLALANTAMDLYKKG-EIDELYICYTEFISPLTQTPKLMKVLPLAFDKEEAK-SKENSGSRARVQYLPSPEAVLSYLIPKYVSGVVYDGVIESFASEQSARRNAMKSASDNADEMLSTLELSYNRARQTAVTQEITEIVGGVEA 286
>gi|110835588|ref|YP_694447.1| ATP synthase, gamma subunit [Alcanivorax borkumensis SK2] >gi|123345187|sp|Q0VKX3|ATPG_ALCBS ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|110648699|emb|CAL18175.1| ATP synthase, gamma subunit [Alcanivorax borkumensis SK2] (286 aa)
Score = 331, Expect = 3.9e-29, Identities = 88/283 (31%), Positives = 165/283 (58%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEI--LSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDE------IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MAS  EIK +I  ++ST KIT AM++V+++K++K +E       Y  +   +  ++ +N+D E   + L++ E     ++   S  GLCG  N+N++K + K  K+ +E        ++G KG +  KS G   E ++    D   +N DL   I + +L  Y++   I  + ++Y++FVN+++ +P    LLPL+   +    ++     D+  +P   ++ + +L+ ++ + ++  +VE+  CE A+R  AM +A+ NA ++I++ +L +N+ RQ+ ITQEI+EIV GA
  S:     1 MASGKEIKGKIASVQSTKKITRAMEMVAASKMRKAQERMTASKPYASRMRQVVAHL-ANADLEYRHVYLQEREVKNVGYIVVSSDRGLCGGLNVNLLKNVVKSAKAWEEKGAKTSYCVVGSKGMSFFKSVGGNVEANITGLGDTPHLN-DLIGSI-KVMLDAYESG-AIDRLYIVYNEFVNTMTQSPKNIQLLPLEAGSD----EELKRHWDYIYEPAPKELLDELLVRFIESQVYQGVVENNACEQAARMIAMKAASDNAGDIIRDLQLVYNKARQAAITQEISEIVGGA 283
>gi|172058682|ref|YP_001815142.1| ATP synthase F1, gamma subunit [Exiguobacterium sibiricum 255-15] >gi|171991203|gb|ACB62125.1| ATP synthase F1, gamma subunit [Exiguobacterium sibiricum 255-15] (283 aa)
Score = 330, Expect = 4.5e-29, Identities = 93/286 (32%), Positives = 156/286 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLF-TYIKSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKEL-----QKHIKSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKGE 286
           MASL EI+ RI   +ST +IT AM +VS++KL + +        Y  K  ++  T     + +    L+K    KT ++   S  GL G++N N+++E+     +KH   +  ++++GK G    +S+GI    ++   L+D     D+  I+   + A    +  I  +K+ Y+ F++ +S    V +LLPL +        + ++   +  +P+   +   +L  Y  + I GA++++KV E+ASR  AM SAT NA++LI    L +NR RQ+ ITQEITEIVSGA  +
  S:     1 MASLREIQMRINSTKSTKQITKAMNMVSASKLNRAQAHSAKFQPYMLKMQEVLGTIANGTTGASHPMLEKRPVKKTGYIVITSDRGLAGAYNANVLREVYREINEKHTTDSYVLFVVGKVGVQFFRSRGITVTDAIT-GLNDSPSYVDVAEIVKRTVSAFTLGE--IDELKLCYNHFMSVISQEVKVETLLPLGEI-------EASSSTTYEYEPSEEQILAELLPRYAESLIFGALLDAKVAEHASRMTAMQSATDNADDLIGRLTLVYNRARQAAITQEITEIVSGAAAQ 282
>gi|153093200|gb|EDN74211.1| H(+)-transporting two-sector ATPase, (F1) gamma subunit [Mannheimia haemolytica PHL213] (288 aa)
Score = 330, Expect = 5.0e-29, Identities = 89/283 (31%), Positives = 155/283 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDE------IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  + +T KIT AM++V+++K++K +E       Y +      ++I K N + +   L      K  +L   +  GLCG  N+N+ K +   +K  D+      + ++G KG +     G+E +  ++  L D     DL  I+  N +     +  I  + V+Y++F+N++S  P+V  LLPL  A+E   L++     D+  +PN   + +S+L+ YL + ++ A+V++   E A+R  AM +AT NA  LI   +L +N+ RQ+ IT E+ EIV+GA
  S:     1 MAGAKEIRTKIASVRNTQKITKAMEMVAASKMRKTQERMAASRPYAESIRKAISHIAKGNIEYKHPFLTPRPVKKVGYLVVSTDRGLCGGLNINLFKTVLHELKEKDDQGVKSRLAVVGNKGISFFNPMGLEIKGHIN-GLGDTPAMEDLVGIV--NGMVNAYREGEIDEVYVVYNRFINTMSQKPTVQQLLPL-PALENDSLEQ-TGSWDYLYEPNPQALLDSLLVRYLESQVYQAVVDNLASEQAARMVAMKAATDNAGNLINELQLVYNKARQASITNELNEIVAGA 285
>gi|158430156|pdb|2QE7|G Chain G, Crystal Structure Of The F1-Atpase From The Thermoalkaliphilic Bacterium Bacillus Sp. Ta2.A1 >gi|33329386|gb|AAQ10089.1| ATP synthase subunit gamma [Bacillus sp. TA2.A1] (286 aa)
Score = 329, Expect = 6.5e-29, Identities = 92/283 (32%), Positives = 157/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNS-DSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHI----KSNDE--IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           M  + EIK+RI+ +++T +IT AMK+V++AKL++ +E   N   Y  K  ++ + I + + D     L+     KT ++   S  GL G +N NI++ + K I    +S DE  I+ +G+KG++  K +G      +    D   +       IA++ +  +  D     + + Y++FV+ +   P    LLPL     +  LD P +  ++  +P++  V E +L  Y  T I+ A++++K  E  +R  AM +AT NA E+++   L+FNR RQ+ ITQEI EIV+GA
  S:     1 MQGMREIKRRIRSVKNTRQITKAMKMVAAAKLRRAQETAENARPYADKIKEVISSIAAGTKDFSHPMLEARPVKKTGYMVITSDRGLAGPYNANILRLVSKTIEERHQSKDEYVIFAVGRKGRDFFKKRGYPVVEEVTGISDTPSLT--EIQDIAQSAIGMFA-DETFDKLTIFYNEFVSPIVQRPVEKQLLPL---TSEEVLDGPVSAYEY--EPDSESVLEVLLPKYAETLIYSALLDAKASEFGARMTAMGNATDNATEMLETLTLQFNRARQAAITQEIAEIVAGA 282
>gi|150011017|gb|ABR57165.1| F0F1-type ATP synthase gamma subunit [Staphylococcus xylosus] (288 aa)
Score = 329, Expect = 7.2e-29, Identities = 96/283 (33%), Positives = 164/283 (57%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIK-SNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSN----DE--IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNG--ADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           M SL EI  RIK  +   +IT AM +VSS+KL++ +        Y +K  D  T +  ++ +S    L++ E  K+ +L   S  GL G++N N++K L K I+S     DE  I ++G+ G + +K+KG E   SL +++ D+  +F     IA+  +  Y  +  +  +K+ +S FV+ L  TPS  ++LPL      P      +G  + +  +P+   +   IL  Y+ + I+G I+++K  E+A+R  AM +A+ NA+++I +  +++NR RQ+ ITQ+ITEIV G+
  S:     1 MGSLKEIDTRIKSTKKMKQITKAMNMVSSSKLRRAESNTKQFRPYMEKMQDAITAVAGADKNSHHPMLQQREVKKSGYLVITSDKGLAGAYNANVLKHLVKDIESKHASKDEYSILVLGQTGVDFLKNKGYEIHESL-IDVPDQP-SFKEVQAIAKKAIDLYSEEV-VDEVKIYFSHFVSVLENTPSTKTVLPL-----SPEDSSLGHGQMSSYEFEPDKEAILSVILPQYVESLIYGTILDAKASEHATRMTAMKNASDNASDIIDDLSIQYNRARQAAITQQITEIVGGS 284
>gi|167856122|ref|ZP_02478863.1| F0F1 ATP synthase subunit gamma [Haemophilus parasuis 29755] >gi|167852763|gb|EDS24036.1| F0F1 ATP synthase subunit gamma [Haemophilus parasuis 29755] (288 aa)
Score = 328, Expect = 7.9e-29, Identities = 91/283 (32%), Positives = 158/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNS-DSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDE------IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGA-DFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  + +T KIT AM++V+++K++K +E       Y      + ++I   S D +   L + E  K  ++   +  GLCG  N+N+ K +   +K+  +      + L+G K  +  +S G+E +  +   L D     DL  I+   ++  Y+N   +  + +IY++FVN++S  P+V  LLPL +  +    D  N G+ D+  +PN   + +S+L+ YL + ++ AIV++   E A+R  AM +AT NA  LI   +L +N+ RQ+ IT E+ EIV+GA
  S:     1 MAGAKEIRTKIASVRNTQKITKAMEMVAASKMRKTQERMSASRPYSDAIRKVISHIAKGSIDYKHPFLTEREVKKVGFIVVSTDRGLCGGLNINLFKTVLNELKTRKDKGGDSVLGLVGNKAVSFFQSMGVEIKAQVT-GLGDTPAMEDLVGIV-NGMIENYRNG-EVDEVYIIYNRFVNTMSQKPTVQKLLPLPELEDD---DLENKGSWDYIYEPNPKVLLDSLLVRYLESQVYQAIVDNLASEQAARMVAMKAATDNAGNLINELQLVYNKARQASITNELNEIVAGA 285
>gi|126667607|ref|ZP_01738576.1| F0F1 ATP synthase subunit gamma [Marinobacter sp. ELB17] >gi|126627876|gb|EAZ98504.1| F0F1 ATP synthase subunit gamma [Marinobacter sp. ELB17] (286 aa)
Score = 328, Expect = 8.2e-29, Identities = 95/283 (33%), Positives = 157/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHI---KSND---EIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYK------NDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  I+ST KIT+AM++V+++K++K +E       Y +K   +  +I KSN D     + + E  +  ++   S  GLCG  N N  K L + +   K+ D   ++  IG+KG +  +S G     +L    D            AE L+   K       D  I  + ++ ++FVN+++  P    LLPL +  E    D   +  D+  +P+A  + +++L  Y+ + ++  +VE+  CE A+R  AM SAT NA ++IK+ +L +N+ RQ+ ITQEI+EIVSGA
  S:     1 MAIGKEIRNQIGSIKSTQKITSAMEMVAASKMRKAQERMRATRPYAEKMRQVIGHIAKSNKDYRHPFMLEREVKRVGYIVISSDRGLCGGLNSNAFKLLVREMRDWKNKDVAIDLCAIGQKGASFFRSYGGNVVAALTHIGDAPS---------AEALIGNVKVMLDSFRDGKIDRLYLVSNEFVNTMTQMPKAQQLLPLPEGKE----DDIGHQWDYIYEPDARPILDALLPRYIESQVYQGVVENLACEQAARMIAMKSATDNAGDIIKDLQLVYNKARQAAITQEISEIVSGA 283
>gi|75529287|sp|Q8VV78|ATPG_COLMA ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|18146850|dbj|BAB82483.1| F0F1-ATPase subunit gamma [Colwellia maris] (287 aa)
Score = 328, Expect = 9.0e-29, Identities = 88/283 (31%), Positives = 161/283 (56%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIK-SNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKEL------QKHIKSNDEIWLIGKKGKNLIKSKG--IEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EIK +I  ++ T KIT+AM++V+++K++K +E       Y     ++  +I   N +     + + E  +  ++   S  GLCG  N+N+ K++      ++   +  E  +IG K      + G  + A+IS    L D     DL   +A  ++ K  ++  I  + V+Y+KFVN+++  P++  LLPL K+ +    +  ++  D+  +P+AN + + +L+ Y+ + ++  +VE+  CE ASR  +M +AT NA +LI + +L +N+ RQ+ ITQE+ EIV+GA
  S:     1 MAVGKEIKTKIASVKGTQKITSAMEMVAASKMRKAQEGMAASRPYATNIRNVIGHIALGNLEYRHPYMDEREAKRVGYIVVSSDRGLCGGLNINLFKKVLADAAEKQASGAEVEFCVIGSKATAFFNNMGAKVSAQIS---GLGDSPSLTDLVGSVA--VMLKAYDNGEIDRLHVVYNKFVNTMTQEPTIDQLLPLPKSDD----EAISHRWDYIYEPDANSLLDQLLVRYIESQVYQGVVENIACEQASRMVSMKAATDNAGDLIDDLQLVYNKARQAAITQELGEIVAGA 283
>gi|148377621|ref|YP_001256497.1| F0F1 ATP synthase subunit gamma [Mycoplasma agalactiae PG2] >gi|148291667|emb|CAL59053.1| ATP synthase gamma chain [Mycoplasma agalactiae PG2] (287 aa)
Score = 328, Expect = 9.8e-29, Identities = 91/283 (32%), Positives = 161/283 (56%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYY----KKFYDLFTYIKSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           M+S+  I+ RIK ++S  KIT+AM+LVS +KLKK K  F     Y     + F  +F  I  +   E++  + + + K +++   S++GL G++N N++K +++ + S+D + +IG  G   ++ +  E  I+L      K  +  +  II      KY  +  + SI  IY+KF+N+L        + P D+ + +  +D+         +P+A DV    +  ++ + +H A+  S + E+++RR+AM++AT+N++ LI    +EF RKRQ++IT EI EIVSGA
  S:     1 MSSIQSIQSRIKTVQSIRKITHAMELVSYSKLKKAKTAFDEVEKYNLLIDQTFNKIFENISHDDLKELMKSRNNSKSK-LYIIVTSNLGLAGAYNANVIKLVKETVTSDDYLIIIGSYGVRALRQQYNEQIINLSDITTSKRTSTLVSKIIKRAF--KYYRNGAVSSINFIYTKFINNLVQEELCEKVFPFDEQMIREHIDRKEIDYKLEFEPSAKDVLADAIPLFVDSKLHLAMATSLISEHSARRSAMENATRNSDSLITELDMEFKRKRQAKITNEIIEIVSGA 284
>gi|70725932|ref|YP_252846.1| F0F1 ATP synthase subunit gamma [Staphylococcus haemolyticus JCSC1435] >gi|82592650|sp|Q4L7Y5|ATPG_STAHJ ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|68446656|dbj|BAE04240.1| ATP synthase gamma chain [Staphylococcus haemolyticus JCSC1435] (288 aa)
Score = 327, Expect = 1.1e-28, Identities = 96/283 (33%), Positives = 164/283 (57%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNS-DSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIK----SNDE--IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MASL EI  RIK  +   +IT AM +VSS+KL++ ++       Y +K  D  T I   S +S    L+  +  ++ +L   S  GL G+++ N++K L   IK    S+DE  I ++G+ G + +K++G E E SL +++ D+  +F     IA++ +  +  ++ I  +K+ YS +V+ L   P+   +LPL +   +         + +  +P+   +   IL  Y+ + I+G I+++K  E+A+R  AM +A+ NA ELI +  L++NR RQ+EITQ+ITEIV G+
  S:     1 MASLKEIDGRIKSTKKMKQITKAMNMVSSSKLRRAEKNTKQFEPYMEKMQDAITAIAGASKNSSHPMLRPRQVQRSGYLVITSDKGLAGAYSSNVLKRLINDIKEKHTSSDEYSIIVLGQSGVDFLKNRGYEIENSL-VDVPDQP-SFKSIQAIAKHAIDLFSEEH-IDELKIYYSHYVSVLENKPTTKQVLPLSR---EDSSQGQGQMSSYEFEPDKESILSVILPQYVESLIYGTILDAKASEHAARMTAMKNASDNATELIDDLSLQYNRARQAEITQQITEIVGGS 284
>gi|27468619|ref|NP_765256.1| F0F1 ATP synthase subunit gamma [Staphylococcus epidermidis ATCC 12228] >gi|57867650|ref|YP_189275.1| F0F1 ATP synthase subunit gamma [Staphylococcus epidermidis RP62A] >gi|81673870|sp|Q5HMB8|ATPG_STAEQ ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|81842668|sp|Q8CNJ6|ATPG_STAES ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|27316166|gb|AAO05300.1|AE016749_246 ATP synthase gamma chain [Staphylococcus epidermidis ATCC 12228] >gi|57638308|gb|AAW55096.1| ATP synthase F1, gamma subunit [Staphylococcus epidermidis RP62A] (288 aa)
Score = 327, Expect = 1.1e-28, Identities = 98/283 (34%), Positives = 160/283 (56%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIK-SNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS--NDE----IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MASL EI  RIK      +IT AM +VSS+KL++ ++   +   Y +K  D  T +  SNS S    LK  +  ++ +L   S  GL G+++ N++K L   I S  ND     + ++G++G +  K +G E E SL +E+ D+  +F     IA++ +  +  + NI  + + YS +V+ L   P+   +LPL    ++         + +  +P+   +   IL  Y+ + I+G I+++K  E+ASR  AM +A+ NA ELI +  LE+NR RQ+ ITQ+ITEIV G+
  S:     1 MASLKEIDSRIKSTSKMKQITKAMNMVSSSKLRRAEKNTKSFRPYMEKMQDAITAVAGSNSTSNHPMLKSRDIKRSGYLVITSDKGLAGAYSTNVLKSLVNDINSKHNDSSEYSLIVLGQQGVDFFKHRGYEIESSL-VEVPDQP-SFKSIQSIAKHAIDLFSEE-NIDELTIYYSHYVSVLENKPATKQVLPLS---QEDSGQGHGQMSSYEFEPDKESILSVILPQYVESLIYGTILDAKASEHASRMTAMRNASDNATELIDDLSLEYNRARQAAITQQITEIVGGS 284
>gi|127514771|ref|YP_001095968.1| F0F1 ATP synthase subunit gamma [Shewanella loihica PV-4] >gi|166224104|sp|A3QJR1|ATPG_SHELP ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|126640066|gb|ABO25709.1| ATP synthase F1, gamma subunit [Shewanella loihica PV-4] (286 aa)
Score = 327, Expect = 1.1e-28, Identities = 88/283 (31%), Positives = 160/283 (56%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNS-DSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKEL------QKHIKSNDEIWLIGKKGKNLIKSKG--IEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EIK +I  +++T KIT+AM++V+++K++K ++       Y +    +  ++   S + +   L+  E  +  ++   +  GLCG  N+N+ K++      Q+   +  E   IG +      S G  + A  S    L D     DL   +   ++ K  N+  +  + V+++KFVN++S TP +  LLPL K+ E    D+ ++  D+  +P+  ++ E++L+ Y+ + ++  +VE+   E A+R  AM +AT NA ELI + +L +N+ RQ+ ITQE++EIVSGA
  S:     1 MAGAKEIKTKIASVQNTQKITSAMEMVAASKMRKAQDRMAASRPYAENMRKVIGHVAQGSLEYKHPYLEVREAKRVGYIVVSTDRGLCGGLNVNLFKKVVADVKKQREAGAEVEFCPIGARSVQFFNSFGGKVSAHAS---GLGDAPKLADLIGTV--RVMLKAYNEGTLDRLYVVFNKFVNTMSQTPVIEQLLPLPKSEE----DEISHHWDYLYEPDPKELLETLLVRYVESQVYQGVVENIASEQAARMVAMKAATDNAGELIDDLQLVYNKARQAAITQELSEIVSGA 283
>gi|195953927|ref|YP_002122217.1| ATP synthase F1, gamma subunit [Hydrogenobaculum sp. Y04AAS1] >gi|195933539|gb|ACG58239.1| ATP synthase F1, gamma subunit [Hydrogenobaculum sp. Y04AAS1] (292 aa)
Score = 326, Expect = 1.4e-28, Identities = 94/283 (33%), Positives = 164/283 (57%)
  Q:     3 SLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEGKTIWLAFFSS-MGLCGSFNLNIVKELQKHIKS----NDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPL---DKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           S  +IK +I  I++T +ITNAMK+VS+AKL+K +E       Y  K Y+L  ++ ++ D+    L K  E K + L   S+  GL G+FN N+ K++  ++KS       + ++GKK  N   SK     +S   ++  K+INFD+   +   L+++YK +     I +  ++ +   ++ P     LP+   D  I++P+LD   +   ++I+ N  D+ + I+  Y+   ++ A++ES   E+ +R  AMD+AT+NA++LIK + L FN+ RQ  IT E+ +IV+ A+ 
  S:     5 SPRDIKSKIAGIKNTMRITNAMKVVSAAKLRKAQEAIFKARPYSDKLYELMAHLFAHIDTYSHPLFKRRELKNVDLVIISADRGLAGAFNTNLFKKVDSYLKSCPSQRINLHIVGKKA-NQYYSKRSYHIVSSYQDVFKKEINFDIVKELGAKLISRYKEE-ETDHIVLFNNEMITKATYAPKERRFLPITYEDVHIQEPKLD---HNTIYNIEGNETDILDGIISIYMNYQLYRAMLESNAAEHFARMVAMDNATRNASDLIKKWTLIFNKARQESITAELIDIVTAAEA 290
>gi|196195283|gb|EDX90242.1| ATP synthase F1, gamma subunit [Alcanivorax sp. DG881] (286 aa)
Score = 326, Expect = 1.6e-28, Identities = 88/283 (31%), Positives = 163/283 (57%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEI--LSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDE------IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MAS  EIK +I  ++ST KIT AM++V+++K++K +E       Y  +   +  ++ +N+D E   + L++ E     ++   S  GLCG  N+N++K + K  K   E        ++G KG +  KS G   E ++    D   +N DL   I + +L  Y++   I  + ++Y++FVN+++ +P    LLPL+   +    ++     D+  +P   ++ + +L+ ++ + ++  +VE+  CE A+R  AM +A+ NA ++I++ +L +N+ RQ+ ITQEI+EIV GA
  S:     1 MASGKEIKGKIASVQSTKKITRAMEMVAASKMRKAQERMSASKPYASRMRQVVAHL-ANADLEYRHVYLQEREVKNVGYIVVSSDRGLCGGLNVNLLKNVVKSAKEWQEKGVKASYCVVGSKGMSFFKSVGGNVEANVTGLGDTPHLN-DLIGSI-KVMLDAYESG-AIDRLYIVYNEFVNTMTQSPKNIQLLPLEAGSD----EELKRHWDYIYEPAPKELLDELLVRFIESQVYQGVVENNACEQAARMIAMKAASDNAGDIIRDLQLVYNKARQAAITQEISEIVGGA 283
>gi|121534926|ref|ZP_01666745.1| ATP synthase F1, gamma subunit [Thermosinus carboxydivorans Nor1] >gi|121306525|gb|EAX47448.1| ATP synthase F1, gamma subunit [Thermosinus carboxydivorans Nor1] (283 aa)
Score = 325, Expect = 1.9e-28, Identities = 87/285 (30%), Positives = 161/285 (56%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNS-DSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDEIWLI--GKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNG----ADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           M S  +I++RIK +++  +IT AMK+V++A+L++ +E       Y +K  ++   + +++ D     L   E  +  +L   +  GL G+++ NI++E+   ++  D I ++  G+K ++  K +G   + S  L   +K   +D    IA+ L + + +      I+++Y++F + ++  P+   LLPL         D P+ G    A++  +P+A +V + +L  YL T I+ A++++   E  +R  AM SAT NA ELI+   L +N+ RQ+ IT+EITEIV GA+ 
  S:     1 MPSARDIRRRIKSVKNIQQITKAMKMVAAARLRRAQERAAASKPYTQKIREVLASVAASTRDVSHPLLAVREVNRIGYLILSADKGLAGAYSANIIREVLPQVRGKDNIGMVIVGRKARDYFKRRGYTID-SEYLGFSEKP-TYDHAVKIAKELSSAFISG-KYDEIRLVYTQFFSPINQKPTTVKLLPLT--------DTPDGGEAPQAEYIFEPSAAEVLDLLLPKYLETVIYSALLQAAASELGARMTAMSSATDNAQELIQKLILNYNKVRQATITREITEIVGGAEA 281
>gi|77166521|ref|YP_345046.1| Sodium-transporting two-sector ATPase [Nitrosococcus oceani ATCC 19707] >gi|123593196|sp|Q3J6N0|ATPG_NITOC ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|76884835|gb|ABA59516.1| Sodium-transporting two-sector ATPase [Nitrosococcus oceani ATCC 19707] (289 aa)
Score = 324, Expect = 2.2e-28, Identities = 85/283 (30%), Positives = 161/283 (56%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDE------IWLIGKKGKNLIKSKG--IEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MAS  EI+ +I  +++T KIT AM++V+++K++K ++       Y  K  ++  ++ +++ + +   L   E  K  ++   S  GLCG  N N+ + L + ++  DE      + +IG+K     +  G  I A+ +    L D     DL   + + +L  Y+ + N+  + + +++FVN+++  P +  LLP+D  + K   +K  +  D+  +P A +V + +LI Y+ + ++  +VE+  CE A+R  AM +A+ NA   I + +L +N+ RQ+ ITQE++EIV GA
  S:     1 MASGKEIRSKIASVKNTQKITRAMEMVAASKMRKAQDRMRASRPYADKIRNVIRHLAQAHQEYQHPYLTSREAKKVGFIIVSSDRGLCGGLNTNLFRTLLRTMREWDEKGVPVELCIIGQKANAFFRRFGGSIAAQAT---HLGDSPHVEDLIGTV-KVMLDNYQ-EGNVDRLYLAFNEFVNTMTQRPEIEQLLPIDANVGKTD-EKLEHRWDYLYEPEAKEVLDQVLIRYIESLVYQGVVENIACEQAARMVAMKAASDNAGGFIDDLQLAYNKARQAAITQELSEIVGGA 286
>gi|89092248|ref|ZP_01165202.1| ATP synthase gamma chain [Oceanospirillum sp. MED92] >gi|89083336|gb|EAR62554.1| ATP synthase gamma chain [Oceanospirillum sp. MED92] (287 aa)
Score = 324, Expect = 2.2e-28, Identities = 89/283 (31%), Positives = 161/283 (56%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EIK +I  ++ST KIT+AM++V+++K++K ++   +   Y +    +  ++ KSN +   L +++ E  +  ++   +  GLCG  N+N  K   K +K         +I  +G K  +  KS G    ++    L D     DL  I +  ++    ++  +  + ++ + FVN+++  P+V  +LPL KA E    DK N+  D+  +P+A ++  S+L+ Y+ + ++ A+VE+  CE A+R  AM +AT NA ++I   ++ +N+ RQ+ ITQEI+EIV GA
  S:     1 MAVGKEIKTKIASVQSTRKITSAMEMVAASKMRKAQDRMESSRPYARSIRGVIQHLAKSNPEYRHLYMQERETKRVGFVIVATDRGLCGGLNVNAFKAAVKSMKEFHDQGVEIDICALGSKAGSFFKSYGGNV-VAAKTHLGDAPEVADL--IGSVKVMLDAYDEGKLDKLFIVSNDFVNTMTQQPAVSQVLPL-KAEEDD--DKLNHHWDYLYEPDAKELLNSLLVRYVESLVYQAVVENNACEQAARMLAMKNATDNAGDMIDELEMIYNKARQAAITQEISEIVGGA 284
>gi|22537025|ref|NP_687876.1| F0F1 ATP synthase subunit gamma [Streptococcus agalactiae 2603V/R] >gi|76788294|ref|YP_329607.1| F0F1 ATP synthase subunit gamma [Streptococcus agalactiae A909] >gi|76799297|ref|ZP_00781464.1| ATP synthase F1, gamma subunit [Streptococcus agalactiae 18RS21] >gi|77406454|ref|ZP_00783510.1| ATP synthase F1, gamma subunit [Streptococcus agalactiae H36B] >gi|77410729|ref|ZP_00787088.1| ATP synthase F1, gamma subunit [Streptococcus agalactiae CJB111] >gi|123601924|sp|Q3K1J6|ATPG_STRA1 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|81744391|sp|Q8E073|ATPG_STRA5 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|22533882|gb|AAM99748.1|AE014231_6 ATP synthase F1, gamma subunit [Streptococcus agalactiae 2603V/R] >gi|76563351|gb|ABA45935.1| ATP synthase F1, gamma subunit [Streptococcus agalactiae A909] >gi|76585357|gb|EAO61948.1| ATP synthase F1, gamma subunit [Streptococcus agalactiae 18RS21] >gi|77163265|gb|EAO74217.1| ATP synthase F1, gamma subunit [Streptococcus agalactiae CJB111] >gi|77174923|gb|EAO77736.1| ATP synthase F1, gamma subunit [Streptococcus agalactiae H36B] (293 aa)
Score = 324, Expect = 2.2e-28, Identities = 99/282 (35%), Positives = 158/282 (56%)
  Q:     2 ASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-----KSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIK----SNDE--IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
            SL+EIK +I   E TSKIT+AM++VSSAKL K ++   +  +Y  K   + T +      S SD+ +LS +  +  KT ++   S  GL G +N  I+K +   I      ND+  I  IG  G +  K++G+   +S +L   +   +FD    I    +  YKN+     + V Y+  VNSL+    +  +LP+ K ++     +      F ++PN   + E +L  Y  + I+GAI+++K  E+A+   AM +AT NA  +I +  +++NR RQ+ ITQEITEIV+GA
  S:     3 GSLSEIKDKILSTEKTSKITSAMQMVSSAKLVKSEQAARDFQVYASKIRQITTNLLKSDLVSGSDNPMLSSRPVK--KTGYIVITSDKGLVGGYNSKILKAMMDTITDYHTENDDYAIISIGSVGSDFFKARGMN--VSFELRGLEDQPSFDQVGKIIAQAVEMYKNEL-FDELYVCYNHHVNSLTSQVRMQQMLPI-KELDAEEASEDRVITGFELEPNREVILEQLLPQYTESLIYGAIIDAKTAEHAAGMTAMQTATDNAKNVINDLTIQYNRARQAAITQEITEIVAGA 289
>gi|54310643|ref|YP_131663.1| F0F1 ATP synthase subunit gamma [Photobacterium profundum SS9] >gi|81697254|sp|Q6LLG7|ATPG1_PHOPR ATP synthase gamma chain 1 (ATP synthase F1 sector gamma subunit 1) >gi|46915086|emb|CAG21861.1| Putative AtpG, ATP synthase F1, gamma subunit [Photobacterium profundum SS9] (288 aa)
Score = 324, Expect = 2.4e-28, Identities = 88/283 (31%), Positives = 162/283 (57%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIK-SNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIK------SNDEIWLIGKKGKNLIKSKG--IEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MAS  EI+ +I  +++T KIT AM++V+++K++K ++   +   Y +    +  +I   N + +   L+  E  +  ++   S  GLCG  N+N+ K     IK      ++ E+ L+G K      S G  + A++S    L D     +L   +   +L KY N+  +  + ++Y++FVN++   P +  LLPL K+ ++    + N+  D+  +P    + +++L+ Y+ + ++  +VE+  CE A+R  AM SAT NA ++I + +L +N+ RQ+ ITQE++EIVSGA
  S:     1 MASAKEIRNKIGSVQNTQKITKAMEMVAASKMRKTQDAMESSRPYAETMRKVIGHIALGNLEYKHPYLEVREAKRVGYIIVSSDRGLCGGLNINLFKSAMTDIKGWADQGADVEMALVGAKATAFFNSYGGNVVAQVS---GLGDSPTVNELIGTVGV-MLKKY-NEGLLDRLYLVYNQFVNTMIQEPVIDQLLPLPKSKDEEM--QRNHSWDYIYEPEPKPLLDTLLVRYVESQVYQGVVENLACEQAARMVAMKSATDNAGDIINDLQLVYNKARQAAITQELSEIVSGA 285
>gi|90023607|ref|YP_529434.1| TonB-dependent receptor [Saccharophagus degradans 2-40] >gi|123275801|sp|Q21DK7|ATPG_SACD2 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|89953207|gb|ABD83222.1| ATP synthase F1, gamma subunit [Saccharophagus degradans 2-40] (286 aa)
Score = 324, Expect = 2.4e-28, Identities = 88/283 (31%), Positives = 164/283 (57%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKS-NSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MAS  EI+ +I  I++T KIT+AM++V+++K+++ ++       Y  +   +  ++ + N + + L L++ E  +  ++   S  GLCG  N+N+ K++  H K+        ++ +IG KG +   S G     S+  ++ +K    DL  I +  ++     +  I  + ++ ++FVN+++  PSV  LLPL    +K    K  +  D+  +P A ++ + +L+ Y+ + ++ A+VE+  CE A+R  AM +AT NA +LI   +L +N+ RQ+ ITQE++EIVSGA
  S:     1 MASGKEIRTQIGSIKNTQKITSAMEMVAASKMRRAQDRMELGKPYASRMRAVVGHLANGNPEYKHLYLQEREVKRVGYIIVSSDRGLCGGLNVNVFKQVIVHSKAWADKGVGVDLCMIGAKGTSFFNSVGGNIVASVR-DIGEKPKVSDL--IGSVKVMLDAFAEQKIDKLYLVGNEFVNTMTQLPSVEQLLPLQPDEDK----KLQHQWDYIYEPEARELLDGLLVRYIESQVYQAVVENGACEQAARMIAMKNATDNAGDLIDGLQLVYNKARQAAITQELSEIVSGA 283
>gi|51891228|ref|YP_073919.1| F0F1 ATP synthase subunit gamma [Symbiobacterium thermophilum IAM 14863] >gi|81692258|sp|Q67TB8|ATPG_SYMTH ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|51854917|dbj|BAD39075.1| ATP synthase gamma subunit [Symbiobacterium thermophilum IAM 14863] (288 aa)
Score = 324, Expect = 2.6e-28, Identities = 88/277 (31%), Positives = 159/277 (57%)
  Q:     7 IKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYD-LFTYIKSNSDSEILSLKKSEEGK--TIWLAFFSSMGLCGSFNLNIVKE----LQKHIKSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDY---NIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           +++RI+ ++ST +IT AMK+V +AKL++ +E   N   Y ++    L   I++ +  +   L +  EG     ++   +  GL G+FN+N++++    LQK  +    I  IG+KG++    + I+  +   + L D +I F L    A ++L+K  + Y    +  ++VIY++FVN+++  P    LLP+  A    + D  +   ++  +P+   V ++++  Y  T  +  ++ESK  E+ +R  AM +AT NA E+I    L +NR RQ+ IT+EI+EIV GA
  S:     8 VQRRIRAVKSTQQITKAMKMVDAAKLRRAQEKVQNARPYSRELAKTLGRLIQAGAGIDHPLLHRRTEGTPTVAYVLLTADRGLAGAFNINVIRKAHQALQKESRPTKLI-TIGRKGRDYFVKRKIQPVLEF-VNLGD-NITFAL----ARSVLSKIVDLYLSGEVDEVRVIYTEFVNAVTQRPKEMQLLPIQPA----QADGAHTHVEYIYEPSPERVLDTLVPRYAETMFYQLMLESKASEHGARMTAMGNATDNAEEMIAKLTLAYNRARQAAITREISEIVGGA 283
>gi|16801735|ref|NP_472003.1| F0F1 ATP synthase subunit gamma [Listeria innocua Clip11262] >gi|16804568|ref|NP_466053.1| F0F1 ATP synthase subunit gamma [Listeria monocytogenes EGD-e] >gi|46908702|ref|YP_015091.1| F0F1 ATP synthase subunit gamma [Listeria monocytogenes str. 4b F2365] >gi|47094109|ref|ZP_00231833.1| ATP synthase F1, gamma subunit [Listeria monocytogenes str. 4b H7858] >gi|47096953|ref|ZP_00234529.1| ATP synthase F1, gamma subunit [Listeria monocytogenes str. 1/2a F6854] >gi|153184894|ref|ZP_01935542.1| ATP synthase F1, gamma subunit [Listeria monocytogenes J0161] >gi|153197164|ref|ZP_01941434.1| ATP synthase F1, gamma subunit [Listeria monocytogenes 10403S] >gi|167015618|ref|ZP_02278151.1| F0F1 ATP synthase subunit gamma [Listeria monocytogenes FSL J1-194] >gi|167213169|ref|ZP_02283476.1| F0F1 ATP synthase subunit gamma [Listeria monocytogenes LO28] >gi|167218319|ref|ZP_02287955.1| F0F1 ATP synthase subunit gamma [Listeria monocytogenes FSL J1-175] >gi|167405357|ref|ZP_02310114.1| F0F1 ATP synthase subunit gamma [Listeria monocytogenes FSL J2-003] >gi|81698746|sp|Q71WP8|ATPG_LISMF ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|81706550|sp|Q7ANV0|ATPG_LISIN ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|81774205|sp|Q927W3|ATPG_LISMO ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|16412018|emb|CAD00608.1| atpG [Listeria monocytogenes] >gi|16415210|emb|CAC97900.1| atpG [Listeria innocua] >gi|46881974|gb|AAT05268.1| ATP synthase F1, gamma subunit [Listeria monocytogenes str. 4b F2365] >gi|47014663|gb|EAL05620.1| ATP synthase F1, gamma subunit [Listeria monocytogenes str. 1/2a F6854] >gi|47017516|gb|EAL08325.1| ATP synthase F1, gamma subunit [Listeria monocytogenes str. 4b H7858] >gi|126942406|gb|EBA20145.1| ATP synthase F1, gamma subunit [Listeria monocytogenes J0161] >gi|127633215|gb|EBA22632.1| ATP synthase F1, gamma subunit [Listeria monocytogenes 10403S] (290 aa)
Score = 324, Expect = 2.6e-28, Identities = 95/283 (33%), Positives = 164/283 (57%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEE-GKTIWLAFFSSMGLCGSFNLNIVKEL-----QKHIKSND-EIWLIGKKGKNLIKSKGIEAEISLDLE-LDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MASL +IK+RI     TS+IT AM++VS+AKL + +    +   Y  K  D+ T++ S  +S    +  S    +T ++   S  GL GS+N +++KE+     +KH  S++  I  +G+  ++  K++  +  + L+++ + D  I F     IA N +  ++ D     + + Y+  +NS+S       LLPL +  EK + +   +   +  +P+  ++ E +L  Y+ + I GA++++K  E+A+R  AM SAT NA++LI +  L++NR RQ+ ITQEITEIV GA
  S:     1 MASLIDIKQRITSTRKTSQITKAMQMVSAAKLGRAESNARSYEPYVSKIKDVVTHVASTGNSSDHPMLVSRPVHRTGYIVLTSDTGLAGSYNSSVIKEVFQEINKKHTSSDEYAIITVGRSARDFFKAR--QMNVVLEVQGITDHPI-FAEIKDIASNTVQMFE-DGVYDEVFIYYNHHINSISSELRKEQLLPLTEFHEKGK-ETDVDLTTYEFEPSEQEILEVLLPQYVESLIFGALLDAKAAEHAARMTAMRSATDNASDLISDLSLQYNRARQAAITQEITEIVGGA 286
>gi|1929512|gb|AAB51465.1| ATP synthase subunit gamma (282 aa)
Score = 324, Expect = 2.7e-28, Identities = 87/283 (30%), Positives = 152/283 (53%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEGKTI-WLAFFSSMGLCGSFNLNIVKELQKHIKSNDE---IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHI--IAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA + ++K+RI+ ++ST  IT AMK+V++AKL+K +        Y  K  ++   + +  D E   L  + E K   ++   +  GL G +N N+++  ++ ++       +  +G+KG++  + + +E   S      D   N +L     +A  L+  Y  +  +  + +I ++F + +   P V  LLP    I  PR +K + G D+  +P+   V   +L  Y    ++ A++E+K  E+ +R  AMD+ATKNA E+I  + L FNR RQ+ IT EI EIV+GA
  S:     1 MAHMRDLKRRIRSVQSTQHITRAMKMVAAAKLRKAQAQVTAGRPYAAKLEEVVGRLMAAVDPETQPLAATREVKKAGYVLITADRGLAGGYNANLIRLTEERLREEGRPAALVAVGRKGRDFFRRRPVEIVKSFT----DIGDNPELIQARELARQLVTMYL-EGTLDEVNLINTRFYSPIRQVPMVERLLP----IATPR-EKKDTG-DYIYEPSPEGVLRVLLPRYCEIKVYRALLEAKASEHGARMTAMDNATKNAAEMIDKFTLSFNRARQAAITNEIVEIVAGA 278
>gi|160872265|ref|ZP_02062397.1| ATP synthase F1, gamma subunit [Rickettsiella grylli] >gi|159121064|gb|EDP46402.1| ATP synthase F1, gamma subunit [Rickettsiella grylli] (286 aa)
Score = 324, Expect = 2.8e-28, Identities = 92/285 (32%), Positives = 164/285 (57%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIK------SNDEIWLIGKKGKNLIKSKG--IEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           M+   EI+ +I  I+ T KIT AM++V+++K++K ++       Y  K  DL  ++  S+++ +   L+  E  ++ +L   +  GLCG  N N++K + +  +       + ++ +IG KG+   K  G  I A+ S    L D     DL  +I + LL  YK +  + S+ + Y++F+N+++      SLLP+  + EK  +   N   D+  +P+A  + E +L  Y+ + ++ ++VE+  CE A+R  AM SAT NA ELI + +L +N+ RQ+ IT+E+ EIV+GA+ 
  S:     1 MSFAQEIRGKISSIKGTQKITRAMEMVAASKMRKAQDRMTLSRPYAHKMLDLVNHVASSHAEYKHPYLQMRELKRSGFLIITTDKGLCGGLNTNLLKLVLQEFRICQSKGMDVDLAIIGGKGEAFFKRVGGHIVAQAS---HLGDTPQLHDLIGVI-KVLLDAYKQN-KLDSVTIFYNEFINTMTQKAQKLSLLPILPS-EKSEI---NYRWDYLYEPDAKPLLELVLTRYIESQVYQSVVENTACEQAARMVAMKSATDNAGELINDLQLAYNKARQAAITKELAEIVAGAEA 285
>gi|116873894|ref|YP_850675.1| F0F1 ATP synthase subunit gamma [Listeria welshimeri serovar 6b str. SLCC5334] >gi|123458707|sp|A0ALL4|ATPG_LISW6 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|116742772|emb|CAK21896.1| atpG [Listeria welshimeri serovar 6b str. SLCC5334] (290 aa)
Score = 323, Expect = 2.9e-28, Identities = 95/283 (33%), Positives = 164/283 (57%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEE-GKTIWLAFFSSMGLCGSFNLNIVKEL-----QKHIKSND-EIWLIGKKGKNLIKSKGIEAEISLDLE-LDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MASL +IK+RI     TS+IT AM++VS+AKL + +    +   Y  K  D+ T++ S  +S    +  S    +T ++   S  GL GS+N +++KE+     +KH  S++  I  +G+  ++  K++  +  + L+++ + D  I F     IA N +  ++ D     + + Y+  +NS+S       LLPL +  EK + +   +   +  +P+  ++ E +L  Y+ + I GA++++K  E+A+R  AM SAT NA++LI +  L++NR RQ+ ITQEITEIV GA
  S:     1 MASLIDIKQRITSTRKTSQITKAMQMVSAAKLGRAESNARSYEPYVSKIKDVVTHVASTGNSNDHPMLVSRPVHRTGYIVLTSDTGLAGSYNSSVIKEVFQEINKKHTSSDEYAIITVGRSARDFFKAR--QMNVVLEVQGITDHPI-FAEIKDIASNTVQMFE-DGVYDEVFIYYNHHINSISSELRKEQLLPLTEFHEKGK-EADVDLTTYEFEPSEQEILEVLLPQYVESLIFGALLDAKAAEHAARMTAMRSATDNASDLISDLSLQYNRARQAAITQEITEIVGGA 286
>gi|83952824|ref|ZP_00961554.1| ATP synthase subunit C [Roseovarius nubinhibens ISM] >gi|83835959|gb|EAP75258.1| ATP synthase subunit C [Roseovarius nubinhibens ISM] (295 aa)
Score = 323, Expect = 3.2e-28, Identities = 92/285 (32%), Positives = 166/285 (58%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKS---NSDSEILSLKKSEEGKTIWLAFFSS-MGLCGSFNLNIVK----ELQKHIKSND--EIWLIGKKGKNLIKSKGIEAEISLDLELDD-KDINFDLFHIIAENLLAKYK-NDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           M SL ++K RI+ ++ST KIT AM++V++AKL++ ++       Y ++F  +   + +   +SDS    L+ +   +   L   ++  GLCG FN NIVK    E QK +      +I  +GKKG++ +K +   A     ++L + K++ +     IA ++LA++   ++++   K+ +S+F N +S  P++  ++P D A  +   +    G  +  +P+   +   +L   +AT I  A++E+   E  +R +AMD+AT+NA E+I    +EFNR RQ+ IT E+ EI+SGA+ 
  S:     1 MPSLKDLKNRIESVKSTRKITKAMQMVAAAKLRRAQDAAEQSRPYTERFNAVMAKLAASVGDSDSAPRLLRGTGSDQVQLLVVLTAERGLCGGFNTNIVKRAKVEAQKLLAEGKTVKILTVGKKGRDALKRE-YSAHFVGHVDLSEVKNLGYGDAQSIAADILARFDAGEFDVA--KIFFSRFENVVSQVPTMQQVIPADVAEAEAGDEDAAAGVVYDYEPSEEAILADLLPRGVATAIFSALLENGASEQGARMSAMDNATRNAGEMIDKLTIEFNRSRQAVITNELIEIISGAEA 294
>gi|170718140|ref|YP_001785169.1| ATP synthase F1, gamma subunit [Haemophilus somnus 2336] >gi|189081458|sp|B0UWG6|ATPG_HAES2 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|168826269|gb|ACA31640.1| ATP synthase F1, gamma subunit [Haemophilus somnus 2336] (289 aa)
Score = 323, Expect = 3.3e-28, Identities = 93/283 (32%), Positives = 160/283 (56%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDE------IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  ++ST KIT AM++V+++K++K ++   +   Y K    + ++I K+N D +   L + E      L   +  GLCG  N+N+ K     IK+  E      + LIG KG    +S G++ +      + D  +  +L  I A  +   YK +  I +I V Y+KF+N++S  P +  L+PL + ++   L K ++  ++  +PN   + +S+L+ YL + ++ A+VE+   E A+R  AM +AT NA  LI + +L +N+ RQ+ IT E+ EIV+GA
  S:     1 MAGAKEIRTKISSVQSTQKITKAMEMVAASKMRKTQDRMSSSRPYSKAIQGVISHISKANIDYQHPFLIEREVKNVGILIISTDRGLCGGLNVNLFKTALSEIKNWKEQNVDVSLGLIGAKGIGFFQSLGLKIKAQHS-GMGDTPVAEELIGI-ANRMFEAYK-EGKIDAIYVTYNKFINTMSQKPIMEKLVPLPE-LDNDSLGKNSDNWEYIYEPNPQTLLDSLLVRYLESQVYQAVVENLASEQAARMVAMKAATDNAGNLINDLQLVYNKARQASITNELNEIVAGA 286
>gi|163745699|ref|ZP_02153059.1| F0F1 ATP synthase subunit gamma [Oceanibulbus indolifex HEL-45] >gi|161382517|gb|EDQ06926.1| F0F1 ATP synthase subunit gamma [Oceanibulbus indolifex HEL-45] (293 aa)
Score = 323, Expect = 3.4e-28, Identities = 96/285 (33%), Positives = 163/285 (57%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSN---SDSEILSLKKSEEGKTIWLAFFSS-MGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKN-LIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKN-DYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGAD--FSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           M +L ++K RI  ++ST KIT AM++V++AKL++ +E       Y ++F  +   + ++   SDS    L  + E K   L   ++  GLCG FN NI K+ + H +         +I  +GKKG++ L +  G      +DL  D K I +     IA+++L ++   ++++ +I   Y+KFVN +  TP+   ++P     E    D  ++GA   F  +P+   V   +L   +AT I  A++E+   E  +R +AMD+AT+NA E+I    +++NR RQ+ IT E+ EI+SGA+ 
  S:     1 MPNLKDLKNRIASVKSTRKITKAMQMVAAAKLRRAQEAAEASRPYTERFNAVMAGLAASVGGSDSAPKLLSGTGEDKVHLLVVMTAERGLCGGFNSNIAKKAKAHARELLAQGKEVKILTVGKKGRDALRRDMGNLLVGHVDLS-DVKKIGYGDAQKIAQDVLNRFDGGEFDVATI--FYAKFVNVVMQTPTAQQIIPAKFEAE----DGEDSGASTLFDYEPSEEAVLADLLPRGVATAIFSALLENGASEQGARMSAMDNATRNAGEMIDKLTIQYNRSRQAVITNELIEIISGAEA 292
>gi|195977926|ref|YP_002123170.1| ATP synthase gamma chain AtpG [Streptococcus equi subsp. zooepidemicus str. MGCS10565] >gi|195974631|gb|ACG62157.1| ATP synthase gamma chain AtpG [Streptococcus equi subsp. zooepidemicus str. MGCS10565] (291 aa)
Score = 323, Expect = 3.5e-28, Identities = 97/282 (34%), Positives = 157/282 (55%)
  Q:     2 ASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFT-YIKSN----SDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKEL-----QKHIKSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
            SL+EIK +I   E TSKIT+AM++VSSAKL K ++   +  IY  K   + T  +KS+    SD+ +L  +  +  KT ++   S  GL G +N  I+K +     + H   + EI  IG  G +  K++G+     L    D    +FD    I    +  + N+     + V Y+  VNSL+    V  +LP+   + +   ++   G  F ++PN + + E +L  +  + I+GAI+++K  E+A+   AM +AT NA  +I +  +++NR RQ+ ITQEITEIV+GA
  S:     3 GSLSEIKAKIISTEKTSKITSAMRMVSSAKLVKSEQAARDFQIYASKIRQITTDLLKSDLTTGSDNPMLVSRPVK--KTGYIVITSDKGLVGGYNSKILKSIMDMIQEYHAAGDYEIISIGSIGSDFFKARGMNVAFELRGLADQP--SFDQVGRIISQSVDMFVNEI-FDELYVCYNHHVNSLTSQVRVQRMLPISDLVAEEAAEEGVTG--FELEPNRHVILEQLLPQFTESLIYGAIIDAKTAEHAAGMTAMQTATDNAKHVINDLTIQYNRARQAAITQEITEIVAGA 287
>gi|90415393|ref|ZP_01223327.1| ATP synthase subunit C [marine gamma proteobacterium HTCC2207] >gi|90332716|gb|EAS47886.1| ATP synthase subunit C [marine gamma proteobacterium HTCC2207] (286 aa)
Score = 323, Expect = 3.5e-28, Identities = 90/283 (31%), Positives = 164/283 (57%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILS--LKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   E+K +I  I ST KIT+AM++V+++K+++ ++       Y ++  D+  +I +N+ SE     L++ +  +  ++   +  GLCG  N+N+ K   K +K         +I ++G K      S G     ++  ++ D+    DL  I    ++    ++  I  + V+ ++FVN+++ +PSV  LLPL  A +  RL    +  D+  +P+A ++ + +LI Y+ + ++  +VE+K CE A+R  AM +AT+NA E+I   +L +N+ RQ+ ITQE++EIVSGA
  S:     1 MAIGKEVKTKIASIGSTQKITSAMEMVAASKMRRAQDRMALGKPYAQRIRDVVGHI-ANAVSEYKHQYLEERDVKRVAYVVISTDRGLCGGLNINLFKAALKSMKGWTDQGVEVDICVVGNKAAGFFSSVGGNVVAAVK-DVGDEPNAADL--IGGVKVMLDAYDEGRIDRLFVVSNEFVNTMTQSPSVEQLLPL-AANDDTRL---KHHWDYIYEPDAKELLDGLLIRYIESQVYQGVVENKACEQAARMLAMKNATENAGEMIDELQLLYNKARQAAITQELSEIVSGA 283
>gi|160881855|ref|YP_001560823.1| ATP synthase F1, gamma subunit [Clostridium phytofermentans ISDg] >gi|160430521|gb|ABX44084.1| ATP synthase F1, gamma subunit [Clostridium phytofermentans ISDg] (291 aa)
Score = 323, Expect = 3.6e-28, Identities = 96/283 (33%), Positives = 158/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYD-LFTYIKSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVK-ELQKHIKSNDEI-WLIGKKGKNLIKSKGIEAEISLDL-ELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGAD----FSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MAS+ +IK+R + I+ST +IT AMKLVS+ KL+K K    N   Y+   YD +   ++ + +     L   +  K   +   S+ GL G +N NI+K  +   I   D + + +G+KGK  +  +G    I+ D  E+ +  I  D   I  + +L  +  D  +  I + Y+ F N++S  P++  LLP+D        +K  +  +     + +P A +    I+  Y+ + I+GA+V++   EN +R  AMDSAT NA ++I +  L++NR RQS ITQE+TEI++GA
  S:     1 MASMRDIKRRKESIQSTGQITKAMKLVSTVKLQKAKSKAENAKPYFDHMYDTVLNMLRKSGNISHPYLSAGKSNKKAIIVITSNRGLAGGYNSNILKLVMSSDINKEDAVVYAVGRKGKEALARRGYH--IAKDYSEVMNAPIYKDAIEI-GKAVLDAFVAD-EVGEIYLAYTSFKNTVSHEPTLIKLLPVDMEAALQEGEKSEDLNERLTLMNYEPAAEEALNLIIPKYINSLIYGALVQALASENGARMQAMDSATNNAEDMISDLSLKYNRARQSSITQELTEIIAGA 287
>gi|189499278|ref|YP_001958748.1| ATP synthase F1, gamma subunit [Chlorobium phaeobacteroides BS1] >gi|189494719|gb|ACE03267.1| ATP synthase F1, gamma subunit [Chlorobium phaeobacteroides BS1] (295 aa)
Score = 322, Expect = 3.7e-28, Identities = 91/285 (31%), Positives = 158/285 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSL--KKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSND---------EIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           MA+L +I+ RI+ I ST ++T AMK+VS+AKL++ ++  +    Y  K  ++   + +  D+ +  L   + E    + +   S  GLCG+FN NI+K  QK +             E+   G KG +  + +G    IS       ++++F +   IAE    +Y     +  + V+Y++F + L+       LLP+    EK   +K  +  D+  +P+ + + + ++  +L T I   ++ES   E+ASR  AMDSAT+NA EL++  K+ +NR RQ+ IT E++EIV+GA+ 
  S:     1 MATLKDIRTRIQSIASTQQVTKAMKMVSAAKLRRAQDSAIQARPYAAKLKEMLGSLSTRVDTTLNPLLSDRDEVKNVLVVVITSDRGLCGAFNANIIKIAQKVVTEEHGDLYRDGKVEMLCAGSKGNDYFRKRGFS--ISKAYPGLFQNLHFSVAREIAEYASERYLKG-EVDKVVVVYNEFKSVLAPVLKSEVLLPITP--EKVEGEKTGSSIDYIYEPSPSAIIDVLVPKHLNTQIWRMMLESNAAEHASRMTAMDSATENAKELMRVLKISYNRARQAAITTELSEIVAGAEA 291
>gi|81096629|ref|ZP_00874966.1| H+-transporting two-sector ATPase, gamma subunit [Streptococcus suis 89/1591] >gi|146318827|ref|YP_001198539.1| F0F1 ATP synthase subunit gamma [Streptococcus suis 05ZYH33] >gi|146321036|ref|YP_001200747.1| F0F1 ATP synthase subunit gamma [Streptococcus suis 98HAH33] >gi|166224116|sp|A4W1V8|ATPG_STRS2 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|166224118|sp|A4VVK0|ATPG_STRSY ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|80977308|gb|EAP40854.1| H+-transporting two-sector ATPase, gamma subunit [Streptococcus suis 89/1591] >gi|145689633|gb|ABP90139.1| F0F1-type ATP synthase, gamma subunit [Streptococcus suis 05ZYH33] >gi|145691842|gb|ABP92347.1| F0F1-type ATP synthase, gamma subunit [Streptococcus suis 98HAH33] (292 aa)
Score = 322, Expect = 3.8e-28, Identities = 100/282 (35%), Positives = 155/282 (54%)
  Q:     2 ASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSN----SDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHI------KSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGAD-----FSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
            SLNEIK +I   + TS+IT AM++VS++KL K ++L  +  IY  K   + T +       SD+    L +    K+ ++   S  GL GS+N +I+K +   I      K   EI  IG  G +  +++GI     L    D+   +F+    I    +  YKN+     + V Y+  VNSL+    V  +LP++        D  +N AD     F ++PN   + E +L  Y  + I+GAI+++K  ENA+   AM +AT NA  +I +  +++NR RQ+ ITQEITEIV+GA
  S:     3 GSLNEIKSKIASTKKTSQITGAMQMVSASKLAKSEQLAQSFQIYASKVRQITTDLLRGELMASDTSNPMLIRRPVQKSGYIVITSDSGLKGSYNSSILKAVMGMIEQDHDSKDEYEIIAIGSMGADFFRARGINPVFELRGLADNP--SFEEVQKIISKSVEMYKNEL-FDELYVCYNHHVNSLTSQVRVQQMLPVE--------DLDHNEADGYTATFELEPNREVILEQLLTQYAESTIYGAILDAKTAENAAGMTAMQTATDNAKNVINDLTIQYNRARQAAITQEITEIVAGA 288
>gi|121999209|ref|YP_001003996.1| ATP synthase F1, gamma subunit [Halorhodospira halophila SL1] >gi|166215098|sp|A1WZT2|ATPG_HALHL ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|121590614|gb|ABM63194.1| ATP synthase F1, gamma subunit [Halorhodospira halophila SL1] (289 aa)
Score = 322, Expect = 4.0e-28, Identities = 88/285 (30%), Positives = 160/285 (56%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTI-WLAFFSSMGLCGSFNLNIVKELQKHIKSNDE------IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIA--ENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           MA   E+K +IK +++T KIT+AM++V+++K+++ +E       Y +K   +  ++  +N D     L + +E K + ++   +  GLCG  N+N+ K     +K   E      +  IG KG    +  G+E    +  E+ D      L  +I   + LL  Y  D  I  + ++ ++FVN+++  P V  L+P++   E+  L+      D+  +P+A  + + +L  Y+ + ++  +VE+  CE A+R  AM SA+ NA E+I + ++ +N+ RQ+ ITQE+TEIVSGA+ 
  S:     1 MAGAKEVKTKIKSVQNTQKITSAMEMVAASKMRRAQERMEATRPYAEKIRQVIGHLGHANPDYRHPFLVERDEVKRVGYIVVSTDRGLCGGLNVNLFKAAINDLKGWQEQGVGAQVVPIGAKGIGFFERTGVE----IPAEVRDIGDRPKLEQMIGPIKVLLDAYV-DGTIDRVNLVSNQFVNTMTQRPQVQRLIPVEPVREEEMLEN----WDYIYEPDAASLLDDVLRRYVESQVYQGVVENIACEMAARMIAMKSASDNAAEIIDDLQITYNKARQAAITQELTEIVSGAEA 286
>gi|113461833|ref|YP_719902.1| F0F1 ATP synthase subunit gamma [Haemophilus somnus 129PT] >gi|123327496|sp|Q0I5X2|ATPG_HAES1 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|112823876|gb|ABI25965.1| ATP synthase, F1 subunit gamma [Haemophilus somnus 129PT] (289 aa)
Score = 322, Expect = 4.1e-28, Identities = 96/283 (33%), Positives = 162/283 (57%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDE------IWLIGKKGKNLIKSKG--IEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  ++ST KIT AM++V+++K++K ++   +   Y K    + ++I K+N D +   L + E      L   +  GLCG  N+N+ K     IK+  E      + LIG KG    +S G  I+A+ S    + D  +  +L  I A  +   YK +  I +I V Y+KF+N++S  P +  L+PL + ++   L K ++  ++  +PN   + +S+L+ YL + ++ A+VE+   E A+R  AM +AT NA  LI + +L +N+ RQ+ IT E+ EIV+GA
  S:     1 MAGAKEIRTKISSVQSTQKITKAMEMVAASKMRKTQDRMSSSRPYSKAIQGVISHISKANIDYQHPFLIEREVKNVGILIISTDRGLCGGLNVNLFKTALSEIKNWKEQNVEVSLGLIGAKGIGFFQSLGLNIKAQHS---GMGDTPVAEELIGI-ANRMFEAYK-EGKIDAIYVTYNKFINTMSQKPIMEKLVPLPE-LDNDSLGKNSDNWEYIYEPNPQTLLDSLLVRYLESQVYQAVVENLASEQAARMVAMKAATDNAGNLINDLQLVYNKARQASITNELNEIVAGA 286
>gi|158321581|ref|YP_001514088.1| ATP synthase F1, gamma subunit [Alkaliphilus oremlandii OhILAs] >gi|158141780|gb|ABW20092.1| ATP synthase F1, gamma subunit [Alkaliphilus oremlandii OhILAs] (289 aa)
Score = 322, Expect = 4.2e-28, Identities = 87/282 (30%), Positives = 157/282 (55%)
  Q:     4 LNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSD--SEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDEIWLI--GKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLD-KAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           + +IK+RIK + ST +IT AM+LV+S+K+KK +E       Y+    D  + I SNS   S      +     T ++   +  GL G +N N++K   +H+   +++ +I  G+K ++  K +  +  +S +     ++  +     I    L  YK    +  + ++Y++F++++S+ P V  LLPL+ + IE    +K  +    S +P+   V   ++  Y+ + I+GA++ES     ++ + AM++AT NA E+I   +L++NR RQ+ ITQEITEIV GA+ 
  S:     6 MRDIKRRIKSVNSTKQITKAMELVASSKMKKARERLETTRPYFHAVRDAVSDIVSNSKGVSNTFITPRETIKNTGYIVISADRGLAGGYNANVIKAAMQHMSQKEQVSVITIGQKARDFFKKR--KYNLSGEFHHISENPQYSDAQSIGRLSLDLYKQGL-VDEVYLVYTEFLSTISYNPKVIKLLPLEPEKIENQ--EKSGSRELMSYEPSPEVVLSYLIPKYIDSSIYGALIESSASYQSATKVAMENATDNAEEMIDKLQLQYNRARQASITQEITEIVGGAEA 287
>gi|77407958|ref|ZP_00784708.1| ATP synthase F1, gamma subunit [Streptococcus agalactiae COH1] >gi|77173416|gb|EAO76535.1| ATP synthase F1, gamma subunit [Streptococcus agalactiae COH1] (293 aa)
Score = 322, Expect = 4.4e-28, Identities = 98/282 (34%), Positives = 158/282 (56%)
  Q:     2 ASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-----KSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIK----SNDE--IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
            SL+EIK +I   E TSKIT+AM++VSSAKL K ++   +  +Y  K   + T +      S SD+ +L+ +  +  KT ++   S  GL G +N  I+K +   I      ND+  I  IG  G +  K++G+   +S +L   +   +FD    I    +  YKN+     + V Y+  VNSL+    +  +LP+ K ++     +      F ++PN   + E +L  Y  + I+GAI+++K  E+A+   AM +AT NA  +I +  +++NR RQ+ ITQEITEIV+GA
  S:     3 GSLSEIKDKILSTEKTSKITSAMQMVSSAKLVKSEQAARDFQVYASKIRQITTNLLKSDLVSGSDNPMLASRPVK--KTGYIVITSDKGLVGGYNSKILKAMMDTITDYHTENDDYAIISIGSVGSDFFKARGMN--VSFELRGLEDQPSFDQVGKIIAQAVEMYKNEL-FDELYVCYNHHVNSLTSQVRMQQMLPI-KELDAEEASEDRVITGFELEPNREVILEQLLPQYTESLIYGAIIDAKTAEHAAGMTAMQTATDNAKNVINDLTIQYNRARQAAITQEITEIVAGA 289
>gi|50083468|ref|YP_044978.1| F0F1 ATP synthase subunit gamma [Acinetobacter sp. ADP1] >gi|81695969|sp|Q6FFK1|ATPG_ACIAD ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|49529444|emb|CAG67156.1| membrane-bound ATP synthase , F1 sector, gamma-subunit [Acinetobacter sp. ADP1] (289 aa)
Score = 322, Expect = 4.5e-28, Identities = 85/283 (30%), Positives = 157/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTY-IKSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDE------IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA+L EI+ ++  I+ST KIT AM++V+++K+++ +E       Y      +  + +++N + +   +      +  ++   S  GL G  N+N+ K++ +H+K+  E        LIG+K  +  K+ G +  +    +L D      L   +   L A  K +  +  I ++ + FVN+++  P V  L+PL  A E   L++   G D+  +P A  +   +L+ Y+ + ++  ++E+  CE ++R  AM +AT NA +LIK+ +L +N+ RQ+ ITQEI+EIV GA
  S:     1 MANLKEIRAKVASIKSTQKITRAMQMVAASKMRRAQERMAQGRPYADNMRRVIAHLVQANPEYKHRYMVDRPVKRVGYIVVSSDRGLAGGLNINLFKKVVQHVKAQREQSIEVEFALIGQKAVSFFKNYGGKV-LGATTQLGDAPSLEQLTGSVQVMLDAFDKGE--LDRIYLVSNGFVNAMTQQPKVEQLVPLAPAAEGDDLNR-TYGWDYIYEPEAEQLLNGLLVRYIESMVYQGVIENVACEQSARMVAMKAATDNAGQLIKDLQLIYNKLRQAAITQEISEIVGGA 286
>gi|25010935|ref|NP_735330.1| F0F1 ATP synthase subunit gamma [Streptococcus agalactiae NEM316] >gi|77414108|ref|ZP_00790276.1| ATP synthase F1, gamma subunit [Streptococcus agalactiae 515] >gi|81744546|sp|Q8E5U9|ATPG_STRA3 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|23095314|emb|CAD46524.1| H+-transporting ATP synthase gamma chain [Streptococcus agalactiae NEM316] >gi|77159860|gb|EAO71003.1| ATP synthase F1, gamma subunit [Streptococcus agalactiae 515] (293 aa)
Score = 322, Expect = 4.5e-28, Identities = 98/282 (34%), Positives = 158/282 (56%)
  Q:     2 ASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-----KSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIK----SNDE--IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
            SL+EIK +I   E TSKIT+AM++VSSAKL K ++   +  +Y  K   + T +      S SD+ +L+ +  +  KT ++   S  GL G +N  I+K +   I      ND+  I  IG  G +  K++G+   +S +L   +   +FD    I    +  YKN+     + V Y+  VNSL+    +  +LP+ K ++     +      F ++PN   + E +L  Y  + I+GAI+++K  E+A+   AM +AT NA  +I +  +++NR RQ+ ITQEITEIV+GA
  S:     3 GSLSEIKDKILSTEKTSKITSAMQMVSSAKLVKSEQAARDFQVYASKIRQITTNLLKSDLVSGSDNPMLASRPVK--KTGYIVITSDKGLVGGYNSKILKAMMDTITDYHTENDDYAIISIGSVGSDFFKARGMN--VSFELRGLEDQPSFDQVGKIIAQAVEMYKNEL-FDELYVCYNHHVNSLTSQVRMQQMLPI-KELDADEASEDRVITGFELEPNREVILEQLLPQYTESLIYGAIIDAKTAEHAAGMTAMQTATDNAKNVINDLTIQYNRARQAAITQEITEIVAGA 289
>gi|168266762|ref|ZP_02688727.1| F0F1 ATP synthase subunit gamma [Listeria monocytogenes FSL J2-071] (290 aa)
Score = 321, Expect = 5.3e-28, Identities = 95/283 (33%), Positives = 163/283 (57%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEE-GKTIWLAFFSSMGLCGSFNLNIVKEL-----QKHIKSND-EIWLIGKKGKNLIKSKGIEAEISLDLE-LDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MASL +IK+RI     TS+IT AM++VS+AKL + +    +   Y  K  D+ T++ S  +S    +  S    +T ++   S  GL GS+N +++KE+     +KH  S++  I  +G+  ++  K++  +  + L+++ + D  I F     IA N +  ++ D     + + Y+  +NS+S       LLPL +  EK   +   +   +  +P+  ++ E +L  Y+ + I GA++++K  E+A+R  AM SAT NA++LI +  L++NR RQ+ ITQEITEIV GA
  S:     1 MASLIDIKQRITSTRKTSQITKAMQMVSAAKLGRAESNARSYEPYVSKIKDVVTHVASTGNSSDHPMLVSRPVHRTGYIVLTSDTGLAGSYNSSVIKEVFQEINKKHTSSDEYAIITVGRSARDFFKAR--QMNVVLEVQGITDHPI-FAEIKDIASNTVQMFE-DGVYDEVFIYYNHHINSISSELRKEQLLPLTEFHEKGN-ETDVDLTTYEFEPSEQEILEVLLPQYVESLIFGALLDAKAAEHAARMTAMRSATDNASDLISDLSLQYNRARQAAITQEITEIVGGA 286
>gi|157377617|ref|YP_001476217.1| F0F1 ATP synthase subunit gamma [Shewanella sediminis HAW-EB3] >gi|189081478|sp|A8G1W6|ATPG_SHESH ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|157319991|gb|ABV39089.1| H(+)-transporting two-sector ATPase [Shewanella sediminis HAW-EB3] (286 aa)
Score = 321, Expect = 5.5e-28, Identities = 83/283 (29%), Positives = 161/283 (56%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNS-DSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDEIWL------IGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA+  EIK +I  +++T KIT+AM++V+++K++K ++       Y +    +  ++   S + +   L+  E  +  ++   +  GLCG  N+N+ K++   +KS  E  +      IG +      S G +   +    L D     DL   +   ++ +  N+  +  + V++++FVN++S TP +  LLPL K+     +D+ ++  D+  +P+  ++ E++L+ Y+ + ++  +VE+   E A+R  AM SAT NA +LI + +L +N+ RQ+ ITQE++EIV+GA
  S:     1 MANAKEIKTKIASVKNTQKITSAMEMVAASKMRKAQDRMAASRPYAENMRKVIGHVAQGSLEYKHPYLEVREAKRVGYIVVSTDRGLCGGLNVNLFKKVVADVKSQREQGVEVEFCPIGARSVQFFNSFGGQVS-AYASGLGDAPKLADLIGTV--RVMLQAYNEGKLDRLYVVFNRFVNTMSQTPVIEQLLPLPKS----EVDEVSHHWDYLYEPDPKELLETLLVRYVESQVYQGVVENLASEQAARMVAMKSATDNAGDLISDLQLVYNKARQAAITQELSEIVAGA 283
>gi|170729217|ref|YP_001763243.1| ATP synthase F1, gamma subunit [Shewanella woodyi ATCC 51908] >gi|169814564|gb|ACA89148.1| ATP synthase F1, gamma subunit [Shewanella woodyi ATCC 51908] (286 aa)
Score = 321, Expect = 5.8e-28, Identities = 86/283 (30%), Positives = 162/283 (57%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNS-DSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKEL------QKHIKSNDEIWLIGKKGKNLIKSKG--IEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA+  EIK +I  +++T KIT+AM++V+++K++K ++   +   Y +    +  ++   S + +   L+  E  +  ++   +  GLCG  N+N+ K++      Q+   +  E   IG +      S G  + A  S    L D     DL   +   ++ +  N+  +  + V+++KFVN++S TP +  LLPL K+ E    D+ ++  D+  +P+  ++ +++L+ Y+ + ++  +VE+   E A+R  AM +AT NA ELI + +L +N+ RQ+ ITQE++EIVSGA
  S:     1 MANAKEIKTKIASVQNTQKITSAMEMVAASKMRKAQDRMASSRPYAENMRKVIGHVAQGSLEYKHPYLEVREAKRVGYIVVSTDRGLCGGLNVNLFKKVVADVKKQREAGAEVEFCPIGARSVQFFNSFGGQVSAHAS---GLGDAPKLADLIGTV--RVMLQAYNEGKLDRLYVVFNKFVNTMSQTPVIEQLLPLPKSEE----DEISHHWDYLYEPDPKELLDTLLVRYVESQVYQGVVENIASEQAARMVAMKAATDNAGELISDLELVYNKARQAAITQELSEIVSGA 283
>gi|91795098|ref|YP_564749.1| F0F1 ATP synthase subunit gamma [Shewanella denitrificans OS217] >gi|123060487|sp|Q12HQ0|ATPG_SHEDO ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|91717100|gb|ABE57026.1| ATP synthase F1, gamma subunit [Shewanella denitrificans OS217] (286 aa)
Score = 321, Expect = 6.1e-28, Identities = 84/283 (29%), Positives = 158/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNS-DSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIK------SNDEIWLIGKKGKNLIKSKG--IEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EIK +I  +++T KIT+AM++V+++K+++ +E       Y +    +  ++   S + +   L+  E  +  ++   +  GLCG  N+N+ K++   +K      +  E   IG +     KS G  + A  S    L D     DL   +   ++ +  N+  +  + V+++KFVN+++ TP +  LLPL K+ +    D   N  D+  +P+  ++ E++L+ Y+ + ++  ++E+   E A+R  AM +AT NA ++I   +L +N+ RQ+ ITQE++EIVSGA
  S:     1 MAGAKEIKTKIASVKNTQKITSAMEMVAASKMRRAQERMAASRPYAESMRKVIGHVAQGSLEFKHPYLEVREAKRVGYIVVATDRGLCGGLNVNLFKKVTLDVKNWKAQGAEVEFCPIGARSVQFFKSFGGQVSAHAS---GLGDAPKLADLIGTV--RVMLQAYNEGKLDRLYVVFNKFVNTMAQTPVIEQLLPLPKSAD----DVKTNRWDYIYEPDPKEILETLLVRYVESQVYQGVIENLASEQAARMVAMKAATDNAGDMIDGLQLVYNKARQAAITQELSEIVSGA 283
>gi|169826599|ref|YP_001696757.1| ATP synthase gamma chain [Lysinibacillus sphaericus C3-41] >gi|168991087|gb|ACA38627.1| ATP synthase gamma chain [Lysinibacillus sphaericus C3-41] (285 aa)
Score = 320, Expect = 6.4e-28, Identities = 98/283 (34%), Positives = 158/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNS-DSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHI----KSNDE--IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           M +L EIK RI   +ST +IT AM++VSS+KL++ ++       Y +K  D+   I S + DS    L      KT +L   S  GL G++N +I++++Q+ I    KS DE  I  IG+  ++    +     IS  + L D+    D+  I A N +  +  D     + + Y+ FV++++   +   LLPL        L  P++ A +  +P+   + E +L  Y  + ++GA+++ K  E+ASR  AM +AT NA++LI +  L++NR RQ+ ITQEITEIV GA
  S:     1 MVNLREIKGRINSTKSTKQITKAMQMVSSSKLRRAEQNAKAYVPYMEKIQDVVGAIASGTKDSGHPMLTARPVKKTAYLVIGSDRGLAGAYNSSILRQVQRTIDERHKSKDEYVILAIGRVVRDYFVKRDHNV-ISDVVGLPDQPTFADIKEI-ARNAVGMFI-DGTYDQLYMYYNHFVSAIANEVTEKKLLPLTD------LAPPSSNASYEFEPSGEAILEVLLPQYAESLVYGALLDGKASEHASRMTAMKNATDNASDLISDLSLQYNRARQAAITQEITEIVGGA 281
>gi|15674807|ref|NP_268981.1| F0F1 ATP synthase subunit gamma [Streptococcus pyogenes M1 GAS] >gi|19745846|ref|NP_606982.1| F0F1 ATP synthase subunit gamma [Streptococcus pyogenes MGAS8232] >gi|50913943|ref|YP_059915.1| F0F1 ATP synthase subunit gamma [Streptococcus pyogenes MGAS10394] >gi|56808122|ref|ZP_00365910.1| COG0224: F0F1-type ATP synthase, gamma subunit [Streptococcus pyogenes M49 591] >gi|71903224|ref|YP_280027.1| F0F1 ATP synthase subunit gamma [Streptococcus pyogenes MGAS6180] >gi|71910393|ref|YP_281943.1| F0F1 ATP synthase subunit gamma [Streptococcus pyogenes MGAS5005] >gi|94988265|ref|YP_596366.1| F0F1 ATP synthase subunit gamma [Streptococcus pyogenes MGAS9429] >gi|94990144|ref|YP_598244.1| F0F1 ATP synthase subunit gamma [Streptococcus pyogenes MGAS10270] >gi|94992139|ref|YP_600238.1| F0F1 ATP synthase subunit gamma [Streptococcus pyogenes MGAS2096] >gi|94994060|ref|YP_602158.1| F0F1 ATP synthase subunit gamma [Streptococcus pyogenes MGAS10750] >gi|139474051|ref|YP_001128767.1| F0F1 ATP synthase subunit gamma [Streptococcus pyogenes str. Manfredo] >gi|166224111|sp|Q1JCL4|ATPG_STRPB ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|166224112|sp|Q1JMJ0|ATPG_STRPC ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|166224113|sp|Q1JHN6|ATPG_STRPD ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|166224114|sp|Q1J7G0|ATPG_STRPF ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|166224115|sp|A2RFC3|ATPG_STRPG ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|81679688|sp|Q5XCY1|ATPG_STRP6 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|81706822|sp|Q7CND4|ATPG_STRP8 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|81782495|sp|Q9A0I8|ATPG_STRP1 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|82592652|sp|Q48UD4|ATPG_STRPM ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|13621937|gb|AAK33702.1| putative proton-translocating ATPase, gamma subunit [Streptococcus pyogenes M1 GAS] >gi|19747994|gb|AAL97481.1| putative proton-translocating ATPase, gamma subunit [Streptococcus pyogenes MGAS8232] >gi|50903017|gb|AAT86732.1| ATP synthase gamma chain [Streptococcus pyogenes MGAS10394] >gi|71802319|gb|AAX71672.1| ATP synthase gamma chain [Streptococcus pyogenes MGAS6180] >gi|71853175|gb|AAZ51198.1| ATP synthase gamma chain [Streptococcus pyogenes MGAS5005] >gi|94541773|gb|ABF31822.1| ATP synthase gamma chain [Streptococcus pyogenes MGAS9429] >gi|94543652|gb|ABF33700.1| ATP synthase gamma chain [Streptococcus pyogenes MGAS10270] >gi|94545647|gb|ABF35694.1| ATP synthase gamma chain [Streptococcus pyogenes MGAS2096] >gi|94547568|gb|ABF37614.1| ATP synthase gamma chain [Streptococcus pyogenes MGAS10750] >gi|134272298|emb|CAM30552.1| ATP synthase gamma chain [Streptococcus pyogenes str. Manfredo] (291 aa)
Score = 320, Expect = 6.9e-28, Identities = 96/282 (34%), Positives = 156/282 (55%)
  Q:     2 ASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFT-YIKSN----SDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKEL-----QKHIKSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
            SL+EIK +I   E TSKIT+AM++VSSAKL K ++   +  IY  K   + T  +KS     SD+ +L  +  +  KT ++   S  GL G +N  I+K +     + H   + EI  IG  G +  K++G+     L    D    +F+    I    +  + N+     + V Y+  VNSL+    V  +LP+   +     ++   G  F ++PN +D+ + +L  +  + I+GAI+++K  E+A+   AM +AT NA  +I +  +++NR RQ+ ITQEITEIV+GA
  S:     3 GSLSEIKAKIISTEKTSKITSAMRMVSSAKLVKSEQAARDFQIYASKIRQITTDLLKSELTIGSDNPMLVSRPVK--KTGYIVITSDKGLVGGYNSKILKSVMDMITEYHADGDYEIISIGSVGSDFFKARGMNVAFELRGLADQP--SFEQVRQIISQSVDMFVNEI-FDELYVCYNHHVNSLTSQVRVQQMLPISDLVADEAAEEGVTG--FELEPNRHDILDQLLPQFTESLIYGAIIDAKTAEHAAGMTAMQTATDNAKNVINDLTIQYNRARQAAITQEITEIVAGA 287
>gi|89095630|ref|ZP_01168524.1| F0F1-type ATP synthasegamma chain [Bacillus sp. NRRL B-14911] >gi|89089376|gb|EAR68483.1| F0F1-type ATP synthasegamma chain [Bacillus sp. NRRL B-14911] (286 aa)
Score = 320, Expect = 7.7e-28, Identities = 99/283 (34%), Positives = 156/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIK-SNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKE----LQKHIKSNDE--IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGA---DFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MASL +IK RI   + TS+IT AM++VS+AK+ + +    +   Y +K  ++   I   ++D     L      KT +L   S  GL G++N NI++     +QK  KS+DE  I  IG+ G++  + +G+   + LD+        F     IA   +  + +D     + + YS +V+++    +   LLPL         D  ++G     +  +P+A D+ E +L  Y  + I+GA+++SK  E+A+R  AM SAT NA ELI +  L +NR RQ+ ITQEITEIV GA
  S:     1 MASLRDIKNRITSTKKTSQITKAMQMVSAAKMNRAEMNAKSFVPYMEKIQEVTASIALGSTDVSHPMLTSRPVKKTGYLVITSDRGLAGAYNSNILRTVYQTIQKRHKSSDEYAIIAIGRIGRDFFRKRGMN--VILDIVAVADQPAFAEIKDIASKTVGMF-SDETFDELYIYYSHYVSAIQQDVTEKKLLPLT--------DISSSGGKLTSYEFEPSAEDILEVLLPQYAESLIYGALLDSKASEHAARMTAMQSATDNAKELINSLSLSYNRARQAAITQEITEIVGGA 282
>gi|169335792|ref|ZP_02862985.1| hypothetical protein ANASTE_02217 [Anaerofustis stercorihominis DSM 17244] >gi|169258530|gb|EDS72496.1| hypothetical protein ANASTE_02217 [Anaerofustis stercorihominis DSM 17244] (289 aa)
Score = 320, Expect = 8.1e-28, Identities = 91/283 (32%), Positives = 157/283 (55%)
  Q:     3 SLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSD--SEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDE---IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           ++ +IK+R+K + ST +IT AM+LV+S+KL+K KE  +  S Y    Y L   +   +   + I    +    KTI++      GL G FN N++K+    I    E   I+ +G KG +  K    +  +   + + D D N+ +   I   ++  Y +D +I+ +K+IYSKF + +S      ++LP+ +  +    D     ++  I+P   ++ E ++  Y+ + ++GA++E+   E ASRR AM +AT NANEL++  ++ +N  RQS IT E+ EIVSGA+ 
  S:     4 NMADIKRRMKSVSSTKQITKAMELVASSKLRKAKERAICRSHYTDATYQLMLRVAKYTSYINNIYFKDRENADKTIYVVLSGDKGLAGGFNTNVIKQAVSEIGDEKEKAVIFALGAKGADYFKKNDYDV-VGEYIGISD-DPNYGVAKKIIGTVINLYTSDEDIRKVKIIYSKFNSVVSQGIISATVLPISRKADNS--DGTPVTSELVIEPGGEELLEELVPQYITSLLYGAMIENNAGEEASRRMAMSAATDNANELLEELEIRYNSARQSSITNELIEIVSGAEA 287
>gi|231609|sp|P29710|ATPG_PROMO ATP synthase gamma chain, sodium ion specific >gi|45654|emb|CAA41373.1| F1 subunit [Propionigenium modestum] (282 aa)
Score = 320, Expect = 8.3e-28, Identities = 97/283 (34%), Positives = 163/283 (57%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSL--KKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDE----IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA+  EIK RI  ++ST +IT AM++VSS K KK + L      Y      +   + +   +E   L   K+E  +   +   S  GLCG FN + +KE++K I +N +    +  IGKKG++  K K  + ++  +      +  FD    I+EN++  +  D     + +IY++F+++LS    V  LLP++      R++  +N   +  +P+  D+  S+L  YL   ++ AI+E+   E+++R+NAM +AT NA ++IK+  L++NR+RQ+ ITQEI+EIVSGA
  S:     1 MAAGKEIKSRISSVQSTRQITKAMEIVSSTKFKKFQALVNQSKPYSGSMDKVLANLAAGIKNERHPLFDGKTEVKRIGIIVMTSDRGLCGGFNSSTLKEMEKLIVANPDKEVSVIAIGKKGRDYCKKK--DRDLKAEYIQLIPETMFDKAKEISENIVEYFYEDI-FDEVYLIYNEFISALSTELIVKKLLPIE------RIEVQDN-TTYIFEPSVEDILSSLLPKYLNIQLYQAILENTASEHSARKNAMKNATDNAEDMIKDLTLQYNRERQAAITQEISEIVSGA 279
>gi|82751705|ref|YP_417446.1| F0F1 ATP synthase subunit gamma [Staphylococcus aureus RF122] >gi|123548234|sp|Q2YUK0|ATPG_STAAB ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|82657236|emb|CAI81677.1| ATP synthase gamma chain [Staphylococcus aureus RF122] (288 aa)
Score = 319, Expect = 8.6e-28, Identities = 89/283 (31%), Positives = 163/283 (57%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIK-SNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDE------IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MASL EI  RIK  +   +IT AM +VSS+KL++ ++     + Y  K  D  T +  ++S++    L+  +  ++ +L   S  GL G+++ N++K+L   I++  +      I ++G++G + +K++G + E S  +++ D+  +F     +A + +  Y  +  I  + + YS +V+ L   P+   +LPL    ++       + + +  +P+   +   IL  Y+ + I+G I+++K  E+A+R  AM +AT NA ELI +  LE+NR RQ+EITQ+ITEIV G+
  S:     1 MASLKEIDTRIKSTKKMKQITKAMNMVSSSKLRRAEKNTKQFTPYMDKMQDAITAVAGASSNTNHPMLRPRKITRSGYLVITSDKGLAGAYSANVLKKLITDIEAKHQDSSEYGIVVLGQQGVDFLKNRGYDIEYS-QVDVPDQP-SFKSVQALANHAIDLYSEE-EIDELNIYYSHYVSVLENKPTSRQVLPLS---QEDSSKGHGHLSSYEFEPDKESILSVILPQYVESLIYGTILDAKASEHATRMTAMKNATDNATELIDDLSLEYNRARQAEITQQITEIVGGS 284
>gi|83854833|ref|ZP_00948363.1| ATP synthase subunit C [Sulfitobacter sp. NAS-14.1] >gi|83842676|gb|EAP81843.1| ATP synthase subunit C [Sulfitobacter sp. NAS-14.1] (292 aa)
Score = 319, Expect = 8.8e-28, Identities = 93/285 (32%), Positives = 166/285 (58%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIK-----SNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIK------SNDEIWLIGKKGKNLIKSKGIEAEIS-LDLELDDKDINFDLFHIIAENLLAKYK-NDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGAD-----FSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           M +L ++K RI  ++ST KIT AM++V++AKL++ +E       Y ++F  + + +      S++  ++LS   S++   + +   +  GLCG FN NI K  + H +         +I  +GKKG++ I+    +  +  +DL  D K + +     IA+++L ++   +Y+I +I   YSKFVN +S  P+   ++P     E+        GAD     F  +P+   +   +L   +AT I  A++E+   E  +R +AMD+AT+NA ++I++  +E+NR RQ+ IT E+ EI+SGA+ 
  S:     1 MPNLKDLKNRIASVKSTRKITKAMQMVAAAKLRRAQEAAEQSRPYTERFNAVMSRLAASVGGSDTAPKLLSGTGSDQVHLL-VVMTAERGLCGGFNANIAKLAKAHARGLIAKGKEVKILTVGKKGRDSIRRDFGDLLVGHVDLS-DVKRLGYADAQGIAKDVLGRFDAGEYDIATI--FYSKFVNVVSQIPTAQQIIP--ATFEE------TEGADEATTLFDYEPSEEAILADLLPRGVATAIFSALLENAASEQGARMSAMDNATRNAGDMIEDLTIEYNRSRQAVITNELIEIISGAEA 291
>gi|119503556|ref|ZP_01625639.1| TonB-dependent receptor [marine gamma proteobacterium HTCC2080] >gi|119460618|gb|EAW41710.1| TonB-dependent receptor [marine gamma proteobacterium HTCC2080] (287 aa)
Score = 319, Expect = 9.0e-28, Identities = 86/283 (30%), Positives = 164/283 (57%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILS--LKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDE------IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKP-NNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA+  EI+ +I  I+ST KIT+AM++V+++K+++ ++       Y ++  D+  +I +N+  E     +++ +  +  ++   +  GLCG  N+N+ K     ++  +E      + LIG K     KS G     S+    ++  ++  L   + + L A  +    I ++ ++ ++FVN+++ +P V  LLPL     KP  D   ++  D+  +P+A ++ +++L+ Y+ + ++ A+VE+  CE A+R  AM SA+ NA +LI   +L +N+ RQ+ ITQE+ EIVSGA
  S:     1 MAAGKEIRTKISSIQSTQKITSAMEMVAASKMRRAQDRMELGKPYARRIRDVVGHI-ANAVPEYRHAYMQQRDVKRVGYIIVSTDRGLCGGLNINLFKAAIAGMRPQNEAGIEVDLCLIGAKSLAFFKSVGGNVVASVKDVGEEPTVD-QLIGGVKQMLDAYVQG--RIDTLYLVSNEFVNTMTQSPQVEQLLPL-----KPSEDAGLSHHWDYVYEPDARELLDALLVRYVESLVYQAVVENGACEQAARMVAMKSASDNAGDLIDELQLVYNKARQAAITQELAEIVSGA 283
>gi|21910034|ref|NP_664302.1| F0F1 ATP synthase subunit gamma [Streptococcus pyogenes MGAS315] >gi|28896268|ref|NP_802618.1| F0F1 ATP synthase subunit gamma [Streptococcus pyogenes SSI-1] >gi|81759288|sp|Q8K827|ATPG_STRP3 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|21904224|gb|AAM79105.1| putative proton-translocating ATPase gamma subunit [Streptococcus pyogenes MGAS315] >gi|28811519|dbj|BAC64451.1| putative proton-translocating ATPase, gamma subunit [Streptococcus pyogenes SSI-1] (291 aa)
Score = 319, Expect = 9.6e-28, Identities = 95/282 (33%), Positives = 156/282 (55%)
  Q:     2 ASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFT-YIKSN----SDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKEL-----QKHIKSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
            SL+EIK +I   E TSKIT+AM++VSSAKL + ++   +  IY  K   + T  +KS     SD+ +L  +  +  KT ++   S  GL G +N  I+K +     + H   + EI  IG  G +  K++G+     L    D    +F+    I    +  + N+     + V Y+  VNSL+    V  +LP+   +     ++   G  F ++PN +D+ + +L  +  + I+GAI+++K  E+A+   AM +AT NA  +I +  +++NR RQ+ ITQEITEIV+GA
  S:     3 GSLSEIKAKIISTEKTSKITSAMRMVSSAKLVRSEQAARDFQIYASKIRQITTDLLKSELTIGSDNPMLVSRPVK--KTGYIVITSDKGLVGGYNSKILKSVMDMITEYHADGDYEIISIGSVGSDFFKARGMNVAFELRGLADQP--SFEQVRQIISQSVDMFVNEI-FDELYVCYNHHVNSLTSQVRVQQMLPISDLVADEAAEEGVTG--FELEPNRHDILDQLLPQFTESLIYGAIIDAKTAEHAAGMTAMQTATDNAKNVINDLTIQYNRARQAAITQEITEIVAGA 287
>gi|188588467|ref|YP_001919897.1| ATP synthase F1, gamma subunit [Clostridium botulinum E3 str. Alaska E43] >gi|188498748|gb|ACD51884.1| ATP synthase F1, gamma subunit [Clostridium botulinum E3 str. Alaska E43] (283 aa)
Score = 319, Expect = 1.0e-27, Identities = 100/285 (35%), Positives = 161/285 (56%)
  Q:     2 ASLNEIKKRIKIIESTSKITNAMKLVSSAKLKK-QKELFLNESIYY---KKFYDLFTYIKSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHI---KSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDI-NFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKGE 286
           A L EIK+RIK +EST KITNAM LV+++KL+K +KELF+N+  +    K    L + I  + DS  +  K ++    +++   S  GLCGS+N  +V  L   +   K N ++  +G KG + +K  G++   ++   +D  DI       I+ E+ L  YK D  +  I ++Y  FV+ +   P    LLP+++    P         +F  +PN+ +V  + L  +L       ++ +K  E +SR  AM+ AT+NAN+++ N  L++NR RQ  ITQEI+EIV GA+ +
  S:     4 AGLIEIKRRIKSVESTRKITNAMGLVATSKLRKTRKELFINKKFFEETEKIIEKLASTISQDDDS--IYFKSNKSKYKLYILVSSDTGLCGSYNNTVVSYLDSLVRDEKENIKVITVGSKGLSYVKRIGLD---TIADYVDIPDIPTVKEVKIVFESALKMYK-DGEVSEINIVYLDFVSPVKQEPKAEKLLPIERITSVPE--------EFITEPNSEEVLNNALNIHLKGKFRNILLSAKCSEQSSRMTAMNGATQNANDILDNLNLKYNRIRQQIITQEISEIVGGAEAQ 282
>gi|53733036|ref|ZP_00155479.2| COG0224: F0F1-type ATP synthase, gamma subunit [Haemophilus influenzae R2846] >gi|145636252|ref|ZP_01791921.1| F0F1 ATP synthase subunit gamma [Haemophilus influenzae PittHH] >gi|145270417|gb|EDK10351.1| F0F1 ATP synthase subunit gamma [Haemophilus influenzae PittHH] (289 aa)
Score = 319, Expect = 1.1e-27, Identities = 90/283 (31%), Positives = 156/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEGKTIWLAFFSS-MGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EIK +I  ++ST KIT AM++V+++K++K ++       Y +   ++ +++   S           E K I +   S+  G+CG  N+N+ K     IK+      + ++ LIG KG +  +S G   +  L   L D  +  +L  + A  +   Y+N   I +I + Y+KFVN++S  P V  L+PL ++ +   L++     D+  +P    + +S+L+ YL + I+ A+V++   E A+R  AM +AT NA  LI + +L +N+ RQ+ IT E+ EIV+GA
  S:     1 MAGAKEIKTKIASVQSTQKITKAMEMVATSKMRKTQDRMAASRPYSETIRNVISHVSKASIGYKHPFLVEREVKKIGILVISTDRGMCGGLNVNLFKTTLNQIKNWKEQNISTDLGLIGSKGISFFRSFGFNIKGQLS-GLGDTPVLEELIGV-ANTMFDAYRNG-EIDAIYIAYNKFVNTMSQKPVVQQLVPLPES-KDDHLNERQQTWDYLYEPEPKALLDSLLVRYLESQIYQAVVDNLASEQAARMVAMKAATDNAGNLINDLRLVYNKARQASITNELNEIVAGA 286
>gi|145640454|ref|ZP_01796038.1| F0F1 ATP synthase subunit gamma [Haemophilus influenzae R3021] >gi|145275040|gb|EDK14902.1| F0F1 ATP synthase subunit gamma [Haemophilus influenzae 22.4-21] (289 aa)
Score = 319, Expect = 1.1e-27, Identities = 90/283 (31%), Positives = 156/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEGKTIWLAFFSS-MGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EIK +I  ++ST KIT AM++V+++K++K ++       Y +   ++ +++   S           E K I +   S+  G+CG  N+N+ K     IK+      + ++ LIG KG +  +S G   +  L   L D  +  +L  + A  +   Y+N   I +I + Y+KFVN++S  P V  L+PL ++ +   L++     D+  +P    + +S+L+ YL + I+ A+V++   E A+R  AM +AT NA  LI + +L +N+ RQ+ IT E+ EIV+GA
  S:     1 MAGAKEIKTKIASVQSTQKITKAMEMVATSKMRKTQDRMAASRPYSETIRNVISHVSKASVGYKHPFLVEREVKKIGILVISTDRGMCGGLNVNLFKTTLNQIKNWKEQNISTDLGLIGSKGISFFRSFGFNIKGQLS-GLGDTPVLEELIGV-ANTMFDAYRNG-EIDAIYIAYNKFVNTMSQKPVVQQLVPLPES-KDDHLNERQQTWDYLYEPEPKALLDSLLVRYLESQIYQAVVDNLASEQAARMVAMKAATDNAGNLINDLRLVYNKARQASITNELNEIVAGA 286
>gi|83814517|ref|YP_445050.1| ATP synthase F1, gamma subunit [Salinibacter ruber DSM 13855] >gi|123529219|sp|Q2S431|ATPG_SALRD ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|83755911|gb|ABC44024.1| ATP synthase F1, gamma subunit [Salinibacter ruber DSM 13855] (308 aa)
Score = 318, Expect = 1.1e-27, Identities = 90/285 (31%), Positives = 163/285 (57%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEGKT--IWLAFFSSMGLCGSFNLNIVKELQKHI-------KSNDEIWL--IGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPL-DKAIEKPRLDK-------PNNG--ADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           MA+L +I+ RI  IE+T ++T AMK+V++AKL++ +E       Y  K  +L  ++K   D       ++ E  +  + +   +  GLCGSFN + +   +  I       +S D++++  +GKKG    + +  +  +  D +     +NFD+   + E+ +  ++       +K++Y++F N++     V  LLP+ ++  E P +++       P NG   D+  +P A  + + ++  YL   +  A++ES   E  +R  AMD+AT NA ELI++  LE+NR RQS IT+E+ +I SGA+ 
  S:     1 MANLRDIRNRIDSIENTKQVTRAMKMVAAAKLRRAQEKIFRARPYAYKIGELTNHLKQELDPTAHPFFQAPEEASGALVIVITADRGLCGSFNSDAINTAEHLIETTYAETQSADDLFMLCVGKKGHKHFQKR--DYRLVGDYKGVFDGLNFDVAQQVVEDAVEGFERGI-WGEVKLVYNEFKNTIVQNQIVEPLLPIPEERFETPVMEEEADGFALPENGRAIDYIFEPGAPTLLDELVPRYLYYQVWRALLESNAAEQGARMVAMDNATSNAEELIEDLTLEYNRARQSAITRELLDITSGAEA 303
>gi|78187826|ref|YP_375869.1| F0F1 ATP synthase subunit gamma [Pelodictyon luteolum DSM 273] >gi|123582492|sp|Q3B1F5|ATPG_PELLD ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|78167728|gb|ABB24826.1| H+-transporting two-sector ATPase, gamma subunit [Pelodictyon luteolum DSM 273] (290 aa)
Score = 318, Expect = 1.2e-27, Identities = 86/283 (30%), Positives = 152/283 (53%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSL--KKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHI---------KSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           M +L +I+ RIK ++ST ++T AMK+V++AKL+K +E  +    Y  K  ++   +    D+    L   +++  + + +   S  GLCG+FN NI+K   + I           N ++   G +G +  + +G             ++++F     IAE   + Y     +  + V+Y++F + L+ T     LLP+    E P  +    G D+  +P+   + E ++  +L T + G ++ES   E A+R  AMDSAT+NA EL++   + +NR RQ+ IT+E++EIV GA
  S:     1 MPTLKDIRVRIKGVKSTQQVTKAMKMVAAAKLRKAQERAVMARPYAAKLKEMLGSLSGKVDTSASPLLADRADASRVLVVLITSDRGLCGAFNTNIIKLAHRTIHEEYAAAYAAGNVQLICAGTRGFDFFRKRGYSVLKGYPAVF--QNLDFSTAREIAETASSMYVKG-EVDRVVVVYNEFKSVLAPTLKAEVLLPIKS--ELPVAE----GGDYIYEPSPAAIIEELVPKHLNTQVWGMMLESNAAEQAARMTAMDSATENAKELLRGLNISYNRARQAAITKELSEIVGGA 285
>gi|15925094|ref|NP_372628.1| F0F1 ATP synthase subunit gamma [Staphylococcus aureus subsp. aureus Mu50] >gi|15927678|ref|NP_375211.1| F0F1 ATP synthase subunit gamma [Staphylococcus aureus subsp. aureus N315] >gi|21283757|ref|NP_646845.1| F0F1 ATP synthase subunit gamma [Staphylococcus aureus subsp. aureus MW2] >gi|49484328|ref|YP_041552.1| F0F1 ATP synthase subunit gamma [Staphylococcus aureus subsp. aureus MRSA252] >gi|49486897|ref|YP_044118.1| F0F1 ATP synthase subunit gamma [Staphylococcus aureus subsp. aureus MSSA476] >gi|57652126|ref|YP_186911.1| F0F1 ATP synthase subunit gamma [Staphylococcus aureus subsp. aureus COL] >gi|148268555|ref|YP_001247498.1| F0F1 ATP synthase subunit gamma [Staphylococcus aureus subsp. aureus JH9] >gi|150394619|ref|YP_001317294.1| F0F1 ATP synthase subunit gamma [Staphylococcus aureus subsp. aureus JH1] >gi|151222220|ref|YP_001333042.1| F0F1 ATP synthase subunit gamma [Staphylococcus aureus subsp. aureus str. Newman] >gi|156980419|ref|YP_001442678.1| F0F1 ATP synthase subunit gamma [Staphylococcus aureus subsp. aureus Mu3] >gi|161353520|ref|YP_500821.2| F0F1 ATP synthase subunit gamma [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|161510311|ref|YP_001575970.1| F0F1 ATP synthase subunit gamma [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|162138567|ref|YP_494705.2| F0F1 ATP synthase subunit gamma [Staphylococcus aureus subsp. aureus USA300] >gi|166224110|sp|A7X4U4|ATPG_STAA1 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|172048986|sp|A6QIU8|ATPG_STAAE ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|189081480|sp|A6U3I9|ATPG_STAA2 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|189081481|sp|A5IUP9|ATPG_STAA9 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|189081482|sp|A8YY71|ATPG_STAAT ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|81694061|sp|Q5HE96|ATPG_STAAC ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|81696291|sp|Q6G7K6|ATPG_STAAS ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|81696453|sp|Q6GEX1|ATPG_STAAR ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|81704256|sp|Q7A0C5|ATPG_STAAW ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|81705322|sp|Q7A4E8|ATPG_STAAN ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|81781175|sp|Q99SF4|ATPG_STAAM ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|13701898|dbj|BAB43190.1| ATP synthase gamma chain [Staphylococcus aureus subsp. aureus N315] >gi|14247877|dbj|BAB58266.1| ATP synthase gamma chain [Staphylococcus aureus subsp. aureus Mu50] >gi|21205199|dbj|BAB95893.1| ATP synthase gamma chain [Staphylococcus aureus subsp. aureus MW2] >gi|49242457|emb|CAG41173.1| ATP synthase gamma chain [Staphylococcus aureus subsp. aureus MRSA252] >gi|49245340|emb|CAG43815.1| ATP synthase gamma chain [Staphylococcus aureus subsp. aureus MSSA476] >gi|57286312|gb|AAW38406.1| ATP synthase F1, gamma subunit [Staphylococcus aureus subsp. aureus COL] >gi|147741624|gb|ABQ49922.1| ATP synthase F1, gamma subunit [Staphylococcus aureus subsp. aureus JH9] >gi|149947071|gb|ABR53007.1| ATP synthase F1, gamma subunit [Staphylococcus aureus subsp. aureus JH1] >gi|150375020|dbj|BAF68280.1| ATP synthase, gamma subunit [Staphylococcus aureus subsp. aureus str. Newman] >gi|156722554|dbj|BAF78971.1| ATP synthase gamma chain [Staphylococcus aureus subsp. aureus Mu3] >gi|160369120|gb|ABX30091.1| F-ATPase superfamily proton (H+)- or sodium (Na+)-translocating F-type ATPase gamma subunit [Staphylococcus aureus subsp. aureus USA300_TCH1516] (288 aa)
Score = 318, Expect = 1.2e-27, Identities = 91/283 (32%), Positives = 164/283 (57%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIK-SNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKEL-----QKHIKSND-EIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MASL EI  RIK  +   +IT AM +VSS+KL++ ++     + Y  K  D  T +  ++S++    L+  +  ++ +L   S  GL G+++ N++K+L      KH  S++  I ++G++G + +K++G + E S  +++ D+  +F     +A + +  Y  +  I  + + YS +V+ L   P+   +LPL    ++       + + +  +P+   +   IL  Y+ + I+G I+++K  E+A+R  AM +AT NA ELI +  LE+NR RQ+EITQ+ITEIV G+
  S:     1 MASLKEIDTRIKSTKKMKQITKAMNMVSSSKLRRAEKNTKQFTPYMDKMQDAITAVAGASSNTNHPMLRPRKITRSGYLVITSDKGLAGAYSANVLKKLITDIEAKHQDSSEYSIVVLGQQGVDFLKNRGYDIEYS-QVDVPDQP-SFKSVQALANHAIDLYSEE-EIDELNIYYSHYVSVLENKPTSRQVLPLS---QEDSSKGHGHLSSYEFEPDKESILSVILPQYVESLIYGTILDAKASEHATRMTAMKNATDNATELIDDLSLEYNRARQAEITQQITEIVGGS 284
>gi|162286756|ref|YP_001083239.2| F0F1 ATP synthase subunit gamma [Acinetobacter baumannii ATCC 17978] >gi|169632166|ref|YP_001705902.1| membrane-bound ATP synthase, F1 sector, gamma-subunit [Acinetobacter baumannii SDF] >gi|169797645|ref|YP_001715438.1| membrane-bound ATP synthase, F1 sector, gamma-subunit [Acinetobacter baumannii AYE] >gi|184156497|ref|YP_001844836.1| F0F1-type ATP synthase, gamma subunit [Acinetobacter baumannii ACICU] >gi|169150572|emb|CAM88481.1| membrane-bound ATP synthase , F1 sector, gamma-subunit [Acinetobacter baumannii] >gi|169150958|emb|CAO99573.1| membrane-bound ATP synthase , F1 sector, gamma-subunit [Acinetobacter baumannii] >gi|183208091|gb|ACC55489.1| F0F1-type ATP synthase, gamma subunit [Acinetobacter baumannii ACICU] >gi|193076045|gb|ABO10637.2| membrane-bound ATP synthase F1 sector, gamma-subunit [Acinetobacter baumannii ATCC 17978] (289 aa)
Score = 318, Expect = 1.3e-27, Identities = 84/283 (29%), Positives = 158/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTY-IKSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDE------IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA+L EI+ ++  I+ST KIT AM++V+++K+++ +E       Y      +  + +++N + +   +      +  ++   S  GL G  N+N+ K++ +H+K+  E        LIG+K  +  K+ G +  +    ++ D      L   +   L A  K +  +  I ++ + FVN+++  P V  L+PL  A E   L++   G D+  +P A ++   +L+ Y+ + ++  ++E+  CE ++R  AM +AT NA +LIK+ +L +N+ RQ+ ITQEI+EIV GA
  S:     1 MANLKEIRAKVASIKSTQKITRAMQMVAASKMRRAQERMAQGRPYADNMRRVIAHLVQANPEYKHRYMVDRPVKRVGYIIVSSDRGLAGGLNINLFKKVVQHVKAQQEQSIEVQFALIGQKAVSFFKNYGGKV-LGATTQIGDAPSLEQLTGSVQVMLDAFDKGE--LDRIYLVSNGFVNAMTQKPKVEQLVPLAPAEEGDDLNR-TYGWDYIYEPEAEELLNGLLVRYIESMVYQGVIENVACEQSARMVAMKAATDNAGQLIKDLQLIYNKLRQAAITQEISEIVGGA 286
>gi|187934151|ref|YP_001884710.1| ATP synthase F1, gamma subunit [Clostridium botulinum B str. Eklund 17B] >gi|187722304|gb|ACD23525.1| ATP synthase F1, gamma subunit [Clostridium botulinum B str. Eklund 17B] (283 aa)
Score = 318, Expect = 1.3e-27, Identities = 102/285 (35%), Positives = 160/285 (56%)
  Q:     2 ASLNEIKKRIKIIESTSKITNAMKLVSSAKLKK-QKELFLNESIYY---KKFYDLFTYIKSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHI---KSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDI-NFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKGE 286
           A L EIK+RIK +EST KITNAM LV+++KL+K +KELF+N+  +    K    L + I  + DS  +  K ++    +++   S  GLCGS+N  +V  L   +   K N ++  +G KG + +K  G++   ++   +D  DI       I+ E+ L  YK D  +  I V Y  FV+ +   P    LLP++K    P         +F  +PN+ +V  + L  +L       ++ +K  E +SR  AM+ AT+NAN+++ N  L++NR RQ  ITQEI+EIV GA+ +
  S:     4 AGLIEIKRRIKSVESTRKITNAMGLVATSKLRKTRKELFINKKFFEETEKIIEKLASTISQDDDS--IYFKSNKSKYKLYILVSSDTGLCGSYNNTVVSYLDSLVRDEKENIKVITVGSKGLSYVKRIGLD---TIADYVDIPDIPTVKEVKIVFESALKMYK-DGEVSEINVAYLDFVSPVKQEPKAEKLLPIEKITSVPE--------EFITEPNSEEVLNNALNIHLKGKFRNILLSAKCSEQSSRMTAMNGATQNANDILDNLNLKYNRIRQQIITQEISEIVGGAEAQ 282
>gi|146309621|ref|YP_001190086.1| F0F1 ATP synthase subunit gamma [Pseudomonas mendocina ymp] >gi|166224086|sp|A4Y188|ATPG_PSEMY ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|145577822|gb|ABP87354.1| ATP synthase F1, gamma subunit [Pseudomonas mendocina ymp] (287 aa)
Score = 317, Expect = 1.4e-27, Identities = 88/283 (31%), Positives = 159/283 (56%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  I+ST KIT+AM+ V+ +K++K ++       Y ++   +  ++ K+N +     + + +  +  ++   S  GLCG  N+N+ K L K +K         +  ++G KG +  +S G     ++    ++  IN DL   +   L A  +    I  + ++ +KFVN+++  P V  LLPL  A +   + K     D+  +P+A  + +++L+ Y+ + ++ ++VE+  CE A+R  AM +AT NA +LIK+ +L +N+ RQ+ ITQEI+EIV GA
  S:     1 MAGAKEIRSKIASIKSTQKITSAMEKVAVSKMRKAQQRMAAGRPYAERIRQVIGHLAKANPEYRHSFMVERDVKRVGYIVVTSDRGLCGGLNINLFKALLKSLKEWRDQKVEADFCVVGTKGASFFRSNGGNVVAAISKLGEEPSIN-DLIGSVKVVLDAYAEG--RIDRLYLVSNKFVNTMTQKPEVQQLLPL-AASDAQGVQK--GLWDYVYEPDAQQLLDALLVRYIESQVYQSVVENSACEQAARMIAMKNATDNAGDLIKDLQLVYNKARQAAITQEISEIVGGA 284
>gi|148988553|ref|ZP_01819986.1| F0F1 ATP synthase subunit gamma [Streptococcus pneumoniae SP6-BS73] >gi|148992607|ref|ZP_01822275.1| F0F1 ATP synthase subunit gamma [Streptococcus pneumoniae SP9-BS68] >gi|148997431|ref|ZP_01825036.1| F0F1 ATP synthase subunit gamma [Streptococcus pneumoniae SP11-BS70] >gi|149003277|ref|ZP_01828173.1| F0F1 ATP synthase subunit gamma [Streptococcus pneumoniae SP14-BS69] >gi|149007586|ref|ZP_01831221.1| F0F1 ATP synthase subunit gamma [Streptococcus pneumoniae SP18-BS74] >gi|149011743|ref|ZP_01832939.1| F0F1 ATP synthase subunit gamma [Streptococcus pneumoniae SP19-BS75] >gi|149021775|ref|ZP_01835782.1| F0F1 ATP synthase subunit gamma [Streptococcus pneumoniae SP23-BS72] >gi|168483882|ref|ZP_02708834.1| ATP synthase F1, gamma subunit [Streptococcus pneumoniae CDC1873-00] >gi|168487558|ref|ZP_02712066.1| ATP synthase F1, gamma subunit [Streptococcus pneumoniae CDC1087-00] >gi|168489669|ref|ZP_02713868.1| ATP synthase F1, gamma subunit [Streptococcus pneumoniae SP195] >gi|168492578|ref|ZP_02716721.1| ATP synthase F1, gamma subunit [Streptococcus pneumoniae CDC0288-04] >gi|168493410|ref|ZP_02717553.1| ATP synthase F1, gamma subunit [Streptococcus pneumoniae CDC3059-06] >gi|168575964|ref|ZP_02721879.1| ATP synthase F1, gamma subunit [Streptococcus pneumoniae MLV-016] >gi|169834366|ref|YP_001694915.1| ATP synthase F1, gamma subunit [Streptococcus pneumoniae Hungary19A-6] >gi|182684463|ref|YP_001836210.1| ATP synthase subunit C [Streptococcus pneumoniae CGSP14] >gi|147756486|gb|EDK63527.1| F0F1 ATP synthase subunit gamma [Streptococcus pneumoniae SP11-BS70] >gi|147758737|gb|EDK65734.1| F0F1 ATP synthase subunit gamma [Streptococcus pneumoniae SP14-BS69] >gi|147760945|gb|EDK67915.1| F0F1 ATP synthase subunit gamma [Streptococcus pneumoniae SP18-BS74] >gi|147764174|gb|EDK71106.1| F0F1 ATP synthase subunit gamma [Streptococcus pneumoniae SP19-BS75] >gi|147925754|gb|EDK76829.1| F0F1 ATP synthase subunit gamma [Streptococcus pneumoniae SP6-BS73] >gi|147928624|gb|EDK79638.1| F0F1 ATP synthase subunit gamma [Streptococcus pneumoniae SP9-BS68] >gi|147930011|gb|EDK80998.1| F0F1 ATP synthase subunit gamma [Streptococcus pneumoniae SP23-BS72] >gi|168996868|gb|ACA37480.1| ATP synthase F1, gamma subunit [Streptococcus pneumoniae Hungary19A-6] >gi|172042759|gb|EDT50805.1| ATP synthase F1, gamma subunit [Streptococcus pneumoniae CDC1873-00] >gi|182629797|gb|ACB90745.1| ATP synthase subunit C [Streptococcus pneumoniae CGSP14] >gi|183569637|gb|EDT90165.1| ATP synthase F1, gamma subunit [Streptococcus pneumoniae CDC1087-00] >gi|183571898|gb|EDT92426.1| ATP synthase F1, gamma subunit [Streptococcus pneumoniae SP195] >gi|183573307|gb|EDT93835.1| ATP synthase F1, gamma subunit [Streptococcus pneumoniae CDC0288-04] >gi|183576623|gb|EDT97151.1| ATP synthase F1, gamma subunit [Streptococcus pneumoniae CDC3059-06] >gi|183578297|gb|EDT98825.1| ATP synthase F1, gamma subunit [Streptococcus pneumoniae MLV-016] (292 aa)
Score = 317, Expect = 1.5e-27, Identities = 96/281 (34%), Positives = 161/281 (57%)
  Q:     3 SLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI----KSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVK---ELQKHIKSND---EIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGAD------FSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           SLN+IK +I   ++TS+ITNAM++VS+AKL + +E   N  +Y +K   L T I     + + +  + + +S + KT ++   S  GL G +N +I+K   EL++    +    E+  IG  G +  K++GI+    L    D    +FD    I    +  Y+N+     + V Y+  VN+L+    V  +LP+        +D   N AD      F ++ +  ++ E +L  +  + I+GAI+++K  ENA+   AM +AT NA ++I +  +++NR RQ+ ITQEITEIV+GA
  S:     4 SLNDIKTKIASTKNTSQITNAMQMVSAAKLGRSEEAARNFQVYAQKVRKLLTDILHGNGAGASTNPMLISRSVK-KTGYIVITSDRGLVGGYNSSILKAVMELKEEYHPDGKGFEMICIGGMGADFFKARGIQPLYELRGLADQP--SFDQVRKIISKTVEMYQNEL-FDELYVCYNHHVNTLTSQMRVEQMLPI--------VDLDPNEADEEYSLTFELETSREEILEQLLPQFAESMIYGAIIDAKTAENAAGMTAMQTATDNAKKVINDLTIQYNRARQAAITQEITEIVAGA 288
>gi|194016253|ref|ZP_03054867.1| ATP synthase F1, gamma subunit [Bacillus pumilus ATCC 7061] >gi|194011726|gb|EDW21294.1| ATP synthase F1, gamma subunit [Bacillus pumilus ATCC 7061] (288 aa)
Score = 317, Expect = 1.5e-27, Identities = 98/283 (34%), Positives = 155/283 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKE----LQKHIKSNDE--IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MASL +IK RI   + +S+IT AM++VS+AKL + +    +   Y +K  ++   I + + ++   L      KT +L   S  GL G FN +I++     +Q   +S DE  + +IGK G++  K +GI   IS    L D ++ F     +A + +  + +D     + + Y+ FV+++S   +   LLPL         +K    A +  +P+  ++ E +L  Y  + I GA+++SK  E+A+R  AM SAT NA ELI    L +NR RQ+ ITQEITEIV GA
  S:     1 MASLRDIKSRITSTKKSSQITKAMQMVSAAKLNRAENNAKSFVPYMEKIQEVVAAIATGTSAKHPMLLSRPVKKTGYLVITSDRGLAGPFNSSILRAAYQTIQSRHQSADEYAVIVIGKIGRDFFKKRGIPV-ISEVTGLGD-EVAFADIKELASSTVQMF-SDEAFDELYMFYNHFVSAISQEVTEKKLLPLTDISAAATPNK--RSASYEFEPSEEEILEVLLPQYAESLIFGALLDSKASEHAARMTAMKSATDNAKELIDGLTLSYNRARQAAITQEITEIVGGA 284
>gi|157694078|ref|YP_001488540.1| F0F1 ATP synthase subunit gamma [Bacillus pumilus SAFR-032] >gi|166990391|sp|A8FIB3|ATPG_BACP2 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|157682836|gb|ABV63980.1| H(+)-transporting two-sector ATPase, F(1) gamma subunit [Bacillus pumilus SAFR-032] (288 aa)
Score = 317, Expect = 1.5e-27, Identities = 98/283 (34%), Positives = 156/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKE----LQKHIKSNDE--IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MASL +IK RI   + +S+IT AM++VS+AKL + +    +   Y +K  ++   I + + ++   L      KT +L   S  GL G FN +I++     +Q   +S DE  + +IGK G++  K +GI   IS    L D ++ F     +A + +  + +D     + + Y+ FV+++S   +   LLPL         +K    A +  +P+  ++ E +L  Y  + I GA+++SK  E+A+R  AM SAT NA ELI +  L +NR RQ+ ITQEITEIV GA
  S:     1 MASLRDIKSRITSTKKSSQITKAMQMVSAAKLNRAENNAKSFVPYMEKIQEVVAAIATGTSAKHPMLLSRPVKKTGYLVITSDRGLAGPFNSSILRAAYQTIQSRHQSADEYAVIVIGKIGRDFFKKRGIPV-ISEVTGLGD-EVAFADIKELASSTVQMF-SDEAFDELYMFYNHFVSAISQEVTEKKLLPLTDISAAATPNK--RSASYEFEPSEEEILEVLLPQYAESLIFGALLDSKASEHAARMTAMKSATDNAKELIDSLTLSYNRARQAAITQEITEIVGGA 284
>gi|83941356|ref|ZP_00953818.1| ATP synthase subunit C [Sulfitobacter sp. EE-36] >gi|83847176|gb|EAP85051.1| ATP synthase subunit C [Sulfitobacter sp. EE-36] (292 aa)
Score = 317, Expect = 1.5e-27, Identities = 92/285 (32%), Positives = 166/285 (58%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIK-----SNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIK------SNDEIWLIGKKGKNLIKSKGIEAEIS-LDLELDDKDINFDLFHIIAENLLAKYK-NDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGAD-----FSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           M +L ++K RI  ++ST KIT AM++V++AKL++ +E       Y ++F  + + +      S++  ++LS   S++   + +   +  GLCG FN NI K  + H +         +I  +GKKG++ I+    +  +  +DL  D K + +     IA+++L ++   +Y+I +I   Y+KFVN +S  P+   ++P     E+        GAD     F  +P+   +   +L   +AT I  A++E+   E  +R +AMD+AT+NA ++I++  +E+NR RQ+ IT E+ EI+SGA+ 
  S:     1 MPNLKDLKNRIASVKSTRKITKAMQMVAAAKLRRAQEAAEQSRPYTERFNAVMSRLAASVGGSDTAPKLLSGTGSDQVHLL-VVMTAERGLCGGFNANIAKLAKAHARGLIAKGKEVKILTVGKKGRDSIRRDFGDLLVGHVDLS-DVKRLGYADAQGIAKDVLGRFDAGEYDIATI--FYAKFVNVVSQIPTAQQIIP--ATFEE------TEGADEATTLFDYEPSEEAILADLLPRGVATAIFSALLENAASEQGARMSAMDNATRNAGDMIEDLTIEYNRSRQAVITNELIEIISGAEA 291
>gi|145632747|ref|ZP_01788481.1| F0F1 ATP synthase subunit gamma [Haemophilus influenzae 3655] >gi|145634522|ref|ZP_01790231.1| F0F1 ATP synthase subunit gamma [Haemophilus influenzae PittAA] >gi|144986942|gb|EDJ93494.1| F0F1 ATP synthase subunit gamma [Haemophilus influenzae 3655] >gi|145268067|gb|EDK08062.1| F0F1 ATP synthase subunit gamma [Haemophilus influenzae PittAA] (289 aa)
Score = 317, Expect = 1.6e-27, Identities = 91/283 (32%), Positives = 156/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEGKTIWLAFFSS-MGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EIK +I  ++ST KIT AM++V+++KL+K ++       Y +   ++ +++   S           E K I +   S+  G+CG  N+N+ K +   IK+      + ++ LIG KG +  +S G   +  L   L D     +L  + A  +   Y+N   I +I + Y+KFVN++S  P V  L+PL ++ +   L++     D+  +P    + +S+L+ YL + I+ A+V++   E A+R  AM +AT NA  LI + +L +N+ RQ+ IT E+ EIV+GA
  S:     1 MAGAKEIKTKIASVQSTQKITKAMEMVATSKLRKTQDRMAASRPYSETIRNVISHVSKASIGYKHPFLVEREVKKIGILVISTDRGMCGGLNVNLFKTILNQIKNWKEQNISTDLGLIGSKGISFFRSFGFNIKGQLS-GLGDTPALEELIGV-ANTMFDAYRNG-EIDAIYIAYNKFVNTMSQKPVVQQLVPLPES-KDDHLNERQQTWDYLYEPEPKVLLDSLLVRYLESQIYQAVVDNLASEQAARMVAMKAATDNAGNLINDLRLVYNKARQASITNELNEIVAGA 286
>gi|126176548|ref|YP_001052697.1| ATP synthase F1, gamma subunit [Shewanella baltica OS155] >gi|149117394|ref|ZP_01844087.1| ATP synthase F1, gamma subunit [Shewanella baltica OS223] >gi|153002862|ref|YP_001368543.1| F0F1 ATP synthase subunit gamma [Shewanella baltica OS185] >gi|160877609|ref|YP_001556925.1| F0F1 ATP synthase subunit gamma [Shewanella baltica OS195] >gi|166224102|sp|A3DAR5|ATPG_SHEB5 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|166224103|sp|A6WUJ1|ATPG_SHEB8 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|189081475|sp|A9KX07|ATPG_SHEB9 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|125999753|gb|ABN63828.1| ATP synthase F1, gamma subunit [Shewanella baltica OS155] >gi|146862543|gb|EDK48206.1| ATP synthase F1, gamma subunit [Shewanella baltica OS223] >gi|151367480|gb|ABS10480.1| ATP synthase F1, gamma subunit [Shewanella baltica OS185] >gi|160863131|gb|ABX51665.1| ATP synthase F1, gamma subunit [Shewanella baltica OS195] (286 aa)
Score = 317, Expect = 1.7e-27, Identities = 88/283 (31%), Positives = 158/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNS-DSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKG--IEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EIK +I  +++T KIT+AM++V+++K+++ +E       Y +    +  ++   S + +   L+  E  +  ++   +  GLCG  N+N+ K++   +KS        E   IG +     K+ G  + A  S    L D     DL   +   L A   N+  +  + V+++KFVN+++ TP +  LLPL K+ +    D+  +  D+  +P+   + +++L+ Y+ + ++  +VE+   E A+R  AM SAT NA ELI + +L +N+ RQ+ ITQE++EIVSGA
  S:     1 MAGAKEIKTKIASVKNTQKITSAMEMVAASKMRRAQERMAASRPYAESMRKVIGHVAQGSLEYKHPYLEVREAKRVGYIVVATDRGLCGGLNVNLFKKVIADVKSWKAQGAEFEFCPIGARSVQFFKNFGGQVSAHAS---GLGDAPKLADLIGTVGVMLEAY--NEGKLDRLYVVFNKFVNTMTQTPVIEQLLPLPKSED----DETAHRWDYIYEPDPKALLDTLLVRYVESQVYQGVVENIASEQAARMVAMKSATDNAGELINDLQLVYNKARQAAITQELSEIVSGA 283
>gi|119358311|ref|YP_912955.1| F0F1 ATP synthase subunit gamma [Chlorobium phaeobacteroides DSM 266] >gi|166222542|sp|A1BJF4|ATPG_CHLPD ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|119355660|gb|ABL66531.1| ATP synthase F1, gamma subunit [Chlorobium phaeobacteroides DSM 266] (291 aa)
Score = 317, Expect = 1.7e-27, Identities = 88/283 (31%), Positives = 154/283 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSL--KKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQK---------HIKSNDEIWLIGKKGKNLIKSKG---IEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           M +L +I+ RIK ++ST ++T AMK+V++AKL++ +E  +    Y +K  ++   +    D+ +  L   +SE  K + +   +  GLCG+FN NIVK   K         H K+   +   G +G +  + +G   I+    +   LD     F     IAE +   Y        + V+Y++F + L+      +LLP+      P     + G+D+  +P+   + + ++  +L T +   ++ES   E A+R +AMDSAT+NA EL++   + +NR RQ+ IT+E++EIV GA
  S:     1 MPTLKDIRVRIKGVKSTQQVTKAMKMVAAAKLRRAQERAIMARPYARKLKEMLGSLSDKVDTSLNPLLSNRSEVNKVVVILITADRGLCGAFNTNIVKLAYKLIHEDYAAQHSKNGVSLICAGSRGFDFFRKRGYNIIKGYPGVFQRLD-----FSFAKEIAETVSGMYLRG-EADRVVVVYNEFKSVLAPVLKFETLLPI-----TPEASGKDGGSDYIYEPSPESIIDVLVPKHLNTQVWRVMLESNAAEQAARMSAMDSATENAKELLRTLNISYNRARQAAITKELSEIVGGA 286
>gi|154484981|ref|ZP_02027429.1| hypothetical protein EUBVEN_02699 [Eubacterium ventriosum ATCC 27560] >gi|149733934|gb|EDM50053.1| hypothetical protein EUBVEN_02699 [Eubacterium ventriosum ATCC 27560] (295 aa)
Score = 317, Expect = 1.7e-27, Identities = 95/286 (33%), Positives = 160/286 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKS------NSDSEILSLKKS---EEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS--NDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLP-LDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKGE 286
           MA+  EI+KR+K I+ T KITNAM ++SSAKL+  K+   +   Y   FY+L + I        ++ S+      +   EE K  ++   +  GL G++N N++K   +  K   N++++++G+ G+     +G+E +      + +  ++     +IAE +L  Y N   +  I VIY+K  NS+S       LLP   +  EK R        +     +  +V E I+ + +   I+GA+VES   E++SR  AM +AT +A ++++   +E+NR RQS ITQ+ITEI+ GAK +
  S:     1 MANTKEIQKRMKSIQDTMKITNAMYMISSAKLRSAKQKLEDTEPY---FYELQSAIARLLRHLPDARSKYFDPHSNIPDEEKKRGYIVITADKGLAGAYNHNVIKMANELFKQGKNNKLFVVGELGRQFFAKEGMEVDSEFKYTVQNPSLH--RARVIAERVLELY-NKRELDEIYVIYTKMENSVSMVTEKMRLLPCYREQFEKNRPPIDMYQEEIKTDTSVKEVLEHIVPNCVTGFIYGALVESFASEHSSRMMAMQAATDSAKDMLQQLSIEYNRVRQSAITQQITEIIGGAKAQ 292
>gi|15600748|ref|NP_254242.1| F0F1 ATP synthase subunit gamma [Pseudomonas aeruginosa PAO1] >gi|116053706|ref|YP_794033.1| F0F1 ATP synthase subunit gamma [Pseudomonas aeruginosa UCBPP-PA14] >gi|152989165|ref|YP_001351668.1| F0F1 ATP synthase subunit gamma [Pseudomonas aeruginosa PA7] >gi|194548754|ref|YP_002083782.1| ATP synthase gamma chain [Pseudomonas aeruginosa C3719] >gi|194554086|ref|YP_002089113.1| ATP synthase gamma chain [Pseudomonas aeruginosa 2192] >gi|122256274|sp|Q02DF3|ATPG_PSEAB ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|166224085|sp|A6VF33|ATPG_PSEA7 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|81783493|sp|Q9HT19|ATPG_PSEAE ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|9951895|gb|AAG08940.1|AE004967_11 ATP synthase gamma chain [Pseudomonas aeruginosa PAO1] >gi|115588927|gb|ABJ14942.1| ATP synthase gamma chain [Pseudomonas aeruginosa UCBPP-PA14] >gi|126169700|gb|EAZ55211.1| ATP synthase gamma chain [Pseudomonas aeruginosa C3719] >gi|126196479|gb|EAZ60542.1| ATP synthase gamma chain [Pseudomonas aeruginosa 2192] >gi|150964323|gb|ABR86348.1| ATP synthase F1, gamma subunit [Pseudomonas aeruginosa PA7] (286 aa)
Score = 317, Expect = 1.7e-27, Identities = 89/283 (31%), Positives = 156/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDE------IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  I+ST KITNAM+ V+ +K++K +        Y ++   +  ++  +N +     + + E  +  ++   S  GLCG  N+N+ K L K +    E      + +IG KG +  +S G     ++    ++  IN DL   +   L A  +    I  + V+ +KFVN+++  P+V  L+PL    ++    +  +  D+  +P+A  + + +L+ Y+ + ++ A+VE+  CE A+R  AM +AT NA ELI + +L +N+ RQ+ ITQEI+EIV GA
  S:     1 MAGAKEIRSKIASIKSTQKITNAMEKVAVSKMRKAQMRMAAGRPYAERIRQVIGHLANANPEYRHPFMVEREVKRVGYIVVSSDRGLCGGLNINLFKSLVKDMSGYREQGAEIDLCVIGSKGASFFRSFGGNVVAAISHLGEEPSIN-DLIGSVKVMLDAYLEG--RIDRLFVVSNKFVNTMTQKPTVEQLIPLVADDDQ----ELKHHWDYLYEPDAKSLLDGLLVRYVESQVYQAVVENNACEQAARMIAMKNATDNAGELISDLQLIYNKARQAAITQEISEIVGGA 283
>gi|153956280|ref|YP_001397045.1| F0F1 ATP synthase subunit gamma [Clostridium kluyveri DSM 555] >gi|189081396|sp|A5N3H8|ATPG_CLOK5 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|146349138|gb|EDK35674.1| AtpG [Clostridium kluyveri DSM 555] (283 aa)
Score = 317, Expect = 1.8e-27, Identities = 98/284 (34%), Positives = 158/284 (55%)
  Q:     2 ASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDEIWLI---GKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYK-----NDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           A L  IK+RIK I ST KIT AM L++++KL+K ++     + Y + F  +   +   ++   + +K ++  K +++A  S  GLCG FN N+V EL        E +L+   G+KGK   +         L+  ++ + I+      I E     YK      +  I  I ++++KF++++     V  LLPL    E  +++K N    F  +P+A+++ E I+  +L   +   I+ SKV E +SR  AMD ATKNAN+L+    L++NR+RQ+ ITQEITEIV GA+ 
  S:     4 AGLVTIKRRIKSITSTQKITKAMGLIATSKLRKVRKKLEANNKYCELFSSIVNELAMEAEQNNIYIKGNKSNKKLYIALNSDTGLCGGFNANVVNELNSIRSKEKEDFLLITMGQKGKMYFRR--------LNYNIESEYIDIPDVPTIKETEDVVYKALELYRNGEIGEINIVFTKFISTIKQNVIVEKLLPL----EVKKVEKRNFIVKF--EPSADEMIEDIVELHLRQKLLNCIINSKVSEQSSRMTAMDGATKNANDLLDELNLQYNRERQTAITQEITEIVGGAEA 281
>gi|15901356|ref|NP_345960.1| F0F1 ATP synthase subunit gamma [Streptococcus pneumoniae TIGR4] >gi|15903404|ref|NP_358954.1| F0F1 ATP synthase subunit gamma [Streptococcus pneumoniae R6] >gi|111657411|ref|ZP_01408164.1| hypothetical protein SpneT_02001381 [Streptococcus pneumoniae TIGR4] >gi|116515905|ref|YP_816798.1| F0F1 ATP synthase subunit gamma [Streptococcus pneumoniae D39] >gi|148984852|ref|ZP_01818105.1| F0F1 ATP synthase subunit gamma [Streptococcus pneumoniae SP3-BS71] >gi|122277704|sp|Q04HT8|ATPG_STRP2 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|81706933|sp|Q7CRB2|ATPG_STRR6 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|81775648|sp|Q97PT5|ATPG_STRPN ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|18253306|gb|AAL66418.1|AF368465_8 proton-translocating ATPase gamma subunit [Streptococcus pneumoniae] >gi|14972999|gb|AAK75600.1| ATP synthase F1, gamma subunit [Streptococcus pneumoniae TIGR4] >gi|15459009|gb|AAL00165.1| Proton-translocating ATPase, F1 sector, gamma-subunit [Streptococcus pneumoniae R6] >gi|116076481|gb|ABJ54201.1| ATP synthase F1, gamma subunit [Streptococcus pneumoniae D39] >gi|147922874|gb|EDK73990.1| F0F1 ATP synthase subunit gamma [Streptococcus pneumoniae SP3-BS71] (292 aa)
Score = 316, Expect = 2.0e-27, Identities = 97/281 (34%), Positives = 163/281 (58%)
  Q:     3 SLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI----KSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVK---ELQKHIKSND---EIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGAD------FSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           SLN+IK +I   ++TS+ITNAM++VS+AKL + +E   N  +Y +K   L T I     + + +  + + +S + KT ++   S  GL G +N +I+K   EL++    +    E+  IG  G +  K++GI+    L   L D+  +FD    I    +  Y+N+     + V Y+  VN+L+    V  +LP+        +D   N AD      F ++ +  ++ E +L  +  + I+GAI+++K  ENA+   AM +AT NA ++I +  +++NR RQ+ ITQEITEIV+GA
  S:     4 SLNDIKTKIASTKNTSQITNAMQMVSAAKLGRSEEAARNFQVYAQKVRKLLTDILHGNGAGASTNPMLISRSVK-KTGYIVITSDRGLVGGYNSSILKAVMELKEEYHPDGKGFEMICIGGMGADFFKARGIQPLYELR-GLSDQP-SFDQVRKIISKTVEMYQNEL-FDELYVCYNHHVNTLTSQMRVEQMLPI--------VDLDPNEADEEYSLTFELETSREEILEQLLPQFAESMIYGAIIDAKTAENAAGMTAMQTATDNAKKVINDLTIQYNRARQAAITQEITEIVAGA 288
>gi|167748909|ref|ZP_02421036.1| hypothetical protein ANACAC_03683 [Anaerostipes caccae DSM 14662] >gi|167651531|gb|EDR95660.1| hypothetical protein ANACAC_03683 [Anaerostipes caccae DSM 14662] (295 aa)
Score = 316, Expect = 2.0e-27, Identities = 94/285 (32%), Positives = 159/285 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDS------EILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIK--SNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKP---RLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           MA++ EI+ R+K I+ T KITNAM L+SS KL+K +E     + Y++        I  +S        +     K E+ K  ++   +  G+ G++N N++K  Q+ +   +++ +++IG+ G+     K +   I ++     +D +      IAE L+  Y+ +  +  I +IY+K V  L   P +  +LPL +   +     L+K +  AD+S  P    V + ++ +Y+   I+GA+VES   E  +R  AM  AT++A ++I+   L +NR RQ+ ITQEITEIVSGAK 
  S:     1 MANMTEIRSRMKSIQETMKITNAMYLISSTKLRKAREKLDATAPYFELLQSTIKDILFHSPDINHTFFDQRKKIKPEDKKRGYVVMTADKGMAGAYNHNVLKLAQERLAQGNDNTLFVIGQMGRKYFTKKNVR--IDMEFLYTAQDPSMWRARNIAETLVDLYRKE-KLDEIYIIYTKMVTPLKAEPEIIQILPLKRQSFEEMNVELEKYHKIADYSPSPKV--VMDHLVPNYVKGLIYGALVESFSSEQNARMMAMQGATESAKDMIRELSLLYNRARQAAITQEITEIVSGAKA 291
>gi|53733288|ref|ZP_00156313.2| COG0224: F0F1-type ATP synthase, gamma subunit [Haemophilus influenzae R2866] >gi|145628860|ref|ZP_01784660.1| F0F1 ATP synthase subunit gamma [Haemophilus influenzae 22.1-21] >gi|145638604|ref|ZP_01794213.1| F0F1 ATP synthase subunit gamma [Haemophilus influenzae PittII] >gi|144979330|gb|EDJ89016.1| F0F1 ATP synthase subunit gamma [Haemophilus influenzae 22.1-21] >gi|145272199|gb|EDK12107.1| F0F1 ATP synthase subunit gamma [Haemophilus influenzae PittII] (289 aa)
Score = 316, Expect = 2.2e-27, Identities = 89/283 (31%), Positives = 156/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEGKTIWLAFFSS-MGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EIK +I  ++ST KIT AM++V+++K++K ++       Y +   ++ +++   S           E K I +   S+  G+CG  N+N+ K +   IK+      + ++ LIG KG +  +S G   +  L   L D     +L  + A  +   Y+N   I ++ + Y+KFVN++S  P V  L+PL ++ +   L++     D+  +P    + +S+L+ YL + I+ A+V++   E A+R  AM +AT NA  LI + +L +N+ RQ+ IT E+ EIV+GA
  S:     1 MAGAKEIKTKIASVQSTQKITKAMEMVATSKMRKTQDRMAASRPYSETIRNVISHVSKASIGYKHPFLVEREVKKIGILVISTDRGMCGGLNVNLFKTILNQIKNWKEQNISTDLGLIGSKGISFFRSFGFNIKGQLS-GLGDTPALEELIGV-ANTMFDAYRNG-EIDAVYIAYNKFVNTMSQKPVVQQLVPLPES-KDDHLNERQQTWDYLYEPEPKALLDSLLVRYLESQIYQAVVDNLASEQAARMVAMKAATDNAGNLINDLRLVYNKARQASITNELNEIVAGA 286
>gi|189426220|ref|YP_001953397.1| ATP synthase F1, gamma subunit [Geobacter lovleyi SZ] >gi|189422479|gb|ACD96877.1| ATP synthase F1, gamma subunit [Geobacter lovleyi SZ] (288 aa)
Score = 316, Expect = 2.2e-27, Identities = 88/284 (30%), Positives = 160/284 (56%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEGKTIWLAFFSS-MGLCGSFNLNIVKELQKHIKSND------EIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKY-KNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAK 284
           MASL  IKKRI  +++T +IT AMK+VS+AKL++ +E  +    Y +K  ++   +  N +  +  L +  + K + L   +S  GLCG FN N+ K  +++IK          I  +G+KG   +KS+    +   ++       N+    ++A++++  Y   +Y+   + ++++ F   +S   +   LLP++    + ++    NG ++  +P+ +D+   IL   +   I  A++ES   E+ +R  AMDSA+KNA+E+I    L++NR RQ+ IT E+ EI+SGA+
  S:     1 MASLKSIKKRIVSVKNTRQITKAMKMVSAAKLRRAQENVVAARPYAQKMGEVLQSLAGNLEGNLHPLLEKRDAKKLLLIVVTSDRGLCGGFNTNLCKAGERYIKEKQAEFDQISIMTVGRKGYEFLKSRHTVYKNFANML---SKPNYQAAAMLAQDVIEGYLAEEYD--QVVMLFNSFRTVMSQDITFQQLLPIEP---EEKIAADENGVEYIYEPSVSDLLTEILPKNIEVQIFKAMLESVAGEHGARMTAMDSASKNASEMIGKLTLQYNRARQAAITTELMEIISGAE 284
>gi|148975563|ref|ZP_01812434.1| putative ATP synthase F1, gamma subunit [Vibrionales bacterium SWAT-3] >gi|145964991|gb|EDK30242.1| putative ATP synthase F1, gamma subunit [Vibrionales bacterium SWAT-3] (289 aa)
Score = 316, Expect = 2.3e-27, Identities = 86/285 (30%), Positives = 155/285 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNS-DSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKG-IEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           MAS  EI+ +I  + +T KIT+AM++V+++K++K ++       Y +    + +++ S S + +   L++ E  +  ++   S  GLCG  N N+ K++ + ++         E  LIG K  +  +  G + A+ S    L D     D+   +  N +  + ++  I S+ ++Y++FVN++   P+   LLP     E     K     D+  +    D+   +L  Y+ + ++  IVES  CE A+R  AM +AT NA +LI + +L +N+ RQ+ ITQE++EIVSGA+ 
  S:     1 MASTKEIRTKIASVSNTQKITSAMEMVAASKMRKVQDNMTQTRPYAENMRKVISHVASGSLEYQHPYLQQREPKRVAYIIISSDRGLCGGLNSNLFKKVLEEMEQWRAKGVEVETTLIGSKAISFFQRGGNVIAQTS---GLGDAPKLEDILGTV--NAMLGHYDEGKIDSLYLVYNQFVNTMVQAPTTLQLLPHPSDSEADGEAKKERRWDYIYEQAPRDILSELLHRYIESQVYQGIVESIACEQAARMVAMKAATDNAGQLIDDLQLVYNKTRQAAITQELSEIVSGAQA 288
>gi|71282166|ref|YP_266829.1| F0F1 ATP synthase subunit gamma [Colwellia psychrerythraea 34H] >gi|82592642|sp|Q48AW1|ATPG_COLP3 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|71147906|gb|AAZ28379.1| ATP synthase F1, gamma subunit [Colwellia psychrerythraea 34H] (287 aa)
Score = 315, Expect = 2.5e-27, Identities = 85/283 (30%), Positives = 164/283 (57%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIK-SNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKEL------QKHIKSNDEIWLIGKKGKNLIKSKG--IEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EIK +I  +++T KIT+AM++V+++K++K +E       Y     ++  +I   N +     +++ E  +  ++   +  GLCG  N+N+ K++      ++   +  E  ++G K  +   + G  + A+IS    L D     DL   +A  ++ K  ++  I  + V+Y+KFVN+++   ++  LLPL K+ +    ++ ++  D+  +P+AN + + +L+ Y+ + ++  +VE+  CE A+R  AM +AT NA +LI + +L +N+ RQ+ ITQE+ EIV+GA
  S:     1 MAVGKEIKTKIASVKNTQKITSAMEMVAASKMRKAQEGMAASRPYATNIRNVIGHIALGNLEYRHPYMEERETKRVGYIVVSTDRGLCGGLNINLFKKVLADAAEKQASGAEVEFGVVGSKATSFFNNMGAKVSAQIS---GLGDSPSLTDLVGSVA--VMLKAYDNGEIDKLYVVYNKFVNTMTQDATIDQLLPLPKSDD----EEISHRWDYIYEPDANSLLDKLLVRYIESQVYQGVVENIACEQAARMVAMKAATDNAGDLIDDLQLVYNKARQAAITQELGEIVAGA 283
>gi|75530777|sp|Q93Q45|ATPG_CLOPA ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|14715605|gb|AAK72442.1|AF283808_7 ATP synthase gamma subunit [Clostridium pasteurianum] (281 aa)
Score = 315, Expect = 2.5e-27, Identities = 98/285 (34%), Positives = 148/285 (51%)
  Q:     2 ASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDIN----FDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKGE 286
           A L  IK+RI+ I +T KIT AM L++++ L+K +        YY  F D+   + S    E +    +   + +++   S  GLCG FN N+V      I  + E  LI   G+   K +G    +  D   +  DI           I+E+ L+ Y N   I  I ++YSKF++++     +  +LP D        D   +G+    +P  N++ E I+  YL + +   ++ SK  E AS+  AMDSATKNANEL+ +  L +NR RQS ITQEITEIVSGA+ +
  S:     3 AGLITIKRRIQSITNTRKITKAMGLIATSTLRKARRNLDANLSYYSSFEDVMKKVSSGILGENIYTNGNGSKEKLYITMTSDAGLCGGFNGNVVNAAVSEISKDRENSLIMSVGQ---KGRGYFKRLQYDTIAEYVDIQNEPTLTEAKTISEHALSLY-NKGEIGEINIVYSKFISTIKQDIIIKRVLPFDMK------DIKYDGS-IEFEPEINELIEGIVAVYLKSQLFNFLLNSKASEQASKMTAMDSATKNANELLDDLNLRYNRIRQSAITQEITEIVSGAEAQ 280
>gi|86160764|ref|YP_467549.1| ATP synthase F1, gamma subunit [Anaeromyxobacter dehalogenans 2CP-C] >gi|123497399|sp|Q2IHQ1|ATPG_ANADE ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|85777275|gb|ABC84112.1| ATP synthase F1, gamma subunit [Anaeromyxobacter dehalogenans 2CP-C] (289 aa)
Score = 315, Expect = 2.6e-27, Identities = 87/285 (30%), Positives = 159/285 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSE------ILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDE------IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDY---NIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           M SL +I+ RI  + ST +IT AMK+VS+AKL++ ++  L    Y        + + + + +E      +L+ +     + + +   S  GL G FN NI + +Q+ +  N +      +  +GKKG+   K++      +L +  D   I+ +L +  AE L  +    Y    + ++ + Y++F +++S   +V  LLP+D +           G DF  +P+   +   +L  ++A  +  A++ES   E+ +R +AM+SATKNA E+I +  L++NR RQ+ +T+E++EIVSGA+ 
  S:     1 MPSLRDIRTRIGSVRSTRQITKAMKMVSAAKLRRAQDAVLKTRPYAMLLDQTLSRLAARAAAEEQVAHPLLAPRAQRTAEVVVVT--SDRGLAGGFNSNICRFVQRFLTENADRFERIALATVGKKGREYFKAR------NLPIRRDYTGIHANLAYEKAEALAREATERYLAGEVDAVFLAYNEFKSAISQKQAVVQLLPVDTSAAS----ADTAGVDFRYEPSREALLADLLPRHVAMQVWRALLESAASEHGARMSAMESATKNAEEMIASLSLQYNRARQAYVTKELSEIVSGAEA 288
>gi|84683666|ref|ZP_01011569.1| ATP synthase subunit C [Rhodobacterales bacterium HTCC2654] >gi|84668409|gb|EAQ14876.1| ATP synthase subunit C [Rhodobacterales bacterium HTCC2654] (292 aa)
Score = 315, Expect = 2.7e-27, Identities = 94/285 (32%), Positives = 163/285 (57%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI---KSNSDSEILSLKKSEEGKTIWLAFFSS-MGLCGSFNLNIVK------ELQKHIKSNDEIWLIGKKGKNLIKSKGIEAEIS-LDLELDDKDINFDLFHIIAENLLAKYK-NDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPN----NGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           M SL ++K RI  ++ST KIT AM++V++AKL++ +E       Y ++F  +   +    + SD+  + L+ +   +   L   ++  GLCG FN +IVK      E  K      +I  +GKKG+  +K    +  I  +DL  + K+I +     IA +LLA++   D+++ +I   Y++F N +S  P+   ++P        + D P+     G  +  +P+  +V  ++L   +AT I  A++E+   E  +R +AMD+AT+NA E+I    +E+NR RQ+ IT E+ EI+SGA+ 
  S:     1 MPSLKDLKNRIDTVKSTRKITKAMQMVAAAKLRRAQEAAEASRPYTERFNAVLGGLAKASAGSDAAPILLRGTGSDQVQLLVVMTAERGLCGGFNSSIVKLAKQKAETLKGEGKTVKILTVGKKGREQLKRDYGDLLIGHVDLS-EVKNIGYANAQEIANDLLARFDAGDFDVATI--FYNRFENVVSQIPTAVQVIP-------AKFDTPSESDETGYVYDYEPSEEEVLATLLPKGVATAIFSALLENGASEQGARMSAMDNATRNAGEMIDKLTIEYNRSRQAVITNELIEIISGAEA 291
>gi|160893774|ref|ZP_02074558.1| hypothetical protein CLOL250_01328 [Clostridium sp. L2-50] >gi|156864759|gb|EDO58190.1| hypothetical protein CLOL250_01328 [Clostridium sp. L2-50] (294 aa)
Score = 315, Expect = 2.8e-27, Identities = 101/285 (35%), Positives = 164/285 (57%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLN-ESIYYKKFYDLFTYIKSNSDSEILSLK-----KSEEGKTIWLAFFSSMGLCGSFNLNIVK----ELQKHIKSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGAD-----FSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           MAS  EI+ RIK I+ T KITNAM ++SS+KLKK K+   N E  +Y     L   ++   D + L  +     K E  K  ++   +  G+ G++N NI+K    EL  H  S  E++++G+ G++    K +  +I       +  ++     +IA+ +L  Y++   I  + +IY+K +NS++  P +  LLP  K      +D   + AD       I+P+   V + I+ +Y+   I+GA+VES   E  SR  AMDSAT++A +++ +  +++NR RQ+ ITQEITE+V GAK 
  S:     1 MASTKEIQNRIKSIKDTMKITNAMYMISSSKLKKAKKDLENTEPYFYTLQVSLARLLRHLPDMDHLYFENEDDEKKENPKRGYIVVTADKGMAGAYNHNIIKIAEEELANHPDS--ELYVVGQVGRHYFARKNVPVDIHFQYTAQNPSLH--RARVIADKMLENYESG-KIDEVYIIYTKMINSVTAEPEMIQLLPFRK------IDFKISQADVYHEEIIIEPSPRAVMDRIVPNYITGFIYGALVESFCSEQNSRMMAMDSATRSAKDMLADLSIKYNRARQAAITQEITEVVGGAKA 289
>gi|145301173|ref|YP_001144014.1| F0F1 ATP synthase subunit gamma [Aeromonas salmonicida subsp. salmonicida A449] >gi|166222516|sp|A4STP4|ATPG_AERS4 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|142853945|gb|ABO92266.1| F0F1 ATP synthase subunit gamma [Aeromonas salmonicida subsp. salmonicida A449] (288 aa)
Score = 315, Expect = 2.8e-27, Identities = 86/283 (30%), Positives = 159/283 (56%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIK------SNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  +++T KIT AM++V+++K+++ +E       Y +    +  +I + N + +   L + E  +  ++   +  GLCG  N+N+ K     +K      +  ++ LIG K  +  +  G + +  +    D+  +N DL  I +  ++ K  ++  I  + ++Y+KFVN++   P V  LLPL    E  +L K ++  D+  +P+   + +++LI Y+ + ++  +VE+   E A+R  AM +AT NA  LI + +L +N+ RQ+ ITQE+TEIVSGA
  S:     1 MAGAKEIRNKIGSVKNTQKITGAMEMVAASKMRRAQERMSASRPYAETMRKVIGHIAQGNLEYKHPYLMEREVKRVGYIVVSTDRGLCGGLNINLFKAALNDMKQWSAKGAKVDLALIGNKASSFFERHGAKVQAHVAGLGDNPSVN-DL--IGSVKVMLKAYDNGEIDRLYLVYNKFVNTMVQQPRVDQLLPL-PVTEDSKLAKKHHW-DYIYEPDPKQLLDTLLIRYVESQVYQGVVENLASEQAARMVAMQAATDNAGNLINDLQLVYNKARQASITQELTEIVSGA 285
>gi|148825241|ref|YP_001289994.1| F0F1 ATP synthase subunit gamma [Haemophilus influenzae PittEE] >gi|166215096|sp|A5UA10|ATPG_HAEIE ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|148715401|gb|ABQ97611.1| F0F1 ATP synthase subunit gamma [Haemophilus influenzae PittEE] (289 aa)
Score = 315, Expect = 2.9e-27, Identities = 90/283 (31%), Positives = 155/283 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEGKTIWLAFFSS-MGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EIK +I  ++ST KIT AM++V+++K++K ++       Y +   ++ +++   S           E K I +   S+  G+CG  N+N+ K     IK+      + ++ LIG KG +  +S G   +  L   L D     +L  + A  +   Y+N   I +I + Y+KFVN++S  P V  L+PL ++ +   L++     D+  +P    + +S+L+ YL + I+ A+V++   E A+R  AM +AT NA  LI + +L +N+ RQ+ IT E+ EIV+GA
  S:     1 MAGAKEIKTKIASVQSTQKITKAMEMVATSKMRKTQDRMAASRPYSETIRNVISHVSKASIGYKHPFLVEREVKKIGILVISTDRGMCGGLNVNLFKTTLNQIKNWKEQNISTDLGLIGSKGISFFRSFGFNIKGQLS-GLGDTPALEELIGV-ANTMFDAYRNG-EIDAIYIAYNKFVNTMSQKPVVQQLVPLPES-KDDHLNERQQTWDYLYEPEPKALLDSLLVRYLESQIYQAVVDNVASEQAARMVAMKAATDNAGNLINDLRLVYNKARQASITNELNEIVAGA 286
>gi|110680694|ref|YP_683701.1| F0F1 ATP synthase subunit gamma [Roseobacter denitrificans OCh 114] >gi|123172162|sp|Q162S8|ATPG_ROSDO ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|109456810|gb|ABG33015.1| ATP synthase F1, gamma subunit [Roseobacter denitrificans OCh 114] (291 aa)
Score = 315, Expect = 3.1e-27, Identities = 91/285 (31%), Positives = 166/285 (58%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIK-----SNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYK-NDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           M SL ++K RI+ ++ST KIT AM++V++AKL++ +E       Y ++F  +   +      S+S  ++LS   S++ + + +   S  GLCG FN NI K  + H +       + +I  +GKKG++ +K       I      + K +++     IA+++L ++   ++++ +I   Y+KFVN +S  P+   ++P     E+   ++ +   D+  +P+   +   +L   +AT I  A++E+   E  +R +AMD+AT+NA E+I+N  +EFNR RQ+ IT E+ EI+SGA+ 
  S:     1 MPSLKDLKNRIESVKSTRKITKAMQMVAAAKLRRAQEAAEQSRPYTERFNAVMAGLAASVGGSDSAPKLLSGTGSDKVQLL-IVMTSERGLCGGFNTNIAKLARAHAQKLQGEGKDVKILTVGKKGRDQLKRDLGSLFIGHVDLTEIKRVSYVDAQGIAKDVLNRFDVGEFDVATI--FYAKFVNVVSQIPTAQQIIP--AKFEQQEGEEASTLFDY--EPDEEAILADLLPRGVATQIFSALLENGASEQGARMSAMDNATRNAGEMIENLTIEFNRSRQAVITNELIEIISGAEA 290
>gi|24376220|ref|NP_720264.1| F0F1 ATP synthase subunit gamma [Shewanella oneidensis MR-1] >gi|81744608|sp|Q8E8B9|ATPG_SHEON ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|24351280|gb|AAN57707.1|AE015907_5 ATP synthase F1, gamma subunit [Shewanella oneidensis MR-1] (286 aa)
Score = 314, Expect = 3.2e-27, Identities = 85/283 (30%), Positives = 158/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNS-DSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EIK +I  +++T KIT+AM++V+++K+++ +E       Y +    +  ++   S + +   L+  E  +  ++   +  GLCG  N+N+ K++   +KS        E   IG +     KS G +         D   +N DL   + + +L  Y N+  +  + V+++KFVN+++ TP +  LLPL K+ +    D+  +  D+  +P+   + +++L+ Y+ + ++  +VE+   E A+R  AM +AT NA  LI + +L +N+ RQ+ ITQE++EIVSGA
  S:     1 MAGAKEIKTKIASVKNTQKITSAMEMVAASKMRRAQERMAASRPYAESMRKVIGHVAQGSLEYKHPYLEVREAKRVGYIVVATDRGLCGGLNVNLFKKVVADVKSWKEQGAEFEFCPIGARSVQFFKSFGGQVSAQASGLGDAPKLN-DLIGTV-QVMLEAY-NEGKLDRLYVVFNKFVNTMTQTPVIEQLLPLPKSED----DEVAHRWDYIYEPDPKALLDTLLVRYVESQVYQGVVENIASEQAARMVAMKAATDNAGTLIDDLQLVYNKARQAAITQELSEIVSGA 283
>gi|84500101|ref|ZP_00998367.1| ATP synthase subunit C [Oceanicola batsensis HTCC2597] >gi|84392035|gb|EAQ04303.1| ATP synthase subunit C [Oceanicola batsensis HTCC2597] (293 aa)
Score = 314, Expect = 3.3e-27, Identities = 92/285 (32%), Positives = 164/285 (57%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSN---SDSEILSLKKSEEGKTIWLAFFSS-MGLCGSFNLNIVKELQKHIK------SNDEIWLIGKKGKNLIKSKGIEAEIS-LDLELDDKDINFDLFHIIAENLLAKYKN-DYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           M SL ++K RI+ I+ST KIT AM++V++AKL++ +E   N   Y ++F  +   + ++   SDS  L L+ + +     L   ++  GLCG FN NIVK  ++ I          +I  +GKKG+  +K    ++ +  +DL  + K I +     IA++LL +++  ++++ +I   YS+F N ++  P+   ++P   + E    +       +  +P+   +   +L   +AT I  A++E+   E  +R +AMD+AT+NA E+I    +E+NR RQ+ IT E+ EI+SGA+ 
  S:     1 MPSLKDLKLRIESIKSTRKITKAMQMVAAAKLRRAQEAAENARPYAERFNAVLGQLAASVGGSDSAPLLLRGTGKDDVHLLVVMTAERGLCGGFNSNIVKLARQKISDLKAAGKTVKILTVGKKGREQLKRDHADSFVGHVDLT-EVKRIGYANAQDIAKDLLGRFEEGEFDVCTI--FYSEFENVVTQKPTAQQIIP--ASFEASEDEDAGATTLYDYEPDEETILADLLPRGVATQIFAALLENGASEQGARMSAMDNATRNAGEMIDKLTIEYNRSRQAVITNELIEIISGAEA 292
>gi|118046008|ref|ZP_01514663.1| ATP synthase F1, gamma subunit [Chloroflexus aggregans DSM 9485] >gi|117997563|gb|EAV11749.1| ATP synthase F1, gamma subunit [Chloroflexus aggregans DSM 9485] (290 aa)
Score = 314, Expect = 3.6e-27, Identities = 85/283 (30%), Positives = 156/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKS---NSDSEILSLKKSEEGKTIWLAFFS-SMGLCGSFNLNIVKEL------QKHIKSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MAS  EIK+RI+ +++ ++IT AM++VS++K+++ +   L    Y  +  ++   + +    +      L+K E  K++ L   +   GLCGS   N+++        Q+ +    +++  G+KG++     G  A     + L D      +  +    +       Y+   + +IYS+F+N+L   P++  LLP    +E P +    N  D++ +P+  DV  SIL  Y+ T I+ A++ES   E+++R  AM +AT NA +L+++  L FN+ RQ+ IT+E++EI SGA
  S:     1 MASSREIKRRIRSVKNVAQITRAMEMVSASKMRRAQRNVLATRPYADRMREVMANLTARVVGAARRGTLLEKRETVKSVALLVVTPDRGLCGSLVANVLRRAGRFITEQRAMGRTVDVYTFGRKGRDFFLRTGF-APAGEAIRLGDAPKLEAILGVAISAISGFQSGKYD--ELYIIYSEFINTLVQRPAIKQLLP----VESPDISTTIN-VDYTYEPSEEDVLNSILPRYVETQIYQAVLESIASEHSARMVAMRNATNNAKDLVRDLTLSFNKARQAAITKEVSEIASGA 285
>gi|148827676|ref|YP_001292429.1| F0F1 ATP synthase subunit gamma [Haemophilus influenzae PittGG] >gi|166215097|sp|A5UGZ0|ATPG_HAEIG ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|148718918|gb|ABR00046.1| F0F1 ATP synthase subunit gamma [Haemophilus influenzae PittGG] (289 aa)
Score = 314, Expect = 3.7e-27, Identities = 89/283 (31%), Positives = 156/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEGKTIWLAFFSS-MGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EIK +I  ++ST KIT AM++V+++K++K ++       Y +   ++ +++   S           E K I +   S+  G+CG  N+N+ K +   IK+      + ++ LIG KG +  +S G   +  L   L D     +L  + A  +   Y+N   I ++ + Y+KFVN++S  P V  L+PL ++ +   L++     D+  +P    + +S+L+ YL + I+ A+V++   E A+R  AM +AT NA  LI + +L +N+ RQ+ IT E+ EIV+GA
  S:     1 MAGAKEIKTKIASVQSTQKITKAMEMVATSKMRKTQDRMAASRPYSETIRNVISHVSKASIGYKHPFLVEREVKKIGILVISTDRGMCGGLNVNLFKTILNQIKNWKEQNISTDLGLIGSKGISFFRSFGFNIKGQLS-GLGDMPALEELIGV-ANTMFDAYRNG-EIDAVYIAYNKFVNTMSQKPVVQQLVPLPES-KDDHLNERQQTWDYLYEPEPKVLLDSLLVRYLESQIYQAVVDNLASEQAARMVAMKAATDNAGNLINDLRLVYNKARQASITNELNEIVAGA 286
>gi|169188268|ref|ZP_02848414.1| ATP synthase F1, gamma subunit [Paenibacillus sp. JDR-2] >gi|169004917|gb|EDS51772.1| ATP synthase F1, gamma subunit [Paenibacillus sp. JDR-2] (286 aa)
Score = 313, Expect = 4.1e-27, Identities = 91/283 (32%), Positives = 154/283 (54%)
  Q:     4 LNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDS-EILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHI----KSNDE--IWLIGKKGKNLIKSKG---IEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNG--ADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKGE 286
           + +IK+ IK  ++  +IT AM++V+++KL++ +E       Y  K  ++   I + S   +   L+     KT +L   S  GL G +N N+++++ + I    KSNDE  +++IG+KG++  + +    I+  I L       DI    ++ +      KY   Y      + Y++FVN+++  P+   LLPL +           NG    +  +P+   V E +L  Y  T I+ A+++ K  E  +R  AM SATKNAN++I    L +NR RQ+ ITQEI+EIV+GA  +
  S:     5 MRDIKREIKSKQNMKQITKAMEMVAASKLRRAQEASTKARPYSDKLKEVVASIAAGSKGVKHPMLETRPVQKTGYLVITSDRGLAGGYNANVLRKVTQTIREKHKSNDEYVLFVIGRKGRDYFRRRNMPIIDEVIGLSDSPTFADIKSVAYNAVKMFSEGKYDELY------ICYNQFVNAITQIPTETRLLPLQEV--------SGNGPVTSYEYEPSPEGVLEVLLPKYAETLIYSAVLDGKASEQGARMTAMGSATKNANKMINQLTLTYNRARQAAITQEISEIVAGANAQ 285
>gi|117620323|ref|YP_858680.1| ATP synthase F1, gamma subunit [Aeromonas hydrophila subsp. hydrophila ATCC 7966] >gi|166222515|sp|A0KQX9|ATPG_AERHH ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|117561730|gb|ABK38678.1| ATP synthase F1, gamma subunit [Aeromonas hydrophila subsp. hydrophila ATCC 7966] (288 aa)
Score = 313, Expect = 4.1e-27, Identities = 86/283 (30%), Positives = 159/283 (56%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIK------SNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  +++T KIT AM++V+++K+++ ++       Y +    +  +I + N + +   L + E  +  ++   +  GLCG  N+N+ K     +K      +  ++ LIG K  N  +  G + +  +    D+  +N DL  I +  ++ K  ++  I  + ++Y+KFVN++   P V  LLPL    E  +L K ++  D+  +P+   + +++LI Y+ + ++  +VE+   E A+R  AM +AT NA  LI + +L +N+ RQ+ ITQE+TEIVSGA
  S:     1 MAGAKEIRNKIGSVKNTQKITGAMEMVAASKMRRAQDRMSASRPYAETMRKVIGHIAQGNLEYKHPYLIEREVKRVGYIVVSTDRGLCGGLNINLFKAALNDMKQWSAKGAKVDLALIGNKASNFFERHGAKVKAHVAGLGDNPSVN-DL--IGSVKVMLKAYDNGEIDRLYLVYNKFVNTMVQQPRVDQLLPL-PVTEDSKLAKKHHW-DYLYEPDPKQLLDTLLIRYVESQVYQGVVENLASEQAARMVAMQAATDNAGNLINDLQLVYNKARQASITQELTEIVSGA 285
>gi|170744669|ref|YP_001773324.1| ATP synthase F1, gamma subunit [Methylobacterium sp. 4-46] >gi|168198943|gb|ACA20890.1| ATP synthase F1, gamma subunit [Methylobacterium sp. 4-46] (292 aa)
Score = 313, Expect = 4.2e-27, Identities = 83/285 (29%), Positives = 162/285 (56%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFY----DLFTYIKSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKGIEAEISLDLELDD-KDINFDLFHIIAENLLAKYK-NDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           M SL +++ RI  +++T KIT AM++V++AKL++ +    N   Y ++      +L T +   +++  L      +   + L   +  GLCG+FN +I +  + H +         +I  +GKKG ++++ +  +  + L +EL   + + FD    IA+NLL +++  +++I ++   YS+F + +   P+   ++P +     P  +     A +  +P+  ++  ++L   L   I  A++E+   E  +R +AMD+AT+NA E+IK   L +NR RQ++IT+E+ EI+SGA+ 
  S:     1 MPSLKDLRNRIASVKATQKITKAMQMVAAAKLRRAQNAAENARPYAERMAAVLGNLATNLTPGAETPRLLSGTGADRVHLLLVCTAERGLCGAFNSSIARLARDHARRLTAEGRTVKIICVGKKGYDILRREFRDQIVEL-IELRGVRQLGFDNAETIAQNLLGRFEAGEFDIATL--FYSRFRSVIVQIPTAQQIIPAEIP---PAGEAAQTDAAYEYEPDEGEILAALLPKNLTVQILRALLENAASEQGARMSAMDNATRNAGEMIKKQTLVYNRTRQAQITKELIEIISGAEA 291
>gi|54301815|ref|YP_131808.1| putative ATP synthase F1, gamma subunit [Photobacterium profundum SS9] >gi|81697237|sp|Q6LKZ7|ATPG2_PHOPR ATP synthase gamma chain 2 (ATP synthase F1 sector gamma subunit 2) >gi|46915235|emb|CAG22008.1| putative ATP synthase F1, gamma subunit [Photobacterium profundum SS9] (291 aa)
Score = 313, Expect = 4.2e-27, Identities = 90/285 (31%), Positives = 167/285 (58%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNS-DSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVK----ELQKHIKSNDEI--WLIGKKGKNLIKSKG-IEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPL-DKAIEKPRLDKPNNGA---DFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           MA+  EI+ +I  +++T KIT+AM++V+++K++K ++       Y +    + +++ S S + +   L++ E  +  ++   S  GLCG  N N+ K    ++++  + N E+   LIG K  +     G + A+ S    L DK    DL   +   L  ++ +D  I  + ++Y++FVN++   P +  LLP  DK  ++ +  KPN+     D+  +P+  D+  ++++ Y+ + ++   VES  CE A+R  AM SAT NA ++I + +L +N+ RQS ITQE++EIV+GA+ 
  S:     1 MANAKEIRTKIASVQNTQKITSAMEMVAASKMRKVQDNMAATRPYAENMRKVISHVASGSLEYKHPYLEEREAKRVAYIIISSDRGLCGGLNSNLFKRALTDMRQWQEKNVEVDLTLIGSKAISFFHRFGNVIAQTS---GLGDKPKLEDLLGAVTAML--EHFDDGKIDRLYLVYNEFVNTMVQNPRITQLLPHPDK--DESQDSKPNDATSRWDYIYEPDPKDILNALMLRYIESQVYQGTVESIACEQAARMVAMKSATDNAGDIINDLQLVYNKARQSAITQELSEIVAGAQA 290
>gi|120556780|ref|YP_961131.1| ATP synthase F1, gamma subunit [Marinobacter aquaeolei VT8] >gi|166215105|sp|A1U7H5|ATPG_MARAV ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|120326629|gb|ABM20944.1| ATP synthase F1, gamma subunit [Marinobacter aquaeolei VT8] (287 aa)
Score = 313, Expect = 4.6e-27, Identities = 87/283 (30%), Positives = 155/283 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKG--IEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGA--DFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  I+ST KIT+AM++V+++K++K +E       Y +K   +  +I KSN D     +++ E  +  ++   S  GLCG  N N  K L + ++         +I  IG+KG +  ++ G  + A ++   +    D       ++ ++ +     +  I  + +I ++FVN+++ +P    LLPL      P  D    G   D+  +P++  + + ++  Y+ + ++  +VE+  CE A+R  AM SAT NA  +I   +L +N+ RQ+ ITQEI+EIVSGA
  S:     1 MAVGKEIRNQIGSIKSTQKITSAMEMVAASKMRKAQERMQATRPYAEKMRQVIGHIAKSNKDYRHPFMQEREVKRVGYIVVSSDRGLCGGLNTNAFKLLVREMREWKQQGIETDICAIGQKGASFFRNYGGNVVAAVTHLGDSPSADQLIGSVKVMLDSFV-----EGKIDRLFLISNEFVNTMTQSPKALQLLPL------PEGDDEEIGHQWDYIYEPDSRPILDGLMPRYIESQVYQGVVENLACEQAARMIAMKSATDNAGSIIDELQLAYNKARQAAITQEISEIVSGA 283
>gi|157149821|ref|YP_001450822.1| F0F1 ATP synthase subunit gamma [Streptococcus gordonii str. Challis substr. CH1] >gi|189081483|sp|A8AYG2|ATPG_STRGC ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|157074615|gb|ABV09298.1| ATP synthase F1, gamma subunit [Streptococcus gordonii str. Challis substr. CH1] (293 aa)
Score = 313, Expect = 4.9e-27, Identities = 92/281 (32%), Positives = 151/281 (53%)
  Q:     3 SLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILS----LKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQK-----HIKSND-EIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           SLN+IK +I   ++TS+ITNAM++VS+AKL K +E   N  IY  K   L T +    ++E       L      KT ++   S  GL G +N  I+K + +     H   +D EI  IG  G +  +++G++    L    D    +FD    I    +  Y+N+     + V Y+  VNSL+    +  +LP+      P     +   +  ++ +   + + +L  +  + I+GAI+++K  ENA+   AM +AT NA ++I +  +++NR RQ+ ITQEITEIV+GA
  S:     4 SLNDIKNKIASTKNTSQITNAMQMVSAAKLGKSEEAAKNFQIYASKVRKLLTDLLHGHEAENAKYHPMLTSRPVKKTGYIVITSDRGLVGGYNATILKAMMELKAEYHPMGDDFEILCIGGVGADFCRARGVQPVYELRGLADQP--SFDEVRKIINKAIEMYQNEL-FDELYVCYNHHVNSLTSQMRIEQMLPIIDL--DPNEADEDYTVNLELESSREAILDQLLPQFAESMIYGAIIDAKTAENAAGMTAMQTATDNAKKVISDLTIQYNRARQAAITQEITEIVAGA 289
>gi|91786237|ref|YP_547189.1| ATP synthase F1, gamma subunit [Polaromonas sp. JS666] >gi|122968291|sp|Q12GQ1|ATPG_POLSJ ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|91695462|gb|ABE42291.1| ATP synthase F1, gamma subunit [Polaromonas sp. JS666] (288 aa)
Score = 313, Expect = 4.9e-27, Identities = 89/283 (31%), Positives = 158/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEGK-TIWLAFFSSMGLCGSFNLNIVKELQKHIKS-----NDEIWL-IGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA+  EI+ +IK +E+T KIT AM++V+++K++K +E       Y  K  ++   +   +     +  +S + K T ++   +  GLCG  N N+++ +   +K      +D + + IG KG   +   G +  +S   +L DK     L   + + LL  Y ++  I ++ + Y+KF+N++   P V  LLPL  A    + DK  +G D+  +P+A  V + +L+ Y+   I+ A+ E+   E ++R  AM +AT NA  +I   KL +N+ RQ+ IT+E++EIV+GA
  S:     1 MAAGKEIRGKIKSVENTKKITKAMEMVAASKMRKAQERMRAARPYSDKIRNVAANLSQANPEYTHAFMESNDAKATGFIVVTTDKGLCGGLNTNVLRAVTSKLKDLQAAGHDALAVAIGNKGLGFLNRVGAKV-VSHATQLGDKPHLEKLIGPV-KVLLDAY-SEGKINAVYLCYTKFINTMRQEPVVEQLLPLTAA--HLQADKDQHGWDYIYEPDAQTVIDDLLLRYVEALIYQAVAENMASEQSARMVAMKAATDNAGSVIGELKLIYNKTRQAAITKELSEIVAGA 285
>gi|68249082|ref|YP_248194.1| F0F1 ATP synthase subunit gamma [Haemophilus influenzae 86-028NP] >gi|81336512|sp|Q4QN63|ATPG_HAEI8 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|68057281|gb|AAX87534.1| ATP synthase gamma chain [Haemophilus influenzae 86-028NP] (289 aa)
Score = 313, Expect = 5.2e-27, Identities = 89/283 (31%), Positives = 158/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EIK +I  ++ST KIT AM++V+++K++K ++       Y +   ++ +++ K++   +   L + E  K   L   +  G+CG  N+N+ K     IK+      + ++ LIG KG +  +S G   +  L   L D     +L  + A  +   Y+N   I ++ + Y+KFVN++S  P V  L+PL ++ +   L++     D+  +P    + +S+L+ YL + I+ A+V++   E A+R  AM +AT NA  LI + +L +N+ RQ+ IT E+ EIV+GA
  S:     1 MAGAKEIKTKIASVQSTQKITKAMEMVATSKMRKTQDRMAASRPYSETIRNVISHVSKASIGYKHPFLVECEVKKIGILVISTDRGMCGGLNVNLFKTTLNQIKNWKEQNISTDLGLIGSKGISFFRSFGFNIKGQLS-GLGDTPALEELIGV-ANTMFDAYRNG-EIDAVYIAYNKFVNTMSQKPVVQQLVPLPES-KDDHLNERQQTWDYLYEPEPKALLDSLLVRYLESQIYQAVVDNLASEQAARMVAMKAATDNAGNLINDLRLVYNKARQASITNELNEIVAGA 286
>gi|119475221|ref|ZP_01615574.1| ATP synthase subunit C [marine gamma proteobacterium HTCC2143] >gi|119451424|gb|EAW32657.1| ATP synthase subunit C [marine gamma proteobacterium HTCC2143] (288 aa)
Score = 312, Expect = 6.0e-27, Identities = 91/283 (32%), Positives = 164/283 (57%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNI----VKELQKHIKSNDEI--WLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MAS  EI+ +I  I+ST KIT+AM++V+++K++K ++       Y K+   +  +I  +N + + + + + E  +  ++   +  GLCG  N N+    +K+++ +   N EI   L+G K      S G     ++    +D  I  DL   + + +L  Y +   I  + ++ ++FVN+++  P+V  LLPL +A E   +    +  D+  +P+A ++ E +L  Y+ + ++ A+VE+  CE A+R  AM SAT NA +LI + +L +N+ RQ+ ITQE++EIVSGA
  S:     1 MASGKEIRTQISSIQSTQKITSAMEMVAASKMRKAQDRMRVGKPYAKRIRSVVGHIANANPEHKHMYMLEREVKRVGFIIVSTDRGLCGGLNTNLFKAAIKQMKAYADQNIEIDLALVGAKATGFFNSYGGNIVAAVRDLGEDPSIA-DLIGSV-KVMLDAYGSG-AIDKLYLVGNEFVNTMTQEPTVEQLLPL-QAEENEDM---KHYWDYLYEPDAQELLEGLLTRYIESQVYQAVVENGACEQAARMLAMKSATDNAGDLIDDLQLVYNKARQASITQELSEIVSGA 283
>gi|16272427|ref|NP_438640.1| F0F1 ATP synthase subunit gamma [Haemophilus influenzae Rd KW20] >gi|1168597|sp|P43716|ATPG_HAEIN ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|1573458|gb|AAC22138.1| ATP synthase F1, subunit gamma (atpG) [Haemophilus influenzae Rd KW20] (289 aa)
Score = 312, Expect = 6.3e-27, Identities = 89/283 (31%), Positives = 155/283 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEGKTIWLAFFSS-MGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EIK +I  ++ST KIT AM++V+++K++K ++       Y +   ++ +++   S           E K I +   S+  G+CG  N+N+ K     IK+      + ++ LIG KG +  +S G   +  L   L D     +L  + A  +   Y+N   I ++ + Y+KFVN++S  P V  L+PL ++ +   L++     D+  +P    + +S+L+ YL + I+ A+V++   E A+R  AM +AT NA  LI + +L +N+ RQ+ IT E+ EIV+GA
  S:     1 MAGAKEIKTKIASVQSTQKITKAMEMVATSKMRKTQDRMAASRPYSETIRNVISHVSKASIGYKHPFLVEREVKKIGILVISTDRGMCGGLNVNLFKTTLNQIKNWKEQNISTDLGLIGSKGISFFRSFGFNIKGQLS-GLGDTPALEELIGV-ANTMFDAYRNG-EIDAVYIAYNKFVNTMSQKPVVQQLVPLPES-KDDHLNERQQTWDYLYEPEPKVLLDSLLVRYLESQIYQAVVDNVASEQAARMVAMKAATDNAGNLINDLRLVYNKARQASITNELNEIVAGA 286
>gi|149375663|ref|ZP_01893432.1| F0F1-type ATP synthase, gamma subunit [Marinobacter algicola DG893] >gi|149360065|gb|EDM48520.1| F0F1-type ATP synthase, gamma subunit [Marinobacter algicola DG893] (287 aa)
Score = 311, Expect = 7.1e-27, Identities = 87/283 (30%), Positives = 156/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDE------IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYK------NDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  I+ST KIT+AM++V+++K++K +E       Y +K   +  +I K+N   +   + + E  +  ++   +  GLCG  N+N+ K L + +++  E      +  IG+KG +  +S G     +L    D            +E L+   K      ++  I  + ++ ++F N+++ TP V  +LPL    ++  +    N  D+  +P+A  + + +L  Y+ + ++  +VE+  CE A+R  AM SAT NA  +I   +L +N+ RQ+ ITQEI+EIVSGA
  S:     1 MAVGKEIRNQISSIKSTQKITSAMEMVAASKMRKAQERMKATRPYAEKMRQVIGHIAKANVQYKHPFMVEREVKRVGYVVVSTDRGLCGGLNVNLFKALVRDMRAWKEKGVEADLCAIGQKGASFFRSYGGNVVAALTHLGDSPS---------SEKLIGNVKVMLDAFSEGKIDRLYLVSNEFENTMTQTPQVEQILPLPPGEDEEEI---KNQWDYLYEPDARQILDGLLPRYIESQVYQGVVENLACEQAARMIAMKSATDNAGGIIDELQLAYNKARQAAITQEISEIVSGA 284
>gi|194100110|ref|YP_002003250.1| ATP synthase gamma chain [Neisseria gonorrhoeae NCCP11945] >gi|193935400|gb|ACF31224.1| ATP synthase gamma chain [Neisseria gonorrhoeae NCCP11945] (291 aa)
Score = 311, Expect = 7.2e-27, Identities = 87/283 (30%), Positives = 156/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTI-WLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI  +I+ +++T KIT AM++VS++K++K +E       Y +K   + +++ ++N+D  I  L+   E + + ++   S  GLCG  N N++K+    ++        +EI  +G KG    +S G+   ++  + L D      L   + E L  +Y+  + I  I ++YS FVN++   P +  LLP+ + +      KP    ++  +P A  V E ++  YL + ++ A+ ++   E A+R  AM +AT NA   IK  +L +N+ RQ+ IT E++EIV+GA
  S:     1 MAVGKEILTKIRSVQNTQKITKAMQMVSTSKMRKTQERMRLARPYAEKVRMVMSHLAQTNTDHGIPLLESHREIRRVGFILITSDKGLCGGLNANVLKKFLAQVQEYRNQGIEEEIVCLGSKGLMACQSIGLNV-VASAVNLGDTPKMEMLLGPLTE-LFQRYEK-HEIDKIHLVYSGFVNTMRQEPRMEVLLPIGENVIGDSAPKPPFSWEYRYEPTALAVLEYLVRRYLESVVYQALSDNMASEQAARMVAMKAATDNAGNAIKELRLVYNKSRQAAITTELSEIVAGA 288
>gi|56965610|ref|YP_177344.1| F0F1 ATP synthase subunit gamma [Bacillus clausii KSM-K16] >gi|81678696|sp|Q5WB77|ATPG_BACSK ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|56911856|dbj|BAD66383.1| F0F1-type ATP synthase gamma chain [Bacillus clausii KSM-K16] (288 aa)
Score = 311, Expect = 7.3e-27, Identities = 91/283 (32%), Positives = 164/283 (57%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIK----SNDE--IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MASL +IK RI   + T +IT AM++VS+AKL + +E   +  +Y KK  ++   I ++ SD+    L++    KT ++   S  GL G +N ++++++ K I     S DE  I ++G+ G++L++++  +  I   +E+ D+   F+    +A++ +  +  D     + + Y+ FV+ ++   +   LLPL    E    D+ ++ + +  +P+   + E++L  Y  + I+GA++++K  E  +R  AM +AT NA+ LI    L +NR RQ+ ITQEITEIV GA
  S:     1 MASLRDIKNRINSTKKTRQITKAMQMVSAAKLNRAQEKAQSYEVYAKKMREVVGNIAQAGSDTSHPMLEERPVKKTGYILMTSDTGLAGGYNSSLLRDMMKTINERHASEDEYAIIVLGRIGRDLLRTRK-QPIIQEMVEVPDQP-TFNDVSGLAKSSVEMFA-DGVFDELYIWYNHFVSPMTQRVTEQKLLPLASVNEG---DETSSTSLYEFEPSEQQILEAVLPRYAESLIYGALLDAKASEFGARMTAMSAATDNASALIDELTLSYNRARQAAITQEITEIVGGA 284
>gi|126653442|ref|ZP_01725538.1| F0F1-type ATP synthasegamma chain [Bacillus sp. B14905] >gi|126589798|gb|EAZ83931.1| F0F1-type ATP synthasegamma chain [Bacillus sp. B14905] (285 aa)
Score = 311, Expect = 7.4e-27, Identities = 97/283 (34%), Positives = 157/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNS-DSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHI----KSNDE--IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           M +L EIK RI   +ST +IT AM++VSS+KL++ ++       Y +K  D+   I S + DS    L      KT +L   S  GL G++N +I++++Q+ I    KS DE  I  IG+  ++    +     IS  + L D+    D+  I A N +  +  D     + + Y+ FV++++   +   LLPL        L   ++ A +  +P+   + E +L  Y  + ++GA+++ K  E+ASR  AM +AT NA++LI +  L++NR RQ+ ITQEITEIV GA
  S:     1 MVNLREIKGRINSTKSTKQITKAMQMVSSSKLRRAEQNAKAYVPYMEKIQDVVGAIASGTKDSGHPMLTARPVKKTAYLVIGSDRGLAGAYNSSILRQVQRTIDERHKSKDEYVILAIGRVVRDYFVKRDHNV-ISDVVGLPDQPTFADIKEI-ARNAVGMFI-DGTYDQLYMYYNHFVSAIANEVTEKKLLPLTD------LAPASSNASYEFEPSGEAILEVLLPQYAESLVYGALLDGKASEHASRMTAMKNATDNASDLISDLSLQYNRARQAAITQEITEIVGGA 281
>gi|114565196|ref|YP_752710.1| F0F1 ATP synthase subunit gamma [Shewanella frigidimarina NCIMB 400] >gi|122298240|sp|Q07VU3|ATPG_SHEFN ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|114336489|gb|ABI73871.1| ATP synthase F1, gamma subunit [Shewanella frigidimarina NCIMB 400] (286 aa)
Score = 311, Expect = 7.5e-27, Identities = 84/283 (29%), Positives = 159/283 (56%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNS-DSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIK------SNDEIWLIGKKGKNLIKSKGIEAEISLDLE-LDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MAS  EIK +I  +++T KIT+AM++V+++K+++ +E       Y +    +  ++   + + +   L+  +  +  ++   +  GLCG  N+N+ K++   +K      ++ E   IG +     KS G   E+S     L D     DL   +   ++ K  N+  +  + ++++KFVN+++ TP +  LLPL K+ E    +  +   D+  +P+  +V + +L  Y+ + ++  +VE+   E A+R  AM +AT NA E+I + +L +N+ RQ+ ITQE++EIVSGA
  S:     1 MASAKEIKTKIASVKNTQKITSAMEMVAASKMRRAQERMAASRPYAENMRKVIGHVAQGTLEYKHPYLEVRDAKRVGYIVVATDRGLCGGLNVNLFKKVVSDVKKWKEQGADVEFCPIGARSVQFFKSFG--GEVSAHASGLGDAPKLADLIGTV--RVMLKAYNEGKLDRLYIVFNKFVNTMTQTPVIEQLLPLPKSDE----EVASYPWDYIYEPDPKEVLDLLLTRYVESQVYQGVVENIASEQAARMVAMKAATDNAGEMIDDLQLVYNKARQAAITQELSEIVSGA 283
>gi|1773265|gb|AAD13382.1| ATPase, gamma subunit [Streptococcus mutans] (292 aa)
Score = 311, Expect = 7.9e-27, Identities = 99/282 (35%), Positives = 163/282 (57%)
  Q:     2 ASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI------KSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQK-----HIKSND-EIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPL-----DKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
            SL+EIK RI   + T KIT+AMK+VSSAKL K ++   +  IY  K   + T++      K +S+  ++S       KT ++   S  GL G++N  I+K +       H K +D  I  IG  G +  +++ I   ++ +L   + + +F+  + I    +  YKN+     + V YS  +NSL+    V  +LP+     D+A E       +N A+F ++P+   + E +L  Y  + I+GAI+++K  E+A+   AM +AT NA+++I++    +NR RQ+ ITQEITEIV+GA
  S:     3 GSLSEIKVRITSTQKTGKITSAMKMVSSAKLVKSEQAAKDFQIYASKIRQITTHLLHSDLRKGSSNPMLISRPIK---KTAYIVITSDKGLVGAYNSTILKAVMDTIKDYHPKGDDYTIISIGGMGSDFFRARHIP--VAFELHGLEDNPSFEEVNRIISKSVEMYKNEL-FDELYVCYSHHINSLTSQVRVEKMLPISDLDADEASE-------DNVANFELEPSREAILEQLLPQYAESLIYGAIIDAKTAEHAAGMTAMQTATDNADKVIEDLTKLYNRVRQAAITQEITEIVAGA 288
>gi|125717635|ref|YP_001034768.1| F0F1 ATP synthase subunit gamma [Streptococcus sanguinis SK36] >gi|166224117|sp|A3CM13|ATPG_STRSV ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|75535492|sp|Q9ZJ02|ATPG_STRSA ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|4100656|gb|AAD00917.1| proton-translocating ATPase gamma subunit [Streptococcus sanguinis] >gi|125497552|gb|ABN44218.1| Proton-translocating ATPase, F1 sector, gamma subunit, putative [Streptococcus sanguinis SK36] (293 aa)
Score = 311, Expect = 7.9e-27, Identities = 95/281 (33%), Positives = 154/281 (54%)
  Q:     3 SLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILS----LKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQK-----HIKSND-EIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGAD------FSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           SLN+IK +I   ++TS+ITNAM++VS+AKL K +E   N  +Y +K   L T +    ++E       L      K+ ++   S  GL G +N  I+K L +     H    D E+  IG  G +  +++GI+    L    D    +FD    I    +  Y+N+     + V Y+  VNSL+    V  +LP+        +D   N AD        ++ + + + + +L  +  + I+GAI+++K  ENA+   AM +AT NA ++I +  +++NR RQ+ ITQEITEIV+GA
  S:     4 SLNDIKNKIASTKNTSQITNAMQMVSAAKLGKSEEAAKNFQVYAQKVRKLVTDMLHGHEAENARHHSMLISRPVKKSAYIVITSDRGLVGGYNATILKALMELKAEYHPTGEDFEVICIGSVGADFFRARGIQPVYELRGLADQP--SFDEVRKIISKTIEMYQNEL-FDELYVCYNHHVNSLTSQMRVEQMLPI--------IDLDPNEADEDYTLNLELESSRDSILDQLLPQFAESMIYGAIIDAKTAENAAGMTAMQTATDNAKKVISDLTIQYNRARQAAITQEITEIVAGA 289
>gi|192809057|ref|ZP_03037732.1| ATP synthase F1, gamma subunit [Geobacillus sp. Y412MC10] >gi|192801728|gb|EDV78233.1| ATP synthase F1, gamma subunit [Geobacillus sp. Y412MC10] (286 aa)
Score = 311, Expect = 8.1e-27, Identities = 91/283 (32%), Positives = 159/283 (56%)
  Q:     4 LNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDS-EILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHI----KSNDE--IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKGE 286
           L +IK++IK +++T +IT AM++V++AKL++ +E   +   Y +K  ++   I + +       L+K E  KT +L   S  GL G+ N NI++++   I    +S DE  +++IG+KG++  + +G+     L  +L D     D+   IA   + +Y+    I  + + Y++FVN+L+    +  LLP++       +    N   +  +P+   V E +L  Y  T I  A++ +K  E  ++  AM +ATKNA++LI    L +NR RQ+ ITQEI+EIV GA  +
  S:     5 LRDIKRQIKSVQNTRQITKAMEMVAAAKLRRAQEKATSALPYSEKLKEVVGSIAAGTKGISHPMLEKREVKKTGYLVITSDRGLAGASNSNILRKVSNFIAERHQSKDEYCLFVIGRKGRDYFRRRGLPVVEELT-DLSDSPTYADI-KTIANAAVHQYELG-QIDELYLCYNQFVNALTQLQEISKLLPMEN------IGGGENLTGYEYEPSPEGVLEVLLPKYAETLIFSAMLNAKASELGAKMTAMGAATKNASKLINELNLTYNRARQAAITQEISEIVGGANAQ 285
>gi|84385786|ref|ZP_00988816.1| putative ATP synthase F1, gamma subunit [Vibrio splendidus 12B01] >gi|84379102|gb|EAP95955.1| putative ATP synthase F1, gamma subunit [Vibrio splendidus 12B01] (289 aa)
Score = 311, Expect = 8.8e-27, Identities = 86/285 (30%), Positives = 159/285 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNS-DSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINF--DLFHIIAE-----------------NLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           MA+  EI+ +I  + +T KIT+AM++V+++K++K ++       Y +    + +++ S S + +   L++ E  +  ++   S  GLCG  N N+ K++ + +    E+W          ++KG+E E +L   +  K I+F     ++IA+                 N +  + +D  I S+ ++Y++F+N++   P+   LLP     E     K     D+  +    D+   +L  Y+ + ++  IVES  CE A+R  AM +AT NA +LI + +L +N+ RQ+ ITQE++EIVSGA+ 
  S:     1 MANTKEIRTKIGSVSNTQKITSAMEMVAASKMRKVQDNMTLTRPYAENMRKVISHVASGSLEYQHPYLQQREPKRVAYIIISSDRGLCGGLNSNLFKKVLEEM----EMW----------RTKGVEVETTL---IGSKAISFFQRSGNVIAQTSGLGDAPKLEDILGTVNAMLGHYDDEKIDSLYLVYNQFINTMVQEPTTLQLLPHPSDSEGDGGAKKARRWDYIYEQAPRDILSELLHRYIESQVYQGIVESIACEQAARMVAMKAATDNAGQLIDDLQLVYNKARQAAITQELSEIVSGAQA 288
>gi|88711565|ref|ZP_01105653.1| H+-transporting two-sector ATPase, gamma subunit [Flavobacteriales bacterium HTCC2170] >gi|88710506|gb|EAR02738.1| H+-transporting two-sector ATPase, gamma subunit [Flavobacteriales bacterium HTCC2170] (286 aa)
Score = 311, Expect = 8.9e-27, Identities = 96/285 (33%), Positives = 155/285 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEE--GKTIWLAFFSSMGLCGSFNLNIVKEL-----QKHIKSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           MA+L EI+ RI  + ST +IT+AMK+VS+AKLKK ++       Y  K  +L   + ++ D++  S         K + +A  S+ GLCG+FN NI+K+      +       +   IGKK  +++      A IS   ++ D D+ F+   +IAE L+  ++ D +   I+++Y+KF N+ +        LP+      P  D   +GAD+  +P+  ++ E ++   L T ++ AI +S   E+ +R  AM  AT NA EL    KL +N+ RQ+ IT EI EIV GA+ 
  S:     1 MANLKEIRNRISSVSSTMQITSAMKMVSAAKLKKAQDAITAMRPYANKLTELLQSLSASLDADSGSTYADNRPINKVLVVAITSNRGLCGAFNTNIIKQCATLTDESFGGKQVDFVAIGKKSNDILSKNA--AVISNHSDVFD-DLTFENVAVIAEELMELFR-DGSYDRIELVYNKFKNAATQIVMSEQFLPI-----VPSEDSEASGADYIFEPSKAEIVEQLIPKSLKTQLYKAIRDSFASEHGARMTAMHKATDNATELRDQLKLTYNQARQAAITNEILEIVGGAEA 283
>gi|121603171|ref|YP_980500.1| ATP synthase F1, gamma subunit [Polaromonas naphthalenivorans CJ2] >gi|166224079|sp|A1VIV1|ATPG_POLNA ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|120592140|gb|ABM35579.1| ATP synthase F1, gamma subunit [Polaromonas naphthalenivorans CJ2] (288 aa)
Score = 310, Expect = 1.0e-26, Identities = 86/283 (30%), Positives = 154/283 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEGKTI-WLAFFSSMGLCGSFNLNIVKELQKHIK------SNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA+  EI+ +IK +E+T KIT AM++V+++K++K +E       Y  K  ++  ++   +        +S + KT  ++   +  GLCG  N N+++ L   +K       + +   IG KG   +   G++   +   +L DK  + D      + LL  Y ++  IK++ + Y++F+N++     V  LLPL     +P  DK  +  D+  +P+A  V + +L+ Y+   +  A+ E+   E ++R  AM SAT NA  +I   KL +N+ RQ+ IT+E++EIV+GA
  S:     1 MAAGKEIRGKIKSVENTRKITKAMEMVAASKMRKAQERMRAARPYSDKIRNIAAHLSQANPEYTHPFMESNDAKTTGFIVVTTDKGLCGGLNTNVLRLLTTKLKDMQAAGEDAQAVAIGNKGLGFLNRIGVKVA-AHATQLGDKP-HLDKLIGPVKVLLDAY-SEGKIKAVYLCYTRFINTMKQESVVEQLLPLTADRMQP--DKTEHSWDYIYEPDAQTVIDELLVRYVEALVFQAVAENMASEQSARMVAMKSATDNAGSVIGELKLIYNKTRQAAITKELSEIVAGA 285
>gi|117922562|ref|YP_871754.1| F0F1 ATP synthase subunit gamma [Shewanella sp. ANA-3] >gi|166224106|sp|A0L2S9|ATPG_SHESA ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|117614894|gb|ABK50348.1| ATP synthase F1, gamma subunit [Shewanella sp. ANA-3] (286 aa)
Score = 310, Expect = 1.1e-26, Identities = 85/283 (30%), Positives = 157/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNS-DSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKG--IEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EIK +I  +++T KIT+AM++V+++K+++ +E       Y +    +  ++   S + +   L+  E  +  ++   +  GLCG  N+N+ K++   +KS        E   IG +     KS G  + A  S    L D     DL   +   ++    N+  +  + V+++KFVN+++ TP +  LLPL K+ +    D+  +  D+  +P+   + +++L+ Y+ + ++  +VE+   E A+R  AM +AT NA  LI + +L +N+ RQ+ ITQE++EIVSGA
  S:     1 MAGAKEIKTKIASVKNTQKITSAMEMVAASKMRRAQERMAASRPYAESMRKVIGHVAQGSLEYKHPYLEVREAKRVGYIVVATDRGLCGGLNVNLFKKVVSDVKSWKEQGAEFEFCPIGARSVQFFKSFGGQVSAHAS---GLGDAPKLADLIGTV--RVMLDAYNEGKLDRLYVVFNKFVNTMTQTPVIEQLLPLPKSED----DEVAHRWDYIYEPDPKALLDTLLVRYVESQVYQGVVENIASEQAARMVAMKAATDNAGTLIDDLQLVYNKARQAAITQELSEIVSGA 283
>gi|152978011|ref|YP_001343640.1| F0F1 ATP synthase subunit gamma [Actinobacillus succinogenes 130Z] >gi|171472937|sp|A6VL58|ATPG_ACTSZ ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|150839734|gb|ABR73705.1| ATP synthase F1, gamma subunit [Actinobacillus succinogenes 130Z] (289 aa)
Score = 310, Expect = 1.1e-26, Identities = 86/283 (30%), Positives = 155/283 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEGKTIWLAFFSS-MGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MAS  EIK +I  ++ST KIT AM++V+++K++K ++       Y +   ++ +++   S           E KT+ +   S+  G+CG  N+N+ K +   IK         E+ +IG KG    +S G +         D+  +   L   IA ++   YK D  I ++ + +++F+N++S  PSV  L+PL + ++   LD+     D+  +P    + +++L  YL + ++ ++V++   E A+R  AM +AT NA  LI + +L +N+ RQ+ IT E+ EIV+GA
  S:     1 MASGKEIKTKIASVQSTQKITKAMEMVATSKMRKTQDRMAASRPYSETIRNVISHVSKASIGYKHPFLMEREVKTVGMLVVSTDRGMCGGLNINLFKAVLNEIKKWKEQGVTVEVGVIGAKGIAFFRSLGFKIRAQHSGIGDNPSVEELLG--IANDMFDAYKED-KIDALYLAHNQFINTMSQKPSVAQLVPLPE-LDTDNLDERQQVWDYLYEPEPKVLLDNLLTRYLESQVYQSVVDNLASEQAARMVAMKAATDNAGNLINDLQLVYNKARQASITNELNEIVAGA 286
>gi|193214590|ref|YP_001995789.1| ATP synthase F1, gamma subunit [Chloroherpeton thalassium ATCC 35110] >gi|193088067|gb|ACF13342.1| ATP synthase F1, gamma subunit [Chloroherpeton thalassium ATCC 35110] (304 aa)
Score = 310, Expect = 1.2e-26, Identities = 93/283 (32%), Positives = 154/283 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEI--LSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSND---------EIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDY---NIKSIKVIYSKFVNSLSFTPSVFS--LLPL------DKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA+L EI+ RIK ++ST ++T AMK+V++AKL++ ++  L    Y  K  +L   +    D+ I  L   +SE    + +   S  GLCG+FN NI+K  Q+ I  +          ++   G++G +  + +G           +  D N       A+ ++ K    Y    +  + VIY++F N +S  P++ S   LP+      D   +  R +K     D+  +P+   +   ++  +L T +   ++ES   E ASR  AMDSAT NA EL+++  + +NR RQ+ IT+EI EIV GA
  S:     1 MATLREIRTRIKSVKSTQQLTKAMKMVAAAKLRRAQDRALQARPYAAKLKELLDSLSGKVDTTINPLLTPRSEVKNVLVILVTSDRGLCGAFNTNIIKMAQRLIDQDYADMSRQGRVKMICAGRRGNDFFRKRGYNVVYGYPNIFNQLDFN------AAKEIVEKATELYLSGEVDKVHVIYNEFKNVVS--PNLISEVFLPIAPSKKDDAGSDAARQNKLVPIVDYIYEPSPEAIINELVPKHLNTQLWRVLLESNAAEQASRMTAMDSATDNAKELLRSLSITYNRARQAAITKEILEIVGGA 297
>gi|163732296|ref|ZP_02139742.1| F0F1 ATP synthase subunit gamma [Roseobacter litoralis Och 149] >gi|161394594|gb|EDQ18917.1| F0F1 ATP synthase subunit gamma [Roseobacter litoralis Och 149] (291 aa)
Score = 310, Expect = 1.2e-26, Identities = 92/285 (32%), Positives = 167/285 (58%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSN---SDS--EILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIK------SNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYK-NDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           M +L ++K RI  ++ST KIT AM++V++AKL++ +E       Y ++F  +   + S+   SDS  ++LS   S++ + + +   S  GLCG FN NI K  + H +      +  +I  +GKKG++ +K +     I      + K +++     IA+++L ++   ++++ +I   Y+KFVN +S  P+   ++P     E+   D+ +   D+  +P+   +   +L   +AT I  A++E+   E  +R +AMD+AT+NA E+I N  +E+NR RQ+ IT E+ EI+SGA+ 
  S:     1 MPNLKDLKNRIASVKSTRKITKAMQMVAAAKLRRAQEAAEQSRPYTERFNAVMAGLASSVGGSDSAPKLLSGTGSDKVQLL-IVMTSERGLCGGFNTNIAKLARAHAQKLQGEGNEVKILTVGKKGRDQLKRELGSLFIGHVDLTEIKRVSYVDAQGIAKDVLNRFDVGEFDVATI--FYAKFVNVVSQIPTAQQIIP--AKFEEQEGDEASTLFDY--EPDEEAILADLLPRGVATQIFSALLENGASEQGARMSAMDNATRNAGEMIDNLTIEYNRSRQAVITNELIEIISGAEA 290
>gi|89210204|ref|ZP_01188596.1| H+-transporting two-sector ATPase, gamma subunit [Halothermothrix orenii H 168] >gi|89160277|gb|EAR79933.1| H+-transporting two-sector ATPase, gamma subunit [Halothermothrix orenii H 168] (287 aa)
Score = 309, Expect = 1.4e-26, Identities = 86/285 (30%), Positives = 164/285 (57%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILS--LKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDEI--WLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           M ++ +IK+RI  I++T KIT AMK+V++AKLKK +    N   +++K   +   +   +  + +   L++ E  +++++   +  GLCG++N  ++  ++K  +  DE+    +G+KG++    +G    IS  + +DD   ++ L   I E +++ + +D  +  + ++Y+ F +++S      +LLPL    +K + +   N  ++  +P+   V + +L  Y+   ++ A++E+K  E  +R  AMD+AT NA ELI    L +NR RQ+ IT+EITEIV GA+ 
  S:     1 METMRDIKRRINSIKNTQKITKAMKMVAAAKLKKAQLKAENARPFFEKTRSILIDVARRTRQKDIHPLLREKENNRSLFVMITADRGLCGAYNARVIDRVKKLTEKEDEVNFLAVGRKGRDFFGKRGYNI-ISEYINIDDYP-DYSLAGKIGEEIISLFLDD-VVDRVVLVYTYFNSAISQEVRDLTLLPLTPPDDKNQEEGKIN-TEYLYEPSPEAVMDILLPSYIKNILYSALIEAKASEFGARMTAMDAATDNAGELIDKLTLSYNRARQAAITKEITEIVGGAEA 285
>gi|86145157|ref|ZP_01063488.1| putative ATP synthase F1, gamma subunit [Vibrio sp. MED222] >gi|85836734|gb|EAQ54854.1| putative ATP synthase F1, gamma subunit [Vibrio sp. MED222] (289 aa)
Score = 309, Expect = 1.5e-26, Identities = 84/285 (29%), Positives = 155/285 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNS-DSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKG-IEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           MA+  EI+ +I  + +T KIT+AM++V+++K++K ++       Y +    + +++ S S + +   L++ E  +  ++   S  GLCG  N N+ K++ + ++         E  L+G K  +  +  G + A+ S    L D     D+   +  N +  + +D  I S+ ++Y++F+N++   P+   LLP     E     K     D+  +    D+   +L  Y+ + ++  IVES  CE A+R  AM +AT NA +LI + +L +N+ RQ+ ITQE++EIVSGA+ 
  S:     1 MANTKEIRTKIGSVSNTQKITSAMEMVAASKMRKVQDNMTLTRPYAENMRKVISHVASGSLEYQHPYLQQREPKRVAYIIISSDRGLCGGLNSNLFKKVLEEMEQWRTKGVEVETTLVGSKAISFFQRSGNVIAQTS---GLGDAPKLEDILGTV--NAMLGHYDDEKIDSLYLVYNQFINTMVQEPTTLQLLPHPSDSEADGGAKKARRWDYIYEQAPRDILSELLHRYIESQVYQGIVESIACEQAARMVAMKAATDNAGQLIDDLQLVYNKARQAAITQELSEIVSGAQA 288
>gi|1703746|sp|P50005|ATPG_ACEWO ATP synthase gamma chain, sodium ion specific (Na(+)-translocating ATPase gamma chain) >gi|501148|gb|AAA79907.1| F1FO ATPase gamma subunit [Acetobacterium woodii] >gi|1096933|prf||2113197A Na ATPase:SUBUNIT=gamma (300 aa)
Score = 309, Expect = 1.5e-26, Identities = 86/282 (30%), Positives = 167/282 (59%)
  Q:     3 SLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNS-DSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHI--KSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKN-DYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDK---------AIEKPRLDKPNNGAD-----FSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAK 284
           ++ +IK RIK + ST +IT+AM+LV+SAKL+K +EL      Y++   +    I   S ++  + + + E  KT ++      GL G +N+N+ K +++HI  K N  ++ +G +G++  +++  E  I  +     +  NF     +   ++  +KN +Y+   + + Y+KFV++++    +  LLPL +            +   ++ +  +D      + +P   ++ + ++ + +++ ++G+++ES   E  +RR AM+SAT NANE+I    L++NR RQ+ ITQEI+EIV GA+
  S:     4 NVQDIKPRIKSVNSTMQITHAMELVASAKLRKSRELAEGRRPYFEAMIESIGRIVEKSGNARNIFMDQREVKKTAYIIITGDKGLAGGYNVNVAKLVEEHITDKENAVLFTVGSRGRDHFRNR--EYHIQGEYLGISERPNFFNAKEVTAIVMEGFKNGEYD--EVYIAYTKFVSTITQHAQMMKLLPLSREELITSGKVKTTEETKEEKSKMSDRELTIMTYEPEPEELLKYLIPNLVSSTVYGSMIESAASEQGARRTAMESATTNANEMIDGLTLQYNRVRQAPITQEISEIVGGAE 299
>gi|120609074|ref|YP_968752.1| ATP synthase F1, gamma subunit [Acidovorax avenae subsp. citrulli AAC00-1] >gi|166222510|sp|A1TJ40|ATPG_ACIAC ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|120587538|gb|ABM30978.1| ATP synthase F1, gamma subunit [Acidovorax avenae subsp. citrulli AAC00-1] (288 aa)
Score = 308, Expect = 1.6e-26, Identities = 89/283 (31%), Positives = 154/283 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEGKTI-WLAFFSSMGLCGSFNLNIVK-------ELQKHIKSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA+  EI+ +IK +E+T KIT AM++V+++K++K ++       Y +K  ++   +   +   +    KS + KT  ++   +  GLCG  N N+++       ELQ    S   +  IG KG   +   G +  +S    L D   + D      + LL  Y  +  I  + + Y+KF+N++     V  LLPL    EK + +K  +G D+  +P+A  V + +L+ Y+ + I+ A+ E+   E ++R  AM +AT NA  +I   KL +N+ RQ+ IT+E++EIV+GA
  S:     1 MAAGKEIRGKIKSVENTKKITKAMEMVAASKMRKAQDRMRAARPYSEKIRNIAANLGQANPEYVHPFMKSNDAKTAGFIVVTTDKGLCGGMNTNVLRAVTAKLRELQSQGVSTQAV-AIGNKGLGFLNRIGAQV-VSHATGLGDTP-HLDKLIGPVKVLLDAYA-EGKINGVYLAYTKFINTMKQESVVEQLLPLSS--EKMQAEKTEHGWDYIYEPDAQSVIDDLLVRYVESLIYQAVAENMASEQSARMVAMKAATDNAGNVIGELKLVYNKTRQAAITKELSEIVAGA 285
>gi|86134706|ref|ZP_01053288.1| ATP synthase F1, gamma subunit [Tenacibaculum sp. MED152] >gi|85821569|gb|EAQ42716.1| ATP synthase F1, gamma subunit [Polaribacter dokdonensis MED152] (288 aa)
Score = 308, Expect = 1.6e-26, Identities = 99/285 (34%), Positives = 157/285 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSN--SDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS-----NDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           MA+L EI+ RI  I+ST +IT+AMK+VS+AKLKK ++  +    Y  K  +L   + +    D+      + E  K + +   S+ GLCG FN +I K + K I       N EI+ IGKKG++++ SK      S +   D+  + FD    IAE L+  Y  +     I+++Y++F N+ +  P V   LP+ K IE    D     +D+  +P+  ++ E+++   L T ++ A+ +S   E+ +R  AM  AT NA +L     L +N+ RQ+ IT EI EIV GA+ 
  S:     1 MANLKEIRNRITSIKSTMQITSAMKMVSAAKLKKAQDAIVAMRPYSSKLTELLQNLSATLEGDTGGAYSTQREVSKVLLVVVTSNRGLCGGFNSSITKTVNKTIAEKYSDKNVEIFAIGKKGEDVL-SKTCSIVASRNDLYDE--LTFDNVSAIAEKLMNLY-TEGTYDKIELVYNQFKNAATQLPQVEQFLPI-KPIEGG--DAAAVNSDYIFEPSKEEIVEALIPKSLKTQLYKAVRDSFASEHGARMTAMHKATDNAKDLRDELLLTYNKARQAAITNEILEIVGGAEA 285
>gi|75498596|sp|O50141|ATPG_RUMAL ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|2662065|dbj|BAA23687.1| proton-translocating ATPase, gamma subunit [Ruminococcus albus] (286 aa)
Score = 308, Expect = 1.7e-26, Identities = 89/283 (31%), Positives = 161/283 (56%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDE------IWLIGKKGKNLIKSKGIE-----AEISLDLELDDKDINFDLFHIIAENLLAKYK-NDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA++ ++K+RIK +EST +IT AM+LV+S+K++K KE       +++  + +   I  + +   +  KK  +   + +      GL G FN N++K  +    +  E      I  IGKK     + +  +      +I+  +EL D         +IA  ++ ++K  D++  +++++Y+ FV+ ++  P    +LP++  +E      P    D    P+  +VF+S++ +Y+   ++ AIV+S   E A+RR AM+SA+ NANE+I+   L +NR RQ++ITQEITEI S +
  S:     1 MANMKDVKRRIKSVESTMQITKAMQLVASSKMRKAKERAEAVHPFFEGVFQVMADISRDHEFTSVFTKKKFKNSVLLIVIAGDRGLAGGFNTNVLKLAKAKADAITESGGEAVIMAIGKKAVEYFEKREYKLIDGFPQIAEGIELIDA-------MMIANKVIERFKIGDFD--AVELVYTTFVSVMTQEPQHLRILPVEN-LEYLGQKHPMTIYD----PSPEEVFDSLIPEYMGGMLYSAIVDSFASEQAARRTAMESASDNANEMIEKLSLLYNRARQAQITQEITEISSAS 281
>gi|93007152|ref|YP_581589.1| F0F1 ATP synthase subunit gamma [Psychrobacter cryohalolentis K5] >gi|122414744|sp|Q1Q898|ATPG_PSYCK ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|92394830|gb|ABE76105.1| ATP synthase F1, gamma subunit [Psychrobacter cryohalolentis K5] (293 aa)
Score = 308, Expect = 1.7e-26, Identities = 87/283 (30%), Positives = 160/283 (56%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTY-IKSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAI--EKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA+L EI+ ++  I+ST KIT AM++V+++K+++ +E       Y      + ++ + ++SD +   +      +  ++   S  GL G  N+N+ K L K+I+         E  +IG KG +  KS G +   ++  +  DK   F+  +   + +L  Y N   I  I V+Y+KFVN+++  P+V  L+PL ++   E+    +     D+  +P+   + + +L  Y+ + ++ A++E+   E +SR  AM +AT NA +LI + +L +N+ RQ+ IT+EI+EIV GA
  S:     1 MANLKEIRAKVTSIQSTQKITRAMQMVAASKMRRAQERMEVGRPYADSMRRVISHLVHASSDYKHPYMVSRPVNRVGYIVITSDRGLAGGLNINLFKALSKNIQKYQEQSVQAEFAVIGAKGVSFFKSFGGKVTSAVT-DYGDKP-TFEQINAPVQAMLDDYTNG-KIDRIYVVYNKFVNAMTQKPTVNQLVPLPESAFGEEESGIQTELSWDYIYEPDIKTLIDELLGRYIESIVYQAVMENIASEQSSRMVAMKAATDNAGDLINDLQLVYNKLRQAAITREISEIVGGA 289
>gi|124522170|ref|ZP_01696879.1| ATP synthase F1, gamma subunit [Bacillus coagulans 36D1] >gi|124496269|gb|EAY43877.1| ATP synthase F1, gamma subunit [Bacillus coagulans 36D1] (285 aa)
Score = 308, Expect = 1.8e-26, Identities = 94/283 (33%), Positives = 150/283 (53%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEGK-TIWLAFFSSMGLCGSFNLNIVKELQKHIK----SNDE--IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MASL +IK RI   + TS+IT AM++VS+AKL + +    +   Y +K  D+   I   +      +  S   K T +    S  GL G+FN N+++ + + I+    S+DE  I +IG+ G    +   ++  + L +        F     I +  +A Y+ D     + + Y+ FV+++S   +   LLPL       RL        +  +P+A ++   +L  Y  + I+GA+++SK  E+A+R  AM +AT NA ELI +  L +NR RQ+ ITQEITEIV GA
  S:     1 MASLRDIKNRINSTQKTSQITKAMQMVSAAKLNRAELSAKSFVPYMEKMQDVVVSISQGTGGVRHPMLVSRPVKRTGYFVITSDRGLAGAFNSNVLRLVTQTIRERHQSDDEYAIIVIGRTGYEFFRR--LKMNVVLQIVGLSDHPTFQDIENITKKTVAMYE-DGTFDELYLYYNHFVSAISQDVTEKRLLPLTDVTTTNRL------ISYEFEPSAEEILSVLLPQYAESLIYGALLDSKASEHAARMTAMRNATDNATELIDSLTLTYNRARQASITQEITEIVGGA 281
>gi|28899844|ref|NP_799449.1| F0F1 ATP synthase subunit gamma [Vibrio parahaemolyticus RIMD 2210633] >gi|153840150|ref|ZP_01992817.1| ATP synthase F1, gamma subunit [Vibrio parahaemolyticus AQ3810] >gi|81726598|sp|Q87KA7|ATPG_VIBPA ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|28808096|dbj|BAC61333.1| ATP synthase F1, gamma subunit [Vibrio parahaemolyticus RIMD 2210633] >gi|149746217|gb|EDM57321.1| ATP synthase F1, gamma subunit [Vibrio parahaemolyticus AQ3810] (288 aa)
Score = 308, Expect = 1.8e-26, Identities = 84/283 (29%), Positives = 159/283 (56%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKG--IEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  ++ST KIT AM++V+++K+++ ++       Y +    +  ++  +N +     L++ E  +  ++   +  GLCG  N+N+ K+    I++        E+ +IG K     K  G  + A++S    L D     DL   +   +L KY ++  +  + V+++KFVN++   P++  LLPL K+  K    +  +  D+  +P    + +++L+ Y+ + ++  +VE+  CE A+R  AM +AT NA  LI++ +L +N+ RQ+ ITQE++EIV GA
  S:     1 MAGAKEIRNKIGSVKSTQKITKAMEMVAASKMRRSQDAMEASRPYAETMRKVIGHVANANLEYRHPYLEEREAKRVGYIIVSTDRGLCGGLNINVFKKAVTDIQTWKEKGAEIELAVIGSKATAFFKHGGAKVAAQVS---GLGDSPSLEDLIGSVGV-MLKKY-DEGELDRLYVVFNKFVNTMVQQPTIDQLLPLPKSDSKEM--QREHSWDYIYEPEPKPLLDTLLVRYVESQVYQGVVENLACEQAARMIAMKAATDNATNLIEDLELVYNKARQAAITQELSEIVGGA 285
>gi|114636|sp|P20602|ATPG_BACME ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|142560|gb|AAA82525.1| ATP synthase gamma subunit (285 aa)
Score = 308, Expect = 1.9e-26, Identities = 91/283 (32%), Positives = 157/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIK--SNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHI----KSNDE--IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MASL +I+ RI   + TS+IT AM++VS+AKL + ++   +   Y +K  ++ + +   S   S  +   +S + KT ++   S  GL G++N NI++++ + I    +S DE  +  IG+ G++    +GI   + +   L D+    D+  I ++ +  +   D     + + Y+ F+N++S   +   LLPL       +L        +  +P+  ++ E +L  Y  + I+G +++ K  E+A+R  AM SAT NA +LI N  L +NR RQ+ ITQEITEIV GA
  S:     1 MASLRDIQTRITSTKKTSQITKAMEMVSAAKLNRAEQNAKSFVPYMEKIQEVVSSVALGSRGASHPMLTARSVK-KTGYIVITSDRGLAGAYNSNILRKVSQAIEERHQSPDEYGVIAIGRVGRDFFVKRGIPVLLEIT-GLADQPAFADIQGIASQTV--QMFADGTFDELYLYYNHFINTISQEVTEKKLLPLTDLQPSGKL------VGYEFEPSQEEILEVLLPQYAESLIYGGLLDGKASEHAARMTAMKSATDNAKDLINNLTLSYNRARQAAITQEITEIVGGA 281
>gi|26992089|ref|NP_747514.1| F0F1 ATP synthase subunit gamma [Pseudomonas putida KT2440] >gi|148550496|ref|YP_001270598.1| F0F1 ATP synthase subunit gamma [Pseudomonas putida F1] >gi|166224087|sp|A5WBA4|ATPG_PSEP1 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|81733164|sp|Q88BX3|ATPG_PSEPK ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|24987231|gb|AAN70978.1|AE016742_7 ATP synthase F1, gamma subunit [Pseudomonas putida KT2440] >gi|148514554|gb|ABQ81414.1| ATP synthase F1, gamma subunit [Pseudomonas putida F1] (286 aa)
Score = 308, Expect = 1.9e-26, Identities = 87/283 (30%), Positives = 155/283 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDE------IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  I+ST KIT+AM+ V+ +K++K +        Y ++   +  ++  +N +     + +    +  ++   S  GLCG  N N+ K L K + +N E      + +IG KG    +  G     ++    ++  IN DL   +   L A    D  I  + V+ +KF+N+++  P+V  L+PL   +  P  D  ++  D+  +P+A ++ + +++ Y+ + ++ A+VE+   E A+R  AM +AT NA +LIK  +L +N+ RQ+ ITQEI+EIV GA
  S:     1 MAGAKEIRSKIASIKSTQKITSAMEKVAVSKMRKAQMRMAASRPYAERIRQVIGHLANANPEYRHPFMIERPVKRAGYIVVSSDRGLCGGLNTNLFKALVKDMSANREQGVEIDLCVIGSKGATFFRIFGGNVVAAISHLGEEPSIN-DLIGSVKVMLDAYL--DGRIDRLSVVSNKFINTMTQKPTVEQLVPL---VATPDQDLKHHW-DYLYEPDAKELLDGLMVRYVESQVYQAVVENNAAEQAARMIAMKNATDNAGDLIKELQLIYNKARQAAITQEISEIVGGA 283
>gi|148652008|ref|YP_001279101.1| F0F1 ATP synthase subunit gamma [Psychrobacter sp. PRwf-1] >gi|172048449|sp|A5WBW0|ATPG_PSYWF ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|148571092|gb|ABQ93151.1| ATP synthase F1, gamma subunit [Psychrobacter sp. PRwf-1] (293 aa)
Score = 307, Expect = 2.1e-26, Identities = 87/283 (30%), Positives = 160/283 (56%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTY-IKSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPL-DKAIEKPRLDKPNNGA---DFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MASL EI+ ++  I+ST KIT AM++V+++K+++ +E       Y +    + ++ + ++SD +   +      +  ++   S  GL G  N+N+ K+L  H++         E  +IG KG +  KS G +   ++    D+    F+  +   + +L  Y N   +  I ++Y+KFVN+++  P V  L+PL D AI+    D   N     D+  +P+   + + +L  Y+ + ++ A++E+   E ++R  AM +AT NA +LI + +L +N+ RQ+ IT+EI+EIV GA
  S:     1 MASLKEIRAKVTSIKSTQKITRAMQMVAASKMRRAQERMEVGRPYAESMRRVVSHLVNASSDYKHPYMTNRSVNRVGYILVTSDRGLAGGLNINLFKKLMHHVQEFQNQSVEAEFAVIGSKGVSFFKSFGGKVTSAVTDYGDNP--TFEQLNAPVQAMLDDYANG-RLDRIYMVYNKFVNAMTQQPIVTQLVPLPDSAIDSA--DAGINTELSWDYIYEPDVKTLIDGLLNRYIESIVYQAVMENIASEQSARMVAMKAATDNAGDLINDLQLVYNKLRQAAITREISEIVGGA 289
>gi|153853573|ref|ZP_01994953.1| hypothetical protein DORLON_00943 [Dorea longicatena DSM 13814] >gi|149753728|gb|EDM63659.1| hypothetical protein DORLON_00943 [Dorea longicatena DSM 13814] (300 aa)
Score = 307, Expect = 2.3e-26, Identities = 84/286 (29%), Positives = 165/286 (57%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKK-QKELFLNESIYYKKFYDLFTYIKSNSD--SEILSLKKS---EEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS--NDEIWLIGKKGKN-LIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPN------NGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKGE 286
           MA+  EIK+R+  IE T KITNAM L+SS+K+K+ +K+L   E  +Y    ++   ++   D  S+    ++S   EE K  ++   +  GL G++N N++K  ++ +K     +++++G+ G+    K +GIE +      + +  ++     II+  ++ +++N  ++  I ++Y++ +N+++       LLP+ K    P  D P          D    P+ + V  +I+ +Y+   ++G +VE+   E+ +R  AM +AT +A +++    + +NR RQ++ITQE+TEI+ GA  +
  S:     1 MANAKEIKERMASIEETRKITNAMYLISSSKMKQAKKKLADTEPFFYAMQAEIARILRHVPDMHSQFFDGRESIPAEERKIGYIVVTADKGLAGAYNHNVIKATEELLKKPGKHKLFVLGEAGRQYFAKREGIEMDTQFRYTVQNPTLHRS--RIISSEMVEQFRNG-DLDEIHIVYTRMINAMTAETEEQKLLPMKKTTFLPE-DMPALVGTGLYQEDMVFWPSTHSVMANIVPNYINGIVYGCLVEAYCSEHNARMQAMQNATDSATDMLNELNITYNRVRQADITQELTEIIGGANAQ 297
>gi|19703701|ref|NP_603263.1| ATP synthase gamma chain, sodium ion specific [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >gi|81763579|sp|Q8RGE1|ATPG_FUSNN ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|19713825|gb|AAL94562.1| ATP synthase gamma chain, sodium ion specific [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] (282 aa)
Score = 307, Expect = 2.5e-26, Identities = 94/283 (33%), Positives = 163/283 (57%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSL-KKSEEGKTIWLAFFSS-MGLCGSFNLNIVKELQKHIKSNDE----IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           M  + EIK RIK ++ST +ITNAM++VS+ K K+  +L      Y +    +   I S   +E   L    +E K+I +   +S  GLCGSFN + +KEL+K ++ N      I   G+K  + I  +  E   S   ++   ++N  +   I+E ++ KY N++    + VIY+KF+++L +  +   ++P    I +P ++     +++  +P+   +  ++L  ++   I+ AI+ +   E+++R+N+M SAT NA+E+IK   +++NR RQS ITQEITEIV GA
  S:     1 MPGMKEIKSRIKSVQSTRQITNAMEIVSTTKFKRYSKLVTESRPYEESMRKILGNIASGVKNEGHPLFDGRKEVKSIAIIVITSDRGLCGSFNSSTLKELEKLVEKNKNKNITIIPFGRKAIDFITKRNYEFSESFS-KISPDEMN-KIAGEISEEVVEKY-NNHIYDEVYVIYNKFISALRYDLTCERIIP----ITRPEVEL---NSEYIFEPSTEYILSALLPRFINLQIYQAILNNTASEHSARKNSMSSATDNADEMIKTLNIKYNRNRQSAITQEITEIVGGA 279
>gi|114800497|ref|YP_760594.1| ATP synthase F1, gamma subunit [Hyphomonas neptunium ATCC 15444] >gi|123027996|sp|Q0C0Z9|ATPG_HYPNA ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|114740671|gb|ABI78796.1| ATP synthase F1, gamma subunit [Hyphomonas neptunium ATCC 15444] (292 aa)
Score = 307, Expect = 2.5e-26, Identities = 94/285 (32%), Positives = 158/285 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDS---EILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVK-------ELQKHIKSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDD-KDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           M SL ++K RI  ++ST KIT AM+LV++AKLK+ +E       Y ++   +   + + +     ++L+   +++   + +   +  GL G FN  + K       +LQ   K+  ++  IGKKG+ ++ ++   A  +  + L D K  NF    +    +L K   +       +IYS+F N LS  P+   L+P       P +D    GA +  +P+   + E++L  Y+ T I  A++ES   E ASR  AMD+AT+NA +LIK   L++NR RQ++IT+E+ EI+SGA+ 
  S:     1 MPSLKDLKNRIGSVKSTQKITKAMQLVAAAKLKRAQEAATAARPYAERLAAVLANLAATTGQGGPKLLTGNGTDQTHLL-VVMTAERGLAGGFNAYVAKLARLKIQQLQSEGKTV-KVLTIGKKGREVL-AREHSALFTGHVNLSDVKSNNFTDASLSVGQMLTKGFENGEFDVATLIYSQFKNVLSQVPTAQQLIPATAPEGAPVIDL--GGAQYIYEPSEEALLEALLPRYINTQILSAMLESSAGEQASRMTAMDNATRNAKDLIKALNLKYNRARQAQITKELIEIISGAEA 291
>gi|163700377|ref|ZP_02119232.1| H(+)-transporting two-sector ATPase [Methylobacterium nodulans ORS 2060] >gi|162433478|gb|EDQ44067.1| H(+)-transporting two-sector ATPase [Methylobacterium nodulans ORS 2060] (292 aa)
Score = 307, Expect = 2.6e-26, Identities = 82/285 (28%), Positives = 162/285 (56%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFY----DLFTYIKSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIK------SNDEIWLIGKKGKNLIKSKGIEAEISLDLELDD-KDINFDLFHIIAENLLAKYK-NDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           MASL +++ RI  +++T KIT AM++V++AKL++ +    N   Y ++      +L T +   +++  L      +   + +   +  GLCG+FN +I +  + H +         +I  +GKKG ++++ +  +  + L +EL   + + F+    + ENLL +++  +++I ++   YS+F + ++  P+   ++P + +   P  +     A +  +P   ++  ++L   L   I  A++E+   E  +R +AMDSAT+NA E+IK   L +NR RQ+ IT+E+ EI+SGA+ 
  S:     1 MASLKDLRNRIASVKATQKITKAMQMVAAAKLRRAQNAAENARPYAERMAAVLGNLATNLTPGAETPRLLAGTGADRVHLLVVCTAERGLCGAFNSSIARLARDHARRLVAEGKTVKIICVGKKGYDILRREFRDQIVEL-IELRGVRQLGFENAEAVTENLLNRFEAGEFDIATL--FYSRFRSVIAQVPTAQQIIPAEIS---PASESAQTDAAYEYEPEEGEILAALLPKNLTVQILRALLENAASEQGARMSAMDSATRNAGEMIKKQTLVYNRTRQAMITKELIEIISGAEA 291
>gi|188535584|ref|YP_001909381.1| ATP synthase, F1 complex, gamma subunit [Erwinia tasmaniensis] >gi|188030626|emb|CAO98522.1| ATP synthase, F1 complex, gamma subunit [Erwinia tasmaniensis] (289 aa)
Score = 306, Expect = 2.7e-26, Identities = 84/283 (29%), Positives = 157/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIK-SNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKG--IEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  +++T KIT AM++V+++K++K +E       Y +    +  +I   N + +   L + +  +  +L   +  GLCG  N+N+ K +   +K+        ++ +IG KG +   S G  + A+ S    + DK    DL   +   ++ +  ++  I  + ++ +KF+N++S +P +  LLPL  A +   + K +   D+  +P+   + +++L  Y+ + ++  +VE+   E A+R  AM +AT N   LIK  +L +N+ RQ+ ITQE+TEIVSGA
  S:     1 MAGAKEIRSKIGSVQNTQKITKAMEMVAASKMRKSQERMAASRPYAETMRKVIGHIALGNLEYKHPYLDERDVKRVGYLVVSTDRGLCGGLNINLFKRVLADMKAWADKGVESDLAIIGSKGLSFFSSVGGNVVAQAS---GMGDKPALSDLIGPV--KVMLQAYDEGRIDKLYIVSNKFINTMSQSPQIVQLLPLPPADDAEGVVKKSTW-DYLYEPDPKALLDTLLRRYVESQVYQGVVENLASEQAARMVAMKAATDNGGNLIKELQLVYNKARQASITQELTEIVSGA 286
>gi|113972253|ref|YP_736046.1| F0F1 ATP synthase subunit gamma [Shewanella sp. MR-4] >gi|114049502|ref|YP_740052.1| F0F1 ATP synthase subunit gamma [Shewanella sp. MR-7] >gi|122943394|sp|Q0HD78|ATPG_SHESM ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|122944266|sp|Q0HPG0|ATPG_SHESR ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|113886937|gb|ABI40989.1| ATP synthase F1, gamma subunit [Shewanella sp. MR-4] >gi|113890944|gb|ABI44995.1| ATP synthase F1, gamma subunit [Shewanella sp. MR-7] (286 aa)
Score = 306, Expect = 2.7e-26, Identities = 86/283 (30%), Positives = 158/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNS-DSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKG--IEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EIK +I  +++T KIT+AM++V+++K+++ ++       Y +    +  ++   S + +   L+  E  +  ++   +  GLCG  N+N+ K++   +KS        E   IG +     KS G  + A  S    L D     DL   +   +L  Y N+  +  + V+++KFVN+++ TP +  LLPL K+ +    D+  +  D+  +P+   + +++L+ Y+ + ++  +VE+   E A+R  AM +AT NA  LI + +L +N+ RQ+ ITQE++EIVSGA
  S:     1 MAGAKEIKTKIASVKNTQKITSAMEMVAASKMRRAQDRMAASRPYAESMRKVIGHVAQGSLEYKHPYLEVREAKRVGYIVVATDRGLCGGLNVNLFKKVVADVKSWKEQGAEFEFCPIGARSVQFFKSFGGQVSAHAS---GLGDAPKLADLIGTV-RVMLDAY-NEGKLDRLYVVFNKFVNTMTQTPVIEQLLPLPKSED----DEVAHRWDYIYEPDPKALLDTLLVRYVESQVYQGVVENIASEQAARMVAMKAATDNAGTLIDDLQLVYNKARQAAITQELSEIVSGA 283
>gi|196124976|ref|ZP_03116725.1| ATP synthase subunit gamma [Clostridium difficile ATCC 43255] (292 aa)
Score = 306, Expect = 2.8e-26, Identities = 93/284 (32%), Positives = 151/284 (53%)
  Q:     2 ASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDS-EILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDE-IWLIGKKGKNLIKSKGIEAEISLDLELDDKDIN------FDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPL--DKAIEKPRL---DKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           A +  IK R+  +EST +IT AM+LV+S+KL+K KE   +   Y+   Y+    I   +       LK+ E     ++      GL G +N N++KE   H+K   E +  +GKK       +              KDIN      ++    I++ ++  YK    +  + + Y+KF ++LS    +  LLPL  +K I++  +   ++  N +     P+A  V   I+  +++  ++G I+ES   E  +RR AM+SAT NANE++ N +L +NR RQS +TQEITEIV G + 
  S:     4 AGIKAIKTRMGTVESTKQITKAMELVASSKLRKAKEKAEDSREYFNTLYNTVKDIAQTTRGIRNEFLKEREVKNKCYVVVAGDRGLAGGYNSNVLKESVSHMKGKKETVITVGKKAHEFFSKRNYNIA---------KDINSVEACGYEDATEISQTIIDLYKKG-EVDEVYIAYTKFKSALSQEVEILKLLPLVFEKDIDEQGMAVKEEKQNRSKVQYIPSAEAVLSYIVPQFISGTVYGGILESFASEQGARRTAMESATDNANEMLSNLELSYNRARQSAVTQEITEIVGGVEA 290
>gi|15673747|ref|NP_267921.1| F0F1 ATP synthase subunit gamma [Lactococcus lactis subsp. lactis Il1403] >gi|22653661|sp|Q9CER9|ATPG_LACLA ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|12724787|gb|AAK05863.1|AE006406_7 ATP synthase gamma subunit (EC 3.6.1.34) [Lactococcus lactis subsp. lactis Il1403] >gi|15082072|gb|AAK84018.1|AF393838_7 H+-ATPase cytoplasmic F1-part gamma-subunit [Lactococcus lactis subsp. lactis] (289 aa)
Score = 306, Expect = 2.9e-26, Identities = 96/282 (34%), Positives = 156/282 (55%)
  Q:     2 ASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILS---LKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIK------SNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPL---DKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           ASLNEIK +I   + TS+IT AM++VS+AKL+K +       IY +K   + T + S SD E      + K E  KT +L   S  GL G +N NI+K +   I+      S   I  +G  G +  K++ ++    L   L D+    ++  I+ E +      +++   + V Y+  VNSL     +  +LP+   +   +KP L+       F ++P+   +   +L  Y  + I+G+IV++K  E+A+   AM +AT NA+ +I +  +++NR RQ+ ITQEITEIV+GA
  S:     3 ASLNEIKTKIASTKKTSQITGAMQMVSAAKLQKAESHAKAFQIYAEKVRKITTDLVS-SDKEPAKNPMMIKREVKKTGYLVITSDRGLVGGYNSNILKSVMNTIRKRHANESEYTILALGGTGADFFKARNVKVSYVLR-GLSDQPTFEEVRAIVTEAVTEYQAEEFD--ELYVCYNHHVNSLVSDARMEKMLPISFEESGQQKPSLET------FELEPDRETILNQLLPQYAESMIYGSIVDAKTAEHAAGMTAMRTATDNAHSVINDLTIQYNRARQASITQEITEIVAGA 286
>gi|163803598|ref|ZP_02197464.1| F0F1 ATP synthase subunit gamma [Vibrio campbellii AND4] >gi|159172592|gb|EDP57450.1| F0F1 ATP synthase subunit gamma [Vibrio campbellii AND4] (288 aa)
Score = 306, Expect = 2.9e-26, Identities = 83/283 (29%), Positives = 162/283 (57%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVK------ELQKHIKSNDEIWLIGKKGKNLIKSKG--IEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  ++ST KIT AM++V+++K+++ ++       Y +    +  ++  +N +     L++ E  +  ++   +  GLCG  N+N+ K      +  K   +  E+ ++G K      S G  + A++S    L D     DL   ++  +L KY ++  +  + V+++KFVN++   P++  LLPL K+  +    +  +  D+  +P    + +++L+ Y+ + ++  +VE+  CE A+R  AM +AT NA++LI++ +L +N+ RQ+ ITQE++EIVSGA
  S:     1 MAGAKEIRNKIGSVKSTQKITKAMEMVAASKMRRSQDAMEASRPYAETMRKVIGHVANANLEYRHPYLEEREAKRVGYIIVSTDRGLCGGLNINVFKKAVIDMQAWKEKGAEVELAVVGSKATAFFNSSGAKVAAQVS---GLGDSPSLEDLIGSVSV-MLKKY-DEGELDRLYVVFNKFVNTMVQQPTIDQLLPLPKSDSEEM--QREHSWDYIYEPEPKPLLDTLLVRYVESQVYQGVVENLACEQAARMIAMKAATDNASDLIEDLELVYNKARQAAITQELSEIVSGA 285
>gi|119776777|ref|YP_929517.1| F0F1 ATP synthase subunit gamma [Shewanella amazonensis SB2B] >gi|166224101|sp|A1SBU1|ATPG_SHEAM ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|119769277|gb|ABM01848.1| Sodium-transporting two-sector ATPase [Shewanella amazonensis SB2B] (286 aa)
Score = 306, Expect = 3.1e-26, Identities = 83/283 (29%), Positives = 159/283 (56%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNS-DSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKG--IEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EIK +I  +++T KIT+AM++V+++K+++ ++       Y +    +  ++   S + +   L+  E  +  ++   S  GLCG  N+N+ K++   +K+        E   IG +     K+ G  ++A  S    L D     DL   +   ++ +  N+  +  + V+++KFVN+++ TP +  LLPL K+ +    D+  +  D+  + +  D+ +++L+ Y+ + ++  +VE+   E A+R  AM +AT NA  LI + +L +N+ RQ+ ITQE++EIVSGA
  S:     1 MAGAKEIKTKIASVKNTQKITSAMEMVAASKMRRAQDRMTASRPYAESMRKVIGHVAQGSLEYKHPYLEVREAKRVGYIVVASDRGLCGGLNVNLFKKVVSDVKNWKAQGVEVEFCPIGARSVQFFKAFGGKVQAHAS---GLGDAPKLADLIGTV--RVMLQAYNEGKLDRLYVVFNKFVNTMTQTPVIEQLLPLPKSED----DEIAHHWDYIYEQDPKDLLDTLLVRYVESQVYQGVVENIASEQAARMVAMKAATDNAGTLIDDLQLVYNKARQAAITQELSEIVSGA 283
>gi|28872699|ref|NP_795318.1| F0F1 ATP synthase subunit gamma [Pseudomonas syringae pv. tomato str. DC3000] >gi|81728858|sp|Q87TT3|ATPG_PSESM ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|28855955|gb|AAO59013.1| ATP synthase F1, gamma subunit [Pseudomonas syringae pv. tomato str. DC3000] (286 aa)
Score = 306, Expect = 3.1e-26, Identities = 87/283 (30%), Positives = 157/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILS--LKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDE------IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGA----DFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  I+ST KIT+AM+ V+ +K++K +        Y ++   +  ++ +N++ E L   + +    +  ++   S  GLCG  N N+ K L K +  N E      + ++G KG    ++ G     ++    ++  IN DL   +   L A    D  I  + V+ +KF+N+++  P+V  L+PL        +  P+ G     D+  +P+A ++ + +++ Y+ + ++ A+VE+   E A+R  AM +AT NA +LI + +L +N+ RQ+ ITQEI+EIV GA
  S:     1 MAGAKEIRSKIASIKSTQKITSAMEKVAVSKMRKAQMRMAASRPYAERIRQVIGHL-ANANPEYLHPFMIERPLKRVGYVVVSSDRGLCGGLNTNLFKTLVKDMAVNRENGVEIDLCVVGSKGAAFFRNFGGNVVAAISHLGEEPSIN-DLIGSVKVMLDAYL--DGRIDRLSVVSNKFINTMTQQPTVEQLIPL--------VATPDQGLKHHWDYLYEPDAKELLDGLMVRYVESQVYQAVVENNAAEQAARMIAMKNATDNAGDLISDLQLIYNKARQAAITQEISEIVGGA 283
>gi|167458490|ref|ZP_02324692.1| ATP synthase F1, gamma subunit [Anaeromyxobacter dehalogenans 2CP-1] >gi|167415247|gb|EDR81979.1| ATP synthase F1, gamma subunit [Anaeromyxobacter dehalogenans 2CP-1] (290 aa)
Score = 306, Expect = 3.2e-26, Identities = 86/285 (30%), Positives = 156/285 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSE------ILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDE------IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDY---NIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           M SL +I+ RI  + ST +IT AMK+VS+AKL++ ++  L    Y        + + + + +E      +L+ +     + + +   S  GL G FN NI + +Q+ +  N +      +  +GKKG+   K++       LD+  D   ++ +L +  AE L  +    Y    + ++ + Y++F +++S    V  LLP+D +           G DF  +P+   +   +L  ++A  +  A++ES   E+ +R +AM+SATKNA E+I +  L++NR RQ+ +T+E+ EIV GA+ 
  S:     1 MPSLRDIRNRIGSVRSTRQITKAMKMVSAAKLRRAQDAVLKTRPYAVLLDQTLSRLAARAAAEEQVAHPLLAPRAQRTAEVVVVT--SDRGLAGGFNSNICRFVQRFLTENADRFERIALSTVGKKGREYFKAR------RLDIRKDYTGVHANLAYEKAEALAREATERYLAGEVDAVFLAYNEFKSAISQKQVVVQLLPIDTSAA----GADATGIDFKYEPSREALLAELLPRHVAMQVWRALLESAASEHGARMSAMESATKNAEEMIASLSLQYNRARQAYVTKELMEIVGGAEA 288
>gi|52426402|ref|YP_089539.1| F0F1 ATP synthase subunit gamma [Mannheimia succiniciproducens MBEL55E] >gi|81691272|sp|Q65Q06|ATPG_MANSM ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|52308454|gb|AAU38954.1| AtpG protein [Mannheimia succiniciproducens MBEL55E] (289 aa)
Score = 306, Expect = 3.2e-26, Identities = 89/283 (31%), Positives = 157/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGA-----DFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MAS  EIK +I  ++ST KIT AM++V+++K++K ++       Y +   ++ +++ K++   +   L + E  K   L   +  G+CG  N+N+ K +   IK         E+ +IG KG    +S G++         D+  +   L   IA ++   YK D  I ++ + +++F+N++S  PS   L+PL      P LD  N G      D+  +P+   + +S+L  YL + ++ ++V++   E A+R  AM +AT NA  LI + +L +N+ RQ+ IT E+ EIV+GA
  S:     1 MASGKEIKTKIASVQSTQKITKAMEMVATSKMRKTQDRMAASRPYSETIRNVISHVSKASIGYKHPFLVEREVKKVGMLVISTDRGMCGGLNINLFKTVLNEIKKWKEQGITVEVGVIGSKGIAFFRSLGLKIRAQHSGMGDNPSVEELLG--IANDMFDAYK-DGKIDALYLAHNQFINTMSQKPSFAQLVPL------PELDTDNLGERQQAWDYIYEPDPKMLLDSLLTRYLESQVYQSVVDNLASEQAARMVAMKAATDNAGNLINDLQLVYNKARQASITNELNEIVAGA 286
>gi|163848586|ref|YP_001636630.1| ATP synthase F1, gamma subunit [Chloroflexus aurantiacus J-10-fl] >gi|187600998|ref|ZP_02987228.1| ATP synthase F1, gamma subunit [Chloroflexus sp. Y-400-fl] >gi|189081393|sp|A9WGS5|ATPG_CHLAA ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|163669875|gb|ABY36241.1| ATP synthase F1, gamma subunit [Chloroflexus aurantiacus J-10-fl] >gi|187486826|gb|EDU24797.1| ATP synthase F1, gamma subunit [Chloroflexus sp. Y-400-fl] (290 aa)
Score = 306, Expect = 3.3e-26, Identities = 86/283 (30%), Positives = 153/283 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKS---NSDSEILSLKKSEEGKTIWLAFFS-SMGLCGSFNLNIVKEL------QKHIKSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDL-FHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           M S  EIK+RI+ +++ ++IT AM++VS++K+++ +   L    Y  +  ++   + +    +      L+K E  K++ L   +   GLCGS   N+++        Q+ +    +++  G+KG++     G           D   +   L   I A N     K D     + +IYS+F+N+L   P++  LLP    +E P +    N  D++ +P   +V  SIL  Y+ T I+ A++ES   E+++R  AM +AT NA +L+++  L FN+ RQ+ IT+E++EI SGA
  S:     1 MPSSREIKRRIRSVKNVAQITRAMEMVSASKMRRAQRNVLATRPYADRMREVMANLTARVVGAARRGTLLEKRETVKSVALLVVTPDRGLCGSLVANVLRRAGRFITEQRAMGRTVDVYTFGRKGRDFFLRTGFAPAGEATRLGDAPKLEAILGVAISAINGFQSGKYD----ELYIIYSEFINTLVQRPAIKQLLP----VESPDISTTTN-VDYTYEPGEEEVLNSILPRYVETQIYQAVLESIASEHSARMVAMRNATNNAKDLVRDLTLSFNKARQAAITKEVSEIASGA 285
>gi|157964052|ref|YP_001504086.1| F0F1 ATP synthase subunit gamma [Shewanella pealeana ATCC 700345] >gi|189081477|sp|A8HAG4|ATPG_SHEPA ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|157849052|gb|ABV89551.1| ATP synthase F1, gamma subunit [Shewanella pealeana ATCC 700345] (286 aa)
Score = 305, Expect = 3.7e-26, Identities = 81/283 (28%), Positives = 157/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNS-DSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKEL------QKHIKSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA+  EIK +I  +++T KIT+AM++V+++K++K ++       Y +    +  ++   S + +   L+  E  +  ++   +  GLCG  N+N+ K++      Q+   +  E   IG +      S G +   S    L D     DL   +   ++ +  N+  +  + V+++KFVN+++  P +  LLPL K+ +    D+  +  D+  +P+   + +++L+ ++ + ++  +VE+   E A+R  AM +AT NA ELI + +L +N+ RQ+ ITQE++EIVSGA
  S:     1 MANAKEIKTKIASVQNTQKITSAMEMVAASKMRKAQDRMAASRPYAENMRKVIGHVAQGSLEYKHPYLEVREAKRVGYIVVSTDRGLCGGLNVNLFKKVVADVKKQREAGAEVEFCTIGARSAQFFNSFGGQVSASAS-GLGDAPKLADLIGTV--RVMLEAYNEGKLDRLYVVFNKFVNTMTQAPVIEQLLPLPKSED----DEFTHQWDYIYEPDPKLLLDTLLVRFVESQVYQGVVENIASEQAARMVAMKAATDNAGELIGDLQLVYNKARQAAITQELSEIVSGA 283
>gi|90581150|ref|ZP_01236949.1| ATP synthase subunit C [Vibrio angustum S14] >gi|90437671|gb|EAS62863.1| ATP synthase subunit C [Vibrio angustum S14] (288 aa)
Score = 305, Expect = 3.8e-26, Identities = 87/283 (30%), Positives = 160/283 (56%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNS-DSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKG--IEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  +++T KIT AM++V+++K++K +E   +   Y +    +  +I   S + +   L++ E  +  ++   +  GLCG  N+N+ K+    IK+      + ++ LIG K      S G  + A++S    L D     +L   +   +L KY ++  +  + V+Y++FVN++   P +  LLPL K+ E   + + N+  D+  +P    + +++L+ Y  + ++  +VE+   E A+R  AM +AT NA +LI   +L +N+ RQ+ ITQE++EIVSGA
  S:     1 MAGAKEIRNKIGSVKNTQKITKAMEMVAASKMRKTQEAMESSRPYAQTMRKVIGHIALGSLEYKHPYLEEREAKRVGYIIVSTDRGLCGGLNINLFKKAITDIKTWSDKGADVDLALIGAKATAFFNSYGGNVAAQVS---GLGDTPSVDELIGTVGV-MLKKY-DEGQLDRLYVVYNQFVNTMVQQPVIDQLLPLPKS-EDEEMQR-NHSWDYIYEPEPKPLLDTLLVRYAESQVYQGVVENLASEQAARMVAMKAATDNAGDLIDELQLVYNKARQAAITQELSEIVSGA 285
>gi|149913695|ref|ZP_01902228.1| F0F1 ATP synthase subunit gamma [Roseobacter sp. AzwK-3b] >gi|149812815|gb|EDM72644.1| F0F1 ATP synthase subunit gamma [Roseobacter sp. AzwK-3b] (294 aa)
Score = 305, Expect = 3.9e-26, Identities = 88/285 (30%), Positives = 161/285 (56%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKS---NSDSEILSLKKSEEGKTIWLAFFSS-MGLCGSFNLNIVK----ELQKHIKSNDEIWLI--GKKGKNLIKSKGIEAEISLDLELDD-KDINFDLFHIIAENLLAKYK-NDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           M +L ++K RI  ++ST KIT AM++V++AKL++ ++       Y ++F  +   + +   +SDS    L+ +       L   ++  GLCG FN NI K    E +K +     + +I  GKKG++ +K + +       ++L + K+I +     IA  +L ++   ++++   K+ YSKF N +S  P++  ++P +   +    D P  G  +  +P+   +   +L   +AT I  A++E+   E  +R +AMD+AT+NA ++I    +E+NR RQ+ IT E+ EI+SGA+ 
  S:     1 MPNLKDLKNRIASVKSTRKITKAMQMVAAAKLRRAQDAAEMSRPYTERFNAVMGKLAASVGDSDSAPRLLRGTGSDDVHLLVVMTAERGLCGGFNSNIAKKARVEAEKLLAKGKTVKIITVGKKGRDALK-RDLRNHFIHHVDLSEVKNIGYADAQTIAAQVLDRFDAGEFDVA--KIFYSKFENVVSQIPTMQQVIPFE-VDQSAADDAPEAGVVYDYEPDEEAILADLLPRGVATAIFSALLENGASEQGARMSAMDNATRNAGDMIDKLTIEYNRSRQAVITNELIEIISGAEA 293
>gi|124516446|gb|EAY57954.1| F0F1-type ATP synthase, gamma subunit [Leptospirillum sp. Group II UBA] (291 aa)
Score = 305, Expect = 4.2e-26, Identities = 81/285 (28%), Positives = 156/285 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLF---TYIKSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIK----SNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           M SL  I+ RIK +++T +IT AM++V+SAK++K ++  ++   Y +K YDL     Y++ +       ++  +    + ++  +  GLCG+ N N+ + L + +K    +N E   IG+KG++ ++  G+  +  +    D   I   L     + ++ ++    + + + V Y++F + +S  P    LLP+D      ++    +G ++  +P+  D+ E ++  Y  T I   ++E+   E ++R  AM +AT NA E+I    L +N+ RQ+ IT+EI+EI SGA+ 
  S:     1 MPSLRSIRSRIKSVKNTRQITKAMEMVASAKMRKAQQRVMDTRPYAEKIYDLMHRIAYLERSFPHPYFEVRPVKTAGIVLVS--TDRGLCGAINANLFRSLTRFMKERPGTNFEFVTIGRKGRDFVRRSGLPLQGVIHGVKDRGTIEEIL--PATQVVIEEFYTKKHWEEVWVFYTQFESIMSQKPKHEKLLPIDPQKLTEKMPAGLSG-EYLFEPDRRDILEVLIPRYFETVIFQRVLENFASEYSARMVAMKNATANAKEVIYGLTLTYNKLRQANITKEISEISSGAEA 287
>gi|24379918|ref|NP_721873.1| F0F1 ATP synthase subunit gamma [Streptococcus mutans UA159] >gi|26006948|sp|P95788|ATPG_STRMU ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|24377898|gb|AAN59179.1|AE014985_3 FoF1 membrane-bound proton-translocating ATPase, gamma subunit [Streptococcus mutans UA159] (292 aa)
Score = 305, Expect = 4.2e-26, Identities = 99/282 (35%), Positives = 162/282 (57%)
  Q:     2 ASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI------KSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQK-----HIKSND-EIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPL-----DKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
            SL+EIK RI   + T KIT+AMK+VSSAKL K ++   +  IY  K   + T +      K +S+  ++S       KT ++   S  GL G++N  I+K +       H K +D  I  IG  G +  +++ I   ++ +L   + + +F+  + I    +  YKN+     + V YS  +NSL+    V  +LP+     D+A E       +N A+F ++P+   + E +L  Y  + I+GAI+++K  E+A+   AM +AT NA+++I++    +NR RQ+ ITQEITEIV+GA
  S:     3 GSLSEIKVRITSTQKTGKITSAMKMVSSAKLVKSEQAAKDFQIYASKIRQITTDLLHSDLRKGSSNPMLISRPIK---KTAYIVITSDKGLVGAYNSTILKAVMDTIKDYHPKGDDYTIISIGGMGSDFFRARHIP--VAFELRGLEDNPSFEEVNRIISKSVEMYKNEL-FDELYVCYSHHINSLTSQVRVEKMLPISDLDADEASE-------DNVANFELEPSREAILEQLLPQYAESLIYGAIIDAKTAEHAAGMTAMQTATDNADKVIEDLTKLYNRVRQAAITQEITEIVAGA 288
>gi|150026485|ref|YP_001297311.1| ATP synthase gamma subunit [Flavobacterium psychrophilum JIP02/86] >gi|166222554|sp|A6H2D6|ATPG_FLAPJ ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|149773026|emb|CAL44510.1| ATP synthase gamma subunit [Flavobacterium psychrophilum JIP02/86] (286 aa)
Score = 305, Expect = 4.4e-26, Identities = 95/285 (33%), Positives = 156/285 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILS--LKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQK----HIKSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKY-KNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           MA+L EI+ RI  + ST +IT+AMK+VS+AKLKK ++       Y +K  +L   + +  D +      K+ E  K + +A  S+ GLCG+FN N++KE++     +     +++ IGKKG +++ SK +    +     D   + FD    IA+ L  K+   +Y+   I+VIY++F N+ +        LPL       + D P +  D+  +P+  ++  +++   L T ++  I +S   E+ +R  AM  AT NA EL    KL +N+ RQ+ IT EI EIV GA+ 
  S:     1 MANLKEIRNRITSVSSTMQITSAMKMVSAAKLKKAQDAITAMRPYAEKLTELLQNLSATLDGDAGGEFTKQREIKKVLVVAITSNRGLCGAFNTNVIKEVKNRADFYAGKQVDVFAIGKKGNDVL-SKTLSVIDNQSSVFDA--LTFDNVAKIAQMLTDKFVAGEYD--RIEVIYNQFKNAATQIVQTEQFLPLAPI----KSDLPVSTGDYIFEPSKEEIVLTLIPKSLKTQLYKGIRDSFASEHGARMTAMHKATDNATELRDQLKLTYNKARQAAITNEILEIVGGAEA 283
>gi|34763443|ref|ZP_00144390.1| ATP synthase gamma chain, sodium ion specific [Fusobacterium nucleatum subsp. vincentii ATCC 49256] >gi|27886884|gb|EAA24009.1| ATP synthase gamma chain, sodium ion specific [Fusobacterium nucleatum subsp. vincentii ATCC 49256] (282 aa)
Score = 305, Expect = 4.4e-26, Identities = 94/283 (33%), Positives = 163/283 (57%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSL-KKSEEGKTIWLAFFSS-MGLCGSFNLNIVKELQKHIKSNDE----IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           M  + EIK RIK ++ST +ITNAM++VS+ K K+  +L      Y K    +   I S   +E   L    +E K+I +   +S  GLCGSFN + +KEL+K ++ N      +   G+K  + I  +  +   S   ++   ++N  +   I+E ++ KY N++    + VIY+KF+++L +  +   ++P    I +P  +     +++  +P+A  +  ++L  ++   I+ AI+ +   E+++R+N+M SAT NA+E+IK   +++NR RQS ITQEITEIV GA
  S:     1 MPGMKEIKSRIKSVQSTRQITNAMEIVSTTKFKRYSKLVTESRPYEKSMRKILGNIASGVKNEEHPLFDGRKEVKSIAIIVITSDRGLCGSFNSSTLKELEKLVEKNRNKNITVIPFGRKAIDFISKRNYDFSESFS-KISPDEMN-KIAGEISEEVVEKY-NNHIYDEVYVIYNKFISALKYDLTCERIIP----IARPESEL---NSEYIFEPSAEYILSALLPRFINLQIYQAILNNTASEHSARKNSMSSATDNADEMIKTLNIKYNRNRQSAITQEITEIVGGA 279
>gi|183597136|ref|ZP_02958629.1| hypothetical protein PROSTU_00375 [Providencia stuartii ATCC 25827] >gi|188023446|gb|EDU61486.1| hypothetical protein PROSTU_00375 [Providencia stuartii ATCC 25827] (287 aa)
Score = 305, Expect = 4.5e-26, Identities = 83/283 (29%), Positives = 156/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIK-SNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDE------IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  +++T KIT AM++V+++K++K +E       Y +    +  ++   N + +   L++ E  +  +L   +  GLCG  N+N+ K+L   +K+  E      + LIG K  +   S G      +    D+  ++ DL   +  N + +  ++  +  + V+ +KF+N++S  P++  LLPL ++ ++    K     D+  +P+   + +++L  Y+ + ++  +VE+   E A+R  AM +AT N   LIK  +L +N+ RQ+ ITQE+TEIVSGA
  S:     1 MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQERMAASRPYAETMRSVIGHLALGNLEYKHPYLEEREVKRVGYLVVSTDRGLCGGLNINLFKKLLSDMKTWSEKGVQVDLALIGSKAVSFFGSVGGNVVTQVTGMGDNPTLS-DLIGPV--NTMLQAYDEGRLDKLYVVTNKFINTMSQEPTILQLLPLPESNDESLKKK---SWDYLYEPDPKALLDTLLRRYIESQVYQGVVENLASEQAARMVAMKAATDNGGNLIKELQLVYNKARQASITQELTEIVSGA 284
>gi|71066579|ref|YP_265306.1| F0F1 ATP synthase subunit gamma [Psychrobacter arcticus 273-4] >gi|82592649|sp|Q4FQ36|ATPG_PSYA2 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|71039564|gb|AAZ19872.1| ATP synthase F1, gamma subunit [Psychrobacter arcticus 273-4] (293 aa)
Score = 304, Expect = 4.6e-26, Identities = 89/283 (31%), Positives = 159/283 (56%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTY-IKSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPL-DKAI-EKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MASL EI+ ++  I+ST KIT AM++V+++K+++ +E       Y      + ++ + ++SD +   +      K  ++   S  GL G  N+N+ K L K I+         E  +IG KG +  K+ G +   ++  +  DK   F+  +   + +L  Y N   I  I V+Y+KFVN+++  P++  L+PL D A  E+    +     D+  +P+   + + +L  Y+ + ++ A++E+   E +SR  AM +AT NA +LI + +L +N+ RQ+ IT+EI+EIV GA
  S:     1 MASLKEIRAKVTSIKSTQKITRAMQMVAASKMRRAQERMEVGRPYADSMRRVISHLVHASSDYKHPYMVNRPVNKVGYIVITSDRGLAGGLNINLFKALTKSIQQYQDQSVQAEFAVIGAKGVSFFKNFGGKVTSAVT-DYGDKP-TFEQLNSPVQAMLEDYSNG-KIDRIYVVYNKFVNAMTQKPTINQLVPLPDSAFAEEESGIQTELSWDYIYEPDIKTLIDELLGRYIESIVYQAVMENIASEQSSRMVAMKAATDNAGDLINDLQLVYNKLRQAAITREISEIVGGA 289
>gi|187777254|ref|ZP_02993727.1| hypothetical protein CLOSPO_00806 [Clostridium sporogenes ATCC 15579] >gi|187774182|gb|EDU37984.1| hypothetical protein CLOSPO_00806 [Clostridium sporogenes ATCC 15579] (282 aa)
Score = 304, Expect = 4.7e-26, Identities = 90/285 (31%), Positives = 153/285 (53%)
  Q:     2 ASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDE---IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKGE 286
           A L  I++RIK + +  KIT AM LV++AKL+K +        YY K+  +   I ++ + + + +  ++    +++ F S  GLCGSFN+NI+  +   IK + E     +IG+KG+  +K  G++  ++  +E+ D     +    IA++++  Y     I  + ++YS+F + +     +  +LP  K       +  N+       P+   V + +L +YL   +      SK  EN SR  AM+ AT NAN+L+ N  ++FNR RQS ITQEI+EIV GA+ +
  S:     4 AGLIVIRRRIKSVTNIRKITKAMGLVATAKLRKARVNLEINKKYYNKYELVLKDIINSMEDKNIYIDGNDSDNKLYVIFTSDSGLCGSFNVNIINNVIDEIKKDGEKSSAIVIGQKGRMYLKKLGVKT-LAEYIEIPDVPTAKEA-RTIAQSIIELYSTK-KIGEVFLVYSEFYSPVKQQVLINKILPFTK-------ENKNDNRYIEFNPSITQVMDEVLENYLKATVLNCFYNSKASENGSRMTAMNGATDNANDLLDNLNVQFNRLRQSAITQEISEIVGGAEAQ 281
>gi|94501603|ref|ZP_01308120.1| ATP synthase subunit C [Oceanobacter sp. RED65] >gi|94426286|gb|EAT11277.1| ATP synthase subunit C [Oceanobacter sp. RED65] (286 aa)
Score = 304, Expect = 5.5e-26, Identities = 94/283 (33%), Positives = 158/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNI----VKELQKHIKSNDEIWL--IGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGA-DFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EIK++I  I +T KIT+AM++V+++K++K ++       Y  K   +  ++  +NS+     L++ E  +  ++   S  GLCG  N N+    VK++Q+    N EI +  IG+KG +  KS G    I+    L D     +L  I +  ++    N+ +I  + +  ++FVN+++  P V  LLPL         D+   G  D+  +P+A  +   +L  Y+ + ++ A+VE+  CE A+R  AM +AT NA ++IK   L +N+ RQ+ ITQEI+EIV GA
  S:     1 MAVGKEIKQKIGSINNTQKITSAMEMVAASKMRKAQDRMQTSRPYADKIRAVVGHMAHANSEYRHAYLQEREVKRVGYIVVTSDRGLCGGLNTNLLRSLVKDMQELHNKNVEIDICAIGQKGVSFFKSFGGNV-IAAKTHLGDAPEAHEL--IGSVKVMLDSFNNGDIDRLYLAGNEFVNTMTQKPVVRQLLPL-----AADDDQGMKGQWDYIYEPDAEALLNEMLDRYIESQVYQAVVENTACEMAARMLAMKNATDNAGDIIKELNLLYNKARQAAITQEISEIVGGA 283
>gi|86147155|ref|ZP_01065471.1| ATP synthase subunit C [Vibrio sp. MED222] >gi|85835039|gb|EAQ53181.1| ATP synthase subunit C [Vibrio sp. MED222] (288 aa)
Score = 304, Expect = 5.7e-26, Identities = 83/283 (29%), Positives = 164/283 (57%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNS-DSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIK------SNDEIWLIGKKGKNLIKSKG--IEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  ++ST KIT AM++V+++K+++ ++       Y +    +  ++ + S + +   L++ E  +  ++   +  GLCG  N+N+ K+    +K      ++ E+ ++G K      + G  + A++S    L D+    DL   ++  +L KY ++  +  + V+++KF N++   P++  LLPL K+  +    K ++  D+  +P    + +++L+ Y+ + ++  +VE+  CE A+R  AM SAT NA ++I + +L +N+ RQS ITQE++EIVSGA
  S:     1 MAGAKEIRNKIGSVKSTQKITKAMEMVAASKMRRSQDAMEATRPYAETMRKVIGHLANGSLEYKHPYLEEREAKRVGYIIVSTDRGLCGGLNINLFKKAMNDMKDWSEKGADVELAIVGSKATAFFNNSGAKVAAQVS---GLGDRPSLEDLIGSVSV-MLKKY-DEGELDRLFVVFNKFENTMVQEPTIDQLLPLPKSDSEEM--KRSHSWDYIYEPEPKPLLDALLVRYVESQVYQGVVENLACEQAARMIAMKSATDNAGDIIDDLELVYNKARQSAITQELSEIVSGA 285
>gi|88705416|ref|ZP_01103127.1| ATP synthase gamma chain [gamma proteobacterium KT 71] >gi|88700506|gb|EAQ97614.1| ATP synthase gamma chain [Congregibacter litoralis KT71] (287 aa)
Score = 304, Expect = 5.8e-26, Identities = 86/283 (30%), Positives = 164/283 (57%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEI--LSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA+  E++ +I  I+ST KIT+AM++V+++K++K ++       Y ++   +  +I +NS  E   + +++ E  +  ++   +  GLCG  N+N+ K   + +K         ++ LIG K      S G    I++  ++ ++    DL   + + +L  Y+ D  I  + ++ ++FVN+++ TP+V  +LPL    +    ++  +  D+  +P A D+ E +L  Y+ + ++ A++E+  CE A+R  AM +AT NA +LI   +L +N+ RQ+ ITQE++EIVSGA
  S:     1 MAAGKEVRTKITSIQSTQKITSAMEMVAASKMRKAQDRMEVGKPYARRIRSVVGHI-ANSAPEYRHVYMEEREVKRVGFIIVSTDRGLCGGLNMNLFKATIRAMKEWADQDIEIDLSLIGSKAIAFFNSYGGNV-IAVARDIGEEPSLEDLIGGV-KTMLDAYE-DGRIDRLFLVSNEFVNTMTQTPTVEQVLPL----QAEDSEEMAHHWDYIYEPEARDLLEGLLRRYIESQVYQAVIENAACEQAARMLAMKNATDNAGDLIDELQLIYNKARQAAITQELSEIVSGA 283
>gi|163783601|ref|ZP_02178590.1| F0F1 ATP synthase subunit beta [Hydrogenivirga sp. 128-5-R1-1] >gi|159881094|gb|EDP74609.1| F0F1 ATP synthase subunit beta [Hydrogenivirga sp. 128-5-R1-1] (290 aa)
Score = 304, Expect = 5.8e-26, Identities = 85/283 (30%), Positives = 155/283 (54%)
  Q:     3 SLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEGKTIWLAFFSS-MGLCGSFNLNIVKELQKHIKSNDE------IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           S  +I+++I+ I++T +ITNAMK+VS+AKL++ +EL  +   Y  K Y+L   +  + D E   L +  E +T+ +   ++  GL G+FN NI++E +K + +  E      + LIG+KG      +        D E+  K++NF +   ++E +  ++     + ++ +I ++ +   S+ P     LP     E P   +    + ++ +    +    IL  YL   ++ A+VES   E+ +R  AMD+ATKNA++L+K + + FN+ RQ  IT E+ +IV  A+ 
  S:     5 SPRDIRRKIQGIKNTRRITNAMKVVSAAKLRRAQELLYSSRPYSDKLYELVRDLAGHVDRESHPLLEEREERTVDVILVTADRGLAGAFNSNIIRETEKFVAAKKEKGISSNLILIGRKGYQYFSRRDYSVVKGYD-EVFRKEVNFGIAKEVSEIVRERF-TKREVDAVYLINNEMITRASYKPVTRKFLPF----EMPEEGEAVGYSVYTFEVEEEEFISRILDLYLNYQLYRAMVESNAAEHFARMVAMDNATKNADDLVKQWTMIFNKARQESITLELIDIVGAAEA 288
>gi|148322972|gb|EDK88222.1| F-type two-sector ATPase, F(1) gamma subunit [Fusobacterium nucleatum subsp. polymorphum ATCC 10953] (282 aa)
Score = 303, Expect = 6.0e-26, Identities = 93/283 (32%), Positives = 163/283 (57%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSL-KKSEEGKTIWLAFFSS-MGLCGSFNLNIVKELQKHIKSND----EIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           M  + EIK RIK ++ST +ITNAM++VS+ K K+  +L      Y +    +   I S   +E   L    +E K+I +   +S  GLCGSFN + +KEL+K I+ N      I   G+K  + +  +  +   S   ++   ++N  +   I+E ++ KY N++    + VIY+KF+++L +  +   ++P    I +P ++     +++  +P+   +  ++L  ++   I+ AI+ +   E+++R+N+M SAT NA+E+IK   +++NR RQS ITQEITEIV GA
  S:     1 MPGMKEIKSRIKSVQSTRQITNAMEIVSTTKFKRYSKLVAESRPYEESMRKILGNIASGVKNEGHPLFDGRKEVKSIAIIVITSDRGLCGSFNSSTLKELEKLIEKNKNKNISIIPFGRKAIDFVSKRNYDFSESFS-KISPDEMN-KIAGEISEEVVEKY-NNHIYDEVYVIYNKFISALRYDLTCERIIP----IARPEVEL---NSEYIFEPSTEYILSALLPRFINLQIYQAILNNTASEHSARKNSMSSATDNADEMIKTLNIKYNRNRQSAITQEITEIVGGA 279
>gi|170724357|ref|YP_001752045.1| ATP synthase F1, gamma subunit [Pseudomonas putida W619] >gi|169762360|gb|ACA75676.1| ATP synthase F1, gamma subunit [Pseudomonas putida W619] (286 aa)
Score = 303, Expect = 6.5e-26, Identities = 87/283 (30%), Positives = 154/283 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDE------IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  I+ST KIT+AM+ V+ +K++K +        Y ++   +  ++  +N +     + +    +  ++   S  GLCG  N N+ K L K +  N E      + +IG KG    +  G     ++    ++  IN DL   +   L A    D  I  + V+ +KFVN+++ TP+V  L+PL   +  P  +  ++  D+  +P+A ++ + +++ Y+ + ++ A+VE+   E A+R  AM +AT NA +LI   +L +N+ RQ+ ITQEI+EIV GA
  S:     1 MAGAKEIRSKIASIKSTQKITSAMEKVAVSKMRKAQMRMAASRPYAERIRQVIGHLANANPEYRHPFMIERPVKRAGYIVVSSDRGLCGGLNTNLFKALVKDMNVNREQGVEIDLCVIGSKGATFFRIFGGNVVAAISHLGEEPSIN-DLIGSVKVMLDAYL--DGRIDRLSVVSNKFVNTMTQTPTVEQLVPL---VATPDQELKHHW-DYLYEPDAKELLDGLMVRYVESQVYQAVVENNAAEQAARMIAMKNATDNAGDLISELQLIYNKARQAAITQEISEIVGGA 283
>gi|167036418|ref|YP_001671649.1| F0F1 ATP synthase subunit gamma [Pseudomonas putida GB-1] >gi|189081467|sp|B0KRA9|ATPG_PSEPG ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|166862906|gb|ABZ01314.1| ATP synthase F1, gamma subunit [Pseudomonas putida GB-1] (286 aa)
Score = 303, Expect = 6.9e-26, Identities = 86/283 (30%), Positives = 154/283 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDE------IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  I+ST KIT+AM+ V+ +K+++ +        Y ++   +  ++  +N +     + +    +  ++   S  GLCG  N N+ K L K +  N E      + +IG KG    +  G     ++    ++  IN DL   +   L A    D  I  + V+ +KF+N+++  P+V  L+PL   +  P  D  ++  D+  +P+A ++ + +++ Y+ + ++ A+VE+   E A+R  AM +AT NA +LIK  +L +N+ RQ+ ITQEI+EIV GA
  S:     1 MAGAKEIRSKIASIKSTQKITSAMEKVAVSKMRRAQLRMAASRPYAERIRQVIGHLANANPEYRHPFMIERPVKRAGYIVVSSDRGLCGGLNTNLFKALVKDMNENREQGVEIDLCVIGSKGATFFRIFGGNVVAAISHLGEEPSIN-DLIGSVKVMLDAYL--DGRIDRLSVVSNKFINTMTQKPTVEQLVPL---VATPDQDLKHHW-DYLYEPDAKELLDGLMVRYVESQVYQAVVENNAAEQAARMIAMKNATDNAGDLIKELQLIYNKARQAAITQEISEIVGGA 283
>gi|121635591|ref|YP_975836.1| F0F1 ATP synthase subunit gamma [Neisseria meningitidis FAM18] >gi|166224073|sp|A1KW12|ATPG_NEIMF ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|120867297|emb|CAM11068.1| ATP synthase gamma chain [Neisseria meningitidis FAM18] (291 aa)
Score = 303, Expect = 7.1e-26, Identities = 87/283 (30%), Positives = 155/283 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTI-WLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI  +I+ +++T KIT AM++VS++K++K +E       Y +K   + +++ ++N+D  I  L+   E + + ++   S  GLCG  N N++K+    ++        +EI  +G KG    +S G+   I+  + L D      L   + E L  +Y+  + I  I ++YS FVN++   P +  LLP+ + +      K     ++  +P A  V E ++  YL + ++ A+ ++   E A+R  AM +AT NA   IK  +L +N+ RQ+ IT E++EIV+GA
  S:     1 MAVGKEILTKIRSVQNTQKITKAMQMVSTSKMRKTQERMRLARPYAEKVRMVMSHLAQTNTDHGIPLLESHREIRRVGFILITSDKGLCGGLNANVLKKFLAQVQEYRNQGIEEEIVCLGSKGLMACQSIGLNV-IASAVNLGDTPKMEMLLGPLTE-LFQRYEK-HEIDRIHLVYSGFVNTMRQEPRMEVLLPIGENVIGDSAPKSPFSWEYRYEPTALAVLEYLVRRYLESVVYQALSDNMASEQAARMVAMKAATDNAGNAIKELRLVYNKSRQAAITTELSEIVAGA 288
>gi|90409882|ref|ZP_01217899.1| putative ATP synthase F1, gamma subunit [Photobacterium profundum 3TCK] >gi|90329235|gb|EAS45492.1| putative ATP synthase F1, gamma subunit [Photobacterium profundum 3TCK] (291 aa)
Score = 303, Expect = 7.2e-26, Identities = 89/285 (31%), Positives = 163/285 (57%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNS-DSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVK----ELQKHIKSNDEI--WLIGKKGKNLIKSKG-IEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGA---DFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           MA+  EI+ +I  +++T KIT+AM++V+++K++K ++       Y      + +++ S S + +   L++ E  +  ++   S  GLCG  N N+ K    ++++  + N E+   LIG K  +     G + A+ S    L DK    DL   +   L  ++ +D  I  + ++Y++FVN++   P +  LLP     E  + +KPN+     D+  +P+  D+  +++  Y+ + ++   VES  CE A+R  AM SAT NA ++I + +L +N+ RQS ITQE++EIV+GA+ 
  S:     1 MANAKEIRTKIASVQNTQKITSAMEMVAASKMRKVQDNMAATRPYAVNMRKVISHVVSGSLEYKHPYLEEREAKRVAYIIISSDRGLCGGLNTNLFKRAITDMRQWQEKNVEVDLTLIGSKAVSFFHRFGNVIAQTS---GLGDKPKLEDLLGTVKAML--EHFDDGKIDRLYLVYNEFVNTMVQNPRITQLLPHPDNDES-QDNKPNDANSRWDYIYEPDPKDILNALMQRYIESQVYQGTVESIACEQAARMVAMKSATDNAGDIINDLQLIYNKARQSAITQELSEIVAGAQA 290
>gi|29377094|ref|NP_816248.1| F0F1 ATP synthase subunit gamma [Enterococcus faecalis V583] >gi|81722328|sp|Q831A4|ATPG_ENTFA ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|29344560|gb|AAO82318.1| ATP synthase F1, gamma subunit [Enterococcus faecalis V583] (302 aa)
Score = 303, Expect = 7.3e-26, Identities = 96/282 (34%), Positives = 156/282 (55%)
  Q:     2 ASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSE--EG------------KTIWLAFFSSMGLCGSFNLNIVKE----LQKHIKSNDEIWLI--GKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           ASLNEIK+RI   + TS+IT AM++VS+AKL K +    +   Y  K   + T++ +   SE+   ++S   EG            KT ++   S  GL G +N +I+K+    +Q+   SN E  LI  G  G +  K++GI+  +S +L        F+    I       Y+N+     + V Y+  VNSL+    V  +LP+         +  +   ++ ++P+   + + +L  Y  + I+GAI+++K  E+A+   AM +AT NA  +I +  + +NR RQ  ITQEITEIV+GA
  S:     3 ASLNEIKQRIASTKKTSQITKAMQMVSAAKLTKSEGASKSFQEYSSKIRSVVTHLVAAQLSELRETEQSSLSEGNYHVMLAQRPVKKTGYIVITSDKGLVGGYNSSILKQTMSMIQEDHDSNKEYALIAIGGTGADFFKARGID--VSYELRGLTDQPTFEEVRKIVTTATTMYQNEV-FDELYVCYNHHVNSLTSQFRVEKMLPITDLDPS---EATSYEQEYLLEPSPEAILDQLLPQYAESLIYGAIIDAKTAEHAAGMTAMKTATDNAQNIISDLTISYNRARQGAITQEITEIVAGA 298
>gi|153834328|ref|ZP_01986995.1| ATP synthase F1, gamma subunit [Vibrio harveyi HY01] >gi|148869336|gb|EDL68350.1| ATP synthase F1, gamma subunit [Vibrio harveyi HY01] (288 aa)
Score = 303, Expect = 7.4e-26, Identities = 82/283 (28%), Positives = 160/283 (56%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKG--IEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  ++ST KIT AM++V+++K+++ ++       Y +    +  ++  +N +     L++ E  +  ++   +  GLCG  N+N+ K+    ++S        E+ +IG K     ++ G  + A++S    L D     DL   +   +L KY ++  +  + V+++KFVN++   P++  LLPL K+  +    +  +  D+  +P    + +++L+ Y+ + ++  +VE+  CE A+R  AM +AT NA  LI++ +L +N+ RQ+ ITQE++EIV GA
  S:     1 MAGAKEIRNKIGSVKSTQKITKAMEMVAASKMRRSQDAMEASRPYAETMRKVIGHVANANLEYRHPYLEEREAKRVGYIIVSTDRGLCGGLNINVFKKAVTDMQSWKEKGAEVELAVIGSKATAFFRNGGAKVAAQVS---GLGDNPSLEDLIGSVGV-MLKKY-DEGELDRLYVVFNKFVNTMVQQPTIDQLLPLPKSDSEEM--QREHSWDYIYEPEPKPLLDTLLVRYVESQVYQGVVENLACEQAARMIAMKAATDNATNLIEDLELVYNKARQAAITQELSEIVGGA 285
>gi|91226237|ref|ZP_01261077.1| F0F1 ATP synthase subunit gamma [Vibrio alginolyticus 12G01] >gi|91189248|gb|EAS75527.1| F0F1 ATP synthase subunit gamma [Vibrio alginolyticus 12G01] (288 aa)
Score = 303, Expect = 7.5e-26, Identities = 84/283 (29%), Positives = 158/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVK----ELQKHIKSNDEIWL--IGKKGKNLIKSKG--IEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  ++ST KIT AM++V+++K+++ ++       Y +    +  ++  +N +     L++ E  +  ++   +  GLCG  N+N+ K    ++Q   +   EI L  +G K     K  G  + A++S    L D     DL   +   +L KY ++  +  + V+++KFVN++   P++  LLPL K+  +    +  +  D+  +P    + +++L+ Y+ + ++  +VE+  CE A+R  AM +AT NA  LI + +L +N+ RQ+ ITQE++EIV GA
  S:     1 MAGAKEIRNKIGSVKSTQKITKAMEMVAASKMRRSQDAMEASRPYAETMRKVIGHVANANLEYRHPYLEEREAKRVGYIIVSTDRGLCGGLNINVFKKAVTDMQAWREKGAEIELAVVGSKATAFFKHGGAKVAAQVS---GLGDNPSLQDLIGSVGV-MLKKY-DEGELDRLYVVFNKFVNTMVQQPTIDQLLPLPKSDSEEM--QREHSWDYIYEPEPKPLLDTLLVRYVESQVYQGVVENLACEQAARMIAMKAATDNATSLIDDLELVYNKARQAAITQELSEIVGGA 285
>gi|118726891|ref|ZP_01575506.1| ATP synthase F1, gamma subunit [Clostridium cellulolyticum H10] >gi|118663706|gb|EAV70352.1| ATP synthase F1, gamma subunit [Clostridium cellulolyticum H10] (294 aa)
Score = 303, Expect = 7.7e-26, Identities = 91/281 (32%), Positives = 150/281 (53%)
  Q:     3 SLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNS---DSEILSLKKSEEGKT-IWLAFFSSMGLCGSFNLNIVKELQKHIKSNDEIWLI---GKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHI--IAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAI--EKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           ++ EIK RIK I    +IT AMKL+S++KLKK +        YY K  +    I ++S   +S    +++ +EGK   ++      GL G +N NI K  +  I  N E  L+   G  G++    K    E  +  E D    N  +F    I E +L  Y N   +  + ++Y++ ++++S  P +  LLP++ +   E  + D+         +P+  +V   ++  Y+   ++G  VE+   E  +R  AMD+ATKNA+E+++   L +NR RQ+ ITQEI+EIV GA
  S:     4 NMREIKSRIKSINQMRQITKAMKLISASKLKKARAQLEETLPYYNKVKETIADILAHSAEVESRFFDIREEKEGKKKAYIVMAGDKGLAGGYNSNIFKLTEHEIGDNKENALLLVAGTTGRSYFSRK----EYHVHTEFDYAVQNPTVFRAREITEIILDLY-NKQEVDEVYIVYTQMISAISLEPRILKLLPIEISALREDVKADEIVLDQRLKYEPSVTEVLNVLIPKYIKGIMYGTFVEAFTSEQNARMTAMDNATKNADEMLQKLNLYYNRARQATITQEISEIVGGA 290
>gi|85704181|ref|ZP_01035284.1| ATP synthase subunit C [Roseovarius sp. 217] >gi|85671501|gb|EAQ26359.1| ATP synthase subunit C [Roseovarius sp. 217] (292 aa)
Score = 303, Expect = 7.7e-26, Identities = 82/285 (28%), Positives = 157/285 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFY----DLFTYIKSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIK------SNDEIWLIGKKGKNLIKSKGIEAEIS-LDLELDDKDINFDLFHIIAENLLAKYK-NDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           M +L ++K RI  ++ST KIT AM++V++AKL++ ++       Y ++F      L   +   +++  L     E+   + +   +  GLCG FN NI K  + H           +I  +GKKG++ ++    +  +  +DL  + K + +     IA ++L ++   D+++   K+ +S+F N +S  P++  ++P D    +  +D     + +  +P+   +   +L   +AT I  A++E+   E  +R +AMD+AT+NA ++I    +E+NR RQ+ IT E+ EI+SGA+ 
  S:     1 MPNLKDLKNRIASVKSTRKITKAMQMVAAAKLRRAQDAAEQARPYTERFNAVMGKLAASVGDAANAPRLLAGTGEDKVHLLVVMTAERGLCGGFNANIAKLAKLHAADLLAKGKTVKIVTVGKKGRDAMRRDYGQYSVGHIDLS-EVKRVGYADAQAIAADVLGRFDAGDFDVA--KIFFSRFENVVSQIPTMQQVIPFDVTELEQEVD---TDSYYDYEPDEQAILADLLPRGVATAIFAALLENGASEQGARMSAMDNATRNAGDMIDRLTIEYNRSRQAVITNELIEIISGAEA 291
>gi|89074727|ref|ZP_01161185.1| ATP synthase subunit C [Photobacterium sp. SKA34] >gi|89049491|gb|EAR55052.1| ATP synthase subunit C [Photobacterium sp. SKA34] (288 aa)
Score = 302, Expect = 8.1e-26, Identities = 86/283 (30%), Positives = 160/283 (56%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNS-DSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKG--IEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  +++T KIT AM++V+++K++K +E   +   Y +    +  +I   S + +   L++ E  +  ++   +  GLCG  N+N+ K+    I++      + ++ LIG K      S G  + A++S    L D     +L   +   +L KY ++  +  + V+Y++FVN++   P +  LLPL K+ E   + + N+  D+  +P    + +++L+ Y  + ++  +VE+   E A+R  AM +AT NA +LI   +L +N+ RQ+ ITQE++EIVSGA
  S:     1 MAGAKEIRNKIGSVKNTQKITKAMEMVAASKMRKTQEAMESSRPYAQTMRKVIGHIALGSLEYKHPYLEEREAKRVGYIIVSTDRGLCGGLNINLFKKAITDIQTWSDKGADVDLALIGAKATAFFNSYGGNVAAQVS---GLGDTPSVDELIGTVGV-MLKKY-DEGQLDRLYVVYNQFVNTMVQQPVIDQLLPLPKS-EDEEMQR-NHSWDYIYEPEPKPLLDTLLVRYAESQVYQGVVENLASEQAARMVAMKAATDNAGDLIDELQLVYNKARQAAITQELSEIVSGA 285
>gi|84393415|ref|ZP_00992172.1| ATP synthase subunit C [Vibrio splendidus 12B01] >gi|84375931|gb|EAP92821.1| ATP synthase subunit C [Vibrio splendidus 12B01] (288 aa)
Score = 302, Expect = 8.2e-26, Identities = 82/283 (28%), Positives = 164/283 (57%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNS-DSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIK------SNDEIWLIGKKGKNLIKSKG--IEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  ++ST KIT AM++V+++K+++ ++       Y +    +  ++ + S + +   L++ E  +  ++   +  GLCG  N+N+ K+    +K      ++ E+ ++G K      + G  + A++S    L D+    DL   ++  +L KY ++  +  + V++++F N++   P++  LLPL K+  +    K ++  D+  +P    + +++L+ Y+ + ++  +VE+  CE A+R  AM SAT NA ++I + +L +N+ RQS ITQE++EIVSGA
  S:     1 MAGAKEIRNKIGSVKSTQKITKAMEMVAASKMRRSQDAMEATRPYAETMRKVIGHLANGSLEYKHPYLEEREAKRVGYIIVSTDRGLCGGLNINLFKKAMNDMKDWSEKGADVELAIVGSKATAFFNNSGAKVAAQVS---GLGDRPSLEDLIGSVSV-MLKKY-DEGELDRLFVVFNRFENTMVQEPTIDQLLPLPKSDSEEM--KRSHSWDYIYEPEPKPLLDALLVRYVESQVYQGVVENLACEQAARMIAMKSATDNAGDIIDDLELVYNKARQSAITQELSEIVSGA 285
>gi|161869278|ref|YP_001598445.1| F0F1 ATP synthase subunit gamma [Neisseria meningitidis 053442] >gi|189081463|sp|A9M122|ATPG_NEIM0 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|161594831|gb|ABX72491.1| ATP synthase gamma chain [Neisseria meningitidis 053442] (291 aa)
Score = 302, Expect = 8.3e-26, Identities = 86/283 (30%), Positives = 155/283 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTI-WLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI  +I+ +++T KIT AM++VS++K++K +E       Y +K   + +++ ++N+D  I  L+   E + + ++   S  GLCG  N N++K+    ++        +EI  +G KG    +S G+   ++  + L D      L   + E L  +Y+  + I  I ++YS FVN++   P +  LLP+ + +      K     ++  +P A  V E ++  YL + ++ A+ ++   E A+R  AM +AT NA   IK  +L +N+ RQ+ IT E++EIV+GA
  S:     1 MAVGKEILTKIRSVQNTQKITKAMQMVSTSKMRKTQERMRLARPYAEKVRMVMSHLAQTNTDHGIPLLESHREIRRVGFILITSDKGLCGGLNANVLKKFLAQVQEYRNQGIEEEIVCLGSKGLMACQSIGLNV-VASAVNLGDTPKMEMLLGPLTE-LFQRYEK-HEIDRIHLVYSGFVNTMRQEPRMEVLLPIGENVIGDSAPKSPFSWEYRYEPTALAVLEYLVRRYLESVVYQALSDNMASEQAARMVAMKAATDNAGNAIKELRLVYNKSRQAAITTELSEIVAGA 288
>gi|67153589|ref|ZP_00415334.1| H+-transporting two-sector ATPase, gamma subunit [Azotobacter vinelandii AvOP] >gi|67087722|gb|EAM07188.1| H+-transporting two-sector ATPase, gamma subunit [Azotobacter vinelandii AvOP] (287 aa)
Score = 302, Expect = 8.3e-26, Identities = 86/283 (30%), Positives = 155/283 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKG---------IEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPL----DKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  I+ST KIT+AM+ V+ +K++K +        Y ++   +  ++ K+N + +   + +    +  ++   +  GLCG  N+N+ K L K +K         +  +IG KG +  +S G         +  E S++  +    +  D FH            +  +  + +  +KF+N+++  P V  LLPL    D+ ++K          D+  +PNA  + +++L+ Y+ + ++ A+VE+   E A+R  AM +AT NA ELI + +L +N+ RQ+ ITQEI+EIV GA
  S:     1 MAGAKEIRSKIASIKSTQKITSAMEKVAVSKMRKAQLRMAASRPYAERIRQVIGHLAKANPEYKHPFMVERPVKRVGYILVSTDRGLCGGLNINLFKALIKSMKEWHDKGVEADFCVIGNKGASFFRSYGGNVVAAIGNLGEEPSINSLIGSIKVMLDAFH------------EGRVDRLYLASNKFINTMTQKPVVEQLLPLAASDDEGVQK-------GTWDYLYEPNAQQLLDALLVRYMESQVYQAVVENGAAEQAARMIAMKNATDNAGELISDLQLVYNKARQAAITQEISEIVGGA 284
>gi|85712588|ref|ZP_01043635.1| F0F1-type ATP synthase, gamma subunit [Idiomarina baltica OS145] >gi|85693579|gb|EAQ31530.1| F0F1-type ATP synthase, gamma subunit [Idiomarina baltica OS145] (288 aa)
Score = 302, Expect = 8.8e-26, Identities = 89/285 (31%), Positives = 155/285 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDEIWL------IGKKGKNLIKSKG--IEAEISLDLELDDKDINFDLFHIIAE-NLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           MAS  EIK +I  I +T KIT+AM++V+++K+KK +E       Y      +  ++ + N +     +++ E  +  ++   +  GLCG  N N  K + KH     E  +      IG K     K  G  ++A++S    L DK    +L  I     ++     +  I  + V+Y+KFVN+++  P++  LLPL +A +   +       D+  +PN   + ++++  Y+ T ++  +V++   E A+R  AM +AT NA +LI   +L++N+ RQ+ ITQEI+EIVSGA+ 
  S:     1 MASGKEIKTQISSIGNTQKITSAMEMVAASKMKKAQERMDESRPYADTIRKVIGHVARGNIEYRHPFMEEREVKRVGYIVISTDRGLCGGLNSNEFKAVVKHANEWKEQGIEADFAAIGSKATGFFKRFGGKLQAQVS---GLGDKP---ELKEITGSVQIMLDAFEEGKIDRLYVVYNKFVNTMTQEPTIHQLLPLPQAEKDENVQ--TGSWDYLYEPNPESILDTLIRRYVETQVYQGVVDNFASEQAARMIAMKAATDNAEDLIDKLQLQYNKARQAAITQEISEIVSGAEA 287
>gi|126701092|ref|YP_001089989.1| ATP synthase subunit gamma [Clostridium difficile 630] >gi|145952623|ref|ZP_01801632.1| hypothetical protein CdifQ_04003999 [Clostridium difficile QCD-32g58] >gi|168697758|ref|ZP_02730035.1| ATP synthase subunit gamma [Clostridium difficile QCD-37x79] >gi|168714971|ref|ZP_02747248.1| ATP synthase subunit gamma [Clostridium difficile QCD-63q42] >gi|168726393|ref|ZP_02758670.1| ATP synthase subunit gamma [Clostridium difficile QCD-76w55] >gi|168730161|ref|ZP_02762438.1| ATP synthase subunit gamma [Clostridium difficile QCD-97b34] >gi|196162324|ref|ZP_03122885.1| ATP synthase subunit gamma [Clostridium difficile CIP 107932] >gi|115252529|emb|CAJ70372.1| ATP synthase subunit gamma [Clostridium difficile 630] (292 aa)
Score = 302, Expect = 9.1e-26, Identities = 92/284 (32%), Positives = 150/284 (52%)
  Q:     2 ASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDS-EILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDE-IWLIGKKGKNLIKSKGIEAEISLDLELDDKDIN------FDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPL--DKAIEKPRL---DKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           A +  IK R+  +EST +IT AM+LV+S+KL+K KE   +   Y+   Y+    I   +       LK+ E     ++      GL G +N N++KE   H+K   E +  +GKK       +              KDIN      ++    I++ ++  YK    +  + + Y+KF ++LS    +  LLPL  +K  ++  +   ++  N +     P+A  V   I+  +++  ++G I+ES   E  +RR AM+SAT NANE++ N +L +NR RQS +TQEITEIV G + 
  S:     4 AGIKAIKTRMGTVESTKQITKAMELVASSKLRKAKEKAEDSREYFNTLYNTVKDIAQTTRGIRNEFLKEREVKNKCYVVVAGDRGLAGGYNSNVLKESVSHMKGKKETVITVGKKAHEFFSKRNYNIA---------KDINSVEACGYEDATEISQTIIDLYKKG-EVDEVYIAYTKFKSALSQEVEILKLLPLVFEKDTDEQGMAVKEEKQNRSKVQYIPSAEAVLSYIVPQFISGTVYGGILESFASEQGARRTAMESATDNANEMLSNLELSYNRARQSAVTQEITEIVGGVEA 290
>gi|15793516|ref|NP_283338.1| F0F1 ATP synthase subunit gamma [Neisseria meningitidis Z2491] >gi|81784022|sp|Q9JW71|ATPG_NEIMA ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|121051502|emb|CAM07795.1| ATP synthase gamma chain [Neisseria meningitidis Z2491] (291 aa)
Score = 302, Expect = 9.2e-26, Identities = 86/283 (30%), Positives = 155/283 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTI-WLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI  +I+ +++T KIT AM++VS++K++K +E       Y +K   + +++ ++N+D  I  L+   E + + ++   S  GLCG  N N++K+    ++        +EI  +G KG    +S G+   ++  + L D      L   + E L  +Y+  + I  I ++YS FVN++   P +  LLP+ + +      K     ++  +P A  V E ++  YL + ++ A+ ++   E A+R  AM +AT NA   IK  +L +N+ RQ+ IT E++EIV+GA
  S:     1 MAVGKEILTKIRSVQNTQKITKAMQMVSTSKMRKTQERMRLARPYAEKVRMVMSHLAQTNTDHGIPLLESHREIRRVGFILITSDKGLCGGLNANVLKKFLAQVQEYQNQGIEEEIVCLGSKGLMACQSIGLNV-VASAVNLGDTPKMEMLLGPLTE-LFQRYEK-HEIDRIHLVYSGFVNTMRQEPRMEVLLPIGENVIGDSAPKSPFSWEYRYEPTALAVLEYLVRRYLESVVYQALSDNMASEQAARMVAMKAATDNAGNAIKELRLVYNKSRQAAITTELSEIVAGA 288
>gi|167626200|ref|YP_001676494.1| F0F1 ATP synthase subunit gamma [Shewanella halifaxensis HAW-EB4] >gi|189081476|sp|B0TQF5|ATPG_SHEHH ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|167356222|gb|ABZ78835.1| ATP synthase F1, gamma subunit [Shewanella halifaxensis HAW-EB4] (286 aa)
Score = 302, Expect = 9.4e-26, Identities = 80/283 (28%), Positives = 157/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNS-DSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKEL------QKHIKSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA+  EIK +I  +++T KIT+AM++V+++K+++ ++       Y +    +  ++   S + +   L+  E  +  ++   +  GLCG  N+N+ K++      Q+   +  E   IG +      S G +   S    L D     DL   +   ++ +  N+  +  + V+++KFVN+++ TP +  LLPL K+ E     +  +  D+  +P+   + +++L+ ++ + ++  +VE+   E A+R  AM +AT NA ELI + +L +N+ RQ+ ITQE++EIV+GA
  S:     1 MANAKEIKTKIASVKNTQKITSAMEMVAASKMRRAQDRMAASRPYAENMRKVIGHVAQGSLEYKHPYLEVREAKRVGYIVVSTDRGLCGGLNVNLFKKVIADVKKQREAGAEVEFCTIGARSAQFFNSFGGQVSASAS-GLGDAPKLVDLIGTV--RVMLEAYNEGKLDRLYVVFNKFVNTMAQTPVIEQLLPLPKSEE----GEFTHQWDYIYEPDPKLLLDTLLVRFVESQVYQGVVENIASEQAARMVAMKAATDNAGELIDDLQLVYNKARQAAITQELSEIVAGA 283
>gi|156972757|ref|YP_001443664.1| F0F1 ATP synthase subunit gamma [Vibrio harveyi ATCC BAA-1116] >gi|156524351|gb|ABU69437.1| hypothetical protein VIBHAR_00422 [Vibrio harveyi ATCC BAA-1116] (288 aa)
Score = 302, Expect = 9.4e-26, Identities = 82/283 (28%), Positives = 159/283 (56%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKG--IEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  ++ST KIT AM++V+++K+++ ++       Y +    +  ++  +N +     L + E  +  ++   +  GLCG  N+N+ K+    ++S        E+ +IG K     ++ G  + A++S    L D     DL   +   +L KY ++  +  + V+++KFVN++   P++  LLPL K+  +    +  +  D+  +P    + +++L+ Y+ + ++  +VE+  CE A+R  AM +AT NA  LI++ +L +N+ RQ+ ITQE++EIV GA
  S:     1 MAGAKEIRNKIGSVKSTQKITKAMEMVAASKMRRSQDAMEASRPYAETMRKVIGHVANANLEYRHPYLDEREAKRVGYIIVSTDRGLCGGLNINVFKKAVTDMQSWKEKGAEVELAVIGSKATAFFRNGGAKVAAQVS---GLGDNPSLEDLIGSVGV-MLKKY-DEGELDRLYVVFNKFVNTMVQQPTIDQLLPLPKSDSEEM--QREHSWDYIYEPEPKPLLDTLLVRYVESQVYQGVVENLACEQAARMIAMKAATDNATNLIEDLELVYNKARQAAITQELSEIVGGA 285
>gi|72080394|ref|YP_287452.1| ATP synthase gamma chain [Mycoplasma hyopneumoniae 7448] >gi|71913518|gb|AAZ53429.1| ATP synthase gamma chain [Mycoplasma hyopneumoniae 7448] (276 aa)
Score = 302, Expect = 9.6e-26, Identities = 82/282 (29%), Positives = 151/282 (53%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSG 282
           M  LN ++ R   I++  K+TN M+++++AK+ K K  F     Y++    +F  I +N   ++  L  ++  K +++ F S++G CG+ N  I+K +   ++ NDEI + GKK  N +        I   L +++ + +  +  I   N + +   +   K I + Y+KF++ +  +P + +L    K   K        G     +PNA +VF+ ++  Y+ + +    +ESK+ E ++RR +M+SAT+NA+E++   + E N  RQ+ ITQEI EI+SG
  S:     1 MPKLNRLRARFVQIQNIEKMTNVMEMIANAKIPKIKNKFKIVQEYFENLDYIFQNILANLSKKVEELTNTDSKKNLYIIFGSNLGFCGALNNLILKNVVPQLQKNDEIIVFGKKIYNFLSINYSNLIIKFFLNIEETNFSEPILEI--SNFVNQSIFERKYKKIFICYNKFISIIHSSPEMQNLFDFKKNTIK------YGGYGIEFEPNATEVFKKLMPFYIKSILEKLFIESKLVETSARRTSMESATENASEILHKLETEINSSRQAMITQEIIEIISG 274
>gi|114322017|ref|YP_743700.1| ATP synthase F1, gamma subunit [Alkalilimnicola ehrlichei MLHE-1] >gi|122310605|sp|Q0A4M7|ATPG_ALHEH ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|114228411|gb|ABI58210.1| ATP synthase F1, gamma subunit [Alkalilimnicola ehrlichei MLHE-1] (287 aa)
Score = 302, Expect = 1.0e-25, Identities = 81/283 (28%), Positives = 161/283 (56%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIK-SNSDSEILSLKKSEEGKTIWLAFFSS-MGLCGSFNLNIVKELQKHIKSNDEIWLIGKKGKNL------IKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYK------NDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           M+   E++ +IK +++T KIT AM++V+++K+++ +E       Y +K   +  ++  +N D     L++ E+ + + L   S+  GLCG  N+N+ K + + ++  D      K+G  +       K+      +      D + +  D  H+  E+++   K       +  I  + ++++ FVN++S   +   LLP++   E+  L+      D+  +P+A+++ + +L+ Y+ + ++  +VE+  CE A+R  AM SAT NA E+I N +L +N+ RQ+ ITQE++EIV+GA
  S:     1 MSGAKEVRTKIKSVQNTQKITKAMEMVAASKMRRAQERMEATRPYAQKMRQVIGHLAGANPDYRHPFLEEREKVERVGLVVISTDRGLCGGLNVNLFKSVLQQMREWD------KQGVGVDFCTFGAKAAAFFGRLGASTLADTRGLG-DTPHL--EDMIGPIKVMLDAYTEGKIDRLYLVHNDFVNTMSQEAATRRLLPVEPVDEEEMLEN----WDYIYEPSASELLDDVLMRYIESQVYQGVVENVACEMAARMVAMKSATDNAGEIIDNLQLVYNKARQAAITQELSEIVAGA 284
>gi|66048346|ref|YP_238187.1| F0F1 ATP synthase subunit gamma [Pseudomonas syringae pv. syringae B728a] >gi|71738060|ref|YP_277281.1| F0F1 ATP synthase subunit gamma [Pseudomonas syringae pv. phaseolicola 1448A] >gi|81307753|sp|Q4ZL23|ATPG_PSEU2 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|82592647|sp|Q48BG4|ATPG_PSE14 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|63259053|gb|AAY40149.1| H+-transporting two-sector ATPase, gamma subunit [Pseudomonas syringae pv. syringae B728a] >gi|71558613|gb|AAZ37824.1| ATP synthase F1, gamma subunit [Pseudomonas syringae pv. phaseolicola 1448A] (286 aa)
Score = 301, Expect = 1.0e-25, Identities = 85/283 (30%), Positives = 154/283 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDE------IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGA----DFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  I+ST KIT+AM+ V+ +K++K +        Y ++   +  ++  +N +     + +    +  ++   S  GLCG  N N+ K L K +  N E      + ++G KG    ++ G     ++    ++  IN DL   +   L A    D  I  + V+ +KF+N+++  P+V  L+PL        +  P+ G     D+  +P+A ++ + +++ Y+ + ++ A+VE+   E A+R  AM +AT NA +LI + +L +N+ RQ+ ITQEI+EIV GA
  S:     1 MAGAKEIRSKIASIKSTQKITSAMEKVAVSKMRKAQMRMAASRPYAERIRQVIGHLANANPEYRHPFMIERPVKRVGYVVVSSDRGLCGGLNTNLFKTLVKDMAVNRENGVEIDLCVVGSKGAAFFRNFGGNVVAAISHLGEEPSIN-DLIGSVKVMLDAYL--DGRIDRLSVVSNKFINTMTQQPTVEQLIPL--------VATPDQGLKHHWDYLYEPDAKELLDGLMVRYVESQVYQAVVENNAAEQAARMIAMKNATDNAGDLISDLQLIYNKARQAAITQEISEIVGGA 283
>gi|154687797|ref|YP_001422958.1| F0F1 ATP synthase subunit gamma [Bacillus amyloliquefaciens FZB42] >gi|166222521|sp|A7Z9Q1|ATPG_BACA2 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|154353648|gb|ABS75727.1| AtpG [Bacillus amyloliquefaciens FZB42] (287 aa)
Score = 301, Expect = 1.0e-25, Identities = 95/283 (33%), Positives = 156/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDL-FTYIKSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKE----LQKHIKSNDE--IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNG----ADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MASL +IK RI   + TS+IT AM++VS+AKL + +    + + Y  K  ++ F   K   +++   L   E  KT +L   S  GL G+FN ++++     +Q+  +S DE  +  IG+ G++  K +  E  I  +L     ++ F     +    +  +  D     + ++Y+ FV+++S   +   +LPL         D   +G    A +  +P+  +V E +L  Y  + I+GA+++SK  E+A+R  AM +AT NA ELI +  L +NR RQ+ ITQEITEIV GA
  S:     1 MASLRDIKSRITSTKKTSQITKAMQMVSAAKLNRAETNAKSFAPYMDKIQEVVFNVGKGAKNAKHPMLVSREVKKTAYLVITSDRGLAGAFNSSVLRNAYRTIQERHQSKDEYTVIAIGRVGRDFFKKR--EMPILSELVGLGDEVTFAQIKDLTRQTVQMFI-DGAFDELHLVYNHFVSAISQEVTEKKVLPLT--------DFGTSGGKRTASYEFEPDEEEVLEVLLPQYAESLIYGALLDSKASEHAARMTAMKNATDNAKELIDSLSLSYNRARQAAITQEITEIVGGA 283
>gi|114647|sp|P12990|ATPG_VIBAL ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|48338|emb|CAA34180.1| unnamed protein product [Vibrio alginolyticus] (288 aa)
Score = 301, Expect = 1.1e-25, Identities = 84/283 (29%), Positives = 158/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVK----ELQKHIKSNDEIWL--IGKKGKNLIKSKG--IEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  ++ST KIT AM++V+++K+++ ++       Y +    +  ++  +N +     L++ E  +  ++   +  GLCG  N+N+ K    ++Q   +   EI L  +G K     K  G  + A++S    L D     DL   +   +L KY ++  +  + V+++KFVN++   P++  LLPL K+  +    +  +  D+  +P    + +++L+ Y+ + ++  +VE+  CE A+R  AM +AT NA  LI + +L +N+ RQ+ ITQE++EIV GA
  S:     1 MAGAKEIRNKIGSVKSTQKITKAMEMVAASKMRRSQDAMEASRPYAETMRKVIGHVANANLEYRHPYLEEREAKRVGYIIVSTDRGLCGGLNINVFKKAVTDMQTWREKGAEIELAVVGSKATAFFKHGGAKVAAQVS---GLGDNPSLEDLIGSVGV-MLKKY-DEGELDRLYVVFNKFVNTMVQQPTIDQLLPLPKSDSEEM--QREHSWDYIYEPEPKPLLDTLLVRYVESQVYQGVVENLACEQAARMIAMKAATDNATNLIDDLELVYNKARQAAITQELSEIVGGA 285
>gi|77461948|ref|YP_351455.1| F0F1 ATP synthase subunit gamma [Pseudomonas fluorescens PfO-1] >gi|123602674|sp|Q3K440|ATPG_PSEPF ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|77385951|gb|ABA77464.1| Sodium-transporting two-sector ATPase [Pseudomonas fluorescens PfO-1] (286 aa)
Score = 301, Expect = 1.1e-25, Identities = 85/283 (30%), Positives = 155/283 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDE------IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  I+ST KIT+AM+ V+ +K++K +        Y ++   +  ++  +N +     +   E  +  ++   S  GLCG  N N+ K L K +  N E      + ++G KG    ++ G     ++    ++  IN DL   +   L A    D  I  + V+ +KF+N+++  P+V  L+PL   +  P  +  ++  D+  +P+A ++ + +++ Y+ + ++ A+VE+   E A+R  AM +AT NA +LI + +L +N+ RQ+ ITQEI+EIV GA
  S:     1 MAGAKEIRSKIASIKSTQKITSAMEKVAVSKMRKAQMRMAASRPYAERIRQVIGHLANANPEYRHPFMIDREVKRVGYVVVSSDRGLCGGLNTNLFKALVKDMAVNRENGVEIDLCVVGSKGAAFFRNFGGNVVAAISHLGEEPSIN-DLIGSVKVMLDAYL--DGRIDRLSVVSNKFINTMTQQPTVEQLIPL---VATPDQELKHHW-DYLYEPDAKELLDGLMVRYVESQVYQAVVENNAAEQAARMIAMKNATDNAGDLISDLQLIYNKARQAAITQEISEIVGGA 283
>gi|194538921|ref|YP_002073985.1| ATP synthase F1, gamma subunit [Vibrio sp. Ex25] >gi|151937476|gb|EDN56333.1| ATP synthase F1, gamma subunit [Vibrio sp. Ex25] (288 aa)
Score = 301, Expect = 1.1e-25, Identities = 84/283 (29%), Positives = 158/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVK----ELQKHIKSNDEIWL--IGKKGKNLIKSKG--IEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  ++ST KIT AM++V+++K+++ ++       Y +    +  ++  +N +     L++ E  +  ++   +  GLCG  N+N+ K    ++Q   +   EI L  +G K     K  G  + A++S    L D     DL   +   +L KY ++  +  + V+++KFVN++   P++  LLPL K+  +    +  +  D+  +P    + +++L+ Y+ + ++  +VE+  CE A+R  AM +AT NA  LI + +L +N+ RQ+ ITQE++EIV GA
  S:     1 MAGAKEIRNKIGSVKSTQKITKAMEMVAASKMRRSQDAMEASRPYAETMRKVIGHVANANLEYRHPYLEEREAKRVGYIIVSTDRGLCGGLNINVFKKAVTDMQAWREKGAEIELAVVGSKATAFFKHGGAKVAAQVS---GLGDNPSLEDLIGSVGV-MLKKY-DEGELDRLYVVFNKFVNTMVQQPTIDQLLPLPKSDSEEM--QREHSWDYIYEPEPKPLLDTLLVRYVESQVYQGVVENLACEQAARMIAMKAATDNATNLIDDLELVYNKARQAAITQELSEIVGGA 285
>gi|88801714|ref|ZP_01117242.1| ATP synthase F1, gamma subunit [Polaribacter irgensii 23-P] >gi|88782372|gb|EAR13549.1| ATP synthase F1, gamma subunit [Polaribacter irgensii 23-P] (288 aa)
Score = 301, Expect = 1.1e-25, Identities = 95/285 (33%), Positives = 159/285 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSN--SDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKEL-----QKHIKSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           MA+L EI+ RI  I+ST +IT+AMK+VS+AKLKK +++      Y  K  +L   + +   SD+      + E  K + +A  S+ GLCG FN +I K +     +K+ K + +I  IGKKG +++      + I    ++ D D+ F+   ++AE L+  Y N  +   I+++Y++F N+ +  P V   LP+ K +E          AD+  +P+  ++ E+++   L   +  A+ +S   E+ +R  AM  AT NA +L  +  L +N+ RQ+ IT EI EIV GA+ 
  S:     1 MANLKEIRNRITSIKSTMQITSAMKMVSAAKLKKAQDVITAMRPYSLKLTELLQNLSATLESDASGAYATEREVSKVLVVAITSNRGLCGGFNSSITKTVVRTIGEKYNKISVDILAIGKKGGDVLSKA--HSVIGNRNDIFD-DLTFENVAVVAEELMELYANG-SYDKIEIVYNQFKNAATQIPQVEQFLPI-KPVELEGASAVK--ADYIFEPSKEEIVEALIPKSLKNQLFKALRDSFASEHGARMTAMHKATDNATDLRDDLLLTYNKARQASITNEILEIVGGAEA 285
>gi|59802446|ref|YP_209158.1| F0F1 ATP synthase subunit gamma [Neisseria gonorrhoeae FA 1090] >gi|75507265|sp|Q5F4Z1|ATPG_NEIG1 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|59719341|gb|AAW90746.1| putative ATP synthase gamma chain [Neisseria gonorrhoeae FA 1090] (291 aa)
Score = 301, Expect = 1.3e-25, Identities = 86/283 (30%), Positives = 155/283 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTI-WLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI  +I+ +++T KIT AM++VS++K++K +E       Y +K   + +++ ++N+D  I  L+   E + + ++   S  GLCG  N N++K+    ++        +EI  +G KG    +S G+   ++  + L D      L   + E L  +Y+  + I  I ++YS FVN++   P +  LLP+ + +      K     ++  +P A  V E ++  YL + ++ A+ ++   E A+R  AM +AT NA   IK  +L +N+ RQ+ IT E++EIV+GA
  S:     1 MAVGKEILTKIRSVQNTQKITKAMQMVSTSKMRKTQERMSLARPYAEKVRMVMSHLAQTNTDHGIPLLESHREIRRVGFILITSDKGLCGGLNANVLKKFLAQVQEYRNQGIEEEIVCLGSKGLMACQSIGLNV-VASAVNLGDTPKMEMLLGPLTE-LFQRYEK-HEIDRIHLVYSGFVNTMRQEPRMEVLLPIGENVIGDSAPKSPFSWEYRYEPTALAVLEYLVRRYLESVVYQALSDNMASEQAARMVAMKAATDNAGNAIKELRLVYNKSRQAAITTELSEIVAGA 288
>gi|163765117|ref|ZP_02172150.1| ATP synthase F1, gamma subunit [Anaeromyxobacter sp. K] >gi|196174714|gb|ACG75687.1| ATP synthase F1, gamma subunit [Anaeromyxobacter sp. K] (290 aa)
Score = 301, Expect = 1.3e-25, Identities = 85/285 (29%), Positives = 156/285 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSE------ILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDE------IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDY---NIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           M SL +I+ RI  + ST +IT AMK+VS+AKL++ ++  L    Y        + + + + +E      +L+ +     + + +   S  GL G FN NI + +Q+ +  N +      +  +GKKG+   K++       L++  D   ++ +L +  AE L  +    Y    + ++ + Y++F +++S    V  LLP+D +           G DF  +P+   +   +L  ++A  +  A++ES   E+ +R +AM+SATKNA E+I +  L++NR RQ+ +T+E+ EIV GA+ 
  S:     1 MPSLRDIRNRIGSVRSTRQITKAMKMVSAAKLRRAQDAVLKTRPYAVLLDQTLSRLAARAAAEEQVAHPLLAPRAQRTAEVVVVT--SDRGLAGGFNSNICRFVQRFLTENADRFERIALSTVGKKGREYFKAR------RLEIRKDYTGVHANLAYEKAEALAREATERYLAGEVDAVFLAYNEFKSAISQKQVVVQLLPIDTSAA----GADATGIDFKYEPSREALLAELLPRHVAMQVWRALLESAASEHGARMSAMESATKNAEEMIASLSLQYNRARQAYVTKELMEIVGGAEA 288
>gi|27364453|ref|NP_759981.1| F0F1 ATP synthase subunit gamma [Vibrio vulnificus CMCP6] >gi|37681436|ref|NP_936045.1| F0F1 ATP synthase subunit gamma [Vibrio vulnificus YJ016] >gi|81742161|sp|Q8DDG9|ATPG_VIBVU ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|81756324|sp|Q7MGH9|ATPG_VIBVY ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|27360572|gb|AAO09508.1|AE016800_113 ATP synthase F1, gamma subunit [Vibrio vulnificus CMCP6] >gi|37200188|dbj|BAC96016.1| F0F1-type ATP synthase, gamma subunit [Vibrio vulnificus YJ016] (288 aa)
Score = 301, Expect = 1.3e-25, Identities = 83/283 (29%), Positives = 157/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNS-DSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVK------ELQKHIKSNDEIWLIGKKGKNLIKSKG--IEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  ++ST KIT AM++V+++K+++ ++       Y +    +  ++ + S +     L + E  +  ++   +  GLCG  N+N+ K      +  K   +  E+ +IG K     K  G  + A++S    L D     DL   ++  +L KY ++  +  + ++++KFVN++   P++  LLPL K+  K    +  +  D+  +P    + +++L+ Y+ + ++  +VE+  CE A+R  AM +AT NA  LI + +L +N+ RQ+ ITQE++EIV GA
  S:     1 MAGAKEIRSKIGSVKSTQKITKAMEMVAASKMRRSQDAMEASRPYAETMRKVIGHVANASLEYRHPYLDEREAKRVGYIIISTDRGLCGGLNINVFKKAVTDMQAWKEKGAEVELAVIGSKATAFFKHGGAKVAAQVS---GLGDSPSLEDLIGSVSV-MLEKY-DEGELDRLYLVFNKFVNTMVQQPTIDQLLPLPKSDSKDM--QREHSWDYIYEPEPQALLDALLVRYVESQVYQGVVENLACEQAARMVAMKAATDNATNLIDDLELVYNKARQAAITQELSEIVGGA 285
>gi|104784435|ref|YP_610933.1| F0F1 ATP synthase subunit gamma [Pseudomonas entomophila L48] >gi|122401175|sp|Q1I2I6|ATPG_PSEE4 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|95113422|emb|CAK18150.1| ATP synthase F1, gamma subunit [Pseudomonas entomophila L48] (286 aa)
Score = 300, Expect = 1.3e-25, Identities = 86/283 (30%), Positives = 153/283 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDE------IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  I+ST KIT+AM+ V+ +K++K +        Y ++   +  ++  +N +     + +    +  ++   S  GLCG  N N+ K L K +  N E      + +IG KG    +  G     ++    ++  IN DL   +   L A    D  I  + V+ +KF+N+++  P+V  L+PL   +  P  D  ++  D+  +P+A ++ + +++ Y+ + ++ A+VE+   E A+R  AM +AT NA +LI   +L +N+ RQ+ ITQEI+EIV GA
  S:     1 MAGAKEIRSKIASIKSTQKITSAMEKVAVSKMRKAQMRMAASRPYAERIRQVIGHLANANPEYRHPFMIERPVKRAGYIVVSSDRGLCGGLNTNLFKALVKDMNENREQGVEIDLCVIGSKGATFFRIFGGNVVAAISHLGEEPSIN-DLIGSVKVMLDAYL--DGRIDRLSVVSNKFINTMTQKPTVEQLVPL---VATPDQDLKHHW-DYLYEPDAKELLDGLMVRYVESQVYQAVVENNAAEQAARMIAMKNATDNAGDLISELQLIYNKARQAAITQEISEIVGGA 283
>gi|15677765|ref|NP_274929.1| F0F1 ATP synthase subunit gamma [Neisseria meningitidis MC58] >gi|81784176|sp|Q9JXQ1|ATPG_NEIMB ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|7227193|gb|AAF42264.1| ATP synthase F1, gamma subunit [Neisseria meningitidis MC58] (291 aa)
Score = 300, Expect = 1.3e-25, Identities = 86/283 (30%), Positives = 154/283 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTI-WLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI  +I+ +++T KIT AM++VS++K++K +E       Y +K   + +++ ++N+D  I  L+   E + + ++   S  GLCG  N N++K+    ++        +EI   G KG    +S G+   ++  + L D      L   + E L  +Y+  + I  I ++YS FVN++   P +  LLP+ + +      K     ++  +P A  V E ++  YL + ++ A+ ++   E A+R  AM +AT NA   IK  +L +N+ RQ+ IT E++EIV+GA
  S:     1 MAVGKEILTKIRSVQNTQKITKAMQMVSTSKMRKTQERMRLARPYAEKVRMVMSHLAQTNTDHGIPLLESHREIRRVGFILITSDKGLCGGLNANVLKKFLAQVQEYRNQGIEEEIVCFGSKGLMACQSIGLNV-VASAVNLGDTPKMEMLLGPLTE-LFQRYEK-HEIDRIHLVYSGFVNTMRQEPRMEVLLPIGENVIGDSAPKSPFSWEYRYEPTALAVLEYLVRRYLESVVYQALSDNMASEQAARMVAMKAATDNAGNAIKELRLVYNKSRQAAITTELSEIVAGA 288
>gi|152979965|ref|YP_001355318.1| F-type H+-transporting ATPase gamma chain [Janthinobacterium sp. Marseille] >gi|166215100|sp|A6T471|ATPG_JANMA ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|151280042|gb|ABR88452.1| F-type H+-transporting ATPase gamma chain [Janthinobacterium sp. Marseille] (289 aa)
Score = 300, Expect = 1.4e-25, Identities = 89/283 (31%), Positives = 161/283 (56%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTI-WLAFFSSMGLCGSFNLNIVK-------ELQKHIKSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MAS  EI+ +IK +E+T KIT AM++V+++K++K ++       Y  K  ++   + ++N +     L KS+  KT+ ++   +  GLCG  N N ++       EL+   K  + +  IG KG   +   G    +S  +++ D   + D      + +L  Y+ D  + ++ V+Y+KF+N++   P +  LLPL  A++K + D+ +   D+  +P+A  V + +L+ Y+   I  A+ E+   E ++R  AM SA+ NA  +I   KL +N+ RQ+ IT+E++EIV+GA
  S:     1 MASGKEIRGKIKSVENTKKITKAMEMVAASKMRKAQDRMHAARPYSDKIRNIAANLSQANPEYTHPFLVKSDASKTVGFIIVTTDKGLCGGMNTNSLRIVTTKLRELEAEGKKVEAV-AIGNKGLGFLNRIGARV-VSHAVQIGDTP-HLDKLIGPVKVMLDAYQ-DGKLDAVYVVYTKFINTMKQEPMMEQLLPL--AVDKLKADEDSLAWDYIYEPDAQTVIDELLVRYVEALIFQAVAENLASEQSARMVAMKSASDNAGSVISELKLVYNKTRQAAITKELSEIVAGA 286
>gi|171060197|ref|YP_001792546.1| ATP synthase F1, gamma subunit [Leptothrix cholodnii SP-6] >gi|170777642|gb|ACB35781.1| ATP synthase F1, gamma subunit [Leptothrix cholodnii SP-6] (293 aa)
Score = 300, Expect = 1.4e-25, Identities = 83/283 (29%), Positives = 154/283 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDS--EILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSND------EIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPL-DKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA+  EI+ +IK +E+T KIT AM++V+++K++K +E       Y  K  ++   +   +        +K S  G    +   +  GLCG  N N+++ +   ++  D      +   IG KG   +   G +  +S   +L D   + D      + LL  Y  +  + ++ + Y++F+N++   P V  LLPL D+ + +   ++ ++G D+  +P+A  V +++++ Y    I+ ++ E+   E ++R  AM +AT NA  LI   KL +N+ RQ+ IT+E++EIVSGA
  S:     1 MAAGKEIRGKIKSVENTKKITKAMEMVAASKMRKAQERMRAARPYADKIRNITANLSRATPEYHHPFVVKNSGSGVVGMIIVTTDKGLCGGMNTNVLRLVTNKMRELDAAGTKVQAVAIGNKGLGFLNRIGAKV-VSQATQLGDTP-HLDKLIGPVKVLLDLYA-EGKLDAVYICYTRFLNTMKQEPQVEQLLPLSDERLSQSAAEQQSHGWDYIYEPDAQAVIDNLMVRYAEALIYQSVAENMASEQSARMVAMKAATDNAGSLIGELKLVYNKTRQAAITKELSEIVSGA 289
>gi|120600836|ref|YP_965410.1| F0F1 ATP synthase subunit gamma [Shewanella sp. W3-18-1] >gi|124547714|ref|ZP_01706560.1| ATP synthase F1, gamma subunit [Shewanella putrefaciens 200] >gi|146295037|ref|YP_001185461.1| F0F1 ATP synthase subunit gamma [Shewanella putrefaciens CN-32] >gi|166224105|sp|A4YCH9|ATPG_SHEPC ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|166224107|sp|A1RQB1|ATPG_SHESW ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|120560929|gb|ABM26856.1| ATP synthase F1, gamma subunit [Shewanella sp. W3-18-1] >gi|124508978|gb|EAY53064.1| ATP synthase F1, gamma subunit [Shewanella putrefaciens 200] >gi|145566727|gb|ABP77662.1| ATP synthase F1, gamma subunit [Shewanella putrefaciens CN-32] (286 aa)
Score = 300, Expect = 1.4e-25, Identities = 84/283 (29%), Positives = 156/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNS-DSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIK------SNDEIWLIGKKGKNLIKSKG--IEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EIK +I  +++T KIT+AM++V+++K+++ +E       Y +    +  ++   S + +   L+  E  +  ++   +  GLCG  N+N+ K++   +K      +  E   IG +     KS G  + A  S    L D     DL   +   ++ K  N+  +  + ++++KFVN+++  P +  LLPL K+ E        +  D+  +P+   + +++L+ Y+ + ++  +VE+   E A+R  AM +AT NA ELI + +L +N+ RQ+ ITQE++EIVSGA
  S:     1 MAGAKEIKTKIASVKNTQKITSAMEMVAASKMRRAQERMAASRPYAESMRKVIGHVAQGSLEYKHPYLEVREAKRVGYIVVATDRGLCGGLNVNLFKKVLLDLKNWKEQGAEVEFCPIGARSVQFFKSFGGTMPAHAS---GLGDAPSIADLIGTV--RVMLKAYNEGKLDRLFIVFNKFVNTMTQAPVIEQLLPLPKSEEVAN----KHPWDYIYEPDPKVLLDTLLVRYIESQVYQGVVENIASEQAARMVAMKAATDNAGELINDLQLVYNKARQAAITQELSEIVSGA 283
>gi|18311170|ref|NP_563104.1| F0F1 ATP synthase subunit gamma [Clostridium perfringens str. 13] >gi|110800116|ref|YP_696867.1| F0F1 ATP synthase subunit gamma [Clostridium perfringens ATCC 13124] >gi|110803105|ref|YP_699463.1| F0F1 ATP synthase subunit gamma [Clostridium perfringens SM101] >gi|168205575|ref|ZP_02631580.1| ATP synthase F1, gamma subunit [Clostridium perfringens E str. JGS1987] >gi|168210118|ref|ZP_02635743.1| ATP synthase F1, gamma subunit [Clostridium perfringens B str. ATCC 3626] >gi|168213708|ref|ZP_02639333.1| ATP synthase F1, gamma subunit [Clostridium perfringens CPE str. F4969] >gi|168215817|ref|ZP_02641442.1| ATP synthase F1, gamma subunit [Clostridium perfringens NCTC 8239] >gi|169344161|ref|ZP_02865143.1| ATP synthase F1, gamma subunit [Clostridium perfringens C str. JGS1495] >gi|182624033|ref|ZP_02951821.1| ATP synthase F1, gamma subunit [Clostridium perfringens D str. JGS1721] >gi|123047205|sp|Q0SQZ4|ATPG_CLOPS ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|123344545|sp|Q0TNC3|ATPG_CLOP1 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|81766639|sp|Q8XID3|ATPG_CLOPE ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|18145853|dbj|BAB81894.1| ATP synthase gamma subunit [Clostridium perfringens str. 13] >gi|110674763|gb|ABG83750.1| ATP synthase F1, gamma subunit [Clostridium perfringens ATCC 13124] >gi|110683606|gb|ABG86976.1| ATP synthase F1, gamma subunit [Clostridium perfringens SM101] >gi|169297619|gb|EDS79719.1| ATP synthase F1, gamma subunit [Clostridium perfringens C str. JGS1495] >gi|170662944|gb|EDT15627.1| ATP synthase F1, gamma subunit [Clostridium perfringens E str. JGS1987] >gi|170711742|gb|EDT23924.1| ATP synthase F1, gamma subunit [Clostridium perfringens B str. ATCC 3626] >gi|170714820|gb|EDT27002.1| ATP synthase F1, gamma subunit [Clostridium perfringens CPE str. F4969] >gi|177910926|gb|EDT73280.1| ATP synthase F1, gamma subunit [Clostridium perfringens D str. JGS1721] >gi|182382432|gb|EDT79911.1| ATP synthase F1, gamma subunit [Clostridium perfringens NCTC 8239] (283 aa)
Score = 300, Expect = 1.5e-25, Identities = 97/285 (34%), Positives = 159/285 (55%)
  Q:     2 ASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI--KSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLN---IVKELQKHIKSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKGE 286
           A L EIK+RIK I++T KIT AM LV+++KL+K ++     + Y+    ++   +    NS++  L LK ++  K + +   S  GLCG FN N    V++  ++   N E  ++GKKG + +K   I + ++  ++L D     D   I+  N   K   D N   + ++Y+KF + +        LLPLD   EK ++        F I+P+ +++ +S++  YL      A+  SK  E ++R  AMD ATKNA++L+ +   ++NR RQS ITQEI+EIV GA+ +
  S:     4 AGLLEIKRRIKSIKNTRKITKAMGLVATSKLRKARQKLTENNQYFSSLDEIARELIGSLNSNNNPL-LKPNDNPKKLIILLASDSGLCGGFNGNTAAFVRDNYENNLENIEAVVVGKKGIHYVKKNKI-STLAEYVDLGDTPNVGDASTIV--NKAVKEFTDGNFGEVSLVYTKFFSPVKQEVVEEKLLPLDLTGEKGKVS-------FLIEPDEDEIIDSLVSSYLKGKFMNAMFNSKASEQSARMQAMDGATKNADDLLNSLDAKYNRIRQSIITQEISEIVGGAEAQ 282
>gi|146296976|ref|YP_001180747.1| ATP synthase F1, gamma subunit [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|166222535|sp|A4XKX1|ATPG_CALS8 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|145410552|gb|ABP67556.1| ATP synthase F1, gamma subunit [Caldicellulosiruptor saccharolyticus DSM 8903] (292 aa)
Score = 300, Expect = 1.5e-25, Identities = 88/277 (31%), Positives = 159/277 (57%)
  Q:     7 IKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFT--YIKSNSDSEILSLKKSEEGKTIW--LAFFSSMGLCGSFNLNIVKE---LQKHIKSNDEI--WLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           IK RIK +  T KIT AM L+S++K+K+ ++   +   Y++K  +      +     + IL     +EG+     +      GLCG +N N+++    L +++ +  E+  + IG  GKN +   G + E + + +   + ++  +   IA+N++ KY    +I  + +IY+K ++++     V  LLPLD +       K +    +  +P+  +V + ++ +YL   I GA+++S V E A+R  AMD+ATK+A+E+I+   L+ NR+RQ+ ITQEI+EI+SGA
  S:     8 IKSRIKSVNETKKITRAMYLISASKMKRSRDRLDSTRPYFEKINEFMKDLVVHGMQTNHILFEGSYKEGQKRLGVIVISGDKGLCGGYNANVIRSTLNLYENLSNKGEVIFFPIGTVGKNFLSRHGYKVEDNFNYQ--TQSVSVKVAKGIAQNVVKKYYRG-DIHELYIIYTKLISTIKQDVVVKKLLPLDPSEFVSGEFKKDETIRY--EPSPTNVLDVVIYEYLKGIIFGAMMDSYVSELAARMTAMDNATKSADEMIQKLVLKLNRERQAVITQEISEIISGA 288
>gi|145588214|ref|YP_001154811.1| ATP synthase F1, gamma subunit [Polynucleobacter sp. QLW-P1DMWA-1] >gi|189081465|sp|A4SUT3|ATPG_POLSQ ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|145046620|gb|ABP33247.1| ATP synthase F1, gamma subunit [Polynucleobacter sp. QLW-P1DMWA-1] (289 aa)
Score = 300, Expect = 1.5e-25, Identities = 86/283 (30%), Positives = 154/283 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIK----SNDEIWL--IGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MAS  EI+ +IK +++T KIT AM++V+++K+++ +E   N   Y +K  ++   + K+N +     ++  E  K   +   +  GLCG  N N+++ +   ++     N EI    IG KG   +     +  IS  +++ D      L   I   L A  + +  I ++ + Y++FVN++   P +  LLPL+ A   P  DK  N  D+  +P+A  +   +L  Y+   I+ A+ E+   E ++R  +M +A+ NA  +I   +LE+N+ RQ+ IT+E++EIV GA
  S:     1 MASTKEIRSKIKSVQNTRKITKAMEMVAASKMRRAQERMRNARPYAEKIREIVANLSKANPEFRPAYMEAREVKKVGTILVTTDKGLCGGLNTNVLRFITNQVRDLQEKNIEIVYTAIGSKGLQFLNRSKAKL-ISQTIQIGDTPHMDVLIGAIIAQLEAFERGE--IDAVYLAYNRFVNAMKQEPVLEKLLPLEPAALVPE-DKAGNSWDYIYEPDAESILNGLLKRYVEAMIYQAVTENMASEQSARMVSMKAASDNAKNVIGELQLEYNKTRQAAITKELSEIVGGA 286
>gi|56697995|ref|YP_168366.1| F0F1 ATP synthase subunit gamma [Silicibacter pomeroyi DSS-3] >gi|81676122|sp|Q5LNP0|ATPG_SILPO ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|56679732|gb|AAV96398.1| ATP synthase F1, gamma subunit [Silicibacter pomeroyi DSS-3] (291 aa)
Score = 300, Expect = 1.5e-25, Identities = 89/285 (31%), Positives = 162/285 (56%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSN---SDSEILSLKKSEEGKTIWLAFFSS-MGLCGSFNLNIVKELQKHIKSND--------EIWLIGKKGKNLIKSKGIEAEISLDLELDD-KDINFDLFHIIAENLLAKYK-NDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           M +L ++K RI  ++ST KIT AM++V++AKL++ +E       Y ++F  +   + ++   SDS  L L+ +   +   L   ++  GLCG FN NI K     +++N+        +I  +GKKG++ +K +   A +   ++L   K + +     IA ++L ++   ++++ +I   Y+KF N ++  P+   ++P     E     + +  A F  +P+   +   +L   +AT I  A++E+   E  +R +AMD+AT+NA E+I    +EFNR RQ+ IT E+ EI+SGA+ 
  S:     1 MPNLKDLKNRIASVKSTRKITKAMQMVAAAKLRRAQESAEAARPYAERFNAVMAGLAASVGGSDSAPLLLRGTGSDQVHLLVVMTAERGLCGGFNSNIAK--LARVRANELLAKGKTVKILTVGKKGRDAMK-RDFAANMVGHVDLSGIKALGYANAQDIARDVLGRFDAGEFDVATI--FYAKFQNVVTQLPTAQQIIPAAFEAE----GESDEVALFDYEPSEEAILADLLPRGVATQIFSALLENGASEQGARMSAMDNATRNAGEMIDKLTIEFNRSRQAVITNELIEIISGAEA 290
>gi|148654682|ref|YP_001274887.1| ATP synthase F1, gamma subunit [Roseiflexus sp. RS-1] >gi|166224098|sp|A5UQN4|ATPG_ROSS1 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|148566792|gb|ABQ88937.1| ATP synthase F1, gamma subunit [Roseiflexus sp. RS-1] (290 aa)
Score = 300, Expect = 1.6e-25, Identities = 82/283 (28%), Positives = 156/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNS----DSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHI------KSNDEIWLIGKKGKNLI--KSKGIEAEISLDLELDDKDINFDLF----HIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           M S  EI++RI+ +++ ++IT AM++VS++K+++ +   L    Y  +  D+   +   +       +L ++   +G  + +      GL GS   N+++   + I      K   E+  IGKKG++ +    + + AE++   +L D     D+     H+I   L  +Y   Y      V+YS+FVN+L   P++  LLP+D     P  +      D++ +P+  +V   +L  ++   ++ A++E+   E+++R  AM +AT NA EL ++  L +N+ RQ+ IT+E++EI SGA
  S:     1 MPSTREIRRRIRSVKNLAQITRAMEMVSASKMRRAQRNVLATRPYADRLLDVMGELTGRAVGMRRGTLLEVRPVVQGVAL-IVVTPDRGLAGSLVANVLRRASRFILDEQEKKHTVEVLAIGKKGRDFMVRTHQNLVAEVT---KLGDHPRLTDILGISTHVINGFLGGRYDEVY------VLYSQFVNTLVQRPTIKRLLPID-----PPHEPAERMVDYTYEPSQEEVLRELLPRFVEVQLYQAVLEAIASEHSARMVAMRNATDNAKELQRDLTLSYNKTRQANITKEVSEIASGA 284
>gi|163789449|ref|ZP_02183888.1| ATP synthase subunit C [Carnobacterium sp. AT7] >gi|159875303|gb|EDP69368.1| ATP synthase subunit C [Carnobacterium sp. AT7] (304 aa)
Score = 300, Expect = 1.6e-25, Identities = 95/282 (33%), Positives = 159/282 (56%)
  Q:     2 ASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTY-------------IKSNSDSEIL---SLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKEL-----QKHIKSNDEIWL-IGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPL-DKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           ASLNEI K+I   + TS+ITNAM++VS AKL K ++      IY +K  ++ T+             I +NS S I     L +    KT ++   S  GL G +N +++K       + H    + +++ +G    +  K++G+     L+ ++ D+  +F+    IA      YKN+     + V Y+  VN++ F      +LPL D  + + +  K     D+  +P+  ++ + IL  Y  + I+GAI+++K  E+A+R  AM  AT NA  +I +  + +NR RQ+ IT+EITEI+SGA
  S:     3 ASLNEITKKISSTKKTSQITNAMQMVSGAKLSKAEDTAAGFQIYSQKVREIVTHLAHNQLALIENNMIGTNSPSNIDFHDMLVERPIKKTGYIVISSDKGLAGGYNSSVIKSTVDMITRDHTSPEEYVFMAVGSTAADFFKARGMNVAYELN-DISDQP-SFEEVRTIARTATEMYKNEV-FDELYVCYNHHVNTIMFQYRAEKMLPLSDLDVAETKEYK----KDYIYEPSKEEILDIILPQYAESLIYGAILDAKAAEHAARMTAMKGATDNAKTIIDDLTIRYNRARQAAITEEITEIISGA 300
>gi|196164030|ref|ZP_03124561.1| ATP synthase subunit gamma [Clostridium difficile QCD-23m63] (292 aa)
Score = 300, Expect = 1.6e-25, Identities = 92/284 (32%), Positives = 150/284 (52%)
  Q:     2 ASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDS-EILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDE-IWLIGKKGKNLIKSKGIEAEISLDLELDDKDIN------FDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPL--DKAIEKPRLD---KPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           A +  IK R+  +EST +IT AM+LV+S+KL+K KE   +   Y+   Y+    I   +       LK+ E     ++      GL G +N N++KE   H+K   E +  +GKK       +              KDIN      ++    I++ ++  YK    +  + + Y+KF ++LS    +  LLPL  +K  ++  ++   +  N +     P+A  V   I+  +++  ++G I+ES   E  +RR AM+SAT NANE++ N +L +NR RQS +TQEITEIV G + 
  S:     4 AGIKAIKTRMGTVESTKQITKAMELVASSKLRKAKEKAEDSREYFNTLYNTVKDIAQTTRGIRNEFLKEREVKNKCYVVVAGDRGLAGGYNSNVLKESVSHMKGKKETVITVGKKAHEFFSKRNYNIV---------KDINSVEACGYEDATEISQTIIDLYKKG-EVDEVYIAYTKFKSALSQEVEILKLLPLVFEKDTDEQGMEVKEEKQNRSKVQYIPSAEAVLSYIVPQFISGTVYGGILESFASEQGARRTAMESATDNANEMLSNLELSYNRARQSAVTQEITEIVGGVEA 290
>gi|148245075|ref|YP_001219769.1| F0F1-type ATP synthase gamma subunit [Candidatus Vesicomyosocius okutanii HA] >gi|166224124|sp|A5CVI7|ATPG_VESOH ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|146326902|dbj|BAF62045.1| F0F1-type ATP synthase gamma subunit [Candidatus Vesicomyosocius okutanii HA] (288 aa)
Score = 300, Expect = 1.6e-25, Identities = 93/283 (32%), Positives = 163/283 (57%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIK-SNSDSE---ILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHI---KSND---EIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  I++T KIT+AM++V+++K+KK ++  L    Y +K  ++  ++  ++S+ +   + SLKK +    I     S  GLCG  N N+ + + + +   ++N    +I  IGKK     K+ G+  + S+  +L D     DL   I   ++    +   I+ + V Y+KF N++   P++  L+P    I   + D  N+  D+  +PNA +V  ++L+ Y+   ++  +VE+  CE +SR  AM SAT NA +++K  +L +N+ RQ+ ITQEI+EIVSG 
  S:     1 MAVGKEIRTQISSIKNTQKITSAMEMVAASKMKKAQDRMLESRPYCEKISNIIGHLAYAHSEFQHPYMNSLKKLQSIGII--IISSDRGLCGGLNTNLFRYILRQVVEYQANGIKVDICTIGKKATLFFKNFGLNVK-SVLTDLGDSPHFDDLLGTI--KIMLDGFDLGEIQQLSVAYNKFENTMIQIPTIMQLVP----IVSIKSDNINHYWDYIYEPNAQEVLSALLVRYIEALVYQGLVENISCEQSSRMIAMKSATDNAGDMVKELELIYNKARQAAITQEISEIVSGG 284
>gi|189347804|ref|YP_001944333.1| ATP synthase F1, gamma subunit [Chlorobium limicola DSM 245] >gi|189341951|gb|ACD91354.1| ATP synthase F1, gamma subunit [Chlorobium limicola DSM 245] (291 aa)
Score = 300, Expect = 1.7e-25, Identities = 90/283 (31%), Positives = 156/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEG--KTIWLAFFSSMGLCGSFNLNIVKELQKHIKS-------NDEIWLI--GKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           M +L +I+ RIK I+ST ++T AMK+V++AKL++ +E  +    Y  K  ++   + +  D+ +  L  S +   K + +   +  GLCG+FN NI+K  QK +         N  + +I  G +G +  + +G    I        ++++F +   IAE     Y      K I V+Y++F + L+       LLP+  A E    D   N  D+  +P+   + + ++  +L+T +   ++ES   E A+R  AMDSAT+NA EL++   + +NR RQ+ IT+E++EIV+GA
  S:     1 MPTLKDIRVRIKGIKSTQQVTKAMKMVAAAKLRRAQERAIMARPYAGKLKEMLGSLSAKVDTSLNPLLSSRQDVKKVLVILIAADRGLCGAFNTNIIKLAQKVVTEDYAAQYKNGGVSMICAGSRGFDFFRKRGFS--IVKGYPSVFQNLDFSVAKEIAETASGMYLRGEADKVI-VVYNEFKSVLAPVLKAEDLLPI--AAENAGKD---NSGDYIYEPSPAVIIDELVPKHLSTQVWRMMLESNAAEQAARMTAMDSATENAKELLRTLNISYNRARQAAITKELSEIVAGA 286
>gi|51599164|gb|AAU08240.1| ATP synthase gamma subunit [Nonomuraea sp. ATCC 39727] (300 aa)
Score = 299, Expect = 1.7e-25, Identities = 89/279 (31%), Positives = 149/279 (53%)
  Q:     2 ASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDS--EILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDEIWLIGKKGKNLIK----SKGIEAEISLDLELDDKDINFDL------FHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIV 280
           A L  +++RI  ++ST+KIT A +L++S+++ K ++       Y ++     T + SN+ S    L++ K    K   L   S  G CG FN N+++E +  ++      L+  +G  ++      KG+      + E+    + F           IA  L+  +K++  I  I ++ ++FV+ L+    V  +LPL+   E    D       F  +P A DV ES+L  Y+ + I  A+++S   E A+RR AM SAT NANEL++    + N+ RQ+EITQEI+EIV
  S:     3 AQLRLLRRRISSVKSTAKITRAQELIASSRIVKAQQRMQEALPYEREITRAVTGVVSNAASVDHPLTVAKENPAKAGVLVVTSDSGFCGGFNANVLREAEA-LRG-----LLEGRGMTVVPFVTGRKGVTWHTFRNREMGGSWVGFSRKPAYADAKEIANTLIDSFKDENGIDEIHIVSTEFVSMLTQNVVVKRVLPLEVE-ETEATDSTVIPPYFEFEPTAGDVLESLLPRYVESRIFTALLQSAASEEAARRRAMKSATDNANELMRVLTQQMNQARQAEITQEISEIV 286
>gi|89897659|ref|YP_521146.1| F0F1 ATP synthase subunit gamma [Desulfitobacterium hafniense Y51] >gi|89337107|dbj|BAE86702.1| ATP synthase F1 gamma subunit [Desulfitobacterium hafniense Y51] (284 aa)
Score = 299, Expect = 1.8e-25, Identities = 82/283 (28%), Positives = 160/283 (56%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHI--KSND-EIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           +AS  +I++RI+ + +  +IT AMK+V+++KL+K +E  +    Y ++  ++   + +  +D     L +    +  ++   S  GLCG +N N+++     I  +++D  +  +G+KG++  +   IE  I+  + L D + ++     IA+ ++  Y++   +  + ++Y++FV+++S  P+   LLP    IEKP   K  +  ++  +P+A ++  ++L  Y+ T I   ++E K  E  ++  AM +AT NA E I+   L+ NR RQ+ IT EI+EIV GA
  S:     4 VASARDIRRRIRGVRNMQQITKAMKMVAASKLRKAQEKVIAARPYARQLQEVLARLAQDQADVTHPLLMERPVQRVGYIIITSDRGLCGGYNTNLIRMTNSSIAEETHDVRLVAVGRKGRDFYRRGKIET-IAEFVGLGD-NPSYGQAKEIAQEVIGLYESG-ELDEVYLLYNEFVSAISQRPTRIKLLP----IEKP---KQVSNTEYIFEPSAEEILTTLLPKYVETQIFRTLLEGKASEMGAKMTAMGAATDNAKEAIERLTLQLNRARQAAITTEISEIVGGA 280
>gi|163731071|ref|ZP_02138537.1| F0F1 ATP synthase subunit gamma [Vibrio fischeri MJ11] >gi|161395631|gb|EDQ19934.1| F0F1 ATP synthase subunit gamma [Vibrio fischeri MJ11] (288 aa)
Score = 299, Expect = 1.9e-25, Identities = 81/283 (28%), Positives = 156/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIK-SNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDE------IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  ++ST KIT AM++V+++K+++ +E       Y      +  ++   N +     L++ E  +  ++   S  GLCG  N+N+ K++   +K+  E      + +IG K      S G    ++ +  L D     +L   +   +L KY ++  +  + V+ +KF+N++   P++  LLPL K+ ++    +  +  D+  +P    + +++LI Y+ + ++  +VE+  CE+ +R  AM +AT NA ++I   +L +N+ RQ+ ITQE++EIVSGA
  S:     1 MAGAKEIRNKIGSVKSTQKITKAMEMVAASKMRRSQESMEASRPYADTMRKVIGHLALGNLEYRHPYLEEREAKRVGYIVISSDRGLCGGLNINLFKKVMAEMKTWSEDGVEIDLAVIGSKATAFFNSYGGNV-VAQNSGLGDHPSLEELIGTVGV-MLKKY-DEGQLDRLYVVNNKFINTMVQEPAIEQLLPLPKSEDEAM--QRTHAWDYIYEPEPKPLLDALLIRYVESQVYQGVVENLACEHVARMIAMKAATDNAGDIIDELQLVYNKARQAAITQELSEIVSGA 285
>gi|148978362|ref|ZP_01814867.1| F0F1 ATP synthase subunit gamma [Vibrionales bacterium SWAT-3] >gi|145962521|gb|EDK27799.1| F0F1 ATP synthase subunit gamma [Vibrionales bacterium SWAT-3] (288 aa)
Score = 299, Expect = 1.9e-25, Identities = 82/283 (28%), Positives = 164/283 (57%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNS-DSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIK------SNDEIWLIGKKGKNLIKSKG--IEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  ++ST KIT AM++V+++K+++ ++       Y +    +  ++ + S + +   L++ E  +  ++   +  GLCG  N+N+ K+    +K      ++ E+ +IG K      + G  + A++S    L D     DL   ++  +L KY ++  +  + V+++KF N++   P++  LLPL K+  +    + ++  D+  +P    + +++L+ Y+ + ++  +VE+  CE A+R  AM +AT NA++LI + +L +N+ RQ+ ITQE++EIVSGA
  S:     1 MAGAKEIRNKIGSVKSTQKITKAMEMVAASKMRRSQDAMEATRPYAETMRKVIGHLANGSLEYKHPYLEEREAKRVGYIIVSTDRGLCGGLNINLFKKAMNDMKDWSEKGADVELAIIGSKATAFFNNSGAKVAAQVS---GLGDSPSLEDLIGSVSV-MLKKY-DEGELDRLFVVFNKFENTMVQEPTIDQLLPLPKSDSEDM--QRDHAWDYIYEPEPKPLLDALLVRYVESQVYQGVVENLACEQAARMIAMKAATDNASDLIDDLELVYNKARQAAITQELSEIVSGA 285
>gi|88811294|ref|ZP_01126550.1| Sodium-transporting two-sector ATPase [Nitrococcus mobilis Nb-231] >gi|88791833|gb|EAR22944.1| Sodium-transporting two-sector ATPase [Nitrococcus mobilis Nb-231] (286 aa)
Score = 299, Expect = 1.9e-25, Identities = 83/283 (29%), Positives = 160/283 (56%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILS--LKKSEEGKTIWLAFFSSMGLCGSFNLN----IVKELQKHIKSNDEI--WLIGKKGKNLIKSKGIEAE-ISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA+  EI+ +I+ I++T KIT AM++V+++K+++ +E       Y  K  ++  +I +N+  E     + + E  +  ++   +  GLCG  N N    +++E+Q+  K N E+   +IG K    ++   I A  I+    L D     D+   +   L A   ++  +  + ++Y++F+NS++  P +  LLPL  + E     +  +  D+  +P + +V + +L+ Y+   ++  +VE+  CE A+R  AM +A+ NA  LI+  +L +N+ RQ+ IT+E++EIV+GA
  S:     1 MAAGKEIRTQIRSIQNTQKITRAMEMVAASKMRRAQERMSAARPYADKLRNVIGHI-ANAHPEYKHPFMLEREVRRVAFIVISTDRGLCGGLNANEFRQLLREMQQWRKQNVEMEFGVIGNKATMFLRR--IRAHVIAQTTHLGDAPGVSDVIGAVKVALDAY--SEGRVDRLYLVYNRFINSMTQRPEIEQLLPLVPSEEV----ELKHYWDYLYEPGSQEVLQHVLVRYIEALVYQGVVENIACEQAARMVAMKAASDNAGNLIEELQLVYNKARQAAITKELSEIVAGA 283
>gi|84494527|ref|ZP_00993646.1| ATP synthase, gamma chain [Janibacter sp. HTCC2649] >gi|84384020|gb|EAP99900.1| ATP synthase, gamma chain [Janibacter sp. HTCC2649] (300 aa)
Score = 299, Expect = 2.0e-25, Identities = 83/282 (29%), Positives = 160/282 (56%)
  Q:     2 ASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSE-ILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDE------IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKY----KNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSI---QPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           A +   ++RI+ + +T KIT AM+L+++A++ K ++     + Y +      + + + S+ E +L+ +K +  +   +   S  GL G+++ +++KE ++ I    E       +L+G+K     K +  +   + +   D +   FD    I E L+A +    +++  +  + ++YS+FV+ ++  P V  LLPL+  +E    + P  G  F +   +P+  DV +++L  Y+ + +   ++++   E A+R+ AM SAT NA EL+K Y    N+ RQ+EITQEI+EIV GA
  S:     3 AQIRVYRQRIRSVSATKKITRAMELMAAARVVKAQQAVRESTPYARAITRAVSAVATFSNEEHLLTTEKEKVTRAAVVIITSDRGLAGAYSSSVLKESERLIARLREEGKEAVPYLLGRKALGYFKFR--QRPFAAEWTGDSEKPTFDRAREIGERLVADFLLDTESEGGVDEVHIVYSRFVSMVTQEPEVIRLLPLE-IVEGT--EAPAEGDLFPLYEFEPSVEDVLDALLPKYVTSRLFNCMLQAAASELAARQRAMKSATDNAEELVKKYTRLVNQARQAEITQEISEIVGGA 293
>gi|114777382|ref|ZP_01452379.1| ATP synthase subunit C [Mariprofundus ferrooxydans PV-1] >gi|114552164|gb|EAU54666.1| ATP synthase subunit C [Mariprofundus ferrooxydans PV-1] (284 aa)
Score = 299, Expect = 2.0e-25, Identities = 83/283 (29%), Positives = 164/283 (57%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFT-YIKSNSDSEILSLKKSEEGKTIWLAFFSS-MGLCGSFN-------LNIVKELQKHIKSNDEIWLIGKKGKNLIKS-----KGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGA--DFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MAS  EI+ +IK I++T+KIT AM++V+++K++K ++       Y +    +    ++++ + +   + + E+ K + L   ++  GLCG  N       LNIVK+ +  +    E + IG++    ++      +  E E++  +EL D      +  +++  +    K +  +  + +++++FVN+++ TP    LLP   +IE      P++    D+  +P + DV + +L  Y+ + ++  ++E+K CE+++R  AM SAT NA  + ++ K+ +N+ RQ+ ITQEI EI SGA
  S:     1 MASAKEIRGQIKAIQNTAKITKAMEMVAASKMRKAQDRVTAGRAYAEGIKRVVANLMQAHPEYKHPFVVQREQVKRVGLILINTDKGLCGGLNTNAQRLALNIVKDSEVEV----EAYTIGRRAGQFMRKIVDDLRASEDEVADAVELGD------ILGVVSVAMDRYVKGE--VDEVSLVFTEFVNTMTQTPVKIQLLPCASSIE------PSHPGYWDYIYEPESKDVLDGLLRRYVESLVYHGVLENKACEHSARMIAMKSATDNAKGIAQDLKITYNKARQAGITQEIAEICSGA 281
>gi|55820566|ref|YP_139008.1| F0F1 ATP synthase subunit gamma [Streptococcus thermophilus LMG 18311] >gi|55822456|ref|YP_140897.1| F0F1 ATP synthase subunit gamma [Streptococcus thermophilus CNRZ1066] >gi|116627375|ref|YP_819994.1| F0F1 ATP synthase subunit gamma [Streptococcus thermophilus LMD-9] >gi|122268024|sp|Q03LX4|ATPG_STRTD ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|75527789|sp|Q8RKV3|ATPG_STRTR ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|81676597|sp|Q5M105|ATPG_STRT1 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|81676746|sp|Q5M5J2|ATPG_STRT2 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|20070092|gb|AAM01189.1| H+-ATPase cytoplasmic F1-part gamma-subunit [Streptococcus thermophilus] >gi|55736551|gb|AAV60193.1| H+-translocating ATPase gamma subunit [Streptococcus thermophilus LMG 18311] >gi|55738441|gb|AAV62082.1| proton-translocating ATPase, gamma subunit [Streptococcus thermophilus CNRZ1066] >gi|116100652|gb|ABJ65798.1| F0F1-type ATP synthase, gamma subunit [Streptococcus thermophilus LMD-9] (292 aa)
Score = 299, Expect = 2.0e-25, Identities = 92/282 (32%), Positives = 154/282 (54%)
  Q:     2 ASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFT-----YIKSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIK----SNDE--IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
            SL EIK +I  I+ TS IT AM++VS++KL + ++   +  IY  K   + T      + + S + +L  +     K+ ++   S  GL G +N  I+K +   IK    S DE  I  IG  G +  K++ +   ++ +L   +   +FD    I    +  Y+N+     + V Y+  +NSLS    V  +LP+  A   P   + +    F ++P+ + + + +L  Y  + I+GAIV++K  E+A+   AM +AT NA ++I +  +++NR RQ+ ITQEITEIV GA
  S:     3 GSLREIKAKIASIKQTSHITGAMQMVSASKLTRSEQAAKDFQIYASKIRQITTDLLHSELVNGSSNPMLDARPVR--KSGYIVITSDKGLVGGYNSTILKAVLDMIKRDHDSEDEYAIISIGGTGSDFFKARNMN--VAFELRGLEDQPSFDQVGKIISKAVGMYQNEL-FDELYVCYNHHINSLSREVRVEKMLPI--ADFDPNESEGHVLTKFELEPDRDTILDQLLPQYAESLIYGAIVDAKTAEHAAGMTAMQTATDNAKKIINDLTIQYNRARQAAITQEITEIVGGA 288
>gi|159900584|ref|YP_001546831.1| ATP synthase F1, gamma subunit [Herpetosiphon aurantiacus ATCC 23779] >gi|159893623|gb|ABX06703.1| ATP synthase F1, gamma subunit [Herpetosiphon aurantiacus ATCC 23779] (295 aa)
Score = 299, Expect = 2.1e-25, Identities = 90/283 (31%), Positives = 151/283 (53%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNS----DSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDE------IWLIGKKGKNLIKSKG--IEAEISLDLELDDKDINFDLFHIIAENLLAKYKND----YNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGA---DFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MAS  EI++RIK +++T KIT AM+LVS++K+++ +   L    Y  + YD+   +   S        L        +   +      GLCG+ N N+ +   + I           +  IGKKG++ I   G  +++EI   + L D     D+    A   +  Y  D    Y+   + ++ ++FVN+L   P +   LP    +E P     N GA   D+S +P+  DV + +L  ++   ++ AI+ES   E+++R  AM +A  NA EL+++  L +N+ RQ+ IT EI+EI +GA
  S:     1 MASAREIRRRIKSVKNTGKITKAMELVSASKMRRAQRNVLATRPYADRLYDVMGELTLRSMGGGTKHPLLQPHPTVTRVALILITPDRGLCGALNSNLTRAAARFITDQKSQGRSVSVIAIGKKGRDFILRVGQKLDSEI---IGLGDAPPLVDVLPA-ATTAINGYSPDASGNYDYDEVYLLCAEFVNTLVQRPKLRRFLP----VEAP----GNAGATKVDYSYEPSQEDVLDQLLPRFIEVQLYQAILESIASEHSARMMAMRNANDNAKELVRDLTLTYNKARQAAITTEISEIAAGA 290
>gi|82546106|ref|YP_410053.1| F0F1 ATP synthase subunit gamma [Shigella boydii Sb227] >gi|123558237|sp|Q31UN3|ATPG_SHIBS ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|81247517|gb|ABB68225.1| membrane-bound ATP synthase, F1 sector, gamma-subunit [Shigella boydii Sb227] (287 aa)
Score = 299, Expect = 2.1e-25, Identities = 81/283 (28%), Positives = 159/283 (56%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKG--IEAEISLDLELDDKDINFDLFHIIAE-NLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  +++T KIT AM++V+++K++K ++       Y +    +  ++   N + + L L+  +  +  +L   +  GLCG  N+N+ K+L   +K+        ++ +IG KG +   S G  + A+++    + D   N  L  +I    ++ +  ++  +  + ++ +KF+N++S  P++  LLPL  + +    D  +   D+  +P+   + +++L  Y+ + ++  +VE+   E A+R  AM +AT N   LIK  +L +N+ RQ+ ITQE+TEIVSGA
  S:     1 MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQDRMAASRPYAETMRKVIGHLAHGNLEYKHLYLEDRDVKRVGYLVVSTDRGLCGGLNINLFKKLLAEMKTWTDKGVQCDLAMIGSKGVSFFNSVGGNVVAQVT---GMGD---NPSLSELIGPVKVMLQAYDEGRLDKLYIVSNKFINTMSQVPTISQLLPLPASDDD---DLKHKSWDYLYEPDPKALLDTLLRRYVESQVYQGVVENLASEQAARMVAMKAATDNGGSLIKELQLVYNKARQASITQELTEIVSGA 284
>gi|77361905|ref|YP_341480.1| membrane-bound ATP synthase, F1 sector, gamma-subunit [Pseudoalteromonas haloplanktis TAC125] >gi|123589154|sp|Q3IK49|ATPG_PSEHT ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|76876816|emb|CAI88038.1| membrane-bound ATP synthase, F1 sector, gamma-subunit [Pseudoalteromonas haloplanktis TAC125] (286 aa)
Score = 299, Expect = 2.1e-25, Identities = 88/283 (31%), Positives = 156/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MAS  EIK +I  I++T KIT+AM++V+++K+K+ +E       Y  K   +   + ++N D     L++ E  +  ++   +  GLCG  N N  K++   IK+      + E   +G K     +  G +  ++    L DK    D+   +   L A   ++  I  + ++Y+KFVN++   P+V  LLPL KA E    +   +  D+  +PN + + E++L+ ++ + ++  +VE+   E A+R  AM +AT NA +L+   +L +N+ RQ+ ITQEI+EI SG+
  S:     1 MASGKEIKSKIGSIKNTQKITSAMEMVAASKMKRAQERVATSRPYAAKLRTVIGRVAQANLDFTHPFLEEREVKRVGYIVISTDRGLCGGLNSNEFKKVALDIKAWKEKGVSAEFATLGSKAAGFFQRFGGQV-LAKKAGLGDKPSIQDIIGPVKVMLDAF--SEGKIDRLFLVYNKFVNTMKQEPTVDQLLPLPKAEE----EVSAHTWDYLYEPNPDAILEALLVRFVESQVYQGVVENAASEQAARMVAMKAATDNAGDLMDELQLIYNKARQAAITQEISEICSGS 283
>gi|16080735|ref|NP_391563.1| F0F1 ATP synthase subunit gamma [Bacillus subtilis subsp. subtilis str. 168] >gi|2636207|emb|CAB15699.1| ATP synthase (subunit gamma) [Bacillus subtilis subsp. subtilis str. 168] (287 aa)
Score = 299, Expect = 2.1e-25, Identities = 94/283 (33%), Positives = 156/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKE----LQKHIKSNDE--IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNG----ADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MASL +IK RI   + TS+IT AM++VS+AKL + +    +   Y  K  ++ + + + + + +   L   E  KT +L   S  GL G+FN ++++     +Q+  +S DE  +  IG+ G++  K +  E  I  +L     ++ F     +A   +  +  D     + ++Y+ FV++++   +   LLPL         D  + G    A +  +P+  +V E +L  Y  + I GA+++SK  E+A+R  AM +AT NA ELI +  L +NR RQ+ ITQEITEIV GA
  S:     1 MASLRDIKSRITSTKKTSQITKAMQMVSAAKLNRAENNAKSFVPYMDKIQEVVSNVGRVSGNVKHPMLLSREVKKTAYLVITSDRGLAGAFNSSVLRSAYQAMQERHQSKDEYAVIAIGRVGRDFFKKR--EIPIISELTGLGDEVTFTEIKDLARQTIQMFI-DGAFDELHLVYNHFVSAITQEVTEKKLLPLS--------DLGSGGGKRTASYEFEPSEEEVLEVLLPQYAESLIFGALLDSKASEHAARMTAMKNATDNAKELIDSLSLSYNRARQAAITQEITEIVGGA 283
>gi|125624726|ref|YP_001033209.1| F0F1 ATP synthase subunit gamma [Lactococcus lactis subsp. cremoris MG1363] >gi|75533888|sp|Q9RAU1|ATPG_LACLM ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|6048352|gb|AAF02207.1|AF059739_7 H+-ATPase cytoplasmic F1-part gamma-subunit [Lactococcus lactis subsp. cremoris] >gi|15963436|dbj|BAB69470.1| H+-ATPase gamma subunit [Lactococcus lactis subsp. lactis] >gi|124493534|emb|CAL98515.1| ATP synthase F1, gamma subunit [Lactococcus lactis subsp. cremoris MG1363] (289 aa)
Score = 299, Expect = 2.1e-25, Identities = 96/282 (34%), Positives = 155/282 (54%)
  Q:     2 ASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKS--NSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIK------SNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPL---DKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           ASLNEIK +I   + TS+IT AM++VS+AKL+K +        Y +K   + T + S  N  ++   + K E  KT +L   S  GL GS+N NI+K +  +I+      S   I  +G  G +  K++ ++    L   L D+   F+    I    + +Y+ +     + V Y+  VNSL     +  +LP+   +K  EK  L        F ++P+   +   +L  Y  + I+G+IV++K  E+A+   AM +AT NA+ +I +  +++NR RQ+ ITQEITEIV+GA
  S:     3 ASLNEIKTKIASTKKTSQITGAMQMVSAAKLQKAESHAKAFQTYAEKVRKITTDLVSSDNEPAKNPMMIKREVKKTGYLVITSDRGLVGSYNSNILKSVISNIRKRHTNESEYTILALGGTGADFFKARNVKVSYVLR-GLSDQP-TFEEVRAIVTEAVEEYQAE-EFDELYVCYNHHVNSLVSEARMEKMLPISFDEKGDEKASL------VTFELEPDRETILNQLLPQYAESMIYGSIVDAKTAEHAAGMTAMRTATDNAHSVINDLTIQYNRARQASITQEITEIVAGA 286
>gi|73543029|ref|YP_297549.1| F0F1 ATP synthase subunit gamma [Ralstonia eutropha JMP134] >gi|83287949|sp|Q46VX9|ATPG_RALEJ ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|72120442|gb|AAZ62705.1| H+-transporting two-sector ATPase, gamma subunit [Ralstonia eutropha JMP134] (291 aa)
Score = 299, Expect = 2.1e-25, Identities = 83/283 (29%), Positives = 158/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKS-NSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPL--DKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +IK +++T KIT AM++V+++K++K +E   N   Y +K  ++  ++ S N + +   +++ E  +   +   +  GLCG  N N+++ +   +K+      + +   IG KG   +   G +  +S  ++L D      L   I   L A    +  + ++ + Y++F+N++   P V  LLPL  DK + +   +K     D+  +P+A  V E +L+ Y+   ++ A+ E+   E ++R  AM +A+ NA  +I   +L++N+ RQ+ IT+E++EIVSGA
  S:     1 MAGTKEIRTKIKSVQNTRKITKAMEMVAASKMRKAQERMRNARPYAEKVRNIAAHLASANPEFKHPFMQEREVKRVGMIVVTTDKGLCGGLNTNVLRAVTNELKTLQGRGVDVQATAIGGKGMQFLSRIGAKV-VSNVVQLGDTPHLEKLIGAIKVQLDAFTNGE--VDAVYLSYTRFINTMKQEPMVEQLLPLAADK-LAQTEEEKRAYSWDYIYEPDAQTVVEDLLVRYVEALVYQAVAENMASEQSARMVAMKAASDNAKNVIGELQLDYNKTRQAAITKELSEIVSGA 288
>gi|194684375|emb|CAR46021.1| ATP synthase gamma chain [Proteus mirabilis HI4320] (287 aa)
Score = 299, Expect = 2.1e-25, Identities = 80/283 (28%), Positives = 155/283 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIK-SNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  +++T KIT AM++V+++K++K +E       Y +    +  ++   N + +   L++ E  +  +L   +  GLCG  N+N+ K+L   +K         ++ L+G K  +   S G      +    DD  ++ DL   +  N++ +  ++  +  + V+ +KF+N+++  P +  +LPL    ++   +K     D+  +P+   + +++L  Y+ + ++ ++VE+   E A+R  AM +AT N   LIK  +L +N+ RQ+ ITQE+TEIVSGA
  S:     1 MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKTQERMAASRPYAETMRSVIGHLALGNLEYKHPYLEEREVKRVGYLVVSTDRGLCGGLNINLFKKLLADMKEWSDKGVEVDLALVGSKAVSFFASVGGNVVGQVTGMGDDPQLS-DLIGPV--NIMLQAYDEGRLDKLYVVANKFINTMAQEPKILQVLPLPPGDDEELKEK---SWDYLYEPDPKTLLDTLLRRYIESQVYQSVVENLASEQAARMVAMKAATDNGGNLIKELQLVYNKARQASITQELTEIVSGA 284
>gi|124265389|ref|YP_001019393.1| Sodium-transporting two-sector ATPase [Methylibium petroleiphilum PM1] >gi|166215106|sp|A2SC69|ATPG_METPP ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|124258164|gb|ABM93158.1| Sodium-transporting two-sector ATPase [Methylibium petroleiphilum PM1] (291 aa)
Score = 299, Expect = 2.2e-25, Identities = 84/283 (29%), Positives = 156/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSD--SEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIK------SNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA+  EI+ +IK +E+T KIT AM++V+++K++K +E       Y  K  ++   + ++N +     +++  +      ++   +  GLCG  N N+++ +   ++      S  E   IG KG   +   G +  +S   +L D   + +      + LL  Y  +  + ++ + Y++F+N++   P V  LLPL  A +K + D   +G D+  +P+A  V + +L+ ++   I+ A+ E+   E ++R  AM +AT NA  LI   KL +N+ RQ+ IT+E++EIVSGA
  S:     1 MAAGKEIRGKIKSVENTKKITKAMEMVAASKMRKAQERMRAARPYADKIRNITANLAQANPEYTHPFMAVSATAAKTAGFVVVTTDKGLCGGLNTNVLRAVTGKLRELESQGSKAEAVAIGNKGLGFLNRIGAKV-VSHATQLGDAP-HLERLIGPVKVLLDAYA-EGKLNAVYLCYTRFINTMKQEPVVEQLLPL--ASDKLKADAGEHGWDYLYEPDAKTVIDDLLLRFVEALIYQAVAENMASEQSARMVAMKAATDNAGTLIGELKLVYNKTRQAAITKELSEIVSGA 287
>gi|71893407|ref|YP_278853.1| ATP synthase gamma chain [Mycoplasma hyopneumoniae J] >gi|71851534|gb|AAZ44142.1| ATP synthase gamma chain [Mycoplasma hyopneumoniae J] (276 aa)
Score = 299, Expect = 2.2e-25, Identities = 81/282 (28%), Positives = 151/282 (53%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSG 282
           M  LN ++ R   I++  K+TN M+++++AK+ K K  F     Y++    +F  I +N   ++  L  ++  K +++ F S++G CG+ N  I+K +   ++ NDEI + G+K  N +        I   L +++ + +  +  I   N + +   +   K I + Y+KF++ +  +P + +L    K   K        G     +PNA +VF+ ++  Y+ + +    +ESK+ E ++RR +M+SAT+NA+E++   + E N  RQ+ ITQEI EI+SG
  S:     1 MPKLNRLRARFVQIQNIEKMTNVMEMIANAKIPKIKNKFKIVQEYFENLDYIFQNILANLSKKVEELTNADSKKNLYIIFGSNLGFCGALNNLILKNVVPQLQKNDEIIVFGEKIYNFLSINYSNLIIKFFLNIEETNFSEPILEI--SNFVNQSIFERKYKKIFICYNKFISIIHSSPEMQNLFDFKKNTIK------YGGYGIEFEPNATEVFKKLMPFYIKSILEKLFIESKLVETSTRRTSMESATENASEILHKLETEINSSRQAMITQEIIEIISG 274
>gi|149202398|ref|ZP_01879371.1| F0F1 ATP synthase subunit gamma [Roseovarius sp. TM1035] >gi|149144496|gb|EDM32527.1| F0F1 ATP synthase subunit gamma [Roseovarius sp. TM1035] (292 aa)
Score = 298, Expect = 2.4e-25, Identities = 81/285 (28%), Positives = 153/285 (53%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFY----DLFTYIKSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKN-DYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           M +L ++K RI  ++ST KIT AM++V++AKL++ ++       Y ++F      L   +   +++  L     E+   + +   +  GLCG FN NI K  + H           +I  +GKKG++ +K    +  +      + K + +     IA  +L ++   ++++   K+ +S+F N +S  PS+  ++P D      ++D     + +  +P+   +   +L   +AT I  A++E+   E  +R +AMD+AT+NA ++I    +E+NR RQ+ IT E+ EI+SGA+ 
  S:     1 MPNLKDLKNRIASVKSTRKITKAMQMVAAAKLRRAQDAAEQARPYTERFNAVMGKLAASVGDAANAPRLLAGTGEDKVHLLVVMTAERGLCGGFNANIAKLAKTHAAELLAKGKTVKILTVGKKGRDAMKRDFGQYSVGHVDMSEVKRLGYADAQGIAAEVLKRFDGGEFDVA--KIFFSRFENVVSQIPSMQQVIPFDVDTTAGKVD---TDSFYDYEPDEQAILADLLPRGVATAIFAALLENGASEQGARMSAMDNATRNAGDMIDRLTIEYNRSRQAVITNELIEIISGAEA 291
>gi|167762923|ref|ZP_02435050.1| hypothetical protein BACSTE_01287 [Bacteroides stercoris ATCC 43183] >gi|167699263|gb|EDS15842.1| hypothetical protein BACSTE_01287 [Bacteroides stercoris ATCC 43183] (294 aa)
Score = 298, Expect = 2.4e-25, Identities = 92/283 (32%), Positives = 164/283 (57%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFT-YIKSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHI-------KSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLD--KAIEKPR--LDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MASL E+K RI  ++ST +IT+AMK+V+SAKL K +    N   Y +K  ++ T ++ ++   E    ++   GK   +AF S+  LCG+FN N+ K L++ +       K N  ++ +GKK +  +K  G E + S   E+ DK      + + A +L+ ++  +  I  +++IY  F +  S   +  + LP+D  K  E+    + K +   D+ ++P+A+ +   +L   L+  I+  +++S   E+A+R  AM +AT NANELI++   ++N+ RQ  IT E+ +I+ G+
  S:     1 MASLKEVKNRISSVKSTRQITSAMKMVASAKLHKAQGRIENMLPYQRKLNEILTNFLSTDVTVESPYTEERPVGKVAIVAFSSNSSLCGAFNSNVAKMLERTLEDYRSLGKENILVYPVGKKVEEAVKKLGYEPQGSYQ-EMADKPSYVQAYEL-AGHLMKEFL-EGRIDKVELIYHHFKSMGSQVLTRDNYLPIDLGKVAEEATGTVGKSSFNNDYIVEPSASQLVAELLPKVLSQKIYTVLLDSNTSEHAARMLAMQAATDNANELIQDLTKQYNKSRQQAITNELLDIIGGS 292
>gi|109648043|ref|ZP_01371946.1| ATP synthase F1, gamma subunit [Desulfitobacterium hafniense DCB-2] >gi|109641133|gb|EAT50688.1| ATP synthase F1, gamma subunit [Desulfitobacterium hafniense DCB-2] (284 aa)
Score = 298, Expect = 2.4e-25, Identities = 81/283 (28%), Positives = 160/283 (56%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHI--KSND-EIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           +AS  +I++RI+ + +  +IT AMK+V+++KL+K +E  +    Y ++  ++   + +  +D     L +    +  ++   S  GLCG +N N+++     I  +++D  +  +G+KG++  +   IE  I+  + L D + ++     IA+ ++  Y++   +  + ++Y++FV+++S  P+   LLP    IEKP   K  +  ++  +P+A ++  ++L  Y+ T +   ++E K  E  ++  AM +AT NA E I+   L+ NR RQ+ IT EI+EIV GA
  S:     4 VASARDIRRRIRGVRNMQQITKAMKMVAASKLRKAQEKVIAARPYARQLQEVLARLAQDQADVTHPLLMERPVQRVGYIIITSDRGLCGGYNTNLIRMTNSSIAEETHDVRLVAVGRKGRDFYRRGKIET-IAEFVGLGD-NPSYGQAKEIAQEVIGLYESG-ELDEVYLLYNEFVSAISQRPTRIKLLP----IEKP---KQVSNTEYIFEPSAEEILTTLLPKYVETQVFRTLLEGKASEMGAKMTAMGAATDNAKEAIERLTLQLNRARQAAITTEISEIVGGA 280
>gi|15616317|ref|NP_244622.1| F0F1 ATP synthase subunit gamma [Bacillus halodurans C-125] >gi|22653664|sp|Q9K6H4|ATPG_BACHD ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|10176379|dbj|BAB07474.1| ATP synthase gamma subunit [Bacillus halodurans C-125] (285 aa)
Score = 298, Expect = 2.4e-25, Identities = 94/283 (33%), Positives = 154/283 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIK-SNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKEL----QKHIKSNDE--IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MASL +IK+RI   + T +IT AM++VS+AKL + +E   +   Y  K  ++   I  S++D     L++    KT ++   S  GL G++N N+++ L     K  KS DE  I+ IG+ G++L+K + +   IS    L D+   F+    IA+  +  + ++     + + Y+ FV+ +    +   +LPL        L        +  +PN   + E++L  Y  + ++GA++++K  E A+R  AM +AT NA  LI    L +NR RQ+ ITQEITEIV GA
  S:     1 MASLRDIKQRINSTKKTKQITKAMEMVSAAKLNRSQEKAQSFLPYTDKIREVVASIAASDTDVSHPMLEERPVKKTGYIVITSDRGLAGAYNSNLIRGLLYTINKRHKSKDEYGIFAIGRTGRDLLKKRQLPI-ISEMTGLSDQP-TFNDIKDIAKQTVDMFADEV-FDELYIWYNHFVSPIKQDVTEKKVLPLTD------LSDTKVSTTYEYEPNEQVILEALLPQYAESLVYGALLDAKASEFAARMTAMSAATDNATNLIDELTLSYNRARQAAITQEITEIVGGA 281
>gi|59713172|ref|YP_205948.1| F0F1 ATP synthase subunit gamma [Vibrio fischeri ES114] >gi|75506882|sp|Q5E1N6|ATPG_VIBF1 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|59481273|gb|AAW87060.1| ATP synthase F1, gamma subunit [Vibrio fischeri ES114] (288 aa)
Score = 298, Expect = 2.5e-25, Identities = 80/283 (28%), Positives = 156/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIK-SNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDE------IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  ++ST KIT AM++V+++K+++ +E       Y      +  ++   N +     L++ E  +  ++   S  GLCG  N+N+ K++   +K+  E      + +IG K      S G    ++ +  L D     +L   +   +L KY ++  +  + V+ +KF+N++   P++  LLPL K+ ++    +  +  D+  +P    + +++L+ Y+ + ++  +VE+  CE+ +R  AM +AT NA ++I   +L +N+ RQ+ ITQE++EIVSGA
  S:     1 MAGAKEIRNKIGSVKSTQKITKAMEMVAASKMRRSQESMEASRPYADTMRKVIGHLALGNLEYRHPYLEEREAKRVGYIVISSDRGLCGGLNINLFKKVMTEMKTWSEDGVEIDLAVIGSKATAFFNSYGGNV-VAQNSGLGDHPSLEELIGTVGV-MLKKY-DEGQLDRLYVVNNKFINTMVQEPAIEQLLPLPKSEDEAM--QRTHAWDYIYEPEPKPLLDALLVRYVESQVYQGVVENLACEHVARMIAMKAATDNAGDIIDELQLVYNKARQAAITQELSEIVSGA 285
>gi|194291167|ref|YP_002007074.1| membrane-bound ATP synthase, F1 sector, gamma-subunit [Cupriavidus taiwanensis] >gi|193225002|emb|CAQ71013.1| membrane-bound ATP synthase, F1 sector, gamma-subunit [Cupriavidus taiwanensis] (291 aa)
Score = 298, Expect = 2.5e-25, Identities = 84/283 (29%), Positives = 156/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKS-NSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPL--DKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +IK +++T KIT AM++V+++K++K +E   N   Y +K  ++  ++ + N + +   +++ E  +   +   +  GLCG  N N+++ +   +KS      + +   IG KG   +   G +  +S  + L D      L   I   L A    +  + ++ + Y+KF+N++   P V  LLPL  DK + +   +K     D+  +P+A  V E +L+ Y+   ++ A+ E+   E ++R  AM +A+ NA  +I   +L +N+ RQ+ IT+E++EIVSGA
  S:     1 MAGTKEIRTKIKSVQNTRKITKAMEMVAASKMRKAQERMRNARPYAEKVRNIAAHLATANPEFKHPFMQEREVKRVGMIVVTTDKGLCGGLNTNVLRSVTNELKSLQGRGVDVQATAIGTKGMQFLGRIGAKV-VSHVVHLGDTPHLEKLIGAIKVQLDAFTNGE--VDAVYLAYTKFINTMKQEPMVEQLLPLAADK-LSQTEEEKRAYSWDYIYEPDAQTVVEELLVRYVEALVYQAVAENMASEQSARMVAMKAASDNAKNVIGELQLVYNKTRQAAITKELSEIVSGA 288
>gi|54020005|ref|YP_115569.1| ATP synthase gamma chain [Mycoplasma hyopneumoniae 232] >gi|53987178|gb|AAV27379.1| ATP synthase gamma chain [Mycoplasma hyopneumoniae 232] (276 aa)
Score = 298, Expect = 2.5e-25, Identities = 82/282 (29%), Positives = 150/282 (53%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSG 282
           M  LN ++ R   I++  K+TN M+++++AK+ K K  F     Y++    +F  I +N   ++  L  ++  K +++ F S++G CG+ N  I+K +   ++ NDEI + GKK  N +        I   L +++ + +  +  I   N + +   +   K I + Y+KF++ +   P + +L    K   K        G     +PNA +VF+ ++  Y+ + +    +ESK+ E ++RR +M+SAT+NA+E++   + E N  RQ+ ITQEI EI+SG
  S:     1 MPKLNRLRARFVQIQNIEKMTNVMEMIANAKIPKIKNKFKIVQEYFENLDYIFQNILANLSKKVEELTNTDSKKNLYIIFGSNLGFCGALNNLILKNVVPQLQKNDEIIVFGKKIYNFLSINYSNLIIKFFLNIEETNFSEPILEI--SNFVNQSIFEKKYKKIFICYNKFISIIHSRPEMQNLFDFKKNTIK------YGGYGIEFEPNATEVFKKLMPFYIKSILEKLFIESKLVETSARRTSMESATENASEILHKLETEINSSRQAMITQEIIEIISG 274
>gi|119471628|ref|ZP_01614013.1| membrane-bound ATP synthase, F1 sector, gamma-subunit [Alteromonadales bacterium TW-7] >gi|119445407|gb|EAW26694.1| membrane-bound ATP synthase, F1 sector, gamma-subunit [Alteromonadales bacterium TW-7] (286 aa)
Score = 298, Expect = 2.7e-25, Identities = 89/283 (31%), Positives = 157/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKK---------GKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MAS  EIK +I  I++T KIT+AM++V+++K+KK +E   +   Y  K   +   + ++N D     L++ E  +  ++   +  GLCG  N N  K++   IK+      + E   +G K         G+ L K  G+  + S+   +    I  D F            ++  I  + ++Y+ FVN++   P++  LLPL KA E    +   +  D+  +P+ + + ES+L+ ++ + ++  +VE+   E A+R  AM +AT NA +L+   +L +N+ RQ+ ITQEI+EIVSG+
  S:     1 MASGKEIKSKIGSIKNTQKITSAMEMVAASKMKKAQERVASSRPYADKLRKVIGRVAQANLDFTHPFLEEREVKRVGYIVISTDRGLCGGLNSNEFKKVALDIKAWKEKGVDAEFATLGSKAAGFFQRFGGQVLAKKAGLGDKPSVQDVIGPVKIMLDAF------------SEGKIDRLFLVYNNFVNTMKQEPTIDQLLPLPKAEE----EVSAHTWDYLYEPSPDAILESLLVRFVESQVYQGVVENAASEQAARMVAMKAATDNAGDLMDELQLVYNKARQAAITQEISEIVSGS 283
>gi|153874694|ref|ZP_02002816.1| ATPase, F1 complex, gamma subunit [Beggiatoa sp. PS] >gi|152068843|gb|EDN67185.1| ATPase, F1 complex, gamma subunit [Beggiatoa sp. PS] (287 aa)
Score = 298, Expect = 2.8e-25, Identities = 93/283 (32%), Positives = 153/283 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEGKTIWLAFFSS-MGLCGSFNLNIVK----ELQKHIKSNDEIWL--IGKKGKNLIKSKG----IEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYN---IKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           M S  EI+ +I  I+ST KIT AM++V+++K+++ ++       Y +K   + +++         S     E K +     SS  GLCG  N N+ K     ++K   +N E+ +  IG+K     K  G     EAE      L D     DL  I+   L     +DY+   I  + VIY+ F N+++  P+V  LLP+    E  RL    +  D+  +P + +V + +L+ Y+ + ++ ++VE+  CE A+R  AM SA+ NA  +I   +L +N+ RQ+ ITQE++EIV GA
  S:     1 MPSSKEIRTKIASIKSTQKITRAMEMVAASKMRRAQDRMRRSRPYSEKIRQVISHLAHAHPEYKHSYMIPREVKRVGFIIISSDRGLCGGLNNNLFKTTLSSMKKWRDNNVEMDMCAIGRKAAVFFKRFGGNLIAEAE-----HLGDAPPLEDLIGIVKVML-----DDYDEGKIDQLFVIYNNFKNTMTQIPTVQQLLPISYEEEDERL---RHHWDYIYEPESQEVLDGLLMRYIESLVYQSVVENIACEQAARMVAMKSASDNAGGIIDELQLAYNKARQAAITQELSEIVGGA 284
>gi|163751421|ref|ZP_02158646.1| ATP synthase subunit C [Shewanella benthica KT99] >gi|161328724|gb|EDP99872.1| ATP synthase subunit C [Shewanella benthica KT99] (286 aa)
Score = 298, Expect = 2.9e-25, Identities = 81/283 (28%), Positives = 154/283 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNS-DSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDEIWL------IGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA+  EIK +I  +++T KIT+AM++V+++K+++ +E       Y +    +  ++   S + +   L+  E  +  ++   +  GLCG  N+N+ K++   +K   E  +      IG +      + G +   S    L D     DL   +   ++ +  N+  +  + V+++KFVN++S  P +  LLPL K+      D   +  D+  +P+  ++ + +L+ Y+ + ++  +VE+   E A+R  AM +AT NA +LI   +L +N+ RQ+ ITQE++EIVSGA
  S:     1 MANAKEIKTKIASVQNTQKITSAMEMVAASKMRRAQERMAASRPYAENMRKVIGHVAQGSLEYKHPYLEVREAKRVGYIVVSTDRGLCGGLNVNLFKKVVADVKKQREAGVEVEFCAIGARSIQFFNNFGGQVSASAS-ALGDAPALKDLIGTV--RVMLEAYNEGKLDRLYVVFNKFVNTMSQMPVIEQLLPLPKS----ESDVIKHRWDYLYEPDPKELLDILLVRYVESQVYQGVVENIASEQAARMVAMKAATDNAGDLITELELVYNKARQAAITQELSEIVSGA 283
>gi|114571342|ref|YP_758022.1| ATP synthase F1, gamma subunit [Maricaulis maris MCS10] >gi|122315070|sp|Q0AKV9|ATPG_MARMM ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|114341804|gb|ABI67084.1| ATP synthase F1, gamma subunit [Maricaulis maris MCS10] (295 aa)
Score = 297, Expect = 3.1e-25, Identities = 90/285 (31%), Positives = 159/285 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFY----DLFTYIKSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKGIEAEISLDLELD-DKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLP----LDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           MASL ++K RI  ++ST KIT AM++V++AKL++ +E       Y ++      +L T +     +  L +   +    + +   +  GLCG FN NIVK+ ++ I +      + ++  +GKKG + +K +   + I   +EL  +K I       I + +   ++N       +++ ++FV+ +S  P    L+P    +D+ +E+P L     GA +  +P+   +   +L  Y  T I  A++E+   E  ++  AMD+AT+NA ELI    L +NR RQ++IT E+TEI+SGA+ 
  S:     1 MASLKDLKNRIGSVKSTQKITKAMQMVAAAKLRRAQEAAEAARPYAQRMAAVMANLSTAMSGTPGASPLLVGTGKSDAYLLVVMTADRGLCGGFNTNIVKKARERINALKAEGKDVKVICVGKKGADQLK-RNFASLIVDKMELSGEKTITGATSVRIGDKIRHMFENG-EFDVCELVSAEFVSVISQKPRAKVLIPAIDAIDEGVERPDL----GGAVYDAEPDEETILNVLLPRYADTVILSALLENVAGEMGAKMAAMDNATRNAGELIDKLNLVYNRTRQAQITTELTEIISGAEA 294
>gi|16762460|ref|NP_458077.1| F0F1 ATP synthase subunit gamma [Salmonella enterica subsp. enterica serovar Typhi str. CT18] >gi|29143948|ref|NP_807290.1| F0F1 ATP synthase subunit gamma [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] >gi|81773515|sp|Q8Z2Q5|ATPG_SALTI ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|25290520|pir||AE0954 ATP synthase gamma chain [imported] - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) >gi|16504765|emb|CAD03129.1| ATP synthase gamma subunit [Salmonella enterica subsp. enterica serovar Typhi] >gi|29139584|gb|AAO71150.1| ATP synthase gamma subunit [Salmonella enterica subsp. enterica serovar Typhi Ty2] (287 aa)
Score = 297, Expect = 3.2e-25, Identities = 81/283 (28%), Positives = 159/283 (56%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKS-NSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKG--IEAEISLDLELDDKDINFDLFHIIAE-NLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  +++T KIT AM++V+++K++K ++       Y +    +  ++ + N + +   L++ +  +  +L   +  GLCG  N+N+ K+L   +K+        E+ +IG KG +   S G  + A+++    + D   N  L  +I    ++ +  ++  +  + ++ +KF+N++S  P++  LLPL  + +    D      D+  +P+   + +++L  Y+ + ++  +VE+   E A+R  AM +AT N   LIK  +L +N+ RQ+ ITQE+TEIVSGA
  S:     1 MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQDRMAASRPYAETMRKVIGHLANGNLEYKHPYLEERDVKRVGYLVVSTDCGLCGGLNINLFKKLLADMKAWSDKGVQCELAMIGSKGVSFFNSVGGNVVAQVT---GMGD---NPSLSELIGPVKVMLQAYDEGRLDKLYIVSNKFINTMSQVPTITQLLPLPASEDD---DLKRTAWDYLYEPDPKALLDTLLRRYVESQVYQGVVENLASEQAARMVAMKAATDNGGSLIKELQLVYNKARQASITQELTEIVSGA 284
>gi|156936113|ref|YP_001440029.1| F0F1 ATP synthase subunit gamma [Enterobacter sakazakii ATCC BAA-894] >gi|166222553|sp|A7MMX0|ATPG_ENTS8 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|156534367|gb|ABU79193.1| hypothetical protein ESA_04007 [Enterobacter sakazakii ATCC BAA-894] (287 aa)
Score = 297, Expect = 3.2e-25, Identities = 84/283 (29%), Positives = 158/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKS-NSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKG--IEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  +++T KIT AM++V+++K++K ++       Y      +  ++ + N + +   L++ +  +  +L   +  GLCG  N+N+ K+L   +K+        +I +IG KG +   S G  I A+++    + D     DL   +   ++ +  ++  +  + V+ +KF+N++S  P++  LLPL  A E   L   +   D+  +P+   + +++L  Y+ + ++  +VE+   E A+R  AM +AT N   LIK  +L +N+ RQ+ ITQE+TEIVSGA
  S:     1 MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQDRMAASRPYADTMRKVIGHLATGNLEYKHPYLEERDVKRVGYLVVSTDRGLCGGLNINLFKKLLADMKAWSDKGVQCDIAMIGSKGVSFFNSVGGNIVAQVT---GMGDNPSLSDLIGPV--KVMLQAYDEGRLDKLYVVSNKFINTMSQAPTITQLLPL-PASEDDELK--HKSWDYLYEPDPKALLDTLLRRYVESQVYQGVVENLASEQAARMVAMKAATDNGGSLIKELQLVYNKARQASITQELTEIVSGA 284
>gi|86606752|ref|YP_475515.1| F0F1 ATP synthase subunit gamma [Synechococcus sp. JA-3-3Ab] >gi|123505625|sp|Q2JSW2|ATPG_SYNJA ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|86555294|gb|ABD00252.1| ATP synthase F1, gamma subunit [Synechococcus sp. JA-3-3Ab] (314 aa)
Score = 297, Expect = 3.2e-25, Identities = 90/285 (31%), Positives = 163/285 (57%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSN---SDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDE------IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAE------NLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNN----GADFSIQ----------PNANDVFE--------SILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           MA+L  I+ RIK +++T KIT AM+LV++A++++ +E  +    +  +   +F  +++     D ++  LK+        L      GLCG++N N++K  ++ ++   E      ++L+G+K     + +   A I+         +N       AE       LL+ + ++  +  +++IY++FV+ +S  P V SLLPLD      R D+  N    G +F+++          P  + +FE        ++L  YL   +  A+ E+   E A+R  AM +A+ NA ELI+   L +N+ RQ+ ITQEI E+V+GA+ 
  S:     1 MANLKRIRDRIKAVKNTRKITEAMRLVAAARVRRAQEQVMATRPFADRLAQVFYRLQTRLRLEDVDLPLLKQRPIETVGLLVVAGDRGLCGAYNANVIKRTEERVRELQETGQQVRLYLVGRKAVQYFQRR--SAPIA------KTYVNLSQIPTAAEAAQIGDELLSAFLSE-KVDKVELIYTRFVSLISSRPVVQSLLPLDPTRLAARDDEIFNLLVRGGEFTVERSKIVAAVSAPPPDMIFEQDPVQILDALLPLYLNNQLLRALQEAAASELAARMTAMSNASDNATELIRTLGLAYNKARQAAITQEILEVVAGAEA 313
>gi|90409082|ref|ZP_01217206.1| ATP synthase subunit C [Psychromonas sp. CNPT3] >gi|90309809|gb|EAS37970.1| ATP synthase subunit C [Psychromonas sp. CNPT3] (287 aa)
Score = 297, Expect = 3.3e-25, Identities = 89/283 (31%), Positives = 158/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIK-SNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIK---SND---EIWLIGKKGKNLIKSKG--IEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  +++T KIT AM++V+++K+++ +E   +   Y K   D+  +I     + +   + + E  +  ++   S  GLCG  N+N+ K+L   +K    ND   ++ LIG K        G  I A+++    L DK    DL  I +  ++    ND  + S+ ++++KF++++   P++  LLPL K +E   + K  +  D+  + +A  + +++ I Y+ + ++  +VE+  CE  SR  AM SAT NAN+LI   +L  N+ RQ+ ITQE+ EI  GA
  S:     1 MAGDKEIRNKIASVKNTQKITGAMEMVAASKMRRAQERMNSTLAYAKTMRDVIGHIALGRLEYQHPYVLEREIKRVGYIVISSDRGLCGGLNINLFKKLISEMKVHSGNDIEVDLALIGSKSTAFFSRIGANIVAQVT---HLGDKPAVKDL--IGSVKVMLDAFNDGKLDSLYIVHNKFISTMVQEPTISQLLPLPK-VESDEVSK--HLWDYLYEDDAKTLLDALFIRYVESQVYQGVVENLACEQVSRMIAMKSATDNANDLIDELQLVANKARQTAITQELAEICGGA 284
>gi|189462111|ref|ZP_03010896.1| hypothetical protein BACCOP_02791 [Bacteroides coprocola DSM 17136] >gi|189431192|gb|EDV00177.1| hypothetical protein BACCOP_02791 [Bacteroides coprocola DSM 17136] (292 aa)
Score = 297, Expect = 3.6e-25, Identities = 89/282 (31%), Positives = 157/282 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFT-YIKSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHI--------KSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNG--ADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSG 282
           MASL E+K RI  I  T KIT+AMK+V+S+KL K +E   N   Y ++ + + T ++ S    E   + K +  K   + F S+  LCG FN N+++ L   I        K N  ++ IG+K  + +K  G+      D +      N+     +A  L+ ++ ND  I+ ++++Y+ F ++ +   +  + LP++ + +    D+ + G   D+ ++P+A  V + +L   L   ++ A+++S   E+A+R  AM  AT NANELI++  L +N+ RQ  IT E+ +I+ G
  S:     1 MASLKEVKGRINSINGTLKITSAMKMVASSKLHKAQEAIENMLPYERRLHHMLTNFLSSELSVESPFVVKRDVKKIAIVVFASNSSLCGGFNANVIRHLSGMIEEYVQQVGKDNILVYPIGRKVADAVKKLGLTP--MGDYQHMSGKPNYKEASELASELMKRFLND-EIQQVEMLYNHFKSTSTQILTRETYLPINFS-QASATDEEDKGKQVDYIVEPSAEKVMQELLPKVLRMKMYTALLDSNAAEHAARTMAMQIATDNANELIQDLTLIYNKSRQQAITNELLDIIGG 289
>gi|146298821|ref|YP_001193412.1| ATP synthase F1, gamma subunit [Flavobacterium johnsoniae UW101] >gi|189081402|sp|A5FL19|ATPG_FLAJO ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|146153239|gb|ABQ04093.1| ATP synthase F1, gamma subunit [Flavobacterium johnsoniae UW101] (286 aa)
Score = 297, Expect = 3.7e-25, Identities = 91/285 (31%), Positives = 156/285 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEI--LSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQK----HIKSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKY-KNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           MA+L EI+ RI  + ST +IT+AMK+VS+AKLKK ++       Y +K  +L   + +  + E+      + E  K + +A  S+ GLCG+FN N++KE++     +     +++ IGKKG +++ SK  +     +   D   + F+    IA+NL  K+   +Y+   I++IY++F N+ +        LPL       + +   +  D+  +P+  ++  +++   L T ++  I +S   E+ +R  AM  AT NA EL    KL +N+ RQ+ IT EI EIV GA+ 
  S:     1 MANLKEIRNRITSVSSTMQITSAMKMVSAAKLKKAQDAITAMRPYAEKLTELLQNLSATLEGEVGGAYTTQREVKKVLLVAITSNRGLCGAFNSNVIKEIKNRTDFYAGKQVDVFAIGKKGNDVL-SKTHKVHGHHNAIFDH--LTFENVAGIADNLTEKFLSGEYD--KIELIYNQFKNAATQIVQTEQFLPLAPL----KSEVSASAGDYIFEPSKEEIVLTLIPKSLKTQLYKGIRDSFASEHGARMTAMHKATDNATELRNQLKLTYNKARQAAITNEILEIVGGAEA 283
>gi|161505609|ref|YP_001572721.1| F0F1 ATP synthase subunit gamma [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] >gi|189081472|sp|A9MJR8|ATPG_SALAR ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|160866956|gb|ABX23579.1| hypothetical protein SARI_03785 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] (287 aa)
Score = 296, Expect = 3.9e-25, Identities = 81/283 (28%), Positives = 159/283 (56%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKS-NSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKG--IEAEISLDLELDDKDINFDLFHIIAE-NLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  +++T KIT AM++V+++K++K ++       Y +    +  ++ + N + +   L++ +  +  +L   +  GLCG  N+N+ K+L   +K+        E+ +IG KG +   S G  + A+++    + D   N  L  +I    ++ +  ++  +  + ++ +KF+N++S  P++  LLPL  + +    D      D+  +P+   + +++L  Y+ + ++  +VE+   E A+R  AM +AT N   LIK  +L +N+ RQ+ ITQE+TEIVSGA
  S:     1 MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQDRMAASRPYAETMRKVIGHLANGNLEYKHPYLEERDVKRVGYLVVSTDRGLCGGLNINLFKKLLAEMKAWSDKGVQCELAMIGSKGVSFFNSVGGNVVAQVT---GMGD---NPSLSELIGPVKVMLQAYDEGRLDKLYIVSNKFINTMSQVPTITQLLPLPASEDD---DLKRKAWDYLYEPDPKALLDTLLRRYVESQVYQGVVENLASEQAARMVAMKAATDNGGSLIKELQLVYNKARQASITQELTEIVSGA 284
>gi|56415734|ref|YP_152809.1| F0F1 ATP synthase subunit gamma [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|167546970|ref|ZP_02342531.1| F0F1 ATP synthase subunit gamma [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23] >gi|81678059|sp|Q5PKX1|ATPG_SALPA ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|56129991|gb|AAV79497.1| ATP synthase gamma subunit [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] (287 aa)
Score = 296, Expect = 3.9e-25, Identities = 81/283 (28%), Positives = 159/283 (56%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKS-NSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKG--IEAEISLDLELDDKDINFDLFHIIAE-NLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  +++T KIT AM++V+++K++K ++       Y +    +  ++ + N + +   L++ +  +  +L   +  GLCG  N+N+ K+L   +K+        E+ +IG KG +   S G  + A+++    + D   N  L  +I    ++ +  ++  +  + ++ +KF+N++S  P++  LLPL  + +    D      D+  +P+   + +++L  Y+ + ++  +VE+   E A+R  AM +AT N   LIK  +L +N+ RQ+ ITQE+TEIVSGA
  S:     1 MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQDRMAASRPYAETMRKVIGHLANGNLEYKHPYLEERDVKRVGYLVVSTDRGLCGGLNINLFKKLLADMKAWSDKGVQCELAMIGSKGVSFFNSVGGNVVAQVT---GMGD---NPSLSELIGPVKVMLQAYDEGRLDKLYIVSNKFINTMSQVPTITQLLPLPASEDD---DLKRTAWDYLYEPDPKALLDTLLRRYVESQVYQGVVENLASEQAARMVAMKAATDNGGSLIKELQLVYNKARQASITQELTEIVSGA 284
>gi|126739851|ref|ZP_01755542.1| F0F1 ATP synthase subunit gamma [Roseobacter sp. SK209-2-6] >gi|126719083|gb|EBA15794.1| F0F1 ATP synthase subunit gamma [Roseobacter sp. SK209-2-6] (291 aa)
Score = 296, Expect = 4.0e-25, Identities = 86/285 (30%), Positives = 167/285 (58%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSN---SDSEILSLKKSEEGKTIWLAFFSS-MGLCGSFNLNIVKELQKHIKSND--------EIWLIGKKGKNLIKSKGIEAEISLDLELDD-KDINFDLFHIIAENLLAKYK-NDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           M SL ++K RI+ ++ST KIT AM++V++AKL++ +E       Y K+F  +   + ++   SDS    L+ +   +   L   ++  GLCG FN NI K  ++  K+N+        ++  +GKKG++ +K +  E +    ++L + K I +     IA+++L ++  +++++ +I   +++FVN ++  P+   ++P          +  ++ A +  +P+   +   +L   ++T I  A++E+   E  +R +AMD+AT+NA ++I    +EFNR RQ+ IT E+ EI+SGA+ 
  S:     1 MPSLKDLKNRIESVKSTRKITKAMQMVAAAKLRRAQEAAEESRPYTKRFNAVMAGLAASVGGSDSAPKLLRGTGSDQVQLLVVLTAERGLCGGFNSNIAKLARQ--KANELKAAGKTVKVLTVGKKGRDALK-RDFEEDFVGHVDLSEVKRIGYTNAQDIAKDILTRFDASEFDVATI--FFAEFVNVVTQIPTAQQIIPASYE----GAEAADSSAVYDYEPSEEAILADLLPRGVSTQIFSALLENGASEQGARMSAMDNATRNAGDMIDKLTIEFNRSRQAVITNELIEIISGAEA 290
>gi|126728277|ref|ZP_01744093.1| F0F1 ATP synthase subunit gamma [Sagittula stellata E-37] >gi|126711242|gb|EBA10292.1| F0F1 ATP synthase subunit gamma [Sagittula stellata E-37] (293 aa)
Score = 296, Expect = 4.0e-25, Identities = 89/285 (31%), Positives = 158/285 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKS---NSDSEILSLKKSEEGKTIWLAFFSS-MGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKGIEAEIS-LDLELDDKDINFDLFHIIAENLLAKYKN-DYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           M +L ++K RI  ++ST KIT AM++V++AKL++ +E       Y ++F  +   + +   +SDS    L  + +     L   ++  GLCG FN NIVK  +  I          +I  +GKKG+  +K    +  +  +DL  D K + +     IA ++L ++ N ++++ +I   Y+KF + +S  P+   ++P     E+   +      D+  +P+   +   +L   +AT I  A++E+   E  +R +AMD+AT+NA E+I    +E+NR RQ+ IT E+ EI+SGA+ 
  S:     1 MPNLKDLKNRIASVKSTRKITKAMQMVAAAKLRRAQEAAEAARPYAERFNAVMASLAASVGDSDSAPRLLAGTGKDDVHLLVVMTAERGLCGGFNTNIVKLAKARITELRGKGKTVKILTVGKKGREQLKRDYADLFVGHVDLS-DVKRLGYGNAQDIARDVLGRFDNGEFDVATI--FYAKFNSVISQDPTALQIVPASYETEEEEQNDATTLYDY--EPDEESILADLLPRGVATQIFAALLENGASEQGARMSAMDNATRNAGEMIDKLTIEYNRSRQAVITNELIEIISGAEA 292
>gi|116512624|ref|YP_811531.1| F0F1 ATP synthase subunit gamma [Lactococcus lactis subsp. cremoris SK11] >gi|122940012|sp|Q02XA4|ATPG_LACLS ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|116108278|gb|ABJ73418.1| F0F1-type ATP synthase, gamma subunit [Lactococcus lactis subsp. cremoris SK11] (289 aa)
Score = 296, Expect = 4.0e-25, Identities = 95/282 (33%), Positives = 154/282 (54%)
  Q:     2 ASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKS--NSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIK------SNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPL---DKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           ASLNEIK +I   + TS+IT AM++VS+AKL+K +        Y +K   + T + S  N  ++   + K E  KT +L   S  GL G +N NI+K +  +I+      S   I  +G  G +  K++ ++    L   L D+   F+    I    + +Y+ +     + V Y+  VNSL     +  +LP+   +K  EK  L        F ++P+   +   +L  Y  + I+G+IV++K  E+A+   AM +AT NA+ +I +  +++NR RQ+ ITQEITEIV+GA
  S:     3 ASLNEIKTKIASTKKTSQITGAMQMVSAAKLQKAESHAKAFQTYAEKVRKITTDLVSSDNEPAKNPMMIKREVKKTGYLVITSDRGLVGGYNSNILKSVISNIRKRHTNESEYTILALGGTGADFFKARNVKVSYVLR-GLSDQP-TFEEVRAIVTEAVEEYQAE-EFDELYVCYNHHVNSLVSEARMEKMLPISFDEKGDEKASL------VTFELEPDRETILNQLLPQYAESMIYGSIVDAKTAEHAAGMTAMRTATDNAHSVINDLTIQYNRARQASITQEITEIVAGA 286
>gi|94312426|ref|YP_585636.1| F0F1 ATP synthase subunit gamma [Ralstonia metallidurans CH34] >gi|166224090|sp|Q1LHK9|ATPG_RALME ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|93356278|gb|ABF10367.1| ATP synthase F1, gamma subunit [Ralstonia metallidurans CH34] (291 aa)
Score = 296, Expect = 4.0e-25, Identities = 86/283 (30%), Positives = 155/283 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKS-NSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPL--DKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +IK +++T KIT AM++V+++K++K +E   N   Y +K  ++  ++ S N + +   +   +  +   +   +  GLCG  N N+++ +   +K       N +   IG KG   +   G +  +S  ++L D      L   I   L A Y N   + ++ + Y+KF+N++   P V  LLPL  DK + +   +K     D+  +P+A  V E +L+ Y+   ++ A+ E+   E ++R  AM +A+ NA  +I   +L +N+ RQ+ IT+E++EIVSGA
  S:     1 MAGTKEIRTKIKSVQNTRKITKAMEMVAASKMRKAQERMRNARPYAEKVRNIAAHLASANPEFKHPFMVARDVKRAGMIVVTTDKGLCGGLNTNVLRAVTNELKDLQGQGVNVQATAIGTKGMQFLGRIGAKV-VSHVVQLGDTPHLEKLIGAIKVQLDA-YTNG-EVDAVYLAYTKFINTMKQEPMVEQLLPLAADK-LSQTEDEKRAYSWDYIYEPDAQTVVEELLVRYVEALVYQAVAENMASEQSARMVAMKAASDNAKNVIGELQLVYNKTRQAAITKELSEIVSGA 288
>gi|113869574|ref|YP_728063.1| F0F1 ATP synthase subunit gamma [Ralstonia eutropha H16] >gi|123328787|sp|Q0K5M6|ATPG_RALEH ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|113528350|emb|CAJ94695.1| Membrane-bound ATP synthase, F1 sector,gamma-subunit [Ralstonia eutropha H16] (291 aa)
Score = 296, Expect = 4.1e-25, Identities = 83/283 (29%), Positives = 156/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKS-NSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPL--DKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +IK +++T KIT AM++V+++K++K +E   +   Y +K  ++  ++ + N + +   +++ E  +   +   +  GLCG  N N+++ +   +K+      + +   IG KG   +   G +  IS  + L D      L   I   L A    +  + ++ + Y+KF+N++   P V  LLPL  DK ++    +K     D+  +P+A  V E +L+ Y+   ++ A+ E+   E ++R  AM +A+ NA  +I   +L +N+ RQ+ IT+E++EIVSGA
  S:     1 MAGTKEIRTKIKSVQNTRKITKAMEMVAASKMRKAQERMRSARPYAEKVRNIAAHLATANPEFKHPFMQEREVKRVGMIVVTTDKGLCGGLNTNVLRAVTNELKTLQGRGVDVQATAIGTKGMQFLGRVGAKV-ISHVVHLGDTPHLEKLIGAIKVQLDAFTNGE--VDAVYLAYTKFINTMKQEPMVEQLLPLAADKLVQTEE-EKRAYSWDYIYEPDAQTVVEELLVRYVEALVYQAVAENMASEQSARMVAMKAASDNAKNVIGELQLVYNKTRQAAITKELSEIVSGA 288
>gi|146322408|ref|XP_750101.2| ATP synthase gamma chain, mitochondrial precursor [Aspergillus fumigatus Af293] >gi|129557002|gb|EAL88063.2| ATP synthase gamma chain, mitochondrial precursor, putative [Aspergillus fumigatus Af293] >gi|159130582|gb|EDP55695.1| ATP synthase gamma chain, mitochondrial precursor, putative [Aspergillus fumigatus A1163] (297 aa)
Score = 296, Expect = 4.2e-25, Identities = 89/282 (31%), Positives = 156/282 (55%)
  Q:     2 ASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSND--EIWLIGKKGKNLIKSKGIEAEISLDLELDDKDI-NFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           A+L EI+ R+K I++  KITN MK+V+S +L + ++   +  +Y +          SN   E    K  E+ KT+ +   S  GLCG  +  + K  ++ ++ N   ++ ++G+K K  +     +A I +      KDI  F    +IA+ + A+   DY   S+K+IY+KF+N+ S+ PS        +A  +  + K  N A F ++   + V  ++    LA  ++ A+ E   CE ++RRNAM++A+KNA E+I  +++ +NR+RQ+ IT E+ EI++GA
  S:    29 ATLREIEGRLKSIKNIEKITNTMKIVASTRLTRAQKAMDDSRVYGQT---------SNKVFENAETKPLEDKKTLLVVASSDKGLCGGIHSGLSKATRRILQENPNADVVILGEKAKAQLSRSNADA-IVMSFANVCKDIPTFADAQVIADQI-AQLPTDY--ASVKIIYNKFINAQSYEPSTV------EAYSEEAITKSANLATFEVE---DSVLANLREYALANSLYWAMAEGHACEISARRNAMENASKNAGEMINKFQILYNRQRQAAITGELVEIITGA 291
>gi|152972642|ref|YP_001337788.1| F0F1 ATP synthase subunit gamma [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] >gi|166215101|sp|A6TG37|ATPG_KLEP7 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|150957491|gb|ABR79521.1| ATP synthase subunit C [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] (287 aa)
Score = 296, Expect = 4.4e-25, Identities = 82/283 (28%), Positives = 158/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKS-NSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKG--IEAEISLDLELDDKDINFDLFHIIAE-NLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  +++T KIT AM++V+++K++K +E       Y      +  ++ + N + +   L++ +  +  +L   +  GLCG  N+N+ K+L   +K+        ++ +IG KG +   S G  + A+++    + D   N  L  +I    ++ +  ++  +  + V+ +KF+N++S  P++  LLPL  + +    D      D+  +P+   + +++L  Y+ + ++  +VE+   E A+R  AM +AT N   LIK  +L +N+ RQ+ ITQE+TEIVSGA
  S:     1 MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQERMAASRPYADTMRKVIGHLANGNLEYKHPYLEERDVKRVGYLVVSTDRGLCGGLNINLFKKLLAEMKAWSDKGVQCDLAMIGSKGVSFFNSVGGNVVAQVT---GMGD---NPSLSELIGPVKVMLQAYDEGRLDKLYVVSNKFINTMSQVPTITQLLPLPASEDA---DLKRKSWDYLYEPDPKALLDTLLRRYVESQVYQGVVENLASEQAARMVAMKAATDNGGSLIKELQLVYNKARQASITQELTEIVSGA 284
>gi|68536421|ref|YP_251126.1| F0F1 ATP synthase subunit gamma [Corynebacterium jeikeium K411] >gi|82592643|sp|Q4JUJ9|ATPG_CORJK ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|68264020|emb|CAI37508.1| ATP synthase gamma chain [Corynebacterium jeikeium K411] (326 aa)
Score = 296, Expect = 4.6e-25, Identities = 88/283 (31%), Positives = 166/283 (58%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNS--DSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVK---ELQKHIKSNDE---IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLL----------AKYKNDYNIKS---------IKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRL--------DKPNN-GADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MASL E++ RIK + ST KIT A +L++++++ K +    +   Y  +   +   + + S  D +IL  + ++  +   L   S  G+CG +N N+ K   EL+K +++  +   +++ G KG +    +G   +I+       +D ++   H +  +L+          AK++     +          + ++Y++F + LS  P    LLP++  +E+ +         DK ++  AD+  +P+ + + +++L  Y++  I  A++ES   E+A+RR AM +AT NA +L+K      N+ RQ++ITQEITEIV GA
  S:     1 MASLRELRTRIKSVNSTKKITKAQELIATSRITKAQARVDDAEPYADEITRVVQRLAAASTLDHKILQ-EPTDASRAAILVVSSDRGMCGGYNNNVFKKTAELRKRLENEGKDVVLYVSGNKGISYYNFRG--EDIAGAWSGYSQDPDYAATHDVRRHLIDGFVAGSEGTAKWREGLKAEEGQAVQGFDEVHIVYTRFESMLSQKPEAHRLLPIETVVEEEKFELGEDLVSDKVDHIAADYDFEPDPDTLLKALLPQYVSRGIFAAMLESAASESAARRTAMSAATDNATDLVKQLSRVANQARQAQITQEITEIVGGA 316
>gi|32034347|ref|ZP_00134547.1| COG0224: F0F1-type ATP synthase, gamma subunit [Actinobacillus pleuropneumoniae serovar 1 str. 4074] >gi|126209111|ref|YP_001054336.1| F0F1 ATP synthase subunit gamma [Actinobacillus pleuropneumoniae L20] >gi|190150978|ref|YP_001969503.1| ATP synthase gamma chain [Actinobacillus pleuropneumoniae serovar 7 str. AP76] >gi|166222514|sp|A3N2U5|ATPG_ACTP2 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|126097903|gb|ABN74731.1| ATP synthase gamma chain [Actinobacillus pleuropneumoniae L20] >gi|189916109|gb|ACE62361.1| ATP synthase gamma chain [Actinobacillus pleuropneumoniae serovar 7 str. AP76] (288 aa)
Score = 296, Expect = 4.8e-25, Identities = 83/283 (29%), Positives = 155/283 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNS-DSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  +++T KIT AM++V+++K++K +E       Y +    + ++I   S   +   L + +  K  +L   +  GLCG  N+N+ K      K+      + E+ L+G KG +  ++ G+     +    D+ ++   +  +    ++  ++N   + ++ V Y++F N++S  P +  LLPL K ++   LD   +  D+  +PN   + +S+L+ YL T ++ A+V++   E A+R  AM +AT NA  LI   +L +N+ RQ+ IT E+ EIV+GA
  S:     1 MAGAKEIRTKIASVKNTQKITKAMEMVATSKMRKTQERMAASRPYSETIRKVISHIAKGSIGYKHPFLTERDIKKVGYLVVSTDRGLCGGLNINLFKATLNEFKTWKDKDVSVELGLVGSKGVSFYQNLGLNVRSQVTGLGDNPEMERIVGAV--NEMINAFRNG-EVDAVYVAYNRFENTMSQKPVIAQLLPLPK-LDDDELDTKGSW-DYIYEPNPQVLLDSLLVRYLETQVYQAVVDNLASEQAARMVAMKAATDNAGTLIDELQLVYNKARQASITNELNEIVAGA 285
>gi|70733500|ref|YP_263275.1| F0F1 ATP synthase subunit gamma [Pseudomonas fluorescens Pf-5] >gi|82592648|sp|Q4K3A8|ATPG_PSEF5 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|68347799|gb|AAY95405.1| ATP synthase F1, gamma subunit [Pseudomonas fluorescens Pf-5] (286 aa)
Score = 296, Expect = 4.9e-25, Identities = 82/283 (28%), Positives = 154/283 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDE------IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  I+ST KIT+AM+ V+ +K++K +        Y ++   +  ++  +N +     +      +  ++   S  GLCG  N N+ K L K +  N E      + ++G KG    ++ G     ++    ++  IN DL   +   L A  +    I  + V+ +KF+N+++  P+V  L+PL+   ++    +  +  D+  +P+A ++ + +++ Y+ + ++ A+VE+   E A+R  AM +AT NA +LI + +L +N+ RQ+ ITQEI+EIV GA
  S:     1 MAGAKEIRSKIASIKSTQKITSAMEKVAVSKMRKAQMRMAASRPYAERIRQVIGHLANANPEYRHPFMIDRAIKRVGYVVVSSDRGLCGGLNTNLFKALVKDMAVNREQGVEIDLCVVGSKGAAFFRNFGGNVVAAISHLGEEPSIN-DLIGSVKVMLDAYLEG--RIDRLSVVSNKFINTMTQQPTVEQLIPLEATPDQ----ELKHHWDYLYEPDAKELLDGLMVRYVESQVYQAVVENNAAEQAARMIAMKNATDNAGDLISDLQLIYNKARQAAITQEISEIVGGA 283
>gi|16767150|ref|NP_462765.1| F0F1 ATP synthase subunit gamma [Salmonella typhimurium LT2] >gi|62182348|ref|YP_218765.1| F0F1 ATP synthase subunit gamma [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|161616986|ref|YP_001590951.1| F0F1 ATP synthase subunit gamma [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|167554379|ref|ZP_02348120.1| hypothetical protein Sentente_28073 [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] >gi|167560496|ref|ZP_02353499.1| hypothetical protein Sententeri_27042 [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853] >gi|167994870|ref|ZP_02575960.1| hypothetical protein Sententer_01000051_0100025712 [Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701] >gi|168224039|ref|ZP_02649271.1| hypothetical protein Senterenterica_26880 [Salmonella enterica subsp. enterica serovar Agona str. SL483] >gi|168229021|ref|ZP_02654252.1| hypothetical protein Sententeric_24850 [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433] >gi|168234374|ref|ZP_02659432.1| hypothetical protein Sententerica_25567 [Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191] >gi|168239810|ref|ZP_02664868.1| hypothetical protein Senteenterica_26780 [Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480] >gi|168245315|ref|ZP_02670247.1| hypothetical protein Senterienterica_26971 [Salmonella enterica subsp. enterica serovar Heidelberg str. SL486] >gi|168263238|ref|ZP_02685211.1| hypothetical protein Salmentericaenterica_19298 [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] >gi|168464799|ref|ZP_02698691.1| ATP synthase F1, gamma subunit [Salmonella enterica subsp. enterica serovar Newport str. SL317] >gi|168478092|ref|ZP_02707115.1| hypothetical protein Salmoentericaenterica_25876 [Salmonella enterica subsp. enterica serovar Virchow str. SL491] >gi|168823197|ref|ZP_02835197.1| hypothetical protein Salentericaenterica_27692 [Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537] >gi|194446815|ref|YP_002043112.1| ATP synthase F1, gamma subunit [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194449883|ref|YP_002047895.1| ATP synthase F1, gamma subunit [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194469716|ref|ZP_03075700.1| ATP synthase F1, gamma subunit [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|194737461|ref|YP_002116807.1| ATP synthase F1, gamma subunit [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|189081473|sp|A9MXA7|ATPG_SALPB ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|75505462|sp|Q57HX8|ATPG_SALCH ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|81773996|sp|Q8ZKW8|ATPG_SALTY ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|16422440|gb|AAL22724.1| membrane-bound ATP synthase, F1 sector, gamma-subunit [Salmonella typhimurium LT2] >gi|62129981|gb|AAX67684.1| membrane-bound ATP synthase, F1 sector, gamma-subunit [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|161366350|gb|ABX70118.1| hypothetical protein SPAB_04807 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|194405478|gb|ACF65700.1| ATP synthase F1, gamma subunit [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194408187|gb|ACF68406.1| ATP synthase F1, gamma subunit [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194456080|gb|EDX44919.1| ATP synthase F1, gamma subunit [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|194712963|gb|ACF92184.1| ATP synthase F1, gamma subunit [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|195632150|gb|EDX50634.1| ATP synthase F1, gamma subunit [Salmonella enterica subsp. enterica serovar Newport str. SL317] (287 aa)
Score = 296, Expect = 5.0e-25, Identities = 81/283 (28%), Positives = 159/283 (56%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKS-NSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKG--IEAEISLDLELDDKDINFDLFHIIAE-NLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  +++T KIT AM++V+++K++K ++       Y +    +  ++ + N + +   L++ +  +  +L   +  GLCG  N+N+ K+L   +K+        E+ +IG KG +   S G  + A+++    + D   N  L  +I    ++ +  ++  +  + ++ +KF+N++S  P++  LLPL  + +    D      D+  +P+   + +++L  Y+ + ++  +VE+   E A+R  AM +AT N   LIK  +L +N+ RQ+ ITQE+TEIVSGA
  S:     1 MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQDRMAASRPYAETMRKVIGHLANGNLEYKHPYLEERDVKRVGYLVVSTDRGLCGGLNINLFKKLLADMKAWSDKGVQCELAMIGSKGVSFFNSVGGNVVAQVT---GMGD---NPSLSELIGPVKVMLQAYDEGRLDKLYIVSNKFINTMSQVPTITQLLPLPASEDD---DLKRKAWDYLYEPDPKALLDTLLRRYVESQVYQGVVENLASEQAARMVAMKAATDNGGSLIKELQLVYNKARQASITQELTEIVSGA 284
>gi|92115400|ref|YP_575328.1| ATP synthase F1, gamma subunit [Chromohalobacter salexigens DSM 3043] >gi|122419023|sp|Q1QSC9|ATPG_CHRSD ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|91798490|gb|ABE60629.1| ATP synthase F1, gamma subunit [Chromohalobacter salexigens DSM 3043] (292 aa)
Score = 295, Expect = 5.3e-25, Identities = 88/283 (31%), Positives = 161/283 (56%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDEIWL------IGKK--------GKNLIKSK-GIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRL--DKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA+  EI+ +I  I++T KIT+AM++V+++K++K +E       Y +    + ++I K+N +     + + E  +  ++   S  GL G  N+N+ K + +  K   E  +      IG K        G NL+  K G+    ++D          DL  I + +++ K  ++  +  + V++++FVN+++  P V  LLPL+   E       + +   D+  +P+A  + + +L+ Y+ + ++ A+VE+  CE A+R  AM +AT NA  LI + +L +N+ RQ+ ITQEI+EIV GA
  S:     1 MAAAKEIRTQIGSIKNTQKITSAMEMVAASKMRKAQERMTASQPYARLIRRVVSHIAKANPEYRHEYMIEREVKRVGYIVVSSDRGLAGGLNINVFKAVTREAKYWHEQGVEVDYAAIGSKANVFFRNHGGNLVAGKSGLGEAPAVD----------DL--IGSVSVMLKAFDEGQLDRLYVVHNEFVNTMTQKPIVRQLLPLEAEAEADDEEETRASGSWDYLYEPDAKTLLDHLLVRYVESQVYQAVVENAACEQAARMIAMKNATDNAGNLIDDLELVYNKARQAAITQEISEIVGGA 289
>gi|99081927|ref|YP_614081.1| F0F1 ATP synthase subunit gamma [Silicibacter sp. TM1040] >gi|123252234|sp|Q1GEU7|ATPG_SILST ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|99038207|gb|ABF64819.1| ATP synthase F1 gamma subunit [Silicibacter sp. TM1040] (291 aa)
Score = 295, Expect = 5.3e-25, Identities = 87/285 (30%), Positives = 169/285 (59%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-----KSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVK-------ELQKHIKSNDEIWLIGKKGKNLIKSKGIEAEIS-LDLELDDKDINFDLFHIIAENLLAKYK-NDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           M SL ++K RI  +++T KIT AM++V++AKL++ +E   +   Y ++F  +   +     +S++  ++L+   S++ + + +   +  GLCG FN NI K       +LQ   K+  +I  +GKKG++++K +  +  +  +DL  + K + +     IA+++LA++   ++++ +I   YSKF N ++  P+   ++P +   E    +  +   D+  +P+   +   +L   +AT I   ++E+   E  +R +AMD+AT+NA E+I    +E+NR RQ+ IT E+ EI+SGA+ 
  S:     1 MPSLKDLKNRISSVKNTRKITKAMQMVAAAKLRRAQEAAEDARPYAERFNAVMAGLAASVGQSDTAPKLLAGTGSDQVQLL-VVMTAERGLCGGFNANIAKLARQKVLDLQAAGKTV-KILTVGKKGRDVLKREFGDLFVGHVDLT-EVKRVGYVDAQGIAKDILARFDAGEFDVATI--FYSKFQNVVTQIPTAQQIIPAEFDAEGA--EATSGVVDY--EPSEEAILADLLPRGVATQIFAGLLENGASEQGARMSAMDNATRNAGEMIDKLTIEYNRSRQAVITNELIEIISGAEA 290
>gi|186477774|ref|YP_001859244.1| ATP synthase F1, gamma subunit [Burkholderia phymatum STM815] >gi|184194233|gb|ACC72198.1| ATP synthase F1, gamma subunit [Burkholderia phymatum STM815] (295 aa)
Score = 295, Expect = 5.5e-25, Identities = 87/283 (30%), Positives = 156/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEG--KTIWLAFFSSMGLCGSFNLNIV-------KELQKHIKSNDEIWLIGKKGK---NLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYK------NDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDK----PNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA + EI+ +IK +++T KIT AM++V+++K+++ +E       Y  K  D+  ++ S +         S EG   T ++   +  GLCG  N N++       KEL+   K+  E   IG KG    N +++K +   + L           D  H+  E L+   K      ++  + ++ + Y++FVN++   P +  LLPL     + + DK    PN   D+  +P+A  V + +L+ Y+   ++ A+ E+   E ++R  AM +A+ NA  +I   +L +N+ RQ+ IT+E++EIV GA
  S:     1 MAGMKEIRGKIKSVQNTRKITKAMEMVAASKMRRAQERMRAARPYADKVRDIAAHMSSATPEYRHPFMVSNEGAKSTGFILVTTDKGLCGGMNTNVLRATLQKFKELEGQGKTV-EATAIGGKGLGFLNRLRAKVVSNVVQLG----------DTPHL--EKLIGAVKVQLDMYSEGKVSAVYLAYTRFVNTMKQEPVIEQLLPLSTEQFEAKDDKDSPTPNTSWDYIYEPDAQTVVDELLVRYVEALVYQAVAENMASEQSARMVAMKAASDNAKTVINELQLSYNKSRQAAITKELSEIVGGA 292
>gi|86131157|ref|ZP_01049756.1| ATP synthase F1, gamma subunit [Cellulophaga sp. MED134] >gi|85818568|gb|EAQ39728.1| ATP synthase F1, gamma subunit [Dokdonia donghaensis MED134] (287 aa)
Score = 295, Expect = 5.5e-25, Identities = 94/285 (32%), Positives = 155/285 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSN--SDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSN---DEIWLI--GKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYK-NDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           MA+L EI+ RI  + ST +IT+AMK+VS+AKLKK ++       Y  K  +L   + +    DS     +  E  K + +A  S+ GL G+FN NI+K +   + +     E+ L+  GKK   ++       E + D+     D+ FD    IAE+L+A+++  +Y+   I +IY+KF N+ +   +    LP+   ++    ++    AD+  +P+  ++ E ++   L T +   I +S   E+ +R  AM  AT NA EL    KL++N+ RQ+ IT EI EIV GA+ 
  S:     1 MANLKEIRNRISSVSSTMQITSAMKMVSAAKLKKAQDAITAMRPYSDKLTELLQNLSATLEGDSGSKLAEDREINKVLIVAISSNRGLAGAFNTNIIKGVNARVAAKYAGKEVHLVTLGKKADAILGKTFKVIENNNDIY---DDLTFDNVSAIAEDLMARFEAGEYD--RIDIIYNKFKNAATQIVTPEQFLPIVATVQ----EETTATADYIFEPSKEEIVEGLIPKALKTQLFKGIRDSVASEHGARMTAMHKATDNATELRDALKLQYNKARQAAITNEILEIVGGAEA 284
>gi|196186471|gb|EDX81447.1| ATP synthase F1, gamma subunit [Brevundimonas sp. BAL3] (292 aa)
Score = 295, Expect = 5.9e-25, Identities = 85/285 (29%), Positives = 158/285 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIK---SNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKN-LIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           MASL E++ RI  +++T KIT AM++V++AKLK+ ++   +   Y +K   +   +    S +D+  L     ++ + + +   +  GL G F+ N+++  ++ I S      + +I  +G+K ++ L +  G +   + +L    K I   L   +AE ++A    D     + + YS+F + +S  P+   L+P    +E        NGA +  +P+  ++ E++L   L T I  A+ E++     S+  AMD+AT+NA +LI    L++NRKRQ++IT E+ EI++GA+ 
  S:     1 MASLKEMRNRIGSVKATQKITKAMQMVAAAKLKRAQDQAESARPYARKMASVIANLAAGVSGADAPKLLAGTGQDQRHLIVVATADKGLAGGFSTNVIRAARERIGSLIANGKDVKIIAVGRKSRDQLTRLYGDKVVHTFELSAQ-KTIGLPLAQPVAE-MIATAFEDGQADVVTLFYSQFKSVISQVPTGKQLIP--AVVEGDAAPIDLNGAVYDYEPSEEEILETLLPRNLTTQILAALYENQAGFFGSQMAAMDNATRNAGDLINALTLQYNRKRQAQITTELIEIIAGAEA 291
>gi|126647159|ref|ZP_01719669.1| ATP synthase F1, gamma subunit [Algoriphagus sp. PR1] >gi|126577207|gb|EAZ81455.1| ATP synthase F1, gamma subunit [Algoriphagus sp. PR1] (289 aa)
Score = 295, Expect = 6.2e-25, Identities = 88/283 (31%), Positives = 155/283 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSD--SEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS-----NDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKY-KNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA+L E+K+RI  + ST +IT AMK+VS+AKL++ ++  +    Y +K  ++   + + S+  ++++  +K E  K + +   S  GLCG+FN NI+K     IK+     +  I  +GKK        G    +  D     +D+ F+     AE  +  + + +Y+   + V+Y++F N  +        LP+ K  E+   ++     D+ ++P+   + E ++   L   ++ A++ES   E+ +R  AMD AT NA +L+K  +L +NR RQ+ IT EI EIV+GA
  S:     1 MANLKEVKERINSVVSTQQITKAMKMVSAAKLRRAQDKIIQMRPYSQKLTNILNNVSAASEGSADVVYAQKREVKKVLIIPVTSDKGLCGAFNTNIIKATNAAIKNQFVGKDITILPLGKKSNEYFLKAG--HNVISDYFTIFQDLTFENVRKAAEFAMKSFVEGEYD--QVYVVYNEFKNVATQIVRTEQFLPMAK--EENTAEEKAADVDYILEPSRAYIIEELVPTSLKIQLYKAVLESNASEHGARMTAMDKATDNAGDLLKELRLMYNRSRQAAITNEILEIVAGA 285
>gi|77958187|ref|ZP_00822225.1| COG0224: F0F1-type ATP synthase, gamma subunit [Yersinia bercovieri ATCC 43970] (287 aa)
Score = 295, Expect = 6.5e-25, Identities = 85/283 (30%), Positives = 157/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIK-SNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDE------IWLIGKKGKNLIKSKG--IEAEISLDLELDDKDINFDLFHIIAE-NLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  +++T KIT AM++V+++K++K +E       Y +    +  ++   N + +   L++ +  +  +L   +  GLCG  N+N+ K+L   +K   E      + LIG K  +   S G  I A+++    + D   N  L  +I    ++ +  ++  +  + ++ +KF+N++S  P +  LLPL +A E   L K +   D+  +P+   + +++L  Y+ + ++  +VE+   E A+R  AM +AT N   LIK  +L +N+ RQ+ ITQE+TEIV GA
  S:     1 MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQERMAASRPYAETMRSVIGHLALGNLEYKHPYLEERDVKRVGYLVVSTDRGLCGGLNINLFKKLLSEMKGWSEKGVECDLALIGSKAASFFGSVGGKIVAQVT---GMGD---NPSLSELIGPVKVMLQAYDEGRLDKLYIVNNKFINTMSQEPRIMQLLPLPQA-EDGELKKKS--WDYLYEPDPKALLDTLLRRYVESQVYQGVVENLASEQAARMVAMKAATDNGGSLIKELQLVYNKARQASITQELTEIVGGA 284
>gi|188587435|ref|YP_001918980.1| ATP synthase F1, gamma subunit [Natranaerobius thermophilus JW/NM-WN-LF] >gi|179352122|gb|ACB86392.1| ATP synthase F1, gamma subunit [Natranaerobius thermophilus JW/NM-WN-LF] (308 aa)
Score = 294, Expect = 6.8e-25, Identities = 89/283 (31%), Positives = 154/283 (54%)
  Q:     3 SLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI--KSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDE---IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGAD------------------FSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           S  EIK+RI  + ST +IT AM++V++AKL++ ++   +   Y +K       I  ++ + S  L   K ++     +   +  GLCG +N+N+ K   +HI  N E   I  +GK  ++  K +     IS  L+++D   +FD   +IAE +   + +D  I  + + +++F N++   P    +LP+ K    P  ++  N  D                  +  +P+A  V   +L  Y+ + +  A++ESK  E  +R  AM +AT NA ++I+   L +N+ RQ  ITQEI E+VSGA+ 
  S:     4 STREIKRRISSVNSTKQITRAMEMVAAAKLRRAQQRVEDNRPYEEKMRQAIFRILNQAKTISHPLMESKGQDLPAGHIIMAADRGLCGGYNVNVAKAAAEHIGENKESTKIIAVGKYVRDYFKKRDYNV-ISEYLDIEDYP-SFDRPQMIAEAVEQMF-SDGVIGEVYLTFAEFQNAMIQRPVTRKILPMSKEAFLPPEEESENADDTEQNNQDPAETAGLEDQIYKFEPSAGAVLGGLLSSYMKSTLFRALLESKASEQGARMTAMKNATDNAEDMIEELTLSYNKARQGAITQEILEVVSGAEA 306
>gi|42525219|ref|NP_970599.1| ATP synthase gamma chain [Bdellovibrio bacteriovorus HD100] >gi|81697716|sp|Q6MGM6|ATPG_BDEBA ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|39577430|emb|CAE81253.1| ATP synthase gamma chain [Bdellovibrio bacteriovorus HD100] (295 aa)
Score = 294, Expect = 6.8e-25, Identities = 92/285 (32%), Positives = 161/285 (56%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIK-SNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSND------EIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDY---NIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIE--KPRLDKPNNGA-DFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           MASL +I+ +I+  ++T +IT AMKLVS+AKL+K +   +N   Y      +   I  +N  S  L  KK +    + +   S  GLCG+FN NI K  + +  SN       +   +G++G +    +GI+A +    +LD KDI+++L   +A  ++    NDY   +   +++++++F +++S   +  +LLP+D  +   K   D  +N A D   +P    + + +L  +    ++  + ES   E+ +R +AM++AT NA E+I    L +N+ RQ +IT E+ EIVSGA+ 
  S:     1 MASLKDIRAQIESTKNTQQITKAMKLVSAAKLRKAQNNIVNMRPYALALRQVIADIAVTNKVSHPLMEKKEQVKNVLLVVITSDRGLCGAFNSNINKFAEAYYNSNKASLEKIDFLFVGRRGHDYFARRGIKA-VDYITKLD-KDISYELASKVANRVM----NDYLEGSYDEVRIVHNEFKSAISQVVTAETLLPIDLGMTTFKKEADTASNFAVDMIFEPAPEQIIKELLEKHFELQVYRCMSESVAGEHGARMSAMENATNNAKEMINKLTLTYNKLRQEKITTELIEIVSGAEA 292
>gi|162457646|ref|YP_001620013.1| H(+)-transporting two-sector ATPase [Sorangium cellulosum 'So ce 56'] >gi|189081479|sp|A9GHR3|ATPG_SORC5 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|161168228|emb|CAN99533.1| H(+)-transporting two-sector ATPase [Sorangium cellulosum 'So ce 56'] (323 aa)
Score = 294, Expect = 7.4e-25, Identities = 94/285 (32%), Positives = 156/285 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILS-------------------------LKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDE------IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPL--DKAIEKPRLDK-----PNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           M SL  I+KRI  ++ST KIT AMK+V+ AKL K +        Y  K  ++ + I  ++     +                         L    E + + +   S  GLCG+FN NI K  ++  KS  E      + +IG+KG++    +G  A I   L      +N +    +   LLA + N   I +I ++Y++F ++++ T  V  LLP     A E+ + D+     P+  ++F  +P+   + E ++  Y+   I  A+ ES   E  ++  AMD+A KNA E+I N  LE+N+ RQ+ IT+E+ EI+ G++ 
  S:     1 MPSLKSIRKRISSVKSTQKITRAMKMVAGAKLNKAQLRITELRPYAVKVQEVLSAITRDAAPAAEALAAEGIGAEGEAGAPAGGEKALHPLLVTRPERRVLLVVLTSDRGLCGAFNTNINKRAEREWKSRTEAGQEVQLAIIGRKGRDYFNRRG--APILEYLAGVWDKLNLETAQAVGAKLLAPF-NKGEIDAIYLVYNEFKSAITQTVVVERLLPPAGGPAKEQEQGDEGGHGAPSAASEFLYEPDKGALLERLVPMYVDISILRALYESMASELGAKLTAMDAANKNAKEVIDNLTLEYNKARQAAITKELMEIIGGSEA 320
>gi|56421894|ref|YP_149212.1| F0F1 ATP synthase subunit gamma [Geobacillus kaustophilus HTA426] >gi|81675683|sp|Q5KUJ2|ATPG_GEOKA ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|56381736|dbj|BAD77644.1| F0F1-type ATP synthasegamma chain [Geobacillus kaustophilus HTA426] (285 aa)
Score = 294, Expect = 7.5e-25, Identities = 91/283 (32%), Positives = 154/283 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEE-GKTIWLAFFSSMGLCGSFNLNIVK----ELQKHIKSNDE--IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPL-DKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MASL +IK RI   + TS+IT AM++VS++KL + ++   +   Y +K  ++   +   +      +  S    KT +L   S  GL G++N N+++     +QK   S DE  I +IG+ G +  + + +   + LD+       +F     IA   +  +  D     + + Y+ +V+++    +   LLPL D A  K R         +  +P+  ++ + +L  Y  + I+GA++++K  E+A+R  AM +AT NANELI+   L +NR RQ+ ITQEITEIV+GA
  S:     1 MASLRDIKTRINATKKTSQITKAMEMVSTSKLNRAEQNAKSFVPYMEKIQEVVANVALGAGGASHPMLVSRPVKKTGYLVITSDRGLAGAYNSNVLRLVYQTIQKRHASPDEYAIIVIGRVGLSFFRKRNMP--VILDITRLPDQPSFADIKEIARKTVGLFA-DGTFDELYMYYNHYVSAIQQEVTERKLLPLTDLAENKQR-------TVYEFEPSQEEILDVLLPQYAESLIYGALLDAKASEHAARMTAMKNATDNANELIRTLTLSYNRARQAAITQEITEIVAGA 281
>gi|77961817|ref|ZP_00825647.1| COG0224: F0F1-type ATP synthase, gamma subunit [Yersinia mollaretii ATCC 43969] (287 aa)
Score = 294, Expect = 7.5e-25, Identities = 84/283 (29%), Positives = 156/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIK-SNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDE------IWLIGKKGKNLIKSKG--IEAEISLDLELDDKDINFDLFHIIAE-NLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  +++T KIT AM++V+++K++K +E       Y +    +  ++   N + +   L++ +  +  +L   +  GLCG  N+N+ K L   ++   E      + LIG K  +   S G  I A+++    + D   N  L  +I    ++ +  ++  +  + ++ +KF+N++S  P +  LLPL  A E   L K +   D+  +P+   + +++L  Y+ + ++  +VE+   E A+R  AM +AT N  +LIK  +L +N+ RQ+ ITQE+TEIV GA
  S:     1 MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQERMAASRPYAETMRSVIGHLALGNLEYKHPYLEERDVKRVGYLVVSTDRGLCGGLNINLFKRLLSEMRGWSEKGVECDLALIGSKAASFFGSVGGKIVAQVT---GMGD---NPSLSELIGPVKVMLQAYDEGRLDKLYIVNNKFINTMSQEPRIMQLLPLPPA-EDGELKKKS--WDYLYEPDPKALLDTLLRRYVESQVYQGVVENLASEQAARMVAMKAATDNGGDLIKELQLVYNKARQASITQELTEIVGGA 284
>gi|157155717|ref|YP_001465224.1| F0F1 ATP synthase subunit gamma [Escherichia coli E24377A] >gi|170766612|ref|ZP_02901065.1| ATP synthase F1, gamma subunit [Escherichia albertii TW07627] >gi|166990392|sp|A7ZTU5|ATPG_ECO24 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|157077747|gb|ABV17455.1| ATP synthase F1, gamma subunit [Escherichia coli E24377A] >gi|170124050|gb|EDS92981.1| ATP synthase F1, gamma subunit [Escherichia albertii TW07627] (287 aa)
Score = 294, Expect = 7.6e-25, Identities = 80/283 (28%), Positives = 159/283 (56%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKG--IEAEISLDLELDDKDINFDLFHIIAE-NLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  +++T KIT AM++V+++K++K ++       Y +    +  ++   N + +   L++ +  +  +L   +  GLCG  N+N+ K+L   +K+        ++ +IG KG +   S G  + A+++    + D   N  L  +I    ++ +  ++  +  + ++ +KF+N++S  P++  LLPL  + +    D  +   D+  +P+   + +++L  Y+ + ++  +VE+   E A+R  AM +AT N   LIK  +L +N+ RQ+ ITQE+TEIVSGA
  S:     1 MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQDRMAASRPYAETMRKVIGHLAHGNLEYKHPYLEERDVKRVGYLVVSTDRGLCGGLNINLFKKLLAEMKTWTDKGVQCDLAMIGSKGVSFFNSVGGNVVAQVT---GMGD---NPSLSELIGPVKVMLQAYDEGRLDKLYIVSNKFINTMSQVPTISQLLPLPASDDD---DLKHKSWDYLYEPDPKALLDTLLRRYVESQVYQGVVENLASEQAARMVAMKAATDNGGSLIKELQLVYNKARQASITQELTEIVSGA 284
>gi|166033115|ref|ZP_02235944.1| hypothetical protein DORFOR_02837 [Dorea formicigenerans ATCC 27755] >gi|166027472|gb|EDR46229.1| hypothetical protein DORFOR_02837 [Dorea formicigenerans ATCC 27755] (297 aa)
Score = 294, Expect = 7.7e-25, Identities = 89/286 (31%), Positives = 160/286 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKK-QKELFLNESIYYKKFYDLFTYIK-----SNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIK--SNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQ--PNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKGE 286
           MA++ EI+ RI  ++ T KITNAM L+SS K+++ +K+L   E  +YK   ++   ++     SN   +       EE K   +      GL G++N N+ K  ++ +K   + +++++G+ G++   S+G   EI  + +   +  N     II+E L+ ++ N   +  +  +Y++  NS+        LLPL+++        P N    +IQ  P+   V ++I+ +Y+   I+G +VE+   E+ +R  AM SAT +A  +IK+  + +NR RQ+ ITQEITE+ +GAK +
  S:     1 MANIREIQTRINSVKDTMKITNAMYLISSTKMRQARKKLADAEPYFYKLQAEIARILRHMPEVSNQYFDSREEIPKEERKIGSVVITGDKGLAGAYNHNVEKAEEEIMKMPGHHKLFVVGELGRHYFVSQG--HEIEQNFQYTVQKPNLSRARIISETLMEQFNNG-ELDEVYAVYTRMENSMVSEVETVKLLPLERSAFGED-SIPANLRREAIQLYPSVESVMDNIVPNYVTGMIYGCLVEAYASEHNARMTAMKSATDSAEAIIKDLSIAYNRARQAAITQEITEVCAGAKAQ 292
>gi|165977083|ref|YP_001652676.1| F0F1 ATP synthase subunit gamma [Actinobacillus pleuropneumoniae serovar 3 str. JL03] >gi|165877184|gb|ABY70232.1| ATP synthase gamma chain [Actinobacillus pleuropneumoniae serovar 3 str. JL03] (288 aa)
Score = 294, Expect = 7.9e-25, Identities = 82/283 (28%), Positives = 155/283 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNS-DSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  +++T KIT AM++V+++K++K +E       Y +    + ++I   S   +   L + +  K  +L   +  GLCG  N+N+ K      K+      + E+ L+G KG +  ++ G+     +    D+ ++   +  +    ++  ++N   + ++ V Y++F N+++  P +  LLPL K ++   LD   +  D+  +PN   + +S+L+ YL T ++ A+V++   E A+R  AM +AT NA  LI   +L +N+ RQ+ IT E+ EIV+GA
  S:     1 MAGAKEIRTKIASVKNTQKITKAMEMVATSKMRKTQERMAASRPYSETIRKVISHIAKGSIGYKHPFLTERDIKKVGYLVVSTDRGLCGGLNINLFKATLNEFKTWKDKDVSVELGLVGSKGVSFYQNLGLNVRSQVTGLGDNPEMERIVGAV--NEMINAFRNG-EVDAVYVAYNRFENTMTQKPVIAQLLPLPK-LDDDELDTKGSW-DYIYEPNPQVLLDSLLVRYLETQVYQAVVDNLASEQAARMVAMKAATDNAGTLIDELQLVYNKARQASITNELNEIVAGA 285
>gi|584816|sp|P37810|ATPG_BACSU ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|580832|emb|CAA82259.1| ATP synthase subunit gamma [Bacillus subtilis] (290 aa)
Score = 294, Expect = 8.1e-25, Identities = 93/283 (32%), Positives = 156/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKE----LQKHIKSNDE--IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNG----ADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           +ASL +IK RI   + TS+IT AM++VS+AKL + +    +   Y  K  ++ + + + + + +   L   E  KT +L   S  GL G+FN ++++     +Q+  +S DE  +  IG+ G++  K +  E  I  +L     ++ F     +A   +  +  D     + ++Y+ FV++++   +   LLPL         D  + G    A +  +P+  +V E +L  Y  + I GA+++SK  E+A+R  AM +AT NA ELI +  L +NR RQ+ ITQEITEIV GA
  S:     4 LASLRDIKSRITSTKKTSQITKAMQMVSAAKLNRAENNAKSFVPYMDKIQEVVSNVGRVSGNVKHPMLLSREVKKTAYLVITSDRGLAGAFNSSVLRSAYQAMQERHQSKDEYAVIAIGRVGRDFFKKR--EIPIISELTGLGDEVTFTEIKDLARQTIQMFI-DGAFDELHLVYNHFVSAITQEVTEKKLLPLS--------DLGSGGGKRTASYEFEPSEEEVLEVLLPQYAESLIFGALLDSKASEHAARMTAMKNATDNAKELIDSLSLSYNRARQAAITQEITEIVGGA 286
>gi|163762348|ref|ZP_02169413.1| Protein-tyrosine-phosphatase [Bacillus selenitireducens MLS10] >gi|160357087|gb|EDP83735.1| Protein-tyrosine-phosphatase [Bacillus selenitireducens MLS10] (294 aa)
Score = 294, Expect = 8.5e-25, Identities = 92/283 (32%), Positives = 155/283 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSD--SEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIK----SNDEIWLI--GKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNG--ADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MASL +IK RI   + T +IT AM++VS+AKL + ++   +   Y +K  ++   I + S+  S  +   + E  KT ++   S  GLCG++N  ++++ Q+ I+    S DE  LI  G+ G      + +     L    D  + N D+ ++ +  +  +   D     I V Y+ FV+++S   +   LLPL    E+   ++       ++  +P+A+++ E +L  Y  + I GA+++ K  E  +R +AM SAT NA+ LI +  L +NR RQ+ ITQEI EIV GA
  S:     1 MASLKDIKTRIGSTKKTKQITKAMEMVSAAKLNRAQQKATSFVPYTEKIREVVESIAAGSEGVSHPMLEDREEVKKTGYIVITSDRGLCGAYNSGLLRQTQRLIQERHSSPDEYGLIVLGRVGLEFFNKRNMPVYQELTGVPDQPEYN-DVKNLASTTV--QMFTDGIFDEIYVHYNHFVSAISQKVTEQKLLPLTGMSEETGSEEEQATLVQEYIYEPSADEILEHLLPHYAESLIFGALLDGKASEFGARMSAMRSATDNADGLIGDLTLSYNRARQAAITQEINEIVGGA 290
>gi|16124230|ref|NP_407543.1| F0F1 ATP synthase subunit gamma [Yersinia pestis CO92] >gi|22128004|ref|NP_671427.1| F0F1 ATP synthase subunit gamma [Yersinia pestis KIM] >gi|45443752|ref|NP_995291.1| F0F1 ATP synthase subunit gamma [Yersinia pestis biovar Microtus str. 91001] >gi|51598252|ref|YP_072443.1| F0F1 ATP synthase subunit gamma [Yersinia pseudotuberculosis IP 32953] >gi|77977935|ref|ZP_00833372.1| COG0224: F0F1-type ATP synthase, gamma subunit [Yersinia intermedia ATCC 29909] >gi|108810157|ref|YP_654073.1| F0F1 ATP synthase subunit gamma [Yersinia pestis Antiqua] >gi|108814139|ref|YP_649906.1| F0F1 ATP synthase subunit gamma [Yersinia pestis Nepal516] >gi|145601151|ref|YP_001165227.1| F0F1 ATP synthase subunit gamma [Yersinia pestis Pestoides F] >gi|150260944|ref|ZP_01917672.1| ATP synthase gamma subunit protein [Yersinia pestis CA88-4125] >gi|153948374|ref|YP_001403119.1| F0F1 ATP synthase subunit gamma [Yersinia pseudotuberculosis IP 31758] >gi|162421634|ref|YP_001608473.1| F0F1 ATP synthase subunit gamma [Yersinia pestis Angola] >gi|165926097|ref|ZP_02221929.1| ATP synthase F1, gamma subunit [Yersinia pestis biovar Orientalis str. F1991016] >gi|165939971|ref|ZP_02228508.1| ATP synthase F1, gamma subunit [Yersinia pestis biovar Orientalis str. IP275] >gi|166009643|ref|ZP_02230541.1| ATP synthase F1, gamma subunit [Yersinia pestis biovar Antiqua str. E1979001] >gi|166213251|ref|ZP_02239286.1| ATP synthase F1, gamma subunit [Yersinia pestis biovar Antiqua str. B42003004] >gi|167401656|ref|ZP_02307150.1| ATP synthase F1, gamma subunit [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167422827|ref|ZP_02314580.1| ATP synthase F1, gamma subunit [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167425510|ref|ZP_02317263.1| ATP synthase F1, gamma subunit [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|170026429|ref|YP_001722934.1| ATP synthase F1, gamma subunit [Yersinia pseudotuberculosis YPIII] >gi|186897467|ref|YP_001874579.1| ATP synthase F1, gamma subunit [Yersinia pseudotuberculosis PB1/+] >gi|123072472|sp|Q1C094|ATPG_YERPA ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|123073042|sp|Q1CCH4|ATPG_YERPN ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|166224126|sp|A4TSJ2|ATPG_YERPP ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|166990397|sp|A7FPE1|ATPG_YERP3 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|81691600|sp|Q663Q7|ATPG_YERPS ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|81773698|sp|Q8Z9S5|ATPG_YERPE ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|21961152|gb|AAM87678.1|AE014015_3 membrane-bound ATP synthase, F1 sector, gamma-subunit [Yersinia pestis KIM] >gi|45438622|gb|AAS64168.1| ATP synthase gamma subunit protein [Yersinia pestis biovar Microtus str. 91001] >gi|51591534|emb|CAH23206.1| ATP synthase gamma subunit protein [Yersinia pseudotuberculosis IP 32953] >gi|108777787|gb|ABG20306.1| ATP synthase gamma subunit protein [Yersinia pestis Nepal516] >gi|108782070|gb|ABG16128.1| ATP synthase gamma subunit protein [Yersinia pestis Antiqua] >gi|115349709|emb|CAL22690.1| ATP synthase gamma subunit protein [Yersinia pestis CO92] >gi|145212847|gb|ABP42254.1| ATP synthase gamma subunit protein [Yersinia pestis Pestoides F] >gi|149290352|gb|EDM40429.1| ATP synthase gamma subunit protein [Yersinia pestis CA88-4125] >gi|152959869|gb|ABS47330.1| ATP synthase F1, gamma subunit [Yersinia pseudotuberculosis IP 31758] >gi|162354449|gb|ABX88397.1| ATP synthase F1, gamma subunit [Yersinia pestis Angola] >gi|165912097|gb|EDR30737.1| ATP synthase F1, gamma subunit [Yersinia pestis biovar Orientalis str. IP275] >gi|165921957|gb|EDR39134.1| ATP synthase F1, gamma subunit [Yersinia pestis biovar Orientalis str. F1991016] >gi|165991565|gb|EDR43866.1| ATP synthase F1, gamma subunit [Yersinia pestis biovar Antiqua str. E1979001] >gi|166205549|gb|EDR50029.1| ATP synthase F1, gamma subunit [Yersinia pestis biovar Antiqua str. B42003004] >gi|166958219|gb|EDR55240.1| ATP synthase F1, gamma subunit [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167049038|gb|EDR60446.1| ATP synthase F1, gamma subunit [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167055524|gb|EDR65317.1| ATP synthase F1, gamma subunit [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|169752963|gb|ACA70481.1| ATP synthase F1, gamma subunit [Yersinia pseudotuberculosis YPIII] >gi|186700493|gb|ACC91122.1| ATP synthase F1, gamma subunit [Yersinia pseudotuberculosis PB1/+] (287 aa)
Score = 293, Expect = 8.7e-25, Identities = 85/283 (30%), Positives = 155/283 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIK-SNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDE------IWLIGKKGKNLIKSKG--IEAEISLDLELDDKDINFDLFHIIAE-NLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  +++T KIT AM++V+++K++K +E       Y +    +  ++   N + +   L++ +  +  +L   +  GLCG  N+N+ K L   +K   E      + LIG K  +   S G  I A+++    + D   N  L  +I    ++ +  ++  +  + ++ +KF+N++S  P +  LLPL  A E   L K +   D+  +P+   + +++L  Y+ + ++  +VE+   E A+R  AM +AT N   LIK  +L +N+ RQ+ ITQE+TEIV GA
  S:     1 MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQERMAASRPYAETMRSVIGHLALGNLEYKHPYLEERDVKRVGYLVVSTDRGLCGGLNINLFKRLLAEMKGWSEKGVECDLALIGSKAASFFGSVGGKIVAQVT---GMGD---NPSLSELIGPVKVMLQAYDEGRLDKLYIVNNKFINTMSQEPRIMQLLPLPPA-EDGELKKKS--WDYLYEPDPKALLDTLLRRYVESQVYQGVVENLASEQAARMVAMKAATDNGGSLIKELQLVYNKARQASITQELTEIVGGA 284
>gi|6625702|gb|AAF19361.1|AF188265_7 ATP synthase subunit gamma [Salmonella typhimurium] (287 aa)
Score = 293, Expect = 8.8e-25, Identities = 80/283 (28%), Positives = 158/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKG--IEAEISLDLELDDKDINFDLFHIIAE-NLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  +++T KIT AM++V+++K++K ++       Y +    +  ++   N + +   L+  +  +  +L   +  GLCG  N+N+ K+L   +K+        ++ +IG KG +   S G  + A+++    + D   N  L  +I    ++ +  ++  +  + ++ +KF+N++S  P++  LLPL  + +    D  +   D+  +P+   + +++L  Y+ + ++  +VE+   E A+R  AM +AT N   LIK  +L +N+ RQ+ ITQE+TEIVSGA
  S:     1 MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQDRMAASRPYAETMRKVIGHLAHGNLEYKHPYLEDRDVKRVGYLVVSTDRGLCGGLNINLFKKLLAEMKTWTDKGVQCDLAMIGSKGVSFFDSVGGNVVAQVT---GMGD---NPSLSELIGPVKVMLQAYDEGRLDKLYIVSNKFINTMSQVPTISQLLPLPASDDD---DLKHKSWDYLYEPDPKALLDTLLRRYVESQVYQGVVENLASEQAARMVAMKAATDNGGSLIKELQLVYNKARQASITQELTEIVSGA 284
>gi|149190475|ref|ZP_01868746.1| F0F1 ATP synthase subunit gamma [Vibrio shilonii AK1] >gi|148835729|gb|EDL52695.1| F0F1 ATP synthase subunit gamma [Vibrio shilonii AK1] (288 aa)
Score = 293, Expect = 9.1e-25, Identities = 84/283 (29%), Positives = 160/283 (56%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVK----ELQ--KHIKSNDEIWLIGKKGKNLIKSKG--IEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  ++ST KIT AM++V+++K+++ ++       Y +    +  ++  +N + +   L++ E  +  ++   +  GLCG  N+N+ K    E+Q  K   +  E+ +IG K      + G  + A++S    L D+    DL   +   +L KY ++  +  + V+Y+ FVN++   P++  LLPL K+  +    + + G  +  +P    + +++L+ Y+ + ++  +VE+  CE A+R  AM +AT NA  LI + +L +N+ RQ+ ITQE++EIV GA
  S:     1 MAGAKEIRNKIGSVKSTQKITKAMEMVAASKMRRSQDAREASRPYAETMRKVIGHLANANLEYQHPYLEEREAKRVGYVIISTDRGLCGGLNINLFKKAIVEMQGWKDKGAEIELAIIGSKATAFFNNSGAKVAAQVS---GLGDEPSLEDLIGTVGV-MLKKY-DEGELDRLYVVYNHFVNTMIQEPTIDQLLPLPKSDSEEMQREHSWG--YIYEPEPKPLLDALLLRYIESQVYQGVVENLACEQAARMIAMKAATDNATNLIDDLELVYNKARQAAITQELSEIVGGA 285
>gi|67906677|gb|AAY82765.1| predicted ATP synthase F1 gamma subunit [uncultured bacterium eBACred22E04] (287 aa)
Score = 293, Expect = 9.2e-25, Identities = 89/283 (31%), Positives = 158/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILS--LKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDE------IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           M+   EI+ +I  I++T KIT AM++V+++K+KK ++       Y  K  ++  ++ +++  E  S    +    K  ++   S  GLCG  N N+ K + ++I+ +          LIG K  +  +  G +  I+   +L DK    D+  +I +N +  + N  +I  + ++Y+KF+N++S  P V  +LP+    +    D      D+  +P+A  V ES+   Y+ + I+  +VE+  CE ASR  AM +A+ NA++LI   +L +N+ RQ+ ITQEI+EI+SGA
  S:     1 MSGSQEIRTQIASIQNTQKITKAMEMVAASKMKKAQDQMTKARPYADKILNVIKHL-AHAHPEYTSEFFAQRNVSKKGYIIISSDRGLCGGLNNNLFKLVVENIEKDSSSSIKPAFSLIGGKASSFFQRMGGDV-IAQTSQLGDKPKIEDVLGLI-KNTIDSFINK-DIDEVYIVYNKFINTVSQEPIVQKVLPIQTEDKNEEYDYY---WDYLYEPDAEVVLESLFTRYIESLIYRGLVENLACEQASRMVAMKAASDNASDLISELQLIYNKNRQAAITQEISEIISGA 284
>gi|193216471|ref|YP_001999713.1| ATP synthase gamma subunit [Mycoplasma arthritidis 158L3-1] >gi|193001794|gb|ACF07009.1| ATP synthase gamma subunit [Mycoplasma arthritidis 158L3-1] (291 aa)
Score = 293, Expect = 9.5e-25, Identities = 91/282 (32%), Positives = 154/282 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEE-----GKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLP-------LDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSG 282
           M SL +IK RI  + ST KIT AM+LV++AK  + K  F N   YYK    +F  +   +  +I +L           + +++ F S +GLCGS+N  + K++ + I  +D + +IG K   L+K       I    ++ D    +D+  +IA  L    +    + S+ +IY+ ++N + F   V  + P       L+    K R++   N    + +PN + + ++    +    I+ AI  SK+ E +SRR AM+ A+ NA ++I++  +++N  RQ++ITQEITEIVSG
  S:     1 MESLQKIKHRIYSVNSTKKITKAMQLVATAKFGRIKNNFENVKEYYKSVEQIFNDLMLQTTIDIDALLNVNAWTFTAKRKLYIVFGSDIGLCGSYNSEVTKKIYEVITPDDILIVIGSKLLTLLKKDKSLHIIQTITQIGDTP-TYDIARVIANKLYDVLQISL-LSSVNLIYTNYLNPIKFDVVVQEIFPITPKRDSLENKESKARIEVDKN----AFEPNPDVILKNSFPIFFEAAIYHAIFSSKLAETSSRRTAMEQASDNAQDIIEDLTIQYNSSRQAKITQEITEIVSG 288
>gi|49476188|ref|YP_034229.1| F0F1 ATP synthase subunit gamma [Bartonella henselae str. Houston-1] >gi|81827678|sp|Q6G1W8|ATPG_BARHE ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|49238996|emb|CAF28296.1| ATP synthase gamma chain [Bartonella henselae str. Houston-1] (303 aa)
Score = 293, Expect = 9.5e-25, Identities = 83/285 (29%), Positives = 168/285 (58%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDS-EILSLKKSEEGKTIWLAFF--SSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKGIEAEISLDLELDD-KDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPL---DKAIEKPRLD-KPNNGAD-----FSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           MASL +++ RI  +++T KIT AM++V++A+L + +E   +   Y K+   +   + ++ D  +  SL +      + L     +  GLCG+FN+ I +  ++HIK+        ++  +GKKG +++ S+  +A +   ++L   K + F    +I++ ++  + +D       + YS+FV+ ++  P  F L+P+     A+E   ++ K +N AD     +  +P+A  + + ++   L+  I  A++E+   E  ++  AMD+A++NA E+I    + +NR+RQ++IT E+ EI++GA+ 
  S:     1 MASLKDLRDRIASVKATQKITKAMQMVAAARLHRAQEAAHSARPYAKRMAAILANLANDVDPIDAPSLMRGTGRDDVHLLVVCTAERGLCGAFNVQIARRAREHIKTLLAAGKIVKVLTVGKKGADIL-SRDYKALMIDHIDLQSIKRVGFAEAAMISQKIVDLFDDD-AFDVCTLFYSEFVSVINQRPVAFGLVPMVSSGGAVETAEVEQKIDNSADLQSIVYDYEPDAASLLDVLVPRNLSVQIFRALLENVAGEMGAKMTAMDNASRNAGEMINKLTVAYNRQRQAQITTELIEIIAGAEA 302
>gi|77973801|ref|ZP_00829346.1| COG0224: F0F1-type ATP synthase, gamma subunit [Yersinia frederiksenii ATCC 33641] (287 aa)
Score = 293, Expect = 9.5e-25, Identities = 85/283 (30%), Positives = 156/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIK-SNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDE------IWLIGKKGKNLIKSKG--IEAEISLDLELDDKDINFDLFHIIAE-NLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  +++T KIT AM++V+++K++K +E       Y +    +  ++   N + +   L++ +  +  +L   +  GLCG  N+N+ K+L   +K   E      + LIG K  +   S G  I A+++    + D   N  L  +I    ++ +  ++  +  + ++ +KF+N++S  P +  LLPL  A E   L K +   D+  +P+   + +++L  Y+ + ++  +VE+   E A+R  AM +AT N   LIK  +L +N+ RQ+ ITQE+TEIV GA
  S:     1 MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQERMAASRPYAETMRSVIGHLALGNLEYKHPYLEERDVKRVGYLVVSTDRGLCGGLNINLFKKLLSEMKGWSEKGVECDLALIGSKAASFFSSVGGKIVAQVT---GMGD---NPSLSELIGPVKVMLQAYDEGRLDKLYIVNNKFINTMSQEPRIMQLLPLPPA-EDGELKKKS--WDYLYEPDPKALLDTLLRRYVESQVYQGVVENLASEQAARMVAMKAATDNGGSLIKELQLVYNKARQASITQELTEIVGGA 284
>gi|37524073|ref|NP_927417.1| F0F1 ATP synthase subunit gamma [Photorhabdus luminescens subsp. laumondii TTO1] >gi|81707842|sp|Q7NA93|ATPG_PHOLL ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|36783496|emb|CAE12336.1| ATP synthase gamma chain [Photorhabdus luminescens subsp. laumondii TTO1] (287 aa)
Score = 293, Expect = 9.6e-25, Identities = 84/283 (29%), Positives = 155/283 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIK-SNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKG--IEAEISLDLELDDKDINFDLFHIIAE-NLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  +++T KIT AM++V+++K++K ++       Y +    +  ++   N + +   L++ E  +  +L   +  GLCG  N N+ K+L   +K         E+ LIG K  +   S G  + A+++    + D   N  L  +I   N++ +  ++  +  + V+ +KF+N++S  P++  LLPL    ++    K     D+  +P+   + + +L  Y+ + ++  +VE+   E A+R  AM +AT N   LIK  +L +N+ RQ+ ITQE+TEIVSGA
  S:     1 MAGAKEIRTKIASVQNTQKITKAMEMVAASKMRKTQDRMAASRPYAETIRSVIGHLALGNLEYKHPYLEERETKRVGYLVVSTDRGLCGGLNTNLFKKLLSEMKDWSDKDVQCELALIGSKATSFFASVGGNVVAQVT---GMGD---NPSLSELIGPVNIMLRAYDEGRLDKLYVVTNKFINTMSQEPTITQLLPLPAGDDETLKKK---SWDYLYEPDPKALLDILLRRYVESQVYQGVVENLASEQAARMVAMKAATDNGGSLIKELQLVYNKARQASITQELTEIVSGA 284
>gi|24298789|dbj|BAC22104.1| F-ATPase gamma-subunit [Thermotoga neapolitana] (278 aa)
Score = 293, Expect = 9.9e-25, Identities = 91/280 (32%), Positives = 147/280 (52%)
  Q:     6 EIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEG-KTIWLAFFSSMGLCGSFNLNIVKELQKHIKS--NDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           +IK++I   +S  KIT AM++V+ AK +K +  +     +Y++   L++ I   S   +      EEG + + +   S MGLCGSFN  I++E +K I    N  + LIG K  N  ++  I        E+ D      +   I E +  +  N      +KV++S+F N L   P V+ L+PL +  EK R        DF  +P    +   +L  YL+T +   + ++K+ E  +R+NAM +AT NA E+I+   L +N+ RQ+ ITQE+ EIV+GA+ 
  S:     8 QIKRKINATQSLMKITRAMEMVARAKSRKMEAEYQKFKPFYEEVKRLWSLIPDESLDPVFF----EEGDRDLIVVITSDMGLCGSFNSEIIREAEKVISESKNPHLILIGLKAINHFRTGNILKMYDRFYEIPDFRNGSTIVEDIYEFMDGRPVN------VKVVFSRFKNILIQRPEVYDLIPLKRK-EKKR-------EDFEFEPLPEQLVPVVLHYYLSTTLMELMFQTKIGEFYARQNAMKNATDNAQEVIRELTLAYNKARQASITQELIEIVTGAEA 272
>gi|171909872|ref|ZP_02925342.1| ATP synthase F1, gamma subunit [Verrucomicrobium spinosum DSM 4136] (296 aa)
Score = 293, Expect = 9.9e-25, Identities = 85/285 (29%), Positives = 158/285 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEG-KTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDEIWL-IGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDK-AIEKPRLDKPNNGAD-----------FSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           M S  +I++RIK +++T++IT AM+LV+++K+K+ ++  L    Y +    +   +K  +   +  L +  EG + + L   +  GLCG  N N+++++ +  K  D  ++ +G K +N +    ++  +  D  + D  + F     ++  L+ ++  D     +KV ++ FVN L   P + ++LP+    I KP+ D    GAD           +  +PN   VF+ +L  Y+   ++  I+E++  E++SR  AM SAT NA  +IK+  LE+N+ RQ+ IT E+ EI +  K 
  S:     1 MPSTRDIRRRIKSVKNTAQITKAMQLVAASKMKRAQDQALAGRSYAELLNKVLVSLKDKTGDLVHPLLEEREGNRELILVVSTDKGLCGGLNTNLLRKVIEQTKGGDVAFITVGSKLRNSLGK--LKKNLVADFGVKDP-VKFAETRPVSRFLIQQFL-DGKYDRVKVAFTNFVNVLRQEPLIETVLPVSPVTIGKPK-DFEGMGADVPPAASAVGQEYLFEPNPIAVFDQVLPQYIDYMVYQMILEARASEHSSRMVAMKSATDNAKSMIKDLTLEYNKLRQAGITTELLEITTAMKA 294
>gi|14916965|sp|P22482|ATPG_BACPF ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|12061045|gb|AAG48362.1|AF330160_9 ATP synthase gamma subunit [Bacillus pseudofirmus] (289 aa)
Score = 293, Expect = 1.0e-24, Identities = 95/283 (33%), Positives = 155/283 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILS--LKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIK----SNDE--IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MASL +I+ RI   + T +IT AM++VS+AKL + +    + + Y  K  ++   I S S +EI    L++    KT ++   S  GL G +N ++++ L   IK    S DE  I ++G+ G++L K +G+   I   + L D+   F+    IA   +  +  D     + V Y+ FV+ ++   +   LLPL       +    +  A +  +PN   + E +L  Y  + I+G+++++K  E  +R  AM +AT NA+ LI+   L+FNR RQ+ ITQEITEIV GA
  S:     1 MASLRDIQGRITSTKKTKQITKAMQMVSAAKLNRAQHNAQSFTPYTDKIREVVAAIAS-SGTEISHPMLEERPVKKTGYIVVTSDKGLAGGYNSSLIRSLLNTIKERHNSPDEYGIIIMGRIGRDLFKKRGLPI-IQEVIGLPDQP-EFNDIKNIARTSVEMFA-DGIFDELYVWYNHFVSPITQDVTEMKLLPLTDIGSDEKATSAS--ASYEYEPNEQAILEKLLPQYAESLIYGSLLDAKASEFGARMTAMSAATDNASALIEELTLKFNRARQAAITQEITEIVGGA 285
>gi|15804333|ref|NP_290372.1| F0F1 ATP synthase subunit gamma [Escherichia coli O157:H7 EDL933] >gi|15833929|ref|NP_312702.1| F0F1 ATP synthase subunit gamma [Escherichia coli O157:H7 str. Sakai] >gi|16131601|ref|NP_418189.1| F1 sector of membrane-bound ATP synthase, gamma subunit [Escherichia coli str. K-12 substr. MG1655] >gi|24115036|ref|NP_709546.1| F0F1 ATP synthase subunit gamma [Shigella flexneri 2a str. 301] >gi|26250477|ref|NP_756517.1| F0F1 ATP synthase subunit gamma [Escherichia coli CFT073] >gi|30064962|ref|NP_839133.1| F0F1 ATP synthase subunit gamma [Shigella flexneri 2a str. 2457T] >gi|82779075|ref|YP_405424.1| F0F1 ATP synthase subunit gamma [Shigella dysenteriae Sd197] >gi|89110274|ref|AP_004054.1| F1 sector of membrane-bound ATP synthase, gamma subunit [Escherichia coli W3110] >gi|91213258|ref|YP_543244.1| F0F1 ATP synthase subunit gamma [Escherichia coli UTI89] >gi|110644074|ref|YP_671804.1| F0F1 ATP synthase subunit gamma [Escherichia coli 536] >gi|110807557|ref|YP_691077.1| F0F1 ATP synthase subunit gamma [Shigella flexneri 5 str. 8401] >gi|117626006|ref|YP_859329.1| F0F1 ATP synthase subunit gamma [Escherichia coli APEC O1] >gi|157163215|ref|YP_001460533.1| F0F1 ATP synthase subunit gamma [Escherichia coli HS] >gi|168709486|ref|ZP_02741763.1| ATP synthase F1, gamma subunit [Escherichia coli O157:H7 str. EC4045] >gi|168716590|ref|ZP_02748867.1| ATP synthase F1, gamma subunit [Escherichia coli O157:H7 str. EC4206] >gi|168735319|ref|ZP_02767596.1| ATP synthase F1, gamma subunit [Escherichia coli O157:H7 str. EC4115] >gi|168748537|ref|ZP_02773559.1| ATP synthase F1, gamma subunit [Escherichia coli O157:H7 str. EC4113] >gi|168753635|ref|ZP_02778642.1| ATP synthase F1, gamma subunit [Escherichia coli O157:H7 str. EC4401] >gi|168759933|ref|ZP_02784940.1| ATP synthase F1, gamma subunit [Escherichia coli O157:H7 str. EC4501] >gi|168766233|ref|ZP_02791240.1| ATP synthase F1, gamma subunit [Escherichia coli O157:H7 str. EC4486] >gi|168772218|ref|ZP_02797225.1| ATP synthase F1, gamma subunit [Escherichia coli O157:H7 str. EC4196] >gi|168779968|ref|ZP_02804975.1| ATP synthase F1, gamma subunit [Escherichia coli O157:H7 str. EC4076] >gi|168786576|ref|ZP_02811583.1| ATP synthase F1, gamma subunit [Escherichia coli O157:H7 str. EC869] >gi|168790964|ref|ZP_02815971.1| ATP synthase F1, gamma subunit [Escherichia coli O157:H7 str. EC4042] >gi|168798781|ref|ZP_02823788.1| ATP synthase F1, gamma subunit [Escherichia coli O157:H7 str. EC508] >gi|170022230|ref|YP_001727184.1| ATP synthase F1, gamma subunit [Escherichia coli ATCC 8739] >gi|170083234|ref|YP_001732554.1| F1 sector of membrane-bound ATP synthase, gamma subunit [Escherichia coli str. K12 substr. DH10B] >gi|170684229|ref|YP_001746063.1| ATP synthase F1, gamma subunit [Escherichia coli SMS-3-5] >gi|187731265|ref|YP_001882430.1| ATP synthase F1, gamma subunit [Shigella boydii CDC 3083-94] >gi|188493986|ref|ZP_03001256.1| ATP synthase F1, gamma subunit [Escherichia coli 53638] >gi|191165792|ref|ZP_03027630.1| ATP synthase F1, gamma subunit [Escherichia coli B7A] >gi|191170529|ref|ZP_03032082.1| ATP synthase F1, gamma subunit [Escherichia coli F11] >gi|193063817|ref|ZP_03044904.1| ATP synthase F1, gamma subunit [Escherichia coli E22] >gi|193069170|ref|ZP_03050127.1| ATP synthase F1, gamma subunit [Escherichia coli E110019] >gi|194428128|ref|ZP_03060672.1| ATP synthase F1, gamma subunit [Escherichia coli B171] >gi|194430973|ref|ZP_03063266.1| ATP synthase F1, gamma subunit [Shigella dysenteriae 1012] >gi|194435837|ref|ZP_03067940.1| ATP synthase F1, gamma subunit [Escherichia coli 101-1] >gi|195936360|ref|ZP_03081742.1| F0F1 ATP synthase subunit gamma [Escherichia coli O157:H7 str. EC4024] >gi|81175157|sp|P0ABA6|ATPG_ECOLI ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|122421814|sp|Q1R4K1|ATPG_ECOUT ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|123342308|sp|Q0SYU3|ATPG_SHIF8 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|123343412|sp|Q0TAX6|ATPG_ECOL5 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|123561163|sp|Q329S2|ATPG_SHIDS ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|166222552|sp|A1AHR5|ATPG_ECOK1 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|166990393|sp|A8A6J6|ATPG_ECOHS ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|189081401|sp|B1IX05|ATPG_ECOLC ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|81175155|sp|P0ABA8|ATPG_ECO57 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|81175156|sp|P0ABA7|ATPG_ECOL6 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|81175205|sp|P0ABA9|ATPG_SHIFL ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|12518590|gb|AAG58936.1|AE005605_4 membrane-bound ATP synthase, F1 sector, gamma-subunit [Escherichia coli O157:H7 EDL933] >gi|26110907|gb|AAN83091.1|AE016769_206 ATP synthase gamma chain [Escherichia coli CFT073] >gi|41037|emb|CAA23526.1| unnamed protein product [Escherichia coli] >gi|43265|emb|CAA25781.1| unnamed protein product [Escherichia coli] >gi|146324|gb|AAA83874.1| H+ ATPase F1 gamma subunit [Escherichia coli] >gi|290582|gb|AAA62085.1| ATP synthase F1 gamma subunit >gi|1790171|gb|AAC76756.1| F1 sector of membrane-bound ATP synthase, gamma subunit [Escherichia coli str. K-12 substr. MG1655] >gi|13364150|dbj|BAB38098.1| membrane-bound ATP synthase gamma-subunit AtpG [Escherichia coli O157:H7 str. Sakai] >gi|24054295|gb|AAN45253.1| membrane-bound ATP synthase, F1 sector, gamma-subunit [Shigella flexneri 2a str. 301] >gi|30043223|gb|AAP18944.1| membrane-bound ATP synthase, F1 sector, gamma-subunit [Shigella flexneri 2a str. 2457T] >gi|81243223|gb|ABB63933.1| membrane-bound ATP synthase, F1 sector, gamma-subunit [Shigella dysenteriae Sd197] >gi|85676305|dbj|BAE77555.1| F1 sector of membrane-bound ATP synthase, gamma subunit [Escherichia coli W3110] >gi|91074832|gb|ABE09713.1| membrane-bound ATP synthase F1 sector gamma-subunit [Escherichia coli UTI89] >gi|110345666|gb|ABG71903.1| ATP synthase gamma chain [Escherichia coli 536] >gi|110617105|gb|ABF05772.1| membrane-bound ATP synthase, F1 sector, gamma-subunit [Shigella flexneri 5 str. 8401] >gi|115515130|gb|ABJ03205.1| membrane-bound ATP synthase, F1 sector, gamma-subunit [Escherichia coli APEC O1] >gi|157068895|gb|ABV08150.1| ATP synthase F1, gamma subunit [Escherichia coli HS] >gi|169757158|gb|ACA79857.1| ATP synthase F1, gamma subunit [Escherichia coli ATCC 8739] >gi|169891069|gb|ACB04776.1| F1 sector of membrane-bound ATP synthase, gamma subunit [Escherichia coli str. K12 substr. DH10B] >gi|170521947|gb|ACB20125.1| ATP synthase F1, gamma subunit [Escherichia coli SMS-3-5] >gi|187428257|gb|ACD07531.1| ATP synthase F1, gamma subunit [Shigella boydii CDC 3083-94] >gi|187771442|gb|EDU35286.1| ATP synthase F1, gamma subunit [Escherichia coli O157:H7 str. EC4196] >gi|188016989|gb|EDU55111.1| ATP synthase F1, gamma subunit [Escherichia coli O157:H7 str. EC4113] >gi|188489185|gb|EDU64288.1| ATP synthase F1, gamma subunit [Escherichia coli 53638] >gi|189002320|gb|EDU71306.1| ATP synthase F1, gamma subunit [Escherichia coli O157:H7 str. EC4076] >gi|189359205|gb|EDU77624.1| ATP synthase F1, gamma subunit [Escherichia coli O157:H7 str. EC4401] >gi|189364469|gb|EDU82888.1| ATP synthase F1, gamma subunit [Escherichia coli O157:H7 str. EC4486] >gi|189369484|gb|EDU87900.1| ATP synthase F1, gamma subunit [Escherichia coli O157:H7 str. EC4501] >gi|189373262|gb|EDU91678.1| ATP synthase F1, gamma subunit [Escherichia coli O157:H7 str. EC869] >gi|189378702|gb|EDU97118.1| ATP synthase F1, gamma subunit [Escherichia coli O157:H7 str. EC508] >gi|190904116|gb|EDV63827.1| ATP synthase F1, gamma subunit [Escherichia coli B7A] >gi|190909337|gb|EDV68923.1| ATP synthase F1, gamma subunit [Escherichia coli F11] >gi|192930532|gb|EDV83139.1| ATP synthase F1, gamma subunit [Escherichia coli E22] >gi|192957494|gb|EDV87940.1| ATP synthase F1, gamma subunit [Escherichia coli E110019] >gi|194413886|gb|EDX30164.1| ATP synthase F1, gamma subunit [Escherichia coli B171] >gi|194420428|gb|EDX36504.1| ATP synthase F1, gamma subunit [Shigella dysenteriae 1012] >gi|194425380|gb|EDX41364.1| ATP synthase F1, gamma subunit [Escherichia coli 101-1] (287 aa)
Score = 293, Expect = 1.0e-24, Identities = 80/283 (28%), Positives = 158/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKG--IEAEISLDLELDDKDINFDLFHIIAE-NLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  +++T KIT AM++V+++K++K ++       Y +    +  ++   N + +   L+  +  +  +L   +  GLCG  N+N+ K+L   +K+        ++ +IG KG +   S G  + A+++    + D   N  L  +I    ++ +  ++  +  + ++ +KF+N++S  P++  LLPL  + +    D  +   D+  +P+   + +++L  Y+ + ++  +VE+   E A+R  AM +AT N   LIK  +L +N+ RQ+ ITQE+TEIVSGA
  S:     1 MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQDRMAASRPYAETMRKVIGHLAHGNLEYKHPYLEDRDVKRVGYLVVSTDRGLCGGLNINLFKKLLAEMKTWTDKGVQCDLAMIGSKGVSFFNSVGGNVVAQVT---GMGD---NPSLSELIGPVKVMLQAYDEGRLDKLYIVSNKFINTMSQVPTISQLLPLPASDDD---DLKHKSWDYLYEPDPKALLDTLLRRYVESQVYQGVVENLASEQAARMVAMKAATDNGGSLIKELQLVYNKARQASITQELTEIVSGA 284
>gi|123444374|ref|YP_001008339.1| F0F1 ATP synthase subunit gamma [Yersinia enterocolitica subsp. enterocolitica 8081] >gi|166224125|sp|A1JTC7|ATPG_YERE8 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|122091335|emb|CAL14221.1| ATP synthase gamma subunit protein [Yersinia enterocolitica subsp. enterocolitica 8081] (287 aa)
Score = 293, Expect = 1.1e-24, Identities = 85/283 (30%), Positives = 156/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIK-SNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDE------IWLIGKKGKNLIKSKG--IEAEISLDLELDDKDINFDLFHIIAE-NLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  +++T KIT AM++V+++K++K +E       Y +    +  ++   N + +   L++ +  +  +L   +  GLCG  N+N+ K+L   +K   E      + LIG K  +   S G  I A+++    + D   N  L  +I    ++ +  ++  +  + ++ +KF+N++S  P +  LLPL  A E   L K +   D+  +P+   + +++L  Y+ + ++  +VE+   E A+R  AM +AT N   LIK  +L +N+ RQ+ ITQE+TEIV GA
  S:     1 MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQERMAASRPYAETMRSVIGHLALGNLEYKHPYLEERDVKRVGYLVVSTDRGLCGGLNINLFKKLLAEMKGWSEKGVECDLALIGSKAASFFGSVGGKIVAQVT---GMGD---NPSLSELIGPVKVMLQAYDEGRLDKLYIVNNKFINTMSQEPRIMQLLPLPPA-EDGELKKKS--WDYLYEPDPKALLDTLLRRYVESQVYQGVVENLASEQAARMVAMKAATDNGGSLIKELQLVYNKARQASITQELTEIVGGA 284
>gi|52787605|ref|YP_093434.1| F0F1 ATP synthase subunit gamma [Bacillus licheniformis ATCC 14580] >gi|161760684|ref|YP_081005.2| F0F1 ATP synthase subunit gamma [Bacillus licheniformis ATCC 14580] >gi|81690847|sp|Q65DX3|ATPG_BACLD ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|52350107|gb|AAU42741.1| AtpG [Bacillus licheniformis DSM 13] >gi|145903195|gb|AAU25367.2| ATP synthase (subunit gamma) [Bacillus licheniformis ATCC 14580] (284 aa)
Score = 293, Expect = 1.1e-24, Identities = 91/283 (32%), Positives = 154/283 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKE----LQKHIKSNDE--IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPL-DKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MASL +IK RI   +  S+IT A ++VS++KL + +    +   Y +K  ++   I      +   +      +T +L   +  GL G+FN N++++    +Q+  +S DE  +  +G+ G++  K +GI   IS    + D ++ F     +A + +  Y  D     + + Y+ FV+++S   +   LLPL D A  K +         F  +P+  ++ E +L  Y  + I GA+++SK  E+A+R  AM +AT NA E+I + +L +NR RQ+ ITQEITEIV GA
  S:     1 MASLRDIKSRIASNKKMSQITKAQEMVSASKLNRAENKAKSFVPYMEKMQEVVADIAVGYTGKHPMMSSRPVKRTGYLVITADRGLAGAFNANVLRKAYQRIQERHQSKDEYAVIAVGRMGRDFFKKRGIPV-ISEMTGIRD-EVTFSEIKDLANSTVQMYI-DETFDELYLFYNHFVSAISQEVTEKKLLPLTDIAPNKKK-------TSFEFEPDEEEILEVLLPQYAESLIFGALLDSKASEHAARMTAMRNATDNAKEIIADLELSYNRARQASITQEITEIVGGA 280
>gi|134102717|ref|YP_001108378.1| ATP synthase gamma chain [Saccharopolyspora erythraea NRRL 2338] >gi|166224100|sp|A4FN28|ATPG_SACEN ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|133915340|emb|CAM05453.1| ATP synthase gamma chain [Saccharopolyspora erythraea NRRL 2338] (308 aa)
Score = 292, Expect = 1.3e-24, Identities = 81/285 (28%), Positives = 163/285 (57%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNS--DSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVK---ELQKHIKSNDE---IWLIGKKGKNLIKSKGIEAEISLDLELDDKDIN--FDLFHIIAENLLAKYKNDY----------NIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           MA L E++ RI+ ++ST KIT A +L++++++ K +        Y  +  ++ T +   S  D  +L+ +++ +   + L   S  G CG +N N+++   ELQ  ++   +   ++++G+KG+   + +  E   S     D  D +   D+   + +  LA   +DY           +  + +++++FV+ ++  PSV  + PL+  +E     +      +  +P+A+ +F+++L  Y+ T +   ++++   E+A+RR AM SAT NA+E+I+    E N+ RQ++ITQEI+EIV G + 
  S:     1 MAQLRELRNRIRSVKSTRKITKAQELIATSRIMKAQARVEASRPYADEITNVLTALADASTLDHPLLTERENPKRAGV-LVVTSDRGFCGGYNANVLRAAEELQTLLREQGKTPVLYVVGRKGEAYYRFRQREIAKSWTGFTDRPDYSDAADIGETLVKAFLAG-ADDYLDDGGPDGTLGVDELHLVHTEFVSMITQKPSVKRVAPLE--VEYSEEPQKTLRPVYDFEPDADTLFKALLPKYINTRLFAGLLDAAASEHAARRTAMKSATDNADEIIRTLSREANQARQAQITQEISEIVGGVEA 301
>gi|84515109|ref|ZP_01002472.1| ATP synthase subunit C [Loktanella vestfoldensis SKA53] >gi|84511268|gb|EAQ07722.1| ATP synthase subunit C [Loktanella vestfoldensis SKA53] (290 aa)
Score = 292, Expect = 1.3e-24, Identities = 87/285 (30%), Positives = 159/285 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIK-----SNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSK-GIEAEISLDLELDDKDINFDLFHIIAENLLAKYKN-DYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGAD-----FSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           M +L ++K RI  ++ST KIT AM++V++AKL++ ++       Y ++F  +   +      S+S  ++LS    ++   + +   +  GLCG FN NI K  + H +         +I  +GKKG++ +K + G  A   +DL    K + +     IA ++LA++   +Y+I +I   +++F N ++  P+   ++P           K    AD     +  +P   ++   +L   +AT I  A++E+   E  +R +AMD+AT+NA E+I    +++NR RQ+ IT E+ EI+SGA+ 
  S:     1 MPNLKDLKNRIASVKSTRKITKAMQMVAAAKLRRAQDAAEASRPYTERFTAVMAQLAASVGGSDSAPKLLSGTGGDQVHLL-IVMTAERGLCGGFNSNITKLAKVHAQKLLAQGKTVKILTVGKKGRDALKREFGSYAVGHIDLSAV-KRVGYVNAQDIARDVLARFDGGEYDIATI--FFARFENVVTQHPTAQQIIPA----------KFEQAADADVTLYDYEPGEEEILADLLPRGVATAIFSALLENAASEQGARMSAMDNATRNAGEMIDKLTIQYNRSRQAVITNELIEIISGAEA 289
>gi|94986846|ref|YP_594779.1| F0F1 ATP synthase subunit gamma [Lawsonia intracellularis PHE/MN1-00] >gi|166215102|sp|Q1MP34|ATPG_LAWIP ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|94731095|emb|CAJ76119.1| F0F1-type ATP synthase, subunit c [Lawsonia intracellularis PHE/MN1-00] (289 aa)
Score = 292, Expect = 1.3e-24, Identities = 91/285 (31%), Positives = 158/285 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSL--KKSEEGKTIWLAFFSSMGLCGSFN-LNIVKEL----QKHIKSNDEIWL-IGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDY---NIKSIKVIYSKFVNSLSFTPSVFSLLPLD-KAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           MASL ++K +I  +  T +IT AM +V+SAKL+  +    +   Y +KF D+ + + + SD  +  L  K++     I++   S  GLCG FN + I+K L    QK  K     ++ IG+KG++ IK             L D    F   + +A ++  K  + Y   N+  + +IY +F+N++       +LLP+  K ++K +L+K    +++  +P    +   +L  ++ T I+   +++   ENA+R  AMD+AT+N +ELI N    +N+ RQ+ IT E+ +IVSGA+ 
  S:     1 MASLKDVKIKIAGVRKTKQITKAMNMVASAKLRGAQIKIEHFRPYAEKFQDVISNLATRSDETVHKLLEKRTNGTSCIFILITSDRGLCGIFNTMLIIKALELAKQKTTKGKKVSFICIGRKGRDAIKKTHYPI-------LSDYSDKFTRDYQLASHISEKVIDGYLTVNMDEVVLIYGQFINAMRQIVGFSTLLPIHPKPLDKEQLEKY---SEYIYEPGVAILLSELLPKFVTTQIYRGFLDTDASENAARMTAMDNATRNCDELIGNLTRLYNKTRQASITSELIDIVSGAEA 287
>gi|1168596|sp|P43452|ATPG_ENTHR ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|153572|gb|AAA26858.1| H+ ATPase (300 aa)
Score = 292, Expect = 1.3e-24, Identities = 96/282 (34%), Positives = 154/282 (54%)
  Q:     2 ASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILS------------LKKSEEGKTIWLAFFSSMGLCGSFNLNIVKE----LQKHIKSNDEIWLI--GKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDK--AIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           ASLNEIK RI   + TS+IT AM++VS++KL K +       IY  K  ++ T++ +   ++I S            L      KT ++   +  GL G +N +I+K+    L++  KS D+  +I  G  G +  K++GI     L   L D+  +FD    I       Y+N+     + V Y+  +NSL+    V  +LP+      E    D+     ++  +P+  ++   +L  Y  + I+GAIV++K  E+A+   AM +AT NA  +I +  + +NR RQ  ITQEITEIV+GA
  S:     3 ASLNEIKTRIASTKKTSQITRAMQMVSASKLTKSEASSQKFQIYANKVREIVTHLTATQLNDIASDNPRGDINYNSMLISRPVKKTGYIVITADGGLVGGYNSSILKQTMSILEEDHKSPDDYVMIAIGGTGADFFKARGINLAYELR-NLSDQP-SFDEVRKIVGMATTMYQNEV-FDELYVCYNHHINSLTSQFRVEKMLPISDLDPEEATTFDQ-----EYIFEPSKEEILAQLLPQYAESLIYGAIVDAKTAEHAAGMTAMKTATDNAATIIDDLTVSYNRARQGAITQEITEIVAGA 296
>gi|85091417|ref|XP_958891.1| ATP synthase gamma chain, mitochondrial precursor [Neurospora crassa OR74A] >gi|28920282|gb|EAA29655.1| ATP synthase gamma chain, mitochondrial precursor [Neurospora crassa OR74A] (299 aa)
Score = 292, Expect = 1.3e-24, Identities = 86/281 (30%), Positives = 151/281 (53%)
  Q:     3 SLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDE--IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           +L EI+ R+K I +  KITN MK+V+S KL + +        Y     ++FT    +++++ L   ++E  K + +   S  GLCG  +  + + +++   +  E  I +IG+K K  + S+    +I L+     KDI   +      + + + K DY+  S++++Y+KF+N+ S+ P+V      D  +  P         +FS      +V  ++    LA  ++ A+ E   CE ++RRNAMD+A+KNA E+I  Y++ FNR RQ+ IT E+ EI++GA
  S:    30 TLREIETRLKSIRNIEKITNTMKIVASTKLNRAQRAMTESRGYGATSNEVFT----SAETKPL---EAEGKKKLVVVCSSDKGLCGGVHSGLARFIRRRAATEPEFDIVIIGEKAKAQL-SRTNAKDIVLNFSGVGKDIPTFVEASAIADQITQLKGDYS--SVEIVYNKFINATSYEPTVIEAFSEDAILASP---------NFSAFEVDEEVLGNLREYALANSLYWALCEGHACEISARRNAMDNASKNAGEMISKYQILFNRTRQAVITGELVEIITGA 293
>gi|156741252|ref|YP_001431381.1| ATP synthase F1, gamma subunit [Roseiflexus castenholzii DSM 13941] >gi|189081470|sp|A7NIR0|ATPG_ROSCS ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|156232580|gb|ABU57363.1| ATP synthase F1, gamma subunit [Roseiflexus castenholzii DSM 13941] (290 aa)
Score = 292, Expect = 1.3e-24, Identities = 79/283 (27%), Positives = 155/283 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNS----DSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHI------KSNDEIWLIGKKGKNLI--KSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           M S  EI++RI+ +++ ++IT AM++VS++K+++ +   L    Y  +  D+   +   +       +L ++   +G  + +      GL GS   N+++   + I      K   E+  IGKKG++ +    + + AE++   +L D     D+  I    +       Y+   + V+YS+FVN+L   P++  LLP+D     P  +      D++ +P+  +V  ++L  ++   ++ A++E+   E+++R  AM +AT NA EL ++  L +N+ RQ+ IT+E++EI SGA
  S:     1 MPSTREIRRRIRSVKNLAQITRAMEMVSASKMRRAQRNVLATRPYADRLLDVMGELTGRAVGMRRGTLLEVRPVVKGVAL-IVVTPDRGLAGSLVANVLRRASRFILDEQEKKHTVEVLAIGKKGRDFMVRTRQNLVAEVT---KLGDYPRLTDILGIATNVINGFLSGRYD--EVYVLYSQFVNTLVQRPTIKRLLPID-----PPHEPAERMVDYTYEPSQEEVLRALLPRFVEVQLYQAVLEAIASEHSARMVAMRNATDNAKELQRDLTLSYNKTRQANITKEVSEIASGA 284
>gi|86136462|ref|ZP_01055041.1| ATP synthase subunit C [Roseobacter sp. MED193] >gi|85827336|gb|EAQ47532.1| ATP synthase subunit C [Roseobacter sp. MED193] (292 aa)
Score = 292, Expect = 1.3e-24, Identities = 89/285 (31%), Positives = 165/285 (57%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSN---SDSEILSLKKSEEGKTIWLAFFSS-MGLCGSFNLNIVK-------ELQKHIKSNDEIWLIGKKGKNLIKSKGIEAEIS-LDLELDDKDINFDLFHIIAENLLAKYK-NDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           M +L ++K RI  ++ST KIT AM++V++AKL++ +E   +   Y K+F  +   + ++   SDS    L+ +   +   L   +S  GLCG FN NI K       EL+   K+  +I  +GKKG++ ++    +  I  +DL  + K I +     IA+++L ++   ++++ ++   +++FVN ++  P+   ++P   A  +    +  + A +  +P+   +   +L   ++T I  A++E+   E  +R +AMD+AT+NA E+I    +EFNR RQ+ IT E+ EI+SGA+ 
  S:     1 MPNLKDLKNRIASVKSTRKITKAMQMVAAAKLRRAQEAAEDSRPYTKRFNAVMAGLAASVGGSDSAPKLLRGTGSDQVQLLVVMTSERGLCGGFNANISKLARQKAQELKAAGKTV-KILTVGKKGRDALRRDFADDFIGHVDLS-EVKRIGYANAQNIAKDILTRFDAGEFDVATL--FFAEFVNVVTQVPTAQQIIP---ASYEGGAAEETSSAVYDYEPSEEAILADLLPRGVSTQIFSALLENGASEQGARMSAMDNATRNAGEMIDKLTIEFNRSRQAVITNELIEIISGAEA 291
>gi|149183571|ref|ZP_01861993.1| F0F1-type ATP synthasegamma chain [Bacillus sp. SG-1] >gi|148848712|gb|EDL62940.1| F0F1-type ATP synthasegamma chain [Bacillus sp. SG-1] (285 aa)
Score = 292, Expect = 1.4e-24, Identities = 95/283 (33%), Positives = 152/283 (53%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNS-DSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIK----SNDE--IWLIGKKGKNLIKSKG---IEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MASL +IK RI   + TS+IT AM++VS++K+ + +        Y +K  ++ + I   S D+    L      KT +L   S  GL G++N N+++ +   IK    SNDE  I  IG+ G++  + +    IE    +  +    DI       IA   +  + +D     + + Y+ +V+++    +   +LPL        LD       +  +P+A D+ E +L  Y  + I+GA+++ K  E+A+R +AM SAT NA ELI +  L +NR RQ+ ITQEITEIV GA
  S:     1 MASLRDIKSRITSTKKTSQITKAMQMVSASKMARAETNAKAFVPYMEKIQEVVSSIALGSKDASHPMLVSRPVKKTGYLVITSDRGLAGAYNSNVIRLVHNTIKERHSSNDEFAIIAIGRIGRDFFQKRDYNVIEGITGIPDQPSFSDIK-----DIATKAVGMF-SDGAYDELYLYYNHYVSAIQQDVTEKKVLPLTD------LDSSAKLTSYEFEPSAEDILEVLLPQYAESLIYGALLDGKASEHAARMSAMKSATDNAKELINSLSLSYNRARQAAITQEITEIVGGA 281
>gi|121592741|ref|YP_984637.1| ATP synthase F1, gamma subunit [Acidovorax sp. JS42] >gi|166222513|sp|A1W2T6|ATPG_ACISJ ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|120604821|gb|ABM40561.1| ATP synthase F1, gamma subunit [Acidovorax sp. JS42] (288 aa)
Score = 292, Expect = 1.4e-24, Identities = 81/283 (28%), Positives = 153/283 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEGKTIWLAFFSS-MGLCGSFNLNIVKELQKHIKSNDEIWL------IGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA+  EI+ +IK +E+T KIT AM++V+++K++K ++       Y +K  ++  ++   +   +    K+ + K   +   ++  GLCG  N N+++ +   ++      +      IG KG   +   G +  ++    L D   + D      + LL  Y  +  I ++ + Y+KF+N++     V  LLPL    E+ +  K  +G D+  +P+A  V + +L+ Y+ + I+ A+ E+   E ++R  AM +AT NA  +I   KL +N+ RQ+ IT+E++EIV+GA
  S:     1 MAAGKEIRGKIKSVENTKKITKAMEMVAASKMRKAQDRMRAARPYAEKVRNIAAHLGEANPEYVHPFMKANDAKAAGIIVVTTDKGLCGGMNTNVLRAVTTKLRELQSTGVDVQSVAIGNKGLGFLNRVGAKV-VAHATGLGDTP-HLDKLIGPVKVLLDAYA-EGKINAVYLSYTKFINTMKQESVVEQLLPLSS--EQMQAQKTGHGWDYIYEPDAQSVIDELLVRYVESLIYQAVAENMASEQSARMVAMKAATDNAGNVINELKLVYNKTRQAAITKELSEIVAGA 285
>gi|145220430|ref|YP_001131139.1| F0F1 ATP synthase subunit gamma [Prosthecochloris vibrioformis DSM 265] >gi|189081466|sp|A4SGM8|ATPG_PROVI ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|145206594|gb|ABP37637.1| ATP synthase F1, gamma subunit [Prosthecochloris vibrioformis DSM 265] (291 aa)
Score = 292, Expect = 1.4e-24, Identities = 86/283 (30%), Positives = 154/283 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSE---ILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQK-------HIKSNDEIWLI--GKKGKNLIKSKG---IEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           M +L +I+ RIK + ST ++T AMK+V++AKL++ +E  +    Y  K  ++   + +  D+    +LS +    G  + L   S  GLCG FN NI+K  Q+        + +   + +I  G +G +  + +G   ++   S+   LD     F     IAE   + Y     +  + V+Y++F + L+      +LLP+         ++ + G D+  +P+ + +   ++  +L T +   ++ES   E A+R  AMDSAT+NA EL++   + +NR RQ+ IT+E++EIV GA
  S:     1 MPTLKDIRVRIKGVTSTQQVTKAMKMVAAAKLRRAQERAVMARPYAAKLSEMLGSLSAKVDTSENPLLSGRSEVRGALVIL-ITSDRGLCGGFNTNIIKVAQRVVNNEYGELNAAGRLSMICAGTRGFDFFRKRGYTILKGYPSVFQNLD-----FSTAQEIAETASSMYLKG-EVDKVVVVYNEFKSVLAPVLKAETLLPISS-----EENEGDRGGDYIYEPSPSAIISELVPKHLNTQVWRMMLESNAAEQAARMTAMDSATENAKELLRTLNISYNRARQAAITKELSEIVGGA 286
>gi|146313761|ref|YP_001178835.1| F0F1 ATP synthase subunit gamma [Enterobacter sp. 638] >gi|166990394|sp|A4WGF4|ATPG_ENT38 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|145320637|gb|ABP62784.1| ATP synthase F1, gamma subunit [Enterobacter sp. 638] (287 aa)
Score = 291, Expect = 1.5e-24, Identities = 84/283 (29%), Positives = 158/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKS-NSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKG--IEAEISLDLELDDKDINFDLFHIIAE-NLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  +++T KIT AM++V+++K++K ++   +   Y      +  ++ + N + +   L++ +  +  +L   +  GLCG  N+N+ K+L   +K         +I +IG KG +   S G  I A+++    + D   N  L  +I    ++ +  ++  +  + V+ +KF+N++S  P++  LLPL  A E   L +     D+  +P+   + +++L  Y+ + ++  +VE+   E A+R  AM +AT N   LIK  +L +N+ RQ+ ITQE+TEIV GA
  S:     1 MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQDRMASSRPYADTMRKVIGHLANGNLEYKHPYLEERDVKRVGYLVVSTDRGLCGGLNINLFKKLLADMKVWSDKGVQSDIAMIGSKGVSFFNSVGGNIVAQVT---GMGD---NPSLSELIGPVKVMLQAYDEGRLDRLYVVSNKFINTMSQVPTLTQLLPL-PASEDQELKQ--KAWDYLYEPDPKPLLDTLLRRYVESQVYQGVVENLASEQAARMVAMKAATDNGGSLIKELQLVYNKARQASITQELTEIVGGA 284
>gi|74314241|ref|YP_312660.1| F0F1 ATP synthase subunit gamma [Shigella sonnei Ss046] >gi|123615762|sp|Q3YVN7|ATPG_SHISS ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|73857718|gb|AAZ90425.1| membrane-bound ATP synthase, F1 sector, gamma-subunit [Shigella sonnei Ss046] (287 aa)
Score = 291, Expect = 1.5e-24, Identities = 80/283 (28%), Positives = 158/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKG--IEAEISLDLELDDKDINFDLFHIIAE-NLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  +++T KIT AM++V+++K++K ++       Y +    +  ++   N + +   L+  +  +  +L   +  GLCG  N+N+ K+L   +K+        ++ +IG KG +   S G  + A+++    + D   N  L  +I    ++ +  ++  +  + ++ +KF+N++S  P++  LLPL  + +    D  +   D+  +P+   + +++L  Y+ + ++  +VE+   E A+R  AM +AT N   LIK  +L +N+ RQ+ ITQE+TEIVSGA
  S:     1 MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQDRMAASRPYAETMRKVIGHLAHGNLEYKHPYLEDRDVKRVGYLVVSTDRGLCGGLNINLFKKLLAEMKTWTDKSVQCDLAMIGSKGVSFFNSVGGNVVAQVT---GMGD---NPSLSELIGPVKVMLQAYDEGRLDKLYIVSNKFINTMSQVPTISQLLPLPASDDD---DLKHKSWDYLYEPDPKALLDTLLRRYVESQVYQGVVENLASEQAARMVAMKAATDNGGSLIKELQLVYNKARQASITQELTEIVSGA 284
>gi|157368256|ref|YP_001476245.1| F0F1 ATP synthase subunit gamma [Serratia proteamaculans 568] >gi|166990396|sp|A8G7M7|ATPG_SERP5 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|157320020|gb|ABV39117.1| ATP synthase F1, gamma subunit [Serratia proteamaculans 568] (287 aa)
Score = 291, Expect = 1.7e-24, Identities = 85/283 (30%), Positives = 155/283 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIK-SNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDE------IWLIGKKGKNLIKSKG--IEAEISLDLELDDKDINFDLFHIIAE-NLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  +++T KIT AM++V+++K++K +E       Y +    +  ++   N + +   L + +  +  +L   +  GLCG  N+N+ K L   +K   E      + LIG K  +   S G  + A+++    + D   N  L  +I    ++ +  ++  +  + ++ +KF+N++S  P +  LLPL  A E   L K +   D+  +P+   + +++L  Y+ + ++  +VE+   E A+R  AM +AT N   LIK  +L +N+ RQ+ ITQE+TEIVSGA
  S:     1 MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQERMAASRPYAETMRKVIGHLALGNLEYKHPYLDERDVKRVGYLVVSTDRGLCGGLNINLFKRLLAEMKGWSEKGVETDLALIGSKAASFFGSVGGNVVAQVT---GMGD---NPSLSELIGPVKVMLQAYDEGRLDKLYIVSNKFINTMSQEPQIVQLLPLPPA-EDGELKKKS--WDYLYEPDPKVLLDTLLRRYVESQVYQGVVENLASEQAARMVAMKAATDNGGSLIKELQLVYNKARQASITQELTEIVSGA 284
>gi|148266272|ref|YP_001232978.1| F0F1 ATP synthase subunit gamma [Geobacter uraniireducens Rf4] >gi|189081456|sp|A5G9D7|ATPG_GEOUR ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|146399772|gb|ABQ28405.1| ATP synthase F1, gamma subunit [Geobacter uraniireducens Rf4] (287 aa)
Score = 291, Expect = 1.7e-24, Identities = 86/284 (30%), Positives = 156/284 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSL-KKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDE------IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKY-KNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAK 284
           MASL  IKKRI  +++T +IT AMK+VS+AKL++ +E  +    Y KK  ++   +  + D +   L +K + GK + +   S  GLCG FN NI K  ++  K          +  IG+KG   +K++    +I  +       +N+    +IA  L+  Y   +Y+   + ++++ F + ++   ++  LLP+   +       P    ++  +P+   + + +L  ++   +  A++ES   E+ +R  AMDSA+KNA+E+I    L++NR RQ+ IT E+ EI+SG++
  S:     1 MASLKSIKKRIVSVKNTRQITKAMKMVSAAKLRRAQENVVAARPYAKKLGEVLERLSKSQDVDGSPLMEKRQGGKALLIIVSSDRGLCGGFNANICKAAERFAKERGSEFTELSMMTIGRKGYEFLKNR---HKIYKNYANIFGTLNYQTAALIARELIDGYLAEEYD--EVYLLFNAFKSVMTQDITLEQLLPVTPEVAAEEEYAP----EYIYEPSKAALLDELLPKHIEVQMFKAMLESVASEHGARMTAMDSASKNASEMIGKLTLQYNRARQAAITTELMEIISGSE 283
>gi|146328692|ref|YP_001210027.1| ATP synthase F1, gamma subunit [Dichelobacter nodosus VCS1703A] >gi|166222551|sp|A5EXJ6|ATPG_DICNV ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|146232162|gb|ABQ13140.1| ATP synthase F1, gamma subunit [Dichelobacter nodosus VCS1703A] (289 aa)
Score = 291, Expect = 1.7e-24, Identities = 85/283 (30%), Positives = 155/283 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILS-LKKSEEGKTI-WLAFFSSMGLCGSFNLNIVKELQKHIKSNDEIWLIGKKGKNLIKS----KGI----EAEISLDLELDDKDINFDLFHII-AENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           M++  EI+ +IK ++ST KIT AM++V+++K+++ +        Y +    +  ++   S S +   L K E+ +T+ ++   +  GLCG  N+N+ K L +HI          KKG  ++ +    KG+     A++ L   +++         +I A   + +  N   I+ I ++ + F N+++  P++  LLP           K  +  D+  +PNA  + +++L  YL   +  A+ E+  CE ++R  AM SA+ NA  LIK  +L++N+ RQ+ ITQE+TEIV+GA
  S:     1 MSNAKEIRSQIKSVKSTQKITKAMEMVAASKVRRVQNYMRGGRPYAEHIQRVIAHLVRASSSTLHPFLVKPEKVETVGYIVISTDRGLCGGLNINLFKTLWQHICGEQ------KKGHKIVATVFGRKGVAFLNRAQVPLLSTIENYPEEPQTHELIGAIYPMIEGFNRGEIQKIYIVGNVFENAMTQKPTITQLLPASVQFADGMTAK--HAWDYIYEPNAESILDTLLKRYLEFTVKQAVAENIACEMSARMLAMKSASDNAGALIKELQLKYNKARQTAITQELTEIVAGA 286
>gi|146284503|ref|YP_001174656.1| F0F1 ATP synthase subunit gamma [Pseudomonas stutzeri A1501] >gi|166224088|sp|A4VS63|ATPG_PSEU5 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|145572708|gb|ABP81814.1| ATP synthase gamma chain [Pseudomonas stutzeri A1501] (288 aa)
Score = 291, Expect = 1.9e-24, Identities = 83/283 (29%), Positives = 159/283 (56%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIK-SNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPL--DKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  I+ST KIT+AM+ V+ +K++K +        Y ++   +  ++  +N +     + +    +  ++   +  GLCG  N+N+ K L K++K         ++ +IG KG +  +S G     ++    ++  IN DL  I +  ++    ++  I  + ++ +KF+N+++  P++  LLPL  D + E  +        D+  +P+A  + +++L+ ++ + ++ A+VE+   E A+R  AM +AT NA ELI + +L +N+ RQ+ ITQEI+EIV GA
  S:     1 MAGAKEIRSKIASIKSTQKITSAMEKVAVSKMRKAQMRMAASRPYAERIRQVIGHLAYANPEYRHPFMVERPVKRVGYIVVSTDRGLCGGLNINLFKVLIKNMKEWHDQKVEVDLCVIGNKGASFFRSFGGNVVAAIGNLGEEPSIN-DL--IGSVKVMLDGFHEGRIDRLYLVSNKFINTMTQKPTLDQLLPLAADDSAEPVK----KGQWDYLYEPDAQQLLDALLVRFIESQVYQAVVENGAAEQAARMIAMKNATDNAGELISDLQLVYNKARQAAITQEISEIVGGA 285
>gi|118444337|ref|YP_878997.1| F0F1 ATP synthase subunit gamma [Clostridium novyi NT] >gi|166222548|sp|A0Q2Z5|ATPG_CLONN ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|118134793|gb|ABK61837.1| ATP synthase F1, gamma subunit [Clostridium novyi NT] (285 aa)
Score = 290, Expect = 2.0e-24, Identities = 96/285 (33%), Positives = 152/285 (53%)
  Q:     2 ASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEI-LSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHI---KSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKGE 286
           A L  IK+RIK I +T KIT A+ LV+++KL+K ++     + YY    ++   I ++ + E  +  K +   K +++   S  GLCG FN N++ +  + I   + N  I  +GKKG+  +K   I++ I+  +E+ +          I E  L  Y N   I  I V+Y+ FV+S+     V  +LP+   +E+   D          +P+ N V E I   YL   +   ++ SK  E ++R  AMD AT NAN+L+    L++NR RQS ITQEI+EIV GA+ +
  S:     4 AGLIAIKRRIKSINNTKKITKAIGLVATSKLRKARQKLELNNAYYSSVNEIMNGILADKNLEKGIYFKDNGVNKKLYIVITSDSGLCGGFNGNVIAKTLETISGDRENSVIITVGKKGRTYLKKFKIDS-IAEFVEIPEIP-TLKEVKAILEKALNLYMNK-EISEINVVYTHFVSSVKQEAKVKKILPI--TMEE---DSEQTSTFVEFEPDKNIVLEGISELYLKQTLLNLMLNSKTSEESARMTAMDGATSNANDLLDKLNLQYNRIRQSSITQEISEIVGGAQAQ 284
>gi|88860636|ref|ZP_01135273.1| membrane-bound ATP synthase, F1 sector, gamma-subunit [Pseudoalteromonas tunicata D2] >gi|88817231|gb|EAR27049.1| membrane-bound ATP synthase, F1 sector, gamma-subunit [Pseudoalteromonas tunicata D2] (286 aa)
Score = 290, Expect = 2.0e-24, Identities = 86/283 (30%), Positives = 158/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIK-SNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKG--IEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MAS  EIK +I  I++T KIT+AM++V+++K+KK ++   +   Y      +  +I   N +     L++ E  +  ++   +  GLCG  N N  K++   IK+      + +  +IG K  N  K  G  + A+ S    L D     D+   +   ++    N+  +  + V+Y+KFVN++   P++  LLPL KA E   L   ++  D+  +P+   + +++++ ++ + ++  +VE+   E A+R  AM +AT NA +L+   +L +N+ RQ+ ITQEI+EIV+G+
  S:     1 MASGKEIKSKIGSIKNTQKITSAMEMVAASKMKKAQDRVASSRPYADNIRKVIGHIAHGNLEYRHPYLEEREVKRVGYIVISTDRGLCGGLNTNEFKKVALEIKAWKEKGVDADFAVIGSKAANFFKRFGGKVLAQTS---SLGDVPSVSDVIGPV--RVMLDAFNEGKLDRLFVVYNKFVNTMKQEPTIDQLLPLPKA-ESQEL---SHRWDYIYEPDPKAILDTLMVRFVESQVYQGVVENAASEQAARMVAMKAATDNAGDLMDELQLIYNKARQAAITQEISEIVAGS 283
>gi|148138|gb|AAA24736.1| ATP synthase gamma subunit [Escherichia coli] (287 aa)
Score = 290, Expect = 2.1e-24, Identities = 79/283 (27%), Positives = 158/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKG--IEAEISLDLELDDKDINFDLFHIIAE-NLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   +I+ +I  +++T KIT AM++V+++K++K ++       Y +    +  ++   N + +   L+  +  +  +L   +  GLCG  N+N+ K+L   +K+        ++ +IG KG +   S G  + A+++    + D   N  L  +I    ++ +  ++  +  + ++ +KF+N++S  P++  LLPL  + +    D  +   D+  +P+   + +++L  Y+ + ++  +VE+   E A+R  AM +AT N   LIK  +L +N+ RQ+ ITQE+TEIVSGA
  S:     1 MAGAKDIRSKIASVQNTQKITKAMEMVAASKMRKSQDRMAASRPYAETMRKVIGHLAHGNLEYKHPYLEDRDVKRVGYLVVSTDRGLCGGLNINLFKKLLAEMKTWTDKGVQCDLAMIGSKGVSFFNSVGGNVVAQVT---GMGD---NPSLSELIGPVKVMLQAYDEGRLDKLYIVSNKFINTMSQVPTISQLLPLPASDDD---DLKHKSWDYLYEPDPKALLDTLLRRYVESQVYQGVVENLASEQAARMVAMKAATDNGGSLIKELQLVYNKARQASITQELTEIVSGA 284
>gi|188997520|ref|YP_001931771.1| ATP synthase F1, gamma subunit [Sulfurihydrogenibium sp. YO3AOP1] >gi|188932587|gb|ACD67217.1| ATP synthase F1, gamma subunit [Sulfurihydrogenibium sp. YO3AOP1] (291 aa)
Score = 290, Expect = 2.2e-24, Identities = 91/283 (32%), Positives = 156/283 (55%)
  Q:     3 SLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEGKTIWLAFFSS-MGLCGSFNLNIVK----ELQKHIKSNDEI--WLIGKKGKNLIKSKGIEA-EISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           S  +IK++I  I++T +IT AMK VS+AKL+K + L      Y  K Y+L   +    D E   L +  E K++ L   ++  GL G+FN N++K    E+Q+      E+   LIG+KG N  K+KG    E   D+  D  ++ +         +LA    D    ++ +I ++ + S ++   +  LLPL+      +L++    + ++I+P+  +V  S+L  Y+   +  A+VES   E+++R  AMD+ATKNA E I+ + + FN+ RQ  IT E+ +I++ A+ 
  S:     5 SPRDIKRKINGIKNTQRITKAMKAVSAAKLRKAQALLYATRPYSNKLYELIEDLAVYIDRESHPLLEKREEKSVDLVIITADRGLAGAFNSNVIKTAWREIQRLKSEGKEVSLLLIGRKGVNFYKNKGFNIIEAYEDIYRDQVNLTYT---AKVGGILASRFIDKKSDAVYLINNELITSSTYETKIRKLLPLESTASSKKLEEV---SVYNIEPSKEEVLSSLLQRYINYQLFRALVESSTAEHSARMLAMDNATKNAGEAIRKWTIIFNKARQEAITTELIDIINAAEA 289
>gi|119947324|ref|YP_945004.1| ATP synthase F1, gamma subunit [Psychromonas ingrahamii 37] >gi|166224089|sp|A1T0Z0|ATPG_PSYIN ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|119865928|gb|ABM05405.1| ATP synthase F1, gamma subunit [Psychromonas ingrahamii 37] (288 aa)
Score = 290, Expect = 2.2e-24, Identities = 88/283 (31%), Positives = 158/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYY-KKFYDLFTYIKSNS-DSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKEL----QKHIKSNDEIWL--IGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  +++T KIT AM++V+++K+++  +L +N S+ Y K    +  +I     +     L++ E  +  ++   S  GLCG  N+N+ K L    +KH ++N E+ L  IG K        G    ++ +  L D     DL  I +  ++    ++  I  + ++ +KF++++   P++  LLPL KA  +   +  ++  D+  +  A D+ +S+L+ Y+ + ++  +VE+  CE  SR  AM SAT NA ++I   +L  N+ RQS ITQE++EI SGA
  S:     1 MAGDKEIRNKIASVKNTQKITGAMEMVAASKMRR-AQLRMNSSLSYAKSMRKVIGHIALGELEYHHAYLEEREISRVGYIVISSDRGLCGGLNINLFKPLVAAMKKHSEANVEVDLAVIGSKAATFFNGLGANV-VAQNSGLGDAPSVNDL--IGSVKIMLDAYDEGKIDRLFIVNNKFISTMVQEPTISQLLPLPKA--EGDKEVASDSWDYIYEGEAKDILDSLLVRYVESQVYQGVVENLACEQVSRMIAMKSATDNAGDMIDELQLVANKARQSAITQELSEICSGA 285
>gi|77964180|gb|ABB13425.1| ATP synthase subunit gamma [Clostridium paradoxum] (283 aa)
Score = 290, Expect = 2.3e-24, Identities = 87/282 (30%), Positives = 151/282 (53%)
  Q:     4 LNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILS-LKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDE-IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           + +IK+R+K I +T +IT AM+LVSSAKL++ KE       Y+   Y+    I  N+     + L++ +     ++      GL G +N N++K     ++   E +  +GKK  +  + +  +    L      ++++F     IA+  +  Y  +  +  + ++Y++F ++L   P V  +LP+    E    D+         +P+A  V + I+  ++A  I+G IVES   E A+RR AM+SA+ NA+E+I   +L +NR RQS ITQEI+EIV+GA+ 
  S:     6 MKDIKRRMKSINNTKQITKAMELVSSAKLRRAKEQAEKSRPYFLTLYNTIKKIAQNTRGVSSTFLERKDVKSKAFIVIAGDRGLAGGYNSNVIKTTLSSMEGKKEKVVPVGKKSIDFFQKRNYDI---LGKFSGIENMDFSNAKEIAQVCIDAYMKN-EVDEVYLVYTEFKSTLIQEPKVLKVLPISFDKE----DENEKREIIEYEPSAEAVLDYIVPKFVAGTIYGGIVESFASEQAARRTAMESASDNADEMISKLELSYNRARQSSITQEISEIVAGAEA 281
>gi|149173276|ref|ZP_01851907.1| ATP synthase gamma subunit [Planctomyces maris DSM 8797] >gi|148848082|gb|EDL62414.1| ATP synthase gamma subunit [Planctomyces maris DSM 8797] (291 aa)
Score = 290, Expect = 2.4e-24, Identities = 89/283 (31%), Positives = 154/283 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSE-EGKTIWLAFFSSMGLCGSFNLNIVKE-LQKHIK-----SNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDY---NIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA    I KR+K +++  KIT  M+L+++A+ KK  +     + Y KK  +L + + ++N +     L+K E E  ++ L   S+ GLCG +N  ++K  L++H +      N  + + GK+G + +K +GIE   S     +D+      F  + E L  +Y  +Y    I  + V Y++F++S    P+V SLLP+  A++           D+   P+A ++ E I+       +    +++ V E  +R  AM  AT+NANE++ +   ++NR RQS+IT EI EI+ GA
  S:     1 MAKARAIVKRLKAVKNIRKITRTMELIATARFKKAMDRASEAAAYTKKISELVSDLSQANLEFHHPLLEKHETEKNSVLLVLTSNRGLCGGYNSGVLKAALKRHKELTASGQNVRLEISGKRGISFLKFQGIEPSHSYT-HFEDRPT----FEEVDE-LAGRYITEYIEGKIDRLDVAYTEFISSSRQQPAVHSLLPIG-ALDTAEESTATQKYDYEFLPSAQEILEEIVPTAFKARLFKCFLDAAVSEQIARMVAMKGATENANEMVGSLSAQYNRARQSQITSEILEIIGGA 287
>gi|150015307|ref|YP_001307561.1| F0F1 ATP synthase subunit gamma [Clostridium beijerinckii NCIMB 8052] >gi|189081395|sp|A6LQH5|ATPG_CLOB8 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|149901772|gb|ABR32605.1| ATP synthase F1, gamma subunit [Clostridium beijerinckii NCIMB 8052] (283 aa)
Score = 290, Expect = 2.4e-24, Identities = 103/285 (36%), Positives = 151/285 (52%)
  Q:     2 ASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEGKTIW-----------LAFFSSMGLCGSFNLNIVKELQKHIKSNDE---IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKGE 286
           A L EIKKRIK +E+T KITNAM LV+++KL+K K    NE     KF D+   +  N     L+    EEG  ++           +   S  GLCG FN ++V +L   IK   +   I L+G KG   +K   IE  +   + ++D     +   I  +  L  Y N  ++  + ++YS F++S+        +LP+ K+              F I+P+ + V E  L  YL   I   ++ SK  E ++R  AMD ATKNA++L+   KL+FNR RQ  ITQEI+EIV GA  +
  S:     4 AGLLEIKKRIKSVENTRKITNAMGLVATSKLRKTK----NELAVNNKFIDITEPVVRN-----LATTAGEEGSNVYFEGNDSQNKLYVVITSDSGLCGGFNSSVVSQLVSQIKDKKDTAKIVLVGSKGLGYLKRIKIEP-VGEYVGIEDVPTVSEAKEIF-DKALEMYLNG-DVSEVNIVYSDFISSVKQETKSVKILPISKS--------EGTTGSFLIEPDLDIVLEDALNIYLKGKIRSILLSSKCSEQSTRMTAMDGATKNADDLLDKLKLKFNRIRQGAITQEISEIVGGAAAQ 282
>gi|116494661|ref|YP_806395.1| F0F1-type ATP synthase, gamma subunit [Lactobacillus casei ATCC 334] >gi|122263918|sp|Q03A19|ATPG_LACC3 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|116104811|gb|ABJ69953.1| F0F1-type ATP synthase, gamma subunit [Lactobacillus casei ATCC 334] (308 aa)
Score = 289, Expect = 2.5e-24, Identities = 95/281 (33%), Positives = 157/281 (55%)
  Q:     3 SLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI------------KSNSDS----EILS----LKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDE------IWLIGKKGKNLIKSKGIEAEISLDLELDDKDIN----FDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           SL +IK++I   + T +IT AM++VS AKL + ++      IY  K   + T++            +S++DS    +++S    L+K    KT +L   S  GL GS+N  ++K + + IK + E      +  IG  G +  K++G      L+L  + + ++    F+    I +  +  + N      + V Y+  VN+L+       +LP+         D      ++ I+P+ + V ESIL  Y  + I GAI+++K  E+A+   AM SAT NAN+LI +   ++NR RQ+ IT EITEIV GA
  S:     4 SLMDIKRKIASTKKTGQITQAMQMVSGAKLSQIEKRAKKYQIYSDKVRQIVTHLAAGQLLELANAAESDTDSGDKSQVISVASLLQKRPVKKTGYLVITSDRGLVGSYNSTVLKAMMQMIKDDHESPDDYVMMAIGGVGADFFKARG------LNLAYEYRGVSDIPTFNEVREIVKTAVTMFDNGV-FDELYVCYNHHVNTLTSAFRAEKMLPISDLDVSEVAD---TNVEYLIEPDLDSVLESILPQYAESLIFGAIMDAKTAEHAASTTAMRSATDNANDLISHLSTQYNRARQAAITTEITEIVGGA 304
>gi|149911797|ref|ZP_01900401.1| ATP synthase subunit C [Moritella sp. PE36] >gi|149805143|gb|EDM65165.1| ATP synthase subunit C [Moritella sp. PE36] (288 aa)
Score = 289, Expect = 2.7e-24, Identities = 85/283 (30%), Positives = 154/283 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNS-DSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKG--IEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EIK +I  I +T KIT+AM++V+++K++K ++       Y      +  ++   S +     L++ E  +  ++   +  GLCG  N+N+ K+    +K       + ++ LIG K  +   S G  + A ++    L ++    DL   +   +L  Y N   +  + V+Y+KFVN+++  P++  LLPL  + E   L  P +G D+  +    ++   +L+ ++ + ++  +VE+   E A+R  AM +AT NA ++I   +L FN+ RQS ITQEI+EI +GA
  S:     1 MAGAKEIKNKIGSITNTQKITSAMEMVAASKMRKAQDRMAASRPYANTMRRVIGHLAEGSLEYSHPYLEEREVKRVGYIVISTDRGLCGGLNINLFKKTISDMKGWSDKKVDIDLGLIGAKAGSFFGSVGGNVVANVA---NLGEEPALDDLIGSV-RVMLEAYDNG-KLDRLFVVYNKFVNTMTQEPTIDQLLPLPASEENEAL--PKHGWDYLYEGEPAELLTKLLVRFIESQVYQGVVENAASEQAARMFAMKNATDNAGDIIDELQLIFNKARQSAITQEISEICAGA 285
>gi|118054096|ref|ZP_01522637.1| ATP synthase F1, gamma subunit [Comamonas testosteroni KF-1] >gi|117998518|gb|EAV12681.1| ATP synthase F1, gamma subunit [Comamonas testosteroni KF-1] (288 aa)
Score = 289, Expect = 2.7e-24, Identities = 80/283 (28%), Positives = 153/283 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEGKTIWLAFFSS-MGLCGSFNLNIVKELQKHIKSND------EIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA+  EI+ +IK +E+T KIT AM++V+++K++K ++  L    Y +K  ++  ++   +   +    +  + K + +   ++  GLCG  N N+++ +   ++         E   IG KG   +   G +  +S    L D   + D      + LL +Y  +  + ++ + Y+KF+N++     V  LLPL    EK + +K     ++  +P+A  V + +L+ Y+ + ++ A+ E+   E ++R  AM +AT NA  +I   KL +N+ RQ+ IT E++EIV+GA
  S:     1 MAAGKEIRGKIKSVENTKKITKAMEMVAASKMRKAQDRMLAARPYSEKIRNIAAHLGEANPEYVHPFMQVSDAKKVGVIVVTTDKGLCGGMNTNVLRVVTNKLREQQDAGIATEAVAIGGKGLGFLNRVGAKV-VSHATGLGDTP-HLDKLIGPVKVLLDQYA-EGKLSAVYLAYTKFINTMKQESVVEQLLPLSS--EKLQAEKTGASWEYIYEPDAQSVIDELLVRYVESLVYQAVAENMASEQSARMVAMKAATDNAGNVISELKLVYNKTRQAAITTELSEIVAGA 285
>gi|90413753|ref|ZP_01221741.1| ATP synthase subunit C [Photobacterium profundum 3TCK] >gi|90325222|gb|EAS41719.1| ATP synthase subunit C [Photobacterium profundum 3TCK] (288 aa)
Score = 289, Expect = 2.8e-24, Identities = 81/283 (28%), Positives = 158/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNS-DSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKG--IEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  +++T KIT AM++V+++K++K +    +   Y +    +  +I   S + +   L++ E  +  ++   +  GLCG  N+N+ K     +K+        ++ L+G K      S G  + A++S    L D     +L   +   +L KY ++  +  + ++Y++FVN++   P +  LLPL K+ E   + + ++  D+  +P    + +++L+ Y+ + ++  +VE+   E A+R  AM +AT NA ++I + +L +N+ RQ  ITQE++EIVSGA
  S:     1 MAGAKEIRNKIGSVKNTQKITKAMEMVAASKMRKTQGAMESSRPYAQTMRKVIGHIALGSLEYKHPYLEEREAKRVGYVIISTDRGLCGGLNINLFKRAMADMKTWSDKGAEVDLALVGAKATAFFNSYGGNVVAQVS---GLGDSPTVEELIGTVGV-MLKKY-DEGQLDRLYLVYNQFVNTMVQEPVIDQLLPLPKS-EDEEMQR-SHSWDYIYEPEPKPLLDTLLVRYVESQVYQGVVENLASEQAARMVAMKAATDNAGDIINDLQLVYNKARQGAITQELSEIVSGA 285
>gi|171462852|ref|YP_001796965.1| ATP synthase F1, gamma subunit [Polynucleobacter necessarius STIR1] >gi|171192390|gb|ACB43351.1| ATP synthase F1, gamma subunit [Polynucleobacter necessarius STIR1] (289 aa)
Score = 289, Expect = 2.9e-24, Identities = 83/283 (29%), Positives = 153/283 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIK----SNDEIWL--IGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MAS  EI+ +IK +++T KIT AM++V+++K+++ +E   N   Y +K  ++   + K+N       +   E  K   +   +  GLCG  N N+++ +   ++     N EI    IG KG   + ++     IS  +++ D      L   I   L A  + +  I ++ + Y++FVN++   P +  LLPL+     P+ +K  N  D+  +P+A  +   +L  Y+   I+ A+ E+   E ++R  +M +A+ NA  +I   +L++N+ RQ+ IT+E++EIV GA
  S:     1 MASTKEIRSKIKSVQNTRKITKAMEMVAASKMRRAQERMRNARPYAEKIREIVANLSKANPGFRPAYMATREVKKVGTILVTTDKGLCGGLNTNVLRLIANQVRDLQEKNIEIAYTAIGSKGLQFL-NRSKAKLISQTIQIGDIPHMDVLIGAIVSQLEAFERGE--IDAVYLAYTRFVNAMKQEPVLEKLLPLESEALTPQ-EKTGNSWDYICEPDAESILNGLLKRYVEAMIYQAVAENMASEQSARMVSMKAASDNAKNVIGELQLDYNKTRQAAITKELSEIVGGA 286
>gi|156453121|ref|ZP_02059487.1| ATP synthase F1, gamma subunit [Methylobacterium chloromethanicum CM4] >gi|156187999|gb|EDO20202.1| ATP synthase F1, gamma subunit [Methylobacterium chloromethanicum CM4] (296 aa)
Score = 289, Expect = 2.9e-24, Identities = 82/285 (28%), Positives = 156/285 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSN-----SDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIK------SNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYK-NDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLD-KAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           M SL +++ RI  +++T KIT AM++V++AKL++ +    N   Y ++   +   +  N         +LS    ++   + +      GL G+FN +I +  + H           +I  IGKKG ++++ +  +  I+      +K +++     IA+++LA+++  ++++ ++   YS+F + +S  P+   L+P +    E        + A    +PN   + E++L   L   I  A++E+   E  +R +AMDSAT+NA E+IK   L +NR RQ+ IT+E+ EI+SGA+ 
  S:     1 MPSLKDLRNRITSVKATQKITKAMQMVAAAKLRRAQNAAENGRPYAERMAQVLGNLAGNLIGGVGAPRLLS-GTGQDRVHLLVVCTGDRGLAGAFNSSIARLARDHANRLMADGKTVKIITIGKKGLDVLRRQFRDQIIASRDIRGNKPVDYPFAAEIADDILARFEAGEFDVATL--FYSEFRSVISQIPTAQKLIPAELPTAEGASATGAGSDAAMEFEPNEETILETLLPKNLTVQIFRALLENAASEQGARMSAMDSATRNAGEMIKKQTLIYNRTRQAMITKELIEIISGAEA 295
>gi|50954453|ref|YP_061741.1| F0F1 ATP synthase subunit gamma [Leifsonia xyli subsp. xyli str. CTCB07] >gi|81692685|sp|Q6AG59|ATPG_LEIXX ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|50950935|gb|AAT88636.1| ATP synthase, gamma chain [Leifsonia xyli subsp. xyli str. CTCB07] (299 aa)
Score = 289, Expect = 3.0e-24, Identities = 84/282 (29%), Positives = 161/282 (57%)
  Q:     2 ASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSD-SEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIK----SNDEI--WLIGKKGKNLI--KSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLD--KAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           A L   +++IK    T KIT AM+L+S+++++K++      S Y +      + + + S+   +L+ +  +  + + + F S  GL G+FN N++KE +K  +       E+  +LIG+K +     + +  E   + + +  + +   ++   I E+ L +   D  +  I VIY++FV+ L+  P V  LLP++  + +E+P  D+      +  +P+ N V +S+L  Y+ + I  A+++S   ++A+ + AM +A+ NA++LI +Y    N  RQ+EITQ+I+EIV GA
  S:     3 AQLRVYRQKIKSAHRTKKITRAMELISASRIQKEQARVAASSPYARAITRAVSAVATYSNVGHVLTTEPEKIERAVIVIFSSDRGLAGAFNSNVLKESEKLAELLRSQGKEVVYFLIGRKAQGYFSFRRRAFERVWTGNTDAPEFEQAKEVADAILESFL-RDSADGGVDEIHVIYNRFVSMLTQEPQVVRLLPMEVVEGVEEP--DRTQVLPLYEFEPDVNTVLDSLLPVYIESRIFNAMLQSAASKHAATQKAMKAASDNADKLITDYTRLANNARQAEITQQISEIVGGA 292
>gi|109900594|ref|YP_663849.1| ATP synthase F1, gamma subunit [Pseudoalteromonas atlantica T6c] >gi|123170443|sp|Q15MU3|ATPG_PSEA6 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|109702875|gb|ABG42795.1| ATP synthase F1, gamma subunit [Pseudoalteromonas atlantica T6c] (286 aa)
Score = 289, Expect = 3.1e-24, Identities = 86/283 (30%), Positives = 153/283 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDE------IWLIGKKGKNLIKSKG---IEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MAS  EIK +I  I++T KIT+AM++V+++K+KK ++       Y +   ++  ++  +N +     L+  E  +  ++   +  GLCG  N N  K++ K  K   E         +G K        G   + AE  L      KD+      I    ++    N+  I  + ++++KFVN+++  P +  LLPL K+ +K    +     D+  +P+   + +++L+ Y+ + ++  +VE+   E A+R  AM +AT NA +LI + +L +N+ RQ+ ITQEI+EIVSGA
  S:     1 MASGKEIKGKIGSIKNTQKITSAMEMVAASKMKKAQDRMTASRPYAENIRNVIGHLANANLEYRHPYLEDREVKRVGYIVISTDRGLCGGLNTNEFKKVTKDAKKWQEQGVEVDFAALGSKSCAFFNRFGGNMLAAESGLGDAPSVKDV------IGLVRIMLNAFNEGKIDRLYLVFNKFVNTMAQEPLIDQLLPLPKSEDKALKHR----WDYIYEPDPKPILDTLLVRYIESQVYQGVVENAASEQAARMVAMKAATDNAGDLIDDLQLIYNKARQAAITQEISEIVSGA 283
>gi|89053539|ref|YP_508990.1| F0F1 ATP synthase subunit gamma [Jannaschia sp. CCS1] >gi|122499320|sp|Q28TJ7|ATPG_JANSC ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|88863088|gb|ABD53965.1| ATP synthase F1 gamma subunit [Jannaschia sp. CCS1] (296 aa)
Score = 289, Expect = 3.2e-24, Identities = 86/285 (30%), Positives = 164/285 (57%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKS---NSDSEILSLKKSEEGKTIWLAFFSS-MGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKGIEAEIS-LDLELDDKDINFDLFHIIAENLLAKYKND-YNIKSIKVIYSKFVNSLSFTPSVFSLLP-LDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           M +L ++K RI  ++ST KIT AM++V++AKL++ +E       Y +K   + + + S   NS+     L  + + +   L   ++  GLCG FN  IV++ + H +         +I  +GKKG+  ++    +  I  +DL  D K + +     IA ++L +++ D +++ +I   +++F + +S  P+   ++P + + +E+      ++G  +  +P+   V E +L   +AT I  A++E+   E  +R +AMD+AT+NA ++I    +E+NR RQ+ IT E+ EI+SGA+ 
  S:     1 MPNLKDLKNRIASVKSTRKITKAMQMVAAAKLRRAQEAAEMARPYAEKMEAVMSGLASAVGNSEGAPRLLAGNGKDQVHLLVVMTAERGLCGGFNSTIVRKARVHAQKLLGEGKTIKILTVGKKGREQLRRDYADHLIGHVDLS-DVKRLGYADAASIATDVLNRFEEDEFDVATI--FFNRFESVISQIPTATQIIPAVFEDVEEADDTSKDSGTLYEYEPSEEAVLEDLLPRGIATQIFTALLENGASEQGARMSAMDNATRNAGDMIDRLTIEYNRSRQAVITSELIEIISGAEA 295
>gi|196232470|ref|ZP_03131323.1| ATP synthase F1, gamma subunit [Chthoniobacter flavus Ellin428] >gi|196223542|gb|EDY18059.1| ATP synthase F1, gamma subunit [Chthoniobacter flavus Ellin428] (288 aa)
Score = 288, Expect = 3.3e-24, Identities = 80/281 (28%), Positives = 154/281 (54%)
  Q:     2 ASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKS-NSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDI-NFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPR---LDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSG 282
           A+  +I++RIK +++T++IT AM++V+++K++K ++L ++   Y +    +   +   + D +   L++ E  K + +   +  GLCG+ N N+++E  K           G+K           +  +L  E   KD  +F    +I++  + ++  D ++  + V+ ++FVN+L+  P VF LLP+  +    +     +   G D   +PN+  V +++L  Y    I+ A+VE++  E+++R  AM SAT NA  LIK+  LE+N+ RQ+ IT E+ EI + 
  S:     3 ANTRDIRRRIKSVKNTAQITKAMQMVAASKMRKAQQLAIDGRPYAQLLNKISAAVNEVHGDEKHPLLQQREVKKELVIIISTDKGLCGALNTNLLREAAKFDPEKTLFITGGRKAAQW----AARSRRNLIAEFQLKDTPSFVETKVISKMAIEQFL-DGSVDKVSVLVTRFVNTLTQEPVVFQLLPVSASPSNTKDMEAAREAGGLDVEFEPNSLAVLDALLPYYAHFAIYRAVVEARAAEHSARMVAMKSATDNAKSLIKDLTLEYNKIRQASITTELLEITTA 283
>gi|191638160|ref|YP_001987326.1| ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) [Lactobacillus casei] >gi|190712462|emb|CAQ66468.1| ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) [Lactobacillus casei BL23] (308 aa)
Score = 288, Expect = 3.3e-24, Identities = 94/281 (33%), Positives = 157/281 (55%)
  Q:     3 SLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI------------KSNSDS----EILS----LKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDE------IWLIGKKGKNLIKSKGIEAEISLDLELDDKDIN----FDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           SL +IK++I   + T +IT AM++VS AKL + ++      IY  K   + T++            +S++DS    +++S    L+K    KT +L   S  GL GS+N  ++K + + IK + E      +  IG  G +  K++G      L+L  + + ++    F+    I +  +  + N      + V Y+  VN+L+       +LP+         D      ++ I+P+ + V ES+L  Y  + I GAI+++K  E+A+   AM SAT NAN+LI +   ++NR RQ+ IT EITEIV GA
  S:     4 SLMDIKRKIASTKKTGQITQAMQMVSGAKLSQIEKRAKKYQIYSDKVRQIVTHLAAGQLLELANAAESDTDSGDKSQVISVASLLQKRPVKKTGYLVITSDRGLVGSYNSTVLKAMMQMIKDDHESPDDYVMMAIGGVGADFFKARG------LNLAYEYRGVSDIPTFNEVREIVKTAVTMFDNGV-FDELYVCYNHHVNTLTSAFRAEKMLPISDLDVSEVAD---TNVEYLIEPDLDSVLESVLPQYAESLIFGAIMDAKTAEHAASTTAMRSATDNANDLISHLSTQYNRARQAAITTEITEIVGGA 304
>gi|149186092|ref|ZP_01864406.1| F0F1 ATP synthase subunit gamma [Erythrobacter sp. SD-21] >gi|148830123|gb|EDL48560.1| F0F1 ATP synthase subunit gamma [Erythrobacter sp. SD-21] (290 aa)
Score = 288, Expect = 3.4e-24, Identities = 87/285 (30%), Positives = 158/285 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKS--NSDSEILSLKKSEEGKTIWLAFFSS-MGLCGSFNLNIVKELQKHIK------SNDEIWLIGKKGKNLIKSKGIEAEISLDLELDD-KDINFDLFHIIAENLLAKYKN-DYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           MASL E+K RI  ++ST KIT A ++V++AKL++ +        Y ++   +   + S  + DS    L+ +   K   L   ++  GLCG  N NIVK  +   K       +   +L+GKKG+  IK       I+   +  D ++  F     IA++L+ +++N ++++  +  +Y  F ++L+  P+V  L+P    +  P  +  ++ A    +P   ++ E +L  Y+ T + GA++E +  E  +   AMD+AT+NA +LI +  +++NR RQ+ IT E+ EI++GA+ 
  S:     1 MASLKELKGRINSVKSTQKITKAKQMVAAAKLRRAQAAAEAARPYAERLSGVMASLASKVSGDSAPKLLRGTGADKRHMLVVVNTDKGLCGGLNANIVKAAKAKAKALTAEGKDVSFYLVGKKGRAPIKRDYANC-IAKHFDTSDVRNPGFTEAEAIADDLIERFENGEFDVAHL--VYPIFKSALAQDPTVDQLIP----VPSPTSEGDSSDAVVEYEPGEEEILEDLLPRYVKTQVFGALLEREASEQGASMTAMDNATRNAGDLINDLTIQYNRSRQAAITTELIEIIAGAEA 289
>gi|85060391|ref|YP_456093.1| F0F1 ATP synthase subunit gamma [Sodalis glossinidius str. 'morsitans'] >gi|123518615|sp|Q2NQ87|ATPG_SODGM ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|84780911|dbj|BAE75688.1| ATP synthase gamma subunit [Sodalis glossinidius str. 'morsitans'] (287 aa)
Score = 288, Expect = 3.4e-24, Identities = 80/283 (28%), Positives = 152/283 (53%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIK-SNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  +++T KIT AM++V+++K++K +E   +   Y +    +  ++   N + +   L + +  +  +L   +  GL G  N+N+ K+L   +K         E+ LIG K  +   S G +  ++    + D  +  +L   +   ++ +  ++  +  + ++ +KFVN++S  P +  +LPL  A E    D      D+  +P+   + +++L  Y+ + ++  +VE+   E A+R  AM +AT N   LIK  +L +N+ RQ+ ITQE+TEIVSGA
  S:     1 MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKTQERMASSRPYAETMRKVIGHLALGNLEYKHSYLDERDVKRVGYLVVATDRGLAGGLNINLFKKLLADMKEWNGKGVETELALIGSKAVSFFNSVGSKV-VAQVTGMGDNPMLSELIGPV--KVMLQAYDEGRLDKLYIVSNKFVNTMSQVPQILQILPLPPAEEA---DLKIKSWDYLYEPDPKTLLDTLLRRYVESQVYQGVVENLASEQAARMVAMKAATDNGGSLIKELQLVYNKARQTSITQELTEIVSGA 284
>gi|150005517|ref|YP_001300261.1| F0F1 ATP synthase subunit gamma [Bacteroides vulgatus ATCC 8482] >gi|166222523|sp|A6L4M5|ATPG_BACV8 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|149933941|gb|ABR40639.1| ATP synthase gamma chain [Bacteroides vulgatus ATCC 8482] (289 aa)
Score = 288, Expect = 3.4e-24, Identities = 88/283 (31%), Positives = 157/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFT-YIKSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQ---KHIKS----NDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MASL E+K RI  + +T KIT+AMK+V+SAKL K +    N   Y ++   + T ++ ++S+ E   + K E  +   + F S+  LCG FN NI++ L       KS    N  ++ +G+K    +K  G +AE      + DK  ++     +AE+L+ ++ +  +I  ++++Y+ F ++     +  + LP+D   EK   DK     D+ ++P+ + V   +L   L   +   +++S   E+A+R  AM  AT NAN+L+++  + +N+ RQ  IT E+ +IV G+
  S:     1 MASLKEVKGRIASVNNTRKITSAMKMVASAKLHKAQAAIENMLPYERRLNHILTNFLSADSEVESPFIVKREVKRVAIVVFASNTSLCGGFNANIIRHLTVILDEYKSLGMENVLLYPVGRKVAEGVKKLGFKAEGDFQ-HMADKP-SYQEAAALAEDLMRRFLHR-DIDKVELLYNHFRSTAVQVLTRETYLPIDLTQEKKEEDK-GRIPDYIVEPSVDVVMGELLPKVLRMKMFTVLLDSNASEHAARTMAMQIATDNANDLLQDLTVMYNKSRQQAITNELLDIVGGS 287
>gi|154251917|ref|YP_001412741.1| ATP synthase F1, gamma subunit [Parvibaculum lavamentivorans DS-1] >gi|171769590|sp|A7HT51|ATPG_PARL1 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|154155867|gb|ABS63084.1| ATP synthase F1, gamma subunit [Parvibaculum lavamentivorans DS-1] (294 aa)
Score = 288, Expect = 3.5e-24, Identities = 87/285 (30%), Positives = 161/285 (56%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKK----FYDLFTYIKSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKGIEAEISLDLELDD-KDINFDLFHIIAENLLAKYK-NDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLD-KAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           MASL +++ RI  +++T KIT AM++V++AKL++ +E       Y ++      +L T +   SD+  L      +   + +   +  GLCG FN +IV+  ++HI          +I  +G+KG++ +K +   + I    E    + I F+    I+  ++  ++  ++++ +I   YSKFVN +S  P+   L+P    A     +D    GA +  +P+  ++ + IL   L+  I  A++E+   E  ++ +AMD+AT+NA ++IK   + +NR RQ+ IT+E+ EI+SGA+ 
  S:     1 MASLKDLRNRIASVKATQKITKAMQMVAAAKLRRAQEAAEAARPYAERMDRVLANLATGMTGRSDAPALLAGTGSDQVHLVIVATADRGLCGGFNSSIVRLARQHINKLVGEGKTVKILTVGRKGRDALK-RDHASRIVKSYEFTGIRHIGFEQAEDISRTVIDLFEAGEFDVATI--FYSKFVNVVSQIPTAQQLIPASVPADAGGSVDL--GGAVYEYEPDEGEILKDILPRNLSVQIFRALLENVAGEFGAKMSAMDNATRNAGDMIKKLNITYNRSRQAMITKELIEIISGAEA 293
>gi|163869186|ref|YP_001610438.1| F0F1 ATP synthase subunit gamma [Bartonella tribocorum CIP 105476] >gi|189081389|sp|A9IYW8|ATPG_BART1 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|161018885|emb|CAK02443.1| ATP synthase gamma chain [Bartonella tribocorum CIP 105476] (308 aa)
Score = 288, Expect = 3.6e-24, Identities = 80/285 (28%), Positives = 163/285 (57%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSD---SEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKGIEAEISLDLELDD-KDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPL--------------DKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           MASL +++ RI  +++T KIT AM++V++A+L + +E   +   Y K+  D+ T + ++ D   +  L      +   + +   +  GLCG+FN+ I +  ++ IK+        +I  +GKKG +++ S+  ++ +   ++L   K I F    +I++ ++  + N+       + YS+FV+ ++  P+ F L+P+               K   K      +    +  +P+A  + E+++   L+  I  A++E+   E  ++  AMD+A++NA E+I    + +NR+RQ++IT E+ EI++GA+ 
  S:     1 MASLKDLRDRIASVKATQKITKAMQMVAAARLHRAQEAAQSARPYAKRMADILTSVAADVDGVDAPALMRGTGRDDVHLLVVCTAERGLCGAFNVQIARRAREQIKALLAAGKIVKIITVGKKGADIL-SRDYKSLMIDHIDLHAVKRIGFAEALVISQRIVDLF-NEGAFDVCTLFYSEFVSVINQRPTAFGLIPMGAPKAAVEATDVVEQKETSKDSQSIVHEAIVYEYEPDAASLLEALVPRNLSVQIFRALLENVAGEMGAKMTAMDNASRNAGEMINKLTVAYNRQRQAQITTELIEIIAGAEA 307
>gi|94263073|ref|ZP_01286892.1| Sodium-transporting two-sector ATPase [delta proteobacterium MLMS-1] >gi|93456616|gb|EAT06724.1| Sodium-transporting two-sector ATPase [delta proteobacterium MLMS-1] (292 aa)
Score = 288, Expect = 3.7e-24, Identities = 82/285 (28%), Positives = 152/285 (53%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEGKTIWLAFFSS-MGLCGSFNLNIVKELQKHIKSNDE------IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHI--IAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDK-AIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           M SL ++K +I  ++ T++IT AM +V+++KL+  +    N   Y ++F+     +  N+      L +  E KT+ L   +S  GLCGSFN +I++   + I +++       +  +GKK +N  +  G      +  E  D    F +F+   IA++L A +        ++VIY +F +  S  P   ++LP+   A E        + A +  +P+  ++ + +   YL   ++ +++E    E+A+R  AMD+AT+  N++I N  L +N+ RQ+ IT E+ +IV GA+ 
  S:     1 MPSLKDVKSKIGGVKKTAQITRAMNMVAASKLRGAQSRMENFRPYAEQFHAAMAGLSRNTGGGNFPLMEVREVKTLELLVVTSDRGLCGSFNAHILRMADRAIAASESEGKKVSLVCVGKKARNYYRRTG-----KMRKEYTDLMGTFQMFNARAIAQDLAANFLAG-EADEVQVIYGRFHSVASQKPEQTTILPIKPVADEAGEASATASHAVYIYEPSQEEIMQVLQPMYLNVMVYHSMLEVSASEHAARMTAMDNATRACNDMIDNLTLVYNKTRQAGITGELMDIVGGAEA 289
>gi|86610099|ref|YP_478861.1| F0F1 ATP synthase subunit gamma [Synechococcus sp. JA-2-3B'a(2-13)] >gi|123500933|sp|Q2JIG1|ATPG_SYNJB ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|86558641|gb|ABD03598.1| ATP synthase F1, gamma subunit [Synechococcus sp. JA-2-3B'a(2-13)] (314 aa)
Score = 288, Expect = 3.7e-24, Identities = 89/285 (31%), Positives = 165/285 (57%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSN---SDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDE------IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAE------NLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNN--------GADFSIQ----------PNANDVFE--------SILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           MA+L  I+ RIK +++T KIT AM+LV++A++++ +E  +    +  +   +F  +++     D  +  LK+        L      GLCG++N N++K  ++ ++   E      ++L+G+K     + +   A I+         +N       AE       LLA + ++  +  ++++Y++FV+ +S  P V SLLPLD +    RL   ++        G +F+++          P  + +FE        ++L  YL   +  A+ E+   E A+R  AM++A+ NA+ELI+   L +N+ RQ+ ITQEI E+V+GA+ 
  S:     1 MANLKRIRDRIKAVKNTRKITEAMRLVAAARVRRAQEQVMATRPFADRLAQVFYRLQTRLRLEDVNLPLLKQRPIQTVGLLVVAGDRGLCGAYNANVIKRTEERVRELQETGQQVQLYLVGRKAVQYFQRR--SAPIA------KTYVNLSQIPTAAEAAQIGDQLLAAFLSE-KVDKVELLYTRFVSLISSRPVVQSLLPLDPS----RLATQDDEIFRLLVRGGEFTVERSKVIAAVSAPPQDMIFEQDPVQILDALLPLYLNNQLLRALQEAAASELAARMTAMNNASDNASELIRTLGLAYNKARQAAITQEILEVVAGAEA 313
>gi|188580723|ref|YP_001924168.1| ATP synthase F1, gamma subunit [Methylobacterium populi BJ001] >gi|179344221|gb|ACB79633.1| ATP synthase F1, gamma subunit [Methylobacterium populi BJ001] (295 aa)
Score = 288, Expect = 3.8e-24, Identities = 82/285 (28%), Positives = 158/285 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSN-----SDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIK------SNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYK-NDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGAD----FSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           M SL +++ RI  +++T KIT AM++V++AKL++ +    N   Y +K   +   +  N         +LS    ++   + +      GL G+FN +I +  + H           +I  +GKKG ++++ +  +  I+      +K +++     IA+++LA+++  ++++ ++   YS+F + +S  P+   ++P     E P+ D    GA        +P+   + E++L   L   +  A++E+   E  +R +AMDSAT+NA E+IK   L +NR RQ+ IT+E+ EI+SGA+ 
  S:     1 MPSLKDLRNRITSVKATQKITKAMQMVAAAKLRRAQNAAENGRPYAEKMASVLANLAGNLIGGVGAPRLLS-GTGQDRVHLLVVCTGDRGLAGAFNSSIARLARDHANRLMAEGKTVKIMTVGKKGLDVLRRQFRDQIIASRDIRGNKPVDYPFAAEIADDILARFEAGEFDVATL--FYSEFRSVISQIPTAQKIIP----AELPQTDGAAKGAGSDAAMEFEPSEETILETLLPKNLTVQVFRALLENAASEQGARMSAMDSATRNAGEMIKKQTLIYNRTRQAMITKELIEIISGAEA 294
>gi|152998458|ref|YP_001343293.1| ATP synthase F1, gamma subunit [Marinomonas sp. MWYL1] >gi|189081460|sp|A6W3S9|ATPG_MARMS ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|150839382|gb|ABR73358.1| ATP synthase F1, gamma subunit [Marinomonas sp. MWYL1] (286 aa)
Score = 288, Expect = 3.9e-24, Identities = 87/283 (30%), Positives = 154/283 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  I +T KIT AM+ V+++K +K ++       Y ++   +  ++  +N + +   L + E  +  ++   S  GLCG  N+N+ K+  + +K         +I  IG K  +  ++ G     +    L D     DL   +   L A   ++  I  + V+ ++FVN+++  P+V  LLPL KA E   L    +  D+  +P A ++ + +L+ Y+ + ++ ++VE+  CE A+R  AM +AT NA ++I   +L +N+ RQ+ ITQEI+EIVSGA
  S:     1 MAVGKEIRTQISSINNTRKITRAMEKVAASKTRKAQDRMAASRPYAERIRQVVGHLANANPEYKHRYLTEREAKRVGYIVISSDRGLCGGLNVNVFKKAIRDMKQFADTGVEIDICAIGSKAVSFFRNYGGNVTAA-HTGLGDAPKADDLVGSVKVMLDAF--DEGRIDRLYVVSNEFVNTMTQNPTVEQLLPL-KAEENTEL---KHHWDYIYEPEAVEILDELLVRYIESQVYQSVVENIACEQAARMLAMKNATDNAGDIIDELQLVYNKARQAAITQEISEIVSGA 283
>gi|39995223|ref|NP_951174.1| F0F1 ATP synthase subunit gamma [Geobacter sulfurreducens PCA] >gi|81703672|sp|Q74GY1|ATPG_GEOSL ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|39981985|gb|AAR33447.1| ATP synthase F1, gamma subunit [Geobacter sulfurreducens PCA] (287 aa)
Score = 288, Expect = 4.0e-24, Identities = 84/284 (29%), Positives = 156/284 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSND------EIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKY-KNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAK 284
           MASL  IKKRI  +++T +IT AMK+VS+AKL++ +E  +    Y KK  ++   + KS  +S    +++    K + +   S  GLCG FN NI K  ++ IK          +  +G+KG   +K++    +I  +      ++++    ++A+ ++  Y   +Y+   + ++++ F + +S   ++  LLP+           P    ++  +P+  ++   +L  ++   +  A++ES   E+ +R  AMDSA+KNA E+I    L++NR RQ+ IT E+ EI+SGA+
  S:     1 MASLKSIKKRIVSVKNTRQITKAMKMVSAAKLRRAQENVVAARPYAKKLGEVLQRLAKSQDESGSPLMQQRLSQKALLIVVTSDRGLCGGFNANICKAAERFIKEKKAEFAEISVTTVGRKGYEFLKNR---QKIHKNYGNVLANLSYPAAALLAQEMIEGYIAEEYD--EVYILFNAFKSVMSQDITLEKLLPIAPEAASTEEYAP----EYIYEPSKGELLAELLPKHIEVQVFKALLESVASEHGARMTAMDSASKNATEMIGKLTLQYNRARQAAITTELMEIISGAE 283
>gi|728932|sp|P41169|ATPG_THIFE ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|154673|gb|AAA53126.1| F1F0-ATPase gamma-subunit (298 aa)
Score = 288, Expect = 4.0e-24, Identities = 78/283 (27%), Positives = 155/283 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDE------IWLIGKKGKNLIKSKGIEAEISLDLE-LDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGA--DFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA+  EI+ +IK +++T KIT AM++V+++K+++ +E         +K  ++  ++ +++ + E   ++     K  +L   +  GLCG  N+N+++ + + ++   E      + ++G KG   ++  G  A +  D+  L D     D+   I     A  K + ++  + ++ S+FVN++    +V  LLP    +EKP           D+  +P A  V + ++  Y+ + ++ A++E   CE ++R  AM SA+ NA  ++ + +L +N+ RQ+ ITQEI EI +GA
  S:     1 MANAKEIRGQIKSVKNTRKITRAMEMVAASKMRRAQERMRAARPCAEKIREVLGHLAQAHPEYEHPLMQVRPVKKAGFLVVTTDRGLCGGLNVNVLRNVVQKMRELHEEGVESNLAVVGNKGLGFLRRHG--AHLVADVNGLGDSPHLGDMIGPIRAMADAYAKGEVDV--VYLVSSRFVNTMLQRATVEQLLP----VEKPTASAEQRAELWDYIYEPEARPVLDRLMQRYVESVVYQAVIEHLACEQSARMVAMKSASDNAKRMVDDLQLAYNKARQAAITQEIAEISAGA 285
>gi|148260677|ref|YP_001234804.1| ATP synthase F1, gamma subunit [Acidiphilium cryptum JF-5] >gi|166222512|sp|A5FZ53|ATPG_ACICJ ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|146402358|gb|ABQ30885.1| ATP synthase F1, gamma subunit [Acidiphilium cryptum JF-5] (296 aa)
Score = 288, Expect = 4.0e-24, Identities = 86/285 (30%), Positives = 150/285 (52%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKS----NSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNI-------VKELQKHIKSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDK---AIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           MASL  ++ RI  ++ST KIT AMK+V++AKL++ +        Y  +   +   +      N ++  L +    +   + +   +  GL G FN +I        ++L+   K    ++ +G+KG++  +    E  I     +  K I F     IA  ++A + ND       +++++FV+ +S  PS   L+P      A +    D+P    D+ I+P+   + + +L   LA  I+ A++ES   E  +R  AMD+AT+NA E+I    L +NR RQ+ IT+E+ EI+SGA+ 
  S:     1 MASLKALRNRIASVKSTQKITKAMKMVAAAKLRRAQAQAEAARPYATRMAAMMGALAEGAAENPNAPALLVGNGADRTHLIVVVSADRGLAGPFNASINRAARARARKLEAEGKQV-RLFTVGRKGRDFFRRDMREKIIGEANFVGKKTIEFADAEAIANQIIAAF-NDGKFDVCTLMFNRFVSVMSQVPSETPLIPASAGQAANDNAGSDQP--AGDYEIEPDDGTLLDRLLPRNLAVQIYSALLESAAGEQGARMTAMDNATRNAGEMINRLTLNYNRTRQANITKELIEIISGAEA 295
>gi|15603358|ref|NP_246432.1| F0F1 ATP synthase subunit gamma [Pasteurella multocida subsp. multocida str. Pm70] >gi|13431312|sp|Q9L6B6|ATPG_PASMU ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|7716505|gb|AAF68408.1|AF237922_1 ATP synthase F1 gamma chain [Pasteurella multocida] >gi|12721877|gb|AAK03577.1| AtpG [Pasteurella multocida subsp. multocida str. Pm70] (289 aa)
Score = 288, Expect = 4.1e-24, Identities = 84/283 (29%), Positives = 155/283 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEGKTIWLAFFSS-MGLCGSFNLNIVKELQKHIKSNDE------IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  ++ST KIT AM++V+++K++K +E   +   Y +   ++ +++   +           E K + +   S+  GLCG  N+N+ K +   +K   E      + LIG K  N  +S GI+  ++ D  + D      L   +   + A  K + ++  + ++Y+KF+N++S  P +  L+PL + ++   L +     D+  +P+A  + +++L+ YL + ++ A VE+   E A+R  AM +AT NA  LI   +L +N+ RQ+ IT E+ EIV+GA
  S:     1 MAGAKEIRTKIASVKSTQKITKAMEMVAASKMRKTQERMSSSRPYSETIRNVISHVSKATIGYKHPFLVDREVKKVGMIVVSTDRGLCGGLNVNLFKTVLNEMKEWKEKDVSVQLSLIGSKSINFFQSLGIKI-LTQDSGIGDTPSVEQLIGSVNSMIDAYKKGEVDV--VYLVYNKFINTMSQKPVLEKLIPLPE-LDNDELGERKQVWDYIYEPDAKVLLDNLLVRYLESQVYQAAVENLASEQAARMVAMKAATDNAGNLINELQLVYNKARQASITNELNEIVAGA 286
>gi|194333107|ref|YP_002014967.1| ATP synthase F1, gamma subunit [Prosthecochloris aestuarii DSM 271] >gi|194310925|gb|ACF45320.1| ATP synthase F1, gamma subunit [Prosthecochloris aestuarii DSM 271] (292 aa)
Score = 288, Expect = 4.2e-24, Identities = 85/285 (29%), Positives = 154/285 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSL--KKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQK---------HIKSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           MA+L +I+ RIK ++ST ++T AMK+V++AKL++ +E  +    Y  K  ++   + +  D+ +  +   + E G+ + +   S  GLCG+FN NI+K  QK         H     ++   G KG +  + +  +  I        ++++F +   IAE     Y     +  + V+Y++F + L+       LLP+      P       G+D+  +P+   + + ++  +L T +   ++ES   E A+R  AMDSAT+NA EL++   + +NR RQ+ IT E++EIV+GA+ 
  S:     1 MATLKDIRTRIKGVKSTQQVTKAMKMVAAAKLRRAQESAVQARPYAAKLKEMLGSLSTKVDTSLNPMLSARDEVGRVLVVLITSDRGLCGAFNTNIIKVAQKVMTVDHADLHKSGKVDLICAGSKGYDFFRKR--DYRILKGYPGVFQNLDFSVAKEIAEQASGMYLRG-EVDKVVVVYNEFKSVLAPNLKSEVLLPI-----TPEGSGDEGGSDYIYEPSPASIIDVLVPKHLNTQVWRMMLESNAAEQAARMAAMDSATENAKELLRLLNISYNRARQAAITTELSEIVAGAEA 288
>gi|118594198|ref|ZP_01551545.1| F0F1 ATP synthase subunit gamma [Methylophilales bacterium HTCC2181] >gi|118439976|gb|EAV46603.1| F0F1 ATP synthase subunit gamma [Methylophilales bacterium HTCC2181] (288 aa)
Score = 287, Expect = 4.4e-24, Identities = 87/283 (30%), Positives = 160/283 (56%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILS--LKKSEEGKTIWLAFFSS-MGLCGSFNLNIVKELQKHIKSND------EIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +IK +E+T KIT AM++V+++K++K +E   +   Y +K   +  ++ S++ SE     L   ++ K+I L   +S  GLCG  N N+++     +K+ +      ++  IG KG   +   G   + ++    D  +++  L  I  + +L  Y     I  + + Y+KF+N++   P +  +LPL    +  +L  P++  D+  +P++  V + +L  Y+ + I+ A+ E+   E ++R  AM SA+ NAN +I + KL +N+ RQ+ IT+EI+EIV GA
  S:     1 MAGSKEIRTKIKSVENTRKITKAMEMVAASKMRKAQERMSSARPYAEKIRQIAAHL-SHAQSEYRHPFLVSRDQVKSIGLIVVTSDKGLCGGLNTNVLRASITQMKTWEKEGKKIQVSTIGNKGLGFMTRMGANLKSNIAGLGDQPELDSLLGSI--KVMLDAYVAG-EIDQLFICYTKFINTMKQEPIMDQVLPL----KGEKLGSPDSSWDYLYEPDSKTVIDELLSRYIESYIYHAVTENMASEQSARMVAMKSASDNANTVIDDLKLVYNKARQAAITKEISEIVGGA 284
>gi|71082936|ref|YP_265655.1| F0F1 ATP synthase subunit gamma [Candidatus Pelagibacter ubique HTCC1062] >gi|82592646|sp|Q4FP37|ATPG_PELUB ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|71062049|gb|AAZ21052.1| H+-transporting two-sector ATPase (F0F1-type ATP synthase) gamma chain [Candidatus Pelagibacter ubique HTCC1062] (291 aa)
Score = 287, Expect = 4.4e-24, Identities = 91/284 (32%), Positives = 164/284 (57%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSN-SDSE---ILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHI-KSNDE-----IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKY-KNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAK 284
           MA+L+++KKRI  ++ST KIT AMK+V++AKL++ +E       Y +K  ++   + S  SD E    L     E+   + +   S  GLCG FN NI+K+ + +  K +DE     I  +G KG + +K    +A +      D K IN+     + + ++  + K ++++ +I   Y+KF N ++  P    ++PL  +  +    + N    +  +P+ +++  ++L   ++T I  A++E+   E  SR +AMD+AT+NA E++    +E+NR RQ+ IT+E+ EI+SGA+
  S:     1 MATLDDLKKRIASVKSTQKITKAMKMVAAAKLRRAQENAEKGRPYSEKMNNIILNLSSGISDKENAPKLLSGTGEDKVHLCIVLTSDRGLCGGFNTNIIKKAKTYFQKISDEGKTLKIITVGSKGYDQLKRVYKDAIVERISFKDSKTINYLDAEKVGKMIIENFEKEEFDVCTI--FYNKFKNVITQIPQEQQIIPLKTSEAEENSSEDN----YEFEPDEDEILSNLLPKNISTQIFKAMLENSASEQGSRMSAMDNATRNAGEMVDKLTIEYNRSRQAAITKELIEIISGAE 289
>gi|196249753|ref|ZP_03148449.1| ATP synthase F1, gamma subunit [Geobacillus sp. G11MC16] >gi|196210629|gb|EDY05392.1| ATP synthase F1, gamma subunit [Geobacillus sp. G11MC16] (285 aa)
Score = 287, Expect = 4.4e-24, Identities = 89/283 (31%), Positives = 155/283 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEE-GKTIWLAFFSSMGLCGSFNLNIVKELQKHIK----SNDE--IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPL-DKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MASL +IK RI   + TS+IT AM++VS++KL + ++   +   Y +K  ++   +   +      +  S    KT +L   S  GL G++N N+++ + + I+    S DE  I +IG+ G N  + + +   + LD+       +F     IA   +  +  D     + + Y+ +V+++    +   LLPL D A  + R         +  +P+  ++ + +L  Y  + I+GA++++K  E+A+R  AM +AT NA+ELI+   L +NR RQ+ ITQEITEIV+GA
  S:     1 MASLRDIKTRINSTKKTSQITKAMEMVSTSKLNRAEQNAKSFVPYMEKMQEVVANVALGAGGASHPMLISRPVKKTGYLVITSDRGLAGAYNSNVLRTVYQTIQARHSSPDEYAIIVIGRVGLNFFRKRNMP--VILDITRLPDQPSFADIKEIANKAVGLFA-DGTFDELYMYYNHYVSAIQQDVTERKLLPLTDLADNQQR-------TMYEFEPSQEEILDVLLPQYAESLIYGALLDAKASEHAARMTAMKNATDNAHELIRTLTLSYNRARQASITQEITEIVAGA 281
>gi|116333889|ref|YP_795416.1| F0F1-type ATP synthase, gamma subunit [Lactobacillus brevis ATCC 367] >gi|122269424|sp|Q03QY7|ATPG_LACBA ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|116099236|gb|ABJ64385.1| F0F1-type ATP synthase, gamma subunit [Lactobacillus brevis ATCC 367] (299 aa)
Score = 287, Expect = 4.8e-24, Identities = 84/283 (29%), Positives = 149/283 (52%)
  Q:     3 SLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKS-----NSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDE------IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGA----DFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           S++++++RI   ++T +IT+AM +VS+AKL K ++  +    Y  K   +  ++       NS S + S +  +  KT +L   S  G+ GS+N +++++    IK          +  +G  G +  K +G+          D  +  F+    I + +   + N+     + V Y+ FVN +S       +LP+DK        K    A    ++  +P+  +V + +L  Y  + ++GAI+++K  E+AS  NAM SAT NA++LI   +L +NR RQ+ IT EITEI  G + 
  S:     4 SIHDVQRRINSTKATRQITSAMHMVSTAKLNKIQKQAVGYQDYVSKVKAVVMHLSQSHLLDNSSSSLQSNRPVK--KTAYLVITSDRGMVGSYNSSVLRDTNAFIKERTPNPDDYMVLAVGGTGADFYKHRGVNVAYEYRGVSDVPE--FNEVREIVKTVTTMFNNEV-FDELFVCYNHFVNRISSRFRAEKMLPVDKETMSTDAAKDTQAAPLTAEYDTEPSEEEVLQVVLPQYAESLVYGAILDAKTAEHASSTNAMQSATDNADDLIATLQLHYNRARQAAITTEITEITGGQEA 296
>gi|171323835|ref|ZP_02912353.1| ATP synthase F1, gamma subunit [Geobacillus sp. WCH70] >gi|171090146|gb|EDT36458.1| ATP synthase F1, gamma subunit [Geobacillus sp. WCH70] (285 aa)
Score = 287, Expect = 4.8e-24, Identities = 89/283 (31%), Positives = 155/283 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIK---SNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKE----LQKHIKSNDE--IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MASL +IKKRI   + TS+IT AM++VS++KL + +    +   Y  K  ++   I     N+   +L  +  +  KT +L   S  GL G++N N+++     +Q+  +S DE  I +IG+ G +  K +     +++   L D+    D+  I   N       D     + + Y+ +V+++    +   LLPL   ++  +         +  +P+  ++ + +L  Y  + I+GA++++K  E+A+R  AM +AT NA+ELI+   L +NR RQ+ ITQEITEIV+GA
  S:     1 MASLRDIKKRINATKKTSQITKAMEMVSASKLNRAEMNAKSFVPYMDKMQEVVANIALGAGNATHPMLVTRPVK--KTGYLVITSDRGLAGAYNSNVLRTVYQTIQQRHQSPDEYAIIVIGRVGLSFFKKRNFPVILNIT-GLPDQPSFADIKEI--ANKAVGLFADGTFDELYMYYNHYVSAIQQEVTERKLLPLTDLVDNKQR------TTYEFEPSQEEILDVLLPQYAESLIYGALLDAKASEHAARMTAMKNATDNAHELIRTLTLSYNRARQAAITQEITEIVAGA 281
>gi|91762640|ref|ZP_01264605.1| ATP synthase subunit C [Candidatus Pelagibacter ubique HTCC1002] >gi|91718442|gb|EAS85092.1| ATP synthase subunit C [Candidatus Pelagibacter ubique HTCC1002] (291 aa)
Score = 287, Expect = 4.9e-24, Identities = 91/284 (32%), Positives = 164/284 (57%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSN-SDSE---ILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHI-KSNDE-----IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKY-KNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAK 284
           MA+L+++KKRI  ++ST KIT AMK+V++AKL++ +E       Y +K  ++   + S  SD E    L     E+   + +   S  GLCG FN NI+K+ + +  K +DE     I  +G KG + +K    +A +      D K IN+     + + ++  + K ++++ +I   Y+KF N ++  P    ++PL  +  +    + N    +  +P+ +++  ++L   ++T I  A++E+   E  SR +AMD+AT+NA E++    +E+NR RQ+ IT+E+ EI+SGA+
  S:     1 MATLDDLKKRIASVKSTQKITKAMKMVAAAKLRRAQENAEKGRPYSEKMNNIILNLSSGISDKENAPKLLSGTGEDKVHLCIVLTSDRGLCGGFNTNIIKKAKTYFQKISDEGKILKIITVGSKGYDQLKRVYKDAIVERISFKDSKTINYLDAEKVGKMIIENFEKEEFDVCTI--FYNKFKNVITQIPQEQQIIPLKTSEAEENSSEDN----YEFEPDEDEILSNLLPKNISTQIFKAMLENSASEQGSRMSAMDNATRNAGEMVDKLTIEYNRSRQAAITKELIEIISGAE 289
>gi|118579929|ref|YP_901179.1| F0F1 ATP synthase subunit gamma [Pelobacter propionicus DSM 2379] >gi|118502639|gb|ABK99121.1| ATP synthase F1, gamma subunit [Pelobacter propionicus DSM 2379] (288 aa)
Score = 287, Expect = 5.0e-24, Identities = 82/284 (28%), Positives = 160/284 (56%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEGKTIWLAFFSS-MGLCGSFNLNIVKELQKHIKSNDE------IWLIGKKGKNLIKSKGIEAEISLDLELDDKDI----NFDLFHIIAENLLAKY-KNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAK 284
           MASL  IKKRI  +++T +IT AMK+VS+AKL++ +E  +    Y  K   + T +  +   +   L K  E K + L   ++  GLCG+FN N+ K  ++ ++ N +      +  +G+KG    K++        D+  +  DI     +    ++A++++  + + +Y+   ++++Y+ F + ++   +   LLP+     +   D  ++ +++  +P+  ++   +L   +   +  +++ES   E+ +R  AMDSATKNA E+I    L++NR RQ+ IT E+ EI+SG++
  S:     1 MASLKSIKKRIVSVKNTYQITKAMKMVSAAKLRRAQENVVAARPYATKLNQVLTSLAGSLHDDPHPLLKQREAKNLLLVVITADRGLCGAFNSNLCKAGERFLQENGDEYERIHVLTVGRKGYEYFKNR-------CDIYKNYVDIIAKPTYGGVALLAQDVIDGFLEQEYD--RVELLYNSFRSVMTQDITFQQLLPV---ATESVCDPDDSCSEYIYEPSQKELLSEVLPKNIEVQLFRSVLESVAGEHGARMTAMDSATKNATEMIGKLTLQYNRARQAAITTELMEIISGSE 284
>gi|56461720|ref|YP_157001.1| F0F1-type ATP synthase, gamma subunit [Idiomarina loihiensis L2TR] >gi|81678429|sp|Q5QZI5|ATPG_IDILO ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|56180730|gb|AAV83452.1| F0F1-type ATP synthase, gamma subunit [Idiomarina loihiensis L2TR] (287 aa)
Score = 287, Expect = 5.5e-24, Identities = 86/285 (30%), Positives = 157/285 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHI---KSND---EIWLIGKKGKNLIKSKG-IEAEISLDLELDDKDINFDLFHIIAE-NLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           MAS  EIK +I  I +T KIT+AM++V+++K+KK +E       Y      +  ++ + N +     +++ +  +  ++   +  GLCG  N N  K++ KH    K  D   +   IG KG +  K  G ++A++S    + DK    +L  I     ++     +  I  + V+++KFVN+++  P++  LLPL +A  +   D      D+  +PN   + ++++  ++   ++  +V++   E A+R  AM +AT NA ++I   +L +N+ RQ+ ITQEI+EIVSGA+ 
  S:     1 MASGKEIKTQISSIGNTQKITSAMEMVAASKMKKAQERMEASRPYADTIRKVIGHVARGNLEYRHPFMEERQVKRVGYIIVSTDRGLCGGLNGNEFKKVVKHANEWKEQDVEADFAAIGSKGTSFFKRFGKLKAQVS---GMGDKP---ELKEITGSIQVMLDAFEEGKIDRLYVVFNKFVNTMTQEPTIHQLLPLPQAGSEE--DVQTGSWDYLYEPNPESILDTLIRRFVEMQVYQGVVDNFASEQAARMIAMKAATDNAEDIIDQLQLRYNKARQAAITQEISEIVSGAEA 286
>gi|88804488|ref|ZP_01120008.1| ATP synthase F1, gamma subunit [Robiginitalea biformata HTCC2501] >gi|88785367|gb|EAR16536.1| ATP synthase F1, gamma subunit [Robiginitalea biformata HTCC2501] (286 aa)
Score = 286, Expect = 5.6e-24, Identities = 91/285 (31%), Positives = 149/285 (52%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILS--LKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIK-----SNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           MA+L EI+ RI  + ST +IT+AMK+VS+AKLKK ++       Y  K  +L   + +N D +  S      E  + + ++  S+ GLCG+FN NI+K+    ++        +   IGKK  +LI+ +     I  D      ++ F+    IAE L+  +  +     I ++Y++F N+ +        LP+     +P   + +  AD+  +P+  ++ E ++   L T +  AI +S   E+ +R  AM  AT NA EL    KL +N+ RQ+ IT EI EIV GA+ 
  S:     1 MANLKEIRNRITSVSSTMQITSAMKMVSAAKLKKAQDAITAMRPYADKLTELLQGLSANLDGDSGSQYADVREVRRVLVVSISSNRGLCGAFNSNIIKQSMSLVQGTYGDKQVDFLTIGKKAHDLIRKR---HTIISDHSAVYDNLTFEAVEAIAEELMQLFA-EGKYDRIDLVYNQFKNAATQIVRTEQFLPI-----QPAETESSVSADYIFEPSEAEIVEQLIPKSLKTQLFKAIRDSFASEHGARMTAMHKATDNAAELRDQLKLTYNKARQAAITNEILEIVGGAEA 283
>gi|168185931|ref|ZP_02620566.1| ATP synthase F1, gamma subunit [Clostridium botulinum C str. Eklund] >gi|169295937|gb|EDS78070.1| ATP synthase F1, gamma subunit [Clostridium botulinum C str. Eklund] (285 aa)
Score = 286, Expect = 5.7e-24, Identities = 97/285 (34%), Positives = 154/285 (54%)
  Q:     2 ASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEI-LSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHI---KSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKGE 286
           A L  IK+RIK I +T KIT A+ LV+++KL+K ++     + YY    ++   I ++ + E  +  K +   K +++   S  GLCG FN N++ +  + I   + N  +  +GKKG+  +K   I++ I+  +E+ +          I E  L  Y N   I  I V+Y+ FV+S+     V  LLP+    +   L   N+  +F  +P+ N V E I   YL   +   ++ SK  E ++R  AMD AT NAN+L+    L++NR RQS ITQEI+EIV GA+ +
  S:     4 AGLIAIKRRIKSINNTKKITKAIGLVATSKLRKARQKLELNNTYYSSVSEIMNGILADKNLEKGVYFKDNGVNKKLYIVITSDSGLCGGFNGNVISKTLETISGDRENSVLITVGKKGRTYLKKFKIDS-IAEFVEIPEIP-TLKEVKAILEKALNLYLNK-EISEINVVYTDFVSSVKQESKVKKLLPITMEEDNKEL---NSFVEF--EPDKNIVLEGISELYLKQTLLNLMLNSKTSEESARMTAMDGATSNANDLLDKLNLKYNRIRQSSITQEISEIVGGAQAQ 284
>gi|192359948|ref|YP_001984261.1| ATP synthase F1, gamma subunit [Cellvibrio japonicus Ueda107] >gi|190686113|gb|ACE83791.1| ATP synthase F1, gamma subunit [Cellvibrio japonicus Ueda107] (287 aa)
Score = 286, Expect = 5.9e-24, Identities = 87/283 (30%), Positives = 153/283 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEGKTI-WLAFFSSMGLCGSFNLNIVKELQKHIKSNDEIW----------LIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  ++ST KIT+AM++V+++K+++ ++       Y  +   +  ++ + S        K  E K + ++   S  GLCG  N+N  K   K +K    +W          +IG K     K+ G    I+   ++ +     DL  I +  ++     +  I  + ++ ++FVN+++  P+V  LLPL  A E  +L    +  D+  +P+A  + + +L  Y+ + ++ A+VE+  CE A+R  AM +AT NA ELI   KL +N+ RQ+ ITQE++EIV GA
  S:     1 MAGTKEIRTQISSVKSTQKITSAMEMVAASKMRRAQDRMQLGKPYATRIRAVIGHLANASAEYKHRFMKEREVKRVGYILVSSDRGLCGGLNINAFKTAIKSMK----VWADQGIAIDLCIIGAKAAQFFKTYGGNV-IASTRDIGEAPELADL--IGSVKVMLDAFEEGKIDKLFLVSNEFVNTMTQKPNVHQLLPL-VAEETTKL---KHHWDYIYEPDAEALLKGLLTRYIESQVYQAVVENAACEQAARMIAMKNATDNAGELIDTLKLIYNKARQAAITQELSEIVGGA 283
>gi|85858476|ref|YP_460678.1| ATP synthase gamma chain [Syntrophus aciditrophicus SB] >gi|123515869|sp|Q2LQZ6|ATPG_SYNAS ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|85721567|gb|ABC76510.1| ATP synthase gamma chain [Syntrophus aciditrophicus SB] (291 aa)
Score = 286, Expect = 6.0e-24, Identities = 81/285 (28%), Positives = 153/285 (53%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEGKTIWLAFFSS-MGLCGSFNLNIVKELQKHIKSND------EIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           MA+L +IK+++  +E T +IT AM +V+++K +  +    +   Y  KF ++ + +      +   L  + E K I +   SS  GLCG FN +++K  ++ ++         ++  IG+K +   K K   A +S   ++  K  +  L   IAE+++  + N+     + +IY++F+N     P+V  LLPL    +   ++      D++ +P+  ++   +L  Y+   I  A++E+   EN +R  AMD+AT+N +E+I    L++N+ RQS IT E+ +IV G + 
  S:     1 MAALKDIKRKVAAVEKTKQITRAMNMVAASKFRTSQTRMESFRPYAMKFMEVLSSLAVRVSPDAHPLLAAREAKRIRVVSMSSDRGLCGGFNSSLIKSTERFVREKIAEGLEVDLTPIGRKVREYFKRK--YALVSDRADVMSK-FDMTLAVEIAEDVIDPFVNE-EYDELYLIYNEFINVSMQRPAVVRLLPLPSVGQDAEIEAEKR-IDYNYEPSDEELIGKLLPMYIHVLIFRALLETSAGENGARMAAMDNATRNCDEMISTLTLQYNKVRQSAITAELMDIVGGTEA 287
>gi|116618946|ref|YP_819317.1| F0F1-type ATP synthase, gamma subunit [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|122270854|sp|Q03V28|ATPG_LEUMM ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|116097793|gb|ABJ62944.1| F0F1-type ATP synthase, gamma subunit [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (302 aa)
Score = 286, Expect = 6.0e-24, Identities = 89/282 (31%), Positives = 152/282 (53%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKS-----NSDSEILSL-KKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIK------SNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLD----KAIEKPRLDKP--NNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSG 282
           MASL +I++RI   + T +IT+AM++VS+AKL + ++       Y  +   +  ++ S     N+D++ + L  +    KT  L   S  GL GS+N N++K+    ++      SN  I  +G  G +  K +G E  + L+         F+    + + + + Y+N+    ++ V+Y+ FVN L+       LLPL      A+      K   N  A + I+P+   V   +L  +  + ++ A++++K  E+A+   AM  AT NA +LI   +L+FNR RQ+ IT EITEI  G
  S:     1 MASLQDIQRRISSTKKTRQITSAMQMVSTAKLSQIQKYSAGYGSYAARLEAVVEHLVSAHLFDNADADHIPLIAQRPIKKTGILVVTSDRGLVGSYNANVIKQTNVLMQNLNLDTSNTTILAVGGNGADFYKKRGFE--VILEHRGVSDVPTFNEIRSVVKTVTSLYENEV-FDALHVVYNHFVNRLTSEYRDVQLLPLTGDTLNAMGGTEEQKAELNVQATYEIEPDTTAVLNVVLPQFAQSLVYEAVLDAKTAEHAASSTAMKGATDNAKDLIGRLELQFNRARQAAITTEITEITGG 297
>gi|89898928|ref|YP_521399.1| ATP synthase F1, gamma subunit [Rhodoferax ferrireducens T118] >gi|122480312|sp|Q223D5|ATPG_RHOFD ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|89343665|gb|ABD67868.1| ATP synthase F1, gamma subunit [Rhodoferax ferrireducens T118] (298 aa)
Score = 286, Expect = 6.5e-24, Identities = 83/283 (29%), Positives = 151/283 (53%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEGKTIWLAFFSS-MGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKP------NNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA+  EI+ +IK  EST KIT AM+++S +K++K +E       Y  K  ++   +   +   I +  K+ E   + +   ++  GLCG  N N+++ +   ++       + +   IG KG   +   G +  +S   +L DK  + +      + LL  Y     I ++ + Y+KF+N++     +  LLPL  A  +   +         +G D+  +P+A  V + +L+ Y+   ++ ++ E+   E+A+R  AM +AT NA  +I   KL +N+ RQ+ IT+E++EIVSGA
  S:     1 MATGKEIRGKIKNFESTKKITKAMEMISVSKMRKAQERMRAARPYADKVRNIAANLGQANPEYIHAFMKTNEAPVVGMIVVTTDKGLCGGLNTNVLRSVTNKLRDLQSAGMSAQTVAIGNKGFGFLNRIGAKV-VSHVTQLGDKP-HLERLIGPVKVLLDAYARG-EISAVYLSYTKFINTMKQEVVLEQLLPLSAARMQAETEASETASGAKHGWDYIYEPDAQSVIDDLLVRYVEALVYQSVAENMASEHAARMVAMKAATDNAGNVIGELKLVYNKTRQAAITKELSEIVSGA 293
>gi|33151291|ref|NP_872644.1| F0F1 ATP synthase subunit gamma [Haemophilus ducreyi 35000HP] >gi|81713089|sp|Q7VPP1|ATPG_HAEDU ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|33147511|gb|AAP95033.1| ATP synthase gamma chain [Haemophilus ducreyi 35000HP] (288 aa)
Score = 286, Expect = 7.2e-24, Identities = 84/283 (29%), Positives = 152/283 (53%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNS-DSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  + +T KIT AM++V+++K++K +E       Y +    + ++I   S   +   L + +  K  +L   +  GLCG  N+N+ K      K+      + E+ L+G KG +  +S G++    +    D  ++   +  +    ++  Y+N   +  + + Y++F N++S    +  LLPL K +E   L+   +  D+  +PN   + +S+LI YL T ++ A+V++   E A+R  AM +AT NA  LI   +L +N+ RQ+ IT E+ EIV+GA
  S:     1 MAGAKEIRTKIASVRNTQKITKAMEMVATSKMRKTQERMAAGRPYSETIRKVISHIAKGSIGYKHPFLIERDVKKVGYLVISTDRGLCGGLNINLFKTTLNEFKAWKDKDVSVELGLVGSKGVSFYQSIGLKVRAHITGLGDSPEMERIVGAV--NEMINAYRNG-EVDMVCIAYNRFENTMSQKTVIAQLLPLPK-LENDELETKCSW-DYLYEPNPQVLLDSLLIRYLETQVYQAVVDNLASEQAARMVAMKAATDNAGALIDELQLVYNKARQASITNELNEIVAGA 285
>gi|158312877|ref|YP_001505385.1| ATP synthase F1, gamma subunit [Frankia sp. EAN1pec] >gi|158108282|gb|ABW10479.1| ATP synthase F1, gamma subunit [Frankia sp. EAN1pec] (298 aa)
Score = 285, Expect = 7.4e-24, Identities = 75/282 (26%), Positives = 152/282 (53%)
  Q:     2 ASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSD-SEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVK------ELQKHIKSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKN---DYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGA--DFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
             L E ++RIK ++ST KIT AM+L++++++ K +        Y ++   + + + S +  +  L+ ++ E  +   +   S  GL G ++ N +K      EL +       ++ +G+K     + +G    ++ D     +  ++     +A+ L+  +     +  +  I ++++++V++++       LLP+   + +   + P  G   ++  +P+A  V +++L  Y+ + ++ A++ES   E+A+R+ AM SAT NA +LIK Y    NR RQ  ITQEI+EIV GA
  S:     3 GQLREYRRRIKTVQSTKKITKAMELIAASRIAKARARVAASRPYAEEITRVISAVASQTTIAHPLTTERPEPTRAAVVVITSDRGLAGGYSSNALKRAGELVELLREEGKEPLLYAVGRKAGTYYRFRG--RPLAGDYTGFSEQPSYSDAKAVADALITAFTTPTEEGGVDEIHLVFTEYVSAMTQNAVAHRLLPM---VLREHDEPPAGGPLPNYEFEPSAEAVLDALLPRYVESRLYAALLESAASESAARQRAMKSATDNAEDLIKTYTRAANRARQDAITQEISEIVGGA 291
>gi|42521030|ref|NP_966945.1| F0F1 ATP synthase subunit gamma [Wolbachia endosymbiont of Drosophila melanogaster] >gi|99034642|ref|ZP_01314591.1| hypothetical protein Wendoof_01000594 [Wolbachia endosymbiont of Drosophila willistoni TSC#14030-0811.24] >gi|81700054|sp|Q73FU0|ATPG_WOLPM ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|42410771|gb|AAS14879.1| ATP synthase F1, gamma subunit [Wolbachia endosymbiont of Drosophila melanogaster] (290 aa)
Score = 285, Expect = 7.5e-24, Identities = 94/284 (33%), Positives = 156/284 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILS--LKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSND------EIWLIGKK----GKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENL-LAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPL--DKAIEKPRLDKPNNGADFSIQP-NANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAK 284
           M SL E+  RIK I S  K T  M++VS+AKL + ++  LN  +Y  K +++   +  + D E+L+  L  S +G  +     S  GLCG+FN +IVK  Q+ +  +       +I  +GKK    GKN   SK I     L +E + K I       + + + L+KY        +KV YSKF N+ +  P + ++ P   D ++    L  P     +  +P N   + +S++ DY+   ++ A++ES   EN++R  AM+SA +N  E++    L +NR RQ+ IT ++ E++ GA+
  S:     1 MKSLKELSLRIKNIRSVQKTTKIMQMVSAAKLLQSQKKLLNSKLYVSKLHNIIFSLMLSVDQELLAKILNVSNDGSYLVFIIASDRGLCGNFNSSIVKFSQERVNKSIANGKKVDIVFLGKKAFDVGKNRFDSKSI-----LKIE-NSKGITLKHVEALVDGIDLSKYDK------VKVFYSKFYNTFTQKPMLETIKPWSKDSSLIDSSLAGPTTDYGYEYEPQNIEFILKSLVQDYVVIALYSALLESATSENSARMVAMESANRNTKEILNKLALLYNRSRQAAITTDLIEVIGGAE 288
>gi|167750157|ref|ZP_02422284.1| hypothetical protein EUBSIR_01126 [Eubacterium siraeum DSM 15702] >gi|167656900|gb|EDS01030.1| hypothetical protein EUBSIR_01126 [Eubacterium siraeum DSM 15702] (286 aa)
Score = 285, Expect = 7.8e-24, Identities = 94/283 (33%), Positives = 144/283 (50%)
  Q:     1 MASLN--EIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEGKT-IWLAFFSSMGLCGSFNLNIVKELQKHIKSND---EIWLIGKKGKNLIKSK---------GIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MAS N  +IK+R+K +EST +IT AM+LV+S+KL+K K    +   ++   Y L   I   +++      +  E K  +++      GL G +N NI+K +Q+    N+   +I  +GKK                 GI   I      D   I  DLF                +  I++ +++FV+ L  TP+   +LP+D    K     P N A  +  P+   VF  ++   + + I  A+ ES   E  +RR AM++AT NA E+I N  L +NR RQ +IT E+ EIVSGA
  S:     1 MASGNMKDIKRRVKSVESTMQITKAMELVASSKLRKAKLRAEDARPFFDAQYSLMCRIAGETENLSTVYTRHREVKNRLFIVIAGDRGLAGGYNSNILKLVQQ-THGNEYMPKIIAVGKKSAEFFTKHEYDVVAQFPGIAEHIKTADAADIAQIATDLF------------TKGEVDEIELFFTQFVSPLVQTPTRMPVLPIDAPTGKA---VPENKAGTTYDPSPEAVFNRVIPKLITSLIMCAVNESYASELGARRTAMENATDNAEEMIANLSLMYNRARQEKITNELNEIVSGA 282
>gi|163754727|ref|ZP_02161849.1| ATP synthase, subunit gamma (H(+)-transporting two-sector ATPase) [Kordia algicida OT-1] >gi|161325668|gb|EDP96995.1| ATP synthase, subunit gamma (H(+)-transporting two-sector ATPase) [Kordia algicida OT-1] (286 aa)
Score = 285, Expect = 7.8e-24, Identities = 93/285 (32%), Positives = 151/285 (52%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILS--LKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS-----NDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           MA+L EI+ RI  ++ST +IT+AMK+VS+AKLKK ++       Y  K  +L   + +  D++  S    + E  K + +A  S+ GLCG+FN NI+K+    I +       ++  IGKKG +++       E   D+      + FD    IA+ L+  ++ D +   I+++Y+KF N+ +        LP+      P     N   D+  +P+  ++ E ++   L T +  AI +S   E+ +R  AM  AT NA EL  +  L +N+ RQ+ IT EI EIV GA+ 
  S:     1 MANLKEIRNRISSVKSTMQITSAMKMVSAAKLKKAQDAITAMRPYANKLTELLQSLSATLDADSGSKFADQREVNKVLIVAITSNRGLCGAFNSNIIKQANNLINNVYAGKQVDVLSIGKKGNDILSKTNTILENRSDVF---DALTFDNVAEIAQKLMDLFE-DGSYDKIEIVYNKFKNAATQIIMTEQFLPI-----VPIESSENVQLDYIFEPSKEEIVEGLIPKSLKTQLFKAIRDSFASEHGARMTAMHKATDNAAELRDSLTLTYNKARQAAITNEILEIVGGAEA 283
>gi|160890315|ref|ZP_02071318.1| hypothetical protein BACUNI_02756 [Bacteroides uniformis ATCC 8492] >gi|156860047|gb|EDO53478.1| hypothetical protein BACUNI_02756 [Bacteroides uniformis ATCC 8492] (296 aa)
Score = 285, Expect = 8.1e-24, Identities = 88/283 (31%), Positives = 161/283 (56%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFT-YIKSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHI-------KSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLD------KAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           M+SL E+K RI  ++ST +IT+AMK+V+SAKL K +    N   Y +K  ++ T ++++++  E    +K    +   +AF S+  LCG+FN N+ K L++ +       K N  I+ +G+K +  +K  G   + S  + + DK    + + + AE L+ ++  +  I  +++IY  F +  S      + LP+D      +A E    D  +   D+ ++P+  ++   +L   L+  I   +++S   E+A+R  AM +AT NANELI++   ++N+ RQ  IT E+ +I+ G+
  S:     1 MSSLKEVKNRISSVKSTRQITSAMKMVASAKLHKAQGRIGNMLPYQRKLNEILTNFLRTDASFESPYTEKRPVTRVAVVAFSSNSSLCGAFNSNVAKMLERTLEDYQSLGKENILIYPVGRKVEEAVKKMGYVPQGSYQV-MADKPSYVEAYEL-AEKLMHEFV-EKQIDHVELIYHHFKSMGSQVLLRENYLPIDLTQVAQEAAEDVPEDARSFNNDYIVEPSVGELIAELLPKVLSQKIFTVLLDSNTSEHAARMLAMQTATDNANELIQDLTKQYNKSRQQAITNELLDIIGGS 294
>gi|69247776|ref|ZP_00604481.1| H+-transporting two-sector ATPase, gamma subunit [Enterococcus faecium DO] >gi|68194705|gb|EAN09187.1| H+-transporting two-sector ATPase, gamma subunit [Enterococcus faecium DO] (300 aa)
Score = 285, Expect = 8.1e-24, Identities = 95/282 (33%), Positives = 150/282 (53%)
  Q:     2 ASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILS------------LKKSEEGKTIWLAFFSSMGLCGSFNLNIVKEL-----QKHIKSNDEIWL-IGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFS----IQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           ASLNEIK RI   + TS+IT AM++VS++KL K +       +Y  K  ++ T++ +   ++I S            L      KT ++   +  GL G +N +I+K+      + H   +D + + IG  G +  K++GI     L   L D+  +FD    I       Y+N+     + V Y+  +NSL+    V  +LP+        LD P     F      +P+  ++   +L  Y  + I+GAIV++K  E+A+   AM +AT NA  +I    + +NR RQ  ITQEITEIV+GA
  S:     3 ASLNEIKTRIASTKKTSQITRAMQMVSASKLTKSEVSSQKFQVYATKVREIVTHLTATQLNDIASENPRGDINYNSMLLSRPVKKTGYIVITADGGLVGGYNSSILKQTMSILEEDHQSPDDYVMIAIGGTGADFFKARGINLAYELR-NLSDQP-SFDEVRKIVNMATTMYQNEV-FDELYVCYNHHINSLTSQFRVEKMLPISD------LD-PEEATTFEQEYIFEPSKEEILSQLLPQYAESLIYGAIVDAKTAEHAAGMTAMKTATDNAANIIDELTVSYNRARQGAITQEITEIVAGA 296
>gi|194337685|ref|YP_002019479.1| ATP synthase F1, gamma subunit [Pelodictyon phaeoclathratiforme BU-1] >gi|194310162|gb|ACF44862.1| ATP synthase F1, gamma subunit [Pelodictyon phaeoclathratiforme BU-1] (291 aa)
Score = 285, Expect = 8.3e-24, Identities = 85/283 (30%), Positives = 152/283 (53%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSE---ILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQK---------HIKSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           M +L +I+ RIK ++ST ++T AMK+V++AKL++ +E  +    Y KK  ++   + +  D+    +LS  +SE  K + +   +  GLCG+FN N +K   K         H K    +   G +G +  + +  E  I        + ++F     IA+     Y     +  + V Y++F + L+       +LP+      P +    + +D+  +P+ + + + ++  +L T I   ++ES   E A+R +AMDSAT+NA EL++   + +NR RQ+ IT E++EIVSGA
  S:     1 MPTLKDIRVRIKGVKSTQQVTKAMKMVAAAKLRRAQERAVMARPYAKKLKEMLGSLSAKVDTSRNPMLS-GRSEVNKVLVILVTADRGLCGAFNTNAIKLASKIIHEDYPAIHSKGGVSLICAGSRGFDFFRKR--EYNIVKGYSAVFQHLDFSTAKEIADIASGMYLRG-EVDRVLVAYNEFKSVLAPNLREEVILPI-----APEIPGTESSSDYIYEPSPSAIIDELVPKHLNTQIWRMMLESSAAEQAARMSAMDSATENAKELMRTLNISYNRARQAAITTELSEIVSGA 286
>gi|169198979|ref|ZP_02858264.1| ATP synthase F1, gamma subunit [Rhizobium leguminosarum bv. trifolii WSM2304] >gi|169086354|gb|EDS67070.1| ATP synthase F1, gamma subunit [Rhizobium leguminosarum bv. trifolii WSM2304] (294 aa)
Score = 285, Expect = 8.6e-24, Identities = 82/285 (28%), Positives = 158/285 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKT---IWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYK-NDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           M SL ++K RI  +++T KIT AMK+V++AKL++ +E       Y ++   +   I K+ +D++      +  GK    + +   +  GLCG FN  I +  + H++         +I+ +GKKG ++++ +     I      D K I F+    I + ++  Y   ++++ ++   YS+F + +S  P+   L+P      +   D  + GA +  +P+   + E ++   ++  I  A++E+   E  ++ +AMD+AT+NA E+I    L +NR+RQ++IT+E+ EI+SGA+ 
  S:     1 MPSLKDLKNRIASVKATQKITKAMKMVAAAKLRRAQEAAEAARPYSQRMGAVLANIAKAVTDADGAPTLMTGTGKDQVHLLVVCTAERGLCGGFNSQIARFARDHVRKLVAEGKTVKIFTVGKKGYDILRREYASLIIERKELRDVKRIGFENADQIGKRIIDMYAAGEFDVCTL--FYSEFKSVISQIPTAQQLIPASTGAVQAE-DAAHAGAVYEYEPDPASILEDLIPRNISVQIFRALLENVAGEMGAKMSAMDNATRNAGEMINKLTLSYNRQRQAQITKELIEIISGAEA 293
>gi|114706546|ref|ZP_01439447.1| F0F1 ATP synthase subunit gamma [Fulvimarina pelagi HTCC2506] >gi|114537938|gb|EAU41061.1| F0F1 ATP synthase subunit gamma [Fulvimarina pelagi HTCC2506] (296 aa)
Score = 285, Expect = 8.6e-24, Identities = 82/285 (28%), Positives = 165/285 (57%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEI--LSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKEL---QKHIKSNDE---IWLIGKKGKNLIK---SKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYK-NDYNIKSIKVIYSKFVNSLSFTPSVFSLLPL------DKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           MASL +++ RI  ++ST KIT AM++V+++KL++ +E   N   Y ++ + + + +   + +E   L     ++   + + F +  GLCG FN +IVK+    Q+ +++N +    + +GKKG +L++   S  I   IS     +   + FD    + + ++  ++  ++++    + Y++F N ++  P+   ++P       D   EK   D    G  +  +P+   + + ++   +   I  A++E+   E  +R  AMDSAT+NA ++I+  ++ +NR+RQ++IT E+TEI+SGA+ 
  S:     1 MASLKDLRNRISSVKSTKKITKAMQMVAASKLRRAEEAAQNARPYAERMHSVLSNLAGINQNEAPKLMTGTGKDDVHLLVVFTADRGLCGGFNASIVKKARAKQRELEANGKSVKFYAVGKKGYDLMRRDLSDKIVDSISFR---ESSRVGFDEAAQVGDKVIDMFEAGEFDV--CHLFYAEFENVMTQVPTGQQVIPASVEEDEDGENEKKGSDA---GTTYEYEPDPAGILDDLIPRNIKIQILRALLENAASEQGARMTAMDSATRNAGDMIEKLEISYNRQRQAQITTELTEIISGAEA 295
>gi|114646|sp|P09222|ATPG_BACP3 ATP synthase gamma chain precursor (ATP synthase F1 sector gamma subunit) >gi|77462|pir||S01402 H+-transporting two-sector ATPase (EC 3.6.3.14) gamma chain - thermophilic bacterium PS-3 >gi|581474|emb|CAA30653.1| unnamed protein product [Bacillus sp. PS3] (286 aa)
Score = 285, Expect = 8.6e-24, Identities = 89/283 (31%), Positives = 153/283 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVK----ELQKHIKSNDE--IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPL-DKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           +ASL +IK RI   + TS+IT AM++V ++KL + ++  +    Y +K  ++   +   + +    L      KT +L   S  GL G++N N+++     +QK   S DE  I +IG+ G +  + + +   + LD+       +F     IA   +  +  D     + + Y+ +V+++    +   LLPL D A  K R         +  +P+  ++ + +L  Y  + I+GA++++K  E+A+R  AM +AT NANELI+   L +NR RQ+ ITQEITEIV+GA
  S:     4 LASLRDIKTRINATKKTSQITKAMEMVLTSKLNRAEKREIVRP-YMEKIQEVVANVALAARASHPMLVSRPVKKTGYLVITSDRGLAGAYNSNVLRLVYQTIQKRHASPDEYAIIVIGRVGLSFFRKRNMP--VILDITRLPDQPSFADIKEIARKTVGLFA-DGTFDELYMYYNHYVSAIQQEVTERKLLPLTDLAENKQR-------TVYEFEPSQEEILDVLLPQYAESLIYGALLDAKASEHAARMTAMKNATDNANELIRTLTLSYNRARQAAITQEITEIVAGA 282
>gi|189501530|ref|YP_001957247.1| ATP synthase F1, gamma subunit [Candidatus Amoebophilus asiaticus 5a2] >gi|189496971|gb|ACE05518.1| ATP synthase F1, gamma subunit [Candidatus Amoebophilus asiaticus 5a2] (290 aa)
Score = 285, Expect = 8.6e-24, Identities = 87/285 (30%), Positives = 150/285 (52%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILS--LKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIK-------SNDEIWLIGKKGKNLIKSKG---IEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           M ++ EI  RI  + ST +IT AMK+V++AKL K +   L    Y     D+  ++  ++++E+     +K    + + +   S  GLCGSFN NI+K  + +I        +  +I +IGKK  N  + K    I     L  +L  +DI+ ++   I +  L     +Y    +++IY+ F ++ S    +   LP    I  P     NN  D+  +P+   + E+++   L   ++ A++ES   E+ +R   M  AT NA EL+K+ ++ +N+ RQ+ IT EI EI +GA+ 
  S:     1 MPNIKEIVSRINSVHSTQQITKAMKMVAAAKLTKAQHQLLQLRPYAGGLSDILNHVIYSTEAELTKHYTQKRTIQRLMLVVISSDKGLCGSFNANIIKNTEAYINQFKDLLPTQIDILVIGKKALNFFQKKDYNLITTYTDLAGQLQFEDIS-EVASFIMDAFL-----NYTYDRVELIYNLFGSAASQFVQLEPFLP----IVHPASPSHNNHVDYIYEPSKASLVETLIPMTLKIQLYKALLESAASEHGARMTTMSKATDNAEELLKSLRITYNKTRQAAITNEILEIAAGAEA 287
>gi|163761386|ref|ZP_02168460.1| ATP synthase subunit C [Hoeflea phototrophica DFL-43] >gi|162281381|gb|EDQ31678.1| ATP synthase subunit C [Hoeflea phototrophica DFL-43] (292 aa)
Score = 285, Expect = 8.7e-24, Identities = 81/285 (28%), Positives = 155/285 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIK----SNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKGIEAEISLDLELDD----KDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           M SL ++K RI  +++T KIT AM++V++AKL++ ++       Y ++   +   I     S  D+  L     ++   + +   +  GLCG FN  I +  ++H++         +I  +GKKG ++++ +      SL +E  D    K ++F     +A  +++ ++ +       + YS+F + +S  P+   L+P   A   P        A +  +P+A ++ E +L   +   I  A++E+   E  ++ +AMDSAT+NA E+I    + +NR+RQ++IT+E+ EI+SGA+ 
  S:     1 MPSLKDLKNRIASVKATQKITKAMQMVAAAKLRRAQDAAEAARPYSQRMAAVMANIADAVGSGDDAPRLMAGTGKDDTHLLVVCTAERGLCGGFNSQIARFAREHVRKLVADGKTVKIICVGKKGYDILRRE----YSSLIIERVDFREVKQMSFAQAETVAGKVMSLFE-EGGFDVCTLFYSEFKSVISQVPTAQQLIPASAA---PVEADAGAMAIYDYEPDATEILEDLLPRSIKVQIFRALLENVAGEMGAKMSAMDSATRNAGEMIDKLSMSYNRQRQAQITKELIEIISGAEA 291
>gi|126725128|ref|ZP_01740971.1| F0F1 ATP synthase subunit gamma [Rhodobacterales bacterium HTCC2150] >gi|126706292|gb|EBA05382.1| F0F1 ATP synthase subunit gamma [Rhodobacterales bacterium HTCC2150] (292 aa)
Score = 285, Expect = 9.1e-24, Identities = 84/285 (29%), Positives = 160/285 (56%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKS---NSDSEILSLKKSEEGKTIWLAFFSS-MGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSK-GIEAEISLDLELDDKDINFDLFHIIAENLLAKYKN-DYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           M +L+++K RI  +++T KIT AM++V++AKL++ +E       Y ++F  +   + +   NS      L  S   K   L   +S  GLCG FN NI K  +    +        +I  +GKKG++ ++ + G +    +DL  + K++ +D    IA+++L +++  ++++ +I   Y++F + +S  P+   ++P     ++   +       +  +P+   +   +L   +AT I  A++E+   E  +R +AMD+AT+NA E+I    +E+NR RQ+ IT E+ EI+SGA+ 
  S:     1 MPNLSDLKNRIASVKNTRKITKAMQMVAAAKLRRAQEAAEMGRPYAQRFNAVLGGLAASVGNSAGAPKLLAGSGADKVHLLVVMTSERGLCGGFNSNISKLARTRAAALIAAGKTVKILTVGKKGRDALRREFGDQMVHHVDLS-EVKNVGYDNAASIAKDILGRFEGGEFDVATI--FYARFESVISQVPTEHQIIPASFEADE---ETAGESTVYDYEPSEEGILADLLPRGVATQIFSALLENGASEQGARMSAMDNATRNAGEMIDKLTIEYNRSRQAVITNELIEIISGAEA 291
>gi|121607475|ref|YP_995282.1| ATP synthase F1, gamma subunit [Verminephrobacter eiseniae EF01-2] >gi|166224123|sp|A1WF57|ATPG_VEREI ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|121552115|gb|ABM56264.1| ATP synthase F1, gamma subunit [Verminephrobacter eiseniae EF01-2] (291 aa)
Score = 285, Expect = 9.1e-24, Identities = 83/281 (29%), Positives = 154/281 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSND------EIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVS 281
           MA+  EI+ +IK +E+T KIT AM++VS +K++K +E       Y +K  ++   + K+N +     +KK++     ++   S  GLCG  N N+++ +   ++         E   IG KG   +   G    ++    L D   + D      + LL  Y  +  + ++ + Y+KF+N++   P V  LLPL  A +  ++++  +  D+  +P+A  V + +L+ Y+ + ++ A+ E+   E+++R  AM +AT NA  +I   KL +N+ RQ+ IT+E++EIVS
  S:     1 MAAGKEIRGKIKSVENTKKITKAMEMVSVSKMRKAQERMRAARPYSEKIRNIAANLGKANPEYTHAFMKKNDAKALGFIIVTSDKGLCGGLNTNLLRAVTAKLREAQAAGVAIESVAIGSKGLGFLNRIGARV-VAHVTHLGDTP-HLDKLIGPVKTLLDAYA-EGKLSAVYLSYTKFINTIKQEPLVEQLLPL--AEDSLKVEEGQHSWDYIYEPDAQSVIDELLVRYVESLVYQAVAENMASEHSARMVAMKAATDNAGNVISELKLVYNKTRQAGITKELSEIVS 283
>gi|149188272|ref|ZP_01866566.1| putative ATP synthase F1, gamma subunit [Vibrio shilonii AK1] >gi|148837861|gb|EDL54804.1| putative ATP synthase F1, gamma subunit [Vibrio shilonii AK1] (285 aa)
Score = 284, Expect = 9.7e-24, Identities = 83/285 (29%), Positives = 158/285 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNS-DSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDE------IWLIGKKGKNLIKSKG-IEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           MA+  EI+ +I  I+ST KIT+AM++V+++K++K ++       Y      + +++   + +     L++ E  +  ++   S  GLCG  N N+ +++   ++S  E        LIG K  +  +S G + A+ S    L D     +L   +  + + ++  +  I  + ++YS+FVN+++  P+V  LLP  K  E  +  +     D+  +    D+ + +++ Y+ + ++  +VES  CE A+R  AM +AT NA +LI + +L FN+ RQ+ ITQE++EI +GA+ 
  S:     1 MANTKEIRTKIASIQSTQKITSAMEMVAASKMRKVQDNMEASRPYADNMKKVISHVSGGTLEYSHPYLQEREVKRVAYIIISSDRGLCGGLNTNLFRKVLSEMQSWQEQGVEVDTTLIGSKAISFFQSSGRVIAQTS---GLGDHPKLEELLGTV--HAMMEHYAEGQIDRLFLVYSQFVNTMTQQPTVMQLLPFPKHEEAEKETR----WDYIYEQAPRDILDHLMLRYVESLVYQGVVESIACEQAARMVAMRAATDNAGQLIDDLQLVFNKARQAAITQELSEITAGAQA 284
>gi|21230028|ref|NP_635945.1| F0F1 ATP synthase subunit gamma [Xanthomonas campestris pv. campestris str. ATCC 33913] >gi|66769978|ref|YP_244740.1| F0F1 ATP synthase subunit gamma [Xanthomonas campestris pv. campestris str. 8004] >gi|188993190|ref|YP_001905200.1| ATP synthase gamma chain [Xanthomonas campestris pv. campestris] >gi|81304069|sp|Q4UQF3|ATPG_XANC8 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|81796769|sp|Q8PCZ6|ATPG_XANCP ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|21111548|gb|AAM39869.1| ATP synthase gamma chain [Xanthomonas campestris pv. campestris str. ATCC 33913] >gi|66575310|gb|AAY50720.1| ATP synthase gamma chain [Xanthomonas campestris pv. campestris str. 8004] >gi|167734950|emb|CAP53162.1| ATP synthase gamma chain [Xanthomonas campestris pv. campestris] (287 aa)
Score = 284, Expect = 1.0e-23, Identities = 81/283 (28%), Positives = 157/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTI-WLAFFSSMGLCGSFNLNIVKELQKHIK------SNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EIK +IK +++T K+T A+++VS++K++K +E       Y +    +  ++ ++++D +   L + E+ K + ++   S  GL G  N N+ +++   ++      +  ++  IG+K     +   +    S+    D   I   L  +I   L A  +    +  + ++Y++FVN+++   S   LLPL  A  K      ++  D+  +P+A  V E ++  Y+ + ++ A++E+   E+A+R  AM +A+ NAN++I   +L +N+ RQ+ ITQEI+EIVSGA
  S:     1 MAGGREIKTKIKSVQNTRKVTRALEMVSASKIRKAQERMKTSRPYAQAMKQVIGHLAQASTDYQHPFLVEREQVKRVGYIVISSDRGLAGGLNNNLFRKMLGEVRPWQDKGAEIDVVTIGQKASAFFRRIKVNMVGSVTHLGDSPHIE-QLVGVIKVMLDAFTEG--KVDRVYLVYNRFVNTMTQKASFEQLLPLPAAEHK----VAHHDWDYLYEPDAATVLEHVMTRYIESLVYQAVLENVASEHAARMVAMKAASDNANKMIGTLQLVYNKARQAAITQEISEIVSGA 284
>gi|15642758|ref|NP_232391.1| F0F1 ATP synthase subunit gamma [Vibrio cholerae O1 biovar eltor str. N16961] >gi|121591173|ref|ZP_01678478.1| ATP synthase F1, gamma subunit [Vibrio cholerae 2740-80] >gi|121729379|ref|ZP_01682046.1| ATP synthase F1, gamma subunit [Vibrio cholerae V52] >gi|147673449|ref|YP_001218420.1| F0F1 ATP synthase subunit gamma [Vibrio cholerae O395] >gi|153212927|ref|ZP_01948521.1| ATP synthase F1, gamma subunit [Vibrio cholerae 1587] >gi|153224010|ref|ZP_01954172.1| ATP synthase F1, gamma subunit [Vibrio cholerae MAK 757] >gi|153803374|ref|ZP_01957960.1| ATP synthase F1, gamma subunit [Vibrio cholerae MZO-3] >gi|153820052|ref|ZP_01972719.1| ATP synthase F1, gamma subunit [Vibrio cholerae NCTC 8457] >gi|153827194|ref|ZP_01979861.1| ATP synthase F1, gamma subunit [Vibrio cholerae MZO-2] >gi|153829681|ref|ZP_01982348.1| ATP synthase F1, gamma subunit [Vibrio cholerae 623-39] >gi|194532282|ref|YP_002067712.1| ATP synthase F1, gamma subunit [Vibrio cholerae MO10] >gi|194534494|ref|YP_002069711.1| ATP synthase F1, gamma subunit [Vibrio cholerae RC385] >gi|172047488|sp|A5F458|ATPG_VIBC3 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|81788383|sp|Q9KNH4|ATPG_VIBCH ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|9657366|gb|AAF95904.1| ATP synthase F1, gamma subunit [Vibrio cholerae O1 biovar El Tor str. N16961] >gi|121546990|gb|EAX57135.1| ATP synthase F1, gamma subunit [Vibrio cholerae 2740-80] >gi|121628660|gb|EAX61132.1| ATP synthase F1, gamma subunit [Vibrio cholerae V52] >gi|124116153|gb|EAY34973.1| ATP synthase F1, gamma subunit [Vibrio cholerae 1587] >gi|124117888|gb|EAY36631.1| ATP synthase F1, gamma subunit [Vibrio cholerae MAK 757] >gi|124121098|gb|EAY39841.1| ATP synthase F1, gamma subunit [Vibrio cholerae MZO-3] >gi|125618283|gb|EAZ46825.1| ATP synthase F1, gamma subunit [Vibrio cholerae MO10] >gi|125620538|gb|EAZ48906.1| ATP synthase F1, gamma subunit [Vibrio cholerae V51] >gi|126509409|gb|EAZ72003.1| ATP synthase F1, gamma subunit [Vibrio cholerae NCTC 8457] >gi|146315332|gb|ABQ19871.1| ATP synthase F1, gamma subunit [Vibrio cholerae O395] >gi|148874857|gb|EDL72992.1| ATP synthase F1, gamma subunit [Vibrio cholerae 623-39] >gi|149738917|gb|EDM53241.1| ATP synthase F1, gamma subunit [Vibrio cholerae MZO-2] >gi|150419210|gb|EDN11629.1| ATP synthase F1, gamma subunit [Vibrio cholerae RC385] >gi|150422992|gb|EDN14942.1| ATP synthase F1, gamma subunit [Vibrio cholerae AM-19226] (288 aa)
Score = 284, Expect = 1.0e-23, Identities = 79/283 (27%), Positives = 157/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNS-DSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVK------ELQKHIKSNDEIWLIGKKGKNLIKSKG--IEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  ++ST KIT AM++V+++K+++ ++   +   Y +    +  ++ + S +     L++ E  +  ++   +  GLCG  N+N+ K      +  K   +  E+ +IG K      + G  + A++S    L D     DL   +   +L KY     +  + +++++FVN++   P +  LLPL K+  +    + ++  D+  +P    + +++L+ ++ + ++  +VE+  CE A+R  AM +AT NA+ LI + +L +N+ RQ+ ITQE++EIV GA
  S:     1 MAGAKEIRTKIGSVKSTQKITKAMEMVAASKMRRSQDAMESSRPYAQTIRKVIGHVANASLEYRHPYLEEREAKRVGYIIISTDRGLCGGLNINLFKKAITDMQTWKEKGAQIELAIIGSKATAFFNNSGAKVAAQVS---GLGDSPSLEDLIGSVGV-MLKKYDKG-ELDRLYLVFNQFVNTMVQKPKIDQLLPLPKSDSEDM--QRDHMWDYIYEPEPKPLLDALLLRFIESQVYQGVVENLACEQAARMVAMKAATDNASNLIDDLQLVYNKARQAAITQELSEIVGGA 285
>gi|78224597|ref|YP_386344.1| F0F1 ATP synthase subunit gamma [Geobacter metallireducens GS-15] >gi|123570735|sp|Q39Q55|ATPG_GEOMG ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|78195852|gb|ABB33619.1| H+-transporting two-sector ATPase, gamma subunit [Geobacter metallireducens GS-15] (287 aa)
Score = 284, Expect = 1.1e-23, Identities = 85/284 (29%), Positives = 160/284 (56%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSND------EIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKY-KNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPL--DKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAK 284
           MASL  IKKRI  +++T +IT AMK+VS+AKL++ +E  +    Y KK  ++   + KS   S    L+K    K + +   S  GLCG FN NI K  ++ I+          +  +G+KG   +K++    +I  +      ++++    ++A+ ++  Y   +Y+   + ++++ F + +S   ++  LLP+  ++  E+  +       ++  +P+  ++ + +L  ++   +  A++ES   E+ +R  AMDSA+KNA E+I    L++NR RQ+ IT E+ EI+SGA+
  S:     1 MASLKSIKKRIVSVKNTRQITKAMKMVSAAKLRRAQENVVAARPYAKKLGEVLDRLAKSQDGSSSPLLQKRISQKALLVVVTSDRGLCGGFNANICKAAERFIREKKAEFAEISVTTVGRKGFEFLKNR---QKIHKNYGNVLSNLSYPTAALLAQEVVEGYVAEEYD--EVYLLFNAFRSVMSQDITLQQLLPIVPEETAEEEYV------PEYIYEPSKGELLDELLPKHIEVQVFKALLESVASEHGARMTAMDSASKNATEMIGKLTLQYNRARQAAITTELMEIISGAE 283
>gi|138896936|ref|YP_001127389.1| F0F1 ATP synthase subunit gamma [Geobacillus thermodenitrificans NG80-2] >gi|134268449|gb|ABO68644.1| ATPase gamma subunit [Geobacillus thermodenitrificans NG80-2] (288 aa)
Score = 284, Expect = 1.1e-23, Identities = 88/283 (31%), Positives = 155/283 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEE-GKTIWLAFFSSMGLCGSFNLNIVKELQKHIK----SNDE--IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPL-DKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           +ASL +IK RI   + TS+IT AM++VS++KL + ++   +   Y +K  ++   +   +      +  S    KT +L   S  GL G++N N+++ + + I+    S DE  I +IG+ G N  + + +   + LD+       +F     IA   +  +  D     + + Y+ +V+++    +   LLPL D A  + R         +  +P+  ++ + +L  Y  + I+GA++++K  E+A+R  AM +AT NA+ELI+   L +NR RQ+ ITQEITEIV+GA
  S:     4 LASLRDIKTRINSTKKTSQITKAMEMVSTSKLNRAEQNAKSFVPYMEKMQEVVANVALGAGGASHPMLISRPVKKTGYLVITSDRGLAGAYNSNVLRTVYQTIQARHSSPDEYAIIVIGRVGLNFFRKRNMP--VILDITRLPDQPSFADIKEIANKAVGLFA-DGTFDELYMYYNHYVSAIQQDVTERKLLPLTDLADNQQR-------TMYEFEPSQEEILDVLLPQYAESLIYGALLDAKASEHAARMTAMKNATDNAHELIRTLTLSYNRARQASITQEITEIVAGA 284
>gi|83746949|ref|ZP_00943995.1| ATP synthase gamma chain [Ralstonia solanacearum UW551] >gi|83726369|gb|EAP73501.1| ATP synthase gamma chain [Ralstonia solanacearum UW551] (291 aa)
Score = 283, Expect = 1.3e-23, Identities = 80/283 (28%), Positives = 152/283 (53%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPL--DKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +IK +++T KIT AM++V+++K++K +E   +   Y +K  ++  ++ ++N + +   + K +  +   +   +  GLCG  N N+++ +   ++         +   IG KG   +   G +  +S  + L D      L   I   L A       I ++ + Y++F+N++   P V  LLPL  DK + +   +K     D+  +P+A  V + +LI Y+   ++ A+ E+   E ++R  AM +A+ NA  +I   +L +N+ RQ+ IT+E++EIV GA
  S:     1 MAGTKEIRTKIKSVQNTRKITKAMEMVAASKMRKAQERMRSARPYAEKIRNVAAHMAQANPEYQHPFMVKRDIKRAGLIVVTTDKGLCGGLNTNVLRAVTNQLRELQGKGVETQATAIGTKGMQFLGRIGAKV-VSNVVHLGDTPHLEKLIGAIKVQLDAFTAG--QIDAVYIAYTRFINTMKQEPVVEQLLPLTADK-LTQTEAEKQAYSWDYIYEPDAQTVVDELLIRYVEALVYQAVAENMASEQSARMVAMKAASDNAKNVIGELQLVYNKTRQAAITKELSEIVGGA 288
>gi|75498600|sp|O50158|ATPG_STRBO ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|2662325|dbj|BAA23754.1| proton-translocating ATPase gamma subunit [Streptococcus equinus] (291 aa)
Score = 283, Expect = 1.3e-23, Identities = 97/282 (34%), Positives = 156/282 (55%)
  Q:     2 ASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFT-YIKSN--SDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKEL-----QKHIKSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
            SL+EIK +I   + TS IT AM++VS+AKL K ++   +  +Y  K   + T  +KS   + S+   L      KT ++   S  GL G +N  I+K +     + H   N  I  IG  G +  K++G+     L   L+D+     + +IIA+++   YKN+     + V Y+  VNSL+    V  +LP+ +       ++  +G  F ++PN   + E +L  Y  + I+GAIV++K  E+A+   AM +AT NA  +I +  +++NR RQ+ ITQEITEIV+GA
  S:     3 GSLSEIKGKIISTQKTSHITGAMQMVSAAKLTKSEQAAKDFQVYASKIRQITTDLLKSELVNGSKNPMLAARPVKKTGYIVITSDKGLVGGYNSKILKAMMDLIEEYHQDGNYAIIAIGGIGADFFKARGMNVVFELR-GLEDQPSFEQVGNIIAKSV-EMYKNEL-FDELYVCYNHHVNSLTSQVRVQQMLPIAELDADEAAEEGVSG--FELEPNREMILEQLLPQYTESLIYGAIVDAKTAEHAAGMTAMQTATDNAKNVINDLTIQYNRARQAAITQEITEIVAGA 287
>gi|29655228|ref|NP_820920.1| ATP synthase F1, gamma subunit [Coxiella burnetii RSA 493] >gi|154707638|ref|YP_001423603.1| ATP synthase F1, gamma subunit [Coxiella burnetii Dugway 5J108-111] >gi|161830155|ref|YP_001597760.1| ATP synthase F1, gamma subunit [Coxiella burnetii RSA 331] >gi|189081397|sp|A9KBF8|ATPG_COXBN ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|189081398|sp|A9NBC9|ATPG_COXBR ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|81722486|sp|Q83AF6|ATPG_COXBU ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|29542500|gb|AAO91434.1| ATP synthase, F1 gamma subunit [Coxiella burnetii RSA 493] >gi|154356924|gb|ABS78386.1| ATP synthase F1, gamma subunit [Coxiella burnetii Dugway 5J108-111] >gi|161762022|gb|ABX77664.1| ATP synthase F1, gamma subunit [Coxiella burnetii RSA 331] (289 aa)
Score = 283, Expect = 1.4e-23, Identities = 84/283 (29%), Positives = 162/283 (57%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIK-SNSDSEILSLKKSEEGKTI-WLAFFSSMGLCGSFNLNI----VKELQKHIKSN--DEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPN-ANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           M+   EI+ +I  I++T KIT AM+LV+++K++K ++       Y  K   + +++  S+++     L++ E  K + ++   +  GLCG  N+N+    + +++K    N   ++ +IG+KG+   +  G       D   D  ++  D+  I+ + +L +Y +   I +I +  ++FVN++   P V  LLPL    E+          D+  +P+ + D+ E +L+ Y+ + ++ A++E+  CE ++R  AM +AT+NA +LI   +L +N+ RQ+ IT+EI EIV+GA
  S:     1 MSKAREIRTKIASIKNTQKITRAMELVAASKMRKAQDRMAMSRPYASKIRKVISHVAASHAEYPHPYLQQRENIKRVGYIIVTTDRGLCGGLNVNLFRTAIADMKKWQADNIGMDLCVIGRKGEAFFRRYGGNVLAVADHLGDAPEVQ-DIIGIV-KVMLDQY-DKQQIDAIYIATNEFVNTMVQKPLVRQLLPLKTDEEEVE----GGYWDYIYEPDESKDLLEMLLVRYIESQVYQAVIENIACEQSARMVAMKNATENAGQLIDELRLIYNKARQAGITREIAEIVAGA 285
>gi|171779637|ref|ZP_02920593.1| hypothetical protein STRINF_01474 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gi|171281739|gb|EDT47173.1| hypothetical protein STRINF_01474 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] (292 aa)
Score = 283, Expect = 1.5e-23, Identities = 95/282 (33%), Positives = 158/282 (56%)
  Q:     2 ASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFT-YIKSN--SDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIK---SNDEIWLIGKKGK---NLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
            SLNEIK++I   + TS IT AM++VS+AKL K ++   +  IY  K   + T  +KS   + S+   L      KT ++   S  GL G +N  I+K +   I+   + D+ + I   G    +  K++G+     L   L+D+     + +II++++   YKN+     + V Y+  VNSL+    V  +LP+ +       ++   G  F ++P+   + E +L  Y  + I+GAIV++K  E+A+   AM +AT NA  +I ++ +++NR RQ+ ITQEITEIV+GA
  S:     3 GSLNEIKEKIISTQKTSHITGAMQMVSAAKLTKSEQAAQDFQIYASKIRQITTDLLKSELINGSKNPMLAARPVKKTGYIVITSDKGLVGGYNSKILKAMMDLIQEYHAKDDSYAIIAIGGIGADFFKARGMNVVFELR-GLEDQPSFEQVGNIISKSV-EMYKNEL-FDELYVCYNHHVNSLTSQVRVQQMLPIAELDADEAAEEGTTG--FELEPSRELILEQLLPQYTESLIYGAIVDAKTAEHAAGMTAMQTATDNAKNVINDFTIQYNRARQAAITQEITEIVAGA 288
>gi|89889659|ref|ZP_01201170.1| ATP synthase gamma chain [Flavobacteria bacterium BBFL7] >gi|89517932|gb|EAS20588.1| ATP synthase gamma chain [Flavobacteria bacterium BBFL7] (291 aa)
Score = 283, Expect = 1.5e-23, Identities = 95/285 (33%), Positives = 151/285 (52%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILS--LKKSEEGKTIWLAFFSSMGLCGSFNLNIVKEL----QKHIKSNDEIWL-IGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           MA+L EI+ RI  + ST +IT+AMK+VS+AKLKK ++       Y  K  ++   + S  + E  S   ++ E  K + +A  S+ GL G+FN NI+KEL    Q+ +K     ++ IGKK  +   +K  +  IS   +L D DI+FD   +IAE L+  +        I ++Y+ F N+ +        LPL    +     +     D+  +P+  ++ E ++   L   ++  + +S   E+ +R  AM  AT NA EL    KL +N+ RQ+ IT EI EIV GA+ 
  S:     1 MANLKEIRNRISSVSSTMQITSAMKMVSAAKLKKAQDAITAMRPYSDKLTEILQSLSSTMEGEAGSKFAEQREVNKALVVAITSNRGLAGAFNSNIIKELIRLNQEDLKGVAVSYMTIGKKANDF--AKKTDNIISNKSDLFD-DISFDNVALIAEELMDLFITG-EFDKIVLVYNSFKNAATQIIMTEDFLPLKPVAKDEAAIETQKELDYIFEPSKEEIIEELIPKSLKMQLYKGVRDSWASEHGARMTAMHKATDNATELRDQLKLTYNKARQAAITNEILEIVGGAEA 288
>gi|108804475|ref|YP_644412.1| ATP synthase F1, gamma subunit [Rubrobacter xylanophilus DSM 9941] >gi|122975955|sp|Q1AVH8|ATPG_RUBXD ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|108765718|gb|ABG04600.1| ATP synthase F1, gamma subunit [Rubrobacter xylanophilus DSM 9941] (290 aa)
Score = 283, Expect = 1.5e-23, Identities = 77/279 (27%), Positives = 143/279 (51%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEGKTIWLAFFSS-MGLCGSFNLNIVKELQKHIKSNDEIWL---IGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEI 279
           MASL ++K++I+ +++ +K+T+A++ VS+ K +K +        Y +   ++   I S + +    L   E+ + + +A  +S  GLCGSFN  +++   +  +      L    G+KG    + + I    S     DD   +++    I   L   ++ +     + ++Y++FVN     P V  LLP      +       +GA F   P+A+ +   ++  Y+ T +  A++ES   E+ +R  AM +AT NANEL+    L+ N+ RQ++IT+EI+EI
  S:     1 MASLRDLKRQIQSVKNIAKVTDALQAVSAVKFRKAEARVKQARPYAENMEEVMRAIASKASTRNPMLAGREQVRRVAVATLTSDRGLCGSFNAQVLRRTVRFREQQGAEALQVASGRKGIAFFRFRRIGLAESYSGFTDDP--SYEDAQRIGRGLTRLFERE-EADEVYLVYNRFVNPAVQRPVVVRLLPAAPEGGEEGEGGTVSGAPFDFIPDADTILRRLIPQYVETLVWQALLESAAGEHGARMTAMKNATDNANELVDTLTLQMNKARQAQITREISEI 280
>gi|1333799|emb|CAA30654.1| unnamed protein product [Bacillus sp. PS3] (282 aa)
Score = 283, Expect = 1.5e-23, Identities = 89/282 (31%), Positives = 152/282 (53%)
  Q:     2 ASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVK----ELQKHIKSNDE--IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPL-DKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           ASL +IK RI   + TS+IT AM++V ++KL + ++  +    Y +K  ++   +   + +    L      KT +L   S  GL G++N N+++     +QK   S DE  I +IG+ G +  + + +   + LD+       +F     IA   +  +  D     + + Y+ +V+++    +   LLPL D A  K R         +  +P+  ++ + +L  Y  + I+GA++++K  E+A+R  AM +AT NANELI+   L +NR RQ+ ITQEITEIV+GA
  S:     1 ASLRDIKTRINATKKTSQITKAMEMVLTSKLNRAEKREIVRP-YMEKIQEVVANVALAARASHPMLVSRPVKKTGYLVITSDRGLAGAYNSNVLRLVYQTIQKRHASPDEYAIIVIGRVGLSFFRKRNMP--VILDITRLPDQPSFADIKEIARKTVGLFA-DGTFDELYMYYNHYVSAIQQEVTERKLLPLTDLAENKQR-------TVYEFEPSQEEILDVLLPQYAESLIYGALLDAKASEHAARMTAMKNATDNANELIRTLTLSYNRARQAAITQEITEIVAGA 278
>gi|119497073|ref|XP_001265304.1| ATP synthase gamma chain, mitochondrial precursor [Neosartorya fischeri NRRL 181] >gi|119413466|gb|EAW23407.1| ATP synthase gamma chain, mitochondrial precursor [Neosartorya fischeri NRRL 181] (297 aa)
Score = 283, Expect = 1.6e-23, Identities = 88/282 (31%), Positives = 155/282 (54%)
  Q:     2 ASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSND--EIWLIGKKGKNLIKSKGIEAEISLDLELDDKDI-NFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           A+L EI+ R+K I++  KITN MK+V+S +L + ++   +  +Y +          SN   E    K  E+ KT+ +   S  GLCG  +  + K  ++ ++ N   ++ ++G+K K  +     +A I +      KDI  F    +IA+ + A+   DY   S+K+IY+KF+N+ S+  S        +A  +  + K  N A F ++ +A     ++    LA  ++ A+ E   CE ++RRNAM++A+KNA E+I  +++ +NR+RQ+ IT E+ EI++GA
  S:    29 ATLREIEGRLKSIKNIEKITNTMKIVASTRLTRAQKAMDDSRVYGQT---------SNKVFENAETKPLEDKKTLLVVASSDKGLCGGIHSGLSKATRRILQENPNADVVILGEKAKAQLSRSNPDA-IVMSFANVCKDIPTFADAQVIADQI-AQLPTDY--ASVKIIYNKFINAQSYEASSV------EAYSEEAITKSANLATFEVEDSA---LANLREYALANSLYWAMAEGHACEISARRNAMENASKNAGEMINKFQILYNRQRQAAITGELVEIITGA 291
>gi|116619603|ref|YP_821759.1| ATP synthase F1, gamma subunit [Solibacter usitatus Ellin6076] >gi|122255868|sp|Q02BU2|ATPG_SOLUE ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|116222765|gb|ABJ81474.1| ATP synthase F1, gamma subunit [Solibacter usitatus Ellin6076] (286 aa)
Score = 283, Expect = 1.6e-23, Identities = 86/283 (30%), Positives = 156/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSN---------SDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIK--SNDEIW--LIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           M SL +I++RI+ +++T +IT AMK+VS+AKL++ ++     +I  + +  L   +  N         S +E   L + EE + + +      GL G+FN N++K   + +   S ++I   LIG+KG++  + +  E  +S +       + ++    IA   +  ++N   I ++ ++Y++F + +S   ++  +LP +       L +  N  D+  +    D+   +L  Y+    + A++ES   E+A+R  AMDSAT NA E+I    L  NR RQ+ IT+EI E+VSGA
  S:     1 MPSLIDIRRRIRSVKNTQQITKAMKMVSAAKLRRAQD----RTIAARPYGTLLRKVLGNVAAAVANDESAAENPLLARREERRILLVVITGDKGLAGAFNTNLIKAASRFVAEHSGEQITFELIGRKGRDYFRKR--EVAVSGEAIGLAAKVKYEDTAAIARRAMELFRNQ-EIDAVYLVYNEFKSVVSQKLTLSRVLPAE-------LPEQANPVDYIFEEPPADMLNILLPKYVEMEFYRALLESAASEHAARMTAMDSATSNAAEMIDKLTLYMNRVRQASITKEIIEVVSGA 282
>gi|148270310|ref|YP_001244770.1| ATP synthase F1, gamma subunit [Thermotoga petrophila RKU-1] >gi|147735854|gb|ABQ47194.1| ATP synthase F1, gamma subunit [Thermotoga petrophila RKU-1] (278 aa)
Score = 282, Expect = 1.6e-23, Identities = 93/280 (33%), Positives = 147/280 (52%)
  Q:     6 EIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEG-KTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDE--IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           +IK++I   +S  KIT AM++V+ AK++K +    +E   +K FYD    + +   +E L     EEG + + +   S MGLCGSFN  I++E ++ I  + +  + L+G K  N  K   +        E+ D    F     I E++L     D     ++VI+S+F N L   P V  LLP+ K  EK R        DF  +P    +   I   YL+  +   + ++K+ E  +R+NAM +AT NA E+I+   L +N+ RQ+ ITQE+ EIV+GA+ 
  S:     8 QIKRKINATQSLMKITRAMEMVARAKVRKIE----SEYQKFKPFYDEVKRLWALVPAESLDPIFFEEGNRDLIVVITSDMGLCGSFNSEILREAERVISESRDPHLILVGLKAINHFKDGKVLKMYDRFYEIPD----FRNGSTIVEDILNFL--DGKPARVRVIFSRFKNVLIQRPEVHELLPIKKE-EKKR-------EDFEYEPRLEQIAPLIFHYYLSATLMELMFQTKIGEYYARQNAMKNATDNAQEVIRELTLAYNKARQASITQELIEIVTGAEA 272
>gi|196477122|gb|ACG76650.1| ATP synthase F1, gamma subunit atpG [Phenylobacterium zucineum HLK1] (290 aa)
Score = 282, Expect = 1.7e-23, Identities = 79/285 (27%), Positives = 160/285 (56%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFY----DLFTYIKSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYN---IKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           MASL E++ RI  +++T KIT AM++V++AKL+K ++   N   Y ++      +L   +  +   ++L+   S+    + +A  S  GL G FN  IV+  ++ I +      +  +  IG+K ++ ++    E  ++      +  +       +AE + A+ +  +    +  + +++S F + ++  P+V  L+P + A  +  LD    GA +  +P+   + E++L   + T +  A +E++    A++  AMD+AT+NA ++I +  L++NR RQ++IT+E+ EI+SGA+ 
  S:     1 MASLKEMRNRIGSVKATQKITKAMQMVAAAKLRKAQDAAQNARPYAQRMASVIANLAAGVSGDGAPKLLAGTGSDRRHLVVVAT-SDRGLAGGFNSAIVRAARERINALSAEGKDVRVITIGRKARDQLRRLAGERLVATYEAGSNPSL------AVAEEVSARIQEMFEAGEVDVVHLVFSSFKSVVTQQPTVRQLIPAEVAAGQAPLDL--KGATYEYEPDEEQILETLLPRNVTTQLLSATLENQAGFYAAQMTAMDNATRNAGDMIASLTLQYNRSRQAQITKELIEIISGAEA 289
>gi|58580354|ref|YP_199370.1| F0F1 ATP synthase subunit gamma [Xanthomonas oryzae pv. oryzae KACC10331] >gi|84622324|ref|YP_449696.1| F0F1 ATP synthase subunit gamma [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|188578712|ref|YP_001915641.1| ATP synthase F1, gamma subunit [Xanthomonas oryzae pv. oryzae PXO99A] >gi|123523192|sp|Q2P7Q5|ATPG_XANOM ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|75508329|sp|Q5H4Y5|ATPG_XANOR ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|58424948|gb|AAW73985.1| ATP synthase gamma chain [Xanthomonas oryzae pv. oryzae KACC10331] >gi|84366264|dbj|BAE67422.1| ATP synthase gamma chain [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|188523164|gb|ACD61109.1| ATP synthase F1, gamma subunit [Xanthomonas oryzae pv. oryzae PXO99A] (287 aa)
Score = 282, Expect = 1.8e-23, Identities = 80/283 (28%), Positives = 157/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTI-WLAFFSSMGLCGSFNLNIVKELQKHIK------SNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EIK +IK +++T K+T A+++VS++K++K +E       Y +    +  ++ ++++D +   L + E+ K + ++   S  GL G  N N+ +++   ++      +  ++  IG+K     +   +    S+   L D      L  +I   + A  +    +  + ++Y++FVN+++   S   LLPL  A  K      ++  D+  +P+A  V E ++  Y+ + ++ A++E+   E+A+R  AM +A+ NAN++I   +L +N+ RQ+ ITQEI+EIVSGA
  S:     1 MAGGREIKTKIKSVQNTRKVTRALEMVSASKIRKAQERMKTSRPYAQAMKQVIGHLAQASTDFQHPFLIEREQVKRVGYIVISSDRGLAGGLNNNLFRKMLGEVRPWQGTGAEIDVVTIGQKASAFFRRIKVNMVGSVT-HLGDSPQVEQLIGVIKVMIDAFIEG--KVDRVYLVYNRFVNTMTQKASFDQLLPLPAAEHK----VAHHDWDYLYEPDAASVLEHVMTRYIESLVYQAVLENVASEHAARMVAMKAASDNANKMIGTLQLVYNKARQAAITQEISEIVSGA 284
>gi|153206120|ref|ZP_01945383.1| ATP synthase F1, gamma subunit [Coxiella burnetii 'MSU Goat Q177'] >gi|165918715|ref|ZP_02218801.1| ATP synthase F1, gamma subunit [Coxiella burnetii RSA 334] >gi|120577250|gb|EAX33874.1| ATP synthase F1, gamma subunit [Coxiella burnetii 'MSU Goat Q177'] >gi|165917543|gb|EDR36147.1| ATP synthase F1, gamma subunit [Coxiella burnetii RSA 334] (289 aa)
Score = 282, Expect = 1.9e-23, Identities = 84/283 (29%), Positives = 162/283 (57%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIK-SNSDSEILSLKKSEEGKTI-WLAFFSSMGLCGSFNLNI----VKELQKHIKSN--DEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPN-ANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           M+   EI+ +I  I++T KIT AM+LV+++K++K ++       Y  K   + +++  S+++     L++ E  K + ++   +  GLCG  N+N+    + +++K    N   ++ +IG+KG+   +  G       D   D  ++  D+  I+ + +L +Y +   I +I +  ++FVN++   P V  LLPL    E+          D+  +P+ + D+ E +L+ Y+ + ++ A++E+  CE ++R  AM +AT+NA +LI   +L +N+ RQ+ IT+EI EIV+GA
  S:     1 MSKAREIRTKIASIKNTQKITRAMELVAASKMRKAQDRMAISRPYASKIRKVISHVAASHAEYPHPYLQQRENIKRVGYIIVTTDRGLCGGLNVNLFRTAIADMKKWQADNIGMDLCVIGRKGEAFFRRYGGNVLAVADHLGDAPEVQ-DIIGIV-KVMLDQY-DKQQIDAIYIATNEFVNTMVQKPLVRQLLPLKTDEEEVE----GGYWDYIYEPDESKDLLEMLLVRYIESQVYQAVIENIACEQSARMVAMKNATENAGQLIDELRLIYNKARQAGITREIAEIVAGA 285
>gi|157144367|ref|YP_001451686.1| F0F1 ATP synthase subunit gamma [Citrobacter koseri ATCC BAA-895] >gi|166222543|sp|A8ACN7|ATPG_CITK8 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|157081572|gb|ABV11250.1| hypothetical protein CKO_00071 [Citrobacter koseri ATCC BAA-895] (287 aa)
Score = 282, Expect = 1.9e-23, Identities = 80/283 (28%), Positives = 158/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKS-NSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKG--IEAEISLDLELDDKDINFDLFHIIAE-NLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  +++T KIT AM++V+++K++K ++       Y      +  ++ + N + +   L++ +  +  +L   +  GLCG  N+N+ K+L   +K+        ++ +IG KG +   S G  + A+++    + D   N  L  +I    ++ +  ++  +  + ++ +KF+N++S  P++  LLPL  A E   L +     D+  +P+   + +++L  Y+ + ++  +VE+   E A+R  +M +AT N   LIK  +L +N+ RQ+ ITQE+TEIV GA
  S:     1 MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQDRMAASRPYADTMRKVIGHLANGNLEYKHPYLEERDVKRVGYLVVSTDRGLCGGLNINLFKKLLADMKAWSDKGVQCDLAMIGSKGVSFFSSVGGNVVAQVT---GMGD---NPSLSELIGPVKVMLQAYDEGRLDKLYIVSNKFINTMSQVPTITQLLPL-PASEDDELKRKT--WDYLYEPDPKALLDTLLRRYVESQVYQGVVENLASEQAARMVSMKAATDNGGSLIKELQLVYNKARQASITQELTEIVGGA 284
>gi|87200414|ref|YP_497671.1| F0F1 ATP synthase subunit gamma [Novosphingobium aromaticivorans DSM 12444] >gi|123488845|sp|Q2G5N6|ATPG_NOVAD ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|87136095|gb|ABD26837.1| ATP synthase F1, gamma subunit [Novosphingobium aromaticivorans DSM 12444] (290 aa)
Score = 282, Expect = 2.0e-23, Identities = 86/285 (30%), Positives = 148/285 (51%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYD----LFTYIKSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDE------IWLIGKKGKNLIKS---KGIEAEISLDLELDDKDINFDLFHIIAENLLAKYK-NDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           MASL E+K RI  ++ST KIT A ++V++AKL+K +        Y  +  +    L   +    +  +L        + + +   +  GLCG  N NI+KE +   ++ +        +L+GKKG+  I+     GI A     L    +   FD    IA+ LLA ++   +++  +  +  +F N+L+  P    ++P+        +D     A    +P   ++ E +L  Y+ T I GA++E +  E  +   AMD+AT+NA ELI    +++NR RQ+ IT E+ EI++GA+ 
  S:     1 MASLKELKGRINSVKSTQKITKAKQMVAAAKLRKAQAAAEAARPYASRLAEVMGSLAAKVAGQDNGPLLMRGTGSNQRHLLVVVNTDKGLCGGLNSNIIKEAKLQARALEAAGKTVTFYLVGKKGRAPIRRDYPNGIAAGYDTSLV---RTPGFDEAAAIAQELLALFEAGKFDVAHL--VAPEFKNALTQLPVTTQIIPVPAPTNTVAID-----AVVEYEPGEEEILEELLPRYVTTQIFGALLEREASEQGASMTAMDNATRNAGELINKLTIQYNRSRQAAITTELIEIIAGAEA 289
>gi|78049324|ref|YP_365499.1| F0F1 ATP synthase subunit gamma [Xanthomonas campestris pv. vesicatoria str. 85-10] >gi|123584138|sp|Q3BP14|ATPG_XANC5 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|78037754|emb|CAJ25499.1| ATP synthase gamma chain [Xanthomonas campestris pv. vesicatoria str. 85-10] (287 aa)
Score = 282, Expect = 2.0e-23, Identities = 80/283 (28%), Positives = 157/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTI-WLAFFSSMGLCGSFNLNIVKELQKHIK------SNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EIK +IK +++T K+T A+++VS++K++K +E       Y +    +  ++ ++++D +   L + E+ K + ++   S  GL G  N N+ +++   ++      +  ++  IG+K     +   +    S+   L D      L  +I   + A  +    +  + ++Y++FVN+++   S   LLPL  A  K      ++  D+  +P+A  V E ++  Y+ + ++ A++E+   E+A+R  AM +A+ NAN++I   +L +N+ RQ+ ITQEI+EIVSGA
  S:     1 MAGGREIKTKIKSVQNTRKVTRALEMVSASKIRKAQERMKTSRPYAQAMKQVIGHLAQASTDFQHPFLVEREQVKRVGYIVISSDRGLAGGLNNNLFRKMLGEVRPWQDTGAEIDVVTIGQKASAFFRRIKVNMVGSVT-HLGDSPQVEQLIGVIKVMIDAFIEG--KVDRVYLVYNRFVNTMTQKASFDQLLPLPAAEHK----VAHHDWDYLYEPDAATVLEHVMTRYIESLVYQAVLENVASEHAARMVAMKAASDNANKMIGTLQLVYNKARQAAITQEISEIVSGA 284
>gi|116254140|ref|YP_769978.1| F0F1 ATP synthase subunit gamma [Rhizobium leguminosarum bv. viciae 3841] >gi|166224091|sp|Q1MAZ1|ATPG_RHIL3 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|115258788|emb|CAK09894.1| putative ATP synthase gamma chain [Rhizobium leguminosarum bv. viciae 3841] (294 aa)
Score = 282, Expect = 2.1e-23, Identities = 80/285 (28%), Positives = 159/285 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSE---ILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYK-NDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           M SL ++K RI  +++T KIT AMK+V++AKL++ +E       Y ++   +   I K+ +D++    L     ++   + +   +  GLCG FN  I +  ++H++         +I+ +GKKG ++++ +     I      D K + F+    I + ++  Y   ++++ ++   YS+F + +S  P+   L+P      +   D  + GA +  +P+   + E ++   ++  I  A++E+   E  ++ +AMD+AT+NA E+I    L +NR+RQ++IT+E+ EI+SGA+ 
  S:     1 MPSLKDLKNRIASVKATQKITKAMKMVAAAKLRRAQEAAEAARPYSQRMGAVLANIAKAVTDADGAPTLMTGTGQDQVHLLVVCTAERGLCGGFNSQIARFAREHVRKLVAEGKTVKIFTVGKKGYDILRREFASLIIERKELRDVKRVGFENADQIGKRIIEMYAAGEFDVCTL--FYSEFKSVISQIPTAQRLIPASAEAVQAE-DAEHAGAVYEYEPDPASILEDLIPRNISVQIFRALLENVAGEMGAKMSAMDNATRNAGEMINKLTLSYNRQRQAQITKELIEIISGAEA 293
>gi|190893717|ref|YP_001980259.1| H(+)-transporting ATP synthase protein, gamma subunit [Rhizobium etli CIAT 652] >gi|190698996|gb|ACE93081.1| H(+)-transporting ATP synthase protein, gamma subunit [Rhizobium etli CIAT 652] (294 aa)
Score = 281, Expect = 2.1e-23, Identities = 81/285 (28%), Positives = 162/285 (56%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKT---IWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYK-NDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           M SL ++K RI  +++T KIT AMK+V++AKL++ +E       Y ++   +   I K+ +D++   +  +  GK    + +   +  GLCG FN  I +  + H++         +I+ +GKKG ++++ +     +      + K I F+    I + ++  ++  ++++ ++   YS+F + +S  P+   L+P  KA E    D  + GA +  +P+   + + ++   ++  I  A++E+   E  ++ +AMD+AT+NA E+I    L +NR+RQ++IT+E+ EI+SGA+ 
  S:     1 MPSLKDLKNRIASVKATQKITKAMKMVAAAKLRRAQEAAEAARPYSQRMNTVLANIAKAVTDADGAPVLMTGTGKDQVHLLVVCTAERGLCGGFNSQIARFARDHVRKLVAEGKTVKIFTVGKKGYDILRREFASLIVERKELREVKKIGFENADQIGKRIIEMFEAGEFDVCTL--FYSEFKSVISQVPTAQQLIPA-KAPEAVAEDADHAGAVYEYEPDPAAILDDLIPRNISVQIFRALLENVAGEMGAKMSAMDNATRNAGEMINKLTLSYNRQRQAQITKELIEIISGAEA 293
>gi|87121036|ref|ZP_01076927.1| ATP synthase gamma chain [Marinomonas sp. MED121] >gi|86163528|gb|EAQ64802.1| ATP synthase gamma chain [Marinomonas sp. MED121] (286 aa)
Score = 281, Expect = 2.1e-23, Identities = 86/283 (30%), Positives = 157/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIK--SNDEIWL----IGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYK------NDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  I +T KIT AM+ V+++K +K ++       Y ++   +  ++  +N + +   L + E  +  ++   S  GLCG  N+N+ K+  K ++  +N++I +    +G K  +   + G     ++    D  +         AENL+   K      ++  I  + V+ ++FVN+++  P V  LLPL+ A E   L    +  D+  +P A ++   +L+ Y+ + ++ ++VE+  CE A+R  AM +AT NA ++I   +L +N+ RQ+ ITQEI+EIVSGA
  S:     1 MAVGKEIRTQISSINNTRKITRAMEKVAASKTRKAQDRMAASRPYAERIRQVIGHLANANPEYKHRYLTEREAKRVGYIVVSSDRGLCGGLNVNVFKKTIKDMEQFANEDIEIDICAVGSKSVSFFNNYGGNVTAAVTGLGDAPE---------AENLVGSVKVMLDAFDEGKIDRLYVVSNEFVNTMTQKPRVEQLLPLN-AEENAEL---QHHWDYIYEPEAVEILNDLLVRYIESQVYQSVVENIACEQAARMLAMKNATDNAGDIINELQLVYNKARQAAITQEISEIVSGA 283
>gi|15607016|ref|NP_214398.1| ATP synthase F1 gamma subunit [Aquifex aeolicus VF5] >gi|81669697|sp|O67829|ATPG_AQUAE ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|2984265|gb|AAC07791.1| ATP synthase F1 gamma subunit [Aquifex aeolicus VF5] (291 aa)
Score = 281, Expect = 2.2e-23, Identities = 88/283 (31%), Positives = 157/283 (55%)
  Q:     3 SLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEGKTIWLAFFSS-MGLCGSFNLNIVKELQKHIKSNDE------IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           S  +IK++I+ I++T +ITNAMK+VS+AKL+K +EL      Y +K Y+L  ++ ++ D+E   L    E + + +   ++  GL G+FN N+++  +  I+  +E      + L+G+KG      +G       D E+  K +NF++   +AE +  ++ N      + +I ++ V   S+ P V   LP + A EK    +      +  + +  + F+ I+  YL   ++ A+VES   E+ +R  AMD+ATKNA +LI+ + L FN+ RQ  IT E+ +I +  + 
  S:     5 SPRDIKRKIQGIKNTKRITNAMKVVSAAKLRKAQELVYASRPYSEKLYELVGHLAAHVDTEDNPLFDVREERNVDVILVTADRGLAGAFNSNVIRTAENLIREKEEKGVKVSLILVGRKGFQYFTKRGYNVIKGYD-EVFRKTVNFNVAKEVAEIVKERFLNG-ETDRVYLINNEMVTRASYKPQVRVFLPFE-AQEK----EVEELGTYEFEVSEEEFFDYIVNLYLNYQVYRAMVESNAAEHFARMIAMDNATKNAEDLIRQWTLVFNKARQEAITTELIDITNAVEA 287
>gi|148543701|ref|YP_001271071.1| ATP synthase F1, gamma subunit [Lactobacillus reuteri F275] >gi|184153111|ref|YP_001841452.1| ATP synthase gamma subunit [Lactobacillus reuteri F275] >gi|194468264|ref|ZP_03074250.1| ATP synthase F1, gamma subunit [Lactobacillus reuteri 100-23] >gi|148530735|gb|ABQ82734.1| ATP synthase F1, gamma subunit [Lactobacillus reuteri F275] >gi|183224455|dbj|BAG24972.1| ATP synthase gamma subunit [Lactobacillus reuteri F275] >gi|194453117|gb|EDX42015.1| ATP synthase F1, gamma subunit [Lactobacillus reuteri 100-23] (314 aa)
Score = 281, Expect = 2.2e-23, Identities = 94/285 (32%), Positives = 154/285 (54%)
  Q:     2 ASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFT-YIKSNSDSEILS--------LKKSEEGKTIWLAFFSSMGLCGSFNLNIVKE----LQKH--IKSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNG-----------------ADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKGE 286
           ASL  +K +I   +ST +IT+AM++VS+AKL + +       +Y +K   + +  +KS+S +   S         KK    KT  L   S  GL GS+N NI+K+    + KH   K N     +GK G    K +G+          D     +   H I +  +  Y +D     + ++YS +VN ++    V  +LP+    EK  LD  N                   A++  +P+  ++  +++  Y  + I+GAI+++K  E++S  NAM SAT NA+++I   +L++NR RQ+ IT EITEI  G   +
  S:     3 ASLAAVKHKIDSTKSTRQITSAMQMVSTAKLNQIQHHTQTYEVYAEKVKQMLSDLVKSHSATSAASQDDVYAALFKKRAVKKTGVLVITSDRGLVGSYNSNIIKQTLDMMAKHNLDKDNTVFLTVGKTGTEFFKKRGMNVVYEYSGVSDVP--TYREVHSIVKTAVQMY-SDQVFDEMYMVYSHYVNRITSNVIVHDVLPI---TEKSLLDDENEAQENTELNNSDVSTAHVSAEYEFEPSDTEIISALVAQYAESLIYGAILDAKTSEHSSSANAMRSATDNADDIISTLELQYNRARQAAITTEITEITGGMTAQ 313
>gi|118579044|ref|YP_900294.1| F0F1 ATP synthase subunit gamma [Pelobacter propionicus DSM 2379] >gi|118501754|gb|ABK98236.1| ATP synthase F1, gamma subunit [Pelobacter propionicus DSM 2379] (288 aa)
Score = 281, Expect = 2.2e-23, Identities = 82/284 (28%), Positives = 151/284 (53%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEGKTIWLAFFSS-MGLCGSFNLNIVKELQKHIKSNDE------IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKS---IKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAK 284
           MASL  IKKRI  +++T +IT AMK+VS+AKL++ +E  +    Y  K  ++     +    +   L +  + K + L   ++  GLCG+FN N+ K  ++ ++ N +      +  +G+KG    K++         +  +  DI     +  A  L  +    + + +   ++++Y+ F + ++   +   LLP+      P  + P    +F  +P+ N++   IL   +   +  +++ES   E+ +R  AMDSATKNA E+I    L++NR RQ+ IT E+ EI+SG++
  S:     1 MASLKSIKKRIVSVKNTYQITKAMKMVSAAKLRRAQENVVAARPYADKLREVLDIQAACLSEDAHPLMEHRQAKGLLLVVITADRGLCGAFNSNLCKAGERFLQENGDEYERIHVLTVGRKGYEYFKNR-------CKIYKNYTDIISSPTYARAAFLAQEVIRGFQVGTYDRVELLYNSFRSVMTQDITFQQLLPVVAVCPLPDDENP---PEFIYEPSRNELLAEILPKNIEVQLFRSVLESVAGEHGARMTAMDSATKNATEMIGKLTLQYNRARQAAITTELMEIISGSE 284
>gi|23009399|ref|ZP_00050461.1| COG0224: F0F1-type ATP synthase, gamma subunit [Magnetospirillum magnetotacticum MS-1] (294 aa)
Score = 281, Expect = 2.2e-23, Identities = 82/285 (28%), Positives = 158/285 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKK-SEEGKT---IWLAFFSSMGLCGSFNLNIVKELQKHIK------SNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYK-NDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           MASL +++ RI  +++T KIT AM++V++AKL++ +    N   Y +K   +   +  N    + + +  S  GK    + +      GL G+FN +I +  + H           +I  +GKKG ++++ +  +  I+      +K +++     IA+++LA+++  ++++ ++   YS+F + +S  P+   L+P +   +        + A    +PN   + E++L   L   +  A++E+   E  +R +AMDSAT+NA E+IK   L +NR RQ+ IT+E+ EI+SGA+ 
  S:     1 MASLKDLRNRITSVKATQKITKAMQMVAAAKLRRAQNAAENGRPYAEKMARVLGNLAGNLIGGVGAPRLLSGTGKDQVHLLVVCTGDRGLAGAFNSSIARLARDHANRLMTEGKTVKIMTVGKKGLDILRRQFRDQIIASRDIRGNKPVDYPFAAEIADDILARFEAGEFDVATL--FYSEFRSVISQIPTAQKLIPAELP-QAEAATAAGSDAAMEFEPNEKTILETLLPKNLTVQVFRALLENAASEQGARMSAMDSATRNAGEMIKKQTLVYNRTRQAMITKELIEIISGAEA 293
>gi|119189551|ref|XP_001245382.1| hypothetical protein CIMG_04823 [Coccidioides immitis RS] >gi|90304168|gb|EAS33799.1| hypothetical protein CIMG_04823 [Coccidioides immitis RS] (297 aa)
Score = 281, Expect = 2.3e-23, Identities = 87/282 (30%), Positives = 153/282 (54%)
  Q:     2 ASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS--NDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDI-NFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           A+L EI+ R+K I++  KITN MK+V+S +L K +        Y +    +F     N++++ L     E  KT+++   S  GLCG  +  + K  ++ I++  + +I ++G+K K  +  +  E  I +      KDI  F     IA+ + +    DY   S+K++Y+KF+N+ S+ P        +  I+ P      N   F +    N+V  ++    LA  ++ A+ E   CE ++RRNAMD+A+KNA ++I  +++ +NR+RQ+ IT E+ EI++GA
  S:    29 ATLREIEGRLKSIKNIEKITNTMKIVASTRLTKAQRAMSVSRAYGQTSETVF----ENAETKPL-----ENKKTLFVVASSDKGLCGGIHSGLSKATRRMIEAQPDADIVVLGEKSKGQL-GRTNEKNIVMSFSGVGKDIPTFADAQAIADQI-SLLPTDY--ASVKIVYNKFLNAQSYEPVTVEAFSEEAIIQSP------NVVAFEVD---NEVLANLREYALANSLYWALAEGHACEISARRNAMDNASKNAGDMISRFQILYNRQRQAAITGELVEIITGA 291
>gi|154280292|ref|XP_001540959.1| hypothetical protein HCAG_04799 [Ajellomyces capsulatus NAm1] >gi|150412902|gb|EDN08289.1| hypothetical protein HCAG_04799 [Ajellomyces capsulatus NAm1] (298 aa)
Score = 281, Expect = 2.3e-23, Identities = 87/281 (30%), Positives = 152/281 (54%)
  Q:     3 SLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHI--KSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDI-NFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           +L EI+ R+K I++  KIT  MK+V+S +L K +    +   Y +          SN+  E    K  E  KT+++   S  GLCG  +  + K  ++ +  + + ++ ++G+K K  + S+  E  + L      KD+  F     IA+ +  +   DY   S+K+IY+KFVN+ S+ P V      +   + P L      + F ++   N+V  ++    LA  ++ A+ E   CE ++RRNAMD+A+KNA E+I+ +++ +NR+RQ+ IT E+ EI++GA
  S:    31 TLREIEGRLKSIKNIEKITKTMKIVASTRLNKAQRAMTDSRAYGQT---------SNAVFENAETKSLEGKKTLFVVASSDKGLCGGIHSGLSKATRRMVIEQPDADVVVLGEKAKAQL-SRTNEKNLILSFANVGKDLPTFAEAQAIADQI-TQLPTDY--ASVKIIYNKFVNAQSYEPVVVEAYSEEAITQSPNL------SAFEVE---NEVLANLREYALANSLYWALAEGHACEISARRNAMDNASKNAWEMIQKFQILYNRQRQAAITGELVEIITGA 292
>gi|15644359|ref|NP_229411.1| ATP synthase F1, subunit gamma [Thermotoga maritima MSB8] >gi|170289063|ref|YP_001739301.1| ATP synthase F1, gamma subunit [Thermotoga sp. RQ2] >gi|4982183|gb|AAD36678.1|AE001805_3 ATP synthase F1, subunit gamma [Thermotoga maritima MSB8] >gi|170176566|gb|ACB09618.1| ATP synthase F1, gamma subunit [Thermotoga sp. RQ2] (273 aa)
Score = 281, Expect = 2.3e-23, Identities = 93/280 (33%), Positives = 147/280 (52%)
  Q:     6 EIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEG-KTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDE--IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           +IK++I   +S  KIT AM++V+ AK++K +    +E   +K FYD    + +   +E L     EEG + + +   S MGLCGSFN  I++E ++ I  + +  + L+G K  N  K   +        E+ D    F     I E++L     D     ++VI+S+F N L   P V  LLP+ K  EK R        DF  +P    +   I   YL+  +   + ++K+ E  +R+NAM +AT NA E+I+   L +N+ RQ+ ITQE+ EIV+GA+ 
  S:     3 QIKRKINATQSLMKITRAMEMVARAKVRKIE----SEYQKFKPFYDEVKRLWALVPAESLDPIFFEEGNRDLIVVITSDMGLCGSFNSEILREAERVISESRDPHLILVGLKAINHFKDGKVLKMYDRFYEIPD----FRNGSTIVEDILNFL--DGKPARVRVIFSRFKNVLIQRPEVHELLPIKKE-EKKR-------EDFEYEPRLEQIAPLIFHYYLSATLMELMFQTKIGEYYARQNAMKNATDNAQEVIRELTLAYNKARQASITQELIEIVTGAEA 267
>gi|17548035|ref|NP_521437.1| F0F1 ATP synthase subunit gamma [Ralstonia solanacearum GMI1000] >gi|81768465|sp|Q8XU75|ATPG_RALSO ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|17430341|emb|CAD17106.1| probable atp synthase gamma chain protein [Ralstonia solanacearum] (291 aa)
Score = 281, Expect = 2.3e-23, Identities = 79/283 (27%), Positives = 153/283 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPL--DKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +IK +++T KIT AM++V+++K+++ +E   +   Y +K  ++  ++ ++N + +   + K +  +   +   +  GLCG  N N+++ +   ++         +   IG KG   +   G +  +S  + L D      L   I   L A    +  I ++ + Y++F+N++   P V  LLPL  DK + +   +K     D+  +P+A  V + +LI Y+   ++ A+ E+   E ++R  AM +A+ NA  +I   +L +N+ RQ+ IT+E++EIV GA
  S:     1 MAGTKEIRTKIKSVQNTRKITKAMEMVAASKMRRAQERMRSARPYAEKIRNVAAHMAQANPEYQHPFMVKRDVKRAGLIVVTTDKGLCGGLNTNVLRAVTNQLRDLQNKGVESQATAIGSKGMQFLGRIGAKV-VSNVVHLGDTPHLEKLIGAIKVQLDAFTAGE--IDAVYLAYTRFINTMRQEPVVEQLLPLTADK-LTQTAAEKQAYSWDYIYEPDAQTVVDELLIRYVEALVYQAVAENMASEQSARMVAMKAASDNAKNVIGELQLVYNKTRQAAITKELSEIVGGA 288
>gi|45593079|gb|AAS68124.1| ATP synthase gamma subunit [Bifidobacterium breve] (307 aa)
Score = 281, Expect = 2.4e-23, Identities = 75/283 (26%), Positives = 150/283 (53%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSD-SEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSND------EIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKY---KNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGAD--------FSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           M S   +K RI   ES +KI NA ++++S+ + K +++ LN   Y    +D    + +++  +  +++K     +   LA  S  G+ G +  +I++E +  +   D      E+++ G++G    K +    +I+   E D      ++   I+  L+  Y        +  + ++Y++F+N +     V  +LP++    + ++  P+  A         ++ +P+  +V ++IL  Y+ + IH  ++ +   E ASR+NAM +AT NA+ LI +   + N  RQ+ ITQE+TEI+  A
  S:     1 MGSQLALKSRIHSTESLAKIFNAQEMIASSHIAKARDVALNAKPYTDAIFDAVQALVAHTHITHPIAVKDENNPRVAVLALTSDRGMAGPYTSSIIRETESLLARLDAAGKQPELFVYGRRGSTYYKYR--NRDIAATWEGDTDQPGVEIAETISSTLMDAYMKPAEQGGVSELYIVYTEFINMVVQKVRVLRMLPVEIVENEAKVPAPDEEAPAVADVAPLYTFEPSIEEVLDAILPKYIQSRIHECLLTAAASETASRQNAMHTATDNAHNLIDDLTRKLNASRQASITQELTEIIGSA 299
>gi|85374582|ref|YP_458644.1| F0F1 ATP synthase subunit gamma [Erythrobacter litoralis HTCC2594] >gi|122544084|sp|Q2N8Z4|ATPG_ERYLH ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|84787665|gb|ABC63847.1| ATP synthase F1, gamma subunit [Erythrobacter litoralis HTCC2594] (290 aa)
Score = 281, Expect = 2.6e-23, Identities = 88/285 (30%), Positives = 154/285 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI--KSNSDSEILSLKKS-EEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKGIEAEISLDLELDD-KDINFDLFHIIAENLLAKYK-NDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           MASL E+K RI  ++ST KIT A ++V++AKL++ +        Y ++  D+   +  K + DS    L  S  + K + +   +  GLCG  N NIVKE +   K       + + +L+GKKG+  IK +  E +I+   +    K   F+    IA  L+  ++  ++++  +  +Y  F ++L   P+   L+P    +  P  +     A    +P   ++ E +L  Y+ T + GA++E +  E  +   AMD+AT+NA +LI    +++NR RQ+ IT E+ EI++GA+ 
  S:     1 MASLKELKDRIGSVKSTQKITKAKQMVAAAKLRRAQANAEAARPYAERLADVMASLAGKVSGDSAPRLLAGSGNDQKHLLVVVNTDKGLCGGLNSNIVKEAKAQAKKLIAAGKDVQFYLVGKKGRAPIK-RDYEKQIAKHFDTSTVKQPGFEEADAIANELIDMFEAGEFDVAHL--VYPTFKSALVQDPTTNQLIP----VPSPEGEGTGGDAVVEYEPGEEEILEELLPRYVKTQLFGALLEREASEQGASMTAMDNATRNAGDLINKLTIQYNRSRQAAITTELIEIIAGAEA 289
>gi|196158879|ref|YP_002128368.1| ATP synthase subunit C [Alteromonas macleodii 'Deep ecotype'] >gi|88773292|gb|EAR04560.1| ATP synthase subunit C [Alteromonas macleodii 'Deep ecotype'] >gi|196114658|gb|ACG68374.1| ATP synthase subunit C [Alteromonas macleodii 'Deep ecotype'] (286 aa)
Score = 281, Expect = 2.6e-23, Identities = 83/283 (29%), Positives = 156/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKS-NSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDE------IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MAS  EIK +I  I++T KIT+AM++V+++K+KK +E   +   Y +    +  +I + N +     L++ E  +  ++   +  GLCG  N N  K + + +K   E         +G K  +     G +  ++ +  L DK  +      +   +L  Y ++  I  + ++++ FVN+++  P +  LLPL K+ +    ++  +  D+  +P+  ++ E++++ Y+ + ++  +VE+   E A+R  AM +AT NA  LI   +L +N+ RQ+ ITQEI+EIVSGA
  S:     1 MASGKEIKGKIGSIKNTQKITSAMEMVAASKMKKAQERMASGRPYAQNMLKVIGHIANGNLEYRHPYLEEREVKRVGYIVISTDRGLCGGLNTNEFKLVTQDVKKWREQGVEVDFAALGSKACSFFNRFGGKL-LAAESGLGDKP-SVSDVVGVVRVMLKAY-DEGQIDRVFLVFNDFVNTMTQKPVINQLLPLPKSED----EEYQHRWDYIYEPDPKEILEALMVRYIESQVYQGVVENAASEQAARMVAMKAATDNAGNLIDELQLVYNKARQAAITQEISEIVSGA 283
>gi|153815544|ref|ZP_01968212.1| hypothetical protein RUMTOR_01780 [Ruminococcus torques ATCC 27756] >gi|145847186|gb|EDK24104.1| hypothetical protein RUMTOR_01780 [Ruminococcus torques ATCC 27756] (294 aa)
Score = 281, Expect = 2.6e-23, Identities = 83/286 (29%), Positives = 161/286 (56%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKK-QKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSE-----EGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSN---DEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKA-IEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKGE 286
           MA++ EI+ RI  ++ T KITNAM ++SS+K+   +K+L   E  +Y    ++   ++   D         E     E K   +   +  GL G++N NIVK L++ I +     +++++G+ G++    + ++ + +    + +  ++      IA  LL +++ +  +  I ++Y++  NS+     V  LLPL+++   + ++    +    ++ P+A  V +SI+ +Y+   ++GA+VE+   E+ +R  AM SAT +A  LI +  + +NR RQ+ ITQEITE+ SGA+ +
  S:     1 MANIREIQSRINSVKDTMKITNAMYMISSSKMTHAKKKLADTEPYFYGLQGEISRILRHLPDLHHGYFSARENVPEGERKIGSIVITADKGLAGAYNHNIVK-LEEEILARPGIHKLFIVGELGRHYFAKRDVQIDTNFQYTVQNPTMH--RARDIAAVLLDQFR-ERELDEIYIVYTRMENSVQAEAEVMKLLPLERSSFNEMKMPLNVHREAIALYPSAEAVMDSIIPNYVTGIVYGALVEAYASEHNARMMAMKSATDSAKSLIHDLSIIYNRARQAAITQEITEVCSGARAQ 292
>gi|78188124|ref|YP_378462.1| F0F1 ATP synthase subunit gamma [Chlorobium chlorochromatii CaD3] >gi|123580549|sp|Q3AUA6|ATPG_CHLCH ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|78170323|gb|ABB27419.1| H+-transporting two-sector ATPase, gamma subunit [Chlorobium chlorochromatii CaD3] (293 aa)
Score = 281, Expect = 2.6e-23, Identities = 90/285 (31%), Positives = 156/285 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEI--LSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDEIWLIGKKGKNLI--KSKGIE--AEISLDLELDDKDINFDLFHIIAENLLAKYKNDY---NIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           MA+L +I+ RIK ++ST ++T AMK+V++AKL++ ++  +    Y  K  ++   + +  D+ +  L   +SE  K + +   S  GLCG+FN NI+K   K I   D     GK G ++I   ++G E   +    L      +  +L   +A+ +     N Y    +  + V+Y++F + L+       LLP+          K N+G ++  +PN   + + +L  +L T +   ++ES   E A+R  AMDSAT+NA EL++   + +NR RQ+ IT E++EIV+GA+ 
  S:     1 MATLKDIRVRIKGVKSTQQVTKAMKMVAAAKLRRAQDRAIMARPYASKLKEMLASLSAKVDTSVNPLFAVRSEVNKVLVILVTSDRGLCGAFNGNIIKLAYKTIHE-DYAAQYGKGGVSMICAGTRGYEFFKKRHYTLTKGYPAVFQNLDFAVAKEIADMASNMYLRGEVDRVVVVYNEFKSVLAPQLKSEVLLPITSGDASA---KENSGGEYMYEPNPAAIIDVLLPKHLRTQVWRIMLESNAAEQAARMAAMDSATENAKELLRTLNISYNRARQAAITTELSEIVAGAEA 290
>gi|75534363|sp|Q9RQ77|ATPG_BUCSC ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|6478266|gb|AAF13781.1|AF129403_2 gamma subunit of membrane-bound ATP synthase [Buchnera aphidicola] (290 aa)
Score = 281, Expect = 2.6e-23, Identities = 93/283 (32%), Positives = 154/283 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNS-DSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKEL------QKHIKSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDIN-----FDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           M+   EIK +I  I +T KIT AM++VS AK+KK +    +   Y      + ++I  N      L L   +  K   +   +  GLCGS N+++ K++       K+      ++++G KG +  KS       + D+   +K I      FD  + I  +L  +Y N   I  + + Y++F N+L + P +  LLPL K I K      N+  D+  + N+  + +++L DY+ + I+ +I+E+  CE ASR  +M  AT N+ +LIK  ++ +N+ RQ  ITQE+TEI+SGA
  S:     1 MSEKKEIKNKINCISNTKKITKAMEMVSIAKMKKSEIKMKSRKPYLDIIKTIISHILYNHIKYRHLYLNNRKTKKIGIIVISTDRGLCGSLNISLFKKIIQLINIYKNKNVMSSLFILGSKGVSYFKSS------TYDITYYEKIITKNYTFFDCLNFIHSSL--EYYNTQKIDKLFLSYNQFKNTLVYIPVIMQLLPLSKKIFK---GNKNSHWDYIYESNSGILLDTLLNDYIESQIYQSILENCTCEQASRMISMKQATDNSEDLIKKLRILYNKARQDNITQELTEIISGA 284
>gi|21244375|ref|NP_643957.1| F0F1 ATP synthase subunit gamma [Xanthomonas axonopodis pv. citri str. 306] >gi|81799207|sp|Q8PGG6|ATPG_XANAC ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|21110033|gb|AAM38493.1| ATP synthase gamma chain [Xanthomonas axonopodis pv. citri str. 306] (287 aa)
Score = 281, Expect = 2.6e-23, Identities = 80/283 (28%), Positives = 157/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTI-WLAFFSSMGLCGSFNLNIVKELQKHIK------SNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EIK +IK +++T K+T A+++VS++K++K +E       Y +    +  ++ ++++D +   L + E+ K + ++   S  GL G  N N+ +++   ++      +  ++  IG+K     +   +    S+   L D      L  +I   + A  +    +  + ++Y++FVN+++   S   LLPL  A  K      ++  D+  +P+A  V E ++  Y+ + ++ A++E+   E+A+R  AM +A+ NAN++I   +L +N+ RQ+ ITQEI+EIVSGA
  S:     1 MAGGREIKTKIKSVQNTRKVTRALEMVSASKIRKAQERMKTSRPYAQAMKQVIGHLAQASTDFQHPFLIEREQVKRVGYIVISSDRGLAGGLNNNLFRKMLGEVRPWQDKGAEIDVVTIGQKASAFFRRVKVNMVGSVT-HLGDSPQVEQLIGVIKVMIDAFIEG--KVDRVYLVYNRFVNTMTQKASFDQLLPLPAAEHK----VAHHDWDYLYEPDAASVLEHVMTRYIESLVYQAVLENVASEHAARMVAMKAASDNANKMIGTLQLVYNKARQAAITQEISEIVSGA 284
>gi|22266798|gb|AAM94912.1|AF522463_7 subunit gamma [Ilyobacter tartaricus] (282 aa)
Score = 281, Expect = 2.7e-23, Identities = 90/283 (31%), Positives = 154/283 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSL--KKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSN--DEIWLI--GKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   E+K RIK ++ST +IT AM++VSS K K+   L      Y K    +   I +   SE   L   K +  K   +   S  GLCG FN   +K+++  I  N   E+ +I  GKK ++    +  + +    ++L  + + F+    I+EN++     D     + +IY++FV+++     +  +LP+++        +      +  +P+  D+  S+L  YL   I+ AI+E+   E+++R+NAM +AT NA E+I +  L++NR+RQ+ +TQEI+EIVSGA
  S:     1 MAGGKELKGRIKSVQSTHQITKAMEIVSSTKFKRFSALVNPSKPYSKSMDRVLENIAAGIKSEKHPLFDGKKDVKKIGVIVMTSDRGLCGGFNNATLKKMEALIAENPGKEVSIIATGKKARDYCNKRNYDLKAEY-IQLIPETM-FEKAKEISENIVEYLHADI-FDEVYMIYNEFVSAMQTELVMKRVLPIERV-------EAQENTTYIFEPSVEDILSSLLPKYLNIQIYQAILENTASEHSARKNAMKNATDNAEEMIADLNLQYNRERQAAVTQEISEIVSGA 279
>gi|50123429|ref|YP_052596.1| F0F1 ATP synthase subunit gamma [Pectobacterium atrosepticum SCRI1043] >gi|81693000|sp|Q6CYJ4|ATPG_ERWCT ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|49613955|emb|CAG77408.1| ATP synthase gamma chain [Erwinia carotovora subsp. atroseptica SCRI1043] (287 aa)
Score = 280, Expect = 2.8e-23, Identities = 80/283 (28%), Positives = 155/283 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIK-SNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKG--IEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +I  +++T KIT AM++V+++K++K +E       Y +   ++  ++   N + +   L++    +  +L   +  GLCG  N+N+ K+L   +KS        ++ LIG K  +   S G  I A+++    + D     +L   +   ++ +  ++  +  + ++ +KF+N++S  P +  +LPL  + +   L K     D+  +P+   + +++L  Y+ + ++  +VE+   E A+R  AM +AT N   LIK  +L +N+ RQ+ ITQE+TEIV GA
  S:     1 MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQERMAASRPYAETIRNVIGHLALGNLEYKHPYLEERGVKRVGYLVVSTDRGLCGGLNINLFKKLLADMKSWSDKGVETDLALIGSKAASFFGSVGGNIVAQVT---GMGDNPSVSELIGPV--KVMLQAYDEGRLDKLYIVSNKFINTMSQEPLIVQVLPLPPS-DDSELKK--KAWDYLYEPDPKSLLDTLLRRYVESQVYQGVVENLASEQAARMVAMKAATDNGGSLIKELQLVYNKARQASITQELTEIVGGA 284
>gi|168177488|ref|ZP_02612152.1| ATP synthase F1, gamma subunit [Clostridium botulinum NCTC 2916] >gi|182671119|gb|EDT83093.1| ATP synthase F1, gamma subunit [Clostridium botulinum NCTC 2916] (282 aa)
Score = 280, Expect = 2.9e-23, Identities = 93/285 (32%), Positives = 150/285 (52%)
  Q:     2 ASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQ---KHIKSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKGE 286
           A L  I++RIK + +  KIT AM LVS+AKL+K +        YY ++  +   I +  +   + +  +   K +++ F S  GLCGSFN+NI+  +    K  K N  + +IG+KG+  +K  GI   ++  +E+ D     +    IA+N++  Y +   +  + ++YS+F + +     +  +LP  K       +  ++       P    + + IL +YL   I      SK  EN SR  AM+ AT NAN+L+ N  L+FNR RQS ITQEI+EIV GA+ +
  S:     4 AGLIGIRRRIKSVTNIRKITKAMGLVSTAKLRKARVNLEINKKYYNEYKIILKDIINFIEDSNIYIDGNGSHKKLYVIFTSDSGLCGSFNINIINNVINEIKEDKENSLVIVIGQKGRMYLKKLGINT-LAEYIEIPDVPTTKEA-RTIAKNIIKLYSSK-EVGEVFLVYSEFYSPVKQQVLINKILPFTK-------ENKSDNKYIEFNPPVTQLMDEILENYLKATILNCFSNSKASENGSRMTAMNGATDNANDLLDNLDLQFNRLRQSAITQEISEIVGGAEAQ 281
>gi|189220433|ref|YP_001941073.1| F0F1-type ATP synthase, gamma subunit [Methylokorus infernorum V4] >gi|189187291|gb|ACD84476.1| F0F1-type ATP synthase, gamma subunit [Methylacidiphilum infernorum V4] (293 aa)
Score = 280, Expect = 3.0e-23, Identities = 92/279 (32%), Positives = 159/279 (56%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEE-GKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDEIWLIGKKGKNLIKS-KGIEAEISL--DLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKA--IEKPRLDKP--NNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEI 279
           MA+  EI++RI+ I++T++IT AM++V+++K++K ++  +    Y+  F ++   +   +   I  L ++    K I     +  GLCG  N N+++E+ KH   N     +GKK +N +   KG   E  L  D EL D ++ F     I   L+ KY +   I +I + YS FVN L   P    + P+ K   ++K + + P   +   F+ +P+A ++ ES+L  Y+   I+ AI+++   E+++R  AM SAT+NA  L+++  LE+N+ RQ  IT+EI EI
  S:     1 MATTREIRRRIRSIKNTAQITKAMQMVAASKMRKAQQRAIEGRPYHSLFQEIVHSLIPQAGQLIHPLLEARAIQKEIVFVIGTDKGLCGPLNTNLLREIYKHHSPNHLYVSMGKKVRNYLSGLKGSRGENLLLADFELKD-NLTFREAKRIGHFLIEKYLHK-EIDAISIAYSHFVNPLIQKPIYRRIAPISKVELVKKEKAESPPAESVLPFNFEPSAEELLESLLPFYIHWEIYQAILDNLASEHSARMVAMKSATENAKSLLQDLSLEYNKARQESITKEILEI 285
>gi|84702332|ref|ZP_01016907.1| hypothetical protein PB2503_05202 [Parvularcula bermudensis HTCC2503] >gi|84691578|gb|EAQ17418.1| hypothetical protein PB2503_05202 [Parvularcula bermudensis HTCC2503] (292 aa)
Score = 280, Expect = 3.1e-23, Identities = 89/285 (31%), Positives = 158/285 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSN----SDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDEIWLIGKKGKNL----IKSKGIE--AEISLDL---ELDDKDI---NFDLFHIIAENLLAKYK-NDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           M SL ++K RI  ++ST KIT A ++V++AKL++ +E       Y  K   + T + +     +    L     ++   + +   +  GLCG+FN NIV+      ++ +EI  +  KGK +    + SKG +    I  DL    +D KD+    FD    IA+ LLA+Y+   +++ +  V Y +F + +S  P+   ++P   A    +     + A +  +P+   +  ++L  Y+A  +  A++E+   E A+   AMD+AT+NA +LI    L++NR RQ++IT E+ EI++GA+ 
  S:     1 MPSLKDLKNRIGSVKSTQKITKAKQMVAAAKLRRAEEAAKAARPYADKIESVLTNLAAGMTPGAPGPKLLTGTGKDDVHLLVVATADKGLCGAFNSNIVR------RAREEIVRLQGKGKKVKLFTVGSKGYDQLKRIYGDLIVERVDFKDVRQVGFDEAKSIADTLLAQYEAGAFDVAT--VFYGQFKSVISQVPTANQIIP---AQPPGKAADEASSAPYEYEPDEEAILRTLLPRYVAVQVFRALLENAASEQAASMTAMDNATRNAGDLIDKLNLQYNRARQAQITTELIEIIAGAEA 291
>gi|153811247|ref|ZP_01963915.1| hypothetical protein RUMOBE_01639 [Ruminococcus obeum ATCC 29174] >gi|149832745|gb|EDM87829.1| hypothetical protein RUMOBE_01639 [Ruminococcus obeum ATCC 29174] (296 aa)
Score = 280, Expect = 3.2e-23, Identities = 85/286 (29%), Positives = 158/286 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIK---------SNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVK---ELQKHIKSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQ--PNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKGE 286
           MA+  EIK RI  ++ T KITNAM ++SS+K+KK K++  +   Y   FY++ + I           +    +  L  +EE K   +      G+ G++N NI K   E   +   + +++++G  G+     K ++ + S    +    ++     +I+E ++  +  +  +  + +IY++  N++   P    LLPL K    P L+ P       I+  P+A+ V + ++ +YL   I+G +VE+   E+ +R  AM S+T +A +++++  +++NR RQ+ ITQEITE+ SGAK +
  S:     1 MANAREIKSRISSVQDTMKITNAMYMISSSKMKKAKKILSDTEPY---FYNMQSAIARILRHIPDIQHPFFSVRHLIPTEERKIATIVVTGDKGMAGAYNHNITKMTEEFMANTPGHHKLYVLGVVGRQYFSKKDVDMDGSFRYTVQKPTMH--RARMISEEVIRGFL-EREVDEVHIIYTQMQNAVVMEPVNMQLLPLKKTSFSP-LEMPAEVHQEEIEMFPSADGVLDIMIPNYLTGVIYGCLVEAYASEHNARMTAMQSSTDSAKKMLQDLSIQYNRARQAAITQEITEVCSGAKAQ 293
>gi|194476687|ref|YP_002048866.1| ATP synthase subunit C [Paulinella chromatophora] >gi|171191694|gb|ACB42656.1| ATP synthase subunit C [Paulinella chromatophora] (314 aa)
Score = 280, Expect = 3.6e-23, Identities = 97/285 (34%), Positives = 158/285 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSN---SDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKG--IEAEIS-LDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLD-KAIEKP------------RLD----------KPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           MA+L EI+ RI  +++T KIT AM+LV++AK+++ +E  L    +  K   +   ++S     D+E   L++      I L      GLCG +N N+VK  ++            ++ LIG K     K++   I A  S LD      + N      IA  +LA++ +  +   I++IY+KF+N +S  P V +LLPLD + I  P            RL           +P   +D   + +   +  ++L  YL   +  ++ E+   E ASR  AM +A+ NA +L K+  L++N+ RQ+ ITQEI E+V G+ G
  S:     1 MANLKEIRDRITSVKNTRKITEAMRLVAAAKVRRAQEQVLRSRPFADKLARVLENLQSRMRFEDAEAPLLEERPINSIILLGVTGDRGLCGGYNANVVKRTEQRFADLQSQGYKVDLVLIGSKIITYFKNRNYPIRAIFSGLDQVPTANEAN-----SIANEILAEFTSA-SADRIEIIYTKFINLVSSRPVVQTLLPLDPQGIASPDDEIFRLTTREGRLTIEVDSNTGNTQPTLPSDIIFEQSPEQLLNALLPIYLQNQLLRSLQEAAASELASRMTAMSNASDNAKQLAKSLTLDYNKARQAAITQEILEVVGGSLG 314
>gi|159045475|ref|YP_001534269.1| F0F1 ATP synthase subunit gamma [Dinoroseobacter shibae DFL 12] >gi|189081400|sp|A8LJR5|ATPG_DINSH ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|157913235|gb|ABV94668.1| ATP synthase F1, gamma subunit [Dinoroseobacter shibae DFL 12] (290 aa)
Score = 279, Expect = 3.6e-23, Identities = 84/285 (29%), Positives = 161/285 (56%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKS---NSDSEILSLKKSEEGKTIWLAFFSS-MGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIK---SKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYK-NDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           M +L ++K RI+ ++ST KIT AM++V++AKL++ ++       Y ++F  +   + +   +SDS    L  +   +T  L   ++  GLCG FN +I K  + H +         +I  +GKKG+  +K   SK     + L    + K +++D    IA ++L ++   ++++ +I   +++F + +S  P+   ++P   + E    D   +   +  +P+   +   +L   +AT I  A++E+   E  +R +AMD+AT+NA ++I+   +E+NR RQ+ IT E+ EI+SGA+ 
  S:     1 MPNLKDLKNRIESVKSTRKITKAMQMVAAAKLRRAQDAAEASRPYTERFNAVLAGLAASVGDSDSGPRLLVGTGSDQTHLLVVMTAERGLCGGFNSSIAKLARAHAEKLVAQGKTVKILTVGKKGREQLKRDLSKHFIGHVDLS---EVKRVSYDNAADIAADVLGRFDAGEFDVATI--FFNRFQSVISQIPTAQQIIP--ASFEG---DADADATLYDYEPSEEAILADLLPRGVATQIFAALLENGASEQGARMSAMDNATRNAGDMIERLTIEYNRSRQAVITNELIEIISGAEA 289
>gi|80098|pir||S17725 H+-transporting two-sector ATPase (EC 3.6.3.14) gamma chain - Bacillus firmus (289 aa)
Score = 279, Expect = 3.6e-23, Identities = 94/283 (33%), Positives = 153/283 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILS--LKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIK----SNDE--IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MASL +I+ RI   + T +IT AM++VS+AKL + +    + + Y  K  ++   I S S +EI    L++    KT ++   S  GL G +N ++++ L   IK    S DE  I ++G+ G++L K +G+   I   + L D+   F+    IA   +  +  D     + V Y+ FV+ ++   +   LL L       +    +  A +  +PN   + E +L  Y    I+G+++++K  E  +R  AM +AT NA+ LI+   L+FNR RQ+ ITQEITEIV GA
  S:     1 MASLRDIQGRITSTKKTKQITKAMQMVSAAKLNRAQHNAQSFTPYTDKIREVVAAIAS-SGTEISHPMLEERPVKKTGYIVVTSDKGLAGGYNSSLIRSLLNTIKERHNSPDEYGIIIMGRIGRDLFKKRGLPI-IQEVIGLPDQP-EFNDIKNIARTSVEMFA-DGIFDELYVWYNHFVSPITQDVTEMKLLLLTDIGSDEKATSAS--ASYEYEPNEQAILEKLLPQYAENLIYGSLLDAKASEFGARMTAMSAATDNASALIEELTLKFNRARQAAITQEITEIVGGA 285
>gi|90418836|ref|ZP_01226747.1| ATP synthase gamma subunit [Aurantimonas sp. SI85-9A1] >gi|90336916|gb|EAS50621.1| ATP synthase gamma subunit [Aurantimonas sp. SI85-9A1] (289 aa)
Score = 279, Expect = 3.7e-23, Identities = 85/285 (29%), Positives = 157/285 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKS--NSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSND------EIWLIGKKGKNLIK----SKGIEAEISLDLELDDKDINFDLFHIIAENLLAKY-KNDYNIKSIKVIYSKFVNSLSFTPSVFSLLP--LDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           MASL +++ RI  ++ST KIT AM++V++AKL++ +E       Y  +   +   I      D   L +   ++   + +   +  GLCG FN +IVK  + H +  +      +  ++GKKG + ++    SK IE     DL  + K + F+    I + ++  Y K ++++ S  V YS F N ++  P+   L+P  +D  +E+      N    +  +P   ++ E ++   +   +  A++E+   E  +R +AMD+AT+NA ++I    + +NR+RQ++IT E+ EI+SGA+ 
  S:     1 MASLKDLRNRIASVKSTQKITKAMQMVAAAKLRRAEEAAQAARPYADRMAAVLANISGAMEGDGPPLMVGNGKDDVHLLVVCTADRGLCGGFNSSIVKLARSHQRELEAAGKTVKFMVVGKKGWDQMRRDLASKVIE---RTDLR-EAKRVGFEHAEDIGQTIIDLYEKGEFDVCS--VFYSAFQNVVTQIPTRQRLIPASVDTGVEE------NASTIYEYEPEPGEILEDLIPRNIKIQVLHALLENAASEQGARMSAMDNATRNAGDMIDRLSVSYNRQRQAQITTELVEIISGAEA 288
>gi|116328614|ref|YP_798334.1| F0F1 ATP synthase subunit gamma [Leptospira borgpetersenii serovar Hardjo-bovis L550] >gi|116331343|ref|YP_801061.1| F0F1 ATP synthase subunit gamma [Leptospira borgpetersenii serovar Hardjo-bovis JB197] >gi|122280911|sp|Q04S17|ATPG_LEPBJ ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|122283599|sp|Q04ZU4|ATPG_LEPBL ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|116121358|gb|ABJ79401.1| Gamma subunit of the H(+)-transporting two- sector ATPase, F1 sector [Leptospira borgpetersenii serovar Hardjo-bovis L550] >gi|116125032|gb|ABJ76303.1| Gamma subunit of the H(+)-transporting two- sector ATPase, F1 sector [Leptospira borgpetersenii serovar Hardjo-bovis JB197] (286 aa)
Score = 279, Expect = 3.9e-23, Identities = 96/283 (33%), Positives = 154/283 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDS-EILSLKKSEEGKTI-WLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSI-QPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA+  EIKKRI  +++T KIT  M++VS+AK KK  +       +  K  +L + + S S       L++ E+ KT+  L   ++ GLCG +N N+ +  +  +        N  ++++GKKG +  K  G +AE +    LDDK   +      A   L  + N+  + ++++  + + +S S  P V  +LP + A       K  NG D  + +P+   V ES+L   + T    AI+E+   E  +RR AM SAT  A+E+IK     +NR RQ++ITQEI+EIV+GA
  S:     1 MATPREIKKRINSVKNTRKITRTMEMVSTAKSKKISDRVNASHPFSNKIKELVSSLASLSGVVHSPYLRRPEKIKTVALLVITANRGLCGGYNSNVNRLAKAKVAEWKKAGVNVRLFIVGKKGISFFKFAGEKAEKTYT-HLDDKS-GYKEAEEFANLFLELFANE-EVDAVEIASTVYYSSASQKPEVTRILPFEPA-------KEGNGNDLVVYEPSPERVLESLLPLVVKTAFLKAILEANCSEQIARRIAMKSATDAASEMIKLLTRGYNRVRQAKITQEISEIVAGA 282
>gi|153938889|ref|YP_001389518.1| F0F1 ATP synthase subunit gamma [Clostridium botulinum F str. Langeland] >gi|166222547|sp|A7G9Q8|ATPG_CLOBL ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|152934785|gb|ABS40283.1| ATP synthase F1, gamma subunit [Clostridium botulinum F str. Langeland] (282 aa)
Score = 279, Expect = 3.9e-23, Identities = 93/285 (32%), Positives = 149/285 (52%)
  Q:     2 ASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQ---KHIKSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKGE 286
           A L  I++RIK + +  KIT AM LVS+AKL+K +        YY ++  +   I +  +   + +  +   K +++ F S  GLCGSFN+NI+  +    K  K N  + +IG+KG+  +K  GI   ++  +E+ D     +    IA+N++  Y +   +  + ++YS+F + +     +  +LP  K       +  ++       P      + IL +YL   I      SK  EN SR  AM+ AT NAN+L+ N  L+FNR RQS ITQEI+EIV GA+ +
  S:     4 AGLIGIRRRIKSVTNIRKITKAMGLVSTAKLRKARVNLEINKKYYNEYKVILKDIINFIEDSNIYIDGNGSHKKLYVIFTSDSGLCGSFNINIINNVINEIKEDKENSLVIVIGQKGRMYLKKLGINT-LAEYIEIPDVPTTKEA-RTIAKNIIKLYSSK-EVGEVFLVYSEFYSPVKQQVLINKILPFTK-------ENKSDNKYIEFNPPVTQFMDEILENYLKATILNCFSNSKASENGSRMTAMNGATDNANDLLDNLDLQFNRLRQSAITQEISEIVGGAEAQ 281
>gi|170747038|ref|YP_001753298.1| ATP synthase F1, gamma subunit [Methylobacterium radiotolerans JCM 2831] >gi|170653560|gb|ACB22615.1| ATP synthase F1, gamma subunit [Methylobacterium radiotolerans JCM 2831] (296 aa)
Score = 279, Expect = 4.0e-23, Identities = 82/285 (28%), Positives = 161/285 (56%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSN-----SDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVK----ELQKHIKSNDE---IWLIGKKGKNLIKSKGIEAEI-SLDLELDDKDINFDLFHIIAENLLAKYK-NDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           MASL +++ RI  +++T KIT AM++V++AKL++ +        Y +K   +   +  N        ++LS   SE+   + +      GL G+FN +IV+    E  + + +  +   I  +GKKG + ++ +  +  + S+D+   ++ ++++    IA+ +L +++  ++++ ++   YS+F + +S  P+   L+P +              A    +P+   + E++L   L   I+ A++E+   E  +R +AMDSAT+NA E+IK   L +NR RQ+ IT+E+ EI+SGA+ 
  S:     1 MASLKDLRNRITSVKATQKITKAMQMVAAAKLRRAQMAAEAGRPYAEKMSAVLGNLAGNLVGGVGAPKLLSGTGSEQTHLL-VVCTGDRGLAGAFNSSIVRLAVREYAQKLAAEGKTVKIMTVGKKGLDALRRQYRDQIVESMDIR-GNRPVDYEFAASIADKILTRFEAGEFDVATL--FYSEFRSVISQIPTAQRLIPAELPAADTTAKAAAGNAALEFEPSEEAILETLLPKNLTVQIYRALLENAASEQGARMSAMDSATRNAGEMIKKQTLVYNRTRQAMITKELIEIISGAEA 295
>gi|166713525|ref|ZP_02244732.1| F0F1 ATP synthase subunit gamma [Xanthomonas oryzae pv. oryzicola BLS256] (287 aa)
Score = 279, Expect = 4.0e-23, Identities = 79/283 (27%), Positives = 157/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTI-WLAFFSSMGLCGSFNLNIVKELQKHIK------SNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EIK +IK +++T K+T A+++VS++K++K +E       Y +    +  ++ ++++D +   L + E+   + ++   S  GL G  N N+ +++   ++      +  ++  IG+K     +   +    S+   L D      L  +I   + A  +    +  + ++Y++FVN+++   S   LLPL  A +K      ++  D+  +P+A  V E ++  Y+ + ++ A++E+   E+A+R  AM +A+ NAN++I   +L +N+ RQ+ ITQEI+EIVSGA
  S:     1 MAGGREIKTKIKSVQNTRKVTRALEMVSASKIRKAQERMKTSRPYAQAMKQVIGHLAQASTDFQHPFLIEREQVTRVGYIVISSDRGLAGGLNNNLFRKMLGEVRPWQGTGAEIDVVTIGQKASAFFRRIKVNMVGSVT-HLGDSPQVEQLIGVIKVMIDAFIEG--KVDRVYLVYNRFVNTMTQKASFDQLLPLPAAEQK----VAHHDWDYLYEPDAASVLEHVMTRYIESLVYQAVLENVASEHAARMVAMKAASDNANKMIGTLQLVYNKARQAAITQEISEIVSGA 284
>gi|114330303|ref|YP_746525.1| F0F1 ATP synthase subunit gamma [Nitrosomonas eutropha C91] >gi|122314651|sp|Q0AJB1|ATPG_NITEC ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|114307317|gb|ABI58560.1| ATP synthase F1, gamma subunit [Nitrosomonas eutropha C91] (294 aa)
Score = 279, Expect = 4.1e-23, Identities = 86/283 (30%), Positives = 147/283 (51%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDS--EILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIK------SNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLD----KPNNGA-DFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MAS  EI+ +IK I++T KIT AM++V+++K++K ++       Y +K  ++  ++   S        + ++   +   +   S  GLCG  N N+++     I+         E+  IG KG   +   G+   IS    L D   N +      + +L  Y +D+    + + Y++FVN++   P +  LLPL    E  R D    KP     D+  +P A  V + I+I Y+   ++ A+ E+   E ++R  AM +A+ NA  LI    L +N+ RQ+ IT+E++EIV GA
  S:     1 MASSREIRNKIKSIKNTQKITRAMEMVAASKMRKAQDRMKKARPYGEKIRNVAAHMSKASVEYRHPFLIDRNSVKRVGIIVVTSDKGLCGGLNTNVLRRALNEIRVWGAEGEQIEVCCIGNKGLGFMSRLGVRV-ISQVTGLGDAP-NMEKLIGAVKVVLDAYTDDH-FDRVYIFYNRFVNTMKQIPVMEQLLPLTD--EHMRDDGNEAKPARAPWDYIYEPEAKPVIDDIMIRYIEALVYQAVAENMASEQSARMVAMKAASDNAGNLIDELTLIYNKSRQAAITKELSEIVGGA 291
>gi|148378161|ref|YP_001252702.1| ATP synthase F1, gamma subunit [Clostridium botulinum A str. ATCC 3502] >gi|153933849|ref|YP_001382562.1| F0F1 ATP synthase subunit gamma [Clostridium botulinum A str. ATCC 19397] >gi|153935396|ref|YP_001386114.1| F0F1 ATP synthase subunit gamma [Clostridium botulinum A str. Hall] >gi|166222545|sp|A7FQH8|ATPG_CLOB1 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|166222546|sp|A5HY51|ATPG_CLOBH ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|148287645|emb|CAL81710.1| ATP synthase subunit gamma [Clostridium botulinum A str. ATCC 3502] >gi|152929893|gb|ABS35393.1| ATP synthase F1, gamma subunit [Clostridium botulinum A str. ATCC 19397] >gi|152931310|gb|ABS36809.1| ATP synthase F1, gamma subunit [Clostridium botulinum A str. Hall] (282 aa)
Score = 279, Expect = 4.1e-23, Identities = 93/285 (32%), Positives = 150/285 (52%)
  Q:     2 ASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQ---KHIKSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKGE 286
           A L  I++RIK + +  KIT AM LVS+AKL+K +        YY ++  +   I +  +   + +  +   K +++ F S  GLCGSFN+NI+  +    K  K N  + +IG+KG+  +K  GI   ++  +E+ D     +    IA+N++  Y +   +  + ++YS+F + +     +  +LP  K       +  ++       P    + + IL +YL   I      SK  EN SR  AM+ AT NAN+L+ N  L+FNR RQS ITQEI+EIV GA+ +
  S:     4 AGLIGIRRRIKSVTNIRKITKAMGLVSTAKLRKARVNLEINKKYYNEYKIILKDIINFIEDSNIYIDGNGSHKKLYVIFTSDSGLCGSFNINIINNVINEIKEDKENSLVIVIGQKGRMYLKKLGINT-LAEYIEIPDVPTTKEA-GTIAKNIIKLYSSK-EVGEVFLVYSEFYSPVKQQVLINKILPFTK-------ENKSDNKYIEFNPPVTQLMDEILENYLKATILNCFSNSKASENGSRMTAMNGATDNANDLLDNLDLQFNRLRQSAITQEISEIVGGAEAQ 281
>gi|191163784|ref|ZP_03025656.1| ATP synthase F1, gamma subunit [Geobacter sp. M21] >gi|190995229|gb|EDV70685.1| ATP synthase F1, gamma subunit [Geobacter sp. M21] (287 aa)
Score = 279, Expect = 4.2e-23, Identities = 84/284 (29%), Positives = 154/284 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLK-KSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIK------SNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKY-KNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRL-DKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAK 284
           MA+L  IKKRI  +++T +IT AMK+VS+AKL++ +E  +    Y  K  ++   +    +S+   L  K +  + + +   S  GLCG FN N+ K  ++ I       S   +  IG+KG   ++++    +   ++      +++    +IA  L+  Y   DY+   + VIY+ F + ++   ++  LLP+      P+  D    G ++  +P+   + + +L  ++   +  +++ES   E+ +R  AMDSA+KNA E+I    L +NR RQ+ IT E+ EI+SG++
  S:     1 MANLKSIKKRIVSVKNTRQITKAMKMVSAAKLRRAQENVVAARPYAGKLAEVLERLAKTQESDASPLMVKRDTRRALLVVVTSDRGLCGGFNANLSKAAERFINERKGEFSELSLMTIGRKGYEFLRNRHTVRKHHGNIF---STLSYQTAALIAAELVEGYLAEDYD--EVYVIYNAFKSVMTQDITLEQLLPV-----TPKAGDDDEVGTEYIYEPSKAALLDELLPKHIEVQVFKSLLESVASEHGARMTAMDSASKNATEMIGKLTLIYNRARQAAITTELMEIISGSE 283
>gi|23336547|ref|ZP_00121759.1| COG0224: F0F1-type ATP synthase, gamma subunit [Bifidobacterium longum DJO10A] >gi|23464957|ref|NP_695560.1| F0F1 ATP synthase subunit gamma [Bifidobacterium longum NCC2705] >gi|189439987|ref|YP_001955068.1| F0F1-type ATP synthase gamma subunit [Bifidobacterium longum DJO10A] >gi|81754476|sp|Q8G7B2|ATPG_BIFLO ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|23325554|gb|AAN24196.1| ATP synthase gamma chain [Bifidobacterium longum NCC2705] >gi|189428422|gb|ACD98570.1| F0F1-type ATP synthase gamma subunit [Bifidobacterium longum DJO10A] (307 aa)
Score = 279, Expect = 4.3e-23, Identities = 75/283 (26%), Positives = 150/283 (53%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSD-SEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSND------EIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYN---IKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGAD--------FSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           M S   +K RI+  ES +KI NA ++++S+ + K +++ LN   Y    +D    + +++  +  +++K  +  +   LA  S  G+ G +  +I++E +  +   D      E+++ G++G    K +    +I+   E D      ++   I+  L+  Y        +  + ++Y++F+N +     V  +LP++    + ++  P+  A         ++ +P+   V ++IL  Y+ + IH  ++ +   E ASR+NAM +AT NA  LI +   + N  RQ+ ITQE+TEI+  A
  S:     1 MGSQLALKSRIRSTESLAKIFNAQEMIASSHIAKARDVALNAKPYTDAIFDAVQALVAHTHITHPIAVKDEKNPRVAVLALTSDRGMAGPYTSSIIRETESLLSRLDAAGKQPELFVYGRRGSTYYKYR--NRDIAATWEGDTDQPGVEIAETISNTLMDAYMKPAEKGGVSELYIVYTEFINMVVQKVRVLRMLPVEIVKNETKVPDPDEEAPATADVAPLYTFEPSLEKVLDAILPKYIQSRIHECLLTAAASETASRQNAMHTATDNARNLIDDLTRKLNASRQASITQELTEIIGSA 299
>gi|168182235|ref|ZP_02616899.1| ATP synthase F1, gamma subunit [Clostridium botulinum Bf] >gi|182674549|gb|EDT86510.1| ATP synthase F1, gamma subunit [Clostridium botulinum Bf] (282 aa)
Score = 279, Expect = 4.5e-23, Identities = 93/285 (32%), Positives = 149/285 (52%)
  Q:     2 ASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQ---KHIKSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKGE 286
           A L  I++RIK + +  KIT AM LVS+AKL+K +        YY ++  +   I +  +   + +  +   K +++ F S  GLCGSFN+NI+  +    K  K N  + +IG+KG+  +K  GI   ++  +E+ D     +    IA+N++  Y +   +  + ++YS+F + +     +  +LP  K       +  ++       P      + IL +YL   I      SK  EN SR  AM+ AT NAN+L+ N  L+FNR RQS ITQEI+EIV GA+ +
  S:     4 AGLIGIRRRIKSVTNIRKITKAMGLVSTAKLRKARVNLEINKKYYNEYKIILKDIINFIEDRNIYIDGNGSHKKLYVIFTSDSGLCGSFNINIINNVINEIKEDKENSLVIVIGQKGRMYLKKLGINT-LAEYIEIPDVPTTKEA-RTIAKNIIKLYSSK-EVGEVFLVYSEFYSPVKQQVLINKILPFTK-------ENKSDNKYIEFNPPVTRFMDEILENYLKATILNCFSNSKASENGSRMTAMNGATDNANDLLDNLDLQFNRLRQSAITQEISEIVGGAEAQ 281
>gi|56477132|ref|YP_158721.1| F0F1 ATP synthase subunit gamma [Azoarcus sp. EbN1] >gi|81677478|sp|Q5P4E3|ATPG_AZOSE ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|56313175|emb|CAI07820.1| F1-ATP synthase, gamma subunit [Azoarcus sp. EbN1] (289 aa)
Score = 279, Expect = 4.5e-23, Identities = 82/283 (28%), Positives = 153/283 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSN--SDSEILSLKKSEEGKTIWLAFFSS-MGLCGSFNLNIVKELQKHIKSND-------EIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MAS  EI+ +IK +++T KIT AM++V+++K++K ++       Y +K   L   +     +D +   L + +E K + L   ++  GLCG  N NI +     +K  D       +   IG KG   ++  G +  +S  ++L D   + +      + +L  ++N   + ++ V Y++F+N++   P +  LLPL       +L  P    D+  +P+   V + +L+ Y+   ++ A+ E+   E ++R  AM +A+ NA  +I   +L +N+ RQ+ IT+E++EIVSGA
  S:     1 MASGKEIRTKIKSVQNTRKITKAMEMVAASKMRKAQDRMRAARPYAEKIRRLAANLSQANVTDYKHAFLVQKDEVKRVGLILVTTDKGLCGGLNTNIQRVALNAMKGWDASGTTEIQACCIGNKGFGFMQRMGAKV-VSHVVQLGDTP-HLEKMIGPVKIMLDAFQNG-ELDAVYVAYTRFINTMKQEPVLEQLLPLTGE----KLGTPEGSWDYLYEPDPQVVIDEMLVRYVEALVYQAVAENMASEQSARMVAMKAASDNAKNVIGELQLVYNKTRQAAITKELSEIVSGA 286
>gi|149277101|ref|ZP_01883243.1| ATP synthase, subunit gamma (H(+)-transporting two-sector ATPase) [Pedobacter sp. BAL39] >gi|149231978|gb|EDM37355.1| ATP synthase, subunit gamma (H(+)-transporting two-sector ATPase) [Pedobacter sp. BAL39] (293 aa)
Score = 279, Expect = 4.6e-23, Identities = 84/283 (29%), Positives = 159/283 (56%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSD-SEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKEL---------QKHIKSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA+L E++ RI  ++ST +IT AMK+VS+AKLK+     +    Y  K  ++   + +N + S    +++ E  K + +   S+ GL G+FN+N++K           +++   N  I  IGKK ++  + +     I  + E+    + F+    I ++++A ++       ++++Y+KF N+     +   LLPL K   +   D+  +  D+ ++P   ++ E ++   +   ++ A+++S   E+ +R  +MD AT+NA +L+K  KL +N+ RQ+ IT E+TEIVSGA
  S:     1 MANLKEVRIRIASVQSTQQITKAMKMVSAAKLKRATNAIIQLRPYATKLKEILGNLSANLEGSSSPFIQEREPNKVLIVVVSSNRGLAGAFNMNVIKATNNLIAEKYSEQYKNGNVSIVAIGKKSQDFYEKRNYNV-IGNNNEVY-ASLTFENVTKITDSIMAGFEKG-EFDRVEMVYNKFKNAAVQILTTEQLLPLPKP--EVLKDEKRSKIDYILEPAQEEIVEQLIPKSIKIQLYKAVLDSHASEHGARMTSMDKATENAGDLLKALKLSYNQARQAAITTELTEIVSGA 288
>gi|170755934|ref|YP_001779783.1| ATP synthase F1, gamma subunit [Clostridium botulinum B1 str. Okra] >gi|169121146|gb|ACA44982.1| ATP synthase F1, gamma subunit [Clostridium botulinum B1 str. Okra] (282 aa)
Score = 279, Expect = 4.7e-23, Identities = 93/285 (32%), Positives = 149/285 (52%)
  Q:     2 ASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQ---KHIKSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKGE 286
           A L  I++RIK + +  KIT AM LVS+AKL+K +        YY ++  +   I +  +   + +  +   K +++ F S  GLCGSFN+NI+  +    K  K N  + +IG+KG+  +K  GI   ++  +E+ D     +    IA+N++  Y +   +  + ++YS+F + +     +  +LP  K       +  ++       P      + IL +YL   I      SK  EN SR  AM+ AT NAN+L+ N  L+FNR RQS ITQEI+EIV GA+ +
  S:     4 AGLIGIRRRIKSVTNIRKITKAMGLVSTAKLRKARVNLEINKKYYNEYKVILKDIINFIEDSNIYIDGNGSHKKLYVIFTSDSGLCGSFNINIINNVINEIKEDKENSLVIVIGQKGRMYLKKLGINT-LAEYIEIPDVPTTKEA-RTIAKNIIKLYSSK-EVGEVFLVYSEFYSPVKQQVLINKILPFTK-------ENKSDNKYIEFNPPVTQFIDEILENYLKATILNCFSNSKASENGSRMTAMNGATDNANDLLDNLDLQFNRLRQSAITQEISEIVGGAEAQ 281
>gi|51244685|ref|YP_064569.1| ATP synthase, gamma chain (AtpG) [Desulfotalea psychrophila LSv54] >gi|81692924|sp|Q6AQ11|ATPG_DESPS ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|50875722|emb|CAG35562.1| probable ATP synthase, gamma chain (AtpG) [Desulfotalea psychrophila LSv54] (290 aa)
Score = 278, Expect = 5.1e-23, Identities = 78/285 (27%), Positives = 147/285 (51%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEGKTIWLAFFSS-MGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKGIEAEISLDLEL-----DDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           M SL E+K +I  ++ TS+IT AM +V++++L+  ++   +   Y  KF +  + +    ++    L    + KT+ L   +S  GLCGSFN N+VK  +K +           +  IGKKG  L++  G   E   D+       + ++I  D    +A+N L    +      +++IY  F +     P    LLP+   +      +     D+  +P++ ++ +++   YL   ++ A++E    E+A+R  AMD+AT    +++ N  + +N+ RQ+ +T E+ +IV GA+ 
  S:     1 MPSLKEVKTKITGVKKTSQITKAMNMVAASRLRGAQDKMESFRPYASKFSEAMSNLSGGGNTNAFPLMDVRDVKTVELIVVTSDRGLCGSFNANVVKLTEKKMAQYRAEGKKVSLICIGKKGYQLLRKSGAVRENYSDIMAHFSINNAREIASD----VADNFLKGTAD-----KVEIIYGAFKSVAVQAPVAEDLLPIQPVVSSEPAGEQTMSGDYIYEPSSEEIMDAMQPLYLNVLVYHAMLEVGASEHAARMTAMDNATTACRDIVSNLTIVYNKARQAAVTNELMDIVGGAEA 288
>gi|91785734|ref|YP_560940.1| F0F1 ATP synthase subunit gamma [Burkholderia xenovorans LB400] >gi|122970051|sp|Q13SQ1|ATPG_BURXL ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|91689688|gb|ABE32888.1| ATP synthase gamma chain [Burkholderia xenovorans LB400] (294 aa)
Score = 278, Expect = 5.1e-23, Identities = 85/283 (30%), Positives = 158/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTIWLAFFSS-MGLCGSFNLNIV-------KELQKHIKSNDEIWLIGKKGK---NLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYK------NDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLD-KAIEKPRLD--KPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA + EI+ +IK +++T KIT AM++V+++K+++ +E       Y  K  D+  ++ ++N +     +  +E  KT  +   ++  GLCG  N N++       KEL+   K+  E   IG KG    N +++K +   + L           D  H+  E L+   K      ++  + ++ + Y++FVN++   P +  LLPL     E+   D   P+   D+  +P+A  V + +L+ Y+   ++ A+ E+   E ++R  AM +A+ NA  +I   +L +N+ RQ+ IT+E++EIV GA
  S:     1 MAGMKEIRGKIKSVQNTRKITKAMEMVAASKMRRAQERMRAARPYADKVRDIAAHMSRANPEYRHPFMVSNEGAKTAGIILVTTDKGLCGGMNTNVLRASLQKFKELEGQGKT-IEATAIGTKGLGFLNRLRAKVVSNVVHLG----------DTPHL--EKLIGAVKVQLDLYSEGKVSAVYLAYTRFVNTMKQEPVIEQLLPLSADQFERKEEDGTTPSTQWDYIYEPDAQAVVDELLVRYVEALVYQAVAENMASEQSARMVAMKAASDNAKTVINELQLVYNKSRQAAITKELSEIVGGA 291
>gi|17227500|ref|NP_484048.1| F0F1 ATP synthase subunit gamma [Nostoc sp. PCC 7120] >gi|20141207|sp|P12408|ATPG_ANASP ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|17134982|dbj|BAB77528.1| ATP synthase subunit gamma [Nostoc sp. PCC 7120] (315 aa)
Score = 278, Expect = 5.5e-23, Identities = 84/285 (29%), Positives = 158/285 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSN---SDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLD----KAIEKPRLDKPNNGADFSIQ---------PNAND---------VFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           M +L  I+ RI+ +++T KIT AM+LV++A++++ +E  +    +  +   +   +++     D ++  LKK E      L      GLCG +N N+++  +   K       +    ++G+K +   + +  E  I       ++    D  + IA+ LL+ + ++  +  I+++Y++FV+ +S  P + +LLPLD    +A +         G  F ++         P   D         + +S+L  YL+  +  A+ ES   E A+R  AM +A++NA ELIK+  L +N+ RQ+ ITQE+ E+V GA+ 
  S:     1 MPNLKSIRDRIQSVKNTKKITEAMRLVAAARVRRAQEQVIATRPFADRLAQVLYGLQTRLRFEDVDLPLLKKREVKSVGLLVISGDRGLCGGYNTNVIRRAENRAKELKAEGLDYTFVIVGRKAEQYFRRR--EQPIDASYTGLEQIPTADEANKIADELLSLFLSE-KVDRIELVYTRFVSLVSSRPVIQTLLPLDTQGLEAADDEIFRLTTRGGQFQVERQTVTSQARPLPRDMIFEQDPVQILDSLLPLYLSNQLLRALQESAASELAARMTAMSNASENAGELIKSLSLSYNKARQAAITQELLEVVGGAEA 313
>gi|91201497|emb|CAJ74557.1| similar to ATP synthase subunit gamma [Candidatus Kuenenia stuttgartiensis] (290 aa)
Score = 278, Expect = 5.6e-23, Identities = 91/285 (31%), Positives = 151/285 (52%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFY----DLFTYIKSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSND---EIWLIGKKGKNLIKSK-----GIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           M S  EIK+RI+ I S  +IT AM++V++++LKK +        + +K +    DL + +   S     + K+S       +   +  GLCG++N NI+++  + IK N+   ++ LIGKK  NL  SK      IE  I   +E     +  D     A  L+  Y N+     + V ++KF   +   P+   L P++K   +    +     ++ ++P+  D+   I   Y+ T I+  I+ES   E A+RR AM +AT+NA ++I N    +N+ RQ  IT+E+ EIVSGA+ 
  S:     1 MQSTREIKERIRGISSIKQITRAMEMVAASRLKKVESRVHASRTFAEKLHQMVSDLISSLPQESAYRWFAKKESVNSPVKVILITADKGLCGAYNNNIIQKTVRFIKENNRQVKLILIGKKA-NLYFSKRRDVYSIEESIPESVE----KLGLDWVKSFAAKLIRDY-NNLEYGELHVFFTKFHTVMQSFPASIRLFPIEK---EGFGGEGREKKEYIVEPSVEDILNKIFPKYIETQIYQCILESLTSEFAARRVAMIAATENAGDMIDNLTSIYNKARQEAITKELLEIVSGAEA 288
>gi|162329626|ref|YP_471344.2| F0F1 ATP synthase subunit gamma [Rhizobium etli CFN 42] (294 aa)
Score = 278, Expect = 5.8e-23, Identities = 83/285 (29%), Positives = 158/285 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIK---SNSDSEILSLKKSEEGKTIWLAFFSS-MGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYK-NDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           M SL ++K RI  +++T KIT AMK+V++AKL++ +E       Y ++   +   I    +++D     +  S + K   L   ++  GLCG FN  I +  + HI+         +I+ +GKKG ++++ +     I      + K I F+    I + ++  +   ++++ ++   YS+F + +S  P+   L+P  KA E    D  + GA +  +P+   +   ++   ++  I  A++E+   E  ++ +AMD+AT+NA E+I    L +NR+RQ++IT+E+ EI+SGA+ 
  S:     1 MPSLKDLKNRIASVKATQKITKAMKMVAAAKLRRAQEAAEAARPYSQRMGAVLANIAKAVTDADGAPALMTGSGQDKVHLLVVCTAERGLCGGFNSQIARFARDHIRKLLAEGKTVKIFTVGKKGYDILRREFAPLIIERKELREVKKIGFENADQIGKRVIEMFSAGEFDVCTL--FYSEFKSVISQVPTAQQLIPA-KAPEAVAEDAEHAGAVYEYEPDPASILGDLIPRNISVQIFRALLENVAGEMGAKMSAMDNATRNAGEMINKLTLSYNRQRQAQITKELIEIISGAEA 293
>gi|152977493|ref|YP_001377010.1| F0F1 ATP synthase subunit gamma [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|189081388|sp|A7GV57|ATPG_BACCN ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|152026245|gb|ABS24015.1| ATP synthase F1, gamma subunit [Bacillus cereus subsp. cytotoxis NVH 391-98] (286 aa)
Score = 278, Expect = 5.9e-23, Identities = 86/283 (30%), Positives = 153/283 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNS---DSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSND-------EIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MASL +IK +I   + TS+IT AM++VS++KL + ++   +   Y +K  ++   I   S   +  +L+ +  +  +T ++   S  GL G +N N+++E+ K I+           I ++G+ G++ +K +G    I   + L D   +F     +A   +A +  D     + + Y+ +V+ +S   +   +LPL       +L        +  +P+  ++ + +L  Y  + ++GA+++ K  E+A+R  AM SAT NA E+I    L FNR RQ+ ITQEITEIV GA
  S:     1 MASLRDIKAKINSTKKTSQITKAMEMVSASKLNRAEQNAKSFVPYMEKIQEVVASIAQGSKGINHPMLTARPVK--RTGYIVITSDRGLAGGYNSNVLREVSKVIRERHNMDPNQYSIIVLGRLGRDYLKRRGFNI-IDEVVGLSDHP-SFTDIKDLASRAIAMFA-DGAYDELYIYYNHYVSKISQEVTENKVLPLTDVKSDKKL------TPYEFEPSEEEILKVLLPQYAESLVYGALLDGKASEHAARMTAMKSATDNAMEVIDTLTLSFNRARQAAITQEITEIVGGA 282
>gi|158425750|ref|YP_001527042.1| F0F1 ATP synthase subunit gamma [Azorhizobium caulinodans ORS 571] >gi|172047826|sp|A8HS13|ATPG_AZOC5 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|158332639|dbj|BAF90124.1| H+-transporting two-sector ATPase gamma subunit [Azorhizobium caulinodans ORS 571] (289 aa)
Score = 278, Expect = 6.0e-23, Identities = 82/285 (28%), Positives = 162/285 (56%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKS----NSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIK------SNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKY-KNDYNIKSIKVIYSKFVNSLSFTPSVFSLLP--LDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           MASL +++ RI  +++T KIT AM++V++AKL++ +        Y ++   +   I S    ++D+ +L     ++ K + L   S  GLCG+FN NIV+ +++          + + + +G+KG + ++       + L      +++ F   H IAE ++ ++ K ++++ ++   +S F + +S  P+   ++P   +KA E P        A +  +P  +++   +L   +A  I  A++E++     S+ +AMD+AT+NA ++IK   L +NR RQ+ IT+E+ EI+SGA+ 
  S:     1 MASLKDLRNRIASVKATQKITKAMQMVAAAKLRRAQMAAEAARPYAERMDSVLGNIASGVTLSADTPLLLSGTGKDEKHLLLVCTSERGLCGAFNTNIVRAVRERANLLIGQGKDVKFFCVGRKGYDQLRRLYPGQIVELVDLRSVRNLGFVNAHDIAEKIIDRFNKGEFDVCTL--FFSHFKSVISQVPTAQQIIPATFEKA-EGP-------SAVYDYEPEESEILADLLPRNVAVQIFRALLENQASFYGSQMSAMDNATRNAGDMIKKQTLIYNRTRQAMITKELIEIISGAEA 288
>gi|90961575|ref|YP_535491.1| F0F1 ATP synthase subunit gamma [Lactobacillus salivarius UCC118] >gi|122449153|sp|Q1WUC7|ATPG_LACS1 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|90820769|gb|ABD99408.1| ATP synthase gamma chain [Lactobacillus salivarius UCC118] (309 aa)
Score = 277, Expect = 6.4e-23, Identities = 93/284 (32%), Positives = 160/284 (56%)
  Q:     2 ASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTIWLAFF--------------SSMGLCGSFNLNIVKELQKHIKSNDE------IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQ----PNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           ASL E+K+RI+  + TS+IT+AM++VS+AKL + ++   +  +Y  K   + T++ KS+    + +  K+ +GK   L                 S  GL GS+N N++KE  + I++N        I  IG  G +  K +G    ++ +         +     + E +++ Y  +     + V YS FVN+L+       +LP+  A      D  +N   +SI+    P+ + + E +L  Y  + ++GAI+++K  E+AS   AM SA+ NA ++I + +L++NR RQS IT EITEI +GA+ 
  S:     3 ASLQEVKRRIESTKKTSQITSAMQMVSTAKLSQIQKHATSYQVYATKIRSVITHLSKSHLLDSVNTTSKNSDGKVNTLGMLRQRPVKTTGIVVITSDRGLVGSYNSNVIKETLELIENNHHSTEDVAIIAIGGTGADFFKKRGYN--VAYEYRGISDIPTYKDARPLVEAIVSMYDKEV-YDELFVCYSHFVNTLTSEFRAEKMLPV-SAENMGHDDLTSNDEGYSIEYETEPSEDAILEVVLPQYAESLVYGAILDAKTSEHASSSTAMKSASDNAKDIISSLELQYNRARQSAITTEITEI-TGAQA 306
>gi|1168595|sp|P42007|ATPG_BACST ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|534853|dbj|BAA07254.1| ATPase subunit gamma [Geobacillus stearothermophilus] (287 aa)
Score = 277, Expect = 6.7e-23, Identities = 84/282 (29%), Positives = 153/282 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSN-----DE--IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSG 282
           +ASL +IK RI   + TS+IT AM++VS++KL +  +  +  S Y +K  ++   + S   S  + + +  + KT +L   S  GL G++N N+V+ +      N     DE  I +IG+ G +  + + +   + LD+       +F     IA   +  +  D     + + Y+ +V+++    +   LLPL   + + +         +  +P+  ++ + +L  Y  + I+GA++++K  E+A+R  AM +AT NAN++I+   L +NR RQ+ ITQEITEIV+G
  S:     4 LASLRDIKTRINATKKTSQITKAMEMVSTSKLNRAAKREIVRS-YMEKIQEVVANVASRGRSHPMLVSRPVK-KTGYLVITSDRGLAGAYNSNVVRLVYPKRSKNAMLPPDEYAIIVIGRVGLSFFRKRNMP--VILDITRLPDQPSFADIKEIARKTVGLFA-DGTFDELYMYYNHYVSAIQQEVTERKLLPLTDFLAENK-----QRTVYEFEPSQEEILDVLLPQYAESLIYGALLDAKASEHAARMTAMKNATDNANDVIRTLTLSYNRARQAAITQEITEIVAG 282
>gi|125975090|ref|YP_001039000.1| F0F1 ATP synthase subunit gamma [Clostridium thermocellum ATCC 27405] >gi|166222549|sp|A3DIM8|ATPG_CLOTH ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|125715315|gb|ABN53807.1| ATP synthase F1, gamma subunit [Clostridium thermocellum ATCC 27405] (295 aa)
Score = 277, Expect = 6.7e-23, Identities = 93/285 (32%), Positives = 152/285 (53%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKK----FYDLFTYIKSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDE--IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRL------DKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           MA +NEIK R+K I  T +ITNAMKL+S+AKLKK K+     S Y++K      D+        +    +  +  + K  ++      G  G +N NI+K  ++ +K + +  +++ G  G+N          +  D  + +  I   +   I E +L  +  +     + +IY+   +++   PS+  LLPL+    K +L      +K  +G     +P+   VF  ++  Y+   ++GA VES   E  SR  AMD+AT NAN+++K   L +NR RQS+ITQ+ITEIV GA+ 
  S:     1 MAHINEIKLRMKSIRETRQITNAMKLISAAKLKKAKKQLEKASPYFEKVRSTMADILLRSGKIENKYFHARDEKTDKKKAYIVITGEKGFAGGYNHNIIKFTEECLKQDKDPLLFVAGNVGRNHFLKNKYNVYMEFDYPVQNPSIY--MAREIMEVILDLFDKEV-FDELYIIYTHMFSNIKMEPSIIKLLPLELDTLKEKLQINESTEKIVDGC-MEYEPDPEYVFNVLVRKYIKGVVYGAFVESFTSEQNSRMTAMDNATANANDMLKKLDLLYNRARQSKITQDITEIVGGAEA 293
>gi|163850896|ref|YP_001638939.1| ATP synthase F1, gamma subunit [Methylobacterium extorquens PA1] >gi|163662501|gb|ABY29868.1| ATP synthase F1, gamma subunit [Methylobacterium extorquens PA1] (296 aa)
Score = 277, Expect = 6.8e-23, Identities = 81/285 (28%), Positives = 155/285 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEI----LSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIK------SNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYK-NDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLD-KAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           M SL +++ RI  +++T KIT AM++V++AKL++ +    N   Y ++   +   +  N    +    L     ++   + +      GL G+FN +I +  + H           +I  IGKKG ++++ +  +  I+      +K +++     IA+++LA+++  ++++ ++   YS+F + +S  P+   L+P +    E        + A    +PN   + E++L   L   I  A++E+   E  +R +AMDSAT+NA E+IK   L +NR RQ+ IT+E+ EI+SGA+ 
  S:     1 MPSLKDLRNRITSVKATQKITKAMQMVAAAKLRRAQNAAENGRPYAERMAQVLGNLAGNLIGGVGAPRLLTGTGQDRVHLLVVCTGDRGLAGAFNSSIARLARDHANRLMADGKTVKIITIGKKGLDVLRRQFRDQIIASRDIRGNKPVDYPFAAEIADDILARFEAGEFDVATL--FYSEFRSVISQIPTAQKLIPAELPTAEGAAATGAGSDAAMEFEPNEETILETLLPKNLTVQIFRALLENAASEQGARMSAMDSATRNAGEMIKKQTLIYNRTRQAMITKELIEIISGAEA 295
>gi|171742082|ref|ZP_02917889.1| hypothetical protein BIFDEN_01187 [Bifidobacterium dentium ATCC 27678] >gi|171277696|gb|EDT45357.1| hypothetical protein BIFDEN_01187 [Bifidobacterium dentium ATCC 27678] (306 aa)
Score = 277, Expect = 6.9e-23, Identities = 76/283 (26%), Positives = 152/283 (53%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEGKTIW-LAFFSSMGLCGSFNLNIVKELQKHIKSND------EIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKY---KNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGAD-------FSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           M S   +K RI    S  KI NA ++++S+ + K +++ LN   Y    +D    + +++  +   +KK E+   +  LA  S  G+ G +  +I++E +  +   D      E+++ G++G    K +    +++   E D      ++   I++ L+  Y    +   +  + +++++FVN +     V  +LP++  + + +   P + +D       ++ +PN ++V ++IL  Y+ + IH  ++ +   E ASR+NAM +AT NA  LI +   + N  RQ+ ITQE+TEI+  A
  S:     1 MGSQLALKSRIASTASLEKIFNAQEMIASSHIAKARDVALNAKPYTDAIFDAVQALVAHTHIDHPIVKKDEDNPRVAVLALTSDRGMAGPYTSSIIRETESLLARLDAAGKQPELYVYGRRGVTYYKYR--NRDVAGTWEGDTDQPGVEVAESISKALMDAYMKPADQGGVSELYIVFTEFVNMVVQKVRVLRMLPVELVLPEQQGSGPVSESDADAATPLYAFEPNVDEVLDAILPKYIQSRIHECLLTAAASETASRQNAMHTATDNARSLIDDLTRKLNASRQASITQELTEIIGSA 298
>gi|49474711|ref|YP_032753.1| F0F1 ATP synthase subunit gamma [Bartonella quintana str. Toulouse] >gi|81695986|sp|Q6FYM2|ATPG_BARQU ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|49240215|emb|CAF26683.1| ATP synthase gamma chain [Bartonella quintana str. Toulouse] (303 aa)
Score = 277, Expect = 7.2e-23, Identities = 80/285 (28%), Positives = 164/285 (57%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDS-EILSLKKSEEGKTIWLAFF--SSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKGIEAEISLDLELDD-KDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDK---AIEKP----RLDKPNNGAD--FSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           MASL +++ RI  +++T KIT AM++V++A+L + +E   +   Y ++   +   + ++ D+ ++  L +      + L     +  GLCG+FN+ I +  ++ IK+        +I  +GKKG +++ S+  +A +   ++L   K + F    II++ ++  +  D       + YS+FV+ ++  P  F L+P+     A+E      ++D+  N     +  +P+   + E ++   L+  I  A++E+   E  ++  AMD+A++NA E+I    + +NR+RQ++IT E+ EI++GA+ 
  S:     1 MASLKDLRDRIASVKATQKITKAMQMVAAARLHRVQEAAQSARPYAQRMAAILANVATDVDTIDVPPLMRGTGRNDVHLLVVCTAERGLCGAFNMQIARRARQQIKALLSAGKIVKILTVGKKGADIL-SRDYKALMIDHIDLRSVKRVGFAEAAIISQKIIDLFDKD-TFDVCTLFYSEFVSVINQRPVAFGLIPMGSPKGAVEAEDVTQKVDENKNLQSIVYDYEPDVASLLEELVPRNLSVQIFQALLENVAGEMGAKVTAMDNASRNAGEMINKLTVAYNRQRQAQITTELIEIIAGAEA 302
>gi|142004|gb|AAA21992.1| ATP synthase subunit gamma [Nostoc sp. PCC 7120] (315 aa)
Score = 277, Expect = 7.5e-23, Identities = 84/285 (29%), Positives = 158/285 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSN---SDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLD----KAIEKPRLDKPNNGADFSIQ---------PNAND---------VFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           M +L  I+ RI+ +++T KIT AM+LV++A++++ +E  +    +  +   +   +++     D ++  LKK E      L      GLCG +N N+++  +   K       +    ++G+K +   + +  E  I       ++    D  + IA+ LL+ + ++  +  I+++Y++FV+ +S  P + +LLPLD    +A +         G  F ++         P   D         + +S+L  YL+  +  A+ ES   E A+R  AM +A++NA ELIK+  L +N+ RQ+ ITQE+ E+V GA+ 
  S:     1 MPNLKSIRDRIQSVKNTKKITEAMRLVAAARVRRAQEQVIATRPFADRLAQVLYGLQTRLRFEDVDLPLLKKREVKSVGLLVISGDRGLCGGYNTNVIRRAENRAKELKAEGLDYTFVIVGRKAEQYFRRR--EQPIDASYTGLEQIPTADEANKIADELLSLFLSE-KVDRIELVYTRFVSLVSSRPVIQTLLPLDTQGLEAADDEIFRLTTRGGQFQVERQTVTSQARPLPRDSIFEQDPVQILDSLLPLYLSNQLLRALQESAASELAARMTAMSNASENAGELIKSLSLSYNKARQAAITQELLEVVGGAEA 313
>gi|30023338|ref|NP_834969.1| F0F1 ATP synthase subunit gamma [Bacillus cereus ATCC 14579] >gi|30265329|ref|NP_847706.1| F0F1 ATP synthase subunit gamma [Bacillus anthracis str. Ames] >gi|42784476|ref|NP_981723.1| F0F1 ATP synthase subunit gamma [Bacillus cereus ATCC 10987] >gi|47778410|ref|YP_022217.2| F0F1 ATP synthase subunit gamma [Bacillus anthracis str. 'Ames Ancestor'] >gi|49188142|ref|YP_031395.1| F0F1 ATP synthase subunit gamma [Bacillus anthracis str. Sterne] >gi|49480406|ref|YP_039297.1| F0F1 ATP synthase subunit gamma [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|52140258|ref|YP_086575.1| F0F1 ATP synthase subunit gamma [Bacillus cereus E33L] >gi|65317283|ref|ZP_00390242.1| COG0224: F0F1-type ATP synthase, gamma subunit [Bacillus anthracis str. A2012] >gi|118480345|ref|YP_897496.1| F0F1 ATP synthase subunit gamma [Bacillus thuringiensis str. Al Hakam] >gi|165873328|ref|ZP_02217931.1| ATP synthase F1, gamma subunit [Bacillus anthracis str. A0488] >gi|166984520|ref|ZP_02255861.1| F0F1 ATP synthase subunit gamma [Bacillus cereus AH187] >gi|166996502|ref|ZP_02262962.1| F0F1 ATP synthase subunit gamma [Bacillus cereus AH820] >gi|167636405|ref|ZP_02394705.1| ATP synthase F1, gamma subunit [Bacillus anthracis str. A0442] >gi|167642061|ref|ZP_02400287.1| ATP synthase F1, gamma subunit [Bacillus anthracis str. A0193] >gi|167940242|ref|ZP_02527317.1| F0F1 ATP synthase subunit gamma [Bacillus cereus AH1134] >gi|168136016|ref|ZP_02579245.1| F0F1 ATP synthase subunit gamma [Bacillus cereus B4264] >gi|168162321|ref|ZP_02597554.1| F0F1 ATP synthase subunit gamma [Bacillus cereus H3081.97] >gi|170689697|ref|ZP_02880874.1| ATP synthase F1, gamma subunit [Bacillus anthracis str. A0465] >gi|170709431|ref|ZP_02899839.1| ATP synthase F1, gamma subunit [Bacillus anthracis str. A0389] >gi|177656029|ref|ZP_02937136.1| ATP synthase F1, gamma subunit [Bacillus anthracis str. A0174] >gi|196036277|ref|ZP_03103675.1| ATP synthase F1, gamma subunit [Bacillus cereus W] >gi|196039449|ref|ZP_03106754.1| ATP synthase F1, gamma subunit [Bacillus cereus NVH0597-99] >gi|196045682|ref|ZP_03112912.1| ATP synthase F1, gamma subunit [Bacillus cereus 03BB108] >gi|166222522|sp|A0RL96|ATPG_BACAH ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|81685358|sp|Q630U2|ATPG_BACCZ ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|81696587|sp|Q6HAX9|ATPG_BACHK ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|81699586|sp|Q72XE7|ATPG_BACC1 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|81714494|sp|Q814W1|ATPG_BACCR ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|81714854|sp|Q81JZ4|ATPG_BACAN ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|29898899|gb|AAP12170.1| ATP synthase gamma chain [Bacillus cereus ATCC 14579] >gi|30260007|gb|AAP29192.1| ATP synthase F1, gamma subunit [Bacillus anthracis str. Ames] >gi|42740408|gb|AAS44331.1| ATP synthase F1, gamma subunit [Bacillus cereus ATCC 10987] >gi|47552115|gb|AAT34692.2| ATP synthase F1, gamma subunit [Bacillus anthracis str. 'Ames Ancestor'] >gi|49182069|gb|AAT57445.1| ATP synthase F1, gamma subunit [Bacillus anthracis str. Sterne] >gi|49331962|gb|AAT62608.1| ATP synthase F1, gamma subunit [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|51973727|gb|AAU15277.1| ATP synthase F1, gamma subunit [Bacillus cereus E33L] >gi|118419570|gb|ABK87989.1| ATP synthase F1, gamma subunit [Bacillus thuringiensis str. Al Hakam] >gi|164710925|gb|EDR16499.1| ATP synthase F1, gamma subunit [Bacillus anthracis str. A0488] >gi|167509979|gb|EDR85399.1| ATP synthase F1, gamma subunit [Bacillus anthracis str. A0193] >gi|167528239|gb|EDR91021.1| ATP synthase F1, gamma subunit [Bacillus anthracis str. A0442] >gi|170125664|gb|EDS94583.1| ATP synthase F1, gamma subunit [Bacillus anthracis str. A0389] >gi|170666339|gb|EDT17125.1| ATP synthase F1, gamma subunit [Bacillus anthracis str. A0465] >gi|172079884|gb|EDT64993.1| ATP synthase F1, gamma subunit [Bacillus anthracis str. A0174] >gi|195991069|gb|EDX55039.1| ATP synthase F1, gamma subunit [Bacillus cereus W] >gi|196023513|gb|EDX62190.1| ATP synthase F1, gamma subunit [Bacillus cereus 03BB108] >gi|196029609|gb|EDX68211.1| ATP synthase F1, gamma subunit [Bacillus cereus NVH0597-99] (286 aa)
Score = 277, Expect = 7.5e-23, Identities = 89/283 (31%), Positives = 156/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNS---DSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIK------SND-EIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MASL +IK +I   + TS+IT AM++VS++KL + ++   +   Y +K  ++   I   S   +  +L+ +  +  +T ++   S  GL G +N N+++ +   I+      SN   I ++G+ G++ +K +G    I   + L D   +F     +A   +A +  D     + + Y+ +V+ +S   +   +LPL         DKP    +F  +P+  ++ + +L  Y  + ++GA+++ K  E+A+R  AM SAT NA E+I +  L FNR RQ+ ITQEITEIV GA
  S:     1 MASLRDIKAKINSTKKTSQITKAMEMVSASKLNRAEQNAKSFVPYMEKIQEVVASIAQGSKGINHPMLNARPVK--RTGYIVITSDRGLAGGYNSNVLRTVSNVIRERHNMDSNQYSIIVLGRLGRDYLKRRGFNI-IDEVVGLSDHP-SFTDIKDLASRAIAMFA-DGAYDELYIYYNHYVSKISQEVTENKILPLTDVAS----DKPTTAYEF--EPSEEEILKVLLPQYAESLVYGALLDGKASEHAARMTAMKSATDNAMEVIDSLTLSFNRARQAAITQEITEIVGGA 282
>gi|170760573|ref|YP_001785484.1| ATP synthase F1, gamma subunit [Clostridium botulinum A3 str. Loch Maree] >gi|169407562|gb|ACA55973.1| ATP synthase F1, gamma subunit [Clostridium botulinum A3 str. Loch Maree] (282 aa)
Score = 277, Expect = 7.6e-23, Identities = 93/285 (32%), Positives = 149/285 (52%)
  Q:     2 ASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQ---KHIKSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKGE 286
           A L  I++RIK + +  KIT AM LVS+AKL+K +        YY ++  +   I +  +   + +  +   K +++ F S  GLCGSFN+NI+  +    K  K N  + +IG+KG+  +K  GI   ++  +E+ D     +    IA+N++  Y +   +  + ++YS+F + +     +  +LP  K       +  ++       P      + IL +YL   I      SK  EN SR  AM+ AT NAN+L+ N  L+FNR RQS ITQEI+EIV GA+ +
  S:     4 AGLIGIRRRIKSVTNIRKITKAMGLVSTAKLRKARLNLEINKKYYNEYKVILKDIINFIEDSNIYIDGNGSHKKLYVIFTSDSGLCGSFNINIINNVINEIKEDKENSLVIVIGQKGRMYLKKLGINT-LAEYIEIPDVPTTKEA-RTIAKNIIKLYSSK-EVGEVFLVYSEFYSPVKQQVLINKILPFTK-------ENKSDNKYIEFNPPVTRFVDEILENYLKATILNCFSNSKASENGSRMTAMNGATDNANDLLDNLDLQFNRLRQSAITQEISEIVGGAEAQ 281
>gi|89070093|ref|ZP_01157423.1| ATP synthase subunit C [Oceanicola granulosus HTCC2516] >gi|89044314|gb|EAR50457.1| ATP synthase subunit C [Oceanicola granulosus HTCC2516] (291 aa)
Score = 277, Expect = 7.9e-23, Identities = 84/285 (29%), Positives = 160/285 (56%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKS---NSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKH---IKSNDE---IWLIGKKGKNLIKSKGIEAEIS-LDLELDDKDINFDLFHIIAENLLAKYK-NDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           M SL ++K RI+ ++ST KIT AM++V++AKL++ +E       Y ++F  +   +          +L+   S++   + +   +  GLCG FN NI K  + H   +K++ +   I  +GKKG++ ++    +  +  +DL  + K + ++    IA+++L ++   ++++ +I   ++KF N +S  P+   ++P   + E            +  +P+   +   +L   +AT I  A++E+   E  +R +AMD+AT+NA E+I    +EFNR RQ+ IT E+ EI+SGA+ 
  S:     1 MPSLKDLKNRIESVKSTRKITKAMQMVAAAKLRRAQEAAEAARPYTERFNAVMAGLAQGVGEGAPRLLAGTGSDQTHLL-VVMTAERGLCGGFNSNIAKLAKTHADKLKADGKTVKILTVGKKGRDSMRRDYGDLFVGHVDLS-EVKRVGYENAQAIAKDVLDRFDAGEFDVATI--FFAKFENVVSQKPTAQQVIP--ASFEADDDADAGTTTLYDYEPSEEAILADLLPRGVATQIFAALLENGASEQGARMSAMDNATRNAGEMIDKLTIEFNRSRQAVITNELIEIISGAEA 290
>gi|58698409|ref|ZP_00373320.1| ATP synthase F1, gamma subunit [Wolbachia endosymbiont of Drosophila ananassae] >gi|58535064|gb|EAL59152.1| ATP synthase F1, gamma subunit [Wolbachia endosymbiont of Drosophila ananassae] (287 aa)
Score = 277, Expect = 7.9e-23, Identities = 94/284 (33%), Positives = 153/284 (53%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILS--LKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSND---EIWLIGKK----GKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENL-LAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPL--DKAIEKPRLDKPNNGADFSIQP-NANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAK 284
           M SL E+  RIK I S  K T  M++VS+AKL + ++   N  +Y  K + + + +  + D E+L+  L  S  G  +     S  GLCG+FN +IVK  Q  + +N    +I  +GKK    GKN   SK I     L +E + K I       +   + L+KY        +KV YSKF N+ +  P + ++ P   D ++    L  P     +  +P N   + +S++ DY+   ++ A++ES   EN++R  AM+SA +N  E++    L +NR RQ+ IT ++ E++ GA+
  S:     1 MKSLKELSLRIKNIRSVQKTTKIMQMVSAAKLLQSQKKLSNSKLYISKLHSIISSLMLSVDQELLAKILNVSNNGSYLVFIVASDRGLCGNFNSSIVKFSQNKLITNGKKVDIVFLGKKAFDIGKNRFDSKSI-----LKIE-NSKGITLKHVEALVGGIDLSKYDK------VKVFYSKFYNTFTQKPMLETIKPWSKDSSLIDNSLAGPITDYGYEYEPQNIEFILKSLVQDYVVIALYSALLESATSENSARMVAMESANRNTKEILNKLALLYNRSRQAAITTDLIEVIGGAE 285
>gi|75763709|ref|ZP_00743386.1| ATP synthase gamma chain [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|168142840|ref|ZP_02586069.1| F0F1 ATP synthase subunit gamma [Bacillus cereus G9842] >gi|74488801|gb|EAO52340.1| ATP synthase gamma chain [Bacillus thuringiensis serovar israelensis ATCC 35646] (286 aa)
Score = 276, Expect = 8.2e-23, Identities = 89/283 (31%), Positives = 156/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNS---DSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIK------SND-EIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MASL +IK +I   + TS+IT AM++VS++KL + ++   +   Y +K  ++   I   S   +  +L+ +  +  +T ++   S  GL G +N N+++ +   I+      SN   I ++G+ G++ +K +G    I   + L D   +F     +A   +A +  D     + + Y+ +V+ +S   +   +LPL         DKP    +F  +P+  ++ + +L  Y  + ++GA+++ K  E+A+R  AM SAT NA E+I +  L FNR RQ+ ITQEITEIV GA
  S:     1 MASLRDIKAKITSTKKTSQITKAMEMVSASKLNRAEQNAKSFVPYMEKIQEVVASIAQGSKGINHPMLNARPVK--RTGYIVITSDRGLAGGYNSNVLRTVSNVIRERHNMDSNQYSIIVLGRLGRDYLKRRGFNI-IDEVVGLSDHP-SFTDIKDLASRAIAMFA-DGAYDELYIYYNHYVSKISQEVTENKILPLTDVAS----DKPTTAYEF--EPSEEEILKVLLPQYAESLVYGALLDGKASEHAARMTAMKSATDNAMEVIDSLTLSFNRARQAAITQEITEIVGGA 282
>gi|157337905|emb|CAO38949.1| unnamed protein product [Vitis vinifera] (337 aa)
Score = 276, Expect = 8.5e-23, Identities = 83/280 (29%), Positives = 150/280 (53%)
  Q:     4 LNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEE---GKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDEIWL------IGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIE---KPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           L E+++RI  I++T KIT AMKLV++AK+++ +E  +N   +     ++  YI      + +S+  +E     +   +      GLCGS N  I+K  +  I    ++ L      +G+KG +  + +     +S+D     +        +IA+++ + + ++  +  ++++Y+KFV+ +     + +LLPL    E    P L+          + +   + ++++  YL + I  A+ ES   E A+R  AM +AT NA EL K   L +NRKRQ++IT EI EIV+GA
  S:    51 LRELRQRIDSIKNTQKITEAMKLVAAAKVRRAQEAVINGRPFSNTLVEVLHYINEQLQDDGVSVPLTEVRAVKRVALVVITGDRGLCGSLNAGILKMAESRIAELTDLGLDCTVISVGRKGNSYFRRRSRAPVVSVDR--GGRFPTAKEAQVIADDVFSLFVSE-EVDKVELLYTKFVSFVESATVIQTLLPLSMKGEVEFSPFLE---------FEQDPAQILDALMPLYLNSQILRALQESLASELAARMCAMSNATDNAVELTKTLSLAYNRKRQAKITGEILEIVAGA 330
>gi|157363032|ref|YP_001469799.1| ATP synthase F1, gamma subunit [Thermotoga lettingae TMO] >gi|157313636|gb|ABV32735.1| ATP synthase F1, gamma subunit [Thermotoga lettingae TMO] (270 aa)
Score = 276, Expect = 8.6e-23, Identities = 85/282 (30%), Positives = 143/282 (50%)
  Q:     4 LNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPL--DKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           L  +K RI+   +  KIT AM++V+ A+++K +E F     +      L   I  +S      +     GK + +   S MGLCGSFN  I++E ++ +K  + +  +G K      S     +++   +   +   F++   + E+LL    N      + +IY KFVN L   P+   L P+   K IE+           +  +P + ++  +    Y+AT I   + E+KV E  +R+NAM +AT+NA E+I+   LE+N+ RQ+ ITQE+ EIV+GA+ 
  S:     6 LRSVKARIQSTSALMKITRAMEMVARARVRKLEEGFRKAKTFASSVEVLKDRIDFSSCDHPFVIG---SGKPVLVVVSSDMGLCGSFNAEIIRETERRLKDFEILITVGSKATAHFSSN---KKLAKSYQRIYETPAFNVAAALMEDLLKISGN------VHIIYGKFVNRLVQRPTCVQLTPIAGGKNIER-----------YEYEPFSEELAANFANFYVATKIFSLLYETKVSEMYARQNAMRNATENAREMIRTLTLEYNKARQASITQELIEIVTGAEA 266
>gi|153885488|ref|ZP_02006645.1| ATP synthase F1, gamma subunit [Ralstonia pickettii 12D] >gi|187930578|ref|YP_001901065.1| ATP synthase F1, gamma subunit [Ralstonia pickettii 12J] >gi|151578388|gb|EDN42787.1| ATP synthase F1, gamma subunit [Ralstonia pickettii 12D] >gi|187727468|gb|ACD28633.1| ATP synthase F1, gamma subunit [Ralstonia pickettii 12J] (291 aa)
Score = 276, Expect = 8.7e-23, Identities = 81/283 (28%), Positives = 151/283 (53%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIK-SNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPL--DKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA   EI+ +IK +++T KIT AM++V+++K++K +E       Y +K  ++  ++  +N + +   +   +  +   +   +  GLCG  N N+++ +   ++         +   IG KG   +   G +  +S  + L D      L   I   L A   N   I ++ + Y++F+N++   P V  LLPL  DK + +   +K     D+  +P+A  V + +LI Y+   ++ A+ E+   E ++R  AM +A+ NA  +I   +L +N+ RQ+ IT+E++EIVSGA
  S:     1 MAGTKEIRTKIKSVQNTRKITKAMEMVAASKMRKAQERMRAARPYAEKIRNVAAHMALANPEYKHPFMVARDIKRAGLIVVTTDKGLCGGLNTNVLRAVTTQLRDLQNKGVETQTTAIGTKGMQFLGRVGAKV-VSNVVHLGDTPHLEKLIGAIKVQLDAF--NAGQIDAVYLAYTRFINTMKQEPVVEQLLPLTADK-LAQSDAEKQAYSWDYIYEPDAQTVVDELLIRYVEALVYQAVAENMASEQSARMVAMKAASDNAKNVIGELQLVYNKTRQAAITKELSEIVSGA 288
>gi|119896450|ref|YP_931663.1| F0F1 ATP synthase subunit gamma [Azoarcus sp. BH72] >gi|166222520|sp|A1K1S1|ATPG_AZOSB ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|119668863|emb|CAL92776.1| probable ATP synthase gamma chain [Azoarcus sp. BH72] (289 aa)
Score = 276, Expect = 8.8e-23, Identities = 81/283 (28%), Positives = 152/283 (53%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSN--SDSEILSLKKSEEGKTIWLAFFSS-MGLCGSFNLNI-------VKELQKHIKSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MAS  EI+ +IK +++T KIT AM++V+++K++K ++       Y  K   L   +     +D +   L + ++ K + L   ++  GLCG  N N+       +KE +    +      IG KG   ++  G +  +S   +L D      L   + + +L  ++N   + ++ V Y++F+N++   P +  LLPL       +L  P+N  D+  +P+   V + +L+ Y+   ++ A+ E+   E ++R  AM +A+ NA  +I   +L +N+ RQ+ IT+E++EIV GA
  S:     1 MASGKEIRTKIKSVQNTRKITKAMEMVAASKMRKAQDRMRAARPYADKIRRLAANLSQANVTDYKHPFLVRKDQVKRVGLILVTTDKGLCGGLNTNVQRVAVNAMKEWEAAGATEIRACCIGNKGFGFMQRIGAKV-VSHVTQLGDTPHLEKLIGPV-KVMLDAFQNG-ELDAVYVAYTRFINTMKQEPQLEQLLPLTGE----KLGTPDNSWDYLYEPDPQVVIDELLVRYVEALVYQAVAENMASEQSARMVAMKAASDNAKNVIGELQLVYNKTRQAAITKELSEIVGGA 286
>gi|167358071|ref|ZP_02292731.1| ATP synthase F1, gamma subunit [Rhizobium leguminosarum bv. trifolii WSM1325] >gi|167075062|gb|EDR78878.1| ATP synthase F1, gamma subunit [Rhizobium leguminosarum bv. trifolii WSM1325] (294 aa)
Score = 276, Expect = 9.4e-23, Identities = 78/285 (27%), Positives = 158/285 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSE---ILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYK-NDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           M SL ++K R+  +++T KIT AMK+V++AKL++ +E       Y ++   +   I K+ +D++    L     ++   + +   +  GLCG FN  I +  ++ ++         +I+ +GKKG ++++ +     I      D K + F+    I + ++  Y   ++++ ++   YS+F + +S  P+   L+P      +   D  + GA +  +P+   + E ++   ++  I  A++E+   E  ++ +AMD+AT+NA E+I    L +NR+RQ++IT+E+ EI+SGA+ 
  S:     1 MPSLKDLKNRVASVKATQKITKAMKMVAAAKLRRAQEAAEAARPYSQRMGVVLANIAKAVTDADGAPTLMTGTGQDKVHLLVVCTAERGLCGGFNSQIARFAREQVRKLLAEGKTVKIFTVGKKGHDILRREFASLIIERKELRDVKRVGFENADQIGKRIIEMYAAGEFDVCTL--FYSEFKSVISQIPTAQQLIPASTGAVQAE-DAAHAGAVYEYEPDPASILEDLIPRNISVQIFRALLENVAGEMGAKMSAMDNATRNAGEMINKLTLSYNRQRQAQITKELIEIISGAEA 293
>gi|163942994|ref|YP_001647878.1| F0F1 ATP synthase subunit gamma [Bacillus weihenstephanensis KBAB4] >gi|163865191|gb|ABY46250.1| ATP synthase F1, gamma subunit [Bacillus weihenstephanensis KBAB4] (286 aa)
Score = 276, Expect = 9.5e-23, Identities = 90/282 (31%), Positives = 151/282 (53%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEGK-TIWLAFFSSMGLCGSFNLNIVKELQKHIK------SND-EIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSG 282
           MASL +IK +I   + TS+IT AM++VS++KL + ++   +   Y +K  ++   I   S      +  S   K T ++   S  GL G +N N+++ +   I+      SN   I ++G+ G++ +K +G    I   + L D   +F     IA   +A +  D     + + Y+ +V+ +S   +   +LPL         DKP    +F  +P+  ++ + +L  Y  + ++GA+++ K  E+A+R  AM SAT NA E+I +  L FNR RQ+ ITQEITEIV G
  S:     1 MASLRDIKAKINSTKKTSQITKAMEMVSASKLNRAEQNAKSFVPYMEKIQEVVASIAQGSKGINHPMLNSRPVKRTGYIVITSDRGLAGGYNSNVLRTVSNVIRERHNMDSNQYSIIVLGRLGRDYLKRRGFNI-IDEVVGLSDHP-SFTDIKDIASRAIAMFA-DGAYDELYIYYNHYVSKISQEVTENKILPLTDVAS----DKPTTAYEF--EPSEEEILKVLLPQYAESLVYGALLDGKASEHAARMTAMKSATDNAMEVIDSLTLSFNRARQAAITQEITEIVGG 281
>gi|187735014|ref|YP_001877126.1| ATP synthase F1, gamma subunit [Akkermansia muciniphila ATCC BAA-835] >gi|187425066|gb|ACD04345.1| ATP synthase F1, gamma subunit [Akkermansia muciniphila ATCC BAA-835] (290 aa)
Score = 276, Expect = 1.0e-22, Identities = 80/285 (28%), Positives = 158/285 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDEIWLIGKK-GKNLIK-SKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPN------NGAD----FSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           M +L +I++RIK +++TS+IT AM++V+SAK+++ ++  +    Y +   ++  +++   D+    L ++  G  + L   +  GLCG  N N++K +++    N     IG+K    L K ++ +EA  SL   L   ++   +F  I +   A+   +Y    + V +S FVN++   P    LLP++    +P ++         +GAD    F ++P+   + ++IL  Y+   +   ++E++  E+++R  AM  AT+NA  +I    L++N+ RQ++IT E+ EI +  + 
  S:     1 MGNLRDIRRRIKSVKNTSQITRAMQMVASAKMRRAQDQAVKGRPYIRALAEVLYHLQDEIDTSNSPLMQTHGGADLVLLVNTDRGLCGGLNANLIKMVREQAPENAHYITIGRKLNAALAKLNERLEATWSLTDPLSLLELK-PVFDFIVQKFKAE---EYG--RVFVAFSGFVNTMVQKPVFRQLLPIEP---EPLMNMAKAGGSSLDGADAHKQFLLEPSPAALLDTILPLYVFHGLVQIVLEARASEHSARMVAMKGATENAKNIIGGLTLDYNKARQTQITNELLEITTAMRA 288
>gi|170694319|ref|ZP_02885473.1| ATP synthase F1, gamma subunit [Burkholderia graminis C4D1M] >gi|170140742|gb|EDT08916.1| ATP synthase F1, gamma subunit [Burkholderia graminis C4D1M] (294 aa)
Score = 275, Expect = 1.1e-22, Identities = 83/283 (29%), Positives = 158/283 (55%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYI-KSNSDSEILSLKKSEEGKTIWLAFFSS-MGLCGSFNLNIV-------KELQKHIKSNDEIWLIGKKGK---NLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYK------NDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDK---PNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MA + EI+ +IK +++T KIT AM++V+++K+++ +E       Y  K  D+  ++ ++N +     +  +E  KT  +   ++  GLCG  N N++       KEL+   K+  E   IG KG    N +++K +   + L           D  H+  E L+   K      ++  + ++ + Y++FVN++   P +  LLPL     + + ++   P    D+  +P+A  V + +L+ Y+   ++ A+ E+   E ++R  AM +A+ NA  +I   +L +N+ RQ+ IT+E++EIV GA
  S:     1 MAGMKEIRGKIKSVQNTRKITKAMEMVAASKMRRAQERMRAARPYADKVRDIAAHMSRANPEYRHPFMVSNEGAKTAGIILVTTDKGLCGGMNTNVLRAALQKFKELEGQGKT-IEATAIGTKGLGFLNRLRAKVVSNVVHLG----------DTPHL--EKLIGAVKVQLDLYSEGKVSAVYLAYTRFVNTMKQEPVIEQLLPLSADQFERKEEQGATPTTQWDYIYEPDAQAVVDELLVRYVEALVYQAVAENMASEQSARMVAMKAASDNAKTVINELQLVYNKSRQAAITKELSEIVGGA 291
>gi|145621084|ref|ZP_01777084.1| ATP synthase F1, gamma subunit [Geobacter bemidjiensis Bem] >gi|144942616|gb|EDJ77741.1| ATP synthase F1, gamma subunit [Geobacter bemidjiensis Bem] >gi|197089672|gb|ACH40943.1| ATP synthase F1, gamma subunit [Geobacter bemidjiensis Bem] (287 aa)
Score = 275, Expect = 1.1e-22, Identities = 82/284 (28%), Positives = 152/284 (53%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEILSLK-KSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIK------SNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKY-KNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAK 284
           MA+L  IKKRI  +++T +IT AMK+VS+AKL++ +E  +    Y  K  ++   +    +S+   L  K +  + + +   S  GLCG FN N+ K  ++ I       S   +  IG+KG   ++++    +   ++      +++    +IA  L+  Y   +Y+   + VIY+ F + ++   ++  LLP    +     D    G ++  +P+   + + +L  ++   +  +++ES   E+ +R  AMDSA+KNA E+I    L +NR RQ+ IT E+ EI+SG++
  S:     1 MANLKSIKKRIVSVKNTRQITKAMKMVSAAKLRRAQENVVAARPYAGKLAEVLERLAKTQESDASPLMVKRDTRRALLVVVTSDRGLCGGFNANLSKAAERFINERKGDFSELSLMTIGRKGYEFLRNRHTVRKHHGNIF---STLSYHTAALIAAELVEGYLAEEYD--EVYVIYNAFKSVMTQDITLEQLLP----VTAKTADTDEVGTEYIYEPSKAALLDELLPKHIEVQVFKSLLESVASEHGARMTAMDSASKNATEMIGKLTLIYNRARQAAITTELMEIISGSE 283
>gi|196251786|ref|ZP_03150452.1| ATP synthase F1, gamma subunit [Clostridium thermocellum DSM 4150] >gi|196198726|gb|EDX93557.1| ATP synthase F1, gamma subunit [Clostridium thermocellum DSM 4150] (295 aa)
Score = 275, Expect = 1.2e-22, Identities = 92/285 (32%), Positives = 151/285 (52%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKK----FYDLFTYIKSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHIKSNDE--IWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPL--DKAIEKPRLDKPNN---GADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           MA +NEIK R+K I  T +ITNAMKL+S+AKLKK K+     S Y++K      D+        +    +  +  + K  ++      G  G +N NI+K  ++ +K + +  +++ G  G+N          +  D  + +  I   +   I E +L  +  +     + +IY+   +++   PS+  LLPL  D   EK ++++            +P+   VF  ++  Y+   ++GA VES   E  SR  AMD+AT NAN+++K   L +NR RQS+ITQ+ITEIV GA+ 
  S:     1 MAHINEIKLRMKSIRETRQITNAMKLISAAKLKKAKKQLEKASPYFEKVRSTMADILLRSGKIENKYFHARDEKTDKKKAYIVITGEKGFAGGYNHNIIKFTEECLKQDKDPLLFVAGNVGRNHFLKNKYNVYMEFDYPVQNPSIY--MAREIMEVILDLFDKEV-FDELYIIYTHMFSNIKMEPSIIKLLPLELDTLKEKFQINESTEKIVDGCMEYEPDPEYVFNVLVRKYIKGVVYGAFVESFTSEQNSRMTAMDNATANANDMLKKLDLLYNRARQSKITQDITEIVGGAEA 293
>gi|168728864|ref|ZP_02761141.1| F0F1 ATP synthase subunit gamma [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|87126229|gb|ABD20743.1| ATP synthase F1, gamma subunit [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|87203566|gb|ABD31376.1| ATP synthase F1, gamma subunit [Staphylococcus aureus subsp. aureus NCTC 8325] (265 aa)
Score = 275, Expect = 1.3e-22, Identities = 79/260 (30%), Positives = 150/260 (57%)
  Q:    24 MKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIK-SNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKEL-----QKHIKSND-EIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLDKAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           M +VSS+KL++ ++     + Y  K  D  T +  ++S++    L+  +  ++ +L   S  GL G+++ N++K+L      KH  S++  I ++G++G + +K++G + E S  +++ D+  +F     +A + +  Y  +  I  + + YS +V+ L   P+   +LPL    ++       + + +  +P+   +   IL  Y+ + I+G I+++K  E+A+R  AM +AT NA ELI +  LE+NR RQ+EITQ+ITEIV G+
  S:     1 MNMVSSSKLRRAEKNTKQFTPYMDKMQDAITAVAGASSNTNHPMLRPRKITRSGYLVITSDKGLAGAYSANVLKKLITDIEAKHQDSSEYSIVVLGQQGVDFLKNRGYDIEYS-QVDVPDQP-SFKSVQALANHAIDLYSEE-EIDELNIYYSHYVSVLENKPTSRQVLPLS---QEDSSKGHGHLSSYEFEPDKESILSVILPQYVESLIYGTILDAKASEHATRMTAMKNATDNATELIDDLSLEYNRARQAEITQQITEIVGGS 261
>gi|119510738|ref|ZP_01629865.1| ATP synthase subunit C [Nodularia spumigena CCY9414] >gi|119464602|gb|EAW45512.1| ATP synthase subunit C [Nodularia spumigena CCY9414] (315 aa)
Score = 275, Expect = 1.4e-22, Identities = 93/285 (32%), Positives = 162/285 (56%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKSNSDSEI--LSLKKSEEGKTIWLAFFS-SMGLCGSFNLNIVKELQKHIKS------NDEIWLIGKKGKNLIKSK---------GIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLD----KAIEKPRLDKPNNGADFSIQ---------PNAND---------VFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGAKG 285
           MA+L  I+ RI+ +++T KIT AM+LV++A++++ +E       +  +   +   +++    E   L L K  E KT+ L   S   GLCG +N NI++  +   K       N +  L+G+K     + +         G+E +I    E  +          +A+ LL+ + ++ ++  I++IY+KFV+ +S  P V +LLPLD    +A +         G  F ++         P   D         + +S+L  YL+  +  A+ ES   E A+R  AM++A+ NA +LIK+  L +N+ RQ+ ITQE+ E+V GA+ 
  S:     1 MANLKSIRDRIQSVKNTKKITEAMRLVAAARVRRAQEQVTATRPFADRLAQVLYGLQTRLRFEDVDLPLLKKREVKTVGLLVISGDRGLCGGYNSNIIRRAETRAKELQAEGVNYKFVLVGRKAIQYFQRREQPIDGTYTGLE-QIPTASEATE----------VADQLLSLFLSE-SVDRIELIYTKFVSLVSSRPVVQTLLPLDPQGLEAADDEIFRLTTRGGQFEVERQKVTSQVRPLPRDMIFEQDPVQILDSLLPLYLSNQLLRALQESAASELAARMTAMNNASDNAGDLIKSLSLSYNKARQAAITQELLEVVGGAEA 313
>gi|170017976|ref|YP_001728895.1| ATP synthase F1, gamma subunit [Leuconostoc citreum KM20] >gi|169804833|gb|ACA83451.1| ATP synthase F1, gamma subunit [Leuconostoc citreum KM20] (302 aa)
Score = 274, Expect = 1.4e-22, Identities = 84/282 (29%), Positives = 151/282 (53%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFTYIKS-----NSDSEILSL-KKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHI------KSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLD---------KAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSG 282
           MASL +I++RI   + T +IT+AM++VS+AKL + +        Y  +   +  ++ +     N+D++ + L  +    KT  L   S  GL GS+N N++K+    +       +N  I  +G  G +  K +G E  + L+        +F+    + + + + Y+++    ++ V+Y+ FVN L+       LLPL              K  LD     + + ++P+   V   +L  +  + ++ A++++K  E+A+   AM +AT NA +LI   +L+FNR RQ+ IT EITEI  G
  S:     1 MASLQDIQRRISSTKKTRQITSAMQMVSTAKLSQIQRYGRGYQAYAARLEAVVEHLVAAHLFDNADAKHIPLIAQRPIRKTGILVVTSDRGLVGSYNANVIKQTNALMARLNLDTTNTAILAVGGNGADFYKKRGFE--VILEHRGVSDVPSFNEIRSVVKTVTSLYESEV-FDALHVVYNHFVNRLTSEYRDVQLLPLTGDTLVAMGGTEAHKAELDIQ---SAYEVEPDTTAVLNVVLPQFAQSLVYEAVLDAKTAEHAASSTAMKAATDNAKDLIGRLELQFNRARQAAITTEITEITGG 297
>gi|29346129|ref|NP_809632.1| F0F1 ATP synthase subunit gamma [Bacteroides thetaiotaomicron VPI-5482] >gi|81740939|sp|Q8A9U6|ATPG_BACTN ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) >gi|29338023|gb|AAO75826.1| ATP synthase gamma chain [Bacteroides thetaiotaomicron VPI-5482] (298 aa)
Score = 274, Expect = 1.4e-22, Identities = 91/283 (32%), Positives = 154/283 (54%)
  Q:     1 MASLNEIKKRIKIIESTSKITNAMKLVSSAKLKKQKELFLNESIYYKKFYDLFT-YIKSNSDSEILSLKKSEEGKTIWLAFFSSMGLCGSFNLNIVKELQKHI-------KSNDEIWLIGKKGKNLIKSKGIEAEISLDLELDDKDINFDLFHIIAENLLAKYKNDYNIKSIKVIYSKFVNSLSFTPSVFSLLPLD--------KAIEKPRLDKPNNGADFSIQPNANDVFESILIDYLATCIHGAIVESKVCENASRRNAMDSATKNANELIKNYKLEFNRKRQSEITQEITEIVSGA 283
           MASL E+K RI  ++ST KIT+AMK+V+SAKL K +    N   Y +K   + T ++ ++   E   +K  E  +   +AF S+  LCG+FN N++K L + +       + N  I+ +GKK    +K  G E +      L DK  ++     +A  L+  Y +   I  +++IY  F +         + LP+D        +  ++  +       D+ I+P+A ++  +++   L+  +  A V+S   E+A+R  AM  AT NANELI++   ++N+ RQ  IT E+ +IV G+
  S:     1 MASLKEVKTRINSVKSTRKITSAMKMVASAKLHKAQGAIENMLPYERKLNKILTNFLSADLPVESPYIKAREVKRVAIVAFSSNTSLCGAFNANVIKMLLQTVGEFRTLGQDNILIFPVGKKVDEAVKRLGFEPQ-ETSPTLSDKP-SYQEASELAHRLMEMYVSG-EIDRVELIYHHFKSMGVQILLRETYLPIDLTRVVDEEEKQKEEEVQGGEIANDYIIEPSAEELIANLIPTVLSQKLFTAAVDSNASEHAARTLAMQVATDNANELIQDLTKQYNKSRQQAITNELLDIVGGS 296