>gi|81846246|sp|Q8EWY8|ATPB_MYCPE ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|26453520|dbj|BAC43852.1| ATP synthase subunit beta [Mycoplasma penetrans HF-2] (778 aa)
Score = 3613, Expect = 0.0e+00, Identities = 778/778 (100%), Positives = 778/778 (100%)
  Q:     1 MKENNKTIEAKNKELRDATKEFNEKLQKFLKDKVKKGFQIKNPNYKIDDNKISSNEVFKNNKNDFELNLPKNTWEEKTNKPESFENYKNVIPPYEDKFLPENFKEKFAPKNIKSEPLINKKDNLKEKNNNPVFDEVKIQEDDKFFDFSKFSETVSNQPENILKIEENDFKEIHDDFVSQYETFSKLETKENTNDLKTNLSSDTIKTIESKNEPEVQIESEIKDDSLEKEISEDDSFMDIFKAEQPDNQEDDSFVIDEEKAKEEYQEIKTNKSIVSDSHKIDIYEENEDLMKLNTLKSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHKNYVAANSNNKVNSSNKPLNSENKSN 778
           MKENNKTIEAKNKELRDATKEFNEKLQKFLKDKVKKGFQIKNPNYKIDDNKISSNEVFKNNKNDFELNLPKNTWEEKTNKPESFENYKNVIPPYEDKFLPENFKEKFAPKNIKSEPLINKKDNLKEKNNNPVFDEVKIQEDDKFFDFSKFSETVSNQPENILKIEENDFKEIHDDFVSQYETFSKLETKENTNDLKTNLSSDTIKTIESKNEPEVQIESEIKDDSLEKEISEDDSFMDIFKAEQPDNQEDDSFVIDEEKAKEEYQEIKTNKSIVSDSHKIDIYEENEDLMKLNTLKSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHKNYVAANSNNKVNSSNKPLNSENKSN
  S:     1 MKENNKTIEAKNKELRDATKEFNEKLQKFLKDKVKKGFQIKNPNYKIDDNKISSNEVFKNNKNDFELNLPKNTWEEKTNKPESFENYKNVIPPYEDKFLPENFKEKFAPKNIKSEPLINKKDNLKEKNNNPVFDEVKIQEDDKFFDFSKFSETVSNQPENILKIEENDFKEIHDDFVSQYETFSKLETKENTNDLKTNLSSDTIKTIESKNEPEVQIESEIKDDSLEKEISEDDSFMDIFKAEQPDNQEDDSFVIDEEKAKEEYQEIKTNKSIVSDSHKIDIYEENEDLMKLNTLKSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHKNYVAANSNNKVNSSNKPLNSENKSN 778
>gi|161723286|ref|NP_757448.2| F0F1 ATP synthase subunit beta [Mycoplasma penetrans HF-2] (489 aa)
Score = 2428, Expect = 0.0e+00, Identities = 489/489 (100%), Positives = 489/489 (100%)
  Q:   290 MKLNTLKSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHKNYVAANSNNKVNSSNKPLNSENKSN 778
           MKLNTLKSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHKNYVAANSNNKVNSSNKPLNSENKSN
  S:     1 MKLNTLKSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHKNYVAANSNNKVNSSNKPLNSENKSN 489
>gi|31544510|ref|NP_853088.1| F0F1 ATP synthase subunit beta [Mycoplasma gallisepticum R] >gi|461567|sp|P33253|ATPB_MYCGA ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|44302|emb|CAA45551.1| adenosinetriphosphatase [Mycoplasma gallisepticum] >gi|31541355|gb|AAP56656.1| AtpD [Mycoplasma gallisepticum R] (471 aa)
Score = 1748, Expect = 0.0e+00, Identities = 354/459 (77%), Positives = 396/459 (86%)
  Q:   292 LNTLKSDKGIIYQIFGPVVDVKFAR-NQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPID-NKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           +NT K   G +YQ+ GPVVDV F + + +P I DCL +  PN  KL LEVA L GDD+ARCI+MG TEGL R ++V +T  PI  PVG+ VLGRMFNV+GEPID  KP+   V+   IH+  PSF +QS + EIFETGIKVIDLL+PY KGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLS+FAGVGERTREGNDLY+EMI+GGVI++TALVFGQMNEPPGARMRVALT LTMAE+FR+ N QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMG LQERITSTKSGSITSVQA+YVPADDLTDPAPSTTF HLDAKTVLDR IASLGI+PA+NPL+S+SR+LDPS+VGI+HY+ AR VQ ILQKF ELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFS   GKYV   +TI GFSEI+EGK DD+PEQ F YVG ID+
  S:     1 MNT-KYSYGKVYQVVGPVVDVVFEKQDDLPKIYDCLIIDEPN-MKLHLEVAQLIGDDIARCIAMGPTEGLARNVKVTSTNQPISVPVGTEVLGRMFNVIGEPIDEKKPIDASVKRMSIHRPAPSFADQSNELEIFETGIKVIDLLIPYAKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSVFAGVGERTREGNDLYYEMIEGGVIDKTALVFGQMNEPPGARMRVALTGLTMAEYFRDVNNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLAEEMGSLQERITSTKSGSITSVQAIYVPADDLTDPAPSTTFTHLDAKTVLDRNIASLGIFPAVNPLDSTSRLLDPSVVGIQHYQTARKVQMILQKFLELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSGNKGKYVPISETIKGFSEIVEGKHDDLPEQAFFYVGSIDE 459
>gi|13508337|ref|NP_110287.1| F0F1 ATP synthase subunit beta [Mycoplasma pneumoniae M129] >gi|2493024|sp|Q50331|ATPB_MYCPN ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|1209766|gb|AAC43659.1| ATP synthase beta chain >gi|1673912|gb|AAB95892.1| ATP synthase beta chain [Mycoplasma pneumoniae M129] (475 aa)
Score = 1713, Expect = 0.0e+00, Identities = 335/451 (74%), Positives = 381/451 (84%)
  Q:   300 GIIYQIFGPVVDVKFARN-QMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           G ++Q+ GPVVDV F  + Q+P I DCL VKL   ++L LE A L GDD+ RCI++G TEGL R  +V N  +PI  PVG  VLGRMFNV+G+PID K    K    PIH+KPPSFD+QS   EIFETGIKVIDLL PY +GGKIGLFGGAGVGKTVLVQELIHNIA  H GLS+FAGVGERTREGNDLY+EMI GGVI++TALVFGQMNEPPGARMRVALTALTMAE+FR+++ QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMGQLQERI STK+GSITSVQA+YVPADDLTDPAP+TTF HLDAKTVLDR IA+LGI+PAINPLES+SR+LDP+IVGI HYKVA  VQ ILQ+F ELQDIIAILGIDEL++EDK+ V RAR+IRNFLSQPFFVAEKFS  +GKYV   DTI  F EI++GK DD+PEQ F +VG I +
  S:     9 GKVHQVIGPVVDVIFTESSQLPRIYDCLSVKLAG-EELFLEAAQLIGDDIVRCIALGPTEGLARNEKVTNYNHPIEVPVGKNVLGRMFNVLGKPIDGKEELPKKPQLPIHRKPPSFDDQSNTLEIFETGIKVIDLLTPYARGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTALVFGQMNEPPGARMRVALTALTMAEYFRDHDNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPNIVGINHYKVALGVQNILQRFAELQDIIAILGIDELADEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVPLSDTIQSFKEILDGKHDDLPEQAFFFVGTIQE 459
>gi|12045261|ref|NP_073072.1| F0F1 ATP synthase subunit beta [Mycoplasma genitalium G37] >gi|2506209|sp|P47639|ATPB_MYCGE ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|3844991|gb|AAC71627.1| ATP synthase F1, beta subunit [Mycoplasma genitalium G37] >gi|166078639|gb|ABY79257.1| ATP synthase F1, beta subunit [synthetic Mycoplasma genitalium JCVI-1.0] (476 aa)
Score = 1705, Expect = 0.0e+00, Identities = 332/451 (73%), Positives = 384/451 (85%)
  Q:   300 GIIYQIFGPVVDVKFARN-QMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNK-PMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           G ++Q+ GPVVDV F+ + Q+P + DCL V+L    +L LE   L GDD+ RCI++G TEGL R ++V N  +PI  PVG  VLGRMFNV+GEPID K P+P+K + S IH+ PP+FDEQ    +IFETGIKVIDLL PYV+GGKIGLFGGAGVGKTVLVQELIHNIA  H GLS+FAGVGERTREGNDLY+EMI GGVI++T LVFGQMNEPPGARMRVALTALTMAE+FR+++ Q+VLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMG+LQERI STK+GSITSVQA+YVPADDLTDPAP+TTF HLDAKTVLDR IA+LGI+PAINPLES+SR+LDPS+VGI HYKVA  VQ ILQ+F ELQDIIAILGIDELS+EDK+ V RAR+IRNFLSQPFFVAEKFS  +GKYVS  DT+  F EI+EGK D +PEQ F YVG I +
  S:    10 GKVHQVIGPVVDVIFSESKQLPRVYDCLSVQL-KKSELFLEATQLIGDDIVRCIALGPTEGLARNVKVTNYNHPIEVPVGKNVLGRMFNVLGEPIDGKEPLPKKPKLS-IHRNPPAFDEQPNTVDIFETGIKVIDLLTPYVRGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREGNDLYYEMIQGGVIDKTVLVFGQMNEPPGARMRVALTALTMAEYFRDHDNQNVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLAIEMGKLQERIASTKTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAINPLESTSRLLDPSVVGINHYKVALGVQNILQRFAELQDIIAILGIDELSDEDKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVSLNDTVQSFKEILEGKHDHLPEQAFFYVGTIQE 460
>gi|160881854|ref|YP_001560822.1| F0F1 ATP synthase subunit beta [Clostridium phytofermentans ISDg] >gi|190358661|sp|A9KK92|ATPB_CLOPH ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|160430520|gb|ABX44083.1| ATP synthase F1, beta subunit [Clostridium phytofermentans ISDg] (472 aa)
Score = 1696, Expect = 0.0e+00, Identities = 328/459 (71%), Positives = 377/459 (82%)
  Q:   293 NTLKSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           N LKS  G I QI G V+D+KFA  ++P I + +++K  +   LV+EVA   GDD  RCI+MG T+GL RG++   T  PI  PVG   LGRMFNV+G PID K  P+ VEY PIH+K P+F+EQST+TEI ETGIKV+DLL PY KGGKIGLFGGAGVGKTVL+QELI NIAT HGG S+F GVGERTREGNDLY+EMID GVIN+T +VFGQMNEPPGARMRV LT LTMAE+FR+ + +DVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTL  EMG LQERITSTK+GSITSVQAVYVPADDLTDPAP+TTFAHLDA TVL R I  LGIYPA++PLES+SRMLDP +VG EHYKVAR VQ ILQ+++ELQDIIAILG+DELSE+DKL V+RARKI+ FLSQPF VAE+F+   G+YV   +TI GF EIIEGK DDIPE YFL  G IDDV
  S:     6 NKLKSGLGKITQIIGAVLDIKFAEGKLPEIYEAIKIKKNDGDTLVVEVAQHLGDDTVRCIAMGPTDGLVRGMDAEGTGAPISVPVGENTLGRMFNVLGNPIDEKEAPKNVEYYPIHRKAPAFEEQSTQTEILETGIKVVDLLCPYQKGGKIGLFGGAGVGKTVLIQELITNIATEHGGYSVFTGVGERTREGNDLYYEMIDSGVINKTTMVFGQMNEPPGARMRVGLTGLTMAEYFRDKSGKDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLQTEMGALQERITSTKNGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSRSIVELGIYPAVDPLESTSRMLDPRVVGEEHYKVARDVQEILQRYKELQDIIAILGMDELSEDDKLLVARARKIQRFLSQPFHVAEQFTGLPGRYVPVAETIQGFKEIIEGKHDDIPESYFLNAGNIDDV 464
>gi|146296975|ref|YP_001180746.1| F0F1 ATP synthase subunit beta [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|189081328|sp|A4XKX0|ATPB_CALS8 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|145410551|gb|ABP67555.1| ATP synthase F1, beta subunit [Caldicellulosiruptor saccharolyticus DSM 8903] (467 aa)
Score = 1694, Expect = 0.0e+00, Identities = 323/461 (70%), Positives = 376/461 (81%)
  Q:   295 LKSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHKNY 755
           ++ + G + QI GPVVDV+F    +P IN+ +E+   + K LV EVA   G+D  RC+++GST+GL RG++ I+T  PI  PVG   LGR+FNV+G+PIDNK   +  +Y PIH+  PSF+EQ    EIFETGIKVIDLL PY KGGKIGLFGGAGVGKTVL+ ELI NIAT HGG SIF GVGERTREGNDL+ EM + GVI +T LVFGQMNEPPGARMRVALT LTMAE+FR+   QDVLLFIDNIFRF QAGSEVSALLGRIPSAVGYQPTLA E+G LQERITSTK GSITSVQA+YVPADDLTDPAP+TTFAHLDA TVL R+IA LGIYPA++PL+S+SR+LDP IVG EHY VAR+VQ ILQ+++ELQDIIAILG+DELSEEDKL V RARKI+ FLSQPFFVAE F+ + G+YV  +DTI GF EIIEGK D IPEQYF  VG ID+V++NY
  S:     1 MEQNVGYVVQIIGPVVDVRFESGNLPAINNAIEIHF-DGKTLVAEVAQHLGNDTVRCVALGSTDGLRRGVKAIDTGGPIKVPVGRGTLGRIFNVLGQPIDNKGEVQATDYWPIHRSAPSFEEQVPAVEIFETGIKVIDLLAPYAKGGKIGLFGGAGVGKTVLIMELIRNIATEHGGFSIFTGVGERTREGNDLWLEMNESGVIEKTVLVFGQMNEPPGARMRVALTGLTMAEYFRDVEGQDVLLFIDNIFRFIQAGSEVSALLGRIPSAVGYQPTLANEVGALQERITSTKRGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRQIAELGIYPAVDPLDSTSRILDPRIVGEEHYYVARTVQQILQRYKELQDIIAILGMDELSEEDKLIVYRARKIQRFLSQPFFVAEAFTGRPGRYVKLKDTIRGFKEIIEGKMDHIPEQYFYMVGTIDEVYENY 460
>gi|171920630|ref|ZP_02931872.1| ATP synthase F1, beta subunit [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|185178799|ref|ZP_02964594.1| ATP synthase F1, beta subunit [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188024161|ref|ZP_02996887.1| ATP synthase F1, beta subunit [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188039640|ref|ZP_02998345.1| ATP synthase F1, beta subunit [Ureaplasma urealyticum serovar 8] >gi|188518551|ref|ZP_03004012.1| ATP synthase F1, beta subunit [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|188524101|ref|ZP_03004181.1| ATP synthase F1, beta subunit [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|188530858|ref|ZP_03005151.1| ATP synthase F1, beta subunit [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gi|188568720|ref|ZP_03005474.1| ATP synthase F1, beta subunit [Ureaplasma urealyticum serovar 2] >gi|188592533|ref|ZP_03005858.1| ATP synthase F1, beta subunit [Ureaplasma urealyticum serovar 10] >gi|195867714|ref|ZP_03079715.1| ATP synthase F1, beta subunit [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|171903354|gb|EDT49643.1| ATP synthase F1, beta subunit [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|184209422|gb|EDU06465.1| ATP synthase F1, beta subunit [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188018792|gb|EDU56832.1| ATP synthase F1, beta subunit [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188997947|gb|EDU67044.1| ATP synthase F1, beta subunit [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|195660096|gb|EDX53476.1| ATP synthase F1, beta subunit [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|195660569|gb|EDX53825.1| ATP synthase F1, beta subunit [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (464 aa)
Score = 1692, Expect = 0.0e+00, Identities = 328/453 (72%), Positives = 379/453 (83%)
  Q:   299 KGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           KG I QI GPVVDV+F    +P IN  LE+   +  KLVLEV+ L GD++ARCI+M +T+GL RG EVINT+ PIM PVG  VLGRMFNV G+PID +P P   +  PIH+  PSF EQ+   EI ETGIKV+DLLVP+ KGGKIGLFGGAGVGKTVL+QELIHNIA  HGGLS+FAGVGERTREGNDLY+EM +  V+++TALVFGQMNEPPGARMRVAL+ LTMAE FR+   QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLAFEMGQLQERITSTK GSITSVQAVYVPADDLTDPAP+TTF+HLDAK VLDR IASLG+YPAI+PL+S+SR+LDP +VG++HY VAR V  ILQ+F ELQDIIAILG+DELSEED+  V RARK+RN+LSQP  VAEKFS + G  V  +DTI GF +I++G+CDDI EQ+FLYVG IDDV
  S:     6 KGKINQILGPVVDVRFPSEWLPEINTALELN-NHGSKLVLEVSQLVGDNIARCIAMDTTDGLVRGQEVINTEKPIMMPVGKQVLGRMFNVTGDPIDEQPAPTG-KRMPIHRPAPSFAEQAEAIEILETGIKVVDLLVPFAKGGKIGLFGGAGVGKTVLMQELIHNIAKNHGGLSVFAGVGERTREGNDLYYEMAESDVLDKTALVFGQMNEPPGARMRVALSGLTMAEEFRDAFGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLAFEMGQLQERITSTKKGSITSVQAVYVPADDLTDPAPATTFSHLDAKVVLDRAIASLGLYPAISPLQSTSRLLDPLVVGVKHYSVARRVIEILQRFMELQDIIAILGMDELSEEDRQLVMRARKVRNYLSQPSHVAEKFSGQPGLSVKLEDTIEGFRKILDGECDDIHEQHFLYVGKIDDV 456
>gi|13357686|ref|NP_077960.1| F0F1 ATP synthase subunit beta [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|170762163|ref|YP_001752212.1| ATP synthase F1, beta subunit [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171920510|ref|ZP_02931798.1| ATP synthase F1, beta subunit [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|183508849|ref|ZP_02958297.1| ATP synthase F1, beta subunit [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186701941|ref|ZP_02971583.1| ATP synthase F1, beta subunit [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|189081353|sp|B1AIB8|ATPB_UREP2 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|81858619|sp|Q9PR15|ATPB_UREPA ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|11266603|pir||H82928 ATP synthase beta chain UU129 [imported] - Ureaplasma urealyticum >gi|6899088|gb|AAF30535.1|AE002114_2 ATP synthase beta chain [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168827740|gb|ACA33002.1| ATP synthase F1, beta subunit [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171902985|gb|EDT49274.1| ATP synthase F1, beta subunit [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|182675823|gb|EDT87728.1| ATP synthase F1, beta subunit [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186700692|gb|EDU18974.1| ATP synthase F1, beta subunit [Ureaplasma parvum serovar 6 str. ATCC 27818] (464 aa)
Score = 1686, Expect = 0.0e+00, Identities = 327/453 (72%), Positives = 378/453 (83%)
  Q:   299 KGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           KG I QI GPVVDV+F    +P IN  LE+   +  KLVLEV+ L GD++ARCI+M +T+GL RG EVINT+ PI  PVG  VLGRMFNV G+PID +P P   +  PIH+  PSF EQ+   EI ETGIKV+DLLVP+ KGGKIGLFGGAGVGKTVL+QELIHNIA  HGGLS+FAGVGERTREGNDLY+EM +  V+++TALVFGQMNEPPGARMRVAL+ LTMAE FR+   QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLAFEMGQLQERITSTK GSITSVQAVYVPADDLTDPAP+TTF+HLDAK VLDR IASLG+YPAI+PL+S+SR+LDP +VG++HY VAR V  ILQ+F ELQDIIAILG+DELSEED+  V RARK+RN+LSQP  VAEKFS + G  V  +DTI GF +I++G+CDDI EQ+FLYVG IDDV
  S:     6 KGKINQILGPVVDVRFPSEWLPEINTALELN-NHGSKLVLEVSQLVGDNIARCIAMDTTDGLVRGQEVINTQKPITMPVGKQVLGRMFNVTGDPIDEQPAPTG-KRMPIHRPAPSFAEQAESIEILETGIKVVDLLVPFAKGGKIGLFGGAGVGKTVLMQELIHNIAKNHGGLSVFAGVGERTREGNDLYYEMAESDVLDKTALVFGQMNEPPGARMRVALSGLTMAEEFRDAFGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLAFEMGQLQERITSTKKGSITSVQAVYVPADDLTDPAPATTFSHLDAKVVLDRAIASLGLYPAISPLQSTSRLLDPLVVGVKHYSVARRVIEILQRFMELQDIIAILGMDELSEEDRQLVMRARKVRNYLSQPSHVAEKFSGQPGLSVKLEDTIEGFRKILDGECDDIHEQHFLYVGKIDDV 456
>gi|110004066|emb|CAK98405.1| atp synthase beta chain protein [Spiroplasma citri] (465 aa)
Score = 1676, Expect = 0.0e+00, Identities = 324/454 (71%), Positives = 378/454 (83%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHK 753
           G + Q+ GPVVDV+F    +P + + + V   N  KLVLEV    GDD  R I++G TEG+ RG++VI+TK PI  PVG  VLGRMFNV+GE ID KP P+     PIH++ PS++EQ T   I ETGIKV+DLLVP+ KGGKIGLFGGAGVGKTVLVQELI+N+A  HGG+S+FAGVGERTREGNDLY+EMI+ GVI++TALVFGQMNE PGARMRVALT LT+AE+FR++  QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMG LQERITSTK GSITS+QAVYVP+DDLTDPAP+TTFAHLDAK VLDR+IA+LGIYPA++PL SSSR+LDP +VG EHY+VAR VQ ILQKF+ELQ IIAILG+DELS+EDKL V+RARKIRNFLSQ FFVAEKFS K+GKYV   +TI  F EI+ GK DD+PEQ FLYVG ID+V K
  S:     5 GKVVQVLGPVVDVRFTEEYLPELYNAITVN-NNGTKLVLEVVQHIGDDTVRAIALGPTEGMVRGMDVIDTKAPITVPVGEEVLGRMFNVLGEAIDEKPQPKTKLMRPIHREAPSYEEQQTTAAILETGIKVVDLLVPFAKGGKIGLFGGAGVGKTVLVQELINNVAKAHGGISVFAGVGERTREGNDLYYEMIEAGVIDKTALVFGQMNETPGARMRVALTGLTIAEYFRDDKNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGALQERITSTKKGSITSIQAVYVPSDDLTDPAPATTFAHLDAKVVLDREIAALGIYPAVDPLGSSSRLLDPLVVGEEHYEVARGVQEILQKFKELQSIIAILGMDELSDEDKLAVARARKIRNFLSQSFFVAEKFSGKTGKYVPVVETIRAFKEILTGKYDDLPEQAFLYVGTIDEVVK 457
>gi|167747404|ref|ZP_02419531.1| hypothetical protein ANACAC_02124 [Anaerostipes caccae DSM 14662] >gi|167652766|gb|EDR96895.1| hypothetical protein ANACAC_02124 [Anaerostipes caccae DSM 14662] (465 aa)
Score = 1670, Expect = 0.0e+00, Identities = 317/452 (70%), Positives = 370/452 (81%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           G I QI G V+D+KF+   +P IND +++      KLV+EV+   GDD  RCI+MG T+GL RG+E + T  PI  PVG   LGRMFNV+G+PIDNKP PE  +  PIH+K P+F +QST+TE+ ETGIKV+DLL PY KGGKIGLFGGAGVGKTVL+QELI NIAT HGG S+F GVGERTREGNDLYHEM + GVI++TA+VFGQMNEPPGARMRV LT LT+AE+FR+   +DVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTL  EMG LQERITSTK GSITSVQAVYVPADDLTDPAP+TTFAHLDA TVL R I   GIYPA++PLES+SR+LDP IVG EHY+VAR VQ ILQ+++ELQDIIAILG+DELS+E+KL V RARKI+ FLSQPFFVAE+F+   GKYV+  DTI GF EI++GK DDIPE  FL  G ID+V
  S:     7 GKITQIIGAVLDIKFSDGHLPEINDAIDIMTKQGGKLVVEVSQHLGDDTVRCIAMGPTDGLVRGMEAVCTGGPISVPVGEQTLGRMFNVLGDPIDNKPAPENAKRQPIHRKAPAFKDQSTETEVLETGIKVVDLLCPYQKGGKIGLFGGAGVGKTVLIQELIRNIATEHGGYSVFTGVGERTREGNDLYHEMSESGVIDKTAMVFGQMNEPPGARMRVGLTGLTIAENFRDEGGKDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLQTEMGALQERITSTKDGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSRAIVEQGIYPAVDPLESTSRILDPKIVGEEHYQVARGVQEILQRYKELQDIIAILGMDELSDEEKLIVDRARKIQRFLSQPFFVAEQFTGTVGKYVTLNDTIQGFKEILDGKHDDIPEGMFLNAGSIDEV 458
>gi|167768338|ref|ZP_02440391.1| hypothetical protein CLOSS21_02894 [Clostridium sp. SS2/1] >gi|167709862|gb|EDS20441.1| hypothetical protein CLOSS21_02894 [Clostridium sp. SS2/1] (467 aa)
Score = 1669, Expect = 0.0e+00, Identities = 319/460 (69%), Positives = 376/460 (81%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHKNYVAAN 759
           G I Q+ G V+D+KF  + +P IND ++++  +  KLV+EVA   GDD  RCI+MG T+GL RG+E   T  PI  PVG A LGR+FNV+G+PIDNKP PE     PIH+K P F EQST+TE+ ETGIKV+DLL PY KGGKIGLFGGAGVGKTVL+QELI NIAT HGG S+F GVGERTREGNDLY EM + GVI++TA+VFGQMNEPPGARMRV LT LT+AE FR+   +DVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTL  EMG LQERITSTK+GSITSVQAVYVPADDLTDPAP+TTFAHLDA TVL R I+ +GIYPA++PLES+SR+LDP +VG EHYKVAR VQ ILQK++ELQDIIAILG+DELSE++KL V RARK++ FLSQPFFVAE+F+ K G+YVS  DTI GF EI+EGK D+IPE  FL  G I++V + + A N
  S:     7 GKITQVIGAVLDIKFGSDNLPEINDAIDIQTKDGGKLVVEVAQHLGDDTVRCIAMGPTDGLVRGMEAQATGGPISVPVGEATLGRIFNVLGDPIDNKPAPEGANRLPIHRKAPEFSEQSTETEVLETGIKVVDLLCPYQKGGKIGLFGGAGVGKTVLIQELIRNIATEHGGYSVFTGVGERTREGNDLYTEMSESGVIDKTAMVFGQMNEPPGARMRVGLTGLTIAEDFRDRGGKDVLLFIDNIFRFTQAGSEVSALLGRVPSAVGYQPTLQTEMGALQERITSTKNGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSRAISEMGIYPAVDPLESTSRILDPKVVGEEHYKVARGVQEILQKYKELQDIIAILGMDELSEDEKLVVDRARKVQRFLSQPFFVAEQFTGKPGQYVSLSDTIQGFKEILEGKHDEIPEGMFLNAGTIEEVVERFAARN 466
>gi|77964181|gb|ABB13426.1| ATP synthase subunit beta [Clostridium paradoxum] (465 aa)
Score = 1667, Expect = 0.0e+00, Identities = 316/451 (70%), Positives = 380/451 (84%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           G + QI GPV+D+KF+ + +PN+ + +E+     +K+V EVA   GDD  RCI+M ST+GL RG++ I+T N I  PVG   LGR+FNV+G+P+DNKP  E     PIH+  PSF++Q T TEI ETGIKV+DL+ PY KGGKIGLFGGAGVGKTVL+ ELI+NIA  HGGLS+F+GVGERTREGNDLYHEMID GVI++T LV+GQMNEPPGARMRVALT LTMAE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMG LQERITSTK GSITSVQAVYVPADDLTDPAP+TTFAHLDA TVL R+IA+LGIYPA++PL+S+SR+LDP+IVG EHY+VAR VQ++LQ+++ELQDIIAILG+DELS+EDKL V+RARKI+ FLSQPF VAE+F+  +GKYV  ++TI GF EI+EGK DD+PE  FLYVG ID+
  S:     7 GKVVQIIGPVLDIKFSSDNLPNLLNAIEI-YHEGRKIVAEVAQHIGDDTVRCIAMSSTDGLVRGIDAIDTGNAISVPVGRKTLGRIFNVLGDPVDNKPEVEDAPKLPIHRPAPSFEDQETATEILETGIKVVDLIAPYAKGGKIGLFGGAGVGKTVLIMELINNIAKEHGGLSVFSGVGERTREGNDLYHEMIDSGVIDKTTLVYGQMNEPPGARMRVALTGLTMAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGALQERITSTKKGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSRQIAALGIYPAVDPLDSTSRILDPNIVGREHYEVARGVQSVLQRYKELQDIIAILGMDELSDEDKLIVARARKIQRFLSQPFSVAEQFTGMAGKYVPLKETIRGFREILEGKHDDLPESAFLYVGTIDE 456
>gi|71894420|ref|YP_278528.1| F0F1 ATP synthase subunit beta [Mycoplasma synoviae 53] >gi|118573701|sp|Q4A604|ATPB_MYCS5 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|71851208|gb|AAZ43817.1| ATP synthase beta chain [Mycoplasma synoviae 53] (464 aa)
Score = 1660, Expect = 0.0e+00, Identities = 327/461 (70%), Positives = 369/461 (80%)
  Q:   295 LKSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHKNY 755
           L+ +KG I QI GPVVDV+F   ++P + + L V+LP  +    EVA   GDD  RCISM ST GL RGL V +T   IM PVG  VLGRMF+V+G PID  P+ E  E S IH   P++++Q T +EI ETGIKVIDLL+PY KGGKIGLFGGAGVGKTVLVQELI+NIAT H GLS+F GVGERTREGNDLY+EM   GV+++TALVFGQMNEPPGARMRVALT LTMAE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGRIPSAVGYQPTLA EMG LQERITST+SGSITSVQAVYVPADDLTDPAP+TTF+HLDAKTVLDR +A+LGIYPAI+PLESSSR+LDP +VG EHYKVA+ V  ILQ+F+ELQDIIAILG+ ELSEEDK  V+RARKIRNFLSQPF VAEKFS   G YV   DTI  F EI+ G  DD PE  F Y G IDDV   Y
  S:     2 LEKNKGKIIQILGPVVDVRFTTGKLPKLLNALRVELPTKEVFTFEVAQHIGDDTVRCISMVSTNGLRRGLTVEDTGKAIMVPVGKQVLGRMFDVLGNPIDELPLEEGGEKSSIHGPIPTYEQQKTTSEILETGIKVIDLLIPYAKGGKIGLFGGAGVGKTVLVQELINNIATQHNGLSVFTGVGERTREGNDLYYEMKAAGVLDKTALVFGQMNEPPGARMRVALTGLTMAEYFRDKQNQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGALQERITSTRSGSITSVQAVYVPADDLTDPAPATTFSHLDAKTVLDRNVAALGIYPAIDPLESSSRLLDPLVVGQEHYKVAQDVINILQRFKELQDIIAILGMGELSEEDKKIVARARKIRNFLSQPFTVAEKFSGIKGSYVKLSDTIRSFKEILNGNLDDYPEDIFRYAGSIDDVIARY 462
>gi|158321580|ref|YP_001514087.1| F0F1 ATP synthase subunit beta [Alkaliphilus oremlandii OhILAs] >gi|172048246|sp|A8MJV9|ATPB_ALKOO ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|158141779|gb|ABW20091.1| ATP synthase F1, beta subunit [Alkaliphilus oremlandii OhILAs] (464 aa)
Score = 1660, Expect = 0.0e+00, Identities = 313/451 (69%), Positives = 380/451 (84%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           G + QI GPV+D++F+R  +PN+ + +E++ P+ K +V+EV+   GDD  RC++M ST+GL RG+E  +T  PI  PVG A LGR+FNV+GEP+D K        +PIH+  PSF++Q+T TEI ETGIKV+DL+ PY+KGGKIGLFGGAGVGKTVL+ ELI+NIA  HGGLS+F+GVGERTREGNDLY+EMI+ GVI++TALV+GQMNEPPGARMRV LT LTMAEHFR+   QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMG LQERITST+ GSITSVQAVYVPADDLTDPAP+TTFAHLDA TVL R+I  LGIYPA++PL+S+SR+LDP+IVG EHY VAR VQ +LQ+++ELQDIIAILG+DELS+EDKLTVSRARKI+ FLSQPF VAE+F+  +GKYV  ++TI GF EI+EGK DDIPE  FL+VG ID+
  S:     7 GKLVQIIGPVIDIRFSRENLPNLLNAIEIEGPDGK-IVVEVSQHIGDDTVRCVAMKSTDGLVRGMEAKDTGGPITVPVGRATLGRIFNVIGEPVDEKGAVAAEAKAPIHRPAPSFEDQATSTEILETGIKVVDLIAPYLKGGKIGLFGGAGVGKTVLIMELINNIAKEHGGLSVFSGVGERTREGNDLYNEMIESGVIDKTALVYGQMNEPPGARMRVGLTGLTMAEHFRDEEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGALQERITSTRKGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSRQIVELGIYPAVDPLDSNSRVLDPAIVGDEHYSVARGVQEVLQRYKELQDIIAILGMDELSDEDKLTVSRARKIQRFLSQPFSVAEQFTGMAGKYVPLKETIRGFKEILEGKHDDIPESAFLFVGSIDE 456
>gi|126701091|ref|YP_001089988.1| F0F1 ATP synthase subunit beta [Clostridium difficile 630] >gi|145952622|ref|ZP_01801631.1| hypothetical protein CdifQ_04003998 [Clostridium difficile QCD-32g58] >gi|168697757|ref|ZP_02730034.1| F0F1 ATP synthase subunit beta [Clostridium difficile QCD-37x79] >gi|168714972|ref|ZP_02747249.1| F0F1 ATP synthase subunit beta [Clostridium difficile QCD-63q42] >gi|168726392|ref|ZP_02758669.1| F0F1 ATP synthase subunit beta [Clostridium difficile QCD-76w55] >gi|168730162|ref|ZP_02762439.1| F0F1 ATP synthase subunit beta [Clostridium difficile QCD-97b34] >gi|196124975|ref|ZP_03116724.1| F0F1 ATP synthase subunit beta [Clostridium difficile ATCC 43255] >gi|196162325|ref|ZP_03122886.1| F0F1 ATP synthase subunit beta [Clostridium difficile CIP 107932] >gi|123066472|sp|Q180W5|ATPB_CLOD6 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|115252528|emb|CAJ70371.1| ATP synthase beta chain [Clostridium difficile 630] (464 aa)
Score = 1656, Expect = 0.0e+00, Identities = 316/454 (69%), Positives = 381/454 (83%)
  Q:   297 SDKGIIYQIFGPVVDVKFARNQ-MPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           ++ G + QI G V+DVKF   Q +PN+ + L +KL  +K++V EVA   GDD  RCI+M +T+GL RG+EV++T  PI  PVG   LGR+FNV+G+P+D KP P+     PIH+  P++DE  T  EI ETGIKV+DLL PY+KGGKIGLFGGAGVGKTVL+QELI+NIA  HGG+S+F+GVGERTREGNDLY EM + GVIN+TALVFGQMNEPPGARMRVALT LTMAEHFR+   QDVLLF+DNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMG LQERITSTK GSITSVQAVYVPADDLTDPAP+TTF+HLDAKTVL R+I+SLGIYPA++PLES+SR+LDPSIVG EHY+VAR VQ+ILQ+++ELQDIIAILG+DELS+EDKL V+RARKI+ FLSQ F VAE+F+   G+YV  ++T+ GF EI+EGK DD+PE  FL+VG I+D
  S:     2 ANVGKVVQIVGAVLDVKFDSEQSLPNLLNALVIKL-GDKEIVAEVAQHIGDDTVRCIAMSATDGLVRGMEVVDTGGPISVPVGDETLGRIFNVLGKPVDGKPAPKSAPKLPIHRPAPAYDELETTAEILETGIKVVDLLAPYLKGGKIGLFGGAGVGKTVLIQELINNIAKQHGGISVFSGVGERTREGNDLYGEMSESGVINKTALVFGQMNEPPGARMRVALTGLTMAEHFRDEQGQDVLLFVDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGALQERITSTKKGSITSVQAVYVPADDLTDPAPATTFSHLDAKTVLSRQISSLGIYPAVDPLESTSRILDPSIVGKEHYEVARGVQSILQRYKELQDIIAILGMDELSDEDKLIVARARKIQRFLSQSFTVAEQFTGNPGQYVPVKETVRGFKEILEGKHDDLPESAFLFVGTIED 455
>gi|160914778|ref|ZP_02076992.1| hypothetical protein EUBDOL_00785 [Eubacterium dolichum DSM 3991] >gi|158433318|gb|EDP11607.1| hypothetical protein EUBDOL_00785 [Eubacterium dolichum DSM 3991] (466 aa)
Score = 1656, Expect = 0.0e+00, Identities = 312/456 (68%), Positives = 369/456 (80%)
  Q:   295 LKSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           +  + G I Q+ GPVVD+ F   ++P +   +E+ L +   LV+EV+   GDD  RCI+MGST+GL RG+E I+T  PI  PVG  VLGRMFNV+G  ID     E     PIH+  P+FDEQ T  E+ ETGIKVIDLL PY KGGKIGLFGGAGVGKTVL+QELIHNIA  HGG+S+  GVGERTREGND+YHEM D GV+++T LV+GQMNE PGARMRV LT LTMAEHFR+++ QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMGQLQERITSTK+GSITSVQA+YVPADDLTDPAP+T F HLDAKTVLDR IA+LGIYPA++PLESSSR+LDP +VG EHY+VAR VQ ILQ+++ELQDIIAILG+DELSEEDK+ V+RAR++RNFLSQPF VAE FS   G YVS +DTI  F E++ GK DD+PEQ F++V  I+D
  S:     1 MSKNIGKIVQVIGPVVDITFEDGELPALLTAIEIPLKDQDSLVVEVSQHTGDDRVRCIAMGSTDGLVRGMEAIDTGAPISVPVGKEVLGRMFNVLGREIDGLGKVEAATKLPIHRAAPTFDEQQTSAEMLETGIKVIDLLCPYAKGGKIGLFGGAGVGKTVLIQELIHNIAKEHGGMSVVTGVGERTREGNDMYHEMKDSGVLDKTVLVYGQMNESPGARMRVGLTGLTMAEHFRDHDHQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKNGSITSVQAIYVPADDLTDPAPATAFTHLDAKTVLDRDIAALGIYPAVDPLESSSRILDPLVVGEEHYEVARGVQEILQRYKELQDIIAILGMDELSEEDKIIVNRARRVRNFLSQPFHVAEVFSGIKGCYVSREDTIRSFKELLAGKYDDLPEQAFMFVATIED 456
>gi|196164031|ref|ZP_03124562.1| F0F1 ATP synthase subunit beta [Clostridium difficile QCD-23m63] (464 aa)
Score = 1655, Expect = 0.0e+00, Identities = 317/457 (69%), Positives = 382/457 (83%)
  Q:   297 SDKGIIYQIFGPVVDVKFARNQ-MPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHK 753
           ++ G + QI G V+DVKF   Q +PN+ + L +KL  +K++V EVA   GDD  RCI+M +T+GL RG+EV++T  PI  PVG   LGR+FNV+G+P+D KP P+     PIH+  P++DE  T  EI ETGIKV+DLL PY+KGGKIGLFGGAGVGKTVL+QELI+NIA  HGG+S+F+GVGERTREGNDLY EM + GVIN+TALVFGQMNEPPGARMRVALT LTMAEHFR+   QDVLLF+DNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMG LQERITSTK GSITSVQAVYVPADDLTDPAP+TTF+HLDAKTVL R+I+SLGIYPA++PLES+SR+LDPSIVG EHY+VAR VQ+ILQ+++ELQDIIAILG+DELS+EDKL V+RARKI+ FLSQ F VAE+F+   G+YV  ++T+ GF EI+EGK DD+PE  FL+VG I+D  K
  S:     2 ANVGKVVQIVGAVLDVKFDSEQSLPNLLNALVIKL-GDKEIVAEVAQHIGDDTVRCIAMSATDGLVRGMEVVDTGGPISVPVGDETLGRIFNVLGKPVDGKPAPKSAPKLPIHRPAPAYDELETTAEILETGIKVVDLLAPYLKGGKIGLFGGAGVGKTVLIQELINNIAKQHGGISVFSGVGERTREGNDLYGEMSESGVINKTALVFGQMNEPPGARMRVALTGLTMAEHFRDEQGQDVLLFVDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGALQERITSTKKGSITSVQAVYVPADDLTDPAPATTFSHLDAKTVLSRQISSLGIYPAVDPLESTSRILDPSIVGKEHYEVARGVQSILQRYKELQDIIAILGMDELSDEDKLIVARARKIQRFLSQSFTVAEQFTGNPGQYVPVKETVRGFKEILEGKHDDLPESAFLFVGTIEDAVK 458
>gi|148377622|ref|YP_001256498.1| F0F1 ATP synthase subunit beta [Mycoplasma agalactiae PG2] >gi|148291668|emb|CAL59054.1| ATP synthase beta chain [Mycoplasma agalactiae PG2] (487 aa)
Score = 1655, Expect = 0.0e+00, Identities = 334/471 (70%), Positives = 389/471 (82%)
  Q:   297 SDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV---HKNYVAANSNNKVNSS 767
           S+KG + QI GPVVDV+F + Q+P++ + L +   +N    LEVA   GDD  R ISM ST GL RG++V +T  PI  PVG+ VLGRMF+V+G PID K  P+  E  PIH   PS++EQST++EIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELI+NIA  HGGLS+FAGVGERTREGNDLY+EM+  GV+ +TALVFGQMNEPPGARMRVALT LTMAE+FR+  KQDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMGQLQERI ST  GSITSVQAVYVPADDLTDPAP+TTF HLDAKTVLDR IA+LGIYPA++PLESSSR+LD  ++G EHY+ AR V +ILQ+F+ELQDIIAILGI ELSEEDK  V+RAR+IRNFLSQPFFVAEKFS K GKYV   DT+  F EI++GK D  PE++FLYVG I++V   + NY++ NS N   +S
  S:    15 SNKGKVVQIVGPVVDVRFPKGQLPSLLNALIINYGDNT-YTLEVAQHIGDDTVRAISMVSTSGLPRGIDVYDTGAPISVPVGNKVLGRMFDVLGNPIDLKDAPD-AEKMPIHAPAPSYEEQSTESEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELINNIAREHGGLSVFAGVGERTREGNDLYNEMLASGVLEKTALVFGQMNEPPGARMRVALTGLTMAEYFRDKEKQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERIASTNKGSITSVQAVYVPADDLTDPAPATTFNHLDAKTVLDRNIAALGIYPAVDPLESSSRLLDSLVIGQEHYETARRVVSILQRFKELQDIIAILGIGELSEEDKKVVARARRIRNFLSQPFFVAEKFSGKPGKYVKRDDTVRSFKEILDGKYDHCPEEFFLYVGSIEEVKANYDNYLSQNSTNNEKAS 486
>gi|15828737|ref|NP_326097.1| F0F1 ATP synthase subunit beta [Mycoplasma pulmonis UAB CTIP] >gi|81855822|sp|Q98QU5|ATPB1_MYCPU ATP synthase subunit beta 1 (ATPase subunit beta 1) (ATP synthase F1 sector subunit beta 1) >gi|14089679|emb|CAC13439.1| ATP SYNTHASE BETA CHAIN [Mycoplasma pulmonis] (475 aa)
Score = 1644, Expect = 0.0e+00, Identities = 335/455 (73%), Positives = 375/455 (82%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           + + G I QI GPVVD+ FA  ++P I + LE+   NNK    EVA   GD+V R ISM ST GL RGLEVI+T  PIM PVG  VL RMFNV+G+ IDNK   E  E+  IH   PS++EQ+  +EI ETGIKVIDLLVPY KGGKIGLFGGAGVGKTVLVQELI+NIAT HGGLS+FAGVGERTREGNDLYHEMI  GV+++T LVFGQMNEPPGARMRVALT LTMAE+FR+  KQDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMGQLQERITSTK+GSITSVQAVYVPADDLTDPAP+TTF HLDAKTVL+R IA+LGIYPAI+PL SSSRMLDP I+G EHY VA  VQ ILQ+F+ELQDIIAILGI ELSEEDK  V RARKIRNFLSQPF VAEKFS K GK+V  ++TI  F EI+EGK D++PE  FLYVG ID+
  S:     3 QKNVGKIVQILGPVVDISFAGQKIPAIYNNLELVFENNK-YNFEVAQHIGDEVVRTISMVSTNGLSRGLEVIDTGAPIMVPVGKEVLSRMFNVLGQTIDNKGEIEAKEFRSIHASAPSYEEQNDSSEILETGIKVIDLLVPYSKGGKIGLFGGAGVGKTVLVQELINNIATQHGGLSVFAGVGERTREGNDLYHEMIASGVLDKTTLVFGQMNEPPGARMRVALTGLTMAEYFRDKFKQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKNGSITSVQAVYVPADDLTDPAPATTFTHLDAKTVLERNIAALGIYPAIDPLASSSRMLDPLIIGNEHYLVALEVQNILQRFKELQDIIAILGIGELSEEDKKLVFRARKIRNFLSQPFTVAEKFSGKKGKFVPLKETIRSFKEILEGKHDNLPEDAFLYVGSIDE 456
>gi|153809937|ref|ZP_01962605.1| hypothetical protein RUMOBE_00318 [Ruminococcus obeum ATCC 29174] >gi|149834115|gb|EDM89195.1| hypothetical protein RUMOBE_00318 [Ruminococcus obeum ATCC 29174] (464 aa)
Score = 1641, Expect = 1.7e-180, Identities = 304/452 (67%), Positives = 376/452 (83%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           G + Q+ GPV+D++FA +++P + + +E++  N  KL  EVA   GDDV RCI+M ST+GL RG + ++T  PI  PVG A LGR+FN++G+P+DNKP PE  E   IH+  PS++EQ   TEI ETGIKV+DL+ PY KGGKIGLFGGAGVGKTVL+ ELIHN+AT HGGLS+F GVGERTREGNDLY+EM + GVI++TALV+GQMNEPPGARMRV L+ LTMAE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMG LQERITST+ GSITSVQAVYVPADDLTDPAP+TTF+HLDA TVL R+I+S GIYPA++PL+S+SR+L P IVG EHY++ARSVQ +LQ+++ELQDIIAI+G+DELSEEDK TVSRARK++ +LSQ F VAE+F+   GKYV  ++T+ GF  I++G+CDDIPE YFL+ G ID+V
  S:     7 GEVVQVIGPVLDIRFAHDELPALLNAIEIE-SNGAKLTAEVAQQIGDDVVRCIAMNSTDGLVRGTKAVDTGGPITVPVGDACLGRVFNLLGDPVDNKPAPEAKERWSIHRPAPSYEEQMPATEILETGIKVVDLICPYAKGGKIGLFGGAGVGKTVLIMELIHNVATAHGGLSVFTGVGERTREGNDLYNEMKESGVIDKTALVYGQMNEPPGARMRVGLSGLTMAEYFRDEKNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGNLQERITSTRKGSITSVQAVYVPADDLTDPAPATTFSHLDATTVLSREISSQGIYPAVDPLDSTSRILSPEIVGKEHYEIARSVQRVLQRYKELQDIIAIMGMDELSEEDKRTVSRARKVQRYLSQSFSVAEQFTGMPGKYVPLKETLRGFKMILDGECDDIPESYFLFAGTIDEV 457
>gi|158430153|pdb|2QE7|D Chain D, Crystal Structure Of The F1-Atpase From The Thermoalkaliphilic Bacterium Bacillus Sp. Ta2.A1 >gi|158430154|pdb|2QE7|E Chain E, Crystal Structure Of The F1-Atpase From The Thermoalkaliphilic Bacterium Bacillus Sp. Ta2.A1 >gi|158430155|pdb|2QE7|F Chain F, Crystal Structure Of The F1-Atpase From The Thermoalkaliphilic Bacterium Bacillus Sp. Ta2.A1 >gi|33329387|gb|AAQ10090.1| ATP synthase subunit beta [Bacillus sp. TA2.A1] (462 aa)
Score = 1636, Expect = 8.2e-180, Identities = 305/453 (67%), Positives = 372/453 (82%)
  Q:   298 DKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           +KG I Q+ GPVVD++F   Q+P+I + + ++ P    L +E A+  GD+V RC++M ST+GL RGLE ++T  PI  PVG A LGR+FNV+GEPID +      E  PIH+  P F+E ST  EI ETGIKVIDLL PY KGGKIGLFGGAGVGKTVL+QELI+N+A  HGGLS+FAGVGERTREGNDLYHEM D GVI++T++VFGQMNEPPGAR+RVALT LTMAE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMGQLQERITSTK GSITS+QA+YVPADD TDPAP+TTFAHLDA T L+RK+A +GIYPA++PL S+SR+L P++VG EHY+VAR VQ +LQ++ +LQDIIAILG+DELS+EDKL V+RARKI+ FLSQPF VAE+F+   GKYV  ++T+ GF EI+EGK D++PE+ F  VG ID+
  S:     2 NKGRIIQVMGPVVDIQFESGQLPDIYNAITIERPQGGTLTVEAAVHLGDNVVRCVAMASTDGLVRGLEAVDTGAPISVPVGKATLGRVFNVLGEPIDEQGEVNAEERHPIHRPAPEFEELSTADEILETGIKVIDLLAPYAKGGKIGLFGGAGVGKTVLIQELINNVAQEHGGLSVFAGVGERTREGNDLYHEMKDSGVISKTSMVFGQMNEPPGARLRVALTGLTMAEYFRDREGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGSITSIQAIYVPADDYTDPAPATTFAHLDATTNLERKLAEMGIYPAVDPLASTSRILSPAVVGEEHYRVARGVQQVLQRYNDLQDIIAILGMDELSDEDKLIVARARKIQRFLSQPFHVAEQFTGMPGKYVPVKETVRGFKEILEGKHDNLPEEAFYMVGTIDE 454
>gi|168333944|ref|ZP_02692176.1| ATP synthase F1, beta subunit [Epulopiscium sp. 'N.t. morphotype B'] (468 aa)
Score = 1633, Expect = 1.6e-179, Identities = 311/456 (68%), Positives = 370/456 (81%)
  Q:   295 LKSDKGIIYQIFGPVVDVKFARNQMPNINDCLEV-----KLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           + ++ G I  I GPV+D+KF    +P + + + +        NN+ + +EVA   GDDV RCISM +TEGL RG+E INT  PI  PVG   LGR+FNV G+P+DNKP P+  E+ PIH+  PSF+EQST  EI ETGIKV+DLL PY+KGGKIGLFGGAGVGKTVL+QELI NIAT HGG S+FAGVGERTREGNDL+HEM D GVIN+T +VFGQMNEPPGARMRVALT LTMAE+FR+ + QDVLLF+DNIFRF QAGSEVSALLGRIPSAVGYQPTLA E+G LQERITST  GSITSVQAVYVPADDLTDPAP+TTFAHLDAKTVL R I   GIYPA++PL+S+SR+LDP IVG +HY V+R VQ  LQ+++ELQDIIAILG+DELSE DK+TV+RARK++ FLSQPF VAE F+   GK+V  ++T+ GF EI++GK D +PE  FL VG I+D
  S:     1 MANNIGHIITIIGPVIDIKFTPENLPALYNAIHIITGKDDEGNNETITVEVAQHLGDDVVRCISMAATEGLVRGMECINTGAPITVPVGDKTLGRIFNVTGDPVDNKPAPD-AEHWPIHRAAPSFEEQSTTAEILETGIKVVDLLCPYLKGGKIGLFGGAGVGKTVLIQELIRNIATEHGGFSVFAGVGERTREGNDLFHEMTDSGVINKTTMVFGQMNEPPGARMRVALTGLTMAEYFRDESGQDVLLFVDNIFRFIQAGSEVSALLGRIPSAVGYQPTLATEVGTLQERITSTNKGSITSVQAVYVPADDLTDPAPATTFAHLDAKTVLSRSIVEQGIYPAVDPLDSTSRILDPQIVGQDHYDVSRQVQATLQRYKELQDIIAILGMDELSESDKITVNRARKVQKFLSQPFHVAETFTGMHGKFVPVKETVRGFKEILDGKYDHLPENAFLMVGTIED 460
>gi|150388193|ref|YP_001318242.1| F0F1 ATP synthase subunit beta [Alkaliphilus metalliredigens QYMF] >gi|172052470|sp|A6TK65|ATPB_ALKMQ ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|149948055|gb|ABR46583.1| ATP synthase F1, beta subunit [Alkaliphilus metalliredigens QYMF] (464 aa)
Score = 1630, Expect = 3.7e-179, Identities = 306/451 (67%), Positives = 379/451 (84%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDN-KPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           G + QI G VVD++F+  ++P +   + ++ P+   + +EVA   GDD ARC++M ST+GL RG+E I+T  PI  PVG   LGR+FNV+GE +D  KP+  K+ + PIH++ PSF+EQ   TEIFETGIKV+DL+ PY +GGK+GLFGGAGVGKTVL+ ELI+NIA  HGGLS+FAGVGERTREGNDLYHEMI+ GVI++T+LV+GQMNEPPGARMRV LT LTMAE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMG LQERITSTK GSITSVQAVYVPADDLTDPAP+TTFAHLDA TVL R+I+ LGIYPA++PL+S+SR+LDP+ VG EHY+VAR VQ +LQ+++ELQDIIAILG+DELS+EDKLTV+RAR+++ FLSQPFFVAE+F+  +GKYV  ++TI GF EI++GK DD+PE  FL+VG ID+
  S:     7 GKLVQIIGAVVDIRFSSEEIPALLSAITIQGPDGL-VTVEVAQHIGDDTARCVAMRSTDGLVRGMEAIDTGAPITVPVGRETLGRIFNVLGEVVDEGKPVEAKM-HLPIHREAPSFEEQEAATEIFETGIKVVDLIAPYARGGKVGLFGGAGVGKTVLIMELINNIAKEHGGLSVFAGVGERTREGNDLYHEMIESGVIDKTSLVYGQMNEPPGARMRVGLTGLTMAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGALQERITSTKKGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSRQISELGIYPAVDPLDSNSRILDPATVGQEHYEVARGVQEVLQRYKELQDIIAILGMDELSDEDKLTVARARRVQRFLSQPFFVAEQFTGMAGKYVPLKETIRGFKEILDGKHDDLPESAFLFVGSIDE 456
>gi|20807130|ref|NP_622301.1| F0F1 ATP synthase subunit beta [Thermoanaerobacter tengcongensis MB4] >gi|81848163|sp|Q8RC15|ATPB_THETN ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|20515625|gb|AAM23905.1| F0F1-type ATP synthase beta subunit [Thermoanaerobacter tengcongensis MB4] (461 aa)
Score = 1622, Expect = 3.0e-178, Identities = 310/455 (68%), Positives = 373/455 (81%)
  Q:   299 KGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHK 753
           KG I Q+ GPVVD++F    +P IN+ +++ +  +++LV+EVA   GD+  RC++M ST+GL RG+E I+T  PIM PVG  VLGRMFNV+G+PID     + V+Y PIHKKPPSF+EQ+  TEI ETGIKVIDLL PY KGGKIGLFGGAGVGKTVL+ ELI N+A  HGG SIFAGVGER+REGN+L+ EM + GVI++TA VFGQMNEPPGARMRV L  LT+AE+FR+   QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTLA EMG LQERITSTK GSITSVQA+YVPADDLTDPAP+TTFAHLDA TVL R IA +GIYPA++PL+S+SR+L+P IVG EHY VAR VQ ILQ+++ELQDIIAILG++EL+EED+L V RARKI+ FLSQPFFVAE F+   GKYV  ++TI GF +I+EG+ DDIPE  F  VG ID+V++
  S:     3 KGYITQVIGPVVDIRF-EGDLPPINNAIKIPM-GDRELVVEVAQHIGDNTVRCVAMASTDGLRRGMECIDTGGPIMVPVGKGVLGRMFNVLGQPIDELGEVKDVKYMPIHKKPPSFEEQNPATEILETGIKVIDLLTPYPKGGKIGLFGGAGVGKTVLIMELIRNVAIEHGGYSIFAGVGERSREGNELWLEMHEAGVIDKTAFVFGQMNEPPGARMRVGLAGLTIAEYFRDEEHQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLATEMGALQERITSTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRSIAEMGIYPAVDPLDSTSRILEPHIVGEEHYYVARKVQEILQRYKELQDIIAILGMEELTEEDRLIVYRARKIQRFLSQPFFVAEAFTGTPGKYVPLKETIRGFKKIVEGEMDDIPEPAFYMVGTIDEVYE 455
>gi|160942705|ref|ZP_02089947.1| hypothetical protein FAEPRAM212_00181 [Faecalibacterium prausnitzii M21/2] >gi|158445979|gb|EDP22982.1| hypothetical protein FAEPRAM212_00181 [Faecalibacterium prausnitzii M21/2] (464 aa)
Score = 1621, Expect = 3.9e-178, Identities = 301/452 (66%), Positives = 372/452 (82%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           G + Q+ GPV+D++F   ++P + + +E+   + +KLV+EVA L GD+VARCI+M ST+GL RG + ++T   I  PVG   LGR+FN++GEP+DNKP P    Y PIH+  PS++EQ + TEI ETGIKV+DL+ PY KGGKIGLFGGAGVGKTVL+QELI+NIAT H G S+F GVGERTREGNDLY EM + GVIN+TALV+GQMNEPPGARMRVAL+ LTMAE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMG LQERITST+ GSITSVQAVYVPADDLTDPAP+TTF HLDA TVL R IAS GIYPA++PL+S+SR+L P +VG EHY++AR+VQ +LQ+++ELQDIIAI+G+DELSEEDK TVSRARK++ FLSQ F VAE+F+   G+YV  ++T+ GF  I+ G+CD++PE  FL+ G IDDV
  S:     7 GKVIQVIGPVLDIQFKDGELPELLNAIEID-NHGQKLVVEVAQLTGDNVARCIAMSSTDGLVRGTDAVDTGESIKVPVGDQCLGRVFNLLGEPVDNKPAPTPDAYWPIHRPAPSYEEQQSTTEILETGIKVVDLICPYAKGGKIGLFGGAGVGKTVLIQELIYNIATEHNGYSVFTGVGERTREGNDLYGEMTESGVINKTALVYGQMNEPPGARMRVALSGLTMAEYFRDVKNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGALQERITSTRKGSITSVQAVYVPADDLTDPAPATTFTHLDATTVLSRDIASQGIYPAVDPLDSTSRILSPEVVGQEHYEIARAVQKVLQRYKELQDIIAIMGMDELSEEDKRTVSRARKVQRFLSQSFHVAEQFTGMPGQYVPLKETLRGFKMILSGECDELPESAFLFAGTIDDV 457
>gi|193216472|ref|YP_001999714.1| ATP synthase beta subunit [Mycoplasma arthritidis 158L3-1] >gi|193001795|gb|ACF07010.1| ATP synthase beta subunit [Mycoplasma arthritidis 158L3-1] (503 aa)
Score = 1621, Expect = 4.3e-178, Identities = 320/459 (69%), Positives = 376/459 (81%)
  Q:   293 NTLKSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKL--PNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           N + ++ G I QI G V+DV+F  N+ P I + LEV L  PN  + VLEVA   G+D  R I+M  T GL RG++V +   PI  PVG  VL RMFNV+GEPID   +   V+  PIH+ PPS++EQ +  EIFETGIKVIDLL+PYVKGGKIGLFGGAGVGKTVL+QELI+NIA  HGGLS+FAGVGERTREGNDLYHEM   GV+++TALVFGQMNEPPGARMR   TALTMAE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMGQLQERITST  GS+TSVQA+YVPADDLTDPAP+TTF HLDAKTVLDR IA+LGIYPAI+PL S+SRM+DP+++G+EHY +AR VQ ILQ+F+ELQDIIAILG+ ELSEEDK  V+RAR+IRNFLSQPFFVAEKFS  +G+Y+   DTI  F+ I+ GK D++PE+ FLYVG IDDV
  S:    29 NEMPTNMGYISQILGAVIDVRFEENKAPRILNALEVVLDDPNAPRQVLEVAQHIGNDTVRTIAMNLTIGLKRGMKVKDLGAPISVPVGKKVLSRMFNVLGEPIDTGAIEFNVKM-PIHRTPPSYEEQKSTLEIFETGIKVIDLLMPYVKGGKIGLFGGAGVGKTVLIQELINNIAKEHGGLSVFAGVGERTREGNDLYHEMKASGVLDKTALVFGQMNEPPGARMRAPFTALTMAEYFRDTMGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTNKGSVTSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRDIAALGIYPAIDPLASNSRMMDPNVIGLEHYNIARKVQNILQRFKELQDIIAILGMHELSEEDKKIVARARRIRNFLSQPFFVAEKFSGYAGRYIKLADTIRSFAAILSGKYDNLPEEAFLYVGTIDDV 488
>gi|2662066|dbj|BAA23688.1| proton-translocating ATPase, beta subunit [Ruminococcus albus] (479 aa)
Score = 1620, Expect = 5.6e-178, Identities = 310/444 (69%), Positives = 366/444 (82%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFL 743
           G   QI G VVDV+F +  MPN+ + LE+   N  KLV+EVA   GDDV RCI+M ST+GL RG++ ++T   I  PVG   L RMFN++G+P+DN P PE  E   IH++PPS++EQ+   EI ETGIKVIDL+ PY+KGGKIGLFGGAGVGKTVL+QELI+N+A  HGG+S+F GVGERTREGNDLY EM + GVI++T LV+GQMNEPPGARMRV L+ LTMAE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMG LQERITST  GSITSVQAVYVPADDLTDPAP+TTFAHLDA TVL R IASLGI+PA++PLES+SR+L P IVG EHY+VAR VQ+ILQ++ ELQDIIAI+G+DELS+EDKLTVSRARKI+ FLSQPFFVAE+F+   GKYV  ++TI GF EIIEGK DD+PE  FL
  S:     7 GKFVQIVGAVVDVRFDKEHMPNLLNALEID-NNGTKLVVEVAQHIGDDVVRCIAMSSTDGLVRGVDAVDTGRAISVPVGRETLSRMFNLLGDPVDNLPAPETAERWEIHREPPSYEEQTAANEILETGIKVIDLIAPYLKGGKIGLFGGAGVGKTVLIQELINNVANQHGGISVFTGVGERTREGNDLYWEMKESGVIDKTVLVYGQMNEPPGARMRVGLSGLTMAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGALQERITSTNKGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSRSIASLGIFPAVDPLESTSRILTPEIVGNEHYQVARQVQSILQRYVELQDIIAIMGMDELSDEDKLTVSRARKIQRFLSQPFFVAEQFTGYQGKYVPLKETIRGFKEIIEGKHDDLPESAFL 449
>gi|47459043|ref|YP_015905.1| F0F1 ATP synthase subunit beta [Mycoplasma mobile 163K] >gi|81828479|sp|Q6KI82|ATPB_MYCMO ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|47458372|gb|AAT27694.1| ATP synthase beta chain [Mycoplasma mobile 163K] (470 aa)
Score = 1608, Expect = 1.3e-176, Identities = 322/459 (70%), Positives = 374/459 (81%)
  Q:   298 DKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHKNYV 756
           +KG I QI GP+VDVKF  NQ+P + + L ++     K+ LEVA   G+DV R I+M STEGL R LEVI+T+ PI  PVG  VL  MFNV+GE IDN+ +    E   IH+K PS++EQ+  +EI ETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELI+NIA  HGGLS+FAGVGERTREGNDLY+EM   GV+++TALVFGQMNEPPGARMRVAL+ LTMAE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMGQLQERITST+ GSITS+QAVYVPADDLTDPAP+TTF HLDA+TVLDR IASLGIYPAI+PL S+SRML   IVG EHYK+AR VQ ILQKF+ELQDIIAILG+DELS+EDK  V RARKIRNFLSQPF VAEKFS   G +V   DT+  F +I++GK DD+ E  FLYVG I++  + ++
  S:     3 NKGKIIQILGPIVDVKFNENQLPKLLNALTIEF-EKTKITLEVAQHIGNDVVRTIAMSSTEGLVRNLEVIDTEAPISVPVGKNVLSHMFNVIGENIDNQSIDPNTEKWSIHRKAPSYEEQTATSEILETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELINNIAVHHGGLSVFAGVGERTREGNDLYYEMKASGVLDKTALVFGQMNEPPGARMRVALSGLTMAEYFRDELNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTRKGSITSIQAVYVPADDLTDPAPATTFIHLDAQTVLDRNIASLGIYPAIDPLASASRMLSADIVGEEHYKIAREVQRILQKFKELQDIIAILGMDELSDEDKNIVYRARKIRNFLSQPFHVAEKFSGIKGTFVKLSDTLRSFRDILDGKYDDLDESAFLYVGTIEEAKQKHL 460
>gi|22266799|gb|AAM94913.1|AF522463_8 subunit beta [Ilyobacter tartaricus] (467 aa)
Score = 1608, Expect = 1.4e-176, Identities = 308/453 (67%), Positives = 373/453 (82%)
  Q:   298 DKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           +KGI+ QI GPVVDV F  N++P I + +++   N + LV EV    G++V R I M  +EGL RG+EVI+T  PI  PVG AVLGR+ NV+GE ID K      E++PIH++ P+F++Q T  EIFETGIKVIDLL PYVKGGKIGLFGGAGVGKTVL+ ELI+NIA GHGGLS+FAGVGERTREG DL+ EM + GV+++T+LV+GQMNEPPGAR+RVALT LTMAE+FR+   QDVLLF+DNIFRF+QAGSEVSALLGR+PSAVGYQPTLA +MG LQERITSTK+GSITSVQAVYVPADDLTDPAP+TTF HLDA TVL R+IASLGIYPA++PL+S+S  L P + G EHY  AR VQ++LQ+++ELQDIIAILG+DELS+EDK+TVSRARKI  F SQPF VAE+F+   GKYV+ ++TI+GF EI+EGK D +PEQ FLYVG ID+
  S:     3 NKGILTQIIGPVVDVSF-DNELPKIYNAIKIDRGNGEILVAEVQQHLGNNVVRAICMDGSEGLQRGMEVIDTGAPITVPVGKAVLGRILNVLGEAIDQKEELNAEEFAPIHREAPAFEDQGTDVEIFETGIKVIDLLAPYVKGGKIGLFGGAGVGKTVLIMELINNIAKGHGGLSVFAGVGERTREGRDLFDEMTESGVLDKTSLVYGQMNEPPGARLRVALTGLTMAENFRDKEGQDVLLFVDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATDMGALQERITSTKTGSITSVQAVYVPADDLTDPAPATTFTHLDATTVLSRRIASLGIYPAVDPLDSTSTALQPGVTGHEHYTTAREVQSVLQRYKELQDIIAILGMDELSDEDKITVSRARKIERFFSQPFHVAEQFTGMEGKYVTVKETITGFKEILEGKHDALPEQAFLYVGTIDE 454
>gi|164688908|ref|ZP_02212936.1| hypothetical protein CLOBAR_02556 [Clostridium bartlettii DSM 16795] >gi|164602112|gb|EDQ95577.1| hypothetical protein CLOBAR_02556 [Clostridium bartlettii DSM 16795] (463 aa)
Score = 1606, Expect = 2.5e-176, Identities = 312/454 (68%), Positives = 373/454 (82%)
  Q:   297 SDKGIIYQIFGPVVDVKFARNQ-MPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           ++ G I  I G V+DVKF   Q +PN+ + L +KL  ++++V EVA   GDD  RCI+M +T+GL RG+EVI+T  PI  PVG   LGR+FNV+GEP+D    P+     PIH+  P F+E +   EI ETGIKV+DLL PY+KGGKIGLFGGAGVGKTVL+QELI+N+A  HGG+S+F+GVGERTREGNDLY EM + GV+N+TALVFGQMNEPPGARMRVAL+ LTMAE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMG LQERITSTK GSITSVQAVYVPADDLTDPAP+TTF HLDAKTVL R IASLGIYPA++PLES+SR+LDP+IVG EHY VAR VQ+ILQ+++ELQDIIAILG+DEL +EDKL V+RARKI+ FLSQPF V E+F+   GKYV  ++TI GF EI+EGK DD+PE  FL+VG ID+
  S:     2 ANVGKIVSIVGVVLDVKFENEQSLPNLLNALVIKL-GDQEIVAEVAQHIGDDTVRCIAMSATDGLVRGMEVIDTGKPIAVPVGDKTLGRIFNVLGEPVDGFEAPKDAPRDPIHRPAPEFNEIAGSAEILETGIKVVDLLAPYLKGGKIGLFGGAGVGKTVLIQELINNVAKQHGGISVFSGVGERTREGNDLYFEMKESGVLNKTALVFGQMNEPPGARMRVALSGLTMAEYFRDKENQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGALQERITSTKQGSITSVQAVYVPADDLTDPAPATTFTHLDAKTVLSRSIASLGIYPAVDPLESTSRVLDPNIVGEEHYAVARGVQSILQRYKELQDIIAILGMDELGDEDKLIVARARKIQRFLSQPFTVGEQFTGIPGKYVPVKETIRGFKEILEGKHDDLPESAFLFVGTIDE 455
>gi|169351551|ref|ZP_02868489.1| hypothetical protein CLOSPI_02331 [Clostridium spiroforme DSM 1552] >gi|169291773|gb|EDS73906.1| hypothetical protein CLOSPI_02331 [Clostridium spiroforme DSM 1552] (468 aa)
Score = 1603, Expect = 4.3e-176, Identities = 307/456 (67%), Positives = 376/456 (82%)
  Q:   295 LKSDKGIIYQIFGPVVDVKF-ARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNK-PMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           +  + G I    GPV+D++F + N +P +N  +E++    + LV+EVA   GDD+ RC++MG T+G+ RG+E I+T+ PI  PVG+A LGRMFNV+G+PID K  + + V+  PIH+  P++ +Q T+TEI ETGIKV+DL+ P++KGGKIGLFGGAGVGKTVL+QE I+NIAT HGGLS+FAGVGER+REGNDLY+EM + GV+++T LVFGQMNEPPGAR+RVALT LTMAE FR+   QDVLLFIDNIFRF+QAGSEVSALLGR+PS  GYQPTLA EMG LQERITSTK GSITSVQAVYVPADDLTDPAP+TTFAHLDAK VLDR IA+LGIYPA++PL SSSR LDP +VG EHY+VA  VQ ILQ+F+ELQDIIAILG+DEL EEDKLTV+RAR++RN+LSQPF VA +F+   GKYV  +DTI GF EI+EGK DD+PEQ F  VG I++
  S:     1 MSQNIGKIISAKGPVIDIQFNSDNNLPALNTAIEIQ-NGEELLVVEVAQHIGDDIVRCVAMGPTDGVKRGMEAIDTRQPISVPVGNATLGRMFNVLGQPIDGKEALGDDVKKMPIHRSAPTYAQQRTETEILETGIKVVDLICPFIKGGKIGLFGGAGVGKTVLIQEFINNIATQHGGLSVFAGVGERSREGNDLYYEMKESGVLSKTTLVFGQMNEPPGARLRVALTGLTMAEEFRDEQGQDVLLFIDNIFRFTQAGSEVSALLGRVPSQAGYQPTLATEMGALQERITSTKKGSITSVQAVYVPADDLTDPAPATTFAHLDAKVVLDRSIAALGIYPAVDPLNSSSRALDPLVVGKEHYEVAHGVQQILQRFQELQDIIAILGMDELGEEDKLTVARARRVRNYLSQPFTVASQFTGLDGKYVHIKDTIKGFKEILEGKHDDLPEQAFHNVGTIEE 457
>gi|110801467|ref|YP_699462.1| F0F1 ATP synthase subunit beta [Clostridium perfringens SM101] >gi|122956535|sp|Q0SQZ5|ATPB_CLOPS ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|110681968|gb|ABG85338.1| ATP synthase F1, beta subunit [Clostridium perfringens SM101] (465 aa)
Score = 1602, Expect = 7.0e-176, Identities = 307/457 (67%), Positives = 376/457 (82%)
  Q:   295 LKSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           + ++ G + Q+ GPVVD+KFA +++PNI + + +K+ + K LV EV    GDD+ R I+M +TEGL RG+E ++T  PI  PVG  VLGR+FNV+G+P+D+       E  PIH+  PSF+EQS   ++FETGIKVIDLL PY +GGKIGLFGGAGVGKTVL+QELI+NIA  HGGLS+F GVGER+REGNDLY+EM++ GVI  TALVFGQMNEPPGARMRVALT LTMAE+FR+   QDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLA EMG LQERITST  GSITSVQAVYVPADDLTDPAP+TTF HLDAKTVL R IA +GIYPA++PL+SSSR+LDP +VG EHY+VA  V+ IL++++ELQDIIAILG+DEL++EDKL V+RAR+I+ FLSQPF VAE+F+   G+YV  ++TI GF EI+EGK D++PE  FL+VG I++V
  S:     1 MSNNIGKVVQVIGPVVDIKFANDELPNIFNAIHIKMDDGKILVCEVEQHVGDDIVRTIAMEATEGLRRGVEAVDTGAPISVPVGECVLGRIFNVLGKPLDSGAEVNNEEKYPIHRPAPSFEEQSVVPQMFETGIKVIDLLAPYQRGGKIGLFGGAGVGKTVLIQELINNIAKEHGGLSVFTGVGERSREGNDLYYEMMESGVIKNTALVFGQMNEPPGARMRVALTGLTMAEYFRDQG-QDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLATEMGALQERITSTTHGSITSVQAVYVPADDLTDPAPATTFNHLDAKTVLSRSIAEIGIYPAVDPLDSSSRILDPRVVGEEHYEVASKVKHILERYKELQDIIAILGVDELADEDKLIVARARRIQKFLSQPFTVAEQFTGMQGRYVPIKETIRGFKEILEGKHDNVPESAFLFVGTIEEV 456
>gi|167755038|ref|ZP_02427165.1| hypothetical protein CLORAM_00542 [Clostridium ramosum DSM 1402] >gi|167705088|gb|EDS19667.1| hypothetical protein CLORAM_00542 [Clostridium ramosum DSM 1402] (468 aa)
Score = 1601, Expect = 7.6e-176, Identities = 310/465 (66%), Positives = 377/465 (81%)
  Q:   295 LKSDKGIIYQIFGPVVDVKF-ARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNK-PMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD-VHKNYVAAN 759
           +  + G I    GPV+D++F   N +P +N  +E++   ++ LV+EVA   GDDV RC++MG T+G+ RG++ +NT NPI  PVG+  LGRMFNV+G+PID K  + +  +  PIH+  P++ EQ T+TEI ETGIKV+DL+ P++KGGKIGLFGGAGVGKTVL+QE I+NIAT HGGLS+FAGVGER+REGNDLY+EM + GV+++T LVFGQMNEPPGAR+RVALT LTMAE FR+   QDVLLFIDNIFRF+QAGSEVSALLGR+PS  GYQPTLA EMG LQERITSTK GSITSVQAVYVPADDLTDPAP+TTFAHLDAK VLDR IA+LGIYPA++PL SSSR LDP +VG EHY+VA  VQ ILQ+F+ELQDIIAILG+DEL EEDKLTV+RAR++RN+LSQPF VA +F+   GKYV   DTI GF EI+EGK DD+PEQ F  VG I++ + K    AN
  S:     1 MSQNIGKIISAKGPVIDIQFDGDNNLPALNTAIEIQ-NGDELLVVEVAQHIGDDVVRCVAMGPTDGVKRGMDALNTGNPISVPVGNETLGRMFNVLGQPIDGKEALGDSTKKMPIHRSAPTYAEQRTETEILETGIKVVDLICPFIKGGKIGLFGGAGVGKTVLIQEFINNIATEHGGLSVFAGVGERSREGNDLYYEMKESGVLSKTTLVFGQMNEPPGARLRVALTGLTMAEEFRDEQGQDVLLFIDNIFRFTQAGSEVSALLGRVPSQAGYQPTLATEMGALQERITSTKKGSITSVQAVYVPADDLTDPAPATTFAHLDAKVVLDRSIAALGIYPAVDPLNSSSRALDPLVVGTEHYEVAHGVQQILQRFQELQDIIAILGMDELGEEDKLTVARARRVRNYLSQPFTVASQFTGMDGKYVRVADTIKGFKEILEGKHDDLPEQAFHNVGTIEEAIEKAKTLAN 467
>gi|14916961|sp|P22478|ATPB_BACPF ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|12061046|gb|AAG48363.1|AF330160_10 ATP synthase beta subunit [Bacillus pseudofirmus] (470 aa)
Score = 1600, Expect = 9.7e-176, Identities = 311/454 (68%), Positives = 371/454 (81%)
  Q:   298 DKGIIYQIFGPVVDVKFARNQMPNINDCLEV------KLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPID-NKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           + G I Q+ GPVVDVKF   Q+P IN+ L+V      K   +  + LEVAL  GDD  R ++MGST+GL RG E ++T  PI  PVG A LGR+FNV+GE ID  +P+   V+  PIH++ P F+E ST TEI ETGIKV+DLL PY+KGGKIGLFGGAGVGKTVL+QELI+NIA  HGG+S+FAGVGERTREGNDLYHEM D GVI +TA+VFGQMNEPPGARMRVAL+ LTMAEHFR+ + QDVLLF+DNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMGQLQERITSTK GS+TS+QA+YVPADD TDPAP+TTFAHLDA T L+RK++ +GIYPA++PL S+SR L P IVG EHY VAR VQ  LQK++ELQDIIAILG+DELSEEDKL V RAR+I+ FLSQ F VAE+F+ + G YV  ++TI GF EI++GK DD+PE  F  VG I++V
  S:     2 NTGHITQVMGPVVDVKFKSGQLPEINNALKVVQVGADKNAVDVTVTLEVALHLGDDSVRTVAMGSTDGLVRGTEALDTGAPISVPVGEATLGRVFNVLGEAIDLGEPVAADVKRDPIHREAPKFEELSTTTEILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELINNIAQEHGGISVFAGVGERTREGNDLYHEMTDSGVIKKTAMVFGQMNEPPGARMRVALSGLTMAEHFRDRDGQDVLLFVDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKVGSVTSIQAIYVPADDYTDPAPATTFAHLDATTNLERKLSEMGIYPAVDPLASTSRALSPEIVGEEHYSVARQVQQTLQKYKELQDIIAILGMDELSEEDKLVVHRARRIQFFLSQNFHVAEQFTGQKGSYVPVKETIKGFKEILDGKYDDLPEDAFRLVGRIEEV 462
>gi|152977492|ref|YP_001377009.1| F0F1 ATP synthase subunit beta [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|189081327|sp|A7GV56|ATPB_BACCN ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|152026244|gb|ABS24014.1| ATP synthase F1, beta subunit [Bacillus cereus subsp. cytotoxis NVH 391-98] (464 aa)
Score = 1600, Expect = 1.1e-175, Identities = 312/457 (68%), Positives = 369/457 (80%)
  Q:   298 DKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPID-NKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHKN 754
           +KG + QI GPVVDVKF   ++P I + L +K  +   L LEVAL  GDD  R ++M ST+GL RG EV +T  PI  PVG A LGR+FNV+GE ID +  +P  V   PIH++ P+F+E STK EI ETGIKV+DLL PY+KGGKIGLFGGAGVGKTVL+QELI+NIA  HGG+S+FAGVGERTREGNDLYHEM D GVI +TA+VFGQMNEPPGAR RVALT LTMAEHFR+   QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMGQLQERITST  GSITS+QAVYVPADD TDPAP+TTFAHLDA T L+R++  +GIYPA++PL S+SR L P IVG EHY+VAR VQ  LQ+++ELQDIIAILG+DELSEEDKL V RAR+I+ FLSQ F VAE+F+ + G YV  ++T+ GF EI+EGK DD+PE  F  VGGI++V +N
  S:     2 NKGRVTQIMGPVVDVKFDGGKLPEIYNALRIK-KDEVNLTLEVALHLGDDTVRTVAMSSTDGLVRGTEVEDTGRPISVPVGDATLGRVFNVLGEAIDLDGEIPADVRRDPIHRQAPAFEELSTKVEILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELINNIAQEHGGISVFAGVGERTREGNDLYHEMSDSGVIKKTAMVFGQMNEPPGARQRVALTGLTMAEHFRDEQGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTNKGSITSIQAVYVPADDYTDPAPATTFAHLDATTNLERRLTQMGIYPAVDPLASTSRALSPEIVGEEHYEVARQVQQTLQRYKELQDIIAILGMDELSEEDKLVVHRARRIQFFLSQNFHVAEQFTGQPGSYVPVKETVRGFKEILEGKHDDLPEDAFRLVGGIEEVVEN 458
>gi|50364930|ref|YP_053355.1| F0F1 ATP synthase subunit beta [Mesoplasma florum L1] >gi|81827328|sp|Q6F202|ATPB_MESFL ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|50363486|gb|AAT75471.1| ATP synthase beta chain [Mesoplasma florum L1] (479 aa)
Score = 1600, Expect = 1.1e-175, Identities = 319/471 (67%), Positives = 371/471 (78%)
  Q:   293 NTLKSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYS----PIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHKNYVAANSNNK 763
           NT+ S  G ++QI GPVVDVKF+ + +P I D L V   N  +LVLEV    GD+V R I+MG TEGL +GL VINT  PI+APVG  VLGRMFNV G  ID KP     E++    PIH+  P+++E  T  EI ETGIKVIDL++P+ KGGKIGLFGGAGVGKTVL+QELI+NIA  H G+S+FAGVGERTREGNDLYHE I+ GV+++T+LVFGQMNEPPGARMRVALT LT+AEHFR+    DVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITST  GSITSVQAVYVPADDLTDPAP+TTF HLDAK VLDR IASLGIYPA++PL SSSRMLDP I+G EHY VA  VQ  LQK+++LQ IIAILG+DELS EDKL V RARKIRNFLSQ F+V EKF+ + G+YV   DT+  F  I++G+ DDIPE  FLY G  +DV + Y      NK
  S:    10 NTVNSANGFVFQILGPVVDVKFSEDNIPMIYDALVVD-NNGVELVLEVEQHMGDEVVRTIAMGPTEGLAKGLPVINTNAPILAPVGDDVLGRMFNVTGHAIDEKP-----EFTGKRMPIHRDAPAYEELITNAEILETGIKVIDLMIPFAKGGKIGLFGGAGVGKTVLIQELINNIAKAHSGVSVFAGVGERTREGNDLYHEFIEAGVLDKTSLVFGQMNEPPGARMRVALTGLTIAEHFRDEKNMDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTNKGSITSVQAVYVPADDLTDPAPATTFTHLDAKIVLDRSIASLGIYPAVDPLSSSSRMLDPEIIGEEHYNVALGVQGTLQKYQDLQSIIAILGMDELSAEDKLIVQRARKIRNFLSQSFYVGEKFTGRPGQYVKVSDTVRSFKMILDGEMDDIPEILFLYKGTAEDVIQAYNETKVKNK 478
>gi|18311169|ref|NP_563103.1| F0F1 ATP synthase subunit beta [Clostridium perfringens str. 13] >gi|110800751|ref|YP_696866.1| F0F1 ATP synthase subunit beta [Clostridium perfringens ATCC 13124] >gi|168205576|ref|ZP_02631581.1| ATP synthase F1, beta subunit [Clostridium perfringens E str. JGS1987] >gi|168210117|ref|ZP_02635742.1| ATP synthase F1, beta subunit [Clostridium perfringens B str. ATCC 3626] >gi|168213709|ref|ZP_02639334.1| ATP synthase F1, beta subunit [Clostridium perfringens CPE str. F4969] >gi|168215816|ref|ZP_02641441.1| ATP synthase F1, beta subunit [Clostridium perfringens NCTC 8239] >gi|169344156|ref|ZP_02865138.1| ATP synthase F1, beta subunit [Clostridium perfringens C str. JGS1495] >gi|182623961|ref|ZP_02951749.1| ATP synthase F1, beta subunit [Clostridium perfringens D str. JGS1721] >gi|123148561|sp|Q0TNC4|ATPB_CLOP1 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|20137355|sp|Q8XID4|ATPB_CLOPE ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|18145852|dbj|BAB81893.1| ATP synthase beta subunit [Clostridium perfringens str. 13] >gi|110675398|gb|ABG84385.1| ATP synthase F1, beta subunit [Clostridium perfringens ATCC 13124] >gi|169297614|gb|EDS79714.1| ATP synthase F1, beta subunit [Clostridium perfringens C str. JGS1495] >gi|170662906|gb|EDT15589.1| ATP synthase F1, beta subunit [Clostridium perfringens E str. JGS1987] >gi|170711767|gb|EDT23949.1| ATP synthase F1, beta subunit [Clostridium perfringens B str. ATCC 3626] >gi|170714819|gb|EDT27001.1| ATP synthase F1, beta subunit [Clostridium perfringens CPE str. F4969] >gi|177910854|gb|EDT73208.1| ATP synthase F1, beta subunit [Clostridium perfringens D str. JGS1721] >gi|182382316|gb|EDT79795.1| ATP synthase F1, beta subunit [Clostridium perfringens NCTC 8239] (465 aa)
Score = 1599, Expect = 1.3e-175, Identities = 306/457 (66%), Positives = 375/457 (82%)
  Q:   295 LKSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           + ++ G + Q+ GPVVD+KFA +++PNI + + +K+ + K LV EV    GDD+ R I+M +TEGL RG+E ++T  PI  PVG  VLGR+FNV+G+P+D+       E  PIH+  PSF+EQS   ++FETGIKVIDLL PY +GGKIGLFGGAGVGKTVL+QELI+NIA  HGGLS+F GVGER+REGNDLY+EM++ GVI  TALVFGQMNEPPGARMRVALT LTMAE+FR+   QDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLA EMG LQERITST  GSITSVQAVYVPADDLTDPAP+TTF HLDAKTVL R IA +GIYPA++PL+SSSR+LDP +VG EHY+VA  V+ IL++++ELQDIIAILG+DEL++EDKL V+RAR+I+ FLSQPF VAE+F+   G+YV  ++TI GF EI+EGK D++PE  FL+ G I++V
  S:     1 MSNNIGKVVQVIGPVVDIKFANDELPNIFNAIHIKMDDGKILVCEVEQHVGDDIVRTIAMEATEGLRRGVEAVDTGAPISVPVGECVLGRIFNVLGKPLDSGAEVNNEEKYPIHRPAPSFEEQSVVPQMFETGIKVIDLLAPYQRGGKIGLFGGAGVGKTVLIQELINNIAKEHGGLSVFTGVGERSREGNDLYYEMMESGVIKNTALVFGQMNEPPGARMRVALTGLTMAEYFRDQG-QDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLATEMGALQERITSTTHGSITSVQAVYVPADDLTDPAPATTFNHLDAKTVLSRSIAEIGIYPAVDPLDSSSRILDPRVVGEEHYEVASKVKHILERYKELQDIIAILGVDELADEDKLIVARARRIQKFLSQPFTVAEQFTGMQGRYVPIKETIRGFKEILEGKHDNVPESAFLFAGTIEEV 456
>gi|83319730|ref|YP_424079.1| F0F1 ATP synthase subunit beta [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|118573698|sp|Q2ST34|ATPB_MYCCT ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|83283616|gb|ABC01548.1| ATP synthase F1, beta subunit [Mycoplasma capricolum subsp. capricolum ATCC 27343] (476 aa)
Score = 1599, Expect = 1.3e-175, Identities = 317/456 (69%), Positives = 370/456 (81%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHKNY 755
           G I Q+ GPVVDVKF+ N +P I D L V   N KKLVLEV    GD++ R I+MG TEGL RGL+VINT +PI APVG+ VLGRMFNV+G+PID KP  + V+  PIH+  P ++E  T TEI ETGIKVIDL++P+ KGGK+GLFGGAGVGKT+L+QELI+NIA  H G+S+FAGVGERTREGNDLYHE I+ GV+N+T LVFGQMNEPPGARMRVALT LT+AE+FR+    DVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK+GSITSVQAVYVPADDLTDPAP+TTF HLDA+ VLDR IASLGIYPA++PL SSSR+LDP IVG EHY +A  VQ  LQK++ELQ IIAILG+DELSEEDKL V RARKIRNFLSQ FFV EKF+ + G +V   DT+  F  I+ G+ D +PE YFLY   ID+V + Y
  S:    17 GKIIQVLGPVVDVKFSENNIPKIYDALVVD-NNGKKLVLEVEQNIGDEIVRTIAMGPTEGLRRGLDVINTNSPITAPVGNEVLGRMFNVLGDPIDEKPDLD-VKRLPIHRDAPIYEELVTTTEILETGIKVIDLMIPFTKGGKVGLFGGAGVGKTILIQELINNIAKAHNGVSVFAGVGERTREGNDLYHEFIEAGVLNKTCLVFGQMNEPPGARMRVALTGLTIAEYFRDKKNMDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKNGSITSVQAVYVPADDLTDPAPATTFTHLDARIVLDRSIASLGIYPAVDPLASSSRVLDPEIVGQEHYDIALKVQITLQKYQELQSIIAILGMDELSEEDKLIVQRARKIRNFLSQSFFVGEKFTGRPGVFVKVSDTVRSFKSILNGEVDHVPETYFLYSSTIDNVIEKY 470
>gi|15616316|ref|NP_244621.1| F0F1 ATP synthase subunit beta [Bacillus halodurans C-125] >gi|14916533|sp|Q9K6H5|ATPB_BACHD ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|10176378|dbj|BAB07473.1| ATP synthase beta subunit [Bacillus halodurans C-125] (470 aa)
Score = 1599, Expect = 1.4e-175, Identities = 312/454 (68%), Positives = 372/454 (81%)
  Q:   298 DKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKK------LVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPID-NKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           + G I Q+ GPVVDV+F   Q+P +N+ L V+     +      + LEVAL  GDD  R I+MGST+GL RG EV++T   I  PVG   LGR+FNV+GE ID ++P+P   E SPIH++ P F+E STKTEI ETGIKV+DLL PY+KGGKIGLFGGAGVGKTVL+QELI+NIA  HGG+S+FAGVGERTREGNDLYHEM D GVI +TA+VFGQMNEPPGARMRVAL+ LTMAE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMGQLQERITSTK GS+TS+QA+YVPADD TDPAP+TTFAHLDA T L+RK++ +GIYPA++PL S+SR L P IVG EHY VAR VQ  LQK++ELQDIIAILG+DELSEEDKL V+RAR+I+ FLSQ F VAE+F+ + G YV  ++TI GF EI+EGK DD+PE  F  VG I++V
  S:     2 NTGHITQVMGPVVDVRFQSGQLPELNNALRVEQKGADQNAVDVNVTLEVALHLGDDTVRTIAMGSTDGLVRGTEVVDTGAAISVPVGEVTLGRVFNVLGESIDLDEPIPADAERSPIHREAPKFEELSTKTEILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELINNIAQEHGGISVFAGVGERTREGNDLYHEMSDSGVIKKTAMVFGQMNEPPGARMRVALSGLTMAEYFRDKQGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKVGSVTSIQAIYVPADDYTDPAPATTFAHLDATTNLERKLSEMGIYPAVDPLASTSRALSPEIVGEEHYNVARQVQQTLQKYKELQDIIAILGMDELSEEDKLIVARARRIQFFLSQNFHVAEQFTGQPGSYVPVKETIKGFKEILEGKYDDLPEDAFRLVGRIEEV 462
>gi|1352033|sp|P29707|ATPB_PROMO ATP synthase subunit beta, sodium ion specific (Na(+)-translocating ATPase subunit beta) >gi|897798|emb|CAA41374.1| beta subunit [Propionigenium modestum] (467 aa)
Score = 1599, Expect = 1.6e-175, Identities = 304/453 (67%), Positives = 373/453 (82%)
  Q:   298 DKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           +KG+I QI GPVVDV F  N++P I + L++   N + LV EV    G+ V R ++M +T+GL RG+EV++T   I  PVG AVLGR+ NV+GEP+D     +  EY+PIH++ P+F++Q T+ E+FETGIKV+DLL PYVKGGKIGLFGGAGVGKTVL+ ELI+NIA GHGGLS+FAGVGERTREG DLY EM++ GV+++T+LV+GQMNEPPGAR+RV LT LTMAE+FR+   QDVL F+DNIFRF+QA SEVSALLGR+PSAVGYQP LA +MG LQERITSTK+GSITSVQAVYVPADDLTDPAP+TTF HLDA TVL R+IASLGIYPA++PL+S+S  L+P I+G EHY  AR VQ ILQ+++ELQDIIAILG+DELS+EDK+TV+RARKI  F SQPF VAE+F+   GKYV+ ++TI GF EIIEGK DD+PEQ FLYVG ID+
  S:     3 NKGVITQIIGPVVDVTF-ENELPRIYNALKIDRGNGEYLVAEVQQHLGNSVVRAVAMDATDGLQRGMEVVDTGPAITVPVGKAVLGRILNVLGEPVDEAGEVKAEEYAPIHREAPAFEDQGTEKEVFETGIKVVDLLAPYVKGGKIGLFGGAGVGKTVLIMELINNIAQGHGGLSVFAGVGERTREGRDLYDEMLESGVLDKTSLVYGQMNEPPGARLRVGLTGLTMAENFRDKEGQDVLFFVDNIFRFTQAPSEVSALLGRMPSAVGYQPNLATDMGALQERITSTKTGSITSVQAVYVPADDLTDPAPATTFTHLDATTVLSRRIASLGIYPAVDPLDSTSTALEPQIIGHEHYNTAREVQQILQRYKELQDIIAILGMDELSDEDKVTVNRARKIERFFSQPFHVAEQFTGMDGKYVTVKETIRGFKEIIEGKHDDLPEQAFLYVGTIDE 454
>gi|14715606|gb|AAK72443.1|AF283808_8 ATP synthase beta subunit [Clostridium pasteurianum] (465 aa)
Score = 1598, Expect = 1.8e-175, Identities = 315/454 (69%), Positives = 371/454 (81%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHK 753
           G + Q+ GPV+D+KFA   +PNI + LE+ +  +K L+ EV    GDDV R ISM  T+GL RG + ++T+ PI  PVG  VLGR+FNV+G+ ID     +  EY PIH+ PPSF+EQS   E+FETGIKVIDLL PY KGGKIGLFGGAGVGKTVL+QELI+NIA  HGGLS+F GVGERTREGNDLY+EM + GVI++TALVFGQMNEPPGARMRVALT LTMAE FR+   QDVLLFIDNIFRF+QAGSEVSALLGRIPSAVGYQPTLA EMG LQERITSTK GSITSVQAVYVPADDLTDPAP+TTF HLDA TVL R I+ LGIYPA++PLESSSR+LDP+IVG EHY+VA  V+ IL+++ ELQDIIAILG+DELSEED+  V+RAR+I+ FLSQPF VAE+F+   GK+VS  DTI GF EI+EGKCDD+PE  FL+VG I++  +
  S:     6 GKVVQVIGPVIDIKFASENLPNIYNALEIGM-GDKILIAEVEQHIGDDVVRAISMEPTDGLRRGAKAVDTEKPISVPVGKPVLGRLFNVLGKTIDEAGDLKDDEYYPIHRLPPSFEEQSVVPEMFETGIKVIDLLAPYQKGGKIGLFGGAGVGKTVLIQELINNIAKEHGGLSVFTGVGERTREGNDLYYEMKESGVIDKTALVFGQMNEPPGARMRVALTGLTMAEKFRDEG-QDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGALQERITSTKHGSITSVQAVYVPADDLTDPAPATTFTHLDATTVLSRSISELGIYPAVSPLESSSRILDPNIVGEEHYQVASKVKLILERYNELQDIIAILGVDELSEEDRAIVNRARRIQRFLSQPFSVAEQFTGMQGKFVSVSDTIKGFKEILEGKCDDLPEAAFLFVGTIEEARE 457
>gi|148322971|gb|EDK88221.1| F-type two-sector ATPase, F(1) beta subunit [Fusobacterium nucleatum subsp. polymorphum ATCC 10953] (462 aa)
Score = 1596, Expect = 3.2e-175, Identities = 316/453 (69%), Positives = 377/453 (83%)
  Q:   298 DKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           +KG I QI   VVDV F ++++P I + L+VKL  +K+LVLEV    G++V R ++M ST+GL RG+EVI+T  PI  PVG AVLGR+ NV+GEP+DN+       + PIH++ P FD+  T+TEIFETGIKVIDLL PY+KGGKIGLFGGAGVGKTVL+ ELI+NIA GHGG+S+FAGVGERTREG DLY EM + GVI +TALV+GQMNEPPGAR+RVALT LT+AE+FR+ + QDVLLFIDNIFRF+QAGSEVSALLGRIPSAVGYQP LA EMG LQERITSTKSGSITSVQAVYVPADDLTDPAP+TTF+HLDA TVL R IASLGIYPA++PL+S+S+ L   +VG EHY+VAR VQ +LQ+++ELQDIIAILG+DELS+EDKLTVSRARKI  F SQPF VAE+F+   GKYV  ++TI GF EI+EGK DDIPEQ FLYVG I++
  S:     2 NKGTITQIISAVVDVAF-KDELPAIYNALKVKL-EDKELVLEVEQHLGNNVVRTVAMDSTDGLKRGMEVIDTGKPITVPVGKAVLGRILNVLGEPVDNQGPINAETFLPIHREAPEFDDLETETEIFETGIKVIDLLAPYIKGGKIGLFGGAGVGKTVLIMELINNIAKGHGGISVFAGVGERTREGRDLYGEMTESGVITKTALVYGQMNEPPGARLRVALTGLTVAENFRDKDGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPNLATEMGALQERITSTKSGSITSVQAVYVPADDLTDPAPATTFSHLDATTVLSRNIASLGIYPAVDPLDSTSKALSEDVVGKEHYEVARKVQEVLQRYKELQDIIAILGMDELSDEDKLTVSRARKIERFFSQPFSVAEQFTGMEGKYVPVKETIRGFREILEGKHDDIPEQAFLYVGTIEE 452
>gi|83591194|ref|YP_431203.1| F0F1 ATP synthase subunit beta [Moorella thermoacetica ATCC 39073] >gi|118573697|sp|Q2RFX9|ATPB_MOOTA ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|83574108|gb|ABC20660.1| ATP synthase F1, beta subunit [Moorella thermoacetica ATCC 39073] (462 aa)
Score = 1595, Expect = 4.6e-175, Identities = 299/456 (65%), Positives = 369/456 (80%)
  Q:   298 DKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHK 753
           ++G + Q+ GPVVDV+FA +++P++ + + +K  +   + +E     G++  RC+++ ST+GL RG++ ++T  PI  PVG A LGR+FNV+GEPIDN+   E  E  PIH+  PSF+EQ   TE+ ETGIKV+DLL PY KGGKIGLFGGAGVGKTVL+ ELI NIA  HGG S+F+GVGERTREGNDLY EM + GV+ +TALVFGQMNEPPGAR+RV LT LTMAE+FR+   QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTLA EMG LQERITSTK GSITSVQA+YVPADDLTDPAP+TTFAHLDA TVL R+IA LGIYPA++PL+S+SR+LDP ++G EHY+VAR VQ +LQ+++ELQDIIAILG+DELSEEDKL V+RARKI+ FLSQPF VAE F+ + G YV  ++TI GF EI+EG+ D++PEQ F  VG ID+  K
  S:     2 NEGQVVQVIGPVVDVEFASDRLPDLYNAITIK-TDKINITMEAMQHLGNNTVRCVALSSTDGLQRGMKAVDTGQPITVPVGRATLGRLFNVLGEPIDNQGPVETTERLPIHRPAPSFEEQQPSTEVLETGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELIRNIAYEHGGFSVFSGVGERTREGNDLYLEMKESGVLEKTALVFGQMNEPPGARLRVGLTGLTMAEYFRDAEGQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLATEMGALQERITSTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRQIAELGIYPAVDPLDSTSRILDPRVLGEEHYQVARGVQQVLQRYKELQDIIAILGMDELSEEDKLIVARARKIQRFLSQPFHVAEAFTGQPGVYVPLKETIRGFKEILEGRHDNLPEQAFYMVGTIDEAVK 456
>gi|15896119|ref|NP_349468.1| F0F1 ATP synthase subunit beta [Clostridium acetobutylicum ATCC 824] >gi|20137589|sp|Q9Z687|ATPB_CLOAB ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|15025911|gb|AAK80808.1|AE007784_5 FoF1-type ATP synthase beta subunit [Clostridium acetobutylicum ATCC 824] >gi|4323568|gb|AAD16426.1| ATP synthase subunit beta [Clostridium acetobutylicum] (466 aa)
Score = 1594, Expect = 5.3e-175, Identities = 309/454 (68%), Positives = 372/454 (81%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHK 753
           G I Q+ GPVVD+KF    +P+I + +E+ + +NKKL+ EV    GDD+ R I+M  T+GL RG+E +NT  PI  PVG  VLGR+FNV+G+ ID        +Y PIH+  P+F+EQS + E+FETGIKVIDLL PY KGGKIGLFGGAGVGKTVL+QELI+NIA  HGGLS+F GVGERTREGNDLY+EM D GVIN+TALVFGQMNEPPGARMRVALT LTMAE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGRIPSAVGYQPTLA EMG LQERITSTK GSITSVQAVYVPADDLTDPAP+TTF HLDA TVL R+I++LGIYPA++PLES+SR+LDP IVG EHY+VA  V+ IL++++ELQDIIAILG+DELS+ED+L V RAR+++ FLSQ F VAE+F+   G++V  +DTI  F EI++GKCDD+PE  FL+ G I+DV +
  S:     6 GKIVQVIGPVVDIKFDAENLPDIYNSIEIDMGDNKKLIAEVEQHVGDDIVRTIAMEGTDGLKRGMEAVNTGKPISVPVGENVLGRLFNVLGQTIDEAGDMNADKYYPIHRPAPTFEEQSVQPEMFETGIKVIDLLAPYQKGGKIGLFGGAGVGKTVLIQELINNIAKEHGGLSVFTGVGERTREGNDLYYEMKDSGVINKTALVFGQMNEPPGARMRVALTGLTMAEYFRDKG-QDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLANEMGALQERITSTKQGSITSVQAVYVPADDLTDPAPATTFTHLDATTVLSREISNLGIYPAVSPLESTSRILDPRIVGEEHYEVANKVKHILERYQELQDIIAILGVDELSDEDRLLVGRARRVQRFLSQAFSVAEQFTGMKGQFVPVKDTIRSFKEILDGKCDDLPEAAFLFAGTIEDVKE 458
>gi|153956279|ref|YP_001397044.1| F0F1 ATP synthase subunit beta [Clostridium kluyveri DSM 555] >gi|190358660|sp|A5N3H7|ATPB_CLOK5 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|146349137|gb|EDK35673.1| AtpD [Clostridium kluyveri DSM 555] (464 aa)
Score = 1593, Expect = 6.9e-175, Identities = 311/455 (68%), Positives = 371/455 (81%)
  Q:   297 SDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           S+ G + Q+ GPVVD+KF    +P+I + + ++   N K++ EVA   GDD+ R ISM ST+GL RG++ ++   PI  PVG  VLGR+FN++G+PID     E  EYSPIH+  PSF++QS K E+FETGIKVIDL+ PY KGGKIGLFGGAGVGKTV++QELI+NIA  HGGLS+F GVGERTREGNDLY+EM + GVIN+TALVFGQMNEPPGARMRVALT LTMAEHFR+   QDVLLFIDNIFRF+QAGSEVSALLGRIPSAVGYQPTLA EMG LQERITSTK GSITSVQAVYVPADDLTDPAP+TTF HLDA TVL R I+ +GIYPA++PL S+SR+LDP +VG EHYKVA  V+ IL+++ ELQDIIAILG+DELSEED+L V RAR+I+ FLSQPF VAE+F+   GKYV  ++TI GF EI+EGK DD+PE  FL+ G ID+V
  S:     2 SNIGKVVQVIGPVVDIKFDEENLPDIYNAISIE-SGNAKIITEVAQHLGDDIVRTISMESTDGLMRGMDALDIGAPISVPVGKPVLGRLFNMLGQPIDENGEVEADEYSPIHRPAPSFEDQSVKPEMFETGIKVIDLIAPYQKGGKIGLFGGAGVGKTVIIQELINNIAKEHGGLSVFTGVGERTREGNDLYYEMQESGVINKTALVFGQMNEPPGARMRVALTGLTMAEHFRDEG-QDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGSLQERITSTKHGSITSVQAVYVPADDLTDPAPATTFTHLDATTVLSRSISEIGIYPAVDPLASTSRILDPRVVGEEHYKVASDVKHILERYSELQDIIAILGVDELSEEDRLVVIRARRIQRFLSQPFSVAEQFTGYEGKYVPIKETIRGFKEILEGKYDDLPETAFLFKGSIDEV 454
>gi|19703700|ref|NP_603262.1| F0F1 ATP synthase subunit beta [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >gi|81848278|sp|Q8RGE2|ATPB_FUSNN ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|19713824|gb|AAL94561.1| ATP synthase beta chain, sodium ion specific [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] (462 aa)
Score = 1593, Expect = 7.9e-175, Identities = 315/453 (69%), Positives = 377/453 (83%)
  Q:   298 DKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           +KG I QI   VVD+ F ++++P I + L+VKL  +K+LVLEV    G++V R ++M ST+GL RG+EVI+T  PI  PVG AVLGR+ NV+GEP+DN+       + PIH++ P FD+  T+TEIFETGIKVIDLL PY+KGGKIGLFGGAGVGKTVL+ ELI+NIA GHGG+S+FAGVGERTREG DLY EM + GVI +TALV+GQMNEPPGAR+RVALT LT+AE+FR+ + QDVLLFIDNIFRF+QAGSEVSALLGRIPSAVGYQP LA EMG LQERITSTKSGSITSVQAVYVPADDLTDPAP+TTF+HLDA TVL R IASLGIYPA++PL+S+S+ L   +VG EHY+VAR VQ +LQ+++ELQDIIAILG+DELS+EDKLTVSRARKI  F SQPF VAE+F+   GKYV  ++TI GF EI+EGK DDIPEQ FLYVG I++
  S:     2 NKGTITQIISAVVDIAF-KDELPAIYNALKVKL-EDKELVLEVEQHLGNNVVRTVAMDSTDGLKRGMEVIDTGKPITIPVGKAVLGRILNVLGEPVDNQGPLNAETFLPIHREAPEFDDLETETEIFETGIKVIDLLAPYIKGGKIGLFGGAGVGKTVLIMELINNIAKGHGGISVFAGVGERTREGRDLYGEMTESGVITKTALVYGQMNEPPGARLRVALTGLTVAENFRDKDGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPNLATEMGALQERITSTKSGSITSVQAVYVPADDLTDPAPATTFSHLDATTVLSRNIASLGIYPAVDPLDSTSKALSEDVVGKEHYEVARKVQEVLQRYKELQDIIAILGMDELSDEDKLTVSRARKIERFFSQPFSVAEQFTGMEGKYVPVKETIRGFREILEGKHDDIPEQAFLYVGTIEE 452
>gi|167750158|ref|ZP_02422285.1| hypothetical protein EUBSIR_01127 [Eubacterium siraeum DSM 15702] >gi|167656901|gb|EDS01031.1| hypothetical protein EUBSIR_01127 [Eubacterium siraeum DSM 15702] (465 aa)
Score = 1592, Expect = 8.0e-175, Identities = 308/451 (68%), Positives = 368/451 (81%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           G + QI G V+D+KF    +PN+ + +E++    KKL +EVA   GDD  RCI+MGST+GL RGL  ++T   I  PVG   LGR+FN++GE +DNKP PE  E   IH+  PSF+EQ   T++ ETGIKV+DL+ PY+KGGKIGLFGGAGVGKTVL+ ELI+NIA  HGGLS+F GVGERTREGNDLY+EM + GVI +T LV+GQMNEPPGARMRVAL+ LTMAE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMG LQERITSTK GSITSVQAVYVPADDLTDPAP+TTFAHLDA TVL R I+S+GI+PA++PL+S+SR+L P IVG EHY+VAR VQ+ILQ++ ELQDIIAILG+DEL + DKLTVSRARKI+ FLSQPF VAE+F+   GKYV  ++TI GF EIIEGK DD+PE  FL+VG ID+
  S:     6 GTVVQIIGAVLDIKFPPEHLPNLLNAIEIE-HEGKKLTVEVAQHIGDDTVRCIAMGSTDGLVRGLPAVDTGASIKVPVGRQTLGRIFNLLGEAVDNKPQPETEEKWEIHRPAPSFEEQEGSTQVLETGIKVVDLIAPYLKGGKIGLFGGAGVGKTVLIMELINNIAKQHGGLSVFTGVGERTREGNDLYNEMTESGVIEKTTLVYGQMNEPPGARMRVALSGLTMAEYFRDKEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGALQERITSTKKGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSRNISSMGIFPAVDPLDSTSRILTPEIVGEEHYEVARQVQSILQRYNELQDIIAILGMDELDDNDKLTVSRARKIQRFLSQPFSVAEQFTGMKGKYVPLKETIRGFKEIIEGKHDDLPESAFLFVGTIDE 455
>gi|34763442|ref|ZP_00144389.1| ATP synthase beta chain, sodium ion specific [Fusobacterium nucleatum subsp. vincentii ATCC 49256] >gi|27886883|gb|EAA24008.1| ATP synthase beta chain, sodium ion specific [Fusobacterium nucleatum subsp. vincentii ATCC 49256] (462 aa)
Score = 1592, Expect = 9.3e-175, Identities = 316/453 (69%), Positives = 377/453 (83%)
  Q:   298 DKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           +KG I QI   VVDV F ++++P I + L+VKL  +K+LVLEV    G++V R ++M ST+GL RG+EVI+T  PI  PVG AVLGR+ NV+GEP+DN+       + PIH++ P FD+  T+TEIFETGIKVIDLL PY+KGGKIGLFGGAGVGKTVL+ ELI+NIA GHGG+S+FAGVGERTREG DLY EM + GVI +TALV+GQMNEPPGAR+RVALT LT+AE+FR+ + QDVLLFIDNIFRF+QAGSEVSALLGRIPSAVGYQP LA EMG LQERITSTKSGSITSVQAVYVPADDLTDPAP+TTF+HLDA TVL R IASLGIYPA++PL+S+S+ L   +VG EHY+VAR VQ +LQ+++ELQDIIAILG+DELS+EDKLTVSRARKI  F SQPF VAE+F+   GKYV  ++TI GF EI+EGK DDIPEQ FLYVG I++
  S:     2 NKGTITQIISAVVDVAF-KDELPAIYNALKVKL-EDKELVLEVEQHLGNNVVRTVAMDSTDGLKRGMEVIDTGKPITIPVGKAVLGRILNVLGEPVDNQGPINAETFLPIHREAPEFDDLETETEIFETGIKVIDLLAPYIKGGKIGLFGGAGVGKTVLIMELINNIAKGHGGISVFAGVGERTREGRDLYGEMTESGVITKTALVYGQMNEPPGARLRVALTGLTVAENFRDKDGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPNLATEMGALQERITSTKSGSITSVQAVYVPADDLTDPAPATTFSHLDATTVLSRNIASLGIYPAVDPLDSTSKALSEDVVGKEHYEVARKVQEVLQRYKELQDIIAILGMDELSDEDKLTVSRARKIERFFSQPFSVAEQFTGMEGKYVPVKETIRGFREILEGKHDDIPEQAFLYVGTIEE 452
>gi|167924983|ref|ZP_02512074.1| F0F1 ATP synthase subunit beta [Mycoplasma mycoides subsp. mycoides LC str. GM12] (475 aa)
Score = 1592, Expect = 9.6e-175, Identities = 317/456 (69%), Positives = 369/456 (80%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHKNY 755
           G + Q+ GPVVDVKF+ N +P I D L V   N KKLVLEV    GD++ R I+MG TEGL RGL+VINT +PI AP G  VLGRMFNV+G+PID KP  + V+  PIHK  P ++E  T TEI ETGIKVIDL++P+ KGGK+GLFGGAGVGKT+L+QELI+NIA  H G+S+FAGVGERTREGNDLYHE I+ GV+N+T LVFGQMNEPPGARMRVALT LT+AE+FR+    DVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK+GSITSVQAVYVPADDLTDPAP+TTF HLDA+ VLDR IASLGIYPA++PL SSSR+LDP IVG EHY +A  VQ  LQK+++LQ IIAILG+DELSEEDKL V RARKIRNFLSQ FFV EKF+ + G +V   DT+  F  I++G+ D IPE YFLY   IDDV + Y
  S:    16 GKVIQVLGPVVDVKFSENNIPKIYDALIVD-NNGKKLVLEVEQNIGDEIVRTIAMGPTEGLKRGLDVINTNSPITAPTGIEVLGRMFNVLGDPIDEKPDLD-VKREPIHKDAPKYEELVTTTEILETGIKVIDLMIPFTKGGKVGLFGGAGVGKTILIQELINNIAKAHNGVSVFAGVGERTREGNDLYHEFIEAGVLNKTCLVFGQMNEPPGARMRVALTGLTIAEYFRDQKNMDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKNGSITSVQAVYVPADDLTDPAPATTFTHLDARIVLDRSIASLGIYPAVDPLASSSRVLDPEIVGQEHYDIALRVQIALQKYQDLQSIIAILGMDELSEEDKLIVQRARKIRNFLSQSFFVGEKFTGRPGVFVKVNDTVRSFKSILDGEVDYIPETYFLYSSTIDDVIEKY 469
>gi|118445003|ref|YP_878996.1| F0F1 ATP synthase subunit beta [Clostridium novyi NT] >gi|171472992|sp|A0Q2Z4|ATPB_CLONN ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|118135459|gb|ABK62503.1| ATP synthase F1, beta subunit [Clostridium novyi NT] (464 aa)
Score = 1591, Expect = 1.1e-174, Identities = 310/451 (68%), Positives = 376/451 (83%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           G + Q+ GPV+D+KF  + +PNI + +E+ +  ++ L+ EV    GDDV R I+M STEGL RG++ +NT+ PI  PVGS +LGR+FNV+G+ ID +   +  EY PIH+  P+F+EQS + E+FETGIKVIDL+ PY KGGKIGLFGGAGVGKTVL+QELI+NIA  HGGLS+F GVGERTREGNDLY+EM + GVIN+TALVFGQMNEPPGARMRVALT LTMAE+FR+   Q+VLLFIDNIFRF+QAGSEVSALLGRIPSAVGYQPTLA EMG LQERITSTK GSITSVQAVYVPADDLTDPAP+TTFAHLDA TVL R IA LGIYPA++PLES+SR+LDP ++G EHY VA +V+ IL++++ELQDIIAILG+DELSEEDKL VSRARK++ FLSQPF VAE+F+   GK+V  ++T+ GF EIIEGK DD+PE  FL+VG I++
  S:     7 GRVVQVIGPVIDIKFDSDCLPNIYNAIEIDM-GDRILITEVEQHIGDDVVRTIAMESTEGLKRGMKAVNTEKPISVPVGSEILGRLFNVLGKTIDEEGEFKAEEYYPIHRPAPTFEEQSVEPEMFETGIKVIDLIAPYQKGGKIGLFGGAGVGKTVLIQELINNIAKEHGGLSVFTGVGERTREGNDLYYEMKESGVINKTALVFGQMNEPPGARMRVALTGLTMAEYFRDQG-QNVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGALQERITSTKHGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSRSIAELGIYPAVDPLESTSRILDPRVIGQEHYDVAINVKHILERYKELQDIIAILGVDELSEEDKLVVSRARKVQRFLSQPFTVAEQFTGMKGKFVPVKETVRGFKEIIEGKYDDVPEAAFLFVGSIEE 455
>gi|416680|sp|Q03235|ATPB_PECFR ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|581446|emb|CAA45841.1| ATPase (beta-subunit); H(+)-transporting ATP synthase [Pectinatus frisingensis] (470 aa)
Score = 1590, Expect = 1.7e-174, Identities = 300/452 (66%), Positives = 367/452 (81%)
  Q:   299 KGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK---KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMP-EKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           KG I Q+ GPVVD++F   ++P+I + + +K  +      L +EV    GD + RCI+M ST+GL RG+E ++T +PI  PVG   LGR+FNV+G+ +D+ P P    E+ PIH+  P FDEQ T T+I ETGIKV+DL+ PY +GGKIGLFGGAGVGKTVL+ ELIHNIAT HGG S+F+GVGERTREGNDL+ EM + GVIN+TALV+GQMNEPPGARMRVALT LTMAE+FR+   QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL  ++G LQERITSTK GSITSVQAVYVPADDLTDP P+ TF HLDA TVL R+IA LGIYPA++PL+S+SR+LDP ++G +HY+VAR VQ +LQK++ELQDIIAILG++ELS+ DKLTV+RARKI+ FLSQPFFVAE+F+   GKYV  ++TI GF EI+EGK DD+PE  F  VG ID+
  S:     3 KGKIVQVIGPVVDIEFPAEELPSILNAITIKGKSGDIDINLTVEVMQHLGDGITRCIAMSSTDGLTRGMEAVDTGSPIKVPVGEETLGRVFNVLGQTVDHNPAPVGNKEFWPIHRPAPKFDEQETSTQILETGIKVVDLIAPYSRGGKIGLFGGAGVGKTVLIMELIHNIATQHGGYSVFSGVGERTREGNDLWSEMTESGVINKTALVYGQMNEPPGARMRVALTGLTMAEYFRDVQHQDVLLFIDNIFRFIQAGSEVSALLGRMPSAVGYQPTLTTDVGALQERITSTKKGSITSVQAVYVPADDLTDPGPAATFTHLDATTVLSRQIAELGIYPAVDPLDSTSRILDPHVIGEDHYEVARGVQAVLQKYKELQDIIAILGMEELSDADKLTVARARKIQRFLSQPFFVAEQFTGSPGKYVPLKETIRGFKEILEGKYDDLPESAFYMVGSIDE 458
>gi|30023337|ref|NP_834968.1| F0F1 ATP synthase subunit beta [Bacillus cereus ATCC 14579] >gi|47569800|ref|ZP_00240471.1| ATP synthase F1, beta subunit [Bacillus cereus G9241] >gi|168136017|ref|ZP_02579246.1| F0F1 ATP synthase subunit beta [Bacillus cereus B4264] >gi|81837221|sp|Q814W2|ATPB_BACCR ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|29898898|gb|AAP12169.1| ATP synthase beta chain [Bacillus cereus ATCC 14579] >gi|47553542|gb|EAL11922.1| ATP synthase F1, beta subunit [Bacillus cereus G9241] (468 aa)
Score = 1589, Expect = 1.9e-174, Identities = 312/457 (68%), Positives = 368/457 (80%)
  Q:   298 DKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK---KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPID-NKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHKN 754
           +KG + QI GPVVDVKF   ++P I + L VK  N      L  EVAL  GDD  R ++M ST+GL RG EV +T   I  PVG A LGR+FNV+G+ ID +  +P  V   PIH++ P+F+E STK EI ETGIKV+DLL PY+KGGKIGLFGGAGVGKTVL+QELI+NIA  HGG+S+FAGVGERTREGNDLYHEM D GVI +TA+VFGQMNEPPGAR RVALT LTMAEHFR+   QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMGQLQERITST  GSITS+QAVYVPADD TDPAP+TTFAHLDA T L+R++  +GIYPA++PL S+SR L P IVG EHY+VAR VQ  LQ+++ELQDIIAILG+DELSEEDKL V RAR+I+ FLSQ F VAE+F+ + G YV  ++T+SGF EI+EGK DD+PE  F  VGGI++V +N
  S:     2 NKGRVTQIMGPVVDVKFDGGKLPEIYNALTVKQSNENGSMNLTFEVALHLGDDTVRTVAMSSTDGLVRGTEVEDTGKAISVPVGDATLGRVFNVLGDAIDLDGELPADVHRDPIHRQAPAFEELSTKVEILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELINNIAQEHGGISVFAGVGERTREGNDLYHEMSDSGVIKKTAMVFGQMNEPPGARQRVALTGLTMAEHFRDEQGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTNKGSITSIQAVYVPADDYTDPAPATTFAHLDATTNLERRLTQMGIYPAVDPLASTSRALSPEIVGEEHYEVARQVQQTLQRYKELQDIIAILGMDELSEEDKLVVHRARRIQFFLSQNFHVAEQFTGQKGSYVPVKNTVSGFKEILEGKYDDLPEDAFRLVGGIEEVIEN 462
>gi|171323836|ref|ZP_02912354.1| ATP synthase F1, beta subunit [Geobacillus sp. WCH70] >gi|171090147|gb|EDT36459.1| ATP synthase F1, beta subunit [Geobacillus sp. WCH70] (473 aa)
Score = 1588, Expect = 2.4e-174, Identities = 309/453 (68%), Positives = 368/453 (81%)
  Q:   299 KGIIYQIFGPVVDVKFARNQMPNINDCLEV--KLPNNKK----LVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNK-PMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           KG + Q+ GPVVDVKF    +P I + L++  K  N  +    L LEVAL  GDD  R I+M ST+GL RG+EVI+T  PI  PVG   LGR+FNV+GEPID +  +P+     PIH+  P F+E +T+ EI ETGIKV+DLL PY+KGGKIGLFGGAGVGKTVL+QELIHNIA  HGG+S+FAGVGERTREGNDLYHEM D GVI++TA+VFGQMNEPPGARMRVALT LTMAE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMGQLQERITST +GSITS+QA+YVPADD TDPAP+TTF+HLDA T L+RK+A +GIYPA++PL S+SR L P IVG EHY+VAR VQ  LQ++ ELQDIIAILG+DELS+EDKL V RAR+I+ FLSQ F VAE+F+ + G YV  ++T+ GF EI+EGK D IPE  F  VG I++V
  S:     3 KGRVIQVMGPVVDVKFENGHLPAIYNALKIQHKARNENEVDIDLTLEVALHLGDDTVRTIAMASTDGLIRGMEVIDTGAPISVPVGEVTLGRVFNVLGEPIDMQGEIPDDARRDPIHRPAPKFEELATEVEILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELIHNIAQEHGGISVFAGVGERTREGNDLYHEMKDSGVISKTAMVFGQMNEPPGARMRVALTGLTMAEYFRDEQGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTATGSITSIQAIYVPADDYTDPAPATTFSHLDATTNLERKLAEMGIYPAVDPLASTSRALAPEIVGEEHYQVARKVQQTLQRYRELQDIIAILGMDELSDEDKLIVHRARRIQFFLSQNFHVAEQFTGQPGSYVPIKETVRGFKEILEGKYDHIPEDAFRLVGRIEEV 462
>gi|42558884|sp|Q9LA80|ATPB_GEOTH ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|7578511|gb|AAF64075.1|AF147781_1 ATP synthase beta subunit [Geobacillus thermoleovorans] (473 aa)
Score = 1588, Expect = 3.0e-174, Identities = 308/453 (67%), Positives = 366/453 (80%)
  Q:   299 KGIIYQIFGPVVDVKFARNQMPNINDCLEV--KLPNNKK----LVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPID-NKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           +G + Q+ GPVVDVKF    +P I + L++  K  N  +    L LEVAL  GDD  R I+M ST+GL RG+EVI+T  PI  PVG   LGR+FNV+GEPID    +P      PIH+  P F+E +T+ EI ETGIKV+DLL PY+KGGKIGLFGGAGVGKTVL+QELIHNIA  HGG+S+FAGVGERTREGNDLYHEM D GVI++TA+VFGQMNEPPGARMRVALT LTMAE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMGQLQERITST  GSITS+QA+YVPADD TDPAP+TTF+HLDA T L+RK+A +GIYPA++PL S+SR L P IVG EHY+VAR VQ  LQ+++ELQDIIAILG+DELS+EDKL V RAR+I+ FLSQ F VAE+F+ + G YV  ++T+ GF EI+EGK D +PE  F  VG I+DV
  S:     3 RGRVIQVMGPVVDVKFENGHLPAIYNALKIQHKARNENEVDIDLTLEVALHLGDDTVRTIAMASTDGLIRGMEVIDTGAPISVPVGEVTLGRVFNVLGEPIDLEGDIPADARRDPIHRPAPKFEELATEVEILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELIHNIAQEHGGISVFAGVGERTREGNDLYHEMKDSGVISKTAMVFGQMNEPPGARMRVALTGLTMAEYFRDEQGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTAKGSITSIQAIYVPADDYTDPAPATTFSHLDATTNLERKLAEMGIYPAVDPLASTSRALAPEIVGEEHYQVARKVQQTLQRYKELQDIIAILGMDELSDEDKLVVHRARRIQFFLSQNFHVAEQFTGQPGSYVPVKETVRGFKEILEGKYDHLPEDRFRLVGRIEDV 462
>gi|196251785|ref|ZP_03150451.1| ATP synthase F1, beta subunit [Clostridium thermocellum DSM 4150] >gi|196198725|gb|EDX93556.1| ATP synthase F1, beta subunit [Clostridium thermocellum DSM 4150] (464 aa)
Score = 1587, Expect = 3.6e-174, Identities = 307/454 (67%), Positives = 359/454 (79%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHK 753
           G + QI GPV+D++F R ++P+I + +++       +V EV    G+D  RC+SM ST+GL RG++ ++T  PI  PVG  VLGR+FNV+GEPID K   +   Y PIH++ P  DEQ   TEI ETGIKVIDLL PY KGGKIGLFGGAGVGKTVL+ ELI NIAT HGG S+F GVGER+REGNDL++EM + GVI +TALVFGQMNEPPG+RMRV LT LTMAE+FR+   QDVLLFIDNIFRF QAGSEVSALLGRIPSAVGYQPTLA EMG LQERITSTK GSITSVQAVYVPADDLTDPAP+TTF HLDA TVL R I   GIYPA++PL+S+SR+LD  IVG EHY VAR VQ ILQ+++ELQDIIAILG+DELSEEDKL V RARKI+ FLSQPFFVAE ++   GK+V  +DTI GF EIIEGK DDIPE  F   G ID+V++
  S:     7 GTVVQIIGPVIDIRFERGKLPSIYNAIKIN-SEGIDIVAEVMQYTGNDTVRCVSMNSTDGLKRGMKAVDTGEPIKVPVGKEVLGRVFNVLGEPIDGKGDVKATTYLPIHREAPGLDEQKPVTEILETGIKVIDLLAPYAKGGKIGLFGGAGVGKTVLIMELIRNIATEHGGYSVFTGVGERSREGNDLWNEMNESGVIQKTALVFGQMNEPPGSRMRVGLTGLTMAEYFRDELGQDVLLFIDNIFRFIQAGSEVSALLGRIPSAVGYQPTLATEMGALQERITSTKKGSITSVQAVYVPADDLTDPAPATTFTHLDATTVLSRHIVEQGIYPAVDPLDSTSRVLDRRIVGDEHYTVARKVQEILQRYKELQDIIAILGLDELSEEDKLIVFRARKIQRFLSQPFFVAEAYTGYKGKFVRIKDTIRGFKEIIEGKMDDIPEAAFYMAGTIDEVYE 459
>gi|166996503|ref|ZP_02262963.1| F0F1 ATP synthase subunit beta [Bacillus cereus AH820] >gi|196039564|ref|ZP_03106869.1| ATP synthase F1, beta subunit [Bacillus cereus NVH0597-99] >gi|196029724|gb|EDX68326.1| ATP synthase F1, beta subunit [Bacillus cereus NVH0597-99] (469 aa)
Score = 1587, Expect = 3.7e-174, Identities = 312/457 (68%), Positives = 367/457 (80%)
  Q:   298 DKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK----KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPID-NKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHKN 754
           +KG + QI GPVVDVKF   ++P I + L VK  N       L  EVAL  GDD  R ++M ST+GL RG EV +T   I  PVG A LGR+FNV+G+ ID +  +P  V   PIH++ P+F+E STK EI ETGIKV+DLL PY+KGGKIGLFGGAGVGKTVL+QELI+NIA  HGG+S+FAGVGERTREGNDLYHEM D GVI +TA+VFGQMNEPPGAR RVALT LTMAEHFR+   QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMGQLQERITST  GSITS+QAVYVPADD TDPAP+TTFAHLDA T L+R++  +GIYPA++PL S+SR L P IVG EHY+VAR VQ  LQ+++ELQDIIAILG+DELSEEDKL V RAR+I+ FLSQ F VAE+F+ + G YV  +DT+ GF EI+EGK DD+PE  F  VGGI++V +N
  S:     2 NKGRVTQIMGPVVDVKFDGGKLPEIYNALTVKQSNENGTSINLTFEVALHLGDDTVRTVAMSSTDGLVRGTEVEDTGKAISVPVGDATLGRVFNVLGDAIDLDGEVPADVRRDPIHRQAPAFEELSTKVEILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELINNIAQEHGGISVFAGVGERTREGNDLYHEMSDSGVIKKTAMVFGQMNEPPGARQRVALTGLTMAEHFRDEQGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTNKGSITSIQAVYVPADDYTDPAPATTFAHLDATTNLERRLTQMGIYPAVDPLASTSRALSPEIVGEEHYEVARQVQQTLQRYKELQDIIAILGMDELSEEDKLVVHRARRIQFFLSQNFHVAEQFTGQKGSYVPVKDTVRGFKEILEGKYDDLPEDAFRLVGGIEEVIEN 463
>gi|42561403|ref|NP_975854.1| F0F1 ATP synthase subunit beta [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|81829344|sp|Q6MS94|ATPB_MYCMS ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|42492901|emb|CAE77496.1| ATP SYNTHASE BETA CHAIN [Mycoplasma mycoides subsp. mycoides SC str. PG1] (475 aa)
Score = 1586, Expect = 4.5e-174, Identities = 316/456 (69%), Positives = 368/456 (80%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHKNY 755
           G + Q+ G VVDVKF+ N +P I D L V   N KKLVLEV    GD++ R I+MG TEGL RGL+VINT +PI AP G  VLGRMFNV+G+PID KP  + V+  PIHK  P ++E  T TEI ETGIKVIDL++P+ KGGK+GLFGGAGVGKT+L+QELI+NIA  H G+S+FAGVGERTREGNDLYHE I+ GV+N+T LVFGQMNEPPGARMRVALT LT+AE+FR+    DVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK+GSITSVQAVYVPADDLTDPAP+TTF HLDA+ VLDR IASLGIYPA++PL SSSR+LDP IVG EHY +A  VQ  LQK+++LQ IIAILG+DELSEEDKL V RARKIRNFLSQ FFV EKF+ + G +V   DT+  F  I++G+ D IPE YFLY   IDDV + Y
  S:    16 GKVIQVLGSVVDVKFSENSIPKIYDALIVD-NNGKKLVLEVEQNIGDEIVRTIAMGPTEGLKRGLDVINTNSPITAPTGMEVLGRMFNVLGDPIDEKPDLD-VKREPIHKDAPKYEELVTTTEILETGIKVIDLMIPFTKGGKVGLFGGAGVGKTILIQELINNIAKAHNGVSVFAGVGERTREGNDLYHEFIEAGVLNKTCLVFGQMNEPPGARMRVALTGLTIAEYFRDQKNMDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKNGSITSVQAVYVPADDLTDPAPATTFTHLDARIVLDRSIASLGIYPAVDPLASSSRVLDPEIVGQEHYDIALRVQIALQKYQDLQSIIAILGMDELSEEDKLIVQRARKIRNFLSQSFFVGEKFTGRPGVFVKVNDTVRSFKSILDGEVDYIPETYFLYSSIIDDVIEKY 469
>gi|125975091|ref|YP_001039001.1| F0F1 ATP synthase subunit beta [Clostridium thermocellum ATCC 27405] >gi|171769992|sp|A3DIM9|ATPB_CLOTH ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|125715316|gb|ABN53808.1| ATP synthase F1, beta subunit [Clostridium thermocellum ATCC 27405] (464 aa)
Score = 1585, Expect = 5.7e-174, Identities = 307/454 (67%), Positives = 359/454 (79%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHK 753
           G + QI GPV+D++F R ++P+I + +++       +V EV    G+D  RC+SM ST+GL RG++ ++T  PI  PVG  VLGR+FNV+GEPID K   +   Y PIH++ P  DEQ   TEI ETGIKVIDLL PY KGGKIGLFGGAGVGKTVL+ ELI NIAT HGG S+F GVGER+REGNDL++EM + GVI +TALVFGQMNEPPG+RMRV LT LTMAE+FR+   QDVLLFIDNIFRF QAGSEVSALLGRIPSAVGYQPTLA EMG LQERITSTK GSITSVQAVYVPADDLTDPAP+TTF HLDA TVL R I   GIYPA++PL+S+SR+LD  IVG EHY VAR VQ ILQ+++ELQDIIAILG+DELSEEDKL V RARKI+ FLSQPFFVAE ++   GK+V  +DTI GF EIIEGK DDIPE  F   G ID+V++
  S:     7 GTVVQIIGPVIDIRFERGKLPSIYNAIKIN-SEGIDIVAEVMQYTGNDTVRCVSMNSTDGLKRGMKAVDTGEPIKVPVGKEVLGRVFNVLGEPIDGKGDVKATTYLPIHREAPGLDEQKPVTEILETGIKVIDLLAPYAKGGKIGLFGGAGVGKTVLIMELIRNIATEHGGYSVFTGVGERSREGNDLWNEMNESGVIEKTALVFGQMNEPPGSRMRVGLTGLTMAEYFRDELGQDVLLFIDNIFRFIQAGSEVSALLGRIPSAVGYQPTLATEMGALQERITSTKKGSITSVQAVYVPADDLTDPAPATTFTHLDATTVLSRHIVEQGIYPAVDPLDSTSRVLDRRIVGDEHYTVARKVQEILQRYKELQDIIAILGLDELSEEDKLIVFRARKIQRFLSQPFFVAEAYTGYKGKFVRIKDTIRGFKEIIEGKMDDIPEAAFYMAGTIDEVYE 459
>gi|168142841|ref|ZP_02586070.1| F0F1 ATP synthase subunit beta [Bacillus cereus G9842] (468 aa)
Score = 1585, Expect = 6.0e-174, Identities = 311/457 (68%), Positives = 367/457 (80%)
  Q:   298 DKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK---KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPID-NKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHKN 754
           +KG + QI GPVVDVKF   ++P I + L VK  N      L  EVAL  GDD  R ++M ST+GL RG EV +T   I  PVG   LGR+FNV+G+ ID +  +P  V   PIH++ P+F+E STK EI ETGIKV+DLL PY+KGGKIGLFGGAGVGKTVL+QELI+NIA  HGG+S+FAGVGERTREGNDLYHEM D GVI +TA+VFGQMNEPPGAR RVALT LTMAEHFR+   QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMGQLQERITST  GSITS+QAVYVPADD TDPAP+TTFAHLDA T L+R++  +GIYPA++PL S+SR L P IVG EHY+VAR VQ  LQ+++ELQDIIAILG+DELSEEDKL V RAR+I+ FLSQ F VAE+F+ + G YV  ++T+SGF EI+EGK DD+PE  F  VGGI++V +N
  S:     2 NKGRVTQIMGPVVDVKFDGGKLPEIYNALTVKQSNENGSMNLTFEVALHLGDDTVRTVAMSSTDGLVRGTEVEDTGKAISVPVGDVTLGRVFNVLGDAIDLDGELPADVHRDPIHRQAPAFEELSTKVEILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELINNIAQEHGGISVFAGVGERTREGNDLYHEMSDSGVIKKTAMVFGQMNEPPGARQRVALTGLTMAEHFRDEQGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTNKGSITSIQAVYVPADDYTDPAPATTFAHLDATTNLERRLTQMGIYPAVDPLASTSRALSPEIVGEEHYEVARQVQQTLQRYKELQDIIAILGMDELSEEDKLVVHRARRIQFFLSQNFHVAEQFTGQKGSYVPVKNTVSGFKEILEGKYDDLPEDAFRLVGGIEEVIEN 462
>gi|168185932|ref|ZP_02620567.1| ATP synthase F1, beta subunit [Clostridium botulinum C str. Eklund] >gi|169295978|gb|EDS78111.1| ATP synthase F1, beta subunit [Clostridium botulinum C str. Eklund] (464 aa)
Score = 1583, Expect = 1.0e-173, Identities = 309/451 (68%), Positives = 376/451 (83%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           G + Q+ GPV+D+KF  + +PNI + +E+ +  ++ L+ EV    GDDV R I+M STEGL RG++ +NT+ PI  PVG+ +LGR+FNV+G+ ID +   +  EY PIH+  P+F+EQS + E+FETGIKVIDL+ PY KGGKIGLFGGAGVGKTVL+QELI+NIA  HGGLS+F GVGERTREGNDLY+EM + GVIN+TALVFGQMNEPPGARMRVALT LTMAE+FR+   Q+VLLFIDNIFRF+QAGSEVSALLGRIPSAVGYQPTLA EMG LQERITSTK GSITSVQAVYVPADDLTDPAP+TTFAHLDA TVL R IA LGIYPA++PLES+SR+LDP ++G EHY VA +V+ IL++++ELQDIIAILG+DELSEEDKL VSRARK++ FLSQPF VAE+F+   GK+V  ++T+ GF EIIEGK DD+PE  FL+VG I++
  S:     7 GRVVQVIGPVIDIKFDSDCLPNIYNAIEIDM-GDRILITEVEQHIGDDVVRTIAMESTEGLKRGMKAVNTEKPISVPVGNEILGRLFNVLGKTIDEEGEFKAEEYYPIHRPAPTFEEQSVEPEMFETGIKVIDLVAPYQKGGKIGLFGGAGVGKTVLIQELINNIAKEHGGLSVFTGVGERTREGNDLYYEMKESGVINKTALVFGQMNEPPGARMRVALTGLTMAEYFRDQG-QNVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGALQERITSTKHGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSRSIAELGIYPAVDPLESTSRILDPRVIGQEHYDVAINVKHILERYKELQDIIAILGVDELSEEDKLVVSRARKVQRFLSQPFTVAEQFTGMKGKFVPVKETVRGFKEIIEGKYDDVPEVAFLFVGSIEE 455
>gi|56421893|ref|YP_149211.1| F0F1 ATP synthase subunit beta [Geobacillus kaustophilus HTA426] >gi|81819603|sp|Q5KUJ3|ATPB_GEOKA ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|56381735|dbj|BAD77643.1| F0F1-type ATP synthasebeta chain [Geobacillus kaustophilus HTA426] (473 aa)
Score = 1583, Expect = 1.0e-173, Identities = 307/453 (67%), Positives = 366/453 (80%)
  Q:   299 KGIIYQIFGPVVDVKFARNQMPNINDCLEV--KLPNNKK----LVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPID-NKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           +G + Q+ GPVVDVKF    +P I + L++  K  N  +    L LEVAL  GDD  R I+M ST+GL RG+EVI+T  PI  PVG   LGR+FNV+GEPID    +P      PIH+  P F+E +T+ EI ETGIKV+DLL PY+KGGKIGLFGGAGVGKTVL+QELIHNIA  HGG+S+FAGVGERTREGNDLYHEM D GVI++TA+VFGQMNEPPGARMRVALT LTMAE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMGQLQERITST  GSITS+QA+YVPADD TDPAP+TTF+HLDA T L+RK+A +GIYPA++PL S+SR L P IVG EHY+VAR VQ  LQ+++ELQDIIAILG+DELS+EDKL V RAR+I+ FLSQ F VAE+F+ + G YV  ++T+ GF EI+EGK D +PE  F  VG I++V
  S:     3 RGRVIQVMGPVVDVKFENGHLPAIYNALKIQHKARNENEVDIDLTLEVALHLGDDTVRTIAMASTDGLIRGMEVIDTGAPISVPVGEVTLGRVFNVLGEPIDLEGDIPADARRDPIHRPAPKFEELATEVEILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELIHNIAQEHGGISVFAGVGERTREGNDLYHEMKDSGVISKTAMVFGQMNEPPGARMRVALTGLTMAEYFRDEQGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTAKGSITSIQAIYVPADDYTDPAPATTFSHLDATTNLERKLAEMGIYPAVDPLASTSRALAPEIVGEEHYQVARKVQQTLQRYKELQDIIAILGMDELSDEDKLVVHRARRIQFFLSQNFHVAEQFTGQPGSYVPVKETVRGFKEILEGKYDHLPEDAFRLVGRIEEV 462
>gi|30265328|ref|NP_847705.1| F0F1 ATP synthase subunit beta [Bacillus anthracis str. Ames] >gi|47530867|ref|YP_022216.1| F0F1 ATP synthase subunit beta [Bacillus anthracis str. 'Ames Ancestor'] >gi|49188141|ref|YP_031394.1| F0F1 ATP synthase subunit beta [Bacillus anthracis str. Sterne] >gi|49481141|ref|YP_039296.1| F0F1 ATP synthase subunit beta [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|52140257|ref|YP_086574.1| F0F1 ATP synthase subunit beta [Bacillus cereus E33L] >gi|65317282|ref|ZP_00390241.1| COG0055: F0F1-type ATP synthase, beta subunit [Bacillus anthracis str. A2012] >gi|118480344|ref|YP_897495.1| F0F1 ATP synthase subunit beta [Bacillus thuringiensis str. Al Hakam] >gi|165873338|ref|ZP_02217941.1| ATP synthase F1, beta subunit [Bacillus anthracis str. A0488] >gi|167636395|ref|ZP_02394695.1| ATP synthase F1, beta subunit [Bacillus anthracis str. A0442] >gi|167642060|ref|ZP_02400286.1| ATP synthase F1, beta subunit [Bacillus anthracis str. A0193] >gi|170689704|ref|ZP_02880881.1| ATP synthase F1, beta subunit [Bacillus anthracis str. A0465] >gi|170709426|ref|ZP_02899834.1| ATP synthase F1, beta subunit [Bacillus anthracis str. A0389] >gi|177656024|ref|ZP_02937131.1| ATP synthase F1, beta subunit [Bacillus anthracis str. A0174] >gi|196036290|ref|ZP_03103688.1| ATP synthase F1, beta subunit [Bacillus cereus W] >gi|196045693|ref|ZP_03112923.1| ATP synthase F1, beta subunit [Bacillus cereus 03BB108] >gi|166201691|sp|A0RL95|ATPB_BACAH ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|81824106|sp|Q630U3|ATPB_BACCZ ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|81828124|sp|Q6HAY0|ATPB_BACHK ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|81837543|sp|Q81JZ5|ATPB_BACAN ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|30260006|gb|AAP29191.1| ATP synthase F1, beta subunit [Bacillus anthracis str. Ames] >gi|47506015|gb|AAT34691.1| ATP synthase F1, beta subunit [Bacillus anthracis str. 'Ames Ancestor'] >gi|49182068|gb|AAT57444.1| ATP synthase F1, beta subunit [Bacillus anthracis str. Sterne] >gi|49332697|gb|AAT63343.1| ATP synthase F1, beta subunit [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|51973726|gb|AAU15276.1| ATP synthase F1, beta subunit [Bacillus cereus E33L] >gi|118419569|gb|ABK87988.1| ATP synthase F1, beta subunit [Bacillus thuringiensis str. Al Hakam] >gi|164710935|gb|EDR16509.1| ATP synthase F1, beta subunit [Bacillus anthracis str. A0488] >gi|167509978|gb|EDR85398.1| ATP synthase F1, beta subunit [Bacillus anthracis str. A0193] >gi|167528229|gb|EDR91011.1| ATP synthase F1, beta subunit [Bacillus anthracis str. A0442] >gi|170125659|gb|EDS94578.1| ATP synthase F1, beta subunit [Bacillus anthracis str. A0389] >gi|170666346|gb|EDT17132.1| ATP synthase F1, beta subunit [Bacillus anthracis str. A0465] >gi|172079879|gb|EDT64988.1| ATP synthase F1, beta subunit [Bacillus anthracis str. A0174] >gi|195991082|gb|EDX55052.1| ATP synthase F1, beta subunit [Bacillus cereus W] >gi|196023524|gb|EDX62201.1| ATP synthase F1, beta subunit [Bacillus cereus 03BB108] (469 aa)
Score = 1581, Expect = 1.5e-173, Identities = 311/457 (68%), Positives = 367/457 (80%)
  Q:   298 DKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK----KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPID-NKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHKN 754
           +KG + QI GPVVDVKF   ++P I + L VK  N       L  EVAL  GDD  R ++M ST+GL RG EV +T   I  PVG A LGR+FNV+G+ ID +  +P  V   PIH++ P+F+E STK EI ETGIKV+DLL PY+KGGKIGLFGGAGVGKTVL+QELI+NIA  HGG+S+FAGVGERTREGNDLYHEM D GVI +TA+VFGQMNEPPGAR RVALT LTMAEHFR+   QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMGQLQERITST  GSITS+QAVYVPADD TDPAP+TTFAHLDA T L+R++  +GIYPA++PL S+SR L P IVG EHY+VAR VQ  LQ+++ELQDIIAILG+DELSEEDKL V RAR+I+ FLSQ F VAE+F+ + G YV  ++T+ GF EI+EGK DD+PE  F  VGGI++V +N
  S:     2 NKGRVTQIMGPVVDVKFDGGKLPEIYNALTVKQSNENGTSINLTFEVALHLGDDTVRTVAMSSTDGLVRGTEVEDTGKAISVPVGDATLGRVFNVLGDAIDLDGEVPADVRRDPIHRQAPAFEELSTKVEILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELINNIAQEHGGISVFAGVGERTREGNDLYHEMSDSGVIKKTAMVFGQMNEPPGARQRVALTGLTMAEHFRDEQGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTNKGSITSIQAVYVPADDYTDPAPATTFAHLDATTNLERRLTQMGIYPAVDPLASTSRALSPEIVGEEHYEVARQVQQTLQRYKELQDIIAILGMDELSEEDKLVVHRARRIQFFLSQNFHVAEQFTGQKGSYVPVKETVRGFKEILEGKYDDLPEDAFRLVGGIEEVIEN 463
>gi|42784475|ref|NP_981722.1| F0F1 ATP synthase subunit beta [Bacillus cereus ATCC 10987] >gi|166984521|ref|ZP_02255862.1| F0F1 ATP synthase subunit beta [Bacillus cereus AH187] >gi|168162322|ref|ZP_02597555.1| F0F1 ATP synthase subunit beta [Bacillus cereus H3081.97] >gi|81830903|sp|Q72XE8|ATPB_BACC1 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|42740407|gb|AAS44330.1| ATP synthase F1, beta subunit [Bacillus cereus ATCC 10987] (468 aa)
Score = 1581, Expect = 1.8e-173, Identities = 311/457 (68%), Positives = 367/457 (80%)
  Q:   298 DKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK---KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPID-NKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHKN 754
           +KG + QI GPVVDVKF   ++P I + L VK  N      L  EVAL  GDD  R ++M ST+GL RG EV +T   I  PVG A LGR+FNV+G+ ID +  +P  V   PIH++ P+F+E STK EI ETGIKV+DLL PY+KGGKIGLFGGAGVGKTVL+QELI+NIA  HGG+S+FAGVGERTREGNDLYHEM D GVI +TA+VFGQMNEPPGAR RVALT LTMAE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMGQLQERITST  GSITS+QAVYVPADD TDPAP+TTFAHLDA T L+R++  +GIYPA++PL S+SR L P IVG EHY+VAR VQ  LQ+++ELQDIIAILG+DELSEEDKL V RAR+I+ FLSQ F VAE+F+ + G YV  +DT+ GF EI+EGK DD+PE  F  VGGI++V +N
  S:     2 NKGRVTQIMGPVVDVKFDGGKLPEIYNALTVKQSNENGELNLTFEVALHLGDDTVRTVAMSSTDGLVRGTEVEDTGKAISVPVGDATLGRVFNVLGDAIDLDGEVPADVRRDPIHRQAPAFEELSTKVEILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELINNIAQEHGGISVFAGVGERTREGNDLYHEMSDSGVIKKTAMVFGQMNEPPGARQRVALTGLTMAEYFRDEQGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTNKGSITSIQAVYVPADDYTDPAPATTFAHLDATTNLERRLTQMGIYPAVDPLASTSRALSPEIVGEEHYEVARQVQQTLQRYKELQDIIAILGMDELSEEDKLVVHRARRIQFFLSQNFHVAEQFTGQKGSYVPVKDTVRGFKEILEGKYDDLPEDAFRLVGGIEEVIEN 462
>gi|138896935|ref|YP_001127388.1| F0F1 ATP synthase subunit beta [Geobacillus thermodenitrificans NG80-2] >gi|196249752|ref|ZP_03148448.1| ATP synthase F1, beta subunit [Geobacillus sp. G11MC16] >gi|166201707|sp|A4ITI9|ATPB_GEOTN ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|134268448|gb|ABO68643.1| ATP synthase beta subunit [Geobacillus thermodenitrificans NG80-2] >gi|196210628|gb|EDY05391.1| ATP synthase F1, beta subunit [Geobacillus sp. G11MC16] (473 aa)
Score = 1580, Expect = 2.3e-173, Identities = 303/453 (66%), Positives = 366/453 (80%)
  Q:   299 KGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKK------LVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPID-NKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           +G + Q+ GPVVDVKF    +P I + L+++     +      L LEVAL  GDD  R I+M ST+GL RG+EV++T  PI  PVG   LGR+FNV+GEPID    +P +    PIH+  P F+E +T+ EI ETGIKV+DLL PY+KGGKIGLFGGAGVGKTVL+QELIHNIA  HGG+S+FAGVGERTREGNDLYHEM D GVI++TA+VFGQMNEPPGARMRVALT LTMAE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMGQLQERITST  GSITS+QA+YVPADD TDPAP+TTF+HLDA T L+RK+A +GIYPA++PL S+SR L P IVG EHY+VAR VQ  LQ+++ELQDIIAILG+DELS+EDKL V RAR+I+ FLSQ F VAE+F+ + G YV  ++T+ GF EI++GK D +PE  F  VG I++V
  S:     3 RGRVIQVMGPVVDVKFENGHLPAIYNALKIQHQARNENEVDIDLTLEVALHLGDDTVRTIAMASTDGLIRGMEVVDTGAPISVPVGDVTLGRVFNVLGEPIDLQDDIPAEARRDPIHRPAPKFEELATEVEILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELIHNIAQEHGGISVFAGVGERTREGNDLYHEMKDSGVISKTAMVFGQMNEPPGARMRVALTGLTMAEYFRDEQGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTSKGSITSIQAIYVPADDYTDPAPATTFSHLDATTNLERKLAEMGIYPAVDPLASTSRALAPEIVGEEHYQVARRVQQTLQRYKELQDIIAILGMDELSDEDKLVVHRARRIQFFLSQNFHVAEQFTGQPGSYVPVKETVRGFKEILDGKYDHLPEDAFRLVGRIEEV 462
>gi|172058681|ref|YP_001815141.1| ATP synthase F1, beta subunit [Exiguobacterium sibiricum 255-15] >gi|171991202|gb|ACB62124.1| ATP synthase F1, beta subunit [Exiguobacterium sibiricum 255-15] (472 aa)
Score = 1579, Expect = 3.1e-173, Identities = 307/452 (67%), Positives = 363/452 (80%)
  Q:   299 KGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK------KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           KG +  + GPV+DVKF    +PNI + L ++            L LEVAL  GDDV R I+M ST+G+ RG+EV++T  PI  PVG A LGR+FNV+G PID K +   VE  PIHKK P+FD  STK EI ETGIKV+DLL PY+KGGKIGLFGGAGVGKTVL+QELI+NIA  H G+S+FAGVGERTREGNDLYHEM D GVI QTA+VFGQMNEPPGAR+RVALT LTMAE+FR+   QDVLLF+DNIFR++QAGSEVSALLGR+PSAVGYQPTLA EMG LQERITST  GS+TS+QAVYVPADD TDPAP+TTFAHLDA T L+R+++ +GIYPA++PL S+SR L P IVG EHY VAR VQ  LQ+++ELQDIIAILG+DELSEEDKLTV RAR+I+ FLSQ F VAE+F+ + G YV  +DTI GF EI+ GK DD+ E+ F  VG I+D
  S:     7 KGRVVAVMGPVIDVKF-DGHLPNIYNALRIQYTPQTVEEVAIDLTLEVALHLGDDVVRTIAMDSTDGVRRGVEVLDTGAPISVPVGEATLGRVFNVLGNPIDEKELDASVERLPIHKKAPTFDNLSTKVEILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELINNIAQEHSGISVFAGVGERTREGNDLYHEMTDSGVIKQTAMVFGQMNEPPGARLRVALTGLTMAEYFRDEQGQDVLLFVDNIFRYTQAGSEVSALLGRMPSAVGYQPTLATEMGMLQERITSTNKGSVTSIQAVYVPADDYTDPAPATTFAHLDATTNLERRLSEMGIYPAVDPLASTSRALSPEIVGEEHYGVARQVQETLQRYKELQDIIAILGMDELSEEDKLTVHRARRIQFFLSQNFHVAEQFTGQKGSYVPVKDTIRGFKEILGGKHDDLTEEAFRLVGPIED 463
>gi|182420269|ref|ZP_02951498.1| ATP synthase F1, beta subunit [Clostridium butyricum 5521] >gi|182375864|gb|EDT73456.1| ATP synthase F1, beta subunit [Clostridium butyricum 5521] (463 aa)
Score = 1579, Expect = 3.1e-173, Identities = 307/452 (67%), Positives = 363/452 (80%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           G + Q+ GPV+D+KF  + +PN+ + + + +     LV EV    GDD+ R I+M +TEGL RG+E I+T  PI  PVG  VLGR+FNV+G PIDN    +  E  PIH+  PSF +Q+ + E+FETGIKVIDLL PY KGGK GLFGGAGVGKTVL+QELI+NIA  HGGLS+F GVGER+REGNDLYHEM D GVI++TALVFGQMNEPPGARMRVALT LTMAE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGR PSAVGYQPTLA EMG LQERITST +GSITSVQAVYVPADDLTDPAP+TTF HLDAKTVL R I  LGIYPA++PLESSSRMLDP IVG EHYKVA  V+ +L+K+++LQDIIAILG+DEL +EDK  V+RAR+I+ FLSQPF V E+F+   GKYV  ++TI GF EI+EGK DD+PE  FL+ G I+DV
  S:     6 GKVVQVIGPVIDIKFDSDSLPNLYNSIHINM-GEHTLVAEVEQHVGDDIVRAIAMEATEGLKRGMEAIDTGRPISVPVGKEVLGRLFNVLGNPIDNAGGVDAKESYPIHRPAPSFKDQAVEPEMFETGIKVIDLLAPYQKGGKTGLFGGAGVGKTVLIQELINNIAKEHGGLSVFTGVGERSREGNDLYHEMKDSGVIDKTALVFGQMNEPPGARMRVALTGLTMAEYFRDKG-QDVLLFIDNIFRFTQAGSEVSALLGRTPSAVGYQPTLATEMGALQERITSTVNGSITSVQAVYVPADDLTDPAPATTFTHLDAKTVLSRSIVELGIYPAVDPLESSSRMLDPRIVGDEHYKVATEVKNVLEKYKQLQDIIAILGVDELGDEDKAVVARARRIQRFLSQPFTVGEQFTGMPGKYVPIKETIRGFKEILEGKYDDLPESAFLFAGTIEDV 455
>gi|187603975|ref|ZP_02990186.1| ATP synthase F1, beta subunit [Exiguobacterium sp. AT1b] >gi|187484037|gb|EDU22030.1| ATP synthase F1, beta subunit [Exiguobacterium sp. AT1b] (472 aa)
Score = 1578, Expect = 3.4e-173, Identities = 304/453 (67%), Positives = 370/453 (81%)
  Q:   299 KGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPN------NKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           KG +  + GPV+DVKF  N +PNI + L+V          +  L LEVA+  GDD  R I+M ST+G+ RG+EV++  +PI  PVG A LGR+FNV+G PID+K +   V  +PIH++ P+FDE STK EI ETGIKV+DLL PY+KGGKIGLFGGAGVGKTVL+QELI+NIA  H G+S+FAGVGERTREGNDL+HEM D GVI QTA+VFGQMNEPPGAR+RVALT LTMAE+FR+   QDVLLF+DNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMG LQERITST  GS+TS+QAVYVPADD TDPAP+TTFAHLDA T L+R+++ +GIYPA++PL S+SR L P IVG EHY+VAR+VQ  LQ+++ELQDIIAILG+DELSE+DKLTV RAR+I+ FLSQ F VAE+F+ + G YV  ++T+ GF EI+EGK DD+PE  F  VG I+DV
  S:     7 KGRVVAVMGPVIDVKF-DNHLPNIYNALKVTHVAATADDVSVDLTLEVAVHLGDDTVRTIAMDSTDGVRRGMEVLDLGSPISVPVGEATLGRVFNVLGNPIDDKEVAADVLRAPIHRQAPTFDELSTKVEILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELINNIAQEHSGISVFAGVGERTREGNDLFHEMTDSGVIKQTAMVFGQMNEPPGARLRVALTGLTMAEYFRDEQGQDVLLFVDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGMLQERITSTAKGSVTSIQAVYVPADDYTDPAPATTFAHLDATTNLERRLSEMGIYPAVDPLASTSRALSPEIVGKEHYEVARNVQQTLQRYKELQDIIAILGMDELSEDDKLTVHRARRIQFFLSQNFHVAEQFTGQKGSYVPVKETVRGFKEILEGKHDDLPEDAFRLVGPIEDV 464
>gi|80091|pir||S17726 H+-transporting two-sector ATPase (EC 3.6.3.14) beta chain - Bacillus firmus (strain OF4) (469 aa)
Score = 1577, Expect = 4.5e-173, Identities = 308/454 (67%), Positives = 366/454 (80%)
  Q:   298 DKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLV-----LEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPID-NKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           + G I Q+ GPVVDVKF   Q+P IN+ L+     +K  V     LEVAL  GDD  R ++MGST+GL RG E ++T  PI  PVG A LGR+FNV+GE ID  +P+   V+  PIH++ P F+E ST TEI ETGIKV+DLL PY+KGGKIGLFGGAGVGKTVL+QELI+NIA  HG +S+FAGVGERTREGNDLYHEM D GVI +TA+VFGQMNEPPGARMRVAL+ LTMAEHFR+ + QDVLLF+DNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMG LQERITSTK GS+TS+QA+YVPADD TDPAP+TTFAHLDA T L+RK++ +GIYPA++PL S+SR L P IVG EHY VAR VQ  LQK++ELQDIIAILG+DELSEEDKL V RAR+I+ FLSQ F VAE+F+   G YV  ++TI GF E ++GK DD+PE  F  VG I++V
  S:     2 NTGHITQVMGPVVDVKFKSGQLPEINNALKSTSGADKNAVDVTVTLEVALHLGDDSVRTVAMGSTDGLVRGTEALDTGAPISVPVGEATLGRVFNVLGEAIDLGEPVAADVKRDPIHREAPKFEELSTTTEILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELINNIAQEHGVISVFAGVGERTREGNDLYHEMTDSGVIKKTAMVFGQMNEPPGARMRVALSGLTMAEHFRDRDGQDVLLFVDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGHLQERITSTKVGSVTSIQAIYVPADDYTDPAPATTFAHLDATTNLERKLSEMGIYPAVDPLASTSRALSPEIVGEEHYSVARQVQQTLQKYKELQDIIAILGMDELSEEDKLVVHRARRIQFFLSQNFHVAEQFTGHKGSYVPVKETIKGFKESLDGKYDDLPEDAFRLVGRIEEV 461
>gi|121534927|ref|ZP_01666746.1| ATP synthase F1, beta subunit [Thermosinus carboxydivorans Nor1] >gi|121306526|gb|EAX47449.1| ATP synthase F1, beta subunit [Thermosinus carboxydivorans Nor1] (469 aa)
Score = 1577, Expect = 5.6e-173, Identities = 301/453 (66%), Positives = 362/453 (79%)
  Q:   298 DKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK---KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVE-YSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           + G + Q+ GPVVD++F   Q+P I + + ++  N     KL  EV    GD   RC++M ST+GL RG+  ++T  PI  PVG   LGR+FNV+GE +DN       E Y PIH+  PSF+EQ T T I ETGIKV+DL+ PY KGGKIGLFGGAGVGKTVL+ ELI NIAT HGG S+FAGVGERTREGNDL+ EM + GVI++TALV+GQMNEPPGARMRV LT LTMAE+FR+ + QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL  ++G LQERITSTK GSITSVQAVYVPADDLTDPAP+ TFAHLDA TVL R+IA LGIYPA++PL+S+SR+LDP+I+G EHY+VAR VQ +LQ+++ELQDIIAILG++ELS+EDKLTV+RARKI+ FLSQPFFVAE F+   GKYV  ++TI GF EI+ GK DD+PE  F  VG ID+
  S:     2 NTGRVIQVIGPVVDIEFPPEQLPAIYNAIRIEGQNGDVKVKLTAEVMQHLGDSTVRCVAMSSTDGLVRGMTAVDTGAPIKVPVGKGTLGRVFNVLGETVDNDDREVIAEDYWPIHRPAPSFEEQETSTTILETGIKVVDLIAPYAKGGKIGLFGGAGVGKTVLIMELIRNIATEHGGFSVFAGVGERTREGNDLWMEMRESGVIDKTALVYGQMNEPPGARMRVGLTGLTMAEYFRDVHGQDVLLFIDNIFRFIQAGSEVSALLGRMPSAVGYQPTLGTDVGALQERITSTKKGSITSVQAVYVPADDLTDPAPAATFAHLDATTVLSRQIAELGIYPAVDPLDSTSRILDPNIIGQEHYEVARGVQEVLQRYKELQDIIAILGMEELSDEDKLTVARARKIQRFLSQPFFVAEAFTGTPGKYVPLKETIRGFKEILSGKHDDLPEAAFYMVGTIDE 458
>gi|1703680|sp|P50002|ATPB_ACEWO ATP synthase subunit beta, sodium ion specific (Na(+)-translocating ATPase subunit beta) >gi|501149|gb|AAA79908.1| F1FO ATPase beta subunit [Acetobacterium woodii] >gi|1096934|prf||2113197B Na ATPase:ISOTYPE=beta (466 aa)
Score = 1576, Expect = 6.2e-173, Identities = 301/451 (66%), Positives = 362/451 (80%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEK-VEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           G + Q+ GPVVDVKF ++++P +N+ + ++L N   LV+EVA   GDD+ RCI+M ST+GL R  E ++T + I  PVG A LGRMFNV+GEPID KP   K V   PIH+ PPSF+EQ T+ E+FETGIKV+DL+ PYV+GGKIGLFGGAGVGKTVL+QELI+NIAT HGGLS+FAGVGERTREGNDLY+EM++ GVIN+TAL FGQMNEPPGARMR+AL  LTMAE+FR++  QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMG LQERITST  GSITSVQAVY PADDLTDPAP+TTFAHLDA TVL R I   GIYPA++PL+S+SR+LDP IVG EHY+ AR VQ ILQ+++ELQDIIAILG+DELS+ DK+TVSRARK+    +    +      + G      DTI GF EI++G+ DD+PE  FL VG I+D
  S:     6 GKVVQVIGPVVDVKFQKDKLPKLNNAVNIEL-NGHTLVIEVAQQLGDDIVRCIAMDSTDGLMRNQEAVDTGSAIQVPVGKATLGRMFNVLGEPIDGKPFDTKDVVMHPIHRHPPSFEEQQTQPEMFETGIKVVDLICPYVRGGKIGLFGGAGVGKTVLIQELINNIATQHGGLSVFAGVGERTREGNDLYYEMMESGVINKTALCFGQMNEPPGARMRIALAGLTMAEYFRDDEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGALQERITSTSKGSITSVQAVYDPADDLTDPAPATTFAHLDATTVLSRAITEKGIYPAVDPLDSTSRILDPKIVGQEHYETAREVQEILQRYKELQDIIAILGMDELSDADKITVSRARKVERLFANHLMLRNSLPVRWGICKRFGDTIKGFKEILQGQHDDLPESAFLLVGTIED 456
>gi|163942993|ref|YP_001647877.1| F0F1 ATP synthase subunit beta [Bacillus weihenstephanensis KBAB4] >gi|163865190|gb|ABY46249.1| ATP synthase F1, beta subunit [Bacillus weihenstephanensis KBAB4] (469 aa)
Score = 1575, Expect = 8.9e-173, Identities = 310/457 (67%), Positives = 366/457 (80%)
  Q:   298 DKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK----KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPID-NKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHKN 754
           +KG + QI GPVVDVKF   ++P I + L VK  N       L  EVAL  GDD  R ++M ST+GL RG EV +T   I  PVG   LGR+FNV+G+ ID +  +P  V   PIH++ P+F+E STK EI ETGIKV+DLL PY+KGGKIGLFGGAGVGKTVL+QELI+NIA  HGG+S+FAGVGERTREGNDLYHEM D GVI +TA+VFGQMNEPPGAR RVALT LTMAEHFR+   QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMGQLQERITST  GSITS+QAVYVPADD TDPAP+TTFAHLDA T L+R++  +GIYPA++PL S+SR L P IVG EHY+VAR VQ  LQ+++ELQDIIAILG+DELSEEDKL V RAR+I+ FLSQ F VAE+F+ + G YV  ++T+SGF EI+EGK DD+PE  F  VG I++V +N
  S:     2 NKGRVTQIMGPVVDVKFDGGKLPEIYNALTVKQSNENGASINLTFEVALHLGDDTVRTVAMSSTDGLVRGTEVEDTGKAISVPVGDVTLGRVFNVLGDAIDLDGDVPADVRRDPIHRQAPAFEELSTKVEILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELINNIAQEHGGISVFAGVGERTREGNDLYHEMSDSGVIKKTAMVFGQMNEPPGARQRVALTGLTMAEHFRDEQGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTNKGSITSIQAVYVPADDYTDPAPATTFAHLDATTNLERRLTQMGIYPAVDPLASTSRALSPEIVGEEHYEVARQVQQTLQRYKELQDIIAILGMDELSEEDKLVVHRARRIQFFLSQNFHVAEQFTGQKGSYVPVKNTVSGFKEILEGKYDDLPEDAFRLVGSIEEVIEN 463
>gi|728922|sp|P41009|ATPB_BACCA ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|533290|dbj|BAA07248.1| ATPase subunit beta [Bacillus caldotenax] (473 aa)
Score = 1572, Expect = 1.7e-172, Identities = 305/453 (67%), Positives = 364/453 (80%)
  Q:   299 KGIIYQIFGPVVDVKFARNQMPNINDCLEV--KLPNNKK----LVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPID-NKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           +G + Q+ GPVVDVKF    +P I + L++  K  N  +    L LEVAL  GDD  R I+M ST+GL RG+EVI+T  PI  PVG   LGR+FNV+GEPID    +P      PIH+  P F+E +T+ EI ETGIKV+DLL PY+KGGKIGLFGGAGVGKTVL+QELIHNIA  HGG+S+FAGVGERTREGNDLYHEM D GVI++TA+VFGQMNEPPGARMRVALT LTMAE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMGQLQERITST  GS TS+QA+YVPADD TDPAP+TTF+HLDA T L+R +A +GIYPA++PL S+SR L P IVG EHY+VAR VQ  LQ+++ELQDIIAILG+DELS+EDKL V RAR+I+ FLSQ F VAE+F+ + G YV  ++T+ GF EI+EGK D +PE  F  VG I++V
  S:     3 RGRVIQVMGPVVDVKFENGHLPAIYNALKIQHKARNENEVDIDLTLEVALHLGDDTVRTIAMASTDGLIRGMEVIDTGAPISVPVGEVTLGRVFNVLGEPIDLEGDIPADARRDPIHRPAPKFEELATEVEILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELIHNIAQEHGGISVFAGVGERTREGNDLYHEMKDSGVISKTAMVFGQMNEPPGARMRVALTGLTMAEYFRDEQGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTAKGSTTSIQAIYVPADDYTDPAPATTFSHLDATTNLERNVAEMGIYPAVDPLASTSRALAPEIVGEEHYQVARKVQQTLQRYKELQDIIAILGMDELSDEDKLVVHRARRIQFFLSQNFHVAEQFTGQPGSYVPVKETVRGFKEILEGKYDHLPEDRFRLVGRIEEV 462
>gi|118573713|sp|Q6MAK7|ATPB_PARUW ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) (464 aa)
Score = 1572, Expect = 1.8e-172, Identities = 296/452 (65%), Positives = 366/452 (80%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKK-LVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           G + QI GP +D++F   Q+PNI + +++  P +++ L+ EVA+  GD+  RCI++ ST+GL R  + ++T+ PI  PVGS  LGR+ NV+G+PID     E  E SPIHK  P+F+EQ T+  IFETGIKVIDLL PY KGGK+GLFGGAGVGK+V+V ELIHNIAT HGG S+F G+GERTREGNDL+ EM + G++++T+LVFGQMNEPPGARMRV LT LTMAEHFR+   Q+VLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTLA E+G LQERITSTK GSITSVQA+YVPADD TDPAP++ F HLDA T L R+IA LGIYPA++PL SSSR+LDP ++G EHY+VAR VQ +LQ++++LQDIIAILGIDELSEED+LTVSRAR+I+ FLSQPFFVAE F+ K G++V   DTI GF  I+EG+ D+IPEQ F  VG I++V
  S:     4 GKVKQIVGPTLDIEFPPGQLPNILNAIKIIDPKDQRELIAEVAMHLGDNQVRCIALSSTDGLVREAQAVDTEAPISIPVGSPTLGRLLNVLGQPIDEMGAIENAEISPIHKASPTFEEQDTQGVIFETGIKVIDLLCPYTKGGKVGLFGGAGVGKSVIVMELIHNIATHHGGYSVFCGIGERTREGNDLWLEMKESGILSKTSLVFGQMNEPPGARMRVGLTGLTMAEHFRDQEHQNVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLASEIGSLQERITSTKHGSITSVQAIYVPADDYTDPAPASIFPHLDAATTLSRQIAELGIYPAVDPLNSSSRILDPHVLGEEHYQVARQVQKVLQRYKDLQDIIAILGIDELSEEDQLTVSRARRIQKFLSQPFFVAETFTGKKGRFVKLPDTIKGFKMIVEGEMDNIPEQAFYMVGTIEEV 456
>gi|169335794|ref|ZP_02862987.1| hypothetical protein ANASTE_02219 [Anaerofustis stercorihominis DSM 17244] >gi|169258532|gb|EDS72498.1| hypothetical protein ANASTE_02219 [Anaerofustis stercorihominis DSM 17244] (470 aa)
Score = 1572, Expect = 2.1e-172, Identities = 313/456 (68%), Positives = 378/456 (82%)
  Q:   295 LKSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMP-EKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           +++ KG I Q+ GPVVDVKFA N +P +N+ +++   + ++L++EV+   GD+  RCI+M +T+GL RG+E ++T +PIM PVG   LGRM NV+G+PID K M    V+ SPIH++ PSF+E  T  EIFETGIKV+DL+ PY KGGKIGLFGGAGVGKTVL+QELI NIAT HGGLS+FAGVGERTREGNDLY+EM + GV+++T+L FGQMNEPPGARMRVALT LTMAEHFR+   QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMG LQERITSTKSGSITSVQAVYVPADDLTDPAP+TTFAHLDA TVLDR I+  GIYPA++PL S+SR+LDP +VG EHY++AR VQ ILQ+++ELQDIIAILG++ELSEEDKL V RAR+I  FLSQPF VAE+F+   G YV   +T+ GF EI++GK DD+PE  FL VG IDD
  S:     1 MENKKGKIVQVVGPVVDVKFAENDLPKLNEAIKID-NHGEELIIEVSEHIGDNTVRCIAMDTTDGLVRGMEAVSTGSPIMVPVGDKTLGRMVNVLGQPIDGKEMDLSDVKLSPIHREAPSFEEMQTVPEIFETGIKVVDLICPYTKGGKIGLFGGAGVGKTVLIQELISNIATEHGGLSVFAGVGERTREGNDLYYEMKESGVLDKTSLCFGQMNEPPGARMRVALTGLTMAEHFRDEENQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGALQERITSTKSGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLDRAISEKGIYPAVDPLGSTSRILDPKVVGEEHYQIARGVQEILQRYKELQDIIAILGMEELSEEDKLIVGRARRIERFLSQPFHVAEQFTGLKGAYVPISETLRGFKEILQGKHDDLPEAAFLLVGTIDD 456
>gi|21675043|ref|NP_663108.1| F0F1 ATP synthase subunit beta [Chlorobium tepidum TLS] >gi|25452812|sp|Q8KAC9|ATPB2_CHLTE ATP synthase subunit beta 2 (ATPase subunit beta 2) (ATP synthase F1 sector subunit beta 2) >gi|21648279|gb|AAM73450.1| ATP synthase F1, beta subunit [Chlorobium tepidum TLS] (462 aa)
Score = 1571, Expect = 2.5e-172, Identities = 303/452 (67%), Positives = 367/452 (81%)
  Q:   299 KGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNK-PMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           +G I QI GPVVDV F   Q+P+I D L V   +  KLVLE     G++  R I+M  T+GL RG+  +NT  PI  PVG  VLGRM NVVG+PID K P+P K  YS IH+  P FDE STKTE+FETGIKVIDLL PY +GGK GLFGGAGVGKTVL+ ELI+NIA    G S+FAGVGERTREGNDL+HEM++ GVI++TALVFGQMNEPPGAR RVALT L++AE+FRE   +DVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTL+ EMG+LQ+RITSTK GS+TSVQA+YVPADDLTDPAP+T F HLDA TVL R+IA LGIYPA++PL+S+SR+LDP+IVG +HY  A++V+ ILQ++++LQDIIAILG+DELS+EDKL V+RARK++ FLSQPFFVAE F+  +GKYV  +DTI GF EII+G+ D++PE  F  VG I++
  S:     3 EGKISQIIGPVVDVDFPEGQLPSILDALTVTRQDGSKLVLETQQHLGEERVRTIAMEGTDGLVRGMSAVNTGKPIQVPVGGEVLGRMLNVVGDPIDGKGPVPAKKTYS-IHRAAPKFDELSTKTEMFETGIKVIDLLEPYSRGGKTGLFGGAGVGKTVLIMELINNIAKQQSGYSVFAGVGERTREGNDLWHEMMESGVIDKTALVFGQMNEPPGARARVALTGLSIAEYFREEEGRDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLSTEMGELQDRITSTKKGSVTSVQAIYVPADDLTDPAPATAFTHLDATTVLSRQIAELGIYPAVDPLDSTSRILDPNIVGDDHYNTAQAVKQILQRYKDLQDIIAILGMDELSDEDKLVVARARKVQRFLSQPFFVAEAFTGLAGKYVKLEDTIKGFKEIIDGRHDNLPEAAFYLVGTIEE 454
>gi|187935792|ref|YP_001884711.1| ATP synthase F1, beta subunit [Clostridium botulinum B str. Eklund 17B] >gi|187723945|gb|ACD25166.1| ATP synthase F1, beta subunit [Clostridium botulinum B str. Eklund 17B] (463 aa)
Score = 1571, Expect = 2.7e-172, Identities = 303/451 (67%), Positives = 369/451 (81%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           G + Q+ GPVVD+KF  + +PN+ + + + +   + L+ EV    GDD+ R I+M +TEGL RG++ ++T+  I  PVG  VLGR+FNV+G+PIDN    E  E  PIH+  PSF +Q+ + E+FETGIKVIDLL PY +GGKIGLFGGAGVGKTVL+QELI+NIA  HGGLS+F GVGER+REGNDLYHEM + GVI++TALVFGQMNEPPGARMRVALT LTMAE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGRIPSAVGYQPTLA EMG LQERITSTK+GSITSVQAVYVPADDLTDPAP+TTF+HLDA TVL R I  LGIYPA++PLESSSR+LDP +VG EHY VA  V+ IL++++ELQDIIAILG+DELS+EDK  VSRARK++ FLSQPF V E+F+   GKYVS ++TI GF EI+EGK DD+PE  FL++G +++
  S:     6 GKVVQVIGPVVDIKFDSDSLPNLYNAISIDM-GERTLIAEVEQHVGDDIVRTIAMEATEGLKRGMDAVDTEKAISVPVGDQVLGRLFNVLGKPIDNAGEVEAEEIYPIHRPAPSFKDQAVEPEMFETGIKVIDLLAPYQRGGKIGLFGGAGVGKTVLIQELINNIAKEHGGLSVFTGVGERSREGNDLYHEMRESGVIDKTALVFGQMNEPPGARMRVALTGLTMAEYFRDKG-QDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGALQERITSTKNGSITSVQAVYVPADDLTDPAPATTFSHLDATTVLSRSIVELGIYPAVDPLESSSRILDPRLVGEEHYNVATKVKNILERYKELQDIIAILGVDELSDEDKAVVSRARKVQRFLSQPFTVGEQFTGMPGKYVSVKETIKGFKEILEGKYDDLPESAFLFIGSVEE 454
>gi|154687796|ref|YP_001422957.1| F0F1 ATP synthase subunit beta [Bacillus amyloliquefaciens FZB42] >gi|166201690|sp|A7Z9Q0|ATPB_BACA2 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|154353647|gb|ABS75726.1| AtpD [Bacillus amyloliquefaciens FZB42] (473 aa)
Score = 1571, Expect = 2.8e-172, Identities = 302/456 (66%), Positives = 365/456 (80%)
  Q:   299 KGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKK------LVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPID-NKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHKN 754
           KG + Q+ GPVVDV+F    +P I + ++V  P   +      L LEVAL  GDD  R I+M ST+G+ RG+E ++T  PI  PVG   LGR+FNV+G+ ID N+P+P   +  PIH+  PSFDE ST+ EI ETGIKV+DLL PY+KGGKIGLFGGAGVGKTVL+QELI+NIA  HGG+S+FAGVGERTREGNDL++EM D GVI +TA+VFGQMNEPPGARMRVALT LTMAEHFR+   QDVL FIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMGQLQERITST  GS+TS+QA+YVPADD TDPAP+TTFAHLDA T L+RK+  +GIYPA++PL S+SR L P IVG EHY VAR VQ+ LQ+++ELQDIIAILG+DEL EEDKL V RAR+I+ FLSQ F VAE+F+ + G YV  ++T+ GF EI+ GK D +PE  F  VG I++V +N
  S:     3 KGRVSQVLGPVVDVRFEDGHLPAIYNAIKVSQPATGENEVGIDLTLEVALHLGDDTVRTIAMASTDGIQRGMEAVDTGAPISVPVGDVTLGRVFNVLGDKIDLNEPLPADAQKDPIHRSAPSFDELSTEVEILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELINNIAQEHGGISVFAGVGERTREGNDLFYEMSDSGVIKKTAMVFGQMNEPPGARMRVALTGLTMAEHFRDKQGQDVLFFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTNVGSVTSIQAIYVPADDYTDPAPATTFAHLDATTNLERKLTEMGIYPAVDPLASTSRALAPEIVGEEHYAVAREVQSTLQRYKELQDIIAILGMDELGEEDKLVVHRARRIQFFLSQNFHVAEQFTGQKGSYVPVKETVRGFKEILSGKYDHLPEDAFRLVGRIEEVIEN 465
>gi|188587434|ref|YP_001918979.1| ATP synthase F1, beta subunit [Natranaerobius thermophilus JW/NM-WN-LF] >gi|179352121|gb|ACB86391.1| ATP synthase F1, beta subunit [Natranaerobius thermophilus JW/NM-WN-LF] (475 aa)
Score = 1570, Expect = 2.9e-172, Identities = 300/451 (66%), Positives = 368/451 (81%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKK--------------LVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           G + QI GP VD++F + ++P + + +++K   N +              + LEVA   GD+V RCI+MGST+G+ RG+E  +T  PI  PVG + LGR+FN+ G+ ID +   E  +Y PIH+  P F++Q T TEI ETGIKV+DLLVPY +GGKIGLFGGAGVGKTVL+QELI NIA  HGG S+F+GVGERTREGNDL  EM + GVI++TALVFGQMNEPPGARMRV LT LTMAE+FR+N  QDVLLFIDNIFRF+QAG EVSAL+GR+PSAVGYQPTL  EMG+LQERITSTK GS+TS+QA+YVPADD TDPAP+TTFAHLDA T L+R IA +GIYPA++PL SSSR+LDP IVG EHY VAR VQ +LQ+++ELQDIIAILG+DELS+EDKLTVSRARKI+ FLSQPFFVAE+F++  GKYV  ++T+ GF EI++GK DD+PE  F  VG ID+
  S:     4 GKVQQIIGPAVDIRFEKGKLPELYNAIDIKAGLNDRGEPVSHEEGSRKIEVTLEVAQHLGDEVVRCIAMGSTDGIVRGMEAYDTGQPITVPVGRSTLGRVFNITGDTIDGQGEVEGEDYYPIHRDSPKFEDQETSTEILETGIKVLDLLVPYARGGKIGLFGGAGVGKTVLIQELIRNIAYEHGGFSVFSGVGERTREGNDLVLEMSESGVIDKTALVFGQMNEPPGARMRVGLTGLTMAEYFRDNEGQDVLLFIDNIFRFTQAGQEVSALMGRMPSAVGYQPTLQTEMGELQERITSTKKGSVTSIQAIYVPADDPTDPAPATTFAHLDASTYLERSIAEMGIYPAVDPLVSSSRILDPQIVGQEHYDVARGVQQVLQRYKELQDIIAILGMDELSDEDKLTVSRARKIQRFLSQPFFVAEQFTNMPGKYVPVKETVRGFREILDGKHDDLPETAFYMVGTIDE 468
>gi|188589828|ref|YP_001919898.1| ATP synthase F1, beta subunit [Clostridium botulinum E3 str. Alaska E43] >gi|188500109|gb|ACD53245.1| ATP synthase F1, beta subunit [Clostridium botulinum E3 str. Alaska E43] (463 aa)
Score = 1570, Expect = 3.0e-172, Identities = 303/451 (67%), Positives = 369/451 (81%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           G + Q+ GPVVD+KF  + +PN+ + + + +   + L+ EV    GDD+ R I+M +TEGL RG++ ++T+  I  PVG  VLGR+FNV+G+PIDN    E  E  PIH+  PSF +Q+ + E+FETGIKVIDLL PY +GGKIGLFGGAGVGKTVL+QELI+NIA  HGGLS+F GVGER+REGNDLYHEM + GVI++TALVFGQMNEPPGARMRVALT LTMAE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGRIPSAVGYQPTLA EMG LQERITSTK+GSITSVQAVYVPADDLTDPAP+TTF+HLDA TVL R I  LGIYPA++PLESSSR+LDP +VG EHY VA  V+ IL++++ELQDIIAILG+DELS+EDK  VSRARK++ FLSQPF V E+F+   GKYVS ++TI GF EI+EGK DD+PE  FL++G +++
  S:     6 GKVVQVIGPVVDIKFDSDSLPNLYNAISIDM-GERTLIAEVEQHVGDDIVRTIAMEATEGLKRGMDAVDTEKAISVPVGDKVLGRLFNVLGKPIDNAGEVEAEEIYPIHRPAPSFKDQAVEPEMFETGIKVIDLLAPYQRGGKIGLFGGAGVGKTVLIQELINNIAKEHGGLSVFTGVGERSREGNDLYHEMRESGVIDKTALVFGQMNEPPGARMRVALTGLTMAEYFRDKG-QDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGALQERITSTKNGSITSVQAVYVPADDLTDPAPATTFSHLDATTVLSRSIVELGIYPAVDPLESSSRILDPRLVGEEHYNVATKVKNILERYKELQDIIAILGVDELSDEDKAVVSRARKVQRFLSQPFTVGEQFTGMPGKYVSVKETIKGFKEILEGKYDDLPESAFLFIGSVEE 454
>gi|19114063|ref|NP_593151.1| F1-ATPase beta subunit (PMID 6228552) [Schizosaccharomyces pombe 972h-] >gi|114565|sp|P22068|ATPB_SCHPO ATP synthase subunit beta, mitochondrial precursor >gi|6433997|emb|CAB60704.1| F1-ATPase beta subunit (PMID 6228552) [Schizosaccharomyces pombe] (525 aa)
Score = 1570, Expect = 3.3e-172, Identities = 318/487 (65%), Positives = 381/487 (78%)
  Q:   267 IKTNKSIVSDSHKIDIYEENEDLMKLNTL--------KSDKGIIYQIFGPVVDVKFA-RNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVI-----NQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHK 753
           + T +S V  S+K+   +   +  K NT+        K +KG I Q+ G VVD +F   + +P+I + LEVKLP+NK+LVLEVA   G++  R I+M  TEGL RG  VI+T +PI  PVG   LGR+ NV+GEP+D +   + V+YSPIH   PSF+EQST  EI ETGIKV+DLL PY +GGKIGLFGGAGVGKTV +QELI+NIA  HGG S+F GVGERTREGNDLY EM + GVI     ++ ALVFGQMNEPPGAR RVALT LT+AE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGRIPSAVGYQPTLA +MG +QERIT+TK GSITSVQAVYVPADDLTDPAP+TTFAHLDA TVL R I+ LGIYPA++PL+S SRM+DP I+G EHY +A SVQ +LQ+++ LQDIIAILG+DELSE DKLTV RARK++ FLSQPF VAE F+   G+ VS +DTI  F EI+EGK D +PE  F  VG IDD  K
  S:    15 LATKQSFVKTSYKLP-RKSWLNTAKFNTIRYASTEAAKHNKGSIKQVIGAVVDCQFEDADSLPSILNALEVKLPDNKRLVLEVAQHVGENTVRTIAMDGTEGLVRGTAVIDTGSPISIPVGPGTLGRIMNVIGEPVDERGPIKAVKYSPIHADAPSFEEQSTTPEILETGIKVVDLLAPYARGGKIGLFGGAGVGKTVFIQELINNIAKAHGGYSVFTGVGERTREGNDLYREMQETGVIKLEGESKAALVFGQMNEPPGARARVALTGLTVAEYFRDIEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGAMQERITTTKKGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSRSISELGIYPAVDPLDSKSRMMDPRILGEEHYNLAGSVQQMLQEYKSLQDIIAILGMDELSEADKLTVERARKVQRFLSQPFAVAEVFTGIEGRLVSLKDTIRSFKEILEGKHDSLPESAFYMVGSIDDAVK 514
>gi|114571|sp|P07677|ATPB_BACP3 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|77453|pir||A25504 H+-transporting two-sector ATPase (EC 3.6.3.14) beta chain - thermophilic bacterium PS-3 >gi|2981977|pdb|1SKY|E Chain E, Crystal Structure Of The Nucleotide Free Alpha3beta3 Sub- Complex Of F1-Atpase From The Thermophilic Bacillus Ps3 >gi|45804|emb|CAA28277.1| unnamed protein product [Bacillus sp. PS3] >gi|45817|emb|CAA30655.1| unnamed protein product [Bacillus sp. PS3] >gi|217147|dbj|BAA00066.1| thermophilic proton ATPase beta subunit [Bacillus sp. PS3] (473 aa)
Score = 1569, Expect = 4.1e-172, Identities = 304/453 (67%), Positives = 365/453 (80%)
  Q:   299 KGIIYQIFGPVVDVKFARNQMPNINDCLEV--KLPNNKK----LVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPID-NKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           +G + Q+ GPVVDVKF    +P I + L++  K  N  +    L LEVAL  GDD  R I+M ST+GL RG+EVI+T  PI  PVG   LGR+FNV+GEPID    +P      PIH+  P F+E +T+ EI ETGIKV+DLL PY+KGGKIGLFGGAGVGKTVL+QELIHNIA  HGG+S+FAGVGERTREGNDLYHEM D GVI++TA+VFGQMNEPPGARMRVALT LTMAE+FR+   QD LLFIDNIFRF+QAGSEVSALLGR+PSA+GYQPTLA EMGQLQERITST  GSITS+QA+YVPADD TDPAP+TTF+HLDA T L+RK+A +GIYPA++PL S+SR L P IVG EHY+VAR VQ  L++++ELQDIIAILG+DELS+EDKL V RAR+I+ FLSQ F VAE+F+ + G YV  ++T+ GF EI+EGK D +PE  F  VG I++V
  S:     3 RGRVIQVMGPVVDVKFENGHLPAIYNALKIQHKARNENEVDIDLTLEVALHLGDDTVRTIAMASTDGLIRGMEVIDTGAPISVPVGQVTLGRVFNVLGEPIDLEGDIPADARRDPIHRPAPKFEELATEVEILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELIHNIAQEHGGISVFAGVGERTREGNDLYHEMKDSGVISKTAMVFGQMNEPPGARMRVALTGLTMAEYFRDEQGQDGLLFIDNIFRFTQAGSEVSALLGRMPSAIGYQPTLATEMGQLQERITSTAKGSITSIQAIYVPADDYTDPAPATTFSHLDATTNLERKLAEMGIYPAVDPLVSTSRALAPEIVGEEHYQVARKVQQTLERYKELQDIIAILGMDELSDEDKLVVHRARRIQFFLSQNFHVAEQFTGQPGSYVPVKETVRGFKEILEGKYDHLPEDRFRLVGRIEEV 462
>gi|23100430|ref|NP_693897.1| F0F1 ATP synthase subunit beta [Oceanobacillus iheyensis HTE831] >gi|81845990|sp|Q8EM83|ATPB_OCEIH ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|22778663|dbj|BAC14931.1| H(+)-transporting ATP synthase beta chain [Oceanobacillus iheyensis HTE831] (464 aa)
Score = 1568, Expect = 5.5e-172, Identities = 305/453 (67%), Positives = 368/453 (81%)
  Q:   299 KGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPID-NKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           KG + Q+ GPVVDV+F   ++P +N+ L V+  + ++L LEVAL  GD+  R I+M ST+G  RG EV N   PI  PVG   LGR+FNV+GE ID ++P+ E V   PIH++ P F+  ST+TEI ETGIKV+DLL PY+KGGKIGLFGGAGVGKTVL+QELI+NIA  HGG+S+FAGVGERTREGNDLY+EM D GVI +TA+VFGQMNEPPGARMRVALT LTMAE+FR+   QDVLLF+DNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMGQLQERITST  GS+TS+QA+YVPADD TDPAP+TTFAHLDA T LDRK++  GIYPA++PLES+SR LDP +VG EHY+VA  VQ  LQK+ ELQDIIAILG+DELS+EDKL V+RAR+I+ FLSQ F VAE+F+ + G YV  Q+T+ GF EI+EGK DD+PE  F  VG I++V
  S:     3 KGRVTQLMGPVVDVRFEDAELPAVNNALVVRSDSGEELTLEVALHLGDNSVRTIAMSSTDGFKRGAEVENLGRPISVPVGDVTLGRVFNVLGEKIDLDEPLEEGVRRDPIHREAPDFENLSTETEILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELINNIAQEHGGISVFAGVGERTREGNDLYYEMSDSGVIAKTAMVFGQMNEPPGARMRVALTGLTMAEYFRDEQGQDVLLFVDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTDKGSVTSIQAIYVPADDYTDPAPATTFAHLDATTNLDRKLSEQGIYPAVDPLESTSRALDPEVVGKEHYEVATEVQQTLQKYRELQDIIAILGMDELSDEDKLVVARARRIQFFLSQNFHVAEQFTGQPGSYVPVQETVKGFKEILEGKYDDLPEDAFRLVGRIEEV 456
>gi|16080734|ref|NP_391562.1| F0F1 ATP synthase subunit beta [Bacillus subtilis subsp. subtilis str. 168] >gi|584808|sp|P37809|ATPB_BACSU ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) (Vegetative protein 31) (VEG31) >gi|433991|emb|CAA82260.1| ATP synthase subunit beta [Bacillus subtilis] >gi|2636206|emb|CAB15698.1| ATP synthase (subunit beta) [Bacillus subtilis subsp. subtilis str. 168] (473 aa)
Score = 1567, Expect = 6.6e-172, Identities = 301/453 (66%), Positives = 365/453 (80%)
  Q:   299 KGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKK------LVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPID-NKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           KG + Q+ GPVVDV+F    +P I + +++  P   +      L LEVAL  GDD  R I+M ST+G+ RG+E ++T  PI  PVG   LGR+FNV+GE ID N+P+P   +  PIH++ PSFD+ ST+ EI ETGIKV+DLL PY+KGGKIGLFGGAGVGKTVL+QELI+NIA  HGG+S+FAGVGERTREGNDL++EM D GVIN+TA+VFGQMNEPPGARMRVALT LTMAEHFR+   QDVL FIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMGQLQERITST  GS+TS+QA+YVPADD TDPAP+TTFAHLDA T L+RK+  +GIYPA++PL S+SR L P IVG EHY VAR VQ+ LQ+++ELQDIIAILG+DEL EEDKL V RAR+I+ FLSQ F VAE+F+ + G YV  ++T+ GF EI+ GK D +PE  F  VG I++V
  S:     3 KGRVSQVLGPVVDVRFEDGHLPEIYNAIKISQPAASENEVGIDLTLEVALHLGDDTVRTIAMASTDGVQRGMEAVDTGAPISVPVGDVTLGRVFNVLGENIDLNEPVPADAKKDPIHRQAPSFDQLSTEVEILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELINNIAQEHGGISVFAGVGERTREGNDLFYEMSDSGVINKTAMVFGQMNEPPGARMRVALTGLTMAEHFRDVQGQDVLFFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTNVGSVTSIQAIYVPADDYTDPAPATTFAHLDATTNLERKLTEMGIYPAVDPLASTSRALAPEIVGEEHYAVAREVQSTLQRYKELQDIIAILGMDELGEEDKLVVHRARRIQFFLSQNFHVAEQFTGQKGSYVPVKETVQGFKEILAGKYDHLPEDAFRLVGRIEEV 462
>gi|89095631|ref|ZP_01168525.1| F0F1 ATP synthase subunit beta [Bacillus sp. NRRL B-14911] >gi|89089377|gb|EAR68484.1| F0F1 ATP synthase subunit beta [Bacillus sp. NRRL B-14911] (473 aa)
Score = 1567, Expect = 6.8e-172, Identities = 302/457 (66%), Positives = 365/457 (79%)
  Q:   298 DKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKK------LVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKP-MPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHKN 754
           +KG + QI GPVVDVKF   ++P I + L + +P   +      L LEVAL  GDD  R I+M ST+GL RG EVI+T  PI  PVG   LGR+FNV+GE ID  P +   +    IH++ P F++ ST+ EI ETGIKV+DLL PY+KGGKIGLFGGAGVGKTVL+QELI+NIA  HGG+S+FAGVGERTREGNDLYHEM D GVI +TA+VFGQMNEPPGARMRVALT LTMAE FR++  QDVL F+DNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMG+LQERITST  GS+TS+QA+YVPADD TDPAP+TTFAHLDA T L+RK++ +GIYPA++PL S+SR L P IVG EHY VAR VQ+ LQ++ ELQDIIAILG+DELS+EDKL V RAR+I+ +LSQ F VAE+F+ + G YV  ++T+ GF EI+EGK D +PE  F  VG I+DV +N
  S:     2 NKGRVLQIMGPVVDVKFDSGELPQIYNALTISVPARNESEVAISLTLEVALHLGDDTVRTIAMASTDGLTRGAEVIDTGAPISVPVGDITLGRVFNVLGETIDLDPALQAGIRRDSIHREAPKFEQLSTEVEILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELINNIAQEHGGISVFAGVGERTREGNDLYHEMTDSGVIKKTAMVFGQMNEPPGARMRVALTGLTMAEFFRDDQGQDVLFFMDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGRLQERITSTNVGSVTSIQAIYVPADDYTDPAPATTFAHLDATTNLERKLSEMGIYPAVDPLASTSRALSPEIVGEEHYSVARQVQSTLQRYRELQDIIAILGMDELSDEDKLVVHRARRIQFYLSQNFHVAEQFTGQKGSYVPVKETVKGFKEILEGKYDHLPEDAFRLVGTIEDVLEN 465
>gi|356768|prf||1211283A ATPase beta F1 (473 aa)
Score = 1566, Expect = 8.5e-172, Identities = 304/453 (67%), Positives = 365/453 (80%)
  Q:   299 KGIIYQIFGPVVDVKFARNQMPNINDCLEV--KLPNNKK----LVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPID-NKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           +G + Q+ GPVVDVKF    +P I + L++  K  N  +    L LEVAL  GDD  R I+M ST+GL RG+EVI+T  PI  PVG   LGR+FNV+GEPID    +P      PIH+  P F+E +T+ EI ETGIKV+DLL PY+KGGKIGLFGGAG GKTVL+QELIHNIA  HGG+S+FAGVGERTREGNDLYHEM D GVI++TA+VFGQMNEPPGARMRVALT LTMAE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGR+PSA+GYQPTLA EMGQLQERITST  GSITS+QA+YVPADD TDPAP+TTF+HLDA T L+RK+A +GIYPA++PL S+SR L P IVG EHY+VAR VQ  L++++ELQDIIAILG+DELS+EDKL V RAR+I+ FLSQ F VAE+F+ + G YV  ++T+ GF EI+EGK D +PE  F  VG I++V
  S:     3 RGRVIQVMGPVVDVKFENGHLPAIYNALKIQHKARNENEVDIDLTLEVALHLGDDTVRTIAMASTDGLIRGMEVIDTGAPISVPVGQVTLGRVFNVLGEPIDLEGDIPADARRDPIHRPAPKFEELATEVEILETGIKVVDLLAPYIKGGKIGLFGGAGDGKTVLIQELIHNIAQEHGGISVFAGVGERTREGNDLYHEMKDSGVISKTAMVFGQMNEPPGARMRVALTGLTMAEYFRDEQGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAIGYQPTLATEMGQLQERITSTAKGSITSIQAIYVPADDYTDPAPATTFSHLDATTNLERKLAEMGIYPAVDPLVSTSRALAPEIVGEEHYQVARKVQQTLERYKELQDIIAILGMDELSDEDKLVVHRARRIQFFLSQNFHVAEQFTGQPGSYVPVKETVRGFKEILEGKYDHLPEDRFRLVGRIEEV 462
>gi|46447302|ref|YP_008667.1| F0F1 ATP synthase subunit beta [Candidatus Protochlamydia amoebophila UWE25] >gi|46400943|emb|CAF24392.1| probable H+-transporting two-sector ATPase (beta chain, atpD) [Candidatus Protochlamydia amoebophila UWE25] (486 aa)
Score = 1566, Expect = 9.8e-172, Identities = 302/463 (65%), Positives = 373/463 (80%)
  Q:   289 LMKLNTLKSDK--------GIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKK-LVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           L KLN   S+K        G + QI GP +D++F   Q+PNI + +++  P +++ L+ EVA+  GD+  RCI++ ST+GL R  + ++T+ PI  PVGS  LGR+ NV+G+PID     E  E SPIHK  P+F+EQ T+  IFETGIKVIDLL PY KGGK+GLFGGAGVGK+V+V ELIHNIAT HGG S+F G+GERTREGNDL+ EM + G++++T+LVFGQMNEPPGARMRV LT LTMAEHFR+   Q+VLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTLA E+G LQERITSTK GSITSVQA+YVPADD TDPAP++ F HLDA T L R+IA LGIYPA++PL SSSR+LDP ++G EHY+VAR VQ +LQ++++LQDIIAILGIDELSEED+LTVSRAR+I+ FLSQPFFVAE F+ K G++V   DTI GF  I+EG+ D+IPEQ F  VG I++V
  S:     7 LKKLNRKGSNKNKRQMMAVGKVKQIVGPTLDIEFPPGQLPNILNAIKIIDPKDQRELIAEVAMHLGDNQVRCIALSSTDGLVREAQAVDTEAPISIPVGSPTLGRLLNVLGQPIDEMGAIENAEISPIHKASPTFEEQDTQGVIFETGIKVIDLLCPYTKGGKVGLFGGAGVGKSVIVMELIHNIATHHGGYSVFCGIGERTREGNDLWLEMKESGILSKTSLVFGQMNEPPGARMRVGLTGLTMAEHFRDQEHQNVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLASEIGSLQERITSTKHGSITSVQAIYVPADDYTDPAPASIFPHLDAATTLSRQIAELGIYPAVDPLNSSSRILDPHVLGEEHYQVARQVQKVLQRYKDLQDIIAILGIDELSEEDQLTVSRARRIQKFLSQPFFVAETFTGKKGRFVKLPDTIKGFKMIVEGEMDNIPEQAFYMVGTIEEV 478
>gi|72080395|ref|YP_287453.1| F0F1 ATP synthase subunit beta [Mycoplasma hyopneumoniae 7448] >gi|118573699|sp|Q4A8V9|ATPB_MYCH7 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|71913519|gb|AAZ53430.1| ATP synthase beta chain [Mycoplasma hyopneumoniae 7448] (471 aa)
Score = 1566, Expect = 1.1e-171, Identities = 308/454 (67%), Positives = 372/454 (81%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDN-KPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGID 749
           + + G I QIFGPV+DV+F    MP I   LEVK+ N++ ++ EVA   G+ + R I+M  T  L +GLEV +T + I  PVG  VL RMFNV+G+PID  KP+   ++ +PIH K P++ EQ   +EI  TGIKVIDLL+P++KGGKIGLFGGAGVGKTVLVQELI+NIA+ HGGLS+FAGVGER+REGNDLY EM   GV+++TALVFGQMNEPPGARMRVAL+ALTMAE+FR+   QDVLLFIDNIFRF+QAGSEVS LLGRIPS VGYQPTL+ EMGQLQERITST  GSITSVQAVYVPADD+TDPAP+TTF+HLDAKTVLDR IA+LGIYPA++PL SSSR L+P+IVG +HY VA+ V  ILQ+F+ELQDIIAILG+DELSE DK  V+RAR+IRNFLSQPFFVA+KFS   G+++  QDT++ F E++ GK D+IPE+ FLYVG ID
  S:     4 QENVGHIVQIFGPVIDVQFPNEHMPAILSALEVKI-NDESIIFEVAQHLGEGIVRAIAMSMTYNLSKGLEVYDTGSQISVPVGKQVLSRMFNVLGQPIDGGKPLDSFIK-NPIHAKAPTYLEQKATSEILVTGIKVIDLLIPFIKGGKIGLFGGAGVGKTVLVQELINNIASKHGGLSVFAGVGERSREGNDLYFEMKKAGVLDKTALVFGQMNEPPGARMRVALSALTMAEYFRDYENQDVLLFIDNIFRFTQAGSEVSTLLGRIPSTVGYQPTLSTEMGQLQERITSTIRGSITSVQAVYVPADDITDPAPATTFSHLDAKTVLDRGIAALGIYPAVDPLASSSRALEPNIVGKKHYLVAKKVVQILQRFKELQDIIAILGVDELSESDKQVVARARRIRNFLSQPFFVAQKFSGIQGQFIKIQDTVNNFDELLSGKYDNIPEEAFLYVGTID 456
>gi|71893408|ref|YP_278854.1| F0F1 ATP synthase subunit beta [Mycoplasma hyopneumoniae J] >gi|118573700|sp|Q4AAV7|ATPB_MYCHJ ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|71851535|gb|AAZ44143.1| ATP synthase beta chain [Mycoplasma hyopneumoniae J] (471 aa)
Score = 1565, Expect = 1.1e-171, Identities = 308/454 (67%), Positives = 372/454 (81%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDN-KPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGID 749
           + + G I QIFGPV+DV+F    MP I   LEVK+ N++ ++ EVA   G+ + R I+M  T  L +GLEV +T + I  PVG  VL RMFNV+G+PID  KP+   ++ +PIH K P++ EQ   +EI  TGIKVIDLL+P++KGGKIGLFGGAGVGKTVLVQELI+NIA+ HGGLS+FAGVGER+REGNDLY EM   GV+++TALVFGQMNEPPGARMRVAL+ALTMAE+FR+   QDVLLFIDNIFRF+QAGSEVS LLGRIPS VGYQPTL+ EMGQLQERITST  GSITSVQAVYVPADD+TDPAP+TTF+HLDAKTVLDR IA+LGIYPA++PL SSSR L+P+IVG +HY VA+ V  ILQ+F+ELQDIIAILG+DELSE DK  V+RAR+IRNFLSQPFFVA+KFS   G+++  QDT++ F E++ GK D+IPE+ FLYVG ID
  S:     4 QKNVGHIVQIFGPVIDVQFPNEHMPAILSALEVKI-NDESIIFEVAQHLGEGIVRAIAMSMTYNLSKGLEVYDTGSQISVPVGKQVLSRMFNVLGQPIDGGKPLDSFIK-NPIHAKAPTYLEQKATSEILVTGIKVIDLLIPFIKGGKIGLFGGAGVGKTVLVQELINNIASKHGGLSVFAGVGERSREGNDLYFEMKKAGVLDKTALVFGQMNEPPGARMRVALSALTMAEYFRDYENQDVLLFIDNIFRFTQAGSEVSTLLGRIPSTVGYQPTLSTEMGQLQERITSTIRGSITSVQAVYVPADDITDPAPATTFSHLDAKTVLDRGIAALGIYPAVDPLASSSRALEPNIVGKKHYLVAKKVVQILQRFKELQDIIAILGVDELSESDKQVVARARRIRNFLSQPFFVAQKFSGIQGQFIKIQDTVNNFDELLSGKYDNIPEEAFLYVGTID 456
>gi|108759590|ref|YP_635037.1| F0F1 ATP synthase subunit beta [Myxococcus xanthus DK 1622] >gi|118573702|sp|Q1CX36|ATPB_MYXXD ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|108463470|gb|ABF88655.1| ATP synthase F1, beta subunit [Myxococcus xanthus DK 1622] (481 aa)
Score = 1565, Expect = 1.2e-171, Identities = 305/455 (67%), Positives = 357/455 (78%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVKLPN----NKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVI-------NQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHKN 754
           G I Q+ GPVVDV+F    +P +   L+V   N       L LEVA   G++  R I+M STEGL RG+ V NT  PI  PVG A LGR+ NV GEP+D     +  EY  IH+ PP F EQ  + ++FETGIKVIDLL PY +GGKIGLFGGAGVGKTVL+QELI N+A   GG S+FAGVGERTREGNDLYHEM D  VI       +Q  LV+GQMNEPPGAR RVAL+ALTMAE+FR+   +DVLLF+DNIFRF+QAGSEVSALLGRIPSAVGYQPTLA EMG LQERITST  GSITSVQA+YVPADDLTDPAP+T FAHLDA TVL+R IA L I+PA++PL+S+SR+LDP+++G EHY VAR VQ ILQ+++ELQDIIAILG+DELSE+DKL V+RARKI+ FLSQPFFVA+ F+ K G+YV  QDTI GF EI EGK DDIPE  F   G ID+V +N
  S:     9 GRIIQVLGPVVDVEFPPGGLPEVYTALKVTNANLSAAADNLTLEVAQHLGENTVRTIAMDSTEGLGRGMAVTNTGAPIQVPVGKATLGRILNVTGEPVDEMGPVKAQEYWSIHRAPPPFTEQDVRVQMFETGIKVIDLLAPYTRGGKIGLFGGAGVGKTVLLQELIRNVAVERGGFSVFAGVGERTREGNDLYHEMQDTKVIQTDNLEASQAVLVYGQMNEPPGARARVALSALTMAEYFRDVEGRDVLLFVDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGGLQERITSTTKGSITSVQAIYVPADDLTDPAPATAFAHLDATTVLNRSIAELAIFPAVDPLDSTSRILDPAVIGAEHYGVARKVQGILQRYKELQDIIAILGMDELSEDDKLVVARARKIQRFLSQPFFVAKVFTGKDGRYVKLQDTIQGFKEIAEGKHDDIPEGAFYMTGSIDEVVEN 474
>gi|193211720|ref|YP_001997673.1| ATP synthase F1, beta subunit [Chlorobaculum parvum NCIB 8327] >gi|1168573|sp|P42465|ATPB_CHLVI ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|560823|emb|CAA54200.1| ATPase beta-subunit [Prosthecochloris vibrioformis] >gi|193085197|gb|ACF10473.1| ATP synthase F1, beta subunit [Chlorobaculum parvum NCIB 8327] (462 aa)
Score = 1564, Expect = 1.6e-171, Identities = 303/452 (67%), Positives = 364/452 (80%)
  Q:   299 KGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNK-PMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           +G I QI GPVVDV F   Q+P+I D L V   +  KLVLE     G++  R ISM  T+GL RG+ V NT  PI APVG+ VLGRM NVVGEPID K P+P K  Y PIH+  P FDE STK E+FETGIKVIDLL PY +GGK GLFGGAGVGKTVL+ ELI+NIA    G S+FAGVGERTREGNDL+HEM++ GVI++TALVFGQMNEPPGAR RVALT L++AE+FR+   +DVLLFIDNIFRF+QAG+EVSALLGR+PSAVGYQPTL  EMG+LQ+RI STK GS+TSVQA+YVPADDLTDPAP+T F HLDA TVL R+IA LGIYPA++PL+S+SR+LDP+I+G +HY  A++V+ ILQ++++LQDIIAILG+DELS+EDKL V+RARK++ FLSQPFFVAE F+  +GKYV  +DTI GF EII GK D +PE  F  VG I++
  S:     3 EGKISQIIGPVVDVDFPEGQLPSILDALTVTRQDGSKLVLETQQHLGEERVRTISMEGTDGLVRGMSVANTGRPIQAPVGAEVLGRMLNVVGEPIDGKGPVPSKKSY-PIHRSAPKFDELSTKAEMFETGIKVIDLLEPYSRGGKTGLFGGAGVGKTVLIMELINNIAKEQSGYSVFAGVGERTREGNDLWHEMMESGVIDKTALVFGQMNEPPGARARVALTGLSIAEYFRDEEGRDVLLFIDNIFRFTQAGAEVSALLGRMPSAVGYQPTLGTEMGELQDRIVSTKKGSVTSVQAIYVPADDLTDPAPATAFTHLDATTVLSRQIAELGIYPAVDPLDSTSRILDPNIIGNDHYDTAQAVKQILQRYKDLQDIIAILGMDELSDEDKLVVARARKVQRFLSQPFFVAEAFTGLAGKYVKLEDTIKGFKEIIAGKHDSLPENAFYLVGTIEE 454
>gi|78185913|ref|YP_373956.1| F0F1 ATP synthase subunit beta [Pelodictyon luteolum DSM 273] >gi|78165815|gb|ABB22913.1| ATP synthase F1, beta subunit [Pelodictyon luteolum DSM 273] (482 aa)
Score = 1563, Expect = 2.0e-171, Identities = 300/459 (65%), Positives = 372/459 (81%)
  Q:   292 LNTLKSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNK-PMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           ++T+   +G I QI GPVVDV F   Q+P+I D L +  P+  +LVLE     G++  R ++M ST+GL RGL V NT  PI APVG  VLGRM NVVG+PID + P+     YS IH+  P F++ STK E+FETGIKVIDLL PY +GGK GLFGGAGVGKTVL+ ELI+NIA    G S+FAGVGERTREGNDL+HEM++ GVI++TALVFGQMNEPPGAR RVALT L++AE+FR+   +DVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMG+LQ+RITSTK+GS+TSVQA+YVPADDLTDPAP+T FAHLDA TVL R+IA LGIYPA++PL+S+SR+LDP+++G +HY  A+SV+ ILQ++++LQDIIAILG+DELS+EDKL V+RARK++ FLSQPFFVAE F+  +GKYV  +D+I GF EII GK D++PE  F  VG I++
  S:    16 IHTVTMQEGKISQIIGPVVDVDFPEGQLPSILDALTITRPDGSRLVLETQQHLGEERVRTVAMESTDGLIRGLSVANTGRPIQAPVGEGVLGRMLNVVGDPIDGRGPVNATKTYS-IHRSAPKFEDLSTKAEMFETGIKVIDLLEPYSRGGKTGLFGGAGVGKTVLIMELINNIAKQQSGYSVFAGVGERTREGNDLWHEMMESGVIDKTALVFGQMNEPPGARARVALTGLSIAEYFRDEEHRDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGELQDRITSTKNGSVTSVQAIYVPADDLTDPAPATAFAHLDATTVLSRQIAELGIYPAVDPLDSTSRILDPNVIGDDHYDTAQSVKQILQRYKDLQDIIAILGMDELSDEDKLVVARARKVQRFLSQPFFVAEAFTGLAGKYVKLEDSIKGFKEIIAGKHDNLPEGAFYLVGTIEE 474
>gi|71018215|ref|XP_759338.1| hypothetical protein UM03191.1 [Ustilago maydis 521] >gi|46099188|gb|EAK84421.1| hypothetical protein UM03191.1 [Ustilago maydis 521] (523 aa)
Score = 1562, Expect = 3.1e-171, Identities = 302/458 (65%), Positives = 361/458 (78%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK-LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVIN-----QTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHK 753
           K   G +  + GPVVDV+F    +P+I + LEV+ +    +LVLEVA   G++  R I+M  TEGL RG +V++T  PI  PVG   LGR+ NV+GEP+D +   +  + +PIH +PP+F +QSTK E+ ETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+QELI+N+A  HGG S+F GVGERTREGNDLYHEMI+ GVIN     + ALVFGQMNEPPGAR RVALT LT+AE+FR+   QDVLLFIDNIFRF+QAGSE SALLGRIPSAVGYQPTLA +MG +QERIT+TK GSITSVQAVYVPADDLTDPAP+TTFAHLDA TVL R IA LGIYPA++PL+S SRMLDP++VG EHY +A  VQ +LQ ++ LQDIIAILG+DELSEEDKLTV RARKI+ F+SQPF VA+ F+   GK VS +DTIS   EI+ G  D +PE  F   GGIDDV K
  S:    51 KGQTGAVKAVIGPVVDVQFDTEDLPSIFNALEVQNVTGGGRLVLEVAQHLGENTVRAIAMEGTEGLVRGQKVVDTGLPIQIPVGPGTLGRIMNVIGEPMDERGPIKGNKLAPIHVEPPAFVDQSTKAEVLETGIKVVDLLAPYARGGKIGLFGGAGVGKTVLIQELINNVAKAHGGYSVFTGVGERTREGNDLYHEMIETGVINLEGDSKVALVFGQMNEPPGARARVALTGLTIAEYFRDEEGQDVLLFIDNIFRFTQAGSETSALLGRIPSAVGYQPTLATDMGVMQERITTTKKGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSRGIAELGIYPAVDPLDSKSRMLDPAVVGREHYDIATGVQKLLQDYKSLQDIIAILGMDELSEEDKLTVERARKIQRFMSQPFAVAQVFTGIEGKLVSLKDTISACKEILRGDHDALPESAFYMCGGIDDVKK 514
>gi|157737829|ref|YP_001490513.1| F0F1 ATP synthase subunit beta [Arcobacter butzleri RM4018] >gi|157699683|gb|ABV67843.1| ATP synthase F1 sector, beta subunit [Arcobacter butzleri RM4018] (464 aa)
Score = 1561, Expect = 3.3e-171, Identities = 302/453 (66%), Positives = 362/453 (79%)
  Q:   299 KGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKK--LVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDN-KPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           KG + Q+ GPVVDV+F    +P IN+ ++V L +  K  LVLEVA   GD   R I+M  TEGL RG E I T  PI  PVG AVLGR+FNV+G+P+D    +P   E   IH+  P+F+EQSTKTE+FETGIKV+DLL PY KGGK+GLFGGAGVGKTV++ ELIHN+A  H G S+FAGVGERTREGNDLYHEM D  V+++ AL +GQM+EPPGAR R+ALT LTMAE+FR+    DVL+FIDNIFRF+Q+GSE+SALLGRIPSAVGYQPTLA EMG+LQERITST  GSITSVQAVYVPADDLTDPAP++ FAHLDA TVL+RKIA  GIYPA++PL+S+SR+L   I+G EHY  AR VQ++LQK+++LQDIIAILG+DELSE DKL V+RARKI  FLSQPFFVAE F+   GKYV  +DTI+GF  I++GK D+IPE  F  VGGID+V
  S:     2 KGKVIQVMGPVVDVEF-DGYLPEINEAIDVTLADASKDRLVLEVAAHIGDSRVRTIAMDMTEGLVRGQECIATGGPIKVPVGEAVLGRIFNVIGDPVDEGSAIPADTERWSIHRSAPTFEEQSTKTEMFETGIKVVDLLAPYSKGGKVGLFGGAGVGKTVIIMELIHNVAFKHSGYSVFAGVGERTREGNDLYHEMKDSNVLDKVALCYGQMSEPPGARNRIALTGLTMAEYFRDEKGLDVLMFIDNIFRFAQSGSEMSALLGRIPSAVGYQPTLASEMGKLQERITSTSKGSITSVQAVYVPADDLTDPAPASVFAHLDATTVLNRKIAEKGIYPAVDPLDSTSRILSADIIGQEHYNTARGVQSVLQKYKDLQDIIAILGMDELSESDKLVVARARKIERFLSQPFFVAEVFTGSPGKYVELKDTIAGFQGILDGKYDNIPEMAFYMVGGIDEV 456
>gi|163762349|ref|ZP_02169414.1| methyl-accepting chemotaxis sensory transducer [Bacillus selenitireducens MLS10] >gi|160357088|gb|EDP83736.1| methyl-accepting chemotaxis sensory transducer [Bacillus selenitireducens MLS10] (473 aa)
Score = 1561, Expect = 3.5e-171, Identities = 304/454 (66%), Positives = 367/454 (80%)
  Q:   298 DKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKK------LVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPID-NKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           +KG + Q+ GPV+DV+F R Q+P IN+ + +             LVLEVAL  GDD  R ++M ST+G+ RG+E ++   PI  PVG   LGR+FNV+G+ ID  +P+PE     PIH++ P++D+ ST TEI ETGIKV+DLL PYVKGGKIGLFGGAGVGKTVL+QELI+NIA  HGG+S+FAGVGERTREGNDLY EM D GVI +TA+VFGQMNEPPGARMRVALT LTMAE+FR+    DVLLFIDNIFRF+QAG EVSALLGR+PSAVGYQPTL+ EMGQLQERITSTK GS+TS+QA+YVPADD TDPAP+TTFAHLDA T L+RK++ +GIYPA++PL S+SR L P IVG EHY VAR VQ  LQK++ELQDIIAILG+DELSEED+ TVSRAR+I+ FLSQ F VAE+F+ + G YV  +DTI GF EI++GK DD+PE  F  VG I+DV
  S:     3 NKGRVTQVTGPVIDVQFERGQLPEINNAVRIVHEAQSSGEVDIDLVLEVALHLGDDTVRTVAMSSTDGIVRGMECVDQGAPISVPVGENTLGRVFNVLGQEIDLQEPIPEGERRDPIHRQAPAYDDLSTNTEILETGIKVVDLLAPYVKGGKIGLFGGAGVGKTVLIQELINNIAQEHGGISVFAGVGERTREGNDLYFEMKDSGVITKTAMVFGQMNEPPGARMRVALTGLTMAEYFRDEKGADVLLFIDNIFRFTQAGMEVSALLGRMPSAVGYQPTLSTEMGQLQERITSTKKGSVTSIQAIYVPADDYTDPAPATTFAHLDATTNLERKLSEMGIYPAVDPLASTSRALSPEIVGDEHYSVAREVQETLQKYKELQDIIAILGMDELSEEDRQTVSRARRIQFFLSQNFHVAEQFTGQPGSYVQVKDTIRGFREILDGKYDDVPEDAFRLVGPIEDV 463
>gi|150015308|ref|YP_001307562.1| F0F1 ATP synthase subunit beta [Clostridium beijerinckii NCIMB 8052] >gi|190358655|sp|A6LQH6|ATPB_CLOB8 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|149901773|gb|ABR32606.1| ATP synthase F1, beta subunit [Clostridium beijerinckii NCIMB 8052] (463 aa)
Score = 1561, Expect = 3.9e-171, Identities = 300/452 (66%), Positives = 367/452 (81%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           G + Q+ GPV+D+KF  + +P++ + + +K   + +LV EV    GDD+ R I+M +TEGL RG++ ++T  PI  PVG  VLGR+FNV+G+PID     E  +  PIH+  PSF +QS + E+FETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+QELI+NIA  HGGLS+F GVGER+REGNDLYHEM + GVI++TALVFGQMNEPPGARMRVALT LTMAE+FR+   QDVLLFIDNIFR++QAGSEVSALLGR PSAVGYQPTLA EMG LQERITST +GSITSVQAVYVPADDLTDPAP+TTFAHLDA TVL R IA LGIYPA++PLES+SR+LDP IVG EHYKVA  V+ +L+K+++LQDIIAILG+DEL +EDK  V+RAR+I+ FLSQPF V E+F+   GKYV  ++T+ GF EI+EGK D++PE  FL+ G IDDV
  S:     6 GKVVQVIGPVIDIKFDSDSLPDLYNAIVIK-AGDYELVAEVEQHVGDDIVRTIAMSATEGLKRGMDAVDTGAPISVPVGEEVLGRLFNVLGKPIDKCGDIEVKQEYPIHRPAPSFKDQSVEPEMFETGIKVVDLLAPYQRGGKIGLFGGAGVGKTVLIQELINNIAKQHGGLSVFTGVGERSREGNDLYHEMRESGVIDKTALVFGQMNEPPGARMRVALTGLTMAEYFRDKG-QDVLLFIDNIFRYTQAGSEVSALLGRTPSAVGYQPTLATEMGALQERITSTVNGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSRGIAELGIYPAVDPLESTSRILDPRIVGEEHYKVAADVKHVLEKYKQLQDIIAILGVDELGDEDKAVVARARRIQRFLSQPFTVGEQFTGLKGKYVPVKETVRGFKEILEGKYDELPESAFLFAGTIDDV 455
>gi|22298068|ref|NP_681315.1| F0F1 ATP synthase subunit beta [Thermosynechococcus elongatus BP-1] >gi|81844966|sp|Q8DLG8|ATPB_SYNEL ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|22294246|dbj|BAC08077.1| ATP synthase beta subunit [Thermosynechococcus elongatus BP-1] (482 aa)
Score = 1561, Expect = 4.0e-171, Identities = 300/459 (65%), Positives = 365/459 (79%)
  Q:   290 MKLNTLKSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKL----VLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGI 748
           M ++  +++ G I Q+ GPVVD++F   +MP I + L ++  N   L      EV  L GD+  R ++M ST+GL RG+EV++T  PI  PVG+A LGR+FNV+GEP+D K      E  PIH+  PSF +  TK  +FETGIKVIDLL PY +GGKIGLFGGAGVGKTV++ ELI+NIAT HGG+S+FAGVGERTREGNDLY+EMI+ GVI++        ALV+GQMNEPPGARMRV L+ LTMAE+FR+ NKQDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL  ++G LQERITST  GSITS+QAVYVPADDLTDPAP+TTFAHLD  TVL R +A+ GIYPA++PL S+S ML P IVG EHY+ AR+VQ  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV+ ++TI GF  I+ G+ DD+PEQ F  VG I
  S:     1 MVISAERTNVGFITQVIGPVVDIEFPSGKMPAIYNALRIQGKNAAGLDVAVTCEVQQLLGDNRVRAVAMSSTDGLVRGMEVVDTGAPISVPVGTATLGRIFNVLGEPVDEKGAVNATETLPIHRPAPSFTQLETKPSVFETGIKVIDLLTPYRRGGKIGLFGGAGVGKTVIMMELINNIATQHGGVSVFAGVGERTREGNDLYNEMIESGVIDKDDPSKSKIALVYGQMNEPPGARMRVGLSGLTMAEYFRDVNKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLGTDVGALQERITSTTEGSITSIQAVYVPADDLTDPAPATTFAHLDGTTVLSRSLAAKGIYPAVDPLGSTSNMLQPDIVGEEHYQTARAVQATLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGAPGKYVTLEETIKGFQMILSGELDDLPEQAFYMVGNI 470
>gi|91201498|emb|CAJ74558.1| strongly similar to ATP synthase subunit beta [Candidatus Kuenenia stuttgartiensis] (471 aa)
Score = 1560, Expect = 4.8e-171, Identities = 298/460 (64%), Positives = 364/460 (79%)
  Q:   292 LNTLKSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK-KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           +N  + + G I Q+ GPVVDV+F   ++P I   + +     K  +V E+A   G+D ARCI+M ST+GL R +EV++   PI  PVG  VLGR+FN++G+PID K   E   Y PIH+ PPSF+E+ T T + ETG+KVIDLL P+ +GGKIGLFGGAGVGKTVL+ ELI +IAT HGG S FAGVGERTREGNDL+ EM + GVI++T LVFGQMNEPPGAR+RVALT LTMAE+FR+   QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTLA EMG LQERIT+TK GSITS+QAVYVPADD TDPAP TTF HLDA   L R+IA LGIYPA++PL S+SR+LDP I+G EHY+VAR VQ ILQ+F+ELQD IAILG++ELSE DK+ V+RAR+++ FLSQPFFVAE+F+   GKYV  ++TI GF E++EGK D++PEQ F  VGGI++V
  S:     2 VNITERNIGQIVQVIGPVVDVRFQPGKLPPIKSAVSINDVKKKISVVAEIAQHLGNDTARCIAMSSTDGLVRSMEVLDDGGPISVPVGKEVLGRIFNLLGKPIDTKEDFEAKNYLPIHRAPPSFEERETTTTVLETGLKVIDLLAPFARGGKIGLFGGAGVGKTVLIMELIRSIATEHGGYSAFAGVGERTREGNDLWLEMKESGVIDKTVLVFGQMNEPPGARLRVALTGLTMAEYFRDVEGQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLATEMGDLQERITTTKKGSITSLQAVYVPADDFTDPAPVTTFPHLDATIALSRQIAELGIYPAVDPLRSTSRILDPRILGQEHYEVAREVQRILQRFKELQDFIAILGMEELSEADKVLVARARRLQRFLSQPFFVAEQFTGTKGKYVPLKETIRGFKEVVEGKYDNLPEQAFYMVGGIEEV 462
>gi|54020006|ref|YP_115570.1| F0F1 ATP synthase subunit beta [Mycoplasma hyopneumoniae 232] >gi|81823562|sp|Q601Z5|ATPB_MYCH2 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|53987179|gb|AAV27380.1| ATP synthase beta chain [Mycoplasma hyopneumoniae 232] (471 aa)
Score = 1560, Expect = 4.9e-171, Identities = 307/454 (67%), Positives = 371/454 (81%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDN-KPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGID 749
           + + G I QIFGPV+DV+F    MP I   LEVK+ N++ ++ EVA   G+ + R I+M  T  L +GLEV +T + I  PVG  VL RMFNV+G+PID  KP+   ++ +PIH   P++ EQ   +EI  TGIKVIDLL+P++KGGKIGLFGGAGVGKTVLVQELI+NIA+ HGGLS+FAGVGER+REGNDLY EM   GV+++TALVFGQMNEPPGARMRVAL+ALTMAE+FR+   QDVLLFIDNIFRF+QAGSEVS LLGRIPS VGYQPTL+ EMGQLQERITST  GSITSVQAVYVPADD+TDPAP+TTF+HLDAKTVLDR IA+LGIYPA++PL SSSR L+P+IVG +HY VA+ V  ILQ+F+ELQDIIAILG+DELSE DK  V+RAR+IRNFLSQPFFVA+KFS   G+++  QDT++ F E++ GK D+IPE+ FLYVG ID
  S:     4 QENVGHIVQIFGPVIDVQFPNEHMPAILSALEVKI-NDESIIFEVAQHLGEGIVRAIAMSMTYNLSKGLEVYDTGSQISVPVGKQVLSRMFNVLGQPIDGGKPLDSFIK-NPIHANAPTYLEQKATSEILVTGIKVIDLLIPFIKGGKIGLFGGAGVGKTVLVQELINNIASKHGGLSVFAGVGERSREGNDLYFEMKKAGVLDKTALVFGQMNEPPGARMRVALSALTMAEYFRDYENQDVLLFIDNIFRFTQAGSEVSTLLGRIPSTVGYQPTLSTEMGQLQERITSTIRGSITSVQAVYVPADDITDPAPATTFSHLDAKTVLDRGIAALGIYPAVDPLASSSRALEPNIVGKKHYLVAKKVVQILQRFKELQDIIAILGVDELSESDKQVVARARRIRNFLSQPFFVAQKFSGIQGQFIKIQDTVNNFDELLSGKYDNIPEEAFLYVGTID 456
>gi|118573714|sp|Q3B6W8|ATPB1_PELLD ATP synthase subunit beta 1 (ATPase subunit beta 1) (ATP synthase F1 sector subunit beta 1) (462 aa)
Score = 1560, Expect = 5.0e-171, Identities = 299/452 (66%), Positives = 368/452 (81%)
  Q:   299 KGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNK-PMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           +G I QI GPVVDV F   Q+P+I D L +  P+  +LVLE     G++  R ++M ST+GL RGL V NT  PI APVG  VLGRM NVVG+PID + P+     YS IH+  P F++ STK E+FETGIKVIDLL PY +GGK GLFGGAGVGKTVL+ ELI+NIA    G S+FAGVGERTREGNDL+HEM++ GVI++TALVFGQMNEPPGAR RVALT L++AE+FR+   +DVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMG+LQ+RITSTK+GS+TSVQA+YVPADDLTDPAP+T FAHLDA TVL R+IA LGIYPA++PL+S+SR+LDP+++G +HY  A+SV+ ILQ++++LQDIIAILG+DELS+EDKL V+RARK++ FLSQPFFVAE F+  +GKYV  +D+I GF EII GK D++PE  F  VG I++
  S:     3 EGKISQIIGPVVDVDFPEGQLPSILDALTITRPDGSRLVLETQQHLGEERVRTVAMESTDGLIRGLSVANTGRPIQAPVGEGVLGRMLNVVGDPIDGRGPVNATKTYS-IHRSAPKFEDLSTKAEMFETGIKVIDLLEPYSRGGKTGLFGGAGVGKTVLIMELINNIAKQQSGYSVFAGVGERTREGNDLWHEMMESGVIDKTALVFGQMNEPPGARARVALTGLSIAEYFRDEEHRDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGELQDRITSTKNGSVTSVQAIYVPADDLTDPAPATAFAHLDATTVLSRQIAELGIYPAVDPLDSTSRILDPNVIGDDHYDTAQSVKQILQRYKDLQDIIAILGMDELSDEDKLVVARARKVQRFLSQPFFVAEAFTGLAGKYVKLEDSIKGFKEIIAGKHDNLPEGAFYLVGTIEE 454
>gi|1168569|sp|P42006|ATPB_BACST ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|534854|dbj|BAA07255.1| ATPase subunit beta [Geobacillus stearothermophilus] (473 aa)
Score = 1559, Expect = 5.6e-171, Identities = 302/453 (66%), Positives = 361/453 (79%)
  Q:   299 KGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKK------LVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPID-NKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           +G + Q+ GPVVDVKF    +P I + L+++     +      L LEVAL  GDD  R I+M ST+GL RG+EVI+T  PI  PVG   LGR+FNV+GEPID    +P      PIH+  P F+E +T+ EI ETGIKVIDLL PY+KGGKIGLFGGAGVGKTVL+QELIHNIA  HGG+S+FAG GERTREGNDLYHEM D GVI++T +VFGQMNEPPG RMRVALT LTMAE+FR+   QDVLLFIDN FRF+QAGSEVSALLGR+PSAVGYQPTLA EMGQLQERITST  GSITS+QA+YVPADD TDPAP+TTF+HLDA T L+RK+A +GIYPA++PL S+SR L P IVG EHY+VAR VQ  LQ+++ELQDIIAILG+DELS+EDKL V RAR+I+ FLSQ F VAE+F+ + G YV  ++T+ GF EI+EGK D +PE  F  VG I++V
  S:     3 RGRVIQVMGPVVDVKFETGHLPAIYNALKIQHQARNENEVDIDLTLEVALHLGDDTVRTIAMASTDGLIRGMEVIDTGAPISRPVGEVTLGRVFNVLGEPIDLEGDIPADARRDPIHRPAPKFEELATEVEILETGIKVIDLLAPYIKGGKIGLFGGAGVGKTVLIQELIHNIAQEHGGISVFAGFGERTREGNDLYHEMKDSGVISKTGMVFGQMNEPPGPRMRVALTGLTMAEYFRDEQGQDVLLFIDNNFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTAKGSITSIQAIYVPADDYTDPAPATTFSHLDATTNLERKLAEMGIYPAVDPLASTSRALAPEIVGEEHYQVARKVQQTLQRYKELQDIIAILGMDELSDEDKLVVHRARRIQFFLSQNFHVAEQFTGQPGSYVPVKETVRGFKEILEGKYDHLPEDRFRLVGRIEEV 462
>gi|162447836|ref|YP_001620968.1| F-type H+-transporting ATPase beta chain [Acholeplasma laidlawii PG-8A] >gi|190358283|sp|A9NGW2|ATPB_ACHLI ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|161985943|gb|ABX81592.1| F-type H+-transporting ATPase beta chain [Acholeplasma laidlawii PG-8A] (460 aa)
Score = 1559, Expect = 6.6e-171, Identities = 294/452 (65%), Positives = 361/452 (79%)
  Q:   299 KGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           KG I  I GPVVDV F  +++PNIND LEV+L   +   LEVA   G+ + R IS+ +T+GL RG+EVI T +PI  PVG  VLGRM NV+G+P+D     +   Y PIHK PP F +   +TEI ETGIKVIDL+ PY+KGGKIGLFGGAGVGKTVL+QE+IHN+A  HGG+S+F GVGER REG++LYHEM D GV+++TALVFGQMNEPPGAR+RVALT LT+AE+FR+  KQ+VLLFIDNI+R+ QAGSE+SALLGR+PSAVGYQPTLA EMG+LQERITST+ GSITS+QAVYVPADD TDPAP+T F+HLDA T L RK+   GIYPAI+PL S+SR L PS+VG EHY  AR VQ +LQ++ EL DIIAILG+DELS++DKL V RAR+I+NFLSQ   VAE+F+ ++G +V  ++TI GF EI++GK DD+PE+ FL VG IDD
  S:     2 KGKIVAIIGPVVDVSFM-DELPNINDALEVRLSETETRTLEVASHLGNHMVRTISLEATDGLARGMEVIGTLSPIKVPVGKKVLGRMLNVLGKPMDGLDEVDTKRYMPIHKLPPDFHDLGGETEILETGIKVIDLIAPYIKGGKIGLFGGAGVGKTVLIQEMIHNVAKNHGGISVFTGVGERVREGHELYHEMKDSGVLDKTALVFGQMNEPPGARLRVALTGLTLAEYFRDGEKQNVLLFIDNIYRYIQAGSEISALLGRMPSAVGYQPTLATEMGKLQERITSTRYGSITSIQAVYVPADDYTDPAPATVFSHLDATTALSRKLTEDGIYPAIDPLGSTSRALTPSVVGQEHYDTAREVQRMLQRYHELLDIIAILGMDELSDDDKLVVHRARRIQNFLSQNMHVAERFTGQTGSFVPIRETIRGFKEILQGKHDDLPEEAFLLVGTIDD 452
>gi|119355899|ref|YP_910543.1| F0F1 ATP synthase subunit beta [Chlorobium phaeobacteroides DSM 266] >gi|166201696|sp|A1BCJ2|ATPB_CHLPD ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|119353248|gb|ABL64119.1| ATP synthase F1, beta subunit [Chlorobium phaeobacteroides DSM 266] (462 aa)
Score = 1558, Expect = 7.8e-171, Identities = 300/452 (66%), Positives = 362/452 (80%)
  Q:   299 KGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           +G I QI GPVVDV F   Q+P+I D L +  P+  KLVLE     G++  R ++M ST+GL RGL V NT+ PI  PVG  VLGRM NVVG+PID +      +   IH+  P FDE STKTE+FETGIKVIDLL PY +GGK GLFGGAGVGKTVL+ ELI+NIA    G S+FAGVGERTREGNDL+HEM++ GVI++TALVFGQMNEPPGAR RVALT L++AE+FR+   +DVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMG+LQ+RI STK GS+TSVQA+YVPADDLTDPAP+T FAHLDA TVL R IA LGIYPA++PL+S+SR+LDP+IVG +HY  A++V+ ILQ++++LQDIIAILG+DELS+EDKL VSRARK++ FLSQPFFVAE F+  +GKYV   +TI GF EII GK D++PE  F  VG I++
  S:     3 EGKISQIIGPVVDVDFPEGQLPSILDALTITRPDGTKLVLETQQHLGEERVRTVAMESTDGLIRGLSVTNTERPIQVPVGPEVLGRMLNVVGDPIDGRGSVHTSKTYSIHRSAPKFDELSTKTEMFETGIKVIDLLEPYSRGGKTGLFGGAGVGKTVLIMELINNIAKQQSGYSVFAGVGERTREGNDLWHEMMESGVIDKTALVFGQMNEPPGARARVALTGLSIAEYFRDEENRDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGELQDRIVSTKKGSVTSVQAIYVPADDLTDPAPATAFAHLDATTVLSRSIAELGIYPAVDPLDSTSRILDPNIVGDDHYDTAQAVKQILQRYKDLQDIIAILGMDELSDEDKLVVSRARKVQRFLSQPFFVAEAFTGLAGKYVKLDETIKGFKEIIAGKHDNLPESAFYLVGTIEE 454
>gi|1929513|gb|AAB51466.1| ATP synthase subunit beta (462 aa)
Score = 1558, Expect = 8.7e-171, Identities = 293/456 (64%), Positives = 364/456 (79%)
  Q:   298 DKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHK 753
           ++G + Q+ GPVVDV+FA +++P++ + + +K  +   + +E     G++  RC+++ ST+GL RG++ ++T  PI  PVG A LGR+FNV+GEPIDN+   E  E  PIH+  PSF+EQ   TE+ ETGIKV+DLL PY KGGKIGLFGGAGVGKTVL+ ELI NIA  HGG S+F+GVGERTREGNDLY EM + GV+ +TALVFGQMNEPPGAR+RV LT LTM E+FR+   QDVLLFIDNIFRF Q GSEVSALL R+PSAVGYQPTL  EMG LQERITSTK GSITSVQA+YVPADDLTDPAP+TTFAHLDA TVL R+IA LGIYPA++PL+S+SR+LDP ++G EHY+V R VQ +LQ+++ELQDIIAILG+DELSE+DKL V+RARKI+ FLSQPF VAE F+ + G YV  ++TI GF EI+EG+ D++PEQ F  VG ID+  K
  S:     2 NEGQVVQVIGPVVDVEFASDRLPDLYNAITIK-TDKINITMEAMQHLGNNTVRCVALSSTDGLQRGMKAVDTGQPITVPVGRATLGRLFNVLGEPIDNQGPVETTERLPIHRPAPSFEEQQPSTEVLETGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELIRNIAYEHGGFSVFSGVGERTREGNDLYLEMKESGVLEKTALVFGQMNEPPGARLRVGLTGLTMPEYFRDPEAQDVLLFIDNIFRFVQPGSEVSALLARMPSAVGYQPTLPTEMGPLQERITSTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRQIAELGIYPAVDPLDSTSRILDPRVLGEEHYQVVRGVQQVLQRYKELQDIIAILGMDELSEDDKLIVARARKIQRFLSQPFHVAEAFTGQPGVYVPLKETIRGFKEILEGRHDNLPEQAFYMVGTIDEAVK 456
>gi|170087348|ref|XP_001874897.1| predicted protein [Laccaria bicolor S238N-H82] >gi|164650097|gb|EDR14338.1| predicted protein [Laccaria bicolor S238N-H82] (540 aa)
Score = 1557, Expect = 1.1e-170, Identities = 303/456 (66%), Positives = 360/456 (78%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVIN-----QTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           K   G +  + G VVDV+F  + +P I + LEV+  +  +LVLEVA   G++  R I+M  TEGL RG +V++T +PIM PVG+A LGR+ NV+GEPID +   + V+  PIH  PP F +QST  E+ ETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+QELI+N+A  HGG SIF GVGERTREGNDLYHEMI+ GVIN     + ALVFGQMNEPPGAR RVALT LT+AE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGRIPSAVGYQPTL+ +MG +QERIT+TK GSITSVQAVYVPADDLTDPAP+TTFAHLDA TVL R IA LGIYPA++PL+S SRMLDP IVG EHY VA +VQ ILQ ++ LQDIIAILG+DELSEEDKLTV RARKI+ F+SQPF VA+ F+   GK V  +DT+  F EI+ G+ D +PE  F   G I+DV
  S:    67 KGAVGSVKTVIGAVVDVQFETDNLPPILNALEVQNFSGGRLVLEVASHLGENSVRTIAMDGTEGLVRGTKVVDTGSPIMVPVGTATLGRIMNVIGEPIDERGPIKGVKLCPIHADPPPFVDQSTTAEVLETGIKVVDLLAPYARGGKIGLFGGAGVGKTVLIQELINNVAKAHGGFSIFCGVGERTREGNDLYHEMIETGVINLEGDSKVALVFGQMNEPPGARARVALTGLTIAEYFRDEEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLSTDMGGMQERITTTKKGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSRGIAELGIYPAVDPLDSKSRMLDPRIVGQEHYDVATAVQKILQDYKSLQDIIAILGMDELSEEDKLTVERARKIQRFMSQPFQVAQVFTGYEGKLVPLKDTVRSFKEILSGQHDSLPESAFYMAGTIEDV 527
>gi|149183570|ref|ZP_01861992.1| F0F1 ATP synthase subunit beta [Bacillus sp. SG-1] >gi|148848711|gb|EDL62939.1| F0F1 ATP synthase subunit beta [Bacillus sp. SG-1] (472 aa)
Score = 1555, Expect = 1.7e-170, Identities = 306/456 (67%), Positives = 364/456 (79%)
  Q:   298 DKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKK-----LVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPID-NKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHK 753
           +KG + Q+ GPVVDVKF   Q+P+I + L VK           L LEVAL  GDD  R I+M ST+GL RG+EV +T  PI  PVG   LGR+FNV+GE ID  + + +     PIH++ P FD+ ST+ EI ETGIKV+DLL PY+KGGKIGLFGGAGVGKTVL+QELI+NIA  HGGLS+FAGVGERTREGNDLYHEM D GVI +TA+VFGQMNEPPGARMRVALT LTMAE+FR+   QDVLLF+DNIFRF+QAGSEVSALLGR+PSAVGYQPTLA +MGQLQERITST  GS+TS+QA+YVPADD TDPAP+TTFAHLDA T L+RK++ +GIYPA++PL S+SR L P IVG EHY VAR VQ  LQ+++ELQDIIAILG+DELS+EDKL VSRAR+++ FLSQ F VAE+F+ + G YV  +DT+  F EI+EGK D IPE  F  VG + DV K
  S:     2 NKGHVLQVMGPVVDVKFESGQLPDIFNALVVKQEAKADAKGIDLTLEVALHLGDDTVRTIAMDSTDGLTRGIEVADTGAPISVPVGDVTLGRVFNVLGETIDLEEEIDKSARRDPIHREAPKFDQLSTEVEILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELINNIAQEHGGLSVFAGVGERTREGNDLYHEMSDSGVIKKTAMVFGQMNEPPGARMRVALTGLTMAEYFRDEQGQDVLLFVDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATDMGQLQERITSTNVGSVTSIQAIYVPADDYTDPAPATTFAHLDATTNLERKLSEMGIYPAVDPLASTSRALSPEIVGEEHYNVARQVQQTLQRYKELQDIIAILGMDELSDEDKLIVSRARRVQFFLSQNFHVAEQFTGQKGSYVQVKDTVQDFKEILEGKYDHIPEDAFRLVGPMSDVLK 463
>gi|160902211|ref|YP_001567792.1| F0F1 ATP synthase subunit beta [Petrotoga mobilis SJ95] >gi|190358699|sp|A9BFX3|ATPB_PETMO ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|160359855|gb|ABX31469.1| ATP synthase F1, beta subunit [Petrotoga mobilis SJ95] (467 aa)
Score = 1554, Expect = 2.1e-170, Identities = 304/456 (66%), Positives = 370/456 (81%)
  Q:   295 LKSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLP-NNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           ++  KG I  + GPVVDVKF   Q+PN+ D L+VK   + ++L+LEV  L GDD ARC++M ST+G+ RG EVINT  PI  PVG   LGRM N++G+PID K   E  EY PIH+ PPS +EQ T  EI ETGIK IDLL P+ +GGKIG FGGAGVGKTVLV ELI NIA  H G+S+FAGVGERTREGNDL+ EM + GVI+ TALVFGQMNEPPGAR RV LTALT++E+FR+  K+DVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTLA +MGQLQERITSTK GSITSVQA+YVPADD TDPAP+TTFAHLDA   L R+ + LG+YPA++PL+S+S+MLDP++VG +HY VAR V+ +LQ++E+LQDIIAILGI+ELSEED+  V+RAR+I+ FL+QPFFVAE+F++ SGKYV+ +DTI GF EI+EGK DD+PE  F  VG I++
  S:     1 MQDQKGKIISVIGPVVDVKFPEGQLPNVYDALKVKNEYSGEELILEVEQLIGDDTARCVAMDSTDGIRRGQEVINTLEPIKVPVGDTTLGRMVNLLGKPIDEKGDVEGEEYWPIHRDPPSLNEQDTSIEILETGIKCIDLLAPFPRGGKIGFFGGAGVGKTVLVMELIRNIAKEHQGISVFAGVGERTREGNDLWLEMQETGVIDSTALVFGQMNEPPGARFRVPLTALTISEYFRDRQKKDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLASDMGQLQERITSTKDGSITSVQAIYVPADDFTDPAPATTFAHLDANINLSRRQSELGLYPAVDPLDSTSKMLDPNVVGQDHYSVAREVKEVLQRYEDLQDIIAILGIEELSEEDRQIVNRARRIQRFLTQPFFVAERFTNYSGKYVNVEDTIKGFKEILEGKHDDLPESAFYMVGTIEE 457
>gi|163726773|ref|ZP_02134280.1| ATP synthase F1, beta subunit [Desulfatibacillum alkenivorans AK-01] >gi|161399918|gb|EDQ24179.1| ATP synthase F1, beta subunit [Desulfatibacillum alkenivorans AK-01] (472 aa)
Score = 1554, Expect = 2.4e-170, Identities = 294/455 (64%), Positives = 364/455 (80%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVKLPN----NKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHKN 754
           G I Q+ GPVVDV+F +  +PNI   L +  P        LV+EVA   GD+V R I+M  T+GL RG+ V +T +PIM PVG AVLGR+ NVVG P+D      + +  PIH+  P F EQ T   + ETG+KVIDLLVP+ +GGK+G+FGGAGVGKTV++ E++HNIA  HGG+S+FAGVGERTREGNDLYHEM +GGV+ + +LV+GQM EPPGAR RVAL+ALT AE+FR+   QDVL+FIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA ++G+LQERITST  GSIT+VQ VYVPADDLTDPAP+TTFAHLD   VL R+I  LGIYPA++PL+SSSR+LDP  +G EHY VAR+VQ +LQK++ELQDIIAILG+DELS+EDK+TV+RARKI+ FLSQPFFVAE F+ K GKYV  +DT+ GF EI++GK DD+PE+ F  VGGI++  +N
  S:     6 GKITQVMGPVVDVEFEQGNLPNILTALLITNPTINDEADNLVVEVAQHLGDNVVRTIAMDVTDGLVRGMPVKDTGDPIMMPVGEAVLGRVLNVVGRPVDGLGPVSQEKMLPIHRLAPKFTEQDTTVRVLETGVKVIDLLVPFPRGGKMGMFGGAGVGKTVIMMEMVHNIAMQHGGISVFAGVGERTREGNDLYHEMKEGGVLPKASLVYGQMTEPPGARARVALSALTSAEYFRDQEGQDVLIFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLAVDLGELQERITSTDKGSITAVQCVYVPADDLTDPAPATTFAHLDGTVVLSRQIVELGIYPAVDPLDSSSRILDPGYLGDEHYGVARTVQQMLQKYKELQDIIAILGMDELSDEDKITVARARKIQRFLSQPFFVAENFTGKPGKYVKLEDTVRGFKEIVDGKHDDLPERAFYMVGGIEEAIEN 464
>gi|145218847|ref|YP_001129556.1| F0F1 ATP synthase subunit beta [Prosthecochloris vibrioformis DSM 265] >gi|189081338|sp|A4SC45|ATPB_PROVI ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|145205011|gb|ABP36054.1| ATP synthase F1, beta subunit [Prosthecochloris vibrioformis DSM 265] (462 aa)
Score = 1554, Expect = 2.6e-170, Identities = 302/452 (66%), Positives = 367/452 (81%)
  Q:   299 KGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNK-PMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           +G I QI GPVVDV F   Q+P I D L +  P+  K+VLE     G++  R ++M ST+GL RG+ V NT  PI APVG  VLGRM NVVG+PID + P+  K  YS IH+  P F++ STK E+FETGIKVIDLL PY +GGK GLFGGAGVGKTVL+ ELI+NIA    G S+FAGVGERTREGNDL+HEM++ GVI++TALVFGQMNEPPGAR RVALT L++AE+FR+   +DVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMG+LQ+RITSTK+GS+TSVQA+YVPADDLTDPAP+T FAHLDA TVL R IA LGIYPA++PL+S+SR+LDP+IVG +HY  A++V+ ILQ++++LQDIIAILG+DELS+EDKL VSRARK++ FLSQPFFVAE F+  SGKYV  ++TI GF EII GK D++PE  F  VG I++
  S:     3 EGKISQIIGPVVDVDFPEGQLPAILDALSIAKPDGTKIVLETQQHLGEERVRTVAMESTDGLIRGMAVENTGRPIQAPVGEGVLGRMLNVVGDPIDGRGPVDAKKTYS-IHRSAPKFEDLSTKAEMFETGIKVIDLLEPYSRGGKTGLFGGAGVGKTVLIMELINNIAKQQSGYSVFAGVGERTREGNDLWHEMMESGVIDKTALVFGQMNEPPGARARVALTGLSIAEYFRDEENRDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGELQDRITSTKNGSVTSVQAIYVPADDLTDPAPATAFAHLDATTVLSRSIAELGIYPAVDPLDSTSRILDPNIVGDDHYDTAQAVKMILQRYKDLQDIIAILGMDELSDEDKLVVSRARKVQRFLSQPFFVAEAFTGLSGKYVKLEETIKGFKEIIAGKHDNLPENAFYLVGTIEE 454
>gi|77920721|ref|YP_358536.1| F0F1 ATP synthase subunit beta [Pelobacter carbinolicus DSM 2380] >gi|118573500|sp|Q39ZU1|ATPB3_PELCD ATP synthase subunit beta 3 (ATPase subunit beta 3) (ATP synthase F1 sector subunit beta 3) >gi|77546804|gb|ABA90366.1| ATP synthase F1, beta subunit [Pelobacter carbinolicus DSM 2380] (468 aa)
Score = 1553, Expect = 3.2e-170, Identities = 303/455 (66%), Positives = 364/455 (80%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK----KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHKN 754
           G I Q+ GPV+DV+F   ++P I   L+V  P+       LV EVA   G++  R I+M ST+GL RG EV+NT   I  PVG   LGR+ NV+GEP+D +   E      IH+  P F +QSTK E FETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELIHNIA  HGG S+FAGVGERTREGNDL++EM +  V+++TALV+GQMNEPPGAR RVAL+ALT+AE+FR+   QDVLLF+DNIFRF+QAGSEVSALLGRIPSAVGYQPTL+ EMG+LQERIT+TK GSITSVQA+YVPADDLTDPAP+TTFAHLDA TVL R+IA LGIYPA++PL+SSSR+LDP ++G EHY+VAR VQ +LQ++++LQDIIAILG+DELSEEDK TVSRARKI+ FLSQPF VAE F+   GKYV   +TI GF EI+EGK D +PEQ F   GGID+V +N
  S:     4 GKITQVIGPVIDVEFEAGELPEIYYALKVSNPSLGDEPWNLVAEVAQHLGENTVRAIAMDSTDGLVRGQEVLNTGRQISVPVGRGTLGRILNVIGEPVDEQGPVETDTTWEIHRPTPEFVDQSTKVEAFETGIKVVDLLAPYARGGKIGLFGGAGVGKTVLIMELIHNIAKKHGGFSVFAGVGERTREGNDLWNEMKESNVLDKTALVYGQMNEPPGARARVALSALTVAEYFRDQENQDVLLFVDNIFRFTQAGSEVSALLGRIPSAVGYQPTLSTEMGELQERITTTKHGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRQIAELGIYPAVDPLDSSSRILDPQVLGEEHYQVARDVQYVLQRYKDLQDIIAILGMDELSEEDKQTVSRARKIQRFLSQPFHVAEIFTGTPGKYVELSETIRGFKEIVEGKHDSVPEQAFYMAGGIDEVLEN 462
>gi|153007332|ref|YP_001381657.1| F0F1 ATP synthase subunit beta [Anaeromyxobacter sp. Fw109-5] >gi|190358251|sp|A7HIX7|ATPB_ANADF ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|152030905|gb|ABS28673.1| ATP synthase F1, beta subunit [Anaeromyxobacter sp. Fw109-5] (481 aa)
Score = 1553, Expect = 3.2e-170, Identities = 300/459 (65%), Positives = 368/459 (80%)
  Q:   292 LNTLKSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLP----NNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVIN-------QTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           + T  +  G I Q+ GPVVDV+F    +P+I   L V  P        LV+EV+   G++ ARCI+M ST+GL RG+ V +T  PI  PVG  VLGR+ NVVG+P+D +     V   PIH+  P+  +Q+ K E FETGIKVIDLL PY++GGKIGLFGGAGVGKTVL+ EL++N+A   GG S+FAGVGERTREGNDLYHEMI+ GVIN       Q  LV+GQMNEPPGAR RVAL+AL +AE+FR+  K+D+LLFIDNIFRF+QAGSEVSALLGRIPSAVGYQPTL+ EMG+LQERITSTK+G+ITSVQA+YVPADDLTDPAP+T FAHLDA TVL RK+  +GIYPA++PL+S+SR+LDP +VG EHY+VAR VQ  LQ++++LQDIIAILG+DELSE+DKLTV+RARK++ FLSQPF VAE+F+   GKYV   DTI GF EI+EGK DD+PEQ F  VGGI++
  S:     1 MATPNAQSGKITQVIGPVVDVEFPPGALPDIYTALSVTNPAIDARADNLVIEVSQHLGENTARCIAMDSTDGLVRGMVVRDTGAPISVPVGKEVLGRILNVVGDPVDERGPVASVRKFPIHRPAPTLVDQNVKIEAFETGIKVIDLLAPYLRGGKIGLFGGAGVGKTVLLMELVNNVAKKRGGFSVFAGVGERTREGNDLYHEMIESGVINKDDLSKSQCVLVYGQMNEPPGARARVALSALAIAEYFRDEEKRDMLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLSTEMGELQERITSTKNGAITSVQAIYVPADDLTDPAPATAFAHLDATTVLSRKLTEIGIYPAVDPLDSTSRILDPLVVGAEHYQVAREVQETLQRYKDLQDIIAILGMDELSEDDKLTVARARKVQRFLSQPFHVAEQFTGNPGKYVELADTIRGFKEIVEGKHDDLPEQAFYMVGGIEE 470
>gi|77918557|ref|YP_356372.1| F0F1 ATP synthase subunit beta [Pelobacter carbinolicus DSM 2380] >gi|118573499|sp|Q3A605|ATPB1_PELCD ATP synthase subunit beta 1 (ATPase subunit beta 1) (ATP synthase F1 sector subunit beta 1) >gi|77544640|gb|ABA88202.1| ATP synthase F1, beta subunit [Pelobacter carbinolicus DSM 2380] (468 aa)
Score = 1552, Expect = 4.2e-170, Identities = 303/455 (66%), Positives = 365/455 (80%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK----KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHKN 754
           G I Q+ GPV+DV+F   ++P I   L+V  P+       LV EVA   G++  R I+M ST+GL RG EV+NT   I  PVG   LGR+ NV+GEP+D +   E      IH+  P F +QSTK E FETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELIHNIA  HGG S+FAGVGERTREGNDL++EM +  V+++TALV+GQMNEPPGAR RVAL+ALT+AE+FR+   QDVLLF+DNIFRF+QAGSEVSALLGRIPSAVGYQPTL+ EMG+LQERIT+TK+GSITSVQA+YVPADDLTDPAP+TTFAHLDA TVL R+IA LGIYPA++PL+SSSR+LDP ++G EHY+VAR VQ +LQ++++LQDIIAILG+DELSEEDK TVSRARKI+ FLSQPF VAE F+   GKYV   +TI GF EI+EGK D +PEQ F   GGID+V +N
  S:     4 GKITQVIGPVIDVEFEAGELPEIYYALKVSNPSLGDEPWNLVAEVAQHLGENTVRAIAMDSTDGLVRGQEVLNTGRQISVPVGRGTLGRILNVIGEPVDEQGPVETDTTWEIHRPTPEFVDQSTKVEAFETGIKVVDLLAPYARGGKIGLFGGAGVGKTVLIMELIHNIAKKHGGFSVFAGVGERTREGNDLWNEMKESNVLDKTALVYGQMNEPPGARARVALSALTVAEYFRDQENQDVLLFVDNIFRFTQAGSEVSALLGRIPSAVGYQPTLSTEMGELQERITTTKNGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRQIAELGIYPAVDPLDSSSRILDPQVLGEEHYQVARDVQYVLQRYKDLQDIIAILGMDELSEEDKQTVSRARKIQRFLSQPFHVAEIFTGTPGKYVELSETIRGFKEIVEGKHDSVPEQAFYMAGGIDEVLEN 462
>gi|169188267|ref|ZP_02848413.1| ATP synthase F1, beta subunit [Paenibacillus sp. JDR-2] >gi|169004916|gb|EDS51771.1| ATP synthase F1, beta subunit [Paenibacillus sp. JDR-2] (467 aa)
Score = 1551, Expect = 4.7e-170, Identities = 297/452 (65%), Positives = 370/452 (81%)
  Q:   299 KGIIYQIFGPVVDVKFARNQMPNINDCLEV--KLPN---NKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           KG +  + GPVVD++F R  +P I + +++  + P    +  L LEVA+  GD++ R ++M +T+GL RG+E ++T  PI  PVG+A LGR+FNV+GEPID           PIH++ P+FDE ST++EI ETGIKVIDLL PY KGGKIGLFGGAGVGKTV +QELI+NIA  HGG+S+FAGVGERTREGNDLYHEM D GV+ +TA+VFGQMNEPPGAR RVALT LTMAE+FR+   +DVLLF+DNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMGQLQERITSTK GS+TS+QA+YVPADD TDPAP+TTFAHLDA T L+RKI+ +GI+PA++PL SSSR+L+P I+G EHY VA+ V+ ILQ+++ELQDIIAILG+DEL+EEDKLTVSRAR+I+ FLSQPF VAE F+   GKYV  ++ +  F EI+EGK DD+PE+ F YVG I++
  S:     3 KGRVVSVMGPVVDLEFERGNLPEILNAVKIVQQAPAGGIDINLTLEVAVHLGDNLVRAVAMSTTDGLVRGMEAVDTGAPITIPVGAATLGRVFNVLGEPIDQAGEAVSETNLPIHRQAPAFDELSTQSEILETGIKVIDLLAPYAKGGKIGLFGGAGVGKTVTIQELINNIAQEHGGISVFAGVGERTREGNDLYHEMKDSGVLPKTAMVFGQMNEPPGARQRVALTGLTMAEYFRDAEGKDVLLFVDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGSVTSIQAIYVPADDYTDPAPATTFAHLDATTNLERKISEMGIFPAVDPLASSSRLLNPEILGEEHYNVAQGVKRILQRYKELQDIIAILGMDELTEEDKLTVSRARRIQLFLSQPFHVAEPFTGIKGKYVPVKEIVRSFKEILEGKHDDLPEEAFRYVGVIEE 459
>gi|51473969|ref|YP_067726.1| F0F1 ATP synthase subunit beta [Rickettsia typhi str. Wilmington] >gi|81826277|sp|Q68VU8|ATPB_RICTY ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|51460281|gb|AAU04244.1| H(+)-transporting two-sector ATPase F(1) beta subunit; ATP synthase.; Chloroplast ATPase.; F(0)F(1)-ATPase.; F(1)-ATPase.; H(+)-transporting ATP synthase.; H(+)-transporting ATPase.; Mitochondrial ATPase. [Rickettsia typhi str. Wilmington] (474 aa)
Score = 1551, Expect = 5.6e-170, Identities = 312/451 (69%), Positives = 363/451 (80%)
  Q:   300 GIIYQIFGPVVDVKFARN-QMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVIN-------QTALVFGQMNEPPGARMRVALTALTMAEHFRENNK-QDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           G I Q+   VVDVKF  N ++P I + LE      +++VLEVA   GDD  RCISMGSTEGL RGLEVI+T NPI  PVG A LGR+ NVVGEPID K   +    S I+K  P F  QST+ +I  TGIKV+DLL PY KGGKIGLFGGAGVGKTVL+ ELI+N+A  HGG ++FAGVGERTREGNDLYHEMI  GVIN       + ALV+GQMNEPPGAR RVAL+ LT+AE FR+ N  QDVL F+DNIFRF+QAG+EVSALLGRIPSAVGYQPTLA +MG+LQERITSTK GSITSVQA+YVPADDLTDPAPST+FAHLDA TVL R+IA LGIYPA++PL+S+S++LDP IVG EHY VAR VQ +LQ ++ LQDIIAILG+DELSEEDKLTVSRARKI+ FLSQPF VAE F+   GK+V+  DTI+GF  ++EGK DD+PE  F  VG ID+
  S:     6 GKITQVISAVVDVKFTNNSKLPEILNALEC-YNAKQRIVLEVAQHIGDDTVRCISMGSTEGLIRGLEVIDTGNPIHIPVGIATLGRIMNVVGEPIDGKGEIKSSTISSIYKPAPDFINQSTERDILVTGIKVVDLLAPYTKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYTVFAGVGERTREGNDLYHEMIASGVINLEAPEKSKVALVYGQMNEPPGARARVALSGLTIAESFRDMNAGQDVLFFVDNIFRFTQAGAEVSALLGRIPSAVGYQPTLATDMGELQERITSTKHGSITSVQAIYVPADDLTDPAPSTSFAHLDATTVLSRQIAELGIYPAVDPLDSNSQVLDPMIVGEEHYSVARQVQQVLQTYKSLQDIIAILGMDELSEEDKLTVSRARKIQRFLSQPFHVAEVFTGVEGKFVNLDDTIAGFKGLVEGKYDDLPEAAFYMVGTIDE 464
>gi|52082213|ref|YP_081004.1| F0F1 ATP synthase subunit beta [Bacillus licheniformis ATCC 14580] >gi|52787604|ref|YP_093433.1| F0F1 ATP synthase subunit beta [Bacillus licheniformis ATCC 14580] >gi|81825160|sp|Q65DX4|ATPB_BACLD ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|52005424|gb|AAU25366.1| ATP synthase (subunit beta) [Bacillus licheniformis ATCC 14580] >gi|52350106|gb|AAU42740.1| AtpD [Bacillus licheniformis DSM 13] (473 aa)
Score = 1551, Expect = 5.9e-170, Identities = 303/453 (66%), Positives = 369/453 (81%)
  Q:   299 KGIIYQIFGPVVDVKFARNQMPNINDCLEV--KLPNNKK----LVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPID-NKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           KG + Q+ GPVVDV+F    +P I + ++V  K  N  +    L LEVAL  GDD  R I+M ST+G+ RG+E I+   PI  PVG+  LGR+FNV+GE ID ++P+P      PIH++ P FD+ ST+ EI ETGIKV+DLL PY+KGGKIGLFGGAGVGKTVL+QELI+NIA  HGG+S+FAGVGERTREGNDLY+EM D GVI +TA+VFGQMNEPPGARMRVALT LTMAEHFR+   QDVL FIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMGQLQERITST  GS+TS+QA+YVPADD TDPAP+TTFAHLDA T L+RK++ +GIYPA++PL S+SR L P IVG EHY+VARSVQ ILQ+++ELQDIIA+LG+DELS+EDKL VSRAR+++ FLSQ F VAE+F+ + G YV  ++T+ GF EI+EGK D +PE  F  VG I++V
  S:     3 KGRVSQVLGPVVDVRFEDGHLPEIYNAIKVTHKAQNENEVDIDLTLEVALHLGDDSVRTIAMASTDGVTRGMEAIDLGEPISVPVGNVTLGRVFNVLGENIDLDEPLPADAAKDPIHREAPKFDQLSTEVEILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELINNIAQEHGGISVFAGVGERTREGNDLYYEMKDSGVIGKTAMVFGQMNEPPGARMRVALTGLTMAEHFRDKEGQDVLFFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTNVGSVTSIQAIYVPADDYTDPAPATTFAHLDATTNLERKLSEMGIYPAVDPLASTSRALSPEIVGEEHYEVARSVQQILQRYKELQDIIAMLGMDELSDEDKLVVSRARRVQFFLSQNFHVAEQFTGQKGSYVPVKETVKGFKEILEGKYDHLPEDAFRLVGRIEEV 462
>gi|118474804|ref|YP_892659.1| F0F1 ATP synthase subunit beta [Campylobacter fetus subsp. fetus 82-40] >gi|190358269|sp|A0RR26|ATPB_CAMFF ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|118414030|gb|ABK82450.1| ATP synthase F1, beta subunit [Campylobacter fetus subsp. fetus 82-40] (465 aa)
Score = 1550, Expect = 6.2e-170, Identities = 303/452 (67%), Positives = 365/452 (80%)
  Q:   299 KGIIYQIFGPVVDVKFARNQMPNINDCLEVKLP---NNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           KGII Q+ GPVVDV F ++ +P IN+ +EV      N  KL+LE A   GD+  R I+M  +EGL RGL+ I   +PI  PVG  VLGR+FNV+G+ ID     +  +   IH+ PP+F++QSTK+EIFETGIKV+DLL PY KGGK+GLFGGAGVGKTV++ ELIHN+A  H G S+FAGVGERTREGNDLY+EM + GV+++ AL +GQMNEPPGAR R+ALT LTMAE+FR+    DVL+FIDNIFRFSQ+GSE+SALLGRIPSAVGYQPTLA EMG+LQERITSTK GSITSVQAVYVPADDLTDPAP+T FAHLDA TVL+R IA  GIYPA++PL+S+SRMLDP I+G EHYK+AR VQ +LQK+++LQDIIAILG+DELSEEDKLTV RARKI  +LSQPFFVAE F+   GKYVS ++TI+GF  I+EGK D +PE  F  VG ID+
  S:     2 KGIISQVMGPVVDVDF-KDYLPKINEAIEVNFTVEGNTHKLILETAAHLGDNRVRTIAMDMSEGLTRGLDAIALGSPISVPVGEKVLGRIFNVIGDLIDEGEEEKFDKKWSIHRDPPAFEDQSTKSEIFETGIKVVDLLAPYAKGGKVGLFGGAGVGKTVIIMELIHNVAFKHSGYSVFAGVGERTREGNDLYNEMKESGVLDKVALCYGQMNEPPGARNRIALTGLTMAEYFRDEMGLDVLMFIDNIFRFSQSGSEMSALLGRIPSAVGYQPTLASEMGRLQERITSTKKGSITSVQAVYVPADDLTDPAPATVFAHLDATTVLNRAIAEKGIYPAVDPLDSTSRMLDPQILGEEHYKIARGVQAVLQKYKDLQDIIAILGMDELSEEDKLTVDRARKIEKYLSQPFFVAEVFTGSPGKYVSLEETIAGFKGILEGKYDQLPENAFYMVGNIDE 455
>gi|118726890|ref|ZP_01575505.1| ATP synthase F1, beta subunit [Clostridium cellulolyticum H10] >gi|118663705|gb|EAV70351.1| ATP synthase F1, beta subunit [Clostridium cellulolyticum H10] (465 aa)
Score = 1550, Expect = 6.9e-170, Identities = 299/459 (65%), Positives = 359/459 (78%)
  Q:   295 LKSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVL-EVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHK 753
           +    G+I Q+ GPV+D++F    +P+I +   +K+P +   V  EV    G+D  RC++M ST+GL RG++  +T + I  PVG  VLGR+FNV+GEP+D     E   Y PIH++ PS +EQ   TEI ETGIKV+DLL PY KGGKIGLFGGAGVGKTVL+ ELI NIAT HGG SIF GVGERTREGNDL+H+M D GVI +TA+VFGQMNEPPGARMRV LT LTMAE+FR+   QDVLLFIDNIFRF QAGSEVSALLGRIPSAVGYQPTLA ++G LQERI ST  GSITSVQAVYVPADDLTDPAP+TTFAHLDA TVL R I ++GIYPA++PLES+SR+LDP +VG EHY +AR VQ ILQ+ +ELQDIIAILG+DEL EEDKLTV RARKI+ +LSQPFFV E+F+   GKYV  ++TI GF EII+GK D+I E  F   G I++V++
  S:     1 MAGSSGVIVQVIGPVLDIRFENGILPDIYNA--IKIPADSGTVTAEVMQHLGNDTVRCVAMSSTDGLVRGMKAEDTGDAITVPVGKEVLGRIFNVLGEPVDKAGPVEPTAYLPIHREAPSLEEQRPSTEILETGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELIRNIATEHGGYSIFTGVGERTREGNDLWHDMNDSGVIEKTAMVFGQMNEPPGARMRVGLTGLTMAEYFRDQMGQDVLLFIDNIFRFVQAGSEVSALLGRIPSAVGYQPTLATDVGALQERIASTNKGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSRDIVAMGIYPAVDPLESTSRILDPKVVGEEHYTIARKVQEILQRNKELQDIIAILGMDELPEEDKLTVFRARKIQRYLSQPFFVGEQFTGYKGKYVPIKETIRGFKEIIDGKMDNISEAAFYMKGTIEEVYE 458
>gi|193214200|ref|YP_001995399.1| ATP synthase F1, beta subunit [Chloroherpeton thalassium ATCC 35110] >gi|193087677|gb|ACF12952.1| ATP synthase F1, beta subunit [Chloroherpeton thalassium ATCC 35110] (465 aa)
Score = 1550, Expect = 7.2e-170, Identities = 302/455 (66%), Positives = 364/455 (80%)
  Q:   299 KGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHK 753
           +G I QI GPVVDV F   Q+P+I D L V+ P+  +LVLE     G++  R I+M +TEGL RG++V+NTKNPI  PVG  VLGRM NVVG+PID        +   IH+  P+FDE STK E+FETGIKVIDLL PY +GGK GLFGGAGVGKTVL+ ELI+NIA    G S+FAGVGERTREGNDL+ EM + GVI++TALVFGQMNEPPGAR RVALTAL++AE+FR+   +DVLLF+DNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMG LQERI STK GSITSVQA+YVPADDLTDPAP+TTF HLDA TVL R IA LGIYPA++PL+S+SR+LDP+I+G +HY  A++V+ ILQ++++LQDIIAILG+DELS+EDKL V+RARK++ FLSQPFFVAE+F+   GKYV  +DTI  F EIIEG+ D +PE  F  VG I+D  K
  S:     3 EGKITQIIGPVVDVDFVDGQLPSIMDALIVERPDGTELVLETQQHLGEERVRTIAMEATEGLVRGMKVVNTKNPIQTPVGENVLGRMLNVVGKPIDGLGEVHATKTYSIHRPSPAFDELSTKAEMFETGIKVIDLLEPYSRGGKTGLFGGAGVGKTVLIMELINNIAKQQSGYSVFAGVGERTREGNDLWEEMKESGVIDKTALVFGQMNEPPGARARVALTALSIAEYFRDEENRDVLLFVDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGALQERIVSTKKGSITSVQAIYVPADDLTDPAPATTFTHLDATTVLSRSIAELGIYPAVDPLDSTSRILDPNIIGRDHYDTAQAVKQILQRYKDLQDIIAILGMDELSDEDKLLVARARKVQRFLSQPFFVAEQFTGLEGKYVRLEDTIKAFKEIIEGRHDSLPENAFYLVGTIEDAIK 457
>gi|169852676|ref|XP_001833020.1| ATP synthase beta chain [Coprinopsis cinerea okayama7#130] >gi|116505814|gb|EAU88709.1| ATP synthase beta chain [Coprinopsis cinerea okayama7#130] (540 aa)
Score = 1549, Expect = 7.8e-170, Identities = 301/452 (66%), Positives = 359/452 (79%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVI-----NQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           G +  + G VVDV+F  + +P I + LEV+  +  +LVLEVA   G++  R I+M  TEGL RG +V++T  PIM PVG   LGR+ NV+GEPID +   +  +  PIH  PP+F +QST  E+ ETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+QELI+N+A  HGG SIF GVGERTREGNDLYHEMI+ GVI     ++ ALVFGQMNEPPGAR RVALT LT+AE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGRIPSAVGYQPTL+ +MG +QERIT+TK GSITSVQAVYVPADDLTDPAP+TTFAHLDA TVL R IA LGIYPA++PL+S SRMLDP IVG EHY+VA +VQ ILQ ++ LQDIIAILG+DELSEEDKLTV RARKI+ F+SQPF VA+ F+   GK V+ +DTI  F EI+ G+ D +PE  F  VG I+DV
  S:    71 GTVKTVIGAVVDVQFESDNLPPILNALEVQDFHGGRLVLEVASHLGENSVRTIAMDGTEGLVRGAKVVDTGAPIMVPVGKGTLGRIINVIGEPIDERGPIKGEKMLPIHADPPAFVDQSTTAEVLETGIKVVDLLAPYARGGKIGLFGGAGVGKTVLIQELINNVAKAHGGFSIFCGVGERTREGNDLYHEMIETGVIQLEGDSKVALVFGQMNEPPGARARVALTGLTIAEYFRDEEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLSTDMGAMQERITTTKKGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSRSIAELGIYPAVDPLDSKSRMLDPRIVGQEHYEVATAVQKILQDYKSLQDIIAILGMDELSEEDKLTVERARKIQRFMSQPFQVAQVFTGYEGKLVTLKDTIRSFKEILSGQHDSLPESAFYMVGTIEDV 527
>gi|189345587|ref|YP_001942116.1| ATP synthase F1, beta subunit [Chlorobium limicola DSM 245] >gi|189339734|gb|ACD89137.1| ATP synthase F1, beta subunit [Chlorobium limicola DSM 245] (462 aa)
Score = 1549, Expect = 9.3e-170, Identities = 300/452 (66%), Positives = 363/452 (80%)
  Q:   299 KGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           +G I QI GPVVDV F   Q+P+I D L +  P+  +LVLE     G++  R ++M ST+GL RGL V+NT   I  PVGS VLGRM NVVGEPID K      +   IH+  P F++ STK E+FETGIKVIDLL PY +GGK GLFGGAGVGKTVL+ ELI+NIA    G S+FAGVGERTREGNDLYHEM++ GVI +TALVFGQMNEPPGAR RVALT L++AE+FR+   +DVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMG+LQ+RITSTK+GS+TSVQA+YVPADDLTDPAP+T FAHLDA TVL R IA LGIYPA++PL+S+SR+LDP+IVG +HY  A++V+ ILQ++++LQDIIAILG+DELS+EDKL VSRARK++ FLSQPFFVAE F+  +GKYV  ++TI GF EII GK D++PE  F  VG I++
  S:     3 EGKISQIIGPVVDVDFPEGQLPSILDALYIVRPDGSRLVLETQQHLGEERVRTVAMESTDGLVRGLSVVNTGKSIQVPVGSEVLGRMLNVVGEPIDGKGAVNTKKTYSIHRSAPKFEDLSTKAEMFETGIKVIDLLEPYSRGGKTGLFGGAGVGKTVLIMELINNIAKQQSGFSVFAGVGERTREGNDLYHEMMESGVIEKTALVFGQMNEPPGARQRVALTGLSIAEYFRDEENRDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGELQDRITSTKNGSVTSVQAIYVPADDLTDPAPATAFAHLDATTVLSRSIAELGIYPAVDPLDSTSRILDPNIVGDDHYNTAQAVKQILQRYKDLQDIIAILGMDELSDEDKLVVSRARKVQRFLSQPFFVAEAFTGLAGKYVKLEETIKGFKEIIAGKHDNLPENAFYLVGTIEE 454
>gi|116618945|ref|YP_819316.1| F0F1 ATP synthase subunit beta [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|122270855|sp|Q03V29|ATPB_LEUMM ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|28193535|emb|CAD48595.1| F1F0-ATPase subunit beta [Leuconostoc mesenteroides subsp. mesenteroides] >gi|116097792|gb|ABJ62943.1| F0F1-type ATP synthase, beta subunit [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (466 aa)
Score = 1549, Expect = 9.8e-170, Identities = 300/452 (66%), Positives = 363/452 (80%)
  Q:   300 GIIYQIFGPVVDVKF-ARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNK-PMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           G + Q+ GPVVD+ F A  Q+P+IN+ L +   N + L +EV+L  GD V R I+M ST+GL RG+ V++T NPI  PVG A LGR+FNV+GEP+DN   +   V  S IH+  P +DE ++ TEI ETGIKVIDLL PYV+GGKIGLFGGAGVGKTVL+QELIHNIA GH G+S+F GVGERTREGND+YHEM + GV+ QTA+V+GQMNEPPGARMRVALT LTMAE+FR+N  +DVLLFIDNIFRF+QAGSEVSALLGRIPSAVGYQPTLA EMGQLQERITSTK GS+TS+QAVYVPADD TDPAP+TTFAHLDA T L+R +   GIYPA++PL S+S  LDP IVG EHY+VA  VQ  LQ++ ELQDII+ILG+DELS+E+K TV+RAR+I+ FLSQPF VAE F+  +G+YV   +T+  F EI++GK DD+PE  F  VG I+ V
  S:     4 GKVVQVIGPVVDIAFEAGQQVPDINNALVIDKGNGQSLTVEVSLALGDGVVRTIAMDSTDGLQRGMGVVDTGNPIEVPVGEATLGRVFNVLGEPVDNNGAIASDVRRSSIHRDAPKYDELTSSTEILETGIKVIDLLAPYVRGGKIGLFGGAGVGKTVLIQELIHNIAQGHNGISVFTGVGERTREGNDMYHEMEESGVLKQTAMVYGQMNEPPGARMRVALTGLTMAENFRDNEGKDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGQLQERITSTKKGSVTSIQAVYVPADDYTDPAPATTFAHLDATTNLERALTQQGIYPAVDPLASTSSALDPQIVGQEHYEVATEVQRTLQRYRELQDIISILGMDELSDEEKTTVNRARRIQFFLSQPFSVAETFTGINGEYVPVAETVRSFKEILDGKYDDLPEDAFRNVGAIEQV 457
>gi|78043094|ref|YP_361338.1| F0F1 ATP synthase subunit beta [Carboxydothermus hydrogenoformans Z-2901] >gi|118573518|sp|Q3A946|ATPB_CARHZ ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|77995209|gb|ABB14108.1| ATP synthase F1, beta subunit [Carboxydothermus hydrogenoformans Z-2901] (473 aa)
Score = 1549, Expect = 1.0e-169, Identities = 297/439 (67%), Positives = 359/439 (81%)
  Q:   313 KFARNQMPNINDCLEVKLPNNK-------KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           +F   ++P I + L+++  +          L LEVA   G++  R ++M ST+GL RG++V++T  PI  PVG  VLGR+ NV+GEPID K   E   Y PIH+  P  +EQST+ EI ETGIKVIDLLVP++KGGKIGLFGGAGVGKTV+V ELI+NIA  HGG+S+FAGVGERTREGNDLYHEM + GV+++T +VFGQMNEPPG R+RV LT LTMAE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMGQLQERITST+ GSITSVQAVYVPADDLTDPAP+TTFAHLDA  VL R+IA LGIYPA++PL+S+SR+LDP IVG EHY+VAR VQ +LQ+++ELQDIIAILG+DELS+EDKL V+RARK++ FLSQPF VAE F+ + GKYV  ++TI GF EI+EGK DDIPE  F   G ID+V
  S:    17 EFEPGKVPPIYNALKIRSEDQDTPTEVPINLTLEVAQHLGNNRVRAVAMSSTDGLVRGMKVVDTGAPITVPVGRPVLGRLLNVLGEPIDGKGPVESDHYYPIHRPAPPLEEQSTRAEILETGIKVIDLLVPFLKGGKIGLFGGAGVGKTVIVMELINNIAKQHGGISVFAGVGERTREGNDLYHEMKEAGVLDKTIMVFGQMNEPPGVRLRVGLTGLTMAEYFRDEEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTRKGSITSVQAVYVPADDLTDPAPATTFAHLDATVVLSRQIAELGIYPAVDPLDSTSRILDPHIVGEEHYQVARGVQRVLQRYKELQDIIAILGMDELSDEDKLIVARARKLQRFLSQPFTVAEAFTGRPGKYVPVKETIRGFKEILEGKHDDIPETCFYMAGTIDEV 462
>gi|156530137|gb|ABU75165.1| AtpB [Hannoa undulata] (470 aa)
Score = 1548, Expect = 1.2e-169, Identities = 303/452 (67%), Positives = 359/452 (79%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           G I QI GPV+DV F   +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIHK  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+SIF GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+V
  S:     3 GHIAQIIGPVLDVAFLPGKMPNIYNALVVKGRDTVGQPINMTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHKPAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSIFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFKLILSGELDGLPEQAFYLVGNIDEV 465
>gi|41179057|ref|NP_958414.1| ATP synthase CF1 beta subunit [Chlamydomonas reinhardtii] >gi|336667|gb|AAA84146.1| ATP synthase beta subunit [Chlamydomonas reinhardtii] >gi|28269780|tpg|DAA00958.1| TPA_inf: TPA_exp: CF1 ATP synthase beta subunit [Chlamydomonas reinhardtii] (491 aa)
Score = 1548, Expect = 1.2e-169, Identities = 300/451 (66%), Positives = 360/451 (79%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK----KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVI-------NQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           G I QI GPV+D+ FA+ Q+PNI + L ++  N+      +  EV  L GD+  R +SM  TEGL RG+EV++T  P+  PVG   LGR+FNV+GEP+DN    +  E  PIH+  P+F +  T+  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+FAGVGERTREGNDLY EM + GVI       ++ ALV+GQMNEPPGARMRVALTALTMAE+FR+ NKQDVL FIDNIFRF QAG+EVSALLGR+PSAVGYQPTLA EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PLES+S ML P I+G +HY  A+SV+  LQ+++ELQDIIAILG+DELSEED+L V+RARKI  FLSQPFFVAE F+   GKYVS  +TI GF +I  G+ DD+PEQ F  VG I +
  S:    21 GRIVQIIGPVLDIVFAKGQVPNIYNALTIRAKNSAGTEMAVTCEVQQLLGDNCVRAVSMNPTEGLMRGMEVVDTGKPLSVPVGKVTLGRIFNVLGEPVDNMGNVKVEETLPIHRTAPAFVDLDTRLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFAGVGERTREGNDLYTEMKESGVIVEKNLSDSKVALVYGQMNEPPGARMRVALTALTMAEYFRDVNKQDVLFFIDNIFRFVQAGAEVSALLGRMPSAVGYQPTLATEMGGLQERITSTKDGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRNLAAKGIYPAVDPLESTSTMLQPWILGEKHYDSAQSVKKTLQRYKELQDIIAILGLDELSEEDRLIVARARKIERFLSQPFFVAEVFTGSPGKYVSLAETIEGFGKIFAGELDDLPEQAFYLVGNITE 482
>gi|124522171|ref|ZP_01696880.1| ATP synthase F1, beta subunit [Bacillus coagulans 36D1] >gi|124496270|gb|EAY43878.1| ATP synthase F1, beta subunit [Bacillus coagulans 36D1] (473 aa)
Score = 1547, Expect = 1.3e-169, Identities = 302/454 (66%), Positives = 366/454 (80%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEV--KLPNNKKL----VLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPID-NKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHK 753
           G + Q+ GPVVDVKF   Q+P+I + L++  K  N  ++     LEVAL  GDD  R I+M ST+G+ RG+EV++T  PI  PVG A LGR+FNV+GE ID +  +   V   PI K  PSF++ ST+ EI ETGIKV+DLL PY+KGGKIGLFGGAGVGKTVL+QELI+N+A  HGG+S+FAGVGERTREGNDLY+EM D GVI +TA+VFGQMNEPPGARMRVALT LTMAE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMGQLQERITST  GSITS+QA+YVPADD TDPAP+TTFAHLDA T L+R+++ +GIYPA++PL S+SR L P IVG EHY VAR VQ  LQ++ ELQDIIAILG+DELSE+DK+ V+RAR+I+ FLSQ F VAE+F+ + G YV  ++T+ GF EI+EGK D +PE  F  VG I+D  K
  S:     4 GHVLQVMGPVVDVKFENGQLPDIYNALKINYKAKNANEVDINVTLEVALHLGDDAVRTIAMASTDGIRRGMEVVDTGAPISVPVGEATLGRVFNVLGEVIDLDGELKGNVRRDPIQKPAPSFEQLSTQVEILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELINNVAQEHGGISVFAGVGERTREGNDLYYEMKDSGVIAKTAMVFGQMNEPPGARMRVALTGLTMAEYFRDEQGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTNKGSITSIQAIYVPADDYTDPAPATTFAHLDATTNLERRLSEMGIYPAVDPLASTSRALSPEIVGEEHYNVARQVQQTLQRYRELQDIIAILGMDELSEDDKMIVARARRIQFFLSQNFHVAEQFTGQPGSYVPVKETVRGFKEILEGKYDHLPEDAFRLVGTIEDAVK 464
>gi|156530211|gb|ABU75202.1| AtpB [Simarouba glauca] (484 aa)
Score = 1547, Expect = 1.4e-169, Identities = 303/456 (66%), Positives = 361/456 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           K + G I QI GPV+DV F   +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIHK  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+SIF GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +T+ GF  I+ G+ D +PEQ F  VG ID+V
  S:    16 KKNLGHIAQIIGPVLDVAFLPGKMPNIYNALVVKGRDTVGQPINMTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHKPAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSIFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETVRGFKLILSGELDGLPEQAFYLVGNIDEV 482
>gi|154148258|ref|YP_001406268.1| F0F1 ATP synthase subunit beta [Campylobacter hominis ATCC BAA-381] >gi|190358270|sp|A7I177|ATPB_CAMHC ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|153804267|gb|ABS51274.1| ATP synthase F1, beta subunit [Campylobacter hominis ATCC BAA-381] (465 aa)
Score = 1547, Expect = 1.4e-169, Identities = 310/453 (68%), Positives = 365/453 (80%)
  Q:   299 KGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPN---NKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYS-PIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           KGII Q+ GPVVDV F ++ +P IN+ +EVK       K+LVLEVA   GD+  R I+M  ++GL RGLE      PI  PVG  VLGR+FNV G+ ID    PE  E    IH+ PPSF++QSTK+EIFETGIKV+DLL PY KGGK+GLFGGAGVGKTV++ ELIHN+A  H G S+FAGVGERTREGNDLY+EM + GV+++ AL +GQMNEPPGAR R+ALT LTMAE+FR+    DVL+FIDNIFRFSQ+GSE+SALLGRIPSAVGYQPTLA EMG+LQERITSTK GSITSVQAVYVPADDLTDPAP+T FAHLDA TVL+R IA  GIYPA++PL S+SRMLDP IVG EHYK+AR VQ +LQK+++LQDIIAILG+DELSEEDKL V RARKI  +LSQPFFVAE F+   GKY+S +DTI+GF  I+EGK DD+PE  F  VG ID+V
  S:     2 KGIISQVMGPVVDVDF-KDYLPKINEAIEVKYDVEGIQKRLVLEVAAHLGDNKVRTIAMDMSDGLRRGLEAEALGAPISVPVGKKVLGRIFNVTGDLIDEGE-PEDFETRWSIHRDPPSFEDQSTKSEIFETGIKVVDLLAPYAKGGKVGLFGGAGVGKTVIIMELIHNVAFKHNGYSVFAGVGERTREGNDLYNEMKESGVLDKVALTYGQMNEPPGARNRIALTGLTMAEYFRDELGLDVLMFIDNIFRFSQSGSEMSALLGRIPSAVGYQPTLASEMGKLQERITSTKKGSITSVQAVYVPADDLTDPAPATVFAHLDATTVLNRSIAEKGIYPAVDPLNSTSRMLDPQIVGEEHYKIARGVQAVLQKYKDLQDIIAILGMDELSEEDKLVVERARKIEKYLSQPFFVAEVFTGSPGKYISLEDTIAGFKGILEGKYDDLPENAFYMVGSIDEV 456
>gi|75908515|ref|YP_322811.1| F0F1 ATP synthase subunit beta [Anabaena variabilis ATCC 29413] >gi|118573506|sp|Q3MAS0|ATPB_ANAVT ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|75702240|gb|ABA21916.1| ATP synthase F1, beta subunit [Anabaena variabilis ATCC 29413] (482 aa)
Score = 1547, Expect = 1.5e-169, Identities = 303/455 (66%), Positives = 364/455 (80%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK----KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K++ G I QI GPVVDVKF   ++P I + L +K  N       L +EV  L GD+  R ++M ST+GL RGLEV++T  PI  PVG A LGR+FNV+GEP+DN+      E  PIH+  P   E  TK  +FETGIKV+DLL PY +GGKIGLFGGAGVGKTV++ ELI+NIAT HGG+S+FAGVGERTREGNDLY+EMI+ GVIN+        ALV+GQMNEPPGARMRV L+ LTMAE+FR+ NKQDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL  ++GQLQERITST  GSITS+QAVYVPADDLTDPAP+TTFAHLD  TVL R +A+ GIYPA++PL S+S ML P+IVG EHY  AR+VQ+ LQ+++ELQDIIAILG+DELSEED+L V+RARK+  FLSQPFFVAE F+   GKYV  +DTI GF +I+ G+ DD+PEQ F  VG I++
  S:     7 KTNIGYITQIIGPVVDVKFPSGKLPQIYNALTIKGTNEAGQELNLTVEVQQLLGDNQIRAVAMSSTDGLVRGLEVVDTGAPISVPVGKATLGRIFNVLGEPVDNRGPVNNQETLPIHRPAPKLTELETKPSVFETGIKVVDLLTPYRRGGKIGLFGGAGVGKTVIMMELINNIATQHGGVSVFAGVGERTREGNDLYNEMIESGVINKDNLNESKIALVYGQMNEPPGARMRVGLSGLTMAEYFRDVNKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLGTDVGQLQERITSTTEGSITSIQAVYVPADDLTDPAPATTFAHLDGTTVLSRGLAAKGIYPAVDPLGSTSTMLQPNIVGDEHYNTARAVQSTLQRYKELQDIIAILGLDELSEEDRLIVARARKVERFLSQPFFVAEVFTGSPGKYVKLEDTIKGFQKILSGELDDLPEQAFYLVGDINE 472
>gi|125717636|ref|YP_001034769.1| F0F1 ATP synthase subunit beta [Streptococcus sanguinis SK36] >gi|166222420|sp|A3CM14|ATPB_STRSV ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|125497553|gb|ABN44219.1| Proton-translocating ATPase, F1 sector, beta subunit, putative [Streptococcus sanguinis SK36] (468 aa)
Score = 1547, Expect = 1.6e-169, Identities = 306/452 (67%), Positives = 364/452 (80%)
  Q:   300 GIIYQIFGPVVDVKFAR-NQMPNINDCLEVKLPNNKK--LVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPID-NKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           G I Q+ GPVVDV FA  +++P IN+ L V   + KK  +VLEVAL  GD V R I+M ST+GL RGLEV++T  PI  PVG   LGR+FNV+G+ ID + P P   E  PIHKK P+FDE ST +EI ETGIKVIDLL PY+KGGK+GLFGGAGVGKTVL+QELIHNIA  HGG+S+F GVGERTREGNDLY EM + GVI +TA+VFGQMNEPPGARMRVALT LT+AE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMGQLQERITSTK GS+TS+QA+YVPADD TDPAP+T FAHLD+ T L+RK+  LGIYPA++PL SSSR L P IVG EHY VA  V+ +LQ++ ELQDIIAILG+DELS+++K  V+RAR+I+ FLSQ F VAE+F+ + G YV   +T+ GF EI+EGK D +PE  F  VG I+DV
  S:     4 GKIAQVIGPVVDVAFAAGDKLPEINNALVVYKNDEKKSKIVLEVALELGDGVVRTIAMESTDGLTRGLEVLDTGRPISVPVGKETLGRVFNVLGDTIDLDAPFPADAERQPIHKKAPTFDELSTSSEILETGIKVIDLLAPYLKGGKVGLFGGAGVGKTVLIQELIHNIAQEHGGISVFTGVGERTREGNDLYWEMKESGVIEKTAMVFGQMNEPPGARMRVALTGLTIAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGSVTSIQAIYVPADDYTDPAPATAFAHLDSTTNLERKLVQLGIYPAVDPLASSSRALSPEIVGEEHYAVAAEVKRVLQRYHELQDIIAILGMDELSDDEKTLVARARRIQFFLSQNFNVAEQFTGQPGSYVPVAETVRGFKEILEGKHDKLPEDAFRGVGSIEDV 459
>gi|156530213|gb|ABU75203.1| AtpB [Simarouba tulae] (471 aa)
Score = 1547, Expect = 1.6e-169, Identities = 303/456 (66%), Positives = 361/456 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           K + G I QI GPV+DV F   +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIHK  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+SIF GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +T+ GF  I+ G+ D +PEQ F  VG ID+V
  S:     3 KKNLGHIAQIIGPVLDVAFLPGKMPNIYNALVVKGRDTVGQPINMTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHKPAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSIFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETVRGFKLILSGELDGLPEQAFYLVGNIDEV 469
>gi|461568|sp|Q05373|ATPB_SYNP1 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|480499|pir||S36972 H+-transporting two-sector ATPase (EC 3.6.3.14) beta chain - Synechococcus sp. (PCC 6716) >gi|49227|emb|CAA49882.1| ATP synthase (beta); H(+)-transporting ATP synthase [Synechococcus sp.] (482 aa)
Score = 1547, Expect = 1.7e-169, Identities = 296/453 (65%), Positives = 361/453 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKL----VLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGI 748
           +++ G I Q+ GPV+D++F   +MP I + L ++  N   L      EV  L GD+  R ++M ST+GL RG+E ++T  PI  PVG+A LGR+FNV+GEP+D K      E  PIH+  PSF E  TK  +FETGIKVIDLL PY +GGKIGLFGGAGVGKTV++ ELI+NIAT HGG+S+FAGVGERTREGNDLY+EMI+ GVI++        ALV+GQMNEPPGARMRV L+ LTMAE+FR+ NKQDVLLF+DNIFRF QAGSEVSALLGR+PSAVGYQPTL  ++G LQERITST  GSITS+QAVYVPADDLTDPAP+TTFAHLD  TVL R +A+ GIYPA++PL S+S ML P IVG EHY+ AR+VQ  LQ+++ELQDIIAILG+DELSEED+LTV+RARK+  FLSQPFFVAE F+   GKYV+ ++TI GF  I+ G+ DD+PEQ F  VG I
  S:     7 RTNVGFITQVIGPVIDIEFPSGKMPAIYNALRIQGKNAAGLDVAVTCEVQQLLGDNRVRAVAMSSTDGLVRGMEAVDTGAPISVPVGTATLGRIFNVLGEPVDEKGEVNISETLPIHRPAPSFTELETKPSVFETGIKVIDLLTPYRRGGKIGLFGGAGVGKTVIMMELINNIATQHGGVSVFAGVGERTREGNDLYNEMIESGVIDKDDPSKSKIALVYGQMNEPPGARMRVGLSGLTMAEYFRDVNKQDVLLFVDNIFRFVQAGSEVSALLGRMPSAVGYQPTLGTDVGALQERITSTMEGSITSIQAVYVPADDLTDPAPATTFAHLDGTTVLSRGLAAKGIYPAVDPLGSTSNMLQPDIVGSEHYQTARAVQATLQRYKELQDIIAILGLDELSEEDRLTVARARKVERFLSQPFFVAEVFTGAPGKYVTLEETIKGFQMILSGELDDLPEQAFYMVGNI 470
>gi|148260678|ref|YP_001234805.1| F0F1 ATP synthase subunit beta [Acidiphilium cryptum JF-5] >gi|190358247|sp|A5FZ54|ATPB_ACICJ ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|146402359|gb|ABQ30886.1| ATP synthase F1, beta subunit [Acidiphilium cryptum JF-5] (476 aa)
Score = 1547, Expect = 1.7e-169, Identities = 305/465 (65%), Positives = 366/465 (78%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNK-PMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVI---------NQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHKNYVAANS 760
           K+  G I QI GPVVDV+F   ++P I + LE ++  +++LVLEVA   G+   RCI+M ST+GL RG EV +T   I  PVG   LGR+ NV+GEPID + P+P     +PIH++ PSFDEQ+T  EI  TGIKV+DLL PY+KGGKIGLFGGAGVGKTVL+QELI+NIA GHGG+S+FAGVGERTREGNDLYHEMID GVI         ++ ALV+GQMNEPPGARMRV L+ LTMAE+FR+   QDVL F+DNIFRF+QAG+EVSALLGRIPSAVGYQPTLA +MG LQERITSTK GSITSVQA+YVPADDLTDPAP+T+F+HLDA T L+R IA  GIYPA++PL+S+SR LDP IVG EHY VAR VQ ILQ ++ LQDIIAILG+DELSE+DKLTV+RARKI  FLSQPF VAE F+   G +V  +DT+  F  I  G+ D +PE  F  VG I+D  K   + N+
  S:     3 KNVTGRITQIMGPVVDVQF-EGELPYILNALETRV-GDRRLVLEVAQEIGERTVRCIAMDSTDGLARGDEVRDTGEAIAVPVGPETLGRILNVIGEPIDERGPIP-TTRTAPIHRQAPSFDEQATSAEILVTGIKVVDLLAPYLKGGKIGLFGGAGVGKTVLIQELINNIAKGHGGVSVFAGVGERTREGNDLYHEMIDAGVIKLGEGTTEGSKVALVYGQMNEPPGARMRVGLSGLTMAEYFRDEEGQDVLFFVDNIFRFTQAGAEVSALLGRIPSAVGYQPTLATDMGALQERITSTKKGSITSVQAIYVPADDLTDPAPATSFSHLDATTTLNRAIAEKGIYPAVDPLDSTSRALDPRIVGEEHYNVAREVQRILQSYKSLQDIIAILGMDELSEDDKLTVARARKIERFLSQPFHVAEVFTGSPGIFVPVEDTVRSFKAICAGEYDHLPEAAFYMVGTIEDAVKKAESLNA 474
>gi|167463135|ref|ZP_02328224.1| F0F1 ATP synthase subunit beta [Paenibacillus larvae subsp. larvae BRL-230010] (468 aa)
Score = 1547, Expect = 1.7e-169, Identities = 292/456 (64%), Positives = 369/456 (80%)
  Q:   298 DKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK------KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHK 753
           +KG I  + GPVVD++F R  +P+I + + ++            L +EVAL  GD++ RC++M ST+GL RG+EV++T  PIM PVG + LGR++NV+GEPID     ++   SPIHK  P + + +T+ E+ ETGIKV+DLL PY+KGGKIGLFGGAGVGKTV +QELIHNIA  HGG+S+FAGVGERTREGNDLYHEM D GVI +TA+VFGQMNEPPGAR+RVAL+ LTMAE+FR+   +DVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMGQLQERITSTK GS+TS+QA+YVPADD TDPAP+T FAHLDA T L+R IA+ GI+PA++PL S+SR+L P IVG EHY+VA+ V+ ILQ+++ELQDIIAILG+DELSEEDK+TV+RAR+I  FLSQP  VAE+F+   G YV  ++T+  F E++EGK DD+PE  F+ VG I++  +
  S:     2 NKGRIVSVQGPVVDIEFERGHLPDILNAITIEKKAESANEVGIHLTVEVALQLGDNLVRCVAMSSTDGLVRGMEVVDTGAPIMVPVGPSTLGRVYNVLGEPIDGDGEADRTLTSPIHKPAPEYSDLTTQAEMLETGIKVVDLLAPYMKGGKIGLFGGAGVGKTVTMQELIHNIAQEHGGISVFAGVGERTREGNDLYHEMKDSGVIAKTAMVFGQMNEPPGARLRVALSGLTMAEYFRDEEGRDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGSVTSIQAIYVPADDYTDPAPATAFAHLDATTNLERSIAAKGIFPAVDPLASTSRILTPQIVGEEHYEVAQGVKEILQRYKELQDIIAILGMDELSEEDKITVNRARRIERFLSQPLHVAEQFTGIKGIYVPVKETVRSFKEVLEGKHDDLPEAAFINVGTIEEARE 463
>gi|70725933|ref|YP_252847.1| F0F1 ATP synthase subunit beta [Staphylococcus haemolyticus JCSC1435] >gi|118573757|sp|Q4L7Y4|ATPB_STAHJ ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|68446657|dbj|BAE04241.1| ATP synthase beta chain [Staphylococcus haemolyticus JCSC1435] (470 aa)
Score = 1546, Expect = 1.7e-169, Identities = 302/452 (66%), Positives = 368/452 (81%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK---KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPID-NKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           G + Q+ GPV+DV+F  N++P IN+ L +++P      +L LEVAL  GDDV R I+M ST+G+ RG+EV NT   I  PVG   LGR+FNV+G+ ID    +   V   PIH++ P+FDE ST+ EI ETGIKV+DLL PY+KGGKIGLFGGAGVGKTVL+QELI+NIA  HGG+S+FAGVGERTREGNDLY+EM D GVI +TA+VFGQMNEPPGARMRVAL+ALTMAE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMGQLQERITST  GS+TS+QAV+VPADD TDPAP+T FAHLDA T L+RK+  +GIYPA++PL S+SR L+P+IVG EHY+VAR VQ+ LQK+ ELQDIIAILG+DELSEEDKLTV RAR+I+ FLSQ F VAE+F+ + G YV  + T++ F +I++GK D IPE  F  VG ++DV
  S:     4 GRVTQVMGPVIDVRFEHNEVPEINNALIIEVPKEDGTFELTLEVALQLGDDVVRTIAMDSTDGVQRGMEVQNTGKDISVPVGEVTLGRVFNVLGDTIDLEDKLDGSVRRDPIHRQSPNFDELSTEVEILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELINNIAQEHGGISVFAGVGERTREGNDLYYEMRDSGVIKKTAMVFGQMNEPPGARMRVALSALTMAEYFRDEQGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTNKGSVTSIQAVFVPADDYTDPAPATAFAHLDATTNLERKLTEMGIYPAVDPLASTSRALEPAIVGQEHYEVARDVQSTLQKYRELQDIIAILGMDELSEEDKLTVERARRIQFFLSQNFHVAEQFTGQKGSYVPVKTTVADFKDILDGKYDHIPEDAFRLVGSMEDV 459
>gi|110598291|ref|ZP_01386566.1| ATP synthase F1, beta subunit [Chlorobium ferrooxidans DSM 13031] >gi|110340099|gb|EAT58599.1| ATP synthase F1, beta subunit [Chlorobium ferrooxidans DSM 13031] (462 aa)
Score = 1546, Expect = 2.0e-169, Identities = 298/452 (65%), Positives = 360/452 (79%)
  Q:   299 KGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           +G I QI GPVVDV F   ++P+I D L +  P+  KLVLE     G++  R +SM ST+GL RG  V NT  PI  PVG  VL RM NVVGEPID +      +   IH+  P FDE STK E+FETGIKVIDLL PY +GGK GLFGGAGVGKTVL+ ELI+NIA    G S+FAGVGERTREGNDL+HEM++ GVI++TALVFGQMNEPPGAR RVALT L++AE+FR+   +DVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMGQLQ+RI STK GS+TSVQA+YVPADDLTDPAP+T FAHLDA TVL R+IA LGIYPA++PL+S+SR+LDP+IVG +HY  A++V+ +LQ++++LQDIIAILG+DELS+EDKL VSRARK++ FLSQPFFVAE F+  +GKYV  ++TI GF EII GK D++PE  F  VG I++
  S:     3 EGKISQIIGPVVDVDFPEGRLPSILDALTITRPDGTKLVLETQQHLGEERVRTVSMESTDGLVRGTSVANTGMPIQVPVGPEVLSRMMNVVGEPIDGRGPVHTAKTYSIHRSAPKFDEISTKAEMFETGIKVIDLLEPYSRGGKTGLFGGAGVGKTVLIMELINNIAKQQSGFSVFAGVGERTREGNDLWHEMMESGVIDKTALVFGQMNEPPGARQRVALTGLSIAEYFRDEEGRDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQDRIVSTKKGSVTSVQAIYVPADDLTDPAPATAFAHLDATTVLSRQIAELGIYPAVDPLDSTSRILDPNIVGDDHYDTAQAVKQLLQRYKDLQDIIAILGMDELSDEDKLVVSRARKVQRFLSQPFFVAEAFTGLAGKYVKLEETIKGFKEIIAGKHDNLPESAFYLVGTIEE 454
>gi|118573528|sp|Q24MP1|ATPB_DESHY ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) (465 aa)
Score = 1546, Expect = 2.2e-169, Identities = 300/451 (66%), Positives = 359/451 (79%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK-KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           G I QI G VVDV+FA   +P I   ++V +P  K  L LEVA   G++  RC++M ST+GL RG+  +NT  PI  PVG A LGR+FNV+G+ IDN          PIH+  P+F +Q   T + ETGIKVIDLL PY KGGKIGLFGGAGVGKTVL+QELI+NIA  HGGLS+FAGVGERTREGNDL++EM + GVI++ A+VFGQMNEPPGAR+RV LT LTMAE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMG LQERITST++GSITSVQA+YVPADDLTDPAP+T FAHLDA TVL+R I+  GIYPA++PL+S+SR+L P I+G EHYKVAR VQ ILQK++ELQDIIAILG+DELSE++KL VSRAR+I  FLSQPF VAE F+   GKYV  ++TI GF EI+EGK D++PE  F  VG I++
  S:     4 GKIVQIMGAVVDVEFASEALPEIYSAVKVTVPEQKIDLTLEVAQHLGNNTVRCVAMSSTDGLQRGMAALNTGAPITVPVGPATLGRIFNVLGKAIDNGEEVHTDTSYPIHRPAPAFVDQDPSTVMLETGIKVIDLLAPYSKGGKIGLFGGAGVGKTVLIQELINNIAMEHGGLSVFAGVGERTREGNDLWNEMRESGVIDKMAMVFGQMNEPPGARLRVGLTGLTMAEYFRDVQNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGALQERITSTRNGSITSVQAIYVPADDLTDPAPATAFAHLDATTVLNRAISEKGIYPAVDPLDSNSRILSPQIIGEEHYKVARDVQQILQKYKELQDIIAILGMDELSEDEKLVVSRARRIERFLSQPFHVAEVFTGSPGKYVPIKETIRGFKEIVEGKHDNLPEAAFHMVGTIEE 455
>gi|157964949|ref|YP_001499773.1| F0F1 ATP synthase subunit beta [Rickettsia massiliae MTU5] >gi|157844725|gb|ABV85226.1| ATP synthase beta chain [Rickettsia massiliae MTU5] (499 aa)
Score = 1545, Expect = 2.4e-169, Identities = 311/462 (67%), Positives = 367/462 (79%)
  Q:   289 LMKLNTLKSDKGIIYQIFGPVVDVKFARN-QMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVIN-------QTALVFGQMNEPPGARMRVALTALTMAEHFRENNK-QDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           L K   +  + G I QI   VVDVKF  N ++P I + LE    + +++VLEVA   GDD  RCI+M STEGL RG+EVI+T +PI  PVG+  LGR+ NVVGEPID K   +    S I+K  P F  QST+  I  TGIKVIDLL PY KGGKIGLFGGAGVGKTVL+ ELI+N+A  HGG ++FAGVGERTREGNDLYHEMID GVIN       + ALV+GQMNEPPGAR RVAL+ LT+AE FR+ N+ QDVL F+DNIFRF+QAGSEVSALLGRIPSAVGYQPTLA +MG+LQERITSTK GSITSVQA+YVPADDLTDPAP+T+FAHLDA TVL R+IA LGIYPA++PL+S+S++LDP IVG EHY VAR VQ +LQ ++ LQDIIAILG+DELSEEDKLTV RARKI+ FLSQPF VAE F+   GK+V+  DTI+GF  ++EGK DD+PE  F  VG ID+
  S:    21 LTKEKIMAKNIGKITQIISAVVDVKFTNNGELPEILNALEC-YNDKQRIVLEVAQHIGDDTVRCIAMDSTEGLVRGVEVIDTGSPIRIPVGTETLGRIMNVVGEPIDGKGDIKSSNISSIYKPAPDFTNQSTERNILVTGIKVIDLLAPYTKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYTVFAGVGERTREGNDLYHEMIDSGVINLAEPEKSKVALVYGQMNEPPGARARVALSGLTIAESFRDMNEGQDVLFFVDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGELQERITSTKYGSITSVQAIYVPADDLTDPAPATSFAHLDATTVLSRQIAELGIYPAVDPLDSNSQVLDPMIVGEEHYSVARQVQQVLQTYKSLQDIIAILGMDELSEEDKLTVVRARKIQRFLSQPFHVAEVFTGAEGKFVNLADTIAGFKGLVEGKYDDLPEAAFYMVGTIDE 490
>gi|119367996|dbj|BAF40481.1| ATP synthase beta subunit [Cratoxylum cochinchinense] (489 aa)
Score = 1545, Expect = 2.7e-169, Identities = 302/455 (66%), Positives = 362/455 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K   G I QI GPV+D+ F   +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVI+T +P+  PVG A LGR+FNV+GEPID+  + +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+FAGVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ NKQDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:     9 KKKLGYITQIIGPVLDIAFPPRKMPNIYNALVVKGRDTIGQEINVTCEVQQLLGNNRVRAVAMSATDGLMRGMEVIDTGSPLSVPVGGATLGRIFNVLGEPIDDLGLVDTRTTSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFAGVGERTREGNDLYKEMKESGVINEENIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPKIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFKLILSGELDSLPEQAFYLVGNIDE 474
>gi|15893158|ref|NP_360872.1| F0F1 ATP synthase subunit beta [Rickettsia conorii str. Malish 7] >gi|15620369|gb|AAL03773.1| ATP synthase beta chain [EC:3.6.1.34] [Rickettsia conorii str. Malish 7] (499 aa)
Score = 1545, Expect = 2.7e-169, Identities = 308/462 (66%), Positives = 366/462 (79%)
  Q:   289 LMKLNTLKSDKGIIYQIFGPVVDVKFARN-QMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVIN-------QTALVFGQMNEPPGARMRVALTALTMAEHFRENNK-QDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           L K   +  + G I QI   VVDVKF  N ++P I + LE    + +++VLEVA   GDD  RCI+M S EGL RG+EVI+T +PI  PVG+  LGR+ NVVGEPID K   +    S I+K  P F  QST+  I  TGIKVIDLL PY KGGKIGLFGGAGVGKTVL+ ELI+N+A  HGG ++FAGVGERTREGNDLYHEMID GVIN       + ALV+GQMNEPPGAR RVAL+ LT+AE FR+ N+ QDVL F+DNIFRF+QAGSEVSALLGRIPSAVGYQPTLA +MG+LQERITSTK GSITSVQA+YVPADDLTDPAP+T+FAHLDA TVL R+IA  GIYPA++PL+S+S++LDP IVG EHY VAR VQ +LQ ++ LQDII ILG+DELSEEDKLTV+RARKI+ FLSQPF VAE F+  +GK+V+  DTI+GF  ++EGK DD+PE  F  VG ID+
  S:    21 LTKEKIMTKNIGKITQIISAVVDVKFTNNGELPKILNALEC-YNDKQRIVLEVAQHIGDDTVRCIAMDSMEGLVRGVEVIDTGSPIRIPVGTETLGRIMNVVGEPIDGKGDIKSSNISSIYKPAPDFTHQSTECNILVTGIKVIDLLAPYTKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYTVFAGVGERTREGNDLYHEMIDSGVINLAEPEKSKVALVYGQMNEPPGARARVALSGLTIAESFRDMNEGQDVLFFVDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGELQERITSTKYGSITSVQAIYVPADDLTDPAPATSFAHLDATTVLSRQIAEFGIYPAVDPLDSNSQVLDPMIVGEEHYSVARQVQQVLQTYKSLQDIITILGMDELSEEDKLTVARARKIQRFLSQPFHVAEVFTGAAGKFVNLADTIAGFKGLVEGKYDDLPEAAFYMVGTIDE 490
>gi|108773085|ref|YP_635994.1| CF1 beta subunit of ATP synthase [Scenedesmus obliquus] >gi|118573743|sp|Q1KVT0|ATPB_SCEOB ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|88696651|gb|ABD48277.1| CF1 beta subunit of ATP synthase [Scenedesmus obliquus] (480 aa)
Score = 1545, Expect = 2.7e-169, Identities = 302/459 (65%), Positives = 366/459 (79%)
  Q:   292 LNTLKSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVL----EVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVI-------NQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           LNT   + G I QI GPV+D+ F + Q+PNI + L +K  N   L +    EV  L GD   R ++M  T+GL RG+EV++T  P+  PVG + LGR+FNV+GEP+DN    +  E  PIH+  P+F +  T+  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+FAGVGERTREGNDLY EM + GVI       ++ ALV+GQMNEPPGARMRVALTALTMAE+FR+ NKQDVL FIDNIFRF QAG+EVSALLGR+PSAVGYQPTLA EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +AS GIYPA++PL+S+S ML P I+G +HY  A+SV+  LQ+++ELQDIIAILG+DELSEED+L V+RARKI  FLSQPFFVAE F+   GKYVS  +TI GF++I+ G+ DD+PEQ F  VG I++
  S:     4 LNT--KNVGKISQIIGPVLDIAFGQGQVPNIYNALTIKAKNAAGLEMSVTCEVQQLLGDSCVRAVAMNPTDGLMRGMEVLDTGKPLNVPVGKSTLGRIFNVLGEPVDNLGPVKNEESLPIHRTAPAFVDLDTRLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFAGVGERTREGNDLYTEMKESGVIVEKNLIDSKVALVYGQMNEPPGARMRVALTALTMAEYFRDVNKQDVLFFIDNIFRFVQAGAEVSALLGRMPSAVGYQPTLATEMGALQERITSTKDGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLASKGIYPAVDPLDSTSTMLQPWILGEKHYGCAQSVKRTLQRYKELQDIIAILGLDELSEEDRLVVARARKIERFLSQPFFVAEVFTGSPGKYVSLAETIEGFNKILAGELDDLPEQAFYLVGNINE 471
>gi|55820567|ref|YP_139009.1| F0F1 ATP synthase subunit beta [Streptococcus thermophilus LMG 18311] >gi|81820501|sp|Q5M5J1|ATPB_STRT2 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|55736552|gb|AAV60194.1| H+-translocating ATPase beta subunit [Streptococcus thermophilus LMG 18311] (468 aa)
Score = 1545, Expect = 2.9e-169, Identities = 305/452 (67%), Positives = 363/452 (80%)
  Q:   300 GIIYQIFGPVVDVKFAR-NQMPNINDCLEVKLPNNK--KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPID-NKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           G I Q+ GPVVDV FA  +++P IN+ L V     K  ++VLEVAL  G+ V R I+M ST+GL RGLEV++T  PI  PVG   LGR+FNV+G+ ID   P  +  E  PIHKK P+FDE ST TEI ETGIKVIDLL PY+KGGK+GLFGGAGVGKTVL+QELIHNIA  HGG+S+F GVGER+REGNDLY EM + GVI +TA+VFGQMNEPPGARMRVALT LT+AE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMGQLQERITSTK GS+TS+QA+YVPADD TDPAP+T FAHLD+ T L+RK+  +GIYPA++PL SSSR L P IVG EHY VA  VQ +LQ++ ELQDIIAILG+DELS+EDK  V+RAR+I+ FLSQ F VAE+F+ + G YV   +T+ GF EI+EGK D++PE  F  VG I+DV
  S:     4 GKIAQVVGPVVDVAFATGDKLPEINNALVVYTDEEKSRRIVLEVALELGEGVVRTIAMESTDGLTRGLEVLDTGRPISVPVGKETLGRVFNVLGDTIDMEAPFADDAEREPIHKKAPTFDELSTSTEILETGIKVIDLLAPYLKGGKVGLFGGAGVGKTVLIQELIHNIAQEHGGISVFTGVGERSREGNDLYWEMKESGVIEKTAMVFGQMNEPPGARMRVALTGLTIAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGSVTSIQAIYVPADDYTDPAPATAFAHLDSTTNLERKLTQMGIYPAVDPLASSSRALSPEIVGEEHYAVATEVQRVLQRYRELQDIIAILGMDELSDEDKTLVARARRIQFFLSQNFNVAEQFTGQPGSYVPVAETVRGFKEILEGKYDNLPEDAFRSVGPIEDV 459
>gi|56965609|ref|YP_177343.1| F0F1 ATP synthase subunit beta [Bacillus clausii KSM-K16] >gi|81821961|sp|Q5WB78|ATPB_BACSK ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|56911855|dbj|BAD66382.1| F0F1-type ATP synthase beta chain [Bacillus clausii KSM-K16] (470 aa)
Score = 1544, Expect = 3.0e-169, Identities = 309/452 (68%), Positives = 364/452 (80%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVKLPN------NKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPID-NKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           G I QI GPVVDVKF   Q+P IN+ L V          + K+ LEVAL  G+D  R ++MGST+GL RG EV++T  PI  PVG A LGR+FNV+GE ID  +P+ E     PIH++ PSF+E +T TEI ETGIKV+DLL PY KGGKIGLFGGAGVGKTVL+QELI+N+A  HGG+S+FAGVGERTREGNDLYHEM D GVI +TA+VFGQMNEPPGARMRVALT LTMAE+FR+    DVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMGQLQERITSTK GS+TS+QA+YVPADD TDPAP+TTFAHLDA T L+RK+   GIYPA++PL S+SR L P IVG EHY VAR VQ  LQK+ ELQDIIAILG++ELSEEDKL V+RAR+I+ FLSQ F VAE+F+ + G YV  ++TI GF +I+ GK DD+PE  F  VG I++V
  S:     4 GRIIQITGPVVDVKFPSGQLPEINNALTVNQQGAADGAVDVKVTLEVALHLGNDTVRTVAMGSTDGLMRGTEVLDTGGPISVPVGEATLGRVFNVLGEEIDLQEPVAEGTRRDPIHREAPSFEELTTTTEILETGIKVVDLLAPYTKGGKIGLFGGAGVGKTVLIQELINNVALEHGGISVFAGVGERTREGNDLYHEMKDAGVITKTAMVFGQMNEPPGARMRVALTGLTMAEYFRDEQGADVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGSVTSIQAIYVPADDYTDPAPATTFAHLDATTNLERKLTEQGIYPAVDPLASTSRALSPEIVGEEHYNVARGVQQTLQKYRELQDIIAILGMEELSEEDKLIVARARRIQFFLSQNFHVAEQFTGQPGSYVPVKETIQGFKDILAGKYDDLPEDAFRLVGRIEEV 462
>gi|17232531|ref|NP_489079.1| F0F1 ATP synthase subunit beta [Nostoc sp. PCC 7120] >gi|20141199|sp|P06540|ATPB_ANASP ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|17134177|dbj|BAB76738.1| ATP synthase beta subunit [Nostoc sp. PCC 7120] (482 aa)
Score = 1544, Expect = 3.0e-169, Identities = 304/455 (66%), Positives = 364/455 (80%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK----KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVIN-------QTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K++ G I QI GPVVDVKF   ++P I + L +K  N       L +EV  L GD+  R ++M ST+GL RGLEV++T  PI  PVG A LGR+FNV+GEP+DN+      E  PIH+  P   E  TK  +FETGIKV+DLL PY +GGKIGLFGGAGVGKTV++ ELI+NIAT HGG+S+FAGVGERTREGNDLY+EMI+ GVIN       + ALV+GQMNEPPGARMRV L+ LTMAE+FR+ NKQDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL  ++GQLQERITST  GSITS+QAVYVPADDLTDPAP+TTFAHLD  TVL R +AS GIYPA++PL S+S ML P+IVG EHY  AR+VQ+ LQ+++ELQDIIAILG+DELSEED+L V+RARK+  FLSQPFFVAE F+   GKYV  +DTI GF +I+ G+ DD+PEQ F  VG I++
  S:     7 KTNIGYITQIIGPVVDVKFPNGKLPQIYNALTIKGTNEAGQQLNLTVEVQQLLGDNQIRAVAMSSTDGLVRGLEVVDTGAPISVPVGKATLGRIFNVLGEPVDNRGPVNNQETLPIHRPAPKLTELETKPSVFETGIKVVDLLTPYRRGGKIGLFGGAGVGKTVIMMELINNIATQHGGVSVFAGVGERTREGNDLYNEMIESGVINNENLNESKIALVYGQMNEPPGARMRVGLSGLTMAEYFRDVNKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLGTDVGQLQERITSTTEGSITSIQAVYVPADDLTDPAPATTFAHLDGTTVLSRGLASKGIYPAVDPLGSTSTMLQPNIVGDEHYNTARAVQSTLQRYKELQDIIAILGLDELSEEDRLIVARARKVERFLSQPFFVAEVFTGSPGKYVKLEDTIKGFQKILSGELDDLPEQAFYLVGDINE 472
>gi|83592562|ref|YP_426314.1| F0F1 ATP synthase subunit beta [Rhodospirillum rubrum ATCC 11170] >gi|114564|sp|P05038|ATPB_RHORU ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|118573735|sp|Q2RV18|ATPB_RHORT ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|46368|emb|CAA26340.1| unnamed protein product [Rhodospirillum rubrum] >gi|83575476|gb|ABC22027.1| ATP synthase F1, beta subunit [Rhodospirillum rubrum ATCC 11170] (474 aa)
Score = 1544, Expect = 3.0e-169, Identities = 300/453 (66%), Positives = 359/453 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVIN------QTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGI 748
           K++ G I Q+ G VVDVKF   ++P+I   LE     N+ LVLEVA   G+ V R I+M STEGL RG +V +T  PI  PVG  VLGR+ NV+GEP+D +      +  PIH++ P+F EQ+T+TEI  TGIKVIDL+ PY KGGK+GLFGGAGVGKTVL+QELI+N+A GHGG S+FAGVGERTREGNDLYHEMID G+I+      + ALV+GQMNEPPGAR RVAL  LT AE+FR+   QDVL F+DNIFRF+QAGSEVSALLGRIPSAVGYQPTLA +MG LQERITSTK GSITSVQA+YVPADDLTDPAP+ +FAHLDA T L+R IA LGIYPA++PL+S+SR LDP +VG EHYKVAR VQ +LQ ++ LQDIIAILG+DELSEED+L V+RARKI+ FLSQPF VAE F+   GK VS +DTI GF  ++EG+ D +PEQ F  VG +
  S:     3 KNNLGTITQVTGAVVDVKF-EGELPSILSALETDNHGNR-LVLEVAQHLGESVVRTIAMDSTEGLVRGQQVTSTGGPITVPVGPQVLGRIMNVIGEPVDERGPVVTAQRYPIHRQAPTFAEQATETEILVTGIKVIDLIAPYTKGGKVGLFGGAGVGKTVLIQELINNVAKGHGGYSVFAGVGERTREGNDLYHEMIDAGIIDLEGDKSKVALVYGQMNEPPGARARVALAGLTQAEYFRDEEGQDVLFFVDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGALQERITSTKKGSITSVQAIYVPADDLTDPAPAASFAHLDATTTLNRSIAELGIYPAVDPLDSTSRALDPLVVGEEHYKVAREVQRVLQTYKSLQDIIAILGMDELSEEDRLVVARARKIQRFLSQPFHVAEVFTGSPGKLVSLEDTIKGFKGLVEGEYDHLPEQAFYMVGNM 459
>gi|149193991|ref|ZP_01871089.1| F0F1 ATP synthase subunit beta [Caminibacter mediatlanticus TB-2] >gi|149135944|gb|EDM24422.1| F0F1 ATP synthase subunit beta [Caminibacter mediatlanticus TB-2] (469 aa)
Score = 1544, Expect = 3.1e-169, Identities = 301/452 (66%), Positives = 366/452 (80%)
  Q:   299 KGIIYQIFGPVVDVKFARNQMPNINDCLEVKLP---NNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDN-KPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           +G + Q+ GPV+DV+F  N++P IN+ L V+       KK+VLEVA   GD+V R I+M  T+GL RG +V+ T  PI  PVG AVLGR+FNV G+ ID  +P+P  VE   IH+ PP F+EQSTK EIFETGIKV+DLL PY+KGGK GLFGGAGVGKTV++ ELIHN+A  H G S+FAGVGERTREGNDLYHEM + GV+++ AL +GQMNEPPG R RVA+T LTMAE+FR+   +DVL+FIDNIFRF+QAG+E+SALLGRIPSAVGYQPTLA EMG+LQERITSTK GSITS+QAVYVPADDLTDPAP++ FAHLDA TVL+RKIA  GIYPA++PL+S+SR+LDP IVG  HYKVAR VQ +LQK+++LQDIIAILG+DELSEEDKL V RARKI  FLSQPFFVA+ F+   G+YV  + TI GF +I+ G+ DD+PE  F  VG +D+
  S:     2 EGKVIQVLGPVIDVEFDGNKVPEINEALIVEFEAEGEKKKVVLEVAAQIGDNVVRTIAMDLTDGLTRGEKVVATGAPIKVPVGEAVLGRIFNVTGDVIDEGEPIPADVERWSIHRDPPPFEEQSTKMEIFETGIKVVDLLCPYMKGGKTGLFGGAGVGKTVIIMELIHNVAYKHSGYSVFAGVGERTREGNDLYHEMKESGVLDKVALCYGQMNEPPGCRNRVAMTGLTMAEYFRDVENRDVLMFIDNIFRFAQAGAEMSALLGRIPSAVGYQPTLATEMGRLQERITSTKKGSITSIQAVYVPADDLTDPAPASVFAHLDATTVLNRKIAEKGIYPAVDPLDSTSRILDPQIVGERHYKVARGVQEVLQKYKDLQDIIAILGMDELSEEDKLIVQRARKIEKFLSQPFFVAKVFTGADGRYVELEKTIEGFEKILNGEVDDLPENAFYMVGDLDE 457
>gi|153168634|ref|ZP_01928457.1| ATP synthase F1, beta subunit [Listeria monocytogenes FSL N1-017] >gi|153175781|ref|ZP_01931085.1| ATP synthase F1, beta subunit [Listeria monocytogenes FSL N3-165] >gi|153180619|ref|ZP_01933662.1| ATP synthase F1, beta subunit [Listeria monocytogenes F6900] >gi|153192185|ref|ZP_01939230.1| ATP synthase F1, beta subunit [Listeria monocytogenes J2818] >gi|153204115|ref|ZP_01944965.1| ATP synthase F1, beta subunit [Listeria monocytogenes HPB2262] >gi|127764513|gb|EBA25045.1| ATP synthase F1, beta subunit [Listeria monocytogenes J2818] >gi|133726197|gb|EBA27895.1| ATP synthase F1, beta subunit [Listeria monocytogenes FSL N1-017] >gi|133729206|gb|EBA30904.1| ATP synthase F1, beta subunit [Listeria monocytogenes FSL N3-165] >gi|133732012|gb|EBA33710.1| ATP synthase F1, beta subunit [Listeria monocytogenes F6900] >gi|133734347|gb|EBA36045.1| ATP synthase F1, beta subunit [Listeria monocytogenes HPB2262] (479 aa)
Score = 1544, Expect = 3.2e-169, Identities = 301/462 (65%), Positives = 373/462 (80%)
  Q:   290 MKLNTLKSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNN------KKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPID-NKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           M+ N   S KG + Q+ GPVVDVKF    +P I + L ++  ++       +L LEVA+  GDDV R I+M ST+G+ RG+EVI+T +PI  PVG+  LGR+FNV+G  ID ++P+P  ++ + IH++ P+FD+ +T TEI ETGIKV+DLL PY+KGGKIGLFGGAGVGKTVL+QELIHNIA  HGG+S+FAGVGERTREGNDLY EM D GVI +TA+VFGQMNEPPGARMRVALT LT+AE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMGQLQERITST  GS+TS+QA+YVPADD TDPAP+TTFAHLDA T L+RK+   GIYPA++PL S+SR L P IVG EHY VA  VQ +LQ+++ELQDIIAILG+DELS+EDK +VSRAR+++ FLSQ F VAE+F+ + G YV  ++T+ GF +++ GK D IPE  F  VG I+DV
  S:     1 MRRNNCMS-KGQVIQVMGPVVDVKFEGGNLPEIYNALVIEYKSDAEEAPTSQLTLEVAIQLGDDVVRTIAMASTDGVQRGMEVIDTGSPITVPVGTVTLGRVFNVLGNTIDLDEPLPSDIKRNKIHREAPTFDQLATTTEILETGIKVVDLLAPYLKGGKIGLFGGAGVGKTVLIQELIHNIAQEHGGISVFAGVGERTREGNDLYFEMKDSGVIEKTAMVFGQMNEPPGARMRVALTGLTIAEYFRDEEHQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTNVGSVTSIQAIYVPADDYTDPAPATTFAHLDATTNLERKLTEQGIYPAVDPLASTSRALSPDIVGEEHYAVATEVQRLLQRYKELQDIIAILGMDELSDEDKQSVSRARRVQFFLSQNFHVAEQFTGQKGSYVPVKETVKGFKDLLAGKYDHIPEDAFRSVGRIEDV 468
>gi|165933793|ref|YP_001650582.1| F0F1 ATP synthase subunit beta [Rickettsia rickettsii str. Iowa] >gi|165908880|gb|ABY73176.1| ATP synthase beta chain [Rickettsia rickettsii str. Iowa] (499 aa)
Score = 1544, Expect = 3.4e-169, Identities = 309/465 (66%), Positives = 367/465 (78%)
  Q:   289 LMKLNTLKSDKGIIYQIFGPVVDVKFARN-QMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVIN-------QTALVFGQMNEPPGARMRVALTALTMAEHFRENNK-QDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHK 753
           L K   +  + G I QI   VVDVKF  N ++P I + LE    + +++VLEVA   GDD  RCI+M S EGL RG+EVI+T +PI  PVG+  LGR+ NVVGEPID K   +    S I+K  P F  QST+  I  TGIKVIDLL PY KGGKIGLFGGAGVGKTVL+ ELI+N+A  HGG ++FAGVGERTREGNDLYHEMID GVIN       + ALV+GQMNEPPGAR RVAL+ LT+AE FR+ N+ QDVL F+DNIFRF+QAGSEVSALLGRIPSAVGYQPTLA +MG+LQERITSTK GSITSVQA+YVPADDLTDPAP+T+FAHLDA TVL R+IA  GIYPA++PL+S+S++LDP IVG EHY VAR VQ +LQ ++ LQDII ILG+DELSEEDKLTV+RARKI+ FLSQPF VAE F+  +GK+V+  DTI+GF  ++EGK DD+PE  F  VG ID+  K
  S:    21 LTKEKIMTKNIGKITQIISAVVDVKFTNNGKLPEILNALEC-YNDTRRVVLEVAQHIGDDTVRCIAMDSMEGLVRGVEVIDTGSPIRIPVGTETLGRIMNVVGEPIDGKGDIKSSNISSIYKPAPDFTNQSTERNILVTGIKVIDLLAPYTKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYTVFAGVGERTREGNDLYHEMIDSGVINLAEPEKSKVALVYGQMNEPPGARARVALSGLTIAESFRDMNEGQDVLFFVDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGELQERITSTKHGSITSVQAIYVPADDLTDPAPATSFAHLDATTVLSRQIAEFGIYPAVDPLDSNSQVLDPMIVGEEHYSVARQVQQVLQTYKSLQDIITILGMDELSEEDKLTVARARKIQRFLSQPFHVAEVFTGAAGKFVNLADTIAGFKGLVEGKYDDLPEAAFYMVGTIDEAIK 493
>gi|156530209|gb|ABU75201.1| AtpB [Simarouba glauca] (475 aa)
Score = 1544, Expect = 3.6e-169, Identities = 303/456 (66%), Positives = 361/456 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           K + G I QI GPV+DV F   +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIHK  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+SIF GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +T+ GF  I+ G+ D +PEQ F  VG ID+V
  S:     1 KKNLGHIAQIIGPVLDVAFLPGKMPNIYNALVVKGRDTVGQPINMTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHKPAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSIFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETVRGFKLILSGELDGLPEQAFYLVGNIDEV 467
>gi|167768302|ref|ZP_02440355.1| hypothetical protein CLOSS21_02858 [Clostridium sp. SS2/1] >gi|167709826|gb|EDS20405.1| hypothetical protein CLOSS21_02858 [Clostridium sp. SS2/1] (462 aa)
Score = 1544, Expect = 3.6e-169, Identities = 307/456 (67%), Positives = 365/456 (80%)
  Q:   298 DKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHK 753
           +KG I QI GPV+DV+F   Q+P I+D L V +   K++V+EV    G+   RCI + ++EGL++G+EV  T  PI  PVG   LGRMFNV+GE ID     E  E   IH++PP F++QS   E+FETGIKVIDLL PY KGGKIGLFGGAGVGKTVL+QELIHNIAT HGG SIF GVGER+REGNDL++EM + GVI  TALVFGQMNEPPG+RMRVA T LTMAE+FR+  KQ+VLLFIDNIFR+ QAGSEVSALLGR+PSAVGYQPTLA E+G LQERITSTK+GSITSVQAVYVPADDLTDPAP+TTFAHLDA TVL R I+  GIYPA++PLESSSR+L+P IVG EHY+VAR V+  LQ+++ELQDIIAILG++EL EEDK+TV RARKI+ FLSQPF VAE F+   GKYV  ++TI GF  I++G+ D+ PEQ FL VG IDDV +
  S:     2 EKGKIVQILGPVIDVEFETEQLPLIHDALTV-VNKGKEVVMEVEQHMGNRTVRCILLAASEGLHKGMEVTATGGPIKVPVGKQTLGRMFNVLGEAIDKGEPVESEEKWAIHREPPKFEDQSPVVEMFETGIKVIDLLAPYAKGGKIGLFGGAGVGKTVLIQELIHNIATEHGGYSIFTGVGERSREGNDLWNEMTESGVIKNTALVFGQMNEPPGSRMRVAQTGLTMAEYFRDQEKQNVLLFIDNIFRYVQAGSEVSALLGRMPSAVGYQPTLANEVGALQERITSTKNGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSRAISEQGIYPAVDPLESSSRILEPDIVGEEHYEVARRVEEALQRYKELQDIIAILGMEELDEEDKITVYRARKIQKFLSQPFNVAETFTGIPGKYVPVKETIRGFKAILDGEMDEYPEQAFLMVGTIDDVKE 456
>gi|27468618|ref|NP_765255.1| F0F1 ATP synthase subunit beta [Staphylococcus epidermidis ATCC 12228] >gi|57867649|ref|YP_189274.1| F0F1 ATP synthase subunit beta [Staphylococcus epidermidis RP62A] >gi|38604812|sp|Q8CNJ7|ATPB_STAES ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|81170379|sp|Q5HMB9|ATPB_STAEQ ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|27316165|gb|AAO05299.1|AE016749_245 ATP synthase beta chain [Staphylococcus epidermidis ATCC 12228] >gi|57638307|gb|AAW55095.1| ATP synthase F1, beta subunit [Staphylococcus epidermidis RP62A] (470 aa)
Score = 1544, Expect = 3.8e-169, Identities = 299/452 (66%), Positives = 368/452 (81%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK---KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPID-NKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           G + Q+ GPV+DV+F  N++P IN+ L +++P      +L LEVAL  GDDV R I+M ST+G+ RG+EV +T   I  PVG   LGR+FNV+GE ID ++ + + V   PIH++ P FDE STK EI ETGIKV+DLL PY+KGGKIGLFGGAGVGKTVL+QELI+NIA  HGG+S+FAGVGERTREGNDLY+EM D GVI +TA+VFGQMNEPPGARMRVAL+ LTMAE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMGQLQERI+ST  GS+TS+QAV+VPADD TDPAP+TTFAHLD+ T L+RK+  +GIYPA++PL S+SR L+PS+VG EHY VAR VQ+ LQK+ ELQDIIAILG+DELS+EDK TV RAR+I+ FLSQ F VAE+F+ + G YV  + T++ F +I++GK D IPE  F  VG ++DV
  S:     4 GRVTQVMGPVIDVRFEHNEVPEINNALHIEVPKEDGALQLTLEVALQLGDDVVRTIAMDSTDGVQRGMEVKDTGRDISVPVGDVTLGRVFNVLGETIDLDEKIDDSVRRDPIHRQAPGFDELSTKVEILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELINNIAQEHGGISVFAGVGERTREGNDLYYEMSDSGVIKKTAMVFGQMNEPPGARMRVALSGLTMAEYFRDEEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERISSTNKGSVTSIQAVFVPADDYTDPAPATTFAHLDSTTNLERKLTEMGIYPAVDPLASTSRALEPSVVGQEHYDVAREVQSTLQKYRELQDIIAILGMDELSDEDKQTVERARRIQFFLSQNFHVAEQFTGQKGSYVPVKTTVADFRDILDGKYDHIPEDAFRLVGSMEDV 459
>gi|116750008|ref|YP_846695.1| F0F1 ATP synthase subunit beta [Syntrophobacter fumaroxidans MPOB] >gi|166222421|sp|A0LLF8|ATPB_SYNFM ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|116699072|gb|ABK18260.1| ATP synthase F1, beta subunit [Syntrophobacter fumaroxidans MPOB] (469 aa)
Score = 1544, Expect = 3.8e-169, Identities = 293/452 (64%), Positives = 357/452 (78%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVKLP----NNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           G I Q+ G VVDV+F   ++P +   L V  P        LVLEVA   GD+V R I M  T+GL RG+ V +T NPIM PVG+AVLGR+ NVVG  +D         Y PIH+  P+F EQ T  ++ ETG+KVIDLLVP+ +GGK+G+FGGAGVGKTV++ E+IHNIA  HGG+S+FAGVGERTREGNDLYHEM D GV+ +  LV+GQM EPPGAR RVAL+ALT+AE+FR+   QDVLLF+DNIFRF+QAG+EVSALLGR+PSAVGYQPTL  ++G+LQERITST  GSITSVQ VYVPADDLTDPAP+TTFAHLD   VL R+IA LGIYPA++PL+S+SR+LDP+++G +HY  AR VQ ILQK+++LQDIIAILG+DELS+EDKLTV+RARKI+ FLSQPF VAE F+  +GKYV  +DT+ GF EI EGK DDIPEQ F   GGI++V
  S:     4 GKIVQVIGNVVDVEFGEGKLPPLLTALFVSNPGLNDQEDNLVLEVAQHLGDNVVRTIGMDLTDGLVRGMPVKDTGNPIMMPVGAAVLGRVINVVGRTVDGLGPVNTDTYMPIHRTAPAFTEQDTSVKVLETGVKVIDLLVPFPRGGKMGMFGGAGVGKTVVMMEMIHNIAMQHGGISVFAGVGERTREGNDLYHEMKDSGVLPRAGLVYGQMTEPPGARARVALSALTVAEYFRDVEGQDVLLFVDNIFRFTQAGAEVSALLGRMPSAVGYQPTLGTDLGELQERITSTTKGSITSVQCVYVPADDLTDPAPATTFAHLDGTVVLSRQIAELGIYPAVDPLDSTSRILDPNVLGEDHYYTAREVQQILQKYKDLQDIIAILGMDELSDEDKLTVARARKIQRFLSQPFHVAETFTGVAGKYVKVEDTVRGFKEICEGKHDDIPEQAFFMAGGIEEV 459
>gi|109648044|ref|ZP_01371947.1| ATP synthase F1, beta subunit [Desulfitobacterium hafniense DCB-2] >gi|109641134|gb|EAT50689.1| ATP synthase F1, beta subunit [Desulfitobacterium hafniense DCB-2] (465 aa)
Score = 1544, Expect = 3.8e-169, Identities = 300/451 (66%), Positives = 359/451 (79%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK-KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           G I QI G VVDV+FA   +P I   ++V +P  K  L LEVA   G++  RC++M ST+GL RG+  +NT  PI  PVG A LGR+FNV+G+ IDN          PIH+  P+F +Q   T + ETGIKVIDLL PY KGGKIGLFGGAGVGKTVL+QELI+NIA  HGGLS+FAGVGERTREGNDL++EM + GVI++ A+VFGQMNEPPGAR+RV LT LTMAE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMG LQERITST++GSITSVQA+YVPADDLTDPAP+T FAHLDA TVL+R I+  GIYPA++PL+S+SR+L P I+G EHYKVAR VQ ILQK++ELQDIIAILG+DELSE++KL VSRAR+I  FLSQPF VAE F+   GKYV  ++TI GF EI+EGK D++PE  F  VG I++
  S:     4 GKIVQIMGAVVDVEFASEALPEIYSAVKVTVPEKKIDLTLEVAQHLGNNTVRCVAMSSTDGLQRGMAALNTGAPITVPVGPATLGRIFNVLGKAIDNGEEVHTDTSYPIHRPAPAFVDQDPSTVMLETGIKVIDLLAPYSKGGKIGLFGGAGVGKTVLIQELINNIAMEHGGLSVFAGVGERTREGNDLWNEMRESGVIDKMAMVFGQMNEPPGARLRVGLTGLTMAEYFRDVQNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGALQERITSTRNGSITSVQAIYVPADDLTDPAPATAFAHLDATTVLNRAISEKGIYPAVDPLDSNSRILSPQILGEEHYKVARDVQQILQKYKELQDIIAILGMDELSEDEKLVVSRARRIERFLSQPFHVAEVFTGSPGKYVPIKETIRGFKEIVEGKHDNLPEAAFHMVGTIEE 455
>gi|55822457|ref|YP_140898.1| F0F1 ATP synthase subunit beta [Streptococcus thermophilus CNRZ1066] >gi|116627376|ref|YP_819995.1| F0F1 ATP synthase subunit beta [Streptococcus thermophilus LMD-9] >gi|122268023|sp|Q03LX3|ATPB_STRTD ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|81820338|sp|Q5M104|ATPB_STRT1 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|20070093|gb|AAM01190.1| H+-ATPase cytoplasmic F1-part beta-subunit [Streptococcus thermophilus] >gi|55738442|gb|AAV62083.1| proton-translocating ATPase, beta subunit [Streptococcus thermophilus CNRZ1066] >gi|116100653|gb|ABJ65799.1| F0F1-type ATP synthase, beta subunit [Streptococcus thermophilus LMD-9] (468 aa)
Score = 1543, Expect = 4.2e-169, Identities = 305/452 (67%), Positives = 362/452 (80%)
  Q:   300 GIIYQIFGPVVDVKFAR-NQMPNINDCLEVKLPNNK--KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPID-NKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           G I Q+ GPVVDV FA  +++P IN+ L V     K  ++VLEVAL  G+ V R I+M ST+GL RGLEV++T  PI  PVG   LGR+FNV+G+ ID   P  +  E  PIHKK P+FDE ST TEI ETGIKVIDLL PY+KGGK+GLFGGAGVGKTVL+QELIHNIA  HGG+S+F GVGER+REGNDLY EM + GVI +TA+VFGQMNEPPGARMRVALT LT+AE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMGQLQERITSTK GS+TS+QA+YVPADD TDPAP+T FAHLD+ T L+RK+  +GIYPA++PL SSSR L P IVG EHY VA  VQ +LQ++ ELQDIIAILG+DELS+EDK  V RAR+I+ FLSQ F VAE+F+ + G YV   +T+ GF EI+EGK D++PE  F  VG I+DV
  S:     4 GKIAQVVGPVVDVAFATGDKLPEINNALVVYTDEEKSRRIVLEVALELGEGVVRTIAMESTDGLTRGLEVLDTGRPISVPVGKETLGRVFNVLGDTIDMEAPFADDAEREPIHKKAPTFDELSTSTEILETGIKVIDLLAPYLKGGKVGLFGGAGVGKTVLIQELIHNIAQEHGGISVFTGVGERSREGNDLYWEMKESGVIEKTAMVFGQMNEPPGARMRVALTGLTIAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGSVTSIQAIYVPADDYTDPAPATAFAHLDSTTNLERKLTQMGIYPAVDPLASSSRALSPEIVGEEHYAVATEVQRVLQRYRELQDIIAILGMDELSDEDKTLVGRARRIQFFLSQNFNVAEQFTGQPGSYVPVAETVRGFKEILEGKYDNLPEDAFRSVGPIEDV 459
>gi|151945186|gb|EDN63437.1| F1F0 ATP synthase beta subunit [Saccharomyces cerevisiae YJM789] >gi|190409593|gb|EDV12858.1| F(1)F(0)-ATPase complex beta subunit [Saccharomyces cerevisiae RM11-1a] (511 aa)
Score = 1543, Expect = 4.5e-169, Identities = 303/452 (67%), Positives = 357/452 (78%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNK-PMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVIN-----QTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           G +  + G +VDV F ++++P I + LE+K P  K LVLEVA   G++  R I+M  TEGL RG +V++T  PI  PVG   LGR+ NV+GEPID + P+  K+   PIH  PPSF EQST  EI ETGIKV+DLL PY +GGKIGLFGGAGVGKTV +QELI+NIA  HGG S+F GVGERTREGNDLY EM + GVIN     + ALVFGQMNEPPGAR RVALT LT+AE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGRIPSAVGYQPTLA +MG LQERIT+TK GS+TSVQAVYVPADDLTDPAP+TTFAHLDA TVL R I+ LGIYPA++PL+S SR+LD ++VG EHY VA  VQ  LQ ++ LQDIIAILG+DELSE+DKLTV RARKI+ FLSQPF VAE F+   GK V  +DT++ F  I+EGK D+IPE  F  VGGI+DV
  S:    44 GKVTAVIGAIVDVHFEQSELPAILNALEIKTPQGK-LVLEVAQHLGENTVRTIAMDGTEGLVRGEKVLDTGGPISVPVGRETLGRIINVIGEPIDERGPIKSKLR-KPIHADPPSFAEQSTSAEILETGIKVVDLLAPYARGGKIGLFGGAGVGKTVFIQELINNIAKAHGGFSVFTGVGERTREGNDLYREMKETGVINLEGESKVALVFGQMNEPPGARARVALTGLTIAEYFRDEEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGLLQERITTTKKGSVTSVQAVYVPADDLTDPAPATTFAHLDATTVLSRGISELGIYPAVDPLDSKSRLLDAAVVGQEHYDVASKVQETLQTYKSLQDIIAILGMDELSEQDKLTVERARKIQRFLSQPFAVAEVFTGIPGKLVRLKDTVASFKAILEGKYDNIPEHAFYMVGGIEDV 499
>gi|192809056|ref|ZP_03037731.1| ATP synthase F1, beta subunit [Geobacillus sp. Y412MC10] >gi|192801727|gb|EDV78232.1| ATP synthase F1, beta subunit [Geobacillus sp. Y412MC10] (466 aa)
Score = 1543, Expect = 4.5e-169, Identities = 296/452 (65%), Positives = 364/452 (80%)
  Q:   299 KGIIYQIFGPVVDVKFARNQMPNINDCLEVKLP----NNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           KG +  I G VVD++F R  +P I + ++++       +  L LEV+   GD++ RCI+M ST+GL RG+E ++   PI  PVGSA LGR+FNV+GEPIDN         +PIH++ P++DE ST+ E+ ETGIKVIDLL PY KGGKIGLFGGAGVGKTV +QELI+NIA  HGG+S+FAGVGERTREGNDLYHEM D GVIN+TA+VFGQMNEPPGAR+RVALT LTMAE+FR+   +DVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMG+LQERITSTK GS+TS+QA+YVPADD TDPAP+TTFAHLDA T L+RKI+ +GIYPA++PL SSSR+L P IVG EHY VA+ V+ IL ++ ELQDIIAILG+DELSEEDK  V RAR+++ FLSQ F VAE+F+   GKYV  ++T+  F EI+EGK D +PE  FL+VG I++
  S:     3 KGRVVSITGAVVDIEFERGHLPEIFNAVKIEATLEGGRSVDLTLEVSNHLGDNLVRCIAMSSTDGLVRGIEAVDLGRPITVPVGSATLGRVFNVLGEPIDNAGAVVSEVNNPIHREAPAYDELSTQAEMLETGIKVIDLLAPYQKGGKIGLFGGAGVGKTVAIQELINNIAQEHGGISVFAGVGERTREGNDLYHEMSDSGVINKTAMVFGQMNEPPGARLRVALTGLTMAEYFRDQEGKDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLASEMGRLQERITSTKKGSVTSIQAIYVPADDYTDPAPATTFAHLDATTNLERKISEMGIYPAVDPLASSSRILAPEIVGEEHYNVAQGVKKILARYNELQDIIAILGMDELSEEDKAIVGRARRVQRFLSQAFHVAEQFNGIPGKYVPVKETVRSFKEILEGKHDHLPEAAFLFVGTIEE 458
>gi|153853572|ref|ZP_01994952.1| hypothetical protein DORLON_00942 [Dorea longicatena DSM 13814] >gi|149753727|gb|EDM63658.1| hypothetical protein DORLON_00942 [Dorea longicatena DSM 13814] (465 aa)
Score = 1543, Expect = 4.6e-169, Identities = 307/453 (67%), Positives = 370/453 (81%)
  Q:   299 KGIIYQIFGPVVDVKF-ARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDN-KPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           KG I Q+ GPVVDV+F +R ++P I D LEV     K+ V+EVA   G+++ARCI + S+EGL +G+EV  T   I  PVG   LGR+FNV+GE IDN +P+ +  E+  IH+K PSF+EQS   E+ ETGIKVIDLL PY KGGKIGLFGGAGVGKTVL+QELIHNIAT HGG SIF GVGER+REGNDL+ EM + GV+++TALVFGQMNEPPG+RMRVA T LTMAE+FR+   Q+VLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTLA EMG LQERI STK+GS+TSVQAVYVPADDLTDPAP+TTF+HLDA TVL RKI   GIYPA++PL+S+SR+L+P++VG EHY+VAR VQ ILQK++ELQDIIAILG++ELSEEDK+TV+RARKI+ FLSQPF VAE F+   GKYV  ++T+ GF  II+G+ D+ PE  F  VG I+DV
  S:     3 KGRIVQVMGPVVDVEFNSREELPFIKDALEVD-NGGKRCVMEVAQHVGNNIARCIMLASSEGLQKGMEVTATGAGIKVPVGEKTLGRLFNVLGETIDNGEPIKDSEEWV-IHRKAPSFEEQSPAVEVLETGIKVIDLLTPYAKGGKIGLFGGAGVGKTVLIQELIHNIATEHGGYSIFTGVGERSREGNDLWTEMRESGVLDKTALVFGQMNEPPGSRMRVAETGLTMAEYFRDVEHQNVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLANEMGALQERIASTKNGSVTSVQAVYVPADDLTDPAPATTFSHLDATTVLSRKIVEQGIYPAVDPLDSTSRILEPAVVGEEHYQVARKVQEILQKYKELQDIIAILGMEELSEEDKMTVARARKIQKFLSQPFSVAETFTGVPGKYVPLKETVRGFKAIIDGEMDEYPENAFFNVGTIEDV 455
>gi|16801734|ref|NP_472002.1| F0F1 ATP synthase subunit beta [Listeria innocua Clip11262] >gi|81853853|sp|Q927W4|ATPB2_LISIN ATP synthase subunit beta 2 (ATPase subunit beta 2) (ATP synthase F1 sector subunit beta 2) >gi|16415209|emb|CAC97899.1| atpD [Listeria innocua] (473 aa)
Score = 1543, Expect = 5.0e-169, Identities = 298/453 (65%), Positives = 370/453 (81%)
  Q:   299 KGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNN------KKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPID-NKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           KG + Q+ GPVVDVKF    +P I + L ++  ++       +L LEVA+  GDDV R I+M ST+G+ RG+EVI+T +PI  PVG+  LGR+FNV+G  ID ++P+P  ++ + IH++ P+FD+ +T TEI ETGIKV+DLL PY+KGGKIGLFGGAGVGKTVL+QELIHNIA  HGG+S+FAGVGERTREGNDLY EM D GVI +TA+VFGQMNEPPGARMRVALT LT+AE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMGQLQERITST  GS+TS+QA+YVPADD TDPAP+TTFAHLDA T L+RK+   GIYPA++PL S+SR L P IVG EHY+VA  VQ +LQ+++ELQDIIAILG+DELS+EDK +VSRAR+++ FLSQ F VAE+F+ + G YV  ++T+ GF +++ GK D IPE  F  VG I+DV
  S:     3 KGQVIQVMGPVVDVKFEGGNLPEIYNALVIEYKSDAEEAPTSQLTLEVAIQLGDDVVRTIAMASTDGVQRGMEVIDTGSPITVPVGTVTLGRVFNVLGNTIDLDEPLPSDIKRNKIHREAPTFDQLATTTEILETGIKVVDLLAPYLKGGKIGLFGGAGVGKTVLIQELIHNIAQEHGGISVFAGVGERTREGNDLYFEMKDSGVIEKTAMVFGQMNEPPGARMRVALTGLTIAEYFRDEEHQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTNVGSVTSIQAIYVPADDYTDPAPATTFAHLDATTNLERKLTEQGIYPAVDPLASTSRALSPDIVGEEHYEVATEVQRLLQRYKELQDIIAILGMDELSDEDKQSVSRARRVQFFLSQNFHVAEQFTGQKGSYVPVKETVKGFKDLLAGKYDHIPEDAFRSVGRIEDV 462
>gi|157151073|ref|YP_001450821.1| F0F1 ATP synthase subunit beta [Streptococcus gordonii str. Challis substr. CH1] >gi|189081352|sp|A8AYG1|ATPB_STRGC ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|157075867|gb|ABV10550.1| ATP synthase F1, beta subunit [Streptococcus gordonii str. Challis substr. CH1] (468 aa)
Score = 1542, Expect = 5.0e-169, Identities = 306/452 (67%), Positives = 364/452 (80%)
  Q:   300 GIIYQIFGPVVDVKFAR-NQMPNINDCLEVKLPNNKK--LVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPID-NKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           G I Q+ GPVVDV FA  +++P IN+ L V   + KK  +VLEVAL  GD V R I+M ST+GL RGLEV++T  PI  PVG   LGR+FNV+G+ ID + P  +  E  PIHKK P+FDE ST +EI ETGIKVIDLL PY+KGGK+GLFGGAGVGKTVL+QELIHNIA  HGG+S+F GVGERTREGNDLY EM + GVI +TA+VFGQMNEPPGARMRVALT LT+AE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMGQLQERITSTK GS+TS+QA+YVPADD TDPAP+T FAHLD+ T L+RK+  LGIYPA++PL SSSR L P IVG EHY VA  V+ +LQ++ ELQDIIAILG+DELS+E+K  V+RAR+I+ FLSQ F VAE+F+ + G YV   +T+ GF EI+EGK D +PE  F  VG I+DV
  S:     4 GKITQVIGPVVDVAFAAGDRLPEINNALVVYKNDEKKSKIVLEVALELGDGVVRTIAMESTDGLTRGLEVLDTGRPISVPVGKETLGRVFNVLGDTIDLDAPFGDDAERQPIHKKAPTFDELSTSSEILETGIKVIDLLAPYLKGGKVGLFGGAGVGKTVLIQELIHNIAQEHGGISVFTGVGERTREGNDLYWEMKESGVIEKTAMVFGQMNEPPGARMRVALTGLTIAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGSVTSIQAIYVPADDYTDPAPATAFAHLDSTTNLERKLVQLGIYPAVDPLASSSRALAPEIVGEEHYAVAAEVKRVLQRYHELQDIIAILGMDELSDEEKTLVARARRIQFFLSQNFNVAEQFTGQPGSYVPVAETVRGFKEILEGKHDKLPEDAFRGVGSIEDV 459
>gi|16804567|ref|NP_466052.1| F0F1 ATP synthase subunit beta [Listeria monocytogenes EGD-e] >gi|46908701|ref|YP_015090.1| F0F1 ATP synthase subunit beta [Listeria monocytogenes str. 4b F2365] >gi|47094108|ref|ZP_00231832.1| ATP synthase F1, beta subunit [Listeria monocytogenes str. 4b H7858] >gi|47096952|ref|ZP_00234528.1| ATP synthase F1, beta subunit [Listeria monocytogenes str. 1/2a F6854] >gi|153184895|ref|ZP_01935543.1| ATP synthase F1, beta subunit [Listeria monocytogenes J0161] >gi|153197165|ref|ZP_01941435.1| ATP synthase F1, beta subunit [Listeria monocytogenes 10403S] >gi|167015617|ref|ZP_02278150.1| F0F1 ATP synthase subunit beta [Listeria monocytogenes FSL J1-194] >gi|167215202|ref|ZP_02285509.1| F0F1 ATP synthase subunit beta [Listeria monocytogenes FSL R2-503] >gi|167218318|ref|ZP_02287954.1| F0F1 ATP synthase subunit beta [Listeria monocytogenes FSL J1-175] >gi|167405356|ref|ZP_02310113.1| F0F1 ATP synthase subunit beta [Listeria monocytogenes FSL J2-003] >gi|167454996|ref|ZP_02321219.1| F0F1 ATP synthase subunit beta [Listeria monocytogenes FSL J2-064] >gi|168266761|ref|ZP_02688726.1| F0F1 ATP synthase subunit beta [Listeria monocytogenes FSL J2-071] >gi|81830121|sp|Q71WP9|ATPB2_LISMF ATP synthase subunit beta 2 (ATPase subunit beta 2) (ATP synthase F1 sector subunit beta 2) >gi|81849742|sp|Q8Y4C1|ATPB2_LISMO ATP synthase subunit beta 2 (ATPase subunit beta 2) (ATP synthase F1 sector subunit beta 2) >gi|16412017|emb|CAD00607.1| atpD [Listeria monocytogenes] >gi|46881973|gb|AAT05267.1| ATP synthase F1, beta subunit [Listeria monocytogenes str. 4b F2365] >gi|47014662|gb|EAL05619.1| ATP synthase F1, beta subunit [Listeria monocytogenes str. 1/2a F6854] >gi|47017515|gb|EAL08324.1| ATP synthase F1, beta subunit [Listeria monocytogenes str. 4b H7858] >gi|126942407|gb|EBA20146.1| ATP synthase F1, beta subunit [Listeria monocytogenes J0161] >gi|127633216|gb|EBA22633.1| ATP synthase F1, beta subunit [Listeria monocytogenes 10403S] (473 aa)
Score = 1542, Expect = 5.5e-169, Identities = 298/453 (65%), Positives = 369/453 (81%)
  Q:   299 KGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNN------KKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPID-NKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           KG + Q+ GPVVDVKF    +P I + L ++  ++       +L LEVA+  GDDV R I+M ST+G+ RG+EVI+T +PI  PVG+  LGR+FNV+G  ID ++P+P  ++ + IH++ P+FD+ +T TEI ETGIKV+DLL PY+KGGKIGLFGGAGVGKTVL+QELIHNIA  HGG+S+FAGVGERTREGNDLY EM D GVI +TA+VFGQMNEPPGARMRVALT LT+AE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMGQLQERITST  GS+TS+QA+YVPADD TDPAP+TTFAHLDA T L+RK+   GIYPA++PL S+SR L P IVG EHY VA  VQ +LQ+++ELQDIIAILG+DELS+EDK +VSRAR+++ FLSQ F VAE+F+ + G YV  ++T+ GF +++ GK D IPE  F  VG I+DV
  S:     3 KGQVIQVMGPVVDVKFEGGNLPEIYNALVIEYKSDAEEAPTSQLTLEVAIQLGDDVVRTIAMASTDGVQRGMEVIDTGSPITVPVGTVTLGRVFNVLGNTIDLDEPLPSDIKRNKIHREAPTFDQLATTTEILETGIKVVDLLAPYLKGGKIGLFGGAGVGKTVLIQELIHNIAQEHGGISVFAGVGERTREGNDLYFEMKDSGVIEKTAMVFGQMNEPPGARMRVALTGLTIAEYFRDEEHQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTNVGSVTSIQAIYVPADDYTDPAPATTFAHLDATTNLERKLTEQGIYPAVDPLASTSRALSPDIVGEEHYAVATEVQRLLQRYKELQDIIAILGMDELSDEDKQSVSRARRVQFFLSQNFHVAEQFTGQKGSYVPVKETVKGFKDLLAGKYDHIPEDAFRSVGRIEDV 462
>gi|4239652|gb|AAD13383.1| ATPase, beta subunit [Streptococcus mutans] (468 aa)
Score = 1542, Expect = 5.5e-169, Identities = 305/452 (67%), Positives = 363/452 (80%)
  Q:   300 GIIYQIFGPVVDVKFARN-QMPNINDCLEVKLPNNK--KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPID-NKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           G I Q+ GPVVDV FA + ++P IN+ L V    +K  ++VLEVAL  GD + R I+M ST+GL RGLEV +T   I  PVG   LGR+FNV+G+ ID +KP  E  E  PIHKK PSFD+ ST TEI ETGIKVIDLL PY+KGGK+GLFGGAGVGKTVL+QELIHNIA  HGG+S+F GVGERTREGNDLY EM + GVI +TA+VFGQMNEPPGARMRVALT LT+AE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMGQLQERITSTK GS+TS+QA+YVPADD TDPAP+T FAHLD+ T L+R++  +GIYPA++PL SSSR L P IVG EHY VA  VQ +LQ++ ELQDIIAILG+DELS+E+K  V RAR+I+ FLSQ F VAE+F+ + G YV   +T+ GF EI+EGK D++PE  F  VG I+DV
  S:     4 GKIAQVVGPVVDVAFATDDKLPEINNALVVYKDGDKSQRIVLEVALELGDGLVRTIAMESTDGLTRGLEVFDTGRAISVPVGKETLGRVFNVLGDTIDLDKPFAEDAERQPIHKKAPSFDDLSTSTEILETGIKVIDLLAPYLKGGKVGLFGGAGVGKTVLIQELIHNIAQEHGGISVFTGVGERTREGNDLYWEMKESGVIEKTAMVFGQMNEPPGARMRVALTGLTIAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGSVTSIQAIYVPADDYTDPAPATAFAHLDSTTNLERRLTQMGIYPAVDPLASSSRALSPEIVGQEHYDVATEVQHVLQRYRELQDIIAILGMDELSDEEKTLVGRARRIQFFLSQNFNVAEQFTGQPGSYVPVAETVRGFKEILEGKYDELPEDAFRSVGAIEDV 459
>gi|24379917|ref|NP_721872.1| F0F1 ATP synthase subunit beta [Streptococcus mutans UA159] >gi|26006949|sp|P95789|ATPB_STRMU ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|24377897|gb|AAN59178.1|AE014985_2 FoF1 membrane-bound proton-translocating ATPase, beta subunit [Streptococcus mutans UA159] (468 aa)
Score = 1542, Expect = 5.7e-169, Identities = 305/452 (67%), Positives = 363/452 (80%)
  Q:   300 GIIYQIFGPVVDVKFARN-QMPNINDCLEVKLPNNK--KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPID-NKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           G I Q+ GPVVDV FA + ++P IN+ L V    +K  ++VLEVAL  GD + R I+M ST+GL RGLEV +T   I  PVG   LGR+FNV+G+ ID +KP  E  E  PIHKK PSFD+ ST TEI ETGIKVIDLL PY+KGGK+GLFGGAGVGKTVL+QELIHNIA  HGG+S+F GVGERTREGNDLY EM + GVI +TA+VFGQMNEPPGARMRVALT LT+AE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMGQLQERITSTK GS+TS+QA+YVPADD TDPAP+T FAHLD+ T L+R++  +GIYPA++PL SSSR L P IVG EHY VA  VQ +LQ++ ELQDIIAILG+DELS+E+K  V RAR+I+ FLSQ F VAE+F+ + G YV   +T+ GF EI+EGK D++PE  F  VG I+DV
  S:     4 GKIAQVVGPVVDVAFATDDKLPEINNALVVYKDGDKSQRIVLEVALELGDGLVRTIAMESTDGLTRGLEVFDTGRAISVPVGKETLGRVFNVLGDTIDLDKPFAEDAERQPIHKKAPSFDDLSTSTEILETGIKVIDLLAPYLKGGKVGLFGGAGVGKTVLIQELIHNIAQEHGGISVFTGVGERTREGNDLYWEMKESGVIEKTAMVFGQMNEPPGARMRVALTGLTIAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGSVTSIQAIYVPADDYTDPAPATAFAHLDSTTNLERRLTQMGIYPAVDPLASSSRALSPEIVGQEHYDVATEVQHVLQRYRELQDIIAILGMDELSDEEKTLVGRARRIQFFLSQNFNVAEQFTGQPGSYVPVAETVRGFKEILEGKYDELPEDAFRSVGAIEDV 459
>gi|142006|gb|AAA21993.1| ATPase beta-subunit (471 aa)
Score = 1542, Expect = 5.9e-169, Identities = 301/455 (66%), Positives = 361/455 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK----KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K++ G I QI GPVVDVKF   ++P I + L +K  N       L +EV  L GD+  R ++M ST+GL RGLEV++T  PI  PVG A LGR+FNV+GEP+DN+      E  PIH+  P   E  TK  +FETGIKV+DLL PY +GGKIGLFGGAGVGKTV++ ELI+NIAT HGG+S+FAGVGERTREGNDLY+EMID    ++ ALV+GQMNEPPGARMRV L+ LTMAE+FR+ NKQDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL  ++GQLQERITST  GSITS+QAVYVPADDLTDPAP+TTFAHLD  TVL R +AS GIYPA++PL S+S ML P+IVG EHY  AR+VQ+ LQ+++ELQDIIAILG+DELSEED+L V+RARK+  FLSQPFFVAE F+   GKYV  +DTI GF +I+ G+ DD+PEQ F  VG I++
  S:     7 KTNIGYITQIIGPVVDVKFPNGKLPQIYNALTIKGTNEAGQQLNLTVEVQQLLGDNQIRAVAMSSTDGLVRGLEVVDTGAPISVPVGKATLGRIFNVLGEPVDNRGPVNNQETLPIHRPAPKLTELETKPSVFETGIKVVDLLTPYRRGGKIGLFGGAGVGKTVIMMELINNIATQHGGVSVFAGVGERTREGNDLYNEMID----SKNALVYGQMNEPPGARMRVGLSGLTMAEYFRDVNKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLGTDVGQLQERITSTTEGSITSIQAVYVPADDLTDPAPATTFAHLDGTTVLSRGLASKGIYPAVDPLGSTSTMLQPNIVGDEHYNTARAVQSTLQRYKELQDIIAILGLDELSEEDRLLVARARKVERFLSQPFFVAEVFTGSPGKYVKLEDTIKGFQKILSGELDDLPEQAFYLVGDINE 461
>gi|150011015|gb|ABR57164.1| F0F1-type ATP synthase beta subunit [Staphylococcus xylosus] (470 aa)
Score = 1542, Expect = 6.0e-169, Identities = 299/452 (66%), Positives = 367/452 (81%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK---KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPID-NKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           G + Q+ GPV+DV+F  N++P IN+ L + +  ++    L LEVAL  GDDV R I+M ST+G+ RG EV ++ + I  PVG A LGR+FNV+G+ ID ++ +   VE  PIH++ P+FD+ STK EI ETGIKVIDLL PY+KGGKIGLFGGAGVGKTVL+QELI+NIA  HGG+S+FAGVGERTREGNDLY+EM D GVI +TA+VFGQMNEPPGARMRVAL+ LTMAEHFR+   QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMGQLQERITST  GS+TS+QAV+VPADD TDPAP+  FAHLDA T L+RK+  +GIYPA++PL S+SR LDP+IVG +HY++AR VQ+ LQK+ ELQDIIAILG+DELSEEDK TV RAR+I+ FLSQ F VAE+F+ + G YV  Q T+ GF  I++G+ D IPE  F  VG +++V
  S:     4 GRVTQVMGPVIDVRFEHNEVPEINNALVLDVEKDEGTVSLTLEVALQLGDDVVRTIAMDSTDGVKRGTEVRDSGSSISVPVGDATLGRVFNVLGDTIDLDEKLDSSVERDPIHRESPAFDQLSTKVEILETGIKVIDLLAPYIKGGKIGLFGGAGVGKTVLIQELINNIAQEHGGISVFAGVGERTREGNDLYYEMSDSGVIKKTAMVFGQMNEPPGARMRVALSGLTMAEHFRDVQGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTTKGSVTSIQAVFVPADDYTDPAPAAVFAHLDATTNLERKLTEMGIYPAVDPLASTSRALDPTIVGQDHYEIARDVQSTLQKYRELQDIIAILGMDELSEEDKQTVERARRIQFFLSQNFHVAEQFTGQKGSYVPVQKTVEGFKAILDGEYDHIPEDAFRLVGSMEEV 459
>gi|154484982|ref|ZP_02027430.1| hypothetical protein EUBVEN_02700 [Eubacterium ventriosum ATCC 27560] >gi|149733935|gb|EDM50054.1| hypothetical protein EUBVEN_02700 [Eubacterium ventriosum ATCC 27560] (468 aa)
Score = 1542, Expect = 6.4e-169, Identities = 302/453 (66%), Positives = 363/453 (80%)
  Q:   299 KGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           KG I Q+ GPVVDV+FA N +P I D LEV   N K+ V+EVA   G++  RCI + ++EGL++G+EV+ T + I  PVG   LGR+FNV+G+ +DN    +  ++  IH+ PPSF++QS   E+ ETGIKVIDLL PY KGGKIGLFGGAGVGKTVL+QELI NIAT HGG SIF GVGER+REGNDL+ EM + GV+++TALVFGQMNEPPGARMRVA T LTMAE+FR+   Q+VLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMG+LQERI STK+GS+TSVQAVYVPADDLTDPAP+TTFAHLDA TVL RKI   GIYPA++PLES+SR+L+  +VG EHY+ AR VQ ILQK+ ELQDII+ILG++ELS+EDKL V RARKI+ FLSQPF VAE F+   GKYV  ++T+ GF  II+G+ DD PE  F  VG IDDV
  S:     3 KGKIVQVMGPVVDVEFADNNLPYIKDALEVD-NNGKRCVMEVAQHIGNNTVRCIMLAASEGLHKGMEVVATGSGISVPVGEKTLGRLFNVLGDTLDNGEKLDGEQHWCIHRDPPSFEDQSPVVEVLETGIKVIDLLAPYAKGGKIGLFGGAGVGKTVLIQELITNIATQHGGYSIFTGVGERSREGNDLWTEMKESGVLDKTALVFGQMNEPPGARMRVAETGLTMAEYFRDEEHQNVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGELQERIASTKNGSVTSVQAVYVPADDLTDPAPATTFAHLDATTVLSRKIVEQGIYPAVDPLESNSRILEEDVVGKEHYETARRVQEILQKYTELQDIISILGMEELSDEDKLVVYRARKIQKFLSQPFHVAENFTGVPGKYVPLKETVRGFKAIIDGEMDDYPEAAFFNVGTIDDV 454
>gi|156530183|gb|ABU75188.1| AtpB [Simaba cedron] (479 aa)
Score = 1541, Expect = 6.8e-169, Identities = 303/452 (67%), Positives = 359/452 (79%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           G I QI GPV+DV F   +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIHK  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+SIF GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+V
  S:     2 GHIAQIIGPVLDVAFLPGKMPNIYNALVVKGRDTVGQPINMTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHKPAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSIFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFKLILSGELDGLPEQAFYLVGNIDEV 464
>gi|6322581|ref|NP_012655.1| Beta subunit of the F1 sector of mitochondrial F1F0 ATP synthase, which is a large, evolutionarily conserved enzyme complex required for ATP synthesis; phosphorylated; Atp2p [Saccharomyces cerevisiae] >gi|84028178|sp|P00830|ATPB_YEAST ATP synthase subunit beta, mitochondrial precursor >gi|1015845|emb|CAA89652.1| ATP2 [Saccharomyces cerevisiae] >gi|1483632|gb|AAC49475.1| F1-ATPase beta-subunit (511 aa)
Score = 1541, Expect = 6.8e-169, Identities = 302/452 (66%), Positives = 357/452 (78%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNK-PMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVIN-----QTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           G +  + G +VDV F ++++P I + LE+K P  K LVLEVA   G++  R I+M  TEGL RG +V++T  PI  PVG   LGR+ NV+GEPID + P+  K+   PIH  PPSF EQST  EI ETGIKV+DLL PY +GGKIGLFGGAGVGKTV +QELI+NIA  HGG S+F GVGERTREGNDLY EM + GVIN     + ALVFGQMNEPPGAR RVALT LT+AE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGRIPSAVGYQPTLA +MG LQERIT+TK GS+TSVQAVYVPADDLTDPAP+TTFAHLDA TVL R I+ LGIYPA++PL+S SR+LD ++VG EHY VA  VQ  LQ ++ LQDIIAILG+DELSE+DKLTV RARKI+ FLSQPF VAE F+   GK V  +DT++ F  ++EGK D+IPE  F  VGGI+DV
  S:    44 GKVTAVIGAIVDVHFEQSELPAILNALEIKTPQGK-LVLEVAQHLGENTVRTIAMDGTEGLVRGEKVLDTGGPISVPVGRETLGRIINVIGEPIDERGPIKSKLR-KPIHADPPSFAEQSTSAEILETGIKVVDLLAPYARGGKIGLFGGAGVGKTVFIQELINNIAKAHGGFSVFTGVGERTREGNDLYREMKETGVINLEGESKVALVFGQMNEPPGARARVALTGLTIAEYFRDEEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGLLQERITTTKKGSVTSVQAVYVPADDLTDPAPATTFAHLDATTVLSRGISELGIYPAVDPLDSKSRLLDAAVVGQEHYDVASKVQETLQTYKSLQDIIAILGMDELSEQDKLTVERARKIQRFLSQPFAVAEVFTGIPGKLVRLKDTVASFKAVLEGKYDNIPEHAFYMVGGIEDV 499
>gi|69247775|ref|ZP_00604480.1| ATP synthase F1, beta subunit [Enterococcus faecium DO] >gi|68194704|gb|EAN09186.1| ATP synthase F1, beta subunit [Enterococcus faecium DO] (468 aa)
Score = 1541, Expect = 7.1e-169, Identities = 310/452 (68%), Positives = 366/452 (80%)
  Q:   300 GIIYQIFGPVVDVKFARNQ-MPNINDCLEV--KLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPID-NKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           G I Q+ GPVVDV+F+ +Q +P+IN+ L V     N  K+VLE AL  GD V R I+M ST+GL RG+EVI+T   I  PVG   LGR+FNV+G+ ID   P PE  E S IHKK P+FDE ST TEI ETGIKVIDLL PY+KGGK+GLFGGAGVGKTVL+QELIHNIA  HGG+S+F GVGERTREGNDLY+EM D GVI +TA+VFGQMNEPPGARMRVALT LT+AE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMGQLQERITSTK GSITS+QA+YVPADD TDPAP+T FAHLDA T L+RK+   GIYPA++PL SSS  L P IVG EHYKVA  VQ +LQ++ ELQDIIAILG+DELS+++K+ VSRAR+++ FLSQ F VAE+F+   G YV  ++T+ GF EI+EGK DD+PE+ F  VG I+DV
  S:     4 GKIVQVIGPVVDVEFSLDQSLPDINNALVVYKNDENKSKVVLEAALELGDGVIRTIAMESTDGLQRGMEVIDTGKAISVPVGKETLGRVFNVLGDTIDLETPFPEDAERSEIHKKAPAFDELSTSTEILETGIKVIDLLAPYLKGGKVGLFGGAGVGKTVLIQELIHNIAQEHGGISVFTGVGERTREGNDLYYEMKDSGVIEKTAMVFGQMNEPPGARMRVALTGLTIAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGSITSIQAIYVPADDYTDPAPATAFAHLDATTNLERKLTEQGIYPAVDPLASSSSALAPEIVGEEHYKVATEVQHVLQRYRELQDIIAILGMDELSDQEKVLVSRARRVQFFLSQNFNVAEQFTGLPGSYVPVEETVKGFREILEGKYDDLPEEAFRSVGRIEDV 459
>gi|139474050|ref|YP_001128766.1| F0F1 ATP synthase subunit beta [Streptococcus pyogenes str. Manfredo] >gi|166222419|sp|A2RFC2|ATPB_STRPG ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|134272297|emb|CAM30551.1| ATP synthase beta chain [Streptococcus pyogenes str. Manfredo] (468 aa)
Score = 1541, Expect = 7.2e-169, Identities = 309/454 (68%), Positives = 365/454 (80%)
  Q:   300 GIIYQIFGPVVDVKFAR-NQMPNINDCLEVKLPNNKK--LVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPID-NKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHK 753
           G I Q+ GPVVDV FA  +++P IN+ L V   ++KK  +VLEVAL  GD + R I+M ST+GL RGLEV++T   I  PVG   LGR+FNV+GE ID  +P  E V+  PIHKK PSFDE ST +EI ETGIKVIDLL PY+KGGK+GLFGGAGVGKTVL+QELIHNIA  HGG+S+F GVGERTREGNDLY EM + GVI +TA+VFGQMNEPPGARMRVALT LT+AE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMGQLQERITST+ GS+TS+QA+YVPADD TDPAP+T FAHLD+ T L+RK+  +GIYPA++PL SSSR L P IVG EHY VA  VQ +LQ++ ELQDIIAILG+DELS+E+K  V RAR+I+ FLSQ F VAE+F+   G YV   DT+ GF EI+EGK DD+PE  F  VG I+DV K
  S:     4 GKIAQVVGPVVDVMFASGDKLPEINNALIVYKDSDKKQKIVLEVALELGDGMVRTIAMESTDGLTRGLEVLDTGRAISVPVGKETLGRVFNVLGETIDLEEPFAEDVDRQPIHKKAPSFDELSTSSEILETGIKVIDLLAPYLKGGKVGLFGGAGVGKTVLIQELIHNIAQEHGGISVFTGVGERTREGNDLYWEMKESGVIEKTAMVFGQMNEPPGARMRVALTGLTIAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTQKGSVTSIQAIYVPADDYTDPAPATAFAHLDSTTNLERKLTQMGIYPAVDPLASSSRALSPEIVGEEHYAVATEVQRVLQRYRELQDIIAILGMDELSDEEKTLVGRARRIQFFLSQNFNVAEQFTGLPGSYVPVADTVRGFKEILEGKYDDLPEDAFRSVGPIEDVIK 461
>gi|108884792|sp|P06541|ATPB_CHLRE ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) (480 aa)
Score = 1541, Expect = 8.0e-169, Identities = 300/451 (66%), Positives = 360/451 (79%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK----KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVI-------NQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           G I QI GPV+D+ FA+ Q+PNI + L ++  N+      +  EV  L GD+  R +SM  TEGL RG+EV++T  P+  PVG   LGR+FNV+GEP+DN    +  E  PIH+  P+F +  T+  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+FAGVGERTREGNDLY EM + GVI       ++ ALV+GQMNEPPGARMRVALTALTMAE+FR+ NKQDVL FIDNIFRF QAG+EVSALLGR+PSAVGYQPTLA EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PLES+S ML P I+G +HY  A+SV+  LQ+++ELQDIIAILG+DELSEED+L V+RARKI  FLSQPFFVAE F+   GKYVS  +TI GF +I  G+ DD+PEQ F  VG I +
  S:    10 GRIVQIIGPVLDIVFAKGQVPNIYNALTIRAKNSAGTEMAVTCEVQQLLGDNCVRAVSMNPTEGLMRGMEVVDTGKPLSVPVGKVTLGRIFNVLGEPVDNMGNVKVEETLPIHRTAPAFVDLDTRLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFAGVGERTREGNDLYTEMKESGVIVEKNLSDSKVALVYGQMNEPPGARMRVALTALTMAEYFRDVNKQDVLFFIDNIFRFVQAGAEVSALLGRMPSAVGYQPTLATEMGGLQERITSTKDGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRNLAAKGIYPAVDPLESTSTMLQPWILGEKHYDSAQSVKKTLQRYKELQDIIAILGLDELSEEDRLIVARARKIERFLSQPFFVAEVFTGSPGKYVSLAETIEGFGKIFAGELDDLPEQAFYLVGNITE 471
>gi|73662090|ref|YP_300871.1| F0F1 ATP synthase subunit beta [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|118573759|sp|Q49Z50|ATPB_STAS1 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|72494605|dbj|BAE17926.1| F0F1-type ATP synthase beta subunit [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (470 aa)
Score = 1541, Expect = 8.2e-169, Identities = 299/452 (66%), Positives = 367/452 (81%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK---KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPID-NKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           G + Q+ GPV+DV+F  N++P IN+ L V +  ++    L LEVAL  GDDV R I+M ST+G+ RG EV ++ + I  PVG A LGR+FNV+G+ ID ++ +   V+  PIH++ P+FD+ STK EI ETGIKVIDLL PY+KGGKIGLFGGAGVGKTVL+QELI+NIA  HGG+S+FAGVGERTREGNDLY+EM D GVI +TA+VFGQMNEPPGARMRVAL+ LTMAEHFR+   QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMGQLQERITST  GS+TS+QAV+VPADD TDPAP+  FAHLDA T L+RK+  +GIYPA++PL S+SR LDP+IVG +HY++AR VQ+ LQK+ ELQDIIAILG+DELSEEDK TV RAR+I+ FLSQ F VAE+F+ + G YV  Q T+ GF  I++G+ D IPE  F  VG +++V
  S:     4 GRVTQVMGPVIDVRFEHNEVPEINNALVVDVERDEGTVSLTLEVALQLGDDVVRTIAMDSTDGVKRGTEVRDSGDSISVPVGDATLGRVFNVLGDTIDLDEKLDTSVKRDPIHREAPAFDQLSTKVEILETGIKVIDLLAPYIKGGKIGLFGGAGVGKTVLIQELINNIAQEHGGISVFAGVGERTREGNDLYYEMSDSGVIKKTAMVFGQMNEPPGARMRVALSGLTMAEHFRDVQGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTTKGSVTSIQAVFVPADDYTDPAPAAVFAHLDATTNLERKLTEMGIYPAVDPLASTSRALDPTIVGQDHYEIARDVQSTLQKYRELQDIIAILGMDELSEEDKQTVERARRIQFFLSQNFHVAEQFTGQKGSYVPVQKTVEGFKAILDGEYDHIPEDAFRLVGSMEEV 459
>gi|156530113|gb|ABU75153.1| AtpB [Brucea tenuifolia] (488 aa)
Score = 1541, Expect = 8.3e-169, Identities = 304/456 (66%), Positives = 361/456 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           K + G I QI GPV+DV F   +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIHK  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+SIF GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+V
  S:     7 KKNLGHIAQIIGPVLDVAFLPGKMPNIYNALVVKGRDTVGQPINMTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHKPAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSIFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFKLILSGELDGLPEQAFYLVGNIDEV 473
>gi|156530135|gb|ABU75164.1| AtpB [Hannoa klaineana] >gi|156530147|gb|ABU75170.1| AtpB [Odyendyea gabonensis] (498 aa)
Score = 1540, Expect = 8.9e-169, Identities = 304/456 (66%), Positives = 361/456 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           K + G I QI GPV+DV F   +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIHK  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+SIF GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+V
  S:    17 KKNLGHIAQIIGPVLDVAFLPGKMPNIYNALVVKGRDTVGQPINMTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHKPAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSIFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFKLILSGELDGLPEQAFYLVGNIDEV 483
>gi|95929971|ref|ZP_01312711.1| ATP synthase F1, beta subunit [Desulfuromonas acetoxidans DSM 684] >gi|95133940|gb|EAT15599.1| ATP synthase F1, beta subunit [Desulfuromonas acetoxidans DSM 684] (468 aa)
Score = 1540, Expect = 9.3e-169, Identities = 301/454 (66%), Positives = 365/454 (80%)
  Q:   298 DKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLP----NNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNK-PMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           DKG I Q+ GPVVDV+F   ++P I   L++  P        LV+EVA   G++  R I+M STEGL RG EV+ T + I+ PVG   LGR+ NVVGEP+D   P+   +++  IH+  P F  QSTK E FETGIKVIDLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG S+FAGVGERTREGNDL+ EM + GV+++ ALV+GQMNEPPGAR RVAL+ALT+AE+FR+   QDVLLF+DNIFRF+QAGSEVSALLGRIPSAVGYQPTL+ EMG+LQERIT+T  GSITSVQA+YVPADDLTDPAP+T FAHLDA TVL R+IA LGIYPA++PL+SSSR+LDP +VG EHYK+AR VQ +LQ++++LQDIIAILG+DELSE+DK  V+RARKI+ FLSQPF VAE F+   GKYV  +DTI GF EI++GK DD+PEQ F  VG I++V
  S:     2 DKGKIVQVIGPVVDVQFEAGKLPEIYHALKITNPALGEGELNLVVEVAQHLGENTVRAIAMDSTEGLVRGQEVLATGDQIVMPVGRKTLGRILNVVGEPVDEAGPVEADLQWG-IHRPAPEFVNQSTKVESFETGIKVIDLLAPYARGGKIGLFGGAGVGKTVLIMELINNIAQQHGGFSVFAGVGERTREGNDLWEEMKESGVLDKAALVYGQMNEPPGARARVALSALTVAEYFRDEEGQDVLLFVDNIFRFTQAGSEVSALLGRIPSAVGYQPTLSTEMGELQERITTTDKGSITSVQAIYVPADDLTDPAPATAFAHLDATTVLSRQIAELGIYPAVDPLDSSSRILDPQVVGEEHYKLARDVQFVLQRYKDLQDIIAILGMDELSEDDKQVVARARKIQRFLSQPFHVAEVFTGSPGKYVELKDTIKGFQEILDGKHDDVPEQAFYLVGTIEEV 459
>gi|4100657|gb|AAD00918.1| proton-translocating ATPase beta subunit [Streptococcus sanguinis] (468 aa)
Score = 1540, Expect = 9.4e-169, Identities = 305/452 (67%), Positives = 364/452 (80%)
  Q:   300 GIIYQIFGPVVDVKFAR-NQMPNINDCLEVKLPNNKK--LVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPID-NKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           G I Q+ GPVVDV FA  +++P IN+ L V   + KK  +VLEVAL  GD V R I+M ST+GL RGLEV++T  PI  PVG   LGR+FNV+G+ ID + P  +  E  PIHKK P+FDE ST +EI ETGIKVIDLL PY+KGGK+GLFGGAGVGKTVL+QELIHNIA  HGG+S+F GVGERTREGNDLY EM + GVI +TA+VFGQMNEPPGARMRVALT LT+AE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMGQLQERITSTK GS+TS+QA+YVPADD TDPAP+T FAHLD+ T L+RK+  LGIYPA++PL SSSR L P IVG EHY VA  V+ +LQ++ ELQDIIAILG+DELS+++K  V+RAR+I+ FLSQ F VAE+F+ + G YV   +T+ GF EI+EGK D +PE  F  VG I+DV
  S:     4 GKIAQVIGPVVDVAFASGDKLPEINNALVVYKNDEKKSKIVLEVALELGDGVVRTIAMESTDGLTRGLEVLDTGRPISVPVGKETLGRVFNVLGDTIDLDAPFADDAERQPIHKKAPTFDELSTSSEILETGIKVIDLLAPYLKGGKVGLFGGAGVGKTVLIQELIHNIAQEHGGISVFTGVGERTREGNDLYWEMKESGVIEKTAMVFGQMNEPPGARMRVALTGLTIAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGSVTSIQAIYVPADDYTDPAPATAFAHLDSTTNLERKLVQLGIYPAVDPLASSSRALSPEIVGEEHYAVAAEVKRVLQRYHELQDIIAILGMDELSDDEKTLVARARRIQFFLSQNFNVAEQFTGQPGSYVPVAETVRGFKEILEGKHDKLPEDAFRGVGSIEDV 459
>gi|461565|sp|P35110|ATPB_CHLLI ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|299279|gb|AAB25774.1| F-ATPase beta subunit [Chlorobium limicola] (462 aa)
Score = 1540, Expect = 9.8e-169, Identities = 298/452 (65%), Positives = 364/452 (80%)
  Q:   299 KGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNK-PMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           +G I QI GPVVDV FA  Q+P+I D L V   +  KLVLE     G++  R I+M  T+GL RG+   NT  PI  PVG  VLGRM NVVG+PID K P+  K  YS IH+  P FDE STK E+FETGIKVIDLL PY +GGK GLFGGAGVGKTVL+ ELI+NIA    G S+FAGVGERTREGNDL+HEM++ GVI++TALVFGQMNEPPGAR RVALT L++AE+FR+   +DVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTL+ EMG+LQ+RITSTK GS+TSVQA+YVPADDLTDPAP+T F HLDA TVL R+IA LGIYPA++PL+S+SR+LDP+++G +HY  A++V+ ILQ++++LQDIIAILG+DELS++DKL V+RARK++ FLSQPFFVAE F+  +GKYV  +DTI GF EII G+ D++PE  F  VG I++
  S:     3 EGKISQIIGPVVDVDFAEGQLPSILDALTVTRQDGSKLVLETQQHLGEERVRRIAMEGTDGLVRGMSAKNTGKPIQVPVGEEVLGRMLNVVGDPIDGKGPVLSKKSYS-IHRTAPKFDELSTKAEMFETGIKVIDLLEPYSRGGKTGLFGGAGVGKTVLIMELINNIAKEQSGFSVFAGVGERTREGNDLWHEMMESGVIDKTALVFGQMNEPPGARARVALTGLSIAEYFRDEEGRDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLSTEMGELQDRITSTKKGSVTSVQAIYVPADDLTDPAPATAFTHLDATTVLSRQIAELGIYPAVDPLDSTSRILDPNVIGDDHYDTAQAVKQILQRYKDLQDIIAILGMDELSDDDKLVVARARKVQRFLSQPFFVAEAFTGLAGKYVKLEDTIKGFKEIIAGRHDNLPEAAFYLVGTIEE 454
>gi|156530131|gb|ABU75162.1| AtpB [Gymnostemon zaizou] >gi|156530133|gb|ABU75163.1| AtpB [Hannoa chlorantha] (494 aa)
Score = 1540, Expect = 1.1e-168, Identities = 304/456 (66%), Positives = 361/456 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           K + G I QI GPV+DV F   +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIHK  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+SIF GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+V
  S:    13 KKNLGHIAQIIGPVLDVAFLPGKMPNIYNALVVKGRDTVGQPINMTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHKPAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSIFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFKLILSGELDGLPEQAFYLVGNIDEV 479
>gi|91204911|ref|YP_537266.1| F0F1 ATP synthase subunit beta [Rickettsia bellii RML369-C] >gi|118573738|sp|Q1RKD7|ATPB_RICBR ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|91068455|gb|ABE04177.1| ATP synthase beta chain [Rickettsia bellii RML369-C] (473 aa)
Score = 1540, Expect = 1.1e-168, Identities = 309/456 (67%), Positives = 366/456 (80%)
  Q:   295 LKSDKGIIYQIFGPVVDVKFA-RNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVIN-------QTALVFGQMNEPPGARMRVALTALTMAEHFRENNK-QDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           +K + G I QI   VVDVKF  + ++P I + LE    + +++VLE+A   GDD  RCI+M STEGL RG+EV++T +PI  PVG   LGR+ NVVGEPID K   +    S I+K  PSF +QST   I  TGIKV+DLL PY KGGKIGLFGGAGVGKTVL+ ELI+N+A  HGG ++FAGVGERTREGNDLYHEMID GVIN       + ALV+GQMNEPPGAR RVALT LT+AE FR+ N+ QDVL F+DNIFRF+QAGSEVSALLGRIPSAVGYQPTLA +MG+LQERITSTK GSITSVQA+YVPADDLTDPAP+T+FAHLDA TVL R+IA LGIYPA++PL+S+S++LDP IVG EHY VAR VQ ILQ ++ LQDIIAILG+DELSEEDKLTVSRARKI+ FLSQPF VAE F+   GK+V+  DTI+GF  + EGK DD+PE  F  VG I++
  S:     1 MKKNIGKITQIISAVVDVKFTNKGKLPQILNALEC-YNDKQRIVLEIAQHIGDDTVRCIAMNSTEGLVRGMEVVDTGSPISIPVGIETLGRIMNVVGEPIDGKGKIKGSSISSIYKSAPSFTQQSTDRNILVTGIKVVDLLAPYTKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYTVFAGVGERTREGNDLYHEMIDSGVINLEEPEKSKVALVYGQMNEPPGARARVALTGLTVAESFRDMNEGQDVLFFVDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGELQERITSTKHGSITSVQAIYVPADDLTDPAPATSFAHLDATTVLSRQIAELGIYPAVDPLDSTSQVLDPMIVGEEHYNVARKVQQILQTYKSLQDIIAILGMDELSEEDKLTVSRARKIQRFLSQPFHVAEVFTGAEGKFVNLADTIAGFKGLTEGKYDDLPEAAFYMVGTIEE 464
>gi|94986847|ref|YP_594780.1| F0F1 ATP synthase subunit beta [Lawsonia intracellularis PHE/MN1-00] >gi|118573693|sp|Q1MRB8|ATPB_LAWIP ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|94731096|emb|CAJ54458.1| proton ATPase beta subunit [Lawsonia intracellularis PHE/MN1-00] (471 aa)
Score = 1539, Expect = 1.1e-168, Identities = 299/461 (64%), Positives = 364/461 (78%)
  Q:   295 LKSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNN---KKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHKNY 755
           +  + G I Q+ G VVDV F   ++P I   LE+  PN+    KL+ EVA   GDD+ R I+M +TEGL RG++V++T +PIMAPVG A LGR+ NVVG+PID   + +   Y PIH+KPPSF +Q+T  E  ETGIKVIDLLVP+ KGGK+GLFGGAGVGKTV++ E+I+NIA  HGG+S+FAGVGERTREGNDLYHEM + GV+ +  LV+GQMNEPPGAR RVALTALT AE+FR+   QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL  ++G L+ERITST +GSITSVQAVYVPADDLTDPAP+TTF+HLD   VL R+IA LGIYPA++PL+S+SR+L+P+ VG EHY VAR VQ ILQK++ELQDIIAILG+DELS+EDKL VSRAR+I+ FLSQPF VAE F+  +G+YV  +DTI GF  I+ G+ D + E  F  VG ID     Y
  S:     1 MSENIGKIVQVIGAVVDVSFPNGKLPPILTALEIHNPNSIDAPKLICEVAQHLGDDIVRTIAMDATEGLKRGMDVLDTGHPIMAPVGKASLGRIMNVVGQPIDGLGVIDTKTYLPIHRKPPSFLDQNTSVEPLETGIKVIDLLVPFPKGGKMGLFGGAGVGKTVILMEMINNIARQHGGISVFAGVGERTREGNDLYHEMKEAGVLEKAILVYGQMNEPPGARSRVALTALTCAEYFRDEEHQDVLLFIDNIFRFIQAGSEVSALLGRMPSAVGYQPTLGTDLGSLEERITSTHNGSITSVQAVYVPADDLTDPAPATTFSHLDGTLVLSRQIAELGIYPAVDPLDSTSRILEPNFVGEEHYTVARGVQKILQKYKELQDIIAILGMDELSDEDKLVVSRARRIQRFLSQPFHVAETFTGTAGEYVKLEDTIKGFKGILAGEYDHLSESDFYMVGNIDSAVAKY 464
>gi|15925093|ref|NP_372627.1| F0F1 ATP synthase subunit beta [Staphylococcus aureus subsp. aureus Mu50] >gi|15927677|ref|NP_375210.1| F0F1 ATP synthase subunit beta [Staphylococcus aureus subsp. aureus N315] >gi|21283756|ref|NP_646844.1| F0F1 ATP synthase subunit beta [Staphylococcus aureus subsp. aureus MW2] >gi|49484327|ref|YP_041551.1| F0F1 ATP synthase subunit beta [Staphylococcus aureus subsp. aureus MRSA252] >gi|49486896|ref|YP_044117.1| F0F1 ATP synthase subunit beta [Staphylococcus aureus subsp. aureus MSSA476] >gi|57652125|ref|YP_186910.1| F0F1 ATP synthase subunit beta [Staphylococcus aureus subsp. aureus COL] >gi|82751704|ref|YP_417445.1| F0F1 ATP synthase subunit beta [Staphylococcus aureus RF122] >gi|87160880|ref|YP_494704.1| F0F1 ATP synthase subunit beta [Staphylococcus aureus subsp. aureus USA300] >gi|88196007|ref|YP_500820.1| F0F1 ATP synthase subunit beta [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|148268554|ref|YP_001247497.1| F0F1 ATP synthase subunit beta [Staphylococcus aureus subsp. aureus JH9] >gi|150394618|ref|YP_001317293.1| F0F1 ATP synthase subunit beta [Staphylococcus aureus subsp. aureus JH1] >gi|151222219|ref|YP_001333041.1| F0F1 ATP synthase subunit beta [Staphylococcus aureus subsp. aureus str. Newman] >gi|156980418|ref|YP_001442677.1| F0F1 ATP synthase subunit beta [Staphylococcus aureus subsp. aureus Mu3] >gi|161510310|ref|YP_001575969.1| F0F1 ATP synthase subunit beta [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|168728863|ref|ZP_02761140.1| F-ATPase superfamily proton( H+)- or sodium (Na+)-translocating F-type ATPase beta subunit [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|166222418|sp|A7X4U3|ATPB_STAA1 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|172048985|sp|A6QIU7|ATPB_STAAE ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|189081349|sp|A6U3I8|ATPB_STAA2 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|189081350|sp|A5IUP8|ATPB_STAA9 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|189081351|sp|A8YY70|ATPB_STAAT ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|54036785|sp|P63680|ATPB_STAAW ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|54036794|sp|P99112|ATPB_STAAN ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|54040855|sp|P63679|ATPB_STAAM ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|60389598|sp|Q6G7K7|ATPB_STAAS ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|60389623|sp|Q6GEX2|ATPB_STAAR ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|81170378|sp|Q5HE97|ATPB_STAAC ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|118573754|sp|Q2FF24|ATPB_STAA3 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|118573755|sp|Q2FWF0|ATPB_STAA8 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|118573756|sp|Q2YUK1|ATPB_STAAB ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|13701897|dbj|BAB43189.1| ATP synthase beta chain [Staphylococcus aureus subsp. aureus N315] >gi|14247876|dbj|BAB58265.1| ATP synthase beta chain [Staphylococcus aureus subsp. aureus Mu50] >gi|21205198|dbj|BAB95892.1| ATP synthase beta chain [Staphylococcus aureus subsp. aureus MW2] >gi|49242456|emb|CAG41172.1| ATP synthase beta chain [Staphylococcus aureus subsp. aureus MRSA252] >gi|49245339|emb|CAG43814.1| ATP synthase beta chain [Staphylococcus aureus subsp. aureus MSSA476] >gi|57286311|gb|AAW38405.1| ATP synthase F1, beta subunit [Staphylococcus aureus subsp. aureus COL] >gi|82657235|emb|CAI81676.1| ATP synthase beta chain [Staphylococcus aureus RF122] >gi|87126854|gb|ABD21368.1| ATP synthase F1, beta subunit [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|87203565|gb|ABD31375.1| ATP synthase F1, beta subunit [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|147741623|gb|ABQ49921.1| ATP synthase F1, beta subunit [Staphylococcus aureus subsp. aureus JH9] >gi|149947070|gb|ABR53006.1| ATP synthase F1, beta subunit [Staphylococcus aureus subsp. aureus JH1] >gi|150375019|dbj|BAF68279.1| ATP synthase, beta subunit [Staphylococcus aureus subsp. aureus str. Newman] >gi|156722553|dbj|BAF78970.1| ATP synthase beta chain [Staphylococcus aureus subsp. aureus Mu3] >gi|160369119|gb|ABX30090.1| F-ATPase superfamily proton( H+)- or sodium (Na+)-translocating F-type ATPase beta subunit [Staphylococcus aureus subsp. aureus USA300_TCH1516] (470 aa)
Score = 1539, Expect = 1.2e-168, Identities = 300/452 (66%), Positives = 367/452 (81%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK---KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKP-MPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           G + Q+ GPV+DV+F  N++P IN+ L + +P  +   +L LEVAL  GDDV R I+M ST+G+ RG++V +T   I  PVG   LGR+FNV+GE ID K  + + V   PIH++ P+FDE ST+ +I ETGIKV+DLL PY+KGGKIGLFGGAGVGKTVL+QELI+NIA  HGG+S+FAGVGERTREGNDLY EM D GVI +TA+VFGQMNEPPGARMRVAL+ LTMAE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMGQLQERITST  GS+TS+QAV+VPADD TDPAP+T FAHLDA T L+RK+  +GIYPA++PL S+SR L+PSIVG EHY+VAR VQ+ LQK+ ELQDIIAILG+DELS+EDK TV RAR+I+ FLSQ F VAE+F+ + G YV  + T++ F +I++GK D IPE  F  VG +DDV
  S:     4 GRVTQVMGPVIDVRFEHNEVPKINNALVIDVPKEEGTIQLTLEVALQLGDDVVRTIAMDSTDGVQRGMDVKDTGKEISVPVGDETLGRVFNVLGETIDLKEEISDSVRRDPIHRQAPAFDELSTEVQILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELINNIAQEHGGISVFAGVGERTREGNDLYFEMSDSGVIKKTAMVFGQMNEPPGARMRVALSGLTMAEYFRDEQGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTTKGSVTSIQAVFVPADDYTDPAPATAFAHLDATTNLERKLTEMGIYPAVDPLASTSRALEPSIVGQEHYEVARDVQSTLQKYRELQDIIAILGMDELSDEDKQTVERARRIQFFLSQNFHVAEQFTGQKGSYVPVKTTVANFKDILDGKYDHIPEDAFRLVGSMDDV 459
>gi|194332903|ref|YP_002014763.1| ATP synthase F1, beta subunit [Prosthecochloris aestuarii DSM 271] >gi|194310721|gb|ACF45116.1| ATP synthase F1, beta subunit [Prosthecochloris aestuarii DSM 271] (462 aa)
Score = 1539, Expect = 1.3e-168, Identities = 302/452 (66%), Positives = 358/452 (79%)
  Q:   299 KGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           +G I QI GPVVDV F   Q+P+I D L V  P+  KLVLE     GD+  R I+M  TEGL RG+ VINT  PI  PVG  VLGRM NVVGEPID     +      IH+  P FDE STK+E+FETGIKVIDLL PY +GGK GLFGGAGVGKTVL+ ELI+NIA    G S+FAGVGERTREGNDL+ EM + GVI++TALVFGQMNEPPGAR RVALT L++AE+FR+   +DVLLF+DNIFRF+QAGSEVSALLGR+PSAVGYQPTL  EMG+LQ+RI STK GS+TSVQA+YVPADDLTDPAP+TTF HLDA TVL R IA LGIYPA++PL+S+SR+LDP+IVG +HY  A++V+ ILQ++++LQDIIAILG+DELS+EDKL VSRARKI+ FLSQPFFVAE F+  SGKYV  +DTI GF EII G+ D++PE  F  VG I++
  S:     3 EGKISQIIGPVVDVDFPEGQLPSILDALTVARPDGSKLVLETQQHLGDERVRAIAMEGTEGLVRGIPVINTGKPIQVPVGQNVLGRMLNVVGEPIDGMGDIDSDTTRSIHRSAPKFDELSTKSEMFETGIKVIDLLEPYSRGGKTGLFGGAGVGKTVLIMELINNIAKQQSGYSVFAGVGERTREGNDLWEEMKESGVIDKTALVFGQMNEPPGARARVALTGLSIAEYFRDVEHRDVLLFVDNIFRFTQAGSEVSALLGRMPSAVGYQPTLGTEMGELQDRIVSTKDGSVTSVQAIYVPADDLTDPAPATTFTHLDATTVLSRSIAELGIYPAVDPLDSTSRILDPNIVGDDHYDTAQAVKEILQRYKDLQDIIAILGMDELSDEDKLVVSRARKIQRFLSQPFFVAEAFTGLSGKYVKLEDTIKGFKEIIAGRHDNLPENAFYLVGTIEE 454
>gi|156530197|gb|ABU75195.1| AtpB [Simaba insignis] (498 aa)
Score = 1539, Expect = 1.3e-168, Identities = 304/456 (66%), Positives = 361/456 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           K + G I QI GPV+DV F   +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIHK  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+SIF GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+V
  S:    17 KKNLGHIAQIIGPVLDVAFLPGKMPNIYNALVVKGRDTVGQPINMTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHKPAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSIFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFKLILSGELDGLPEQAFYLVGNIDEV 483
>gi|156530191|gb|ABU75192.1| AtpB [Simaba glabra] (494 aa)
Score = 1539, Expect = 1.3e-168, Identities = 304/456 (66%), Positives = 361/456 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           K + G I QI GPV+DV F   +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIHK  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+SIF GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+V
  S:    13 KKNLGHIAQIIGPVLDVAFLPGKMPNIYNALVVKGRDTVGQPINMTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRATSPIHKPAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSIFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFKLILSGELDGLPEQAFYLVGNIDEV 479
>gi|156530181|gb|ABU75187.1| AtpB [Simaba glabra] (498 aa)
Score = 1539, Expect = 1.3e-168, Identities = 304/456 (66%), Positives = 361/456 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           K + G I QI GPV+DV F   +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIHK  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+SIF GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+V
  S:    17 KKNLGHIAQIIGPVLDVAFLPGKMPNIYNALVVKGRDTVGQPINMTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRATSPIHKPAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSIFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFKLILSGELDGLPEQAFYLVGNIDEV 483
>gi|194335228|ref|YP_002017022.1| ATP synthase F1, beta subunit [Pelodictyon phaeoclathratiforme BU-1] >gi|194307705|gb|ACF42405.1| ATP synthase F1, beta subunit [Pelodictyon phaeoclathratiforme BU-1] (462 aa)
Score = 1539, Expect = 1.4e-168, Identities = 298/452 (65%), Positives = 364/452 (80%)
  Q:   299 KGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNK-PMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           +G I QI GPVVDV F   ++P+I D L V   +  KLVLE     G++  R ++M ST+GL RG+ V +T  PI  PVG  VLGRM NVVG+PID + P+  K  YS IH+  P FDE STK E+FETGIKVIDLL PY +GGK GLFGGAGVGKTVL+ ELI+NIA    G S+FAGVGERTREGNDL+HEM++ GVI++TALVFGQMNEPPGAR RVALT L++AE+FR+   +DVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMG+LQ+RI STK GS+TSVQA+YVPADDLTDPAP+T FAHLDA TVL R IA LGIYPA++PL+S+SR+LDP+IVG +HY  A++V+ +LQ++++LQDIIAILG+DELS+EDKL VSRARK++ FLSQPFFVAE F+  +GKYV  ++TI GF EII G+ D++PE  F  VG I++
  S:     3 EGKISQIIGPVVDVDFPEGRLPSILDALTVTRADGTKLVLETQQHLGEERVRTVAMESTDGLVRGMNVTHTGKPIQVPVGLEVLGRMLNVVGDPIDGRGPVNTKKSYS-IHRLAPRFDEISTKAEMFETGIKVIDLLEPYSRGGKTGLFGGAGVGKTVLIMELINNIAKQQSGFSVFAGVGERTREGNDLWHEMMESGVIDKTALVFGQMNEPPGARQRVALTGLSIAEYFRDEEGRDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGELQDRIVSTKKGSVTSVQAIYVPADDLTDPAPATAFAHLDATTVLSRSIAELGIYPAVDPLDSTSRILDPNIVGDDHYDTAQAVKQLLQRYKDLQDIIAILGMDELSDEDKLVVSRARKVQRFLSQPFFVAEAFTGLAGKYVKLEETIKGFKEIIAGRHDNLPESAFYLVGTIEE 454
>gi|118579930|ref|YP_901180.1| F0F1 ATP synthase subunit beta [Pelobacter propionicus DSM 2379] >gi|190358235|sp|A1AP52|ATPB2_PELPD ATP synthase subunit beta 2 (ATPase subunit beta 2) (ATP synthase F1 sector subunit beta 2) >gi|118502640|gb|ABK99122.1| ATP synthase F1, beta subunit [Pelobacter propionicus DSM 2379] (471 aa)
Score = 1539, Expect = 1.4e-168, Identities = 302/456 (66%), Positives = 363/456 (79%)
  Q:   295 LKSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLP----NNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           +  + G I Q+ G VVDV+F   ++P I   L V  P    +   LVLEVA   G++  R I+M ST+GL RG  V++T   I APVG   LGR+ NV+GEP+D        + +PIH++ P F++QSTK E F TGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG S+FAGVGERTREGNDL+ EM + GV+ +TALV+GQMNEPPGAR RVALTAL++AEHFR++   DVLLFIDNIFRF+QAGSEVSALLGRIPSAVGYQPTLA EMG+LQERITSTK+GSITSVQA+YVPADDLTDPAP+T FAHLDA TVL R+IA LGIYPA++PL+S+SR+LDP I+G EHY +AR VQ ILQK+++LQDIIAILG+DELSEEDKL V+RARKI+ FLSQPFFVAE F+   GKYV  +DTI GF EI+ GK D +PEQ F  VG I++
  S:     1 MSQNTGKITQVIGAVVDVEFEPGKLPEIYHALRVTNPAINDSENNLVLEVAQHLGENSVRTIAMDSTDGLKRGQAVLDTGKQICAPVGKKTLGRIINVIGEPVDEMGPIGNDKENPIHREAPPFEDQSTKVEAFTTGIKVVDLLAPYARGGKIGLFGGAGVGKTVLIMELINNIARQHGGFSVFAGVGERTREGNDLWMEMKETGVLEKTALVYGQMNEPPGARARVALTALSIAEHFRDDEGLDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGELQERITSTKNGSITSVQAIYVPADDLTDPAPATAFAHLDATTVLSRQIAELGIYPAVDPLDSTSRILDPQIIGEEHYAIARQVQYILQKYKDLQDIIAILGMDELSEEDKLIVARARKIQRFLSQPFFVAEVFTGSPGKYVELKDTIKGFQEIVSGKHDHLPEQAFYMVGSIEE 460
>gi|156530139|gb|ABU75166.1| AtpB [Hannoa undulata] (496 aa)
Score = 1538, Expect = 1.7e-168, Identities = 304/456 (66%), Positives = 361/456 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           K + G I QI GPV+DV F   +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIHK  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+SIF GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+V
  S:    15 KKNLGHIAQIIGPVLDVAFLPGKMPNIYNALVVKGRDTVGQPINMTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHKPAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSIFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFKLILSGELDGLPEQAFYLVGNIDEV 481
>gi|118579045|ref|YP_900295.1| F0F1 ATP synthase subunit beta [Pelobacter propionicus DSM 2379] >gi|190358211|sp|A1ALL7|ATPB1_PELPD ATP synthase subunit beta 1 (ATPase subunit beta 1) (ATP synthase F1 sector subunit beta 1) >gi|118501755|gb|ABK98237.1| ATP synthase F1, beta subunit [Pelobacter propionicus DSM 2379] (471 aa)
Score = 1538, Expect = 1.7e-168, Identities = 301/456 (66%), Positives = 363/456 (79%)
  Q:   295 LKSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLP----NNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           +  + G I Q+ G VVDV+F   ++P I   L V  P    +   LVLEVA   G++  R I+M ST+GL RG  V++T   I APVG   LGR+ NV+GEP+D        + +PIH++ P F++QSTK E F TGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG S+FAGVGERTREGNDL+ EM + GV+ +TALV+GQMNEPPGAR RVALTAL++AEHFR++   DVLLFIDNIFRF+QAGSEVSALLGRIPSAVGYQPTLA EMG+LQERITSTK+GSITSVQA+YVPADDLTDPAP+T FAHLDA TVL R+IA LGIYPA++PL+S+SR+LDP ++G EHY +AR VQ ILQK+++LQDIIAILG+DELSEEDKL V+RARKI+ FLSQPFFVAE F+   GKYV  +DTI GF EI+ GK D +PEQ F  VG I++
  S:     1 MSQNTGKITQVIGAVVDVEFEPGKLPEIYHALRVTNPAINDSENNLVLEVAQHLGENSVRTIAMDSTDGLKRGQAVLDTGKQICAPVGKKTLGRIINVIGEPVDEMGPIGNDKENPIHREAPPFEDQSTKVEAFTTGIKVVDLLAPYARGGKIGLFGGAGVGKTVLIMELINNIARQHGGFSVFAGVGERTREGNDLWMEMKETGVLEKTALVYGQMNEPPGARARVALTALSIAEHFRDDEGLDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGELQERITSTKNGSITSVQAIYVPADDLTDPAPATAFAHLDATTVLSRQIAELGIYPAVDPLDSTSRILDPQVIGEEHYAIARQVQYILQKYKDLQDIIAILGMDELSEEDKLIVARARKIQRFLSQPFFVAEVFTGSPGKYVELKDTIKGFQEIVSGKHDHLPEQAFYMVGSIEE 460
>gi|154173677|ref|YP_001408809.1| F0F1 ATP synthase subunit beta [Campylobacter curvus 525.92] >gi|190358268|sp|A7H017|ATPB_CAMC5 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|112803722|gb|EAU01066.1| ATP synthase F1, beta subunit [Campylobacter curvus 525.92] (465 aa)
Score = 1538, Expect = 1.7e-168, Identities = 301/452 (66%), Positives = 359/452 (79%)
  Q:   299 KGIIYQIFGPVVDVKFARNQMPNINDCLEVKLP---NNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           KG+I Q+ GPVVDV F  + +P IN+ +EV         +L+LEVA   GD+  R I+M  +EGL RGLE      PI  PVG  VLGR+FNVVG+ ID     E  ++  IH+ PP F+EQSTK+EIFETGIKV+DLL PY KGGK+GLFGGAGVGKTV++ ELIHN+A  H G S+FAGVGERTREGNDLYHEM +  V+++ AL +GQMNEPPGAR R+ALT LTMAE+FR+    DVL+FIDNIFRFSQ+G+E+SALLGRIPSAVGYQPTLA EMG+ QERITSTK GSITSVQAVYVPADDLTDPAP+T FAHLDA TVL+R IA  GIYPA++PL+S+SRMLDP I+G +HYKVAR VQ +LQK+++LQDIIAILG+DELSEEDKLTV RARKI  FLSQPFFVAE F+   GKYVS ++ I+GF  I++GK D +PE  F  VG ID+
  S:     2 KGVISQVMGPVVDVDF-NDYLPKINEAIEVYFEVEGKKNRLILEVAAHLGDNRVRTIAMDMSEGLTRGLEATALGAPISVPVGEKVLGRIFNVVGDLIDEGEGVEFDKHWSIHRDPPPFEEQSTKSEIFETGIKVVDLLAPYAKGGKVGLFGGAGVGKTVIIMELIHNVAFKHSGYSVFAGVGERTREGNDLYHEMKESNVLDKVALCYGQMNEPPGARNRIALTGLTMAEYFRDEMGLDVLMFIDNIFRFSQSGAEMSALLGRIPSAVGYQPTLASEMGKFQERITSTKKGSITSVQAVYVPADDLTDPAPATVFAHLDATTVLNRAIAEKGIYPAVDPLDSTSRMLDPQILGEDHYKVARGVQAVLQKYKDLQDIIAILGMDELSEEDKLTVDRARKIERFLSQPFFVAEVFTGSPGKYVSLEENIAGFKGILDGKYDSLPEAAFYMVGNIDE 455
>gi|116873893|ref|YP_850674.1| F0F1 ATP synthase subunit beta [Listeria welshimeri serovar 6b str. SLCC5334] >gi|123466611|sp|A0ALL3|ATPB2_LISW6 ATP synthase subunit beta 2 (ATPase subunit beta 2) (ATP synthase F1 sector subunit beta 2) >gi|116742771|emb|CAK21895.1| atpD [Listeria welshimeri serovar 6b str. SLCC5334] (473 aa)
Score = 1538, Expect = 1.8e-168, Identities = 297/453 (65%), Positives = 369/453 (81%)
  Q:   299 KGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNN------KKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPID-NKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           KG + Q+ GPVVDVKF    +P I + L ++  ++       +L LEVA+  GDDV R I+M ST+G+ RG+EVI+T +PI  PVG+  LGR+FNV+G  ID ++P+P  ++ + IH++ P+FD+ +T TEI ETGIKV+DLL PY+KGGKIGLFGGAGVGKTVL+QELIHNIA  HGG+S+FAGVGERTREGNDLY EM D GVI +TA+VFGQMNEPPGARMRVALT LT+AE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMGQLQERITST  GS+TS+QA+YVPADD TDPAP+TTFAHLDA T L+RK+   GIYPA++PL S+SR L P IVG EHY VA  VQ +LQ+++ELQDIIAILG+DELS+EDK +VSRAR+++ FLSQ F VAE+F+ + G YV  ++T+ GF +++ GK D IPE  F  VG I++V
  S:     3 KGQVIQVMGPVVDVKFEGGNLPEIYNALVIEYKSDAEEAPTSQLTLEVAIQLGDDVVRTIAMASTDGVQRGMEVIDTGSPITVPVGTVTLGRVFNVLGNTIDLDEPLPSDIKRNKIHREAPTFDQLATTTEILETGIKVVDLLAPYLKGGKIGLFGGAGVGKTVLIQELIHNIAQEHGGISVFAGVGERTREGNDLYFEMKDSGVIEKTAMVFGQMNEPPGARMRVALTGLTIAEYFRDEEHQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTNVGSVTSIQAIYVPADDYTDPAPATTFAHLDATTNLERKLTEQGIYPAVDPLASTSRALSPDIVGEEHYAVATEVQRLLQRYKELQDIIAILGMDELSDEDKQSVSRARRVQFFLSQNFHVAEQFTGQKGSYVPVKETVKGFKDLLAGKYDHIPEDAFRSVGRIEEV 462
>gi|156530189|gb|ABU75191.1| AtpB [Simaba ferruginea] (495 aa)
Score = 1538, Expect = 1.9e-168, Identities = 304/456 (66%), Positives = 361/456 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           K + G I QI GPV+DV F   +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIHK  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+SIF GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+V
  S:    14 KKNLGHIAQIIGPVLDVAFLPGKMPNIYNALVVKGRDTVGQPINMTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHKPAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSIFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFKLILSGELDGLPEQAFYLVGNIDEV 480
>gi|171191275|gb|ACB45105.1| AtpB [Simaba cuneata] (495 aa)
Score = 1538, Expect = 1.9e-168, Identities = 304/456 (66%), Positives = 361/456 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           K + G I QI GPV+DV F   +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIHK  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+SIF GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+V
  S:    14 KKNLGHIAQIIGPVLDVAFLPGKMPNIYNALVVKGRDTVGQPINMTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRATSPIHKPAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSIFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFKLILSGELDGLPEQAFYLVGNIDEV 480
>gi|156530185|gb|ABU75189.1| AtpB [Simaba cuneata] (497 aa)
Score = 1538, Expect = 1.9e-168, Identities = 304/456 (66%), Positives = 361/456 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           K + G I QI GPV+DV F   +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIHK  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+SIF GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+V
  S:    16 KKNLGHIAQIIGPVLDVAFLPGKMPNIYNALVVKGRDTVGQPINMTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRATSPIHKPAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSIFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFKLILSGELDGLPEQAFYLVGNIDEV 482
>gi|156530215|gb|ABU75204.1| AtpB [Simarouba versicolor] (496 aa)
Score = 1537, Expect = 2.0e-168, Identities = 303/456 (66%), Positives = 361/456 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           K + G I QI GPV+DV F   +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIHK  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+SIF GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +T+ GF  I+ G+ D +PEQ F  VG ID+V
  S:    15 KKNLGHIAQIIGPVLDVAFLPGKMPNIYNALVVKGRDTVGQPINMTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHKPAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSIFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETVRGFKLILSGELDGLPEQAFYLVGNIDEV 481
>gi|15901355|ref|NP_345959.1| F0F1 ATP synthase subunit beta [Streptococcus pneumoniae TIGR4] >gi|15903403|ref|NP_358953.1| F0F1 ATP synthase subunit beta [Streptococcus pneumoniae R6] >gi|111657410|ref|ZP_01408163.1| hypothetical protein SpneT_02001380 [Streptococcus pneumoniae TIGR4] >gi|116516544|ref|YP_816797.1| F0F1 ATP synthase subunit beta [Streptococcus pneumoniae D39] >gi|148984851|ref|ZP_01818104.1| F0F1 ATP synthase subunit beta [Streptococcus pneumoniae SP3-BS71] >gi|149007587|ref|ZP_01831222.1| F0F1 ATP synthase subunit beta [Streptococcus pneumoniae SP18-BS74] >gi|149021774|ref|ZP_01835781.1| F0F1 ATP synthase subunit beta [Streptococcus pneumoniae SP23-BS72] >gi|168487559|ref|ZP_02712067.1| ATP synthase F1, beta subunit [Streptococcus pneumoniae CDC1087-00] >gi|168575963|ref|ZP_02721878.1| ATP synthase F1, beta subunit [Streptococcus pneumoniae MLV-016] >gi|169833283|ref|YP_001694914.1| ATP synthase F1, beta subunit [Streptococcus pneumoniae Hungary19A-6] >gi|122277705|sp|Q04HT9|ATPB_STRP2 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|81588075|sp|Q8DP44|ATPB_STRR6 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|81854993|sp|Q97PT6|ATPB_STRPN ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|14972998|gb|AAK75599.1| ATP synthase F1, beta subunit [Streptococcus pneumoniae TIGR4] >gi|15459007|gb|AAL00164.1| Proton-translocating ATPase, F1 sector, beta-subunit [Streptococcus pneumoniae R6] >gi|116077120|gb|ABJ54840.1| ATP synthase F1, beta subunit [Streptococcus pneumoniae D39] >gi|147760946|gb|EDK67916.1| F0F1 ATP synthase subunit beta [Streptococcus pneumoniae SP18-BS74] >gi|147922873|gb|EDK73989.1| F0F1 ATP synthase subunit beta [Streptococcus pneumoniae SP3-BS71] >gi|147930010|gb|EDK80997.1| F0F1 ATP synthase subunit beta [Streptococcus pneumoniae SP23-BS72] >gi|168995785|gb|ACA36397.1| ATP synthase F1, beta subunit [Streptococcus pneumoniae Hungary19A-6] >gi|183569628|gb|EDT90156.1| ATP synthase F1, beta subunit [Streptococcus pneumoniae CDC1087-00] >gi|183578206|gb|EDT98734.1| ATP synthase F1, beta subunit [Streptococcus pneumoniae MLV-016] (468 aa)
Score = 1537, Expect = 2.2e-168, Identities = 304/452 (67%), Positives = 363/452 (80%)
  Q:   300 GIIYQIFGPVVDVKFARNQ-MPNINDCLEVKLPNNKK--LVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPID-NKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           G I Q+ GPVVDV FA  + +P IN+ L V   + +K  +VLEVAL  GD + R I+M ST+GL RG+EV++T  PI  PVG   LGR+FNV+G+ ID   P  E  E  PIHKK P+FDE ST +EI ETGIKVIDLL PY+KGGK+GLFGGAGVGKTVL+QELIHNIA  HGG+S+FAGVGERTREGNDLY EM + GVI +TA+VFGQMNEPPGARMRVALT LT+AE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMGQLQERITSTK GS+TS+QA+YVPADD TDPAP+T FAHLD+ T L+RK+  LGIYPA++PL SSSR L P IVG EHY VA  V+ +LQ++ ELQDIIAILG+DELS+E+K  V+RAR+I+ FLSQ F VAE+F+ + G YV   +T+ GF EI++GK D +PE  F  VG I+DV
  S:     4 GKIAQVIGPVVDVLFAAGEKLPEINNALVVYKNDERKTKIVLEVALELGDGMVRTIAMESTDGLTRGMEVLDTGRPISVPVGKETLGRVFNVLGDTIDLEAPFTEDAERQPIHKKAPTFDELSTSSEILETGIKVIDLLAPYLKGGKVGLFGGAGVGKTVLIQELIHNIAQEHGGISVFAGVGERTREGNDLYWEMKESGVIEKTAMVFGQMNEPPGARMRVALTGLTIAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGSVTSIQAIYVPADDYTDPAPATAFAHLDSTTNLERKLVQLGIYPAVDPLASSSRALAPEIVGEEHYAVAAEVKRVLQRYHELQDIIAILGMDELSDEEKTLVARARRIQFFLSQNFNVAEQFTGQPGSYVPVAETVRGFKEILDGKYDHLPEDAFRGVGSIEDV 459
>gi|156530203|gb|ABU75198.1| AtpB [Simaba guianensis] >gi|156530205|gb|ABU75199.1| AtpB [Simaba polyphylla] (494 aa)
Score = 1537, Expect = 2.2e-168, Identities = 304/456 (66%), Positives = 361/456 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           K + G I QI GPV+DV F   +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIHK  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+SIF GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+V
  S:    13 KKNLGHIAQIIGPVLDVAFLPGKMPNIYNALVVKGRDTVGQPINMTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHKPAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSIFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGFPGKYVGLAETIRGFKLILSGELDGLPEQAFYLVGNIDEV 479
>gi|46579188|ref|YP_009996.1| F0F1 ATP synthase subunit beta [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] >gi|120603238|ref|YP_967638.1| F0F1 ATP synthase subunit beta [Desulfovibrio vulgaris subsp. vulgaris DP4] >gi|166201699|sp|A1VFJ5|ATPB_DESVV ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|81830486|sp|Q72E04|ATPB_DESVH ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|46448601|gb|AAS95255.1| ATP synthase, F1 beta subunit [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] >gi|120563467|gb|ABM29211.1| ATP synthase F1, beta subunit [Desulfovibrio vulgaris subsp. vulgaris DP4] (470 aa)
Score = 1537, Expect = 2.5e-168, Identities = 294/461 (63%), Positives = 362/461 (78%)
  Q:   295 LKSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKK---LVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHKNY 755
           + ++ G I Q+ G VVDV+F   Q+PNI + L++K PNN     LV EVA   GD++ R I+M +TEGL RG+E  +T  PIM PVG A LGR+ NVVG P+D        +  PIH+  P F EQ+TK E+ ETGIKV+DLL+P+ KGGK+GLFGGAGVGKTV++ E+I+NIA  HGG+S+FAGVGERTREGNDLYHEM D GV+ + AL++GQMNEPPGAR RVALTAL  AE+FR+   QDVLLF+DNIFRF+QAGSEVSALLGR+PSAVGYQPTL  ++G LQERITST  GSITSVQAVYVPADDLTDPAP+TTF+HLD   VL R+IA LGIYPA++PL+S+SR+LDP++VG+EHY VAR VQ +LQK+++LQDIIAILG+DELS+EDKLTV+RAR+I+ FLSQPF VAE F+   G YV  +DTI GF  I+ G  D + E  F  VGGI+   + Y
  S:     1 MSANIGKIVQVIGAVVDVEFPSGQLPNILNALDIKNPNNTDAPDLVCEVAQHLGDNIVRTIAMDATEGLVRGMEASDTGKPIMVPVGKASLGRIMNVVGRPVDELGPINADKSLPIHRAAPEFTEQNTKVELLETGIKVVDLLIPFPKGGKMGLFGGAGVGKTVILMEMINNIAKQHGGISVFAGVGERTREGNDLYHEMKDAGVLEKAALIYGQMNEPPGARARVALTALACAEYFRDVENQDVLLFVDNIFRFTQAGSEVSALLGRMPSAVGYQPTLGTDLGALQERITSTTKGSITSVQAVYVPADDLTDPAPATTFSHLDGTLVLSRQIAELGIYPAVDPLDSTSRILDPNVVGVEHYGVARQVQQVLQKYKDLQDIIAILGMDELSDEDKLTVARARRIQRFLSQPFHVAETFTGTPGVYVKLEDTIKGFMGILNGDYDHLAEGDFYMVGGIEMALEKY 464
>gi|149003278|ref|ZP_01828174.1| F0F1 ATP synthase subunit beta [Streptococcus pneumoniae SP14-BS69] >gi|147758738|gb|EDK65735.1| F0F1 ATP synthase subunit beta [Streptococcus pneumoniae SP14-BS69] (468 aa)
Score = 1536, Expect = 2.6e-168, Identities = 304/452 (67%), Positives = 363/452 (80%)
  Q:   300 GIIYQIFGPVVDVKFARNQ-MPNINDCLEVKLPNNKK--LVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPID-NKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           G I Q+ GPVVDV FA  + +P IN+ L V   + +K  +VLEVAL  GD + R I+M ST+GL RG+EV++T  PI  PVG   LGR+FNV+G+ ID   P  E  E  PIHKK P+FDE ST +EI ETGIKVIDLL PY+KGGK+GLFGGAGVGKTVL+QELIHNIA  HGG+S+FAGVGERTREGNDLY EM + GVI +TA+VFGQMNEPPGARMRVALT LT+AE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMGQLQERITSTK GS+TS+QA+YVPADD TDPAP+T FAHLD+ T L+RK+  LGIYPA++PL SSSR L P IVG EHY VA  V+ +LQ++ ELQDIIAILG+DELS+E+K  V+RAR+I+ FLSQ F VAE+F+ + G YV   +T+ GF EI++GK D +PE  F  VG I+DV
  S:     4 GKIAQVIGPVVDVLFAAGEKLPEINNALVVYKNDERKTKIVLEVALELGDGMVRTIAMESTDGLTRGMEVLDTGRPISVPVGKETLGRVFNVLGDTIDLEAPFTEDAERQPIHKKAPTFDELSTSSEILETGIKVIDLLAPYLKGGKVGLFGGAGVGKTVLIQELIHNIAQEHGGISVFAGVGERTREGNDLYWEMKESGVIEKTAMVFGQMNEPPGARMRVALTGLTIAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGSVTSIQAIYVPADDYTDPAPATAFAHLDSTTNLERKLVQLGIYPAVDPLASSSRALAPEIVGEEHYAVAAEVKRVLQRYHELQDIIAILGMDELSDEEKTLVARARRIQFFLSQNFNVAEQFTGQPGSYVPVAETVRGFKEILDGKYDHLPEDAFRGVGSIEDV 459
>gi|157164647|ref|YP_001466345.1| F0F1 ATP synthase subunit beta [Campylobacter concisus 13826] >gi|190358267|sp|A7ZC37|ATPB_CAMC1 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|112800107|gb|EAT97451.1| ATP synthase F1, beta subunit [Campylobacter concisus 13826] (465 aa)
Score = 1536, Expect = 2.7e-168, Identities = 302/452 (66%), Positives = 357/452 (78%)
  Q:   299 KGIIYQIFGPVVDVKFARNQMPNINDCLEVKLP---NNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           KG+I Q+ GPVVDV F  + +P IN+ +EV         KL+LEVA   GD+  R I+M  +EGL RGLE      PI  PVG  VLGR+FNVVG+ ID        ++  IH+ PP F+EQSTK+EIFETGIKV+DLL PY KGGK+GLFGGAGVGKTV++ ELIHN+A  H G S+FAGVGERTREGNDLYHEM +  V+++ AL +GQMNEPPGAR R+ALT LTMAE+FR+    DVL+FIDNIFRFSQ+G+E+SALLGRIPSAVGYQPTLA EMG+ QERITSTK GSITSVQAVYVPADDLTDPAP+T FAHLDA TVL+R IA  GIYPA++PL+S+SRMLDP I+G +HYKVAR VQ +LQK+++LQDIIAILG+DELSEEDKLTV RARKI  FLSQPFFVAE F+   GKYVS  + I+GF  I+EGK D +PE  F  VG ID+
  S:     2 KGVISQVMGPVVDVDF-NDYLPKINEAIEVFFEVEGKKHKLILEVAAHLGDNRVRTIAMDMSEGLTRGLEAKALGAPISVPVGEKVLGRIFNVVGDLIDEGEGINFDKHWSIHRDPPPFEEQSTKSEIFETGIKVVDLLAPYAKGGKVGLFGGAGVGKTVIIMELIHNVAFKHSGYSVFAGVGERTREGNDLYHEMKESNVLDKVALCYGQMNEPPGARNRIALTGLTMAEYFRDEMGLDVLMFIDNIFRFSQSGAEMSALLGRIPSAVGYQPTLASEMGKFQERITSTKKGSITSVQAVYVPADDLTDPAPATVFAHLDATTVLNRSIAEKGIYPAVDPLDSTSRMLDPQILGADHYKVARGVQAVLQKYKDLQDIIAILGMDELSEEDKLTVDRARKIERFLSQPFFVAEVFTGSPGKYVSLDENIAGFKGILEGKYDHLPEAAFYMVGNIDE 455
>gi|157776606|ref|XP_001666369.1| hypothetical protein CBG21173 [Caenorhabditis briggsae AF16] >gi|187022807|emb|CAP38046.1| C. briggsae CBR-ATP-2 protein [Caenorhabditis briggsae] (537 aa)
Score = 1536, Expect = 2.7e-168, Identities = 304/460 (66%), Positives = 366/460 (79%)
  Q:   294 TLKSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNK-PMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVIN------QTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHK 753
           T  +  G I  + G VVDV+F  N +P I + LEV +  + +L+LEV+   GD+V RCI+M  TEGL RG  V +T +PI  PVG   LGR+ NV+GEPID + P+P K  ++PIH + P F E S + EI  TGIKV+DLL PY KGGKIGLFGGAGVGKTVL+ ELI+N+A  HGG S+FAGVGERTREGNDLYHEMI+GGVI+      + +LV+GQMNEPPGAR RV LT LT+AE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGRIPSAVGYQPTLA +MG +QERIT+TK GSITSVQA+YVPADDLTDPAP+TTFAHLDA TVL R IA L IYPA++PL+S+SR++DP+IVG  HY +AR VQ ILQ ++ LQDIIAILG+DELSEEDKLTVSRARKI+ FLSQPF VAE F+   GK+VS ++TI GF+ I++G+ D +PE  F   GGIDDV K
  S:    64 TAANASGRIVAVIGAVVDVQFDEN-LPPILNGLEV-VGRSPRLILEVSQHLGDNVVRCIAMDGTEGLVRGQPVADTGDPIKIPVGPETLGRIMNVIGEPIDERGPIPSK-NFAPIHAEAPEFVEMSVEQEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEMIEGGVIDLKGKNSKVSLVYGQMNEPPGARARVCLTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGGMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRGIAELAIYPAVDPLDSTSRIMDPNIVGQNHYDIARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVSRARKIQKFLSQPFQVAEVFTGYQGKFVSLEETIRGFTMILKGELDHLPEVAFYMQGGIDDVFK 527
>gi|171191283|gb|ACB45109.1| AtpB [Simarouba berteroana] (495 aa)
Score = 1536, Expect = 2.9e-168, Identities = 303/456 (66%), Positives = 361/456 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           K + G I QI GPV+DV F   +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIHK  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+SIF GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +T+ GF  I+ G+ D +PEQ F  VG ID+V
  S:    14 KKNLGHIAQIIGPVLDVAFLPGKMPNIYNALVVKGRDTVGQPINMTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHKPAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSIFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETVRGFKLILSGELDGLPEQAFYLVGNIDEV 480
>gi|15674808|ref|NP_268982.1| F0F1 ATP synthase subunit beta [Streptococcus pyogenes M1 GAS] >gi|71910394|ref|YP_281944.1| F0F1 ATP synthase subunit beta [Streptococcus pyogenes MGAS5005] >gi|81856117|sp|Q9A0I7|ATPB_STRP1 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|13621938|gb|AAK33703.1| putative proton-translocating ATPase, beta subunit [Streptococcus pyogenes M1 GAS] >gi|71853176|gb|AAZ51199.1| ATPase, beta subunit [Streptococcus pyogenes MGAS5005] (468 aa)
Score = 1536, Expect = 3.0e-168, Identities = 308/454 (67%), Positives = 365/454 (80%)
  Q:   300 GIIYQIFGPVVDVKFAR-NQMPNINDCLEVKLPNNKK--LVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPID-NKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHK 753
           G I Q+ GPVVDV FA  +++P IN+ L V   ++KK  +VLEVAL  GD + R I+M ST+GL RGLEV++T   I  PVG   LGR+FNV+GE ID  +P  E V+  PIHKK PSFDE ST +EI ETGIKVIDLL PY+KGGK+GLFGGAGVGKTVL+QELIHNIA  HGG+S+F GVGERTREGNDLY EM + GVI +TA+VFGQMNEPPGARMRVALT LT+AE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMGQLQERITST+ GS+TS+QA+YVPADD TDPAP+T FAHLD+ T L+RK+  +GIYPA++PL SSSR L P IVG EHY VA  VQ +LQ++ ELQDIIAILG+DELS+E+K  V RAR+I+ FLSQ F VAE+F+   G YV   DT+ GF EI+EGK D++PE  F  VG I+DV K
  S:     4 GKIAQVVGPVVDVMFASGDKLPEINNALIVYKDSDKKQKIVLEVALELGDGMVRTIAMESTDGLTRGLEVLDTGRAISVPVGKETLGRVFNVLGETIDLEEPFAEDVDRQPIHKKAPSFDELSTSSEILETGIKVIDLLAPYLKGGKVGLFGGAGVGKTVLIQELIHNIAQEHGGISVFTGVGERTREGNDLYWEMKESGVIEKTAMVFGQMNEPPGARMRVALTGLTIAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTQKGSVTSIQAIYVPADDYTDPAPATAFAHLDSTTNLERKLTQMGIYPAVDPLASSSRALSPEIVGEEHYAVATEVQRVLQRYRELQDIIAILGMDELSDEEKTLVGRARRIQFFLSQNFNVAEQFTGLPGSYVPVADTVRGFKEILEGKYDELPEDAFRSVGPIEDVIK 461
>gi|21910035|ref|NP_664303.1| F0F1 ATP synthase subunit beta [Streptococcus pyogenes MGAS315] >gi|28896267|ref|NP_802617.1| F0F1 ATP synthase subunit beta [Streptococcus pyogenes SSI-1] >gi|71903225|ref|YP_280028.1| F0F1 ATP synthase subunit beta [Streptococcus pyogenes MGAS6180] >gi|94988266|ref|YP_596367.1| F0F1 ATP synthase subunit beta [Streptococcus pyogenes MGAS9429] >gi|94992140|ref|YP_600239.1| F0F1 ATP synthase subunit beta [Streptococcus pyogenes MGAS2096] >gi|81847483|sp|Q8K826|ATPB_STRP3 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|118573761|sp|Q1JCL3|ATPB_STRPB ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|118573762|sp|Q1JMI9|ATPB_STRPC ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|118573765|sp|Q48UD3|ATPB_STRPM ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|21904225|gb|AAM79106.1| putative proton-translocating ATPase beta subunit [Streptococcus pyogenes MGAS315] >gi|28811518|dbj|BAC64450.1| putative proton-translocating ATPase, beta subunit [Streptococcus pyogenes SSI-1] >gi|71802320|gb|AAX71673.1| ATPase, beta subunit [Streptococcus pyogenes MGAS6180] >gi|94541774|gb|ABF31823.1| ATP synthase beta chain [Streptococcus pyogenes MGAS9429] >gi|94545648|gb|ABF35695.1| ATP synthase beta chain [Streptococcus pyogenes MGAS2096] (468 aa)
Score = 1536, Expect = 3.0e-168, Identities = 308/454 (67%), Positives = 365/454 (80%)
  Q:   300 GIIYQIFGPVVDVKFAR-NQMPNINDCLEVKLPNNKK--LVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPID-NKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHK 753
           G I Q+ GPVVDV FA  +++P IN+ L V   ++KK  +VLEVAL  GD + R I+M ST+GL RGLEV++T   I  PVG   LGR+FNV+GE ID  +P  E V+  PIHKK PSFDE ST +EI ETGIKVIDLL PY+KGGK+GLFGGAGVGKTVL+QELIHNIA  HGG+S+F GVGERTREGNDLY EM + GVI +TA+VFGQMNEPPGARMRVALT LT+AE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMGQLQERITST+ GS+TS+QA+YVPADD TDPAP+T FAHLD+ T L+RK+  +GIYPA++PL SSSR L P IVG EHY VA  VQ +LQ++ ELQDIIAILG+DELS+E+K  V RAR+I+ FLSQ F VAE+F+   G YV   +T+ GF EI+EGK DD+PE  F  VG I+DV K
  S:     4 GKIAQVVGPVVDVMFASGDKLPEINNALIVYKDSDKKQKIVLEVALELGDGMVRTIAMESTDGLTRGLEVLDTGRAISVPVGKETLGRVFNVLGETIDLEEPFAEDVDRQPIHKKAPSFDELSTSSEILETGIKVIDLLAPYLKGGKVGLFGGAGVGKTVLIQELIHNIAQEHGGISVFTGVGERTREGNDLYWEMKESGVIEKTAMVFGQMNEPPGARMRVALTGLTIAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTQKGSVTSIQAIYVPADDYTDPAPATAFAHLDSTTNLERKLTQMGIYPAVDPLASSSRALSPEIVGEEHYAVATEVQRVLQRYRELQDIIAILGMDELSDEEKTLVGRARRIQFFLSQNFNVAEQFTGLPGSYVPVAETVRGFKEILEGKYDDLPEDAFRSVGPIEDVIK 461
>gi|28193539|emb|CAD48597.1| F1F0-ATPase subunit beta [Lactobacillus hilgardii] (481 aa)
Score = 1536, Expect = 3.1e-168, Identities = 303/476 (63%), Positives = 373/476 (78%)
  Q:   300 GIIYQIFGPVVDVKFARN-QMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKP-MPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHKNYVAANSNNKVNSSNKPLNSEN 775
           G + Q+ GPVVDV+F+ N ++P IN  L V + ++K LV+EVAL  GD V R I+M  T+GL RG+EV NT++ I  PVG+  LGR+FNV+GEPID  P      E  PIH++ P +DE +  TEI ETGIKVIDLL PY++GGK+GLFGGAGVGKTVL+QELIHNIA GH G+S+F GVGERTREGND+Y+EM   GV+ +TA+V+GQMNEPPGARMRVALT LT+AE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGRIPSAVGYQPTLA EMGQLQERITSTK G+ITS+QAVYVPADD TDPAP+TTFAHLDA T L+R +   GIYPA++PL S+S  LDP IVG EHY VA  VQ +LQ++ ELQDII+ILG+DELS+E+K  V+RAR+I+ FLSQ F VAE+F+   GKYVS  DT+ GF +I++GK DDIPE  F   G I+DV  N      N+  ++S++  ++ N
  S:     4 GKVLQVIGPVVDVEFSLNDKLPEINTALNVHVSDDKTLVVEVALDLGDGVVRTIAMDGTDGLRRGMEVENTESSISVPVGNDTLGRVFNVLGEPIDGGPEFGPDAERWPIHREAPKYDELNPSTEILETGIKVIDLLEPYIRGGKVGLFGGAGVGKTVLIQELIHNIAQGHNGISVFTGVGERTREGNDMYYEMKGSGVLAKTAMVYGQMNEPPGARMRVALTGLTIAEYFRDEAGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGQLQERITSTKKGAITSIQAVYVPADDYTDPAPATTFAHLDATTNLERSLTQQGIYPAVDPLASTSSALDPQIVGQEHYDVATEVQHVLQRYRELQDIISILGMDELSDEEKTIVNRARRIQFFLSQSFSVAEQFTGLPGKYVSVTDTVKGFKDILDGKYDDIPEDAFRNCGPIEDVIANAKRLQGNSTADTSDEKQSAAN 481
>gi|78356032|ref|YP_387481.1| F0F1 ATP synthase subunit beta [Desulfovibrio desulfuricans subsp. desulfuricans str. G20] >gi|118573527|sp|Q313W0|ATPB_DESDG ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|78218437|gb|ABB37786.1| ATP synthase F1, beta subunit [Desulfovibrio desulfuricans G20] (470 aa)
Score = 1536, Expect = 3.2e-168, Identities = 295/459 (64%), Positives = 363/459 (79%)
  Q:   297 SDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK---KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHKNY 755
           S+ G I Q+ G VVDV+FA   +PNI + L +K PNN    +L+ EVA   GD+V R I+M +TEGL RG+EV +T NPIM PVGSA LGR+ NVVG P+D     +  +  PIH+  P F+EQ+T  E+ ETGIKV+DLL+P+ KGGK+GLFGGAGVGKTV++ E+I+NIA  HGG+S+FAGVGERTREGNDLYHEM D GV+ + ALV+GQMNEPPGAR RVALTAL  AE+FR+   QDVLLF+DNIFRF+QAGSEVSALLGR+PSAVGYQPTL  ++G LQERITST  GSITSVQAVYVPADDLTDPAP+TTF+HLD   VL R+IA LGIYPA++PL+S+SR+LDP++VG EHY VAR VQ +LQK+++LQDIIAILG+DELS+EDK TV+RAR+I+ FLSQPF VAE F+   G YV  ++TI  F  I+ G+ D + E  F  VGGI+   + Y
  S:     2 SNIGKITQVIGAVVDVEFADGNLPNILNALVIKNPNNADCPELICEVAQHLGDNVVRTIAMDATEGLVRGMEVTDTGNPIMVPVGSASLGRIMNVVGRPVDEMGDIDAAKSLPIHRPAPEFNEQNTNVELLETGIKVVDLLIPFPKGGKMGLFGGAGVGKTVILMEMINNIAKQHGGISVFAGVGERTREGNDLYHEMKDAGVLEKAALVYGQMNEPPGARARVALTALACAEYFRDEENQDVLLFVDNIFRFTQAGSEVSALLGRMPSAVGYQPTLGTDLGGLQERITSTTKGSITSVQAVYVPADDLTDPAPATTFSHLDGTLVLSRQIAELGIYPAVDPLDSTSRILDPNVVGAEHYSVAREVQMVLQKYKDLQDIIAILGMDELSDEDKQTVARARRIQRFLSQPFHVAEVFTGTPGVYVKLEETIKAFRGILNGEYDHLAENDFYMVGGIEMAVERY 463
>gi|189426219|ref|YP_001953396.1| ATP synthase F1, beta subunit [Geobacter lovleyi SZ] >gi|189422478|gb|ACD96876.1| ATP synthase F1, beta subunit [Geobacter lovleyi SZ] (471 aa)
Score = 1535, Expect = 3.3e-168, Identities = 302/456 (66%), Positives = 365/456 (80%)
  Q:   295 LKSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLP----NNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNK-PMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           +  + G I Q+ G V+DV+F   ++P I   L V  P        LVLEVA   G++  R I+M ST+GL RG  VI+T   I APVG   LGR+ NV+GEP+D   P+  + EY  IH++ P+F++QSTK E F TGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG S+FAGVGERTREGNDL+ EM + GV+++ ALV+GQMNEPPGAR RVALTAL++AE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGRIPSAVGYQPTLA EMG+LQERITSTK GSITSVQA+YVPADDLTDPAP+T FAHLDA TVL R+IA LGIYPA++PL+S+SR+LDP ++G EHY VARSVQ +LQK+++LQDIIAILG+DELSEEDKL V+RARKI+ FLSQPF VAE F+   GKYV  +DTI GF EI+ GK D++PEQ F  VG I++
  S:     1 MSQNIGKISQVIGAVIDVEFEPGKLPEIYHALRVTNPAIDDRENNLVLEVAQHLGENSVRTIAMDSTDGLKRGQAVIDTGKQICAPVGRKTLGRIMNVIGEPVDEMGPIGNEKEYG-IHREAPAFEDQSTKVEAFTTGIKVVDLLAPYARGGKIGLFGGAGVGKTVLIMELINNIAKQHGGYSVFAGVGERTREGNDLWMEMKESGVLDKAALVYGQMNEPPGARARVALTALSVAEYFRDEENQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGELQERITSTKKGSITSVQAIYVPADDLTDPAPATAFAHLDATTVLSRQIAELGIYPAVDPLDSTSRILDPQVIGEEHYAVARSVQYVLQKYKDLQDIIAILGMDELSEEDKLVVARARKIQRFLSQPFHVAEAFTGSPGKYVELKDTIKGFQEIVAGKHDNLPEQAFYMVGSIEE 460
>gi|126728278|ref|ZP_01744094.1| F0F1 ATP synthase subunit beta [Sagittula stellata E-37] >gi|126711243|gb|EBA10293.1| F0F1 ATP synthase subunit beta [Sagittula stellata E-37] (474 aa)
Score = 1535, Expect = 3.4e-168, Identities = 299/457 (65%), Positives = 365/457 (79%)
  Q:   295 LKSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVI-------NQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           + + KG + Q+ G VVDV+F  + +P I + L   + N  KLVLEVA   G++  R I+M +TEGL RG EV++T  PI  PVG+A LGR+ NV+GEP+D K   E  EY PIH   P+F +Q+T+ E+  TGIKVIDLL PY KGGKIGLFGGAGVGKTVL+QELI+NIA  H GLS+FAGVGERTREGNDLYHEMI+ GV+       ++ ALV+GQMNEPPGAR R+ALT LTMAE FR+    DVL F+DNIFRF+QAGSE+SALLGRIPSAVGYQPTLA +MG +QERITSTK+GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL+R I+ LGIYPA++PL+S+SR++DP ++G EHY+VAR VQ ILQ+++ LQDIIAILG+DELSEEDKLTV+RARKI+ FLSQPF VA+ F+   G  V  +DTIS F  ++ G+ D +PE  F  VGGIDDV
  S:     1 MANAKGKVTQVIGAVVDVQF-DDHLPEILNAL-TTINNGNKLVLEVAQHLGENTVRTIAMDATEGLVRGQEVVDTDGPISVPVGTATLGRIMNVIGEPVDEKGPVEADEYRPIHAPAPNFADQATEAEVLVTGIKVIDLLAPYAKGGKIGLFGGAGVGKTVLIQELINNIAKVHSGLSVFAGVGERTREGNDLYHEMIESGVLTPDNLTDSKIALVYGQMNEPPGARARIALTGLTMAEQFRDATGTDVLFFVDNIFRFTQAGSEMSALLGRIPSAVGYQPTLATDMGAMQERITSTKNGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLNRAISELGIYPAVDPLDSTSRLMDPQVIGEEHYQVARDVQGILQRYKSLQDIIAILGMDELSEEDKLTVARARKIQRFLSQPFDVAKVFTGSDGVQVPLEDTISSFKAVVAGEYDHLPEAAFYMVGGIDDV 462
>gi|171110|gb|AAA34444.1| F1-ATPase beta-subunit precursor (511 aa)
Score = 1535, Expect = 3.5e-168, Identities = 301/452 (66%), Positives = 358/452 (79%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNK-PMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVIN-----QTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           G +  + G +VDV F ++++P I + LE+K P  K LVLEVA   G++  R I+M  TEGL RG +V++T  PI  PVG   LGR+ NV+GEPID + P+  K+   PIH  PPSF EQST  EI ETGIKV+DLL PY +GGKIGLFGGAGVGKTV +QELI+NIA  HGG S+FAGVGERTREGNDLY EM + GVIN     + ALVFGQMNEPPGAR RVALT LT+AE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGRIPSAVGYQPTLA +MG LQERIT+TK GS+TSVQAVYVPADDLTDP+PST+FAHLDA +VL R I+ LGIYPA++PL+S SR+LD ++VG EHY VA  VQ  LQ ++ LQDIIAILG+DELSE+DKLTV RARKI+ FLSQPF VAE F+   GK V  +DT++ F  ++EGK D+IPE  F  VGGI+DV
  S:    44 GKVTAVIGAIVDVHFEQSELPAILNALEIKTPQGK-LVLEVAQHLGENTVRTIAMDGTEGLVRGEKVLDTGGPISVPVGRETLGRIINVIGEPIDERGPIKSKLR-KPIHADPPSFAEQSTSAEILETGIKVVDLLAPYARGGKIGLFGGAGVGKTVFIQELINNIAKAHGGFSVFAGVGERTREGNDLYREMKETGVINLEGESKVALVFGQMNEPPGARARVALTGLTIAEYFRDEEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGLLQERITTTKKGSVTSVQAVYVPADDLTDPSPSTSFAHLDASSVLSRGISELGIYPAVDPLDSKSRLLDAAVVGQEHYDVASKVQETLQTYKSLQDIIAILGMDELSEQDKLTVERARKIQRFLSQPFAVAEVFTGIPGKLVRLKDTVASFKAVLEGKYDNIPEHAFYMVGGIEDV 499
>gi|156530195|gb|ABU75194.1| AtpB [Simaba guianensis] (498 aa)
Score = 1535, Expect = 3.6e-168, Identities = 304/456 (66%), Positives = 361/456 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           K + G I QI GPV+DV F   +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIHK  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+SIF GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+V
  S:    17 KKNLGHIAQIIGPVLDVAFPPGKMPNIYNALVVKGRDTVGQPINMTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHKPAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSIFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGFPGKYVGLAETIRGFKLILSGELDGLPEQAFYLVGNIDEV 483
>gi|156530187|gb|ABU75190.1| AtpB [Simaba guianensis] >gi|156530199|gb|ABU75196.1| AtpB [Simaba orinocensis] >gi|156530201|gb|ABU75197.1| AtpB [Simaba orinocensis] (496 aa)
Score = 1535, Expect = 3.8e-168, Identities = 304/456 (66%), Positives = 361/456 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           K + G I QI GPV+DV F   +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIHK  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+SIF GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+V
  S:    15 KKNLGHIAQIIGPVLDVAFLPGKMPNIYNALVVKGRDTVGQPINMTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHKPAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSIFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGFPGKYVGLAETIRGFKLILSGELDGLPEQAFYLVGNIDEV 481
>gi|78189967|ref|YP_380305.1| F0F1 ATP synthase subunit beta [Chlorobium chlorochromatii CaD3] >gi|118573520|sp|Q3AP13|ATPB_CHLCH ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|78172166|gb|ABB29262.1| ATP synthase F1, beta subunit [Chlorobium chlorochromatii CaD3] (462 aa)
Score = 1535, Expect = 3.8e-168, Identities = 297/452 (65%), Positives = 364/452 (80%)
  Q:   299 KGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNK-PMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           +G I QI GPVVDV F   ++P+I D L VK  +  KLVLE     G++  R ++M ST+GL RG+ V+NT   I  PVG+ VLGRM NVVG+PID + P+  K  YS IH+  P F++ STK E+FETGIKVIDLL PY +GGK GLFGGAGVGKTVL+ ELI+NIA    G S+FAGVGERTREGNDL+HEM++ GVI++TALVFGQMNEPPGAR RVALT L++AE+FR+   +DVLLF+DNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMGQLQ+RI STK GS+TSVQA+YVPADDLTDPAP+T F HLDA TVL R IA LGIYPA++PL+S+SR+LDP++VG +HY  A++V+ +LQ++++LQDIIAILG+DELS+EDKL VSRARK++ FLSQPFFVAE F+  +GKYV  +DTI GF EII GK D +PE  F  VG I++
  S:     3 EGKISQIIGPVVDVDFPEGRLPSILDALTVKREDGSKLVLETQQHLGEERVRTVAMESTDGLVRGMGVVNTGAAIQVPVGAEVLGRMLNVVGDPIDGRGPVNSKKTYS-IHRSAPKFEDISTKAEMFETGIKVIDLLEPYSRGGKTGLFGGAGVGKTVLIMELINNIAKQQSGFSVFAGVGERTREGNDLWHEMMESGVIDKTALVFGQMNEPPGARQRVALTGLSIAEYFRDEENRDVLLFVDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQDRIVSTKKGSVTSVQAIYVPADDLTDPAPATAFTHLDATTVLSRSIAELGIYPAVDPLDSTSRILDPNVVGDDHYNTAQAVKQLLQRYKDLQDIIAILGMDELSDEDKLVVSRARKVQRFLSQPFFVAEAFTGLAGKYVKLEDTIKGFKEIIAGKHDKLPENAFYLVGTIEE 454
>gi|85858477|ref|YP_460679.1| F0F1 ATP synthase subunit beta [Syntrophus aciditrophicus SB] >gi|118573766|sp|Q2LR05|ATPB_SYNAS ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|85721568|gb|ABC76511.1| ATP synthase beta chain [Syntrophus aciditrophicus SB] (469 aa)
Score = 1535, Expect = 3.8e-168, Identities = 290/451 (64%), Positives = 355/451 (78%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVKLP----NNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           G I Q+ GPV+DV F   Q+P I + + +  P        L++EVA   GD+  RCI+M  T+GL RG+   +T  PI  PVG   LGR+ NVVG+P+D     E     PIH++ PSF EQ T   + ETG+KVIDLLVP+ +GGK+GLFGGAG GKTV++ E+IHNIA  HGG+S+FAGVGERTREGNDLY EM++ GVI Q AL++GQM EPPGAR RV+LTAL  AE+FR+   QDVLLF+DNIFRF+QAGSEVSALLGR+PSAVGYQPTLA ++G+LQERITST  GSIT+VQ VYVPADDLTDPAP+TTFAHLD   VL R IA LGIYPA++PL+S+SR+LDP ++G EHYKVAR+VQ  LQK+++LQDIIAILG+DELSEEDKLTV+RARKI+ FLSQPFFVA +F+   GK+VS  DT+ GF EI+EGK DD+PEQ F  VGGI++
  S:     4 GRIVQVIGPVIDVVFEEGQLPAILNAITITNPVINDEEDNLIVEVAQHLGDNNVRCIAMDVTDGLVRGMPAKDTGAPITVPVGKECLGRILNVVGKPVDGLGPIEAKNTMPIHREAPSFLEQDTSVHVLETGVKVIDLLVPFPRGGKMGLFGGAGCGKTVVMMEMIHNIAMHHGGISVFAGVGERTREGNDLYREMLESGVIKQAALIYGQMTEPPGARARVSLTALAAAEYFRDVEGQDVLLFVDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATDLGELQERITSTDKGSITAVQCVYVPADDLTDPAPATTFAHLDGTVVLSRPIAELGIYPAVDPLDSTSRILDPIVLGEEHYKVARAVQVTLQKYKDLQDIIAILGMDELSEEDKLTVNRARKIQRFLSQPFFVAAQFTGVDGKFVSVPDTVRGFKEILEGKYDDLPEQAFYMVGGIEE 458
>gi|19745847|ref|NP_606983.1| F0F1 ATP synthase subunit beta [Streptococcus pyogenes MGAS8232] >gi|50913944|ref|YP_059916.1| F0F1 ATP synthase subunit beta [Streptococcus pyogenes MGAS10394] >gi|94990145|ref|YP_598245.1| F0F1 ATP synthase subunit beta [Streptococcus pyogenes MGAS10270] >gi|94994061|ref|YP_602159.1| F0F1 ATP synthase subunit beta [Streptococcus pyogenes MGAS10750] >gi|81822768|sp|Q5XCY0|ATPB_STRP6 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|81847967|sp|Q8P1K5|ATPB_STRP8 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|118573763|sp|Q1JHN5|ATPB_STRPD ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|118573764|sp|Q1J7F9|ATPB_STRPF ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|19747995|gb|AAL97482.1| putative proton-translocating ATPase, beta subunit [Streptococcus pyogenes MGAS8232] >gi|50903018|gb|AAT86733.1| ATP synthase beta chain [Streptococcus pyogenes MGAS10394] >gi|94543653|gb|ABF33701.1| ATP synthase beta chain [Streptococcus pyogenes MGAS10270] >gi|94547569|gb|ABF37615.1| ATP synthase beta chain [Streptococcus pyogenes MGAS10750] (468 aa)
Score = 1535, Expect = 4.2e-168, Identities = 307/454 (67%), Positives = 364/454 (80%)
  Q:   300 GIIYQIFGPVVDVKFAR-NQMPNINDCLEVKLPNNKK--LVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPID-NKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHK 753
           G I Q+ GPVVDV FA  +++P IN+ L V   ++KK  +VLEVAL  GD + R I+M ST+GL RGLEV++T   I  PVG   LGR+FNV+GE ID  +P  E V+  PIHKK PSFDE ST +EI ETGIKVIDLL PY+KGGK+GLFGGAGVGKTVL+QELIHNIA  HGG+S+F GVGERTREGNDLY EM + GVI +TA+VFGQMNEPPGARMRVALT LT+AE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMGQLQERITST+ GS+TS+QA+YVPADD TDPAP+T FAHLD+ T L+RK+  +GIYPA++PL SSSR L P IVG EHY VA  VQ +LQ++ ELQDIIAILG+DELS+E+K  V RAR+I+ FLSQ F VAE+F+   G YV   +T+ GF EI+EGK D +PE  F  VG I+DV K
  S:     4 GKIAQVVGPVVDVMFASGDKLPEINNALIVYKDSDKKQKIVLEVALELGDGMVRTIAMESTDGLTRGLEVLDTGRAISVPVGKETLGRVFNVLGETIDLEEPFAEDVDRQPIHKKAPSFDELSTSSEILETGIKVIDLLAPYLKGGKVGLFGGAGVGKTVLIQELIHNIAQEHGGISVFTGVGERTREGNDLYWEMKESGVIEKTAMVFGQMNEPPGARMRVALTGLTIAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTQKGSVTSIQAIYVPADDYTDPAPATAFAHLDSTTNLERKLTQMGIYPAVDPLASSSRALSPEIVGEEHYAVATEVQRVLQRYRELQDIIAILGMDELSDEEKTLVGRARRIQFFLSQNFNVAEQFTGLPGSYVPVAETVRGFKEILEGKYDHLPEDAFRSVGPIEDVIK 461
>gi|156530193|gb|ABU75193.1| AtpB [Simaba guianensis] (495 aa)
Score = 1534, Expect = 4.3e-168, Identities = 304/456 (66%), Positives = 361/456 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           K + G I QI GPV+DV F   +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIHK  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+SIF GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+V
  S:    14 KKNLGHIAQIIGPVLDVAFLPGKMPNIYNALVVKGRDTVGQPINMTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHKPAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSIFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGFPGKYVGLAETIRGFKLILSGELDGLPEQAFYLVGNIDEV 480
>gi|1168575|sp|P43451|ATPB_ENTHR ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|153573|gb|AAA26859.1| H+ ATPase (468 aa)
Score = 1534, Expect = 4.4e-168, Identities = 310/452 (68%), Positives = 366/452 (80%)
  Q:   300 GIIYQIFGPVVDVKFARNQ-MPNINDCLEVKLPNNKK--LVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPID-NKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           G I Q+ GPVVDV+F+ +Q +P+IN+ L V   + KK  +VLE AL  GD V R I+M ST+GL RG+EVI+T   I  PVG   LGR+FNV+G+ ID     PE  E S IHKK PSFDE ST TEI ETGIKVIDLL PY+KGGK+GLFGGAGVGKTVL+QELIHNIA  HGG+S+F GVGERTREGNDLY+EM D GVI +TA+VFGQMNEPPGARMRVALT LT+AE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMGQLQERITSTK GSITS+QA+YVPADD TDPAP+T FAHLDA T L+RK+   GIYPA++PL SSS  L P IVG EHYKVA  VQ +LQ++ ELQDIIAILG+DELS+++K+ VSRAR+++ FLSQ F VAE+F+   G YV  ++T+ GF EI+EGK DD+PE+ F  VG I+DV
  S:     4 GKIVQVIGPVVDVEFSLDQSLPDINNALVVYKNDEKKSKVVLETALELGDGVIRTIAMESTDGLQRGMEVIDTGKAISVPVGKDTLGRVFNVLGDTIDLGSSFPEDAERSEIHKKAPSFDELSTSTEILETGIKVIDLLAPYLKGGKVGLFGGAGVGKTVLIQELIHNIAQEHGGISVFTGVGERTREGNDLYYEMKDSGVIEKTAMVFGQMNEPPGARMRVALTGLTIAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGSITSIQAIYVPADDYTDPAPATAFAHLDATTNLERKLTEQGIYPAVDPLASSSSALAPEIVGEEHYKVATEVQHVLQRYRELQDIIAILGMDELSDQEKVLVSRARRVQFFLSQNFNVAEQFTGLPGSYVPVEETVKGFREILEGKYDDLPEEAFRSVGRIEDV 459
>gi|156530127|gb|ABU75160.1| AtpB [Eurycoma apiculata] (498 aa)
Score = 1534, Expect = 4.5e-168, Identities = 304/456 (66%), Positives = 360/456 (78%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           K + G I QI GPV+DV F   +MPNI + L VK    +     +  EV  L G+   R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIHK  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+SIF GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+V
  S:    17 KKNLGHIAQIIGPVLDVVFLPGKMPNIYNALVVKGRDTVGQPINMTCEVQQLLGNSRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTSSPIHKPAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSIFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFKLILSGELDGLPEQAFYLVGNIDEV 483
>gi|157827763|ref|YP_001496827.1| F0F1 ATP synthase subunit beta [Rickettsia bellii OSU 85-389] >gi|166201730|sp|A8GY40|ATPB_RICB8 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|157803067|gb|ABV79790.1| F0F1 ATP synthase subunit beta [Rickettsia bellii OSU 85-389] (473 aa)
Score = 1534, Expect = 4.6e-168, Identities = 308/456 (67%), Positives = 365/456 (80%)
  Q:   295 LKSDKGIIYQIFGPVVDVKFA-RNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVIN-------QTALVFGQMNEPPGARMRVALTALTMAEHFRENNK-QDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           +K + G I QI   VVDVKF  + ++P I + LE    + +++VLE+A   GDD  RCI+M STEGL RG+EV++T +PI  PVG   LGR+ NVVGEPID K   +    S I+K  PSF +QST   I  TGIKV+DLL PY KGGKIGLFGGAGVGKTVL+ ELI+N+A  HGG ++FAGVGERTREGNDLYHEMID GVIN       + ALV+GQMNEPPGAR RVALT LT+AE FR+ N+ QDVL F+DNIFRF+QAGSEVSALLGRIPSAVGYQPTLA +MG+LQERITSTK GSITSVQA+YVPADDLTDPAP+T+FAHLDA  VL R+IA LGIYPA++PL+S+S++LDP IVG EHY VAR VQ ILQ ++ LQDIIAILG+DELSEEDKLTVSRARKI+ FLSQPF VAE F+   GK+V+  DTI+GF  + EGK DD+PE  F  VG I++
  S:     1 MKKNIGKITQIISAVVDVKFTNKGKLPQILNALEC-YNDKQRIVLEIAQHIGDDTVRCIAMNSTEGLVRGMEVVDTGSPISIPVGIETLGRIMNVVGEPIDGKGKIKGSSISSIYKSAPSFTQQSTDRNILVTGIKVVDLLAPYTKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYTVFAGVGERTREGNDLYHEMIDSGVINLEEPEKSKVALVYGQMNEPPGARARVALTGLTVAESFRDMNEGQDVLFFVDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGELQERITSTKHGSITSVQAIYVPADDLTDPAPATSFAHLDATIVLSRQIAELGIYPAVDPLDSTSQVLDPMIVGEEHYNVARKVQQILQTYKSLQDIIAILGMDELSEEDKLTVSRARKIQRFLSQPFHVAEVFTGAEGKFVNLADTIAGFKGLTEGKYDDLPEAAFYMVGTIEE 464
>gi|167628982|ref|YP_001679481.1| F0F1 ATP synthase subunit beta [Heliobacterium modesticaldum Ice1] >gi|167591722|gb|ABZ83470.1| ATP synthase f1, beta subunit [Heliobacterium modesticaldum Ice1] (471 aa)
Score = 1534, Expect = 4.8e-168, Identities = 289/451 (64%), Positives = 361/451 (80%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKK--------LVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           G + Q+ GPVVD++F   Q+P I + ++++  + +         + LE A   G++  RC++M ST+GL RG++ ++T  PI  PVG+ +LGRMFNV+G+PID        E  PIH+K P+F+     TE+ ETGIKVIDLL PY KGGK+GLFGGAGVGKTVL+QELI+NIA  + G S+FAGVGERTREGNDLY+E  + G++   A+VFGQMNEPPGARMRVAL+ L MAE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTL+ EMGQLQERITSTK+GSITSVQA+YVPADDLTDPAP+T FAHLDA TVL R IA LGIYPA++PL+S+SR+LDP +VG EHY VAR VQ ILQ+++ELQDIIAILG+DELSE+DK+ V+RARKI+ FLSQPF VAE F+   GK+V  +++I GF EI+EGK DD+PE  F  VG I++
  S:     4 GKVIQVIGPVVDIQFPPGQLPEIYNAIKIRSADQENYQGSFEIDITLEAAQHLGNNAVRCVAMSSTDGLMRGMKALDTGAPISVPVGAEILGRMFNVLGDPIDEAGQVAAKEVWPIHRKAPTFENLEPSTEVLETGIKVIDLLAPYAKGGKVGLFGGAGVGKTVLIQELINNIAMEYSGYSVFAGVGERTREGNDLYNEFKESGILKNVAMVFGQMNEPPGARMRVALSGLVMAEYFRDVQNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLSTEMGQLQERITSTKNGSITSVQAIYVPADDLTDPAPATAFAHLDATTVLSRAIAELGIYPAVDPLDSTSRILDPHVVGDEHYSVARGVQKILQRYKELQDIIAILGMDELSEDDKIVVARARKIQRFLSQPFHVAEAFTGTPGKFVPLKESIRGFKEILEGKHDDLPESAFYMVGTIEE 462
>gi|118917348|dbj|BAF40460.1| ATP synthase beta subunit [Pycnocoma cornuta] (489 aa)
Score = 1534, Expect = 4.9e-168, Identities = 301/455 (66%), Positives = 360/455 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K + G I QI GPV+DV F   +MPNI + L VK    +     +  EV  L G++  R I+M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+D+    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:     9 KKNLGRIAQIIGPVLDVAFPPGKMPNIYNALVVKGRDTVGQEINVTCEVQQLLGNNRVRAIAMSATDGLMRGMEVIDTGTPLSVPVGGATLGRIFNVLGEPVDDLGPVDTRATSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGISVFGGVGERTREGNDLYMEMKESGVINEENIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPQIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFKLILSGELDSLPEQAFYLVGNIDE 474
>gi|156530151|gb|ABU75172.1| AtpB [Perriera madagascariensis] (498 aa)
Score = 1534, Expect = 5.2e-168, Identities = 303/456 (66%), Positives = 360/456 (78%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           K + G I QI GPV+DV F   +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIHK  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+SIF GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQP FVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+V
  S:    17 KKNLGHIAQIIGPVLDVAFPPGKMPNIYNALVVKGRDTVGQPINMTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHKPAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSIFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPLFVAEVFTGSPGKYVGLAETIRGFKLILSGELDGLPEQAFYLVGNIDEV 483
>gi|156846713|ref|XP_001646243.1| hypothetical protein Kpol_1013p57 [Vanderwaltozyma polyspora DSM 70294] >gi|156116917|gb|EDO18385.1| hypothetical protein Kpol_1013p57 [Vanderwaltozyma polyspora DSM 70294] (505 aa)
Score = 1534, Expect = 5.4e-168, Identities = 301/452 (66%), Positives = 357/452 (78%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNK-PMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVIN-----QTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           G +  + G +VDV+F +  +P I + LE++ PN K LVLEV+   G++  R I+M  TEGL RG  VI+T  PI  PVG   LGR+ NV+GEPID + P+  K+   PIH +PPSF EQST+ E+ ETGIKV+DLL PY +GGKIGLFGGAGVGKTV +QELI+NIA  HGG S+F GVGERTREGNDLY EM + GVIN     + ALVFGQMNEPPGAR RVALT LT+AE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGRIPSAVGYQPTLA +MG LQERIT+TK GS+TSVQAVYVPADDLTDPAP+TTFAHLDA TVL R I+ LGIYPA++PL+S SR+LD ++VG EHY VA  VQ  LQ ++ LQDIIAILG+DELSE+DK+TV RARKI+ FLSQPF VAE F+   GK V  +DTIS F  ++EGK D +PE  F  VGGI+DV
  S:    38 GKVRAVIGAIVDVQFEQENLPAILNALEIQTPNGK-LVLEVSQHLGENTVRTIAMDGTEGLVRGENVIDTGAPISVPVGRETLGRIINVIGEPIDERGPIKSKLR-KPIHAEPPSFVEQSTEAEVLETGIKVVDLLAPYARGGKIGLFGGAGVGKTVFIQELINNIAKAHGGFSVFTGVGERTREGNDLYREMRETGVINLEGDSKVALVFGQMNEPPGARARVALTGLTIAEYFRDEEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGLLQERITTTKKGSVTSVQAVYVPADDLTDPAPATTFAHLDATTVLSRGISELGIYPAVDPLDSKSRLLDAAVVGQEHYDVATRVQETLQAYKSLQDIIAILGMDELSEQDKITVERARKIQRFLSQPFAVAEVFTGIPGKLVRLKDTISSFKAVLEGKYDHLPENAFYMVGGIEDV 493
>gi|51891229|ref|YP_073920.1| F0F1 ATP synthase subunit beta [Symbiobacterium thermophilum IAM 14863] >gi|81826265|sp|Q67TB7|ATPB_SYMTH ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|51854918|dbj|BAD39076.1| ATP synthase beta subunit [Symbiobacterium thermophilum IAM 14863] (472 aa)
Score = 1534, Expect = 5.5e-168, Identities = 301/450 (66%), Positives = 356/450 (79%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK---KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNK-PMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGID 749
           G I  I G VVDV+F    +P +N  L ++    +    L LEVA   G++  RCI+M ST+GL RG  V +T+ PI  PVG  VLGR+FNV+GE ID K P+   V   PIH++PP        TE+  TGIKVIDLL PY +GGKIGLFGGAGVGKTV++QELIHNIA   GG SIFAGVGERTREGNDLYHEMI+ GVI++ A+VFGQMNEPPGARMRVALT LTMAE+FR+    DVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMG LQERITSTK GSITSVQA+YVPADDLTDPAP+TTFAHLDA TVL R +    I+PA++PL+S+SR+LDP+IVG EHY+VAR VQ +LQ+++ELQDIIAILG+DELS+EDKL V+RARKI  FLSQP FVAEKF++  G +V  +DT+ GF EI+EGK DD+PEQ F  VG I+
  S:     6 GKILAIMGAVVDVEFPDGHLPKLNHALVIRNGGERGDINLTLEVAQHLGNNQVRCIAMDSTDGLRRGETVYDTQAPITVPVGEPVLGRIFNVLGETIDGKGPVNSPVSL-PIHREPPGVANVDPATEMLPTGIKVIDLLCPYARGGKIGLFGGAGVGKTVMIQELIHNIAYKFGGYSIFAGVGERTREGNDLYHEMIEAGVIDKVAMVFGQMNEPPGARMRVALTGLTMAEYFRDEQGLDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGYLQERITSTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAVFEKAIFPAVDPLDSTSRILDPNIVGREHYEVARGVQKVLQRYKELQDIIAILGMDELSDEDKLIVARARKIERFLSQPMFVAEKFTNLPGVFVDPKDTVKGFKEILEGKHDDLPEQAFYMVGTIE 458
>gi|190358726|sp|A8F2U0|ATPB_RICM5 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) (473 aa)
Score = 1533, Expect = 5.6e-168, Identities = 309/451 (68%), Positives = 363/451 (80%)
  Q:   300 GIIYQIFGPVVDVKFARN-QMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVIN-------QTALVFGQMNEPPGARMRVALTALTMAEHFRENNK-QDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           G I QI   VVDVKF  N ++P I + LE    + +++VLEVA   GDD  RCI+M STEGL RG+EVI+T +PI  PVG+  LGR+ NVVGEPID K   +    S I+K  P F  QST+  I  TGIKVIDLL PY KGGKIGLFGGAGVGKTVL+ ELI+N+A  HGG ++FAGVGERTREGNDLYHEMID GVIN       + ALV+GQMNEPPGAR RVAL+ LT+AE FR+ N+ QDVL F+DNIFRF+QAGSEVSALLGRIPSAVGYQPTLA +MG+LQERITSTK GSITSVQA+YVPADDLTDPAP+T+FAHLDA TVL R+IA LGIYPA++PL+S+S++LDP IVG EHY VAR VQ +LQ ++ LQDIIAILG+DELSEEDKLTV RARKI+ FLSQPF VAE F+   GK+V+  DTI+GF  ++EGK DD+PE  F  VG ID+
  S:     6 GKITQIISAVVDVKFTNNGELPEILNALEC-YNDKQRIVLEVAQHIGDDTVRCIAMDSTEGLVRGVEVIDTGSPIRIPVGTETLGRIMNVVGEPIDGKGDIKSSNISSIYKPAPDFTNQSTERNILVTGIKVIDLLAPYTKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYTVFAGVGERTREGNDLYHEMIDSGVINLAEPEKSKVALVYGQMNEPPGARARVALSGLTIAESFRDMNEGQDVLFFVDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGELQERITSTKYGSITSVQAIYVPADDLTDPAPATSFAHLDATTVLSRQIAELGIYPAVDPLDSNSQVLDPMIVGEEHYSVARQVQQVLQTYKSLQDIIAILGMDELSEEDKLTVVRARKIQRFLSQPFHVAEVFTGAEGKFVNLADTIAGFKGLVEGKYDDLPEAAFYMVGTIDE 464
>gi|57240728|ref|ZP_00368676.1| ATP synthase F1, beta subunit [Campylobacter lari RM2100] >gi|57018347|gb|EAL55121.1| ATP synthase F1, beta subunit [Campylobacter lari RM2100] (484 aa)
Score = 1533, Expect = 5.8e-168, Identities = 303/452 (67%), Positives = 361/452 (79%)
  Q:   299 KGIIYQIFGPVVDVKFARNQMPNINDCLEVKLP---NNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           +G I Q+ GPVVDV+F ++ +P IN+ + V         KLVLEVA   GD+  R I+M  T+GL RGL  + T NPI  PVG  VLGR+FNV G+ ID        ++  IH+ PP F+EQSTK+EIFETGIKV+DLL PY KGGK+GLFGGAGVGKTV++ ELIHN+A  H G S+FAGVGERTREGNDLY+EM +  V+++ AL +GQMNEPPGAR R+ALT LTMAE+FR+    DVL+FIDNIFRFSQ+GSE+SALLGRIPSAVGYQPTLA EMG+ QERITSTK GSITSVQAVYVPADDLTDPAP+T FAHLDA TVL+R IA  GIYPA++PL+S+SRMLDP I+G EHYKVAR VQ++LQK+++LQDIIAILG+DELSEEDKL V RARKI  FLSQPFFVAE F+   GKY+S +DTI+GF  I+EGK DD+PE  F  VG ID+
  S:     2 QGFISQVLGPVVDVEF-KDYLPQINEAIVVNYELEGKECKLVLEVAAHLGDNKVRTIAMDMTDGLVRGLTAVATGNPISVPVGEKVLGRIFNVTGDLIDEGEEINFDKHWSIHRDPPPFEEQSTKSEIFETGIKVVDLLAPYAKGGKVGLFGGAGVGKTVIIMELIHNVAFKHSGYSVFAGVGERTREGNDLYNEMKESNVLDKVALCYGQMNEPPGARNRIALTGLTMAEYFRDEMGLDVLMFIDNIFRFSQSGSEMSALLGRIPSAVGYQPTLASEMGKFQERITSTKKGSITSVQAVYVPADDLTDPAPATVFAHLDATTVLNRSIAEKGIYPAVDPLDSTSRMLDPQIIGEEHYKVARGVQSVLQKYKDLQDIIAILGMDELSEEDKLIVERARKIEKFLSQPFFVAEVFTGSPGKYISLEDTIAGFKGILEGKYDDLPENAFYMVGNIDE 455
>gi|156598493|gb|ABU85505.1| ATP synthase CF1 beta subunit [Passiflora biflora] (498 aa)
Score = 1533, Expect = 6.3e-168, Identities = 302/455 (66%), Positives = 361/455 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K++ G I QI GPV+DV F   +MPNI + L +K    +     +  EV  L G++  R ++M +TEGL RG+EVI+T  P+  PVG A LGR+FNV+GEPID     +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+FAGVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ NKQDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK  SITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R++A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:    17 KTNLGHIAQIIGPVLDVAFPPGKMPNIYNALVIKGRDTIGQQSNVTCEVQQLLGNNRIRAVAMSATEGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPIDELGPVDTRTTSPIHRSAPTFIQLDTKFSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFAGVGERTREGNDLYVEMKESGVINEKNITESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEASITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRRLAAKGIYPAVDPLDSTSTMLQPQIVGNEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFQLILSGELDSLPEQAFYLVGNIDE 482
>gi|50288781|ref|XP_446820.1| unnamed protein product [Candida glabrata] >gi|49526129|emb|CAG59751.1| unnamed protein product [Candida glabrata] (507 aa)
Score = 1533, Expect = 6.7e-168, Identities = 302/452 (66%), Positives = 356/452 (78%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNK-PMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVIN-----QTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           G +  + G +VDV+F  + +P I + LE+K P  K LVLEVA   G++  R I+M  TEGL RG +V++T  PI  PVG   LGR+ NV+GEPID + P+  K+   PIH  PPSF EQST  E+ ETGIKV+DLL PY +GGKIGLFGGAGVGKTV +QELI+NIA  HGG S+F GVGERTREGNDLY EM + GVIN     + ALVFGQMNEPPGAR RVALT LT+AE+FR+   QDVLLF+DNIFRF+QAGSEVSALLGRIPSAVGYQPTLA +MG LQERIT+TK GS+TSVQAVYVPADDLTDPAP+TTFAHLDA TVL R I+ LGIYPA++PL+S SR+LD ++VG EHY VA  VQ  LQ ++ LQDIIAILG+DELSE+DKLTV RARKI+ FLSQPF VAE F+   GK V  +DTIS F  ++EGK DD+PE  F  VGGI+DV
  S:    40 GKVSAVIGAIVDVQFEESNLPAILNALEIKTPQGK-LVLEVAQHLGENTVRTIAMDGTEGLVRGEKVVDTGAPISVPVGRETLGRIINVIGEPIDERGPINSKLR-KPIHADPPSFAEQSTAAEVLETGIKVVDLLAPYARGGKIGLFGGAGVGKTVFIQELINNIAKAHGGFSVFTGVGERTREGNDLYREMKETGVINLEGDSKVALVFGQMNEPPGARARVALTGLTIAEYFRDEEGQDVLLFVDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGLLQERITTTKKGSVTSVQAVYVPADDLTDPAPATTFAHLDATTVLSRSISELGIYPAVDPLDSKSRLLDAAVVGEEHYNVATKVQETLQTYKSLQDIIAILGMDELSEQDKLTVERARKIQRFLSQPFAVAEVFTGIEGKLVRLKDTISSFKAVLEGKYDDLPENAFYMVGGIEDV 495
>gi|148988552|ref|ZP_01819985.1| F0F1 ATP synthase subunit beta [Streptococcus pneumoniae SP6-BS73] >gi|148992608|ref|ZP_01822276.1| F0F1 ATP synthase subunit beta [Streptococcus pneumoniae SP9-BS68] >gi|148997432|ref|ZP_01825037.1| F0F1 ATP synthase subunit beta [Streptococcus pneumoniae SP11-BS70] >gi|149011742|ref|ZP_01832938.1| F0F1 ATP synthase subunit beta [Streptococcus pneumoniae SP19-BS75] >gi|168483883|ref|ZP_02708835.1| ATP synthase F1, beta subunit [Streptococcus pneumoniae CDC1873-00] >gi|168489668|ref|ZP_02713867.1| ATP synthase F1, beta subunit [Streptococcus pneumoniae SP195] >gi|168492577|ref|ZP_02716720.1| ATP synthase F1, beta subunit [Streptococcus pneumoniae CDC0288-04] >gi|168493409|ref|ZP_02717552.1| ATP synthase F1, beta subunit [Streptococcus pneumoniae CDC3059-06] >gi|182684462|ref|YP_001836209.1| ATP synthase subunit B [Streptococcus pneumoniae CGSP14] >gi|147756487|gb|EDK63528.1| F0F1 ATP synthase subunit beta [Streptococcus pneumoniae SP11-BS70] >gi|147764173|gb|EDK71105.1| F0F1 ATP synthase subunit beta [Streptococcus pneumoniae SP19-BS75] >gi|147925753|gb|EDK76828.1| F0F1 ATP synthase subunit beta [Streptococcus pneumoniae SP6-BS73] >gi|147928625|gb|EDK79639.1| F0F1 ATP synthase subunit beta [Streptococcus pneumoniae SP9-BS68] >gi|172042786|gb|EDT50832.1| ATP synthase F1, beta subunit [Streptococcus pneumoniae CDC1873-00] >gi|182629796|gb|ACB90744.1| ATP synthase subunit B [Streptococcus pneumoniae CGSP14] >gi|183571943|gb|EDT92471.1| ATP synthase F1, beta subunit [Streptococcus pneumoniae SP195] >gi|183573274|gb|EDT93802.1| ATP synthase F1, beta subunit [Streptococcus pneumoniae CDC0288-04] >gi|183576634|gb|EDT97162.1| ATP synthase F1, beta subunit [Streptococcus pneumoniae CDC3059-06] (468 aa)
Score = 1532, Expect = 7.7e-168, Identities = 303/452 (67%), Positives = 362/452 (80%)
  Q:   300 GIIYQIFGPVVDVKFARNQ-MPNINDCLEVKLPNNKK--LVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPID-NKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           G I Q+ GPVVDV FA  + +P IN+ L V   + +K  +VLEVAL  GD + R I+M ST+GL RG+EV++T  PI  PVG   LGR+FNV+G+ ID   P  E  E  PIHKK P+FDE ST +EI ETGIKVIDLL PY+KGGK+GLFGGAGVGKTVL+QELIHNIA  HGG+S+F GVGERTREGNDLY EM + GVI +TA+VFGQMNEPPGARMRVALT LT+AE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMGQLQERITSTK GS+TS+QA+YVPADD TDPAP+T FAHLD+ T L+RK+  LGIYPA++PL SSSR L P IVG EHY VA  V+ +LQ++ ELQDIIAILG+DELS+E+K  V+RAR+I+ FLSQ F VAE+F+ + G YV   +T+ GF EI++GK D +PE  F  VG I+DV
  S:     4 GKIAQVIGPVVDVLFAAGEKLPEINNALVVYKNDERKTKIVLEVALELGDGMVRTIAMESTDGLTRGMEVLDTGRPISVPVGKETLGRVFNVLGDTIDLEAPFTEDAERQPIHKKAPTFDELSTSSEILETGIKVIDLLAPYLKGGKVGLFGGAGVGKTVLIQELIHNIAQEHGGISVFTGVGERTREGNDLYWEMKESGVIEKTAMVFGQMNEPPGARMRVALTGLTIAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGSVTSIQAIYVPADDYTDPAPATAFAHLDSTTNLERKLVQLGIYPAVDPLASSSRALAPEIVGEEHYAVAAEVKRVLQRYHELQDIIAILGMDELSDEEKTLVARARRIQFFLSQNFNVAEQFTGQPGSYVPVAETVRGFKEILDGKYDHLPEDAFRGVGSIEDV 459
>gi|67459658|ref|YP_247282.1| F0F1 ATP synthase subunit beta [Rickettsia felis URRWXCal2] >gi|67005191|gb|AAY62117.1| ATP synthase beta chain [Rickettsia felis URRWXCal2] (508 aa)
Score = 1532, Expect = 7.9e-168, Identities = 309/462 (66%), Positives = 370/462 (80%)
  Q:   289 LMKLNTLKSDKGIIYQIFGPVVDVKFARN-QMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVIN-------QTALVFGQMNEPPGARMRVALTALTMAEHFRENNK-QDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           ++K   +  + G I QI   VVDVKF  N ++P I + LE    + +++VLEVA   GDD  RCI+M STEGL RG+EVI+T +PI  PVG+  LGR+ NVVGEPID K   +    S I+K  P F  QST+  I  TGIKV+DLL PY KGGKIGLFGGAGVGKTVL+ ELI+N+A  HGG ++FAGVGERTREGNDLYHEMID GVI+       + ALV+GQMNEPPGAR RVAL+ LT+AE FR+ N+ QDVL F+DNIFRF+QAGSEVSALLGRIPSAVGYQPTLA +MG+LQERITSTK+GSITSVQA+YVPADDLTDPAP+T+FAHLDA TVL R+IA LGIYPA++PL+S+S++LDP IVG EHY VAR VQ ILQ ++ LQDIIAILG+DELSEEDKLTVSRARKI+ FLSQPF VAE F+   GK+V+  DTI+GF  ++EGK DD+PE  F  VG +D+
  S:    29 ILKEKIMTKNIGKITQIISAVVDVKFTNNGELPEILNALEC-YNDKQRIVLEVAQHIGDDTVRCIAMDSTEGLVRGVEVIDTGSPIRIPVGTETLGRIMNVVGEPIDGKGDIKSSNISSIYKSAPDFTNQSTERNILVTGIKVVDLLAPYTKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYTVFAGVGERTREGNDLYHEMIDSGVIDLEKPENSKVALVYGQMNEPPGARARVALSGLTIAESFRDMNEGQDVLFFVDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGELQERITSTKNGSITSVQAIYVPADDLTDPAPATSFAHLDATTVLSRQIAELGIYPAVDPLDSNSQVLDPMIVGEEHYSVARQVQQILQTYKSLQDIIAILGMDELSEEDKLTVSRARKIQRFLSQPFHVAEVFTGAEGKFVNLADTIAGFKGLVEGKYDDLPEAAFYMVGTMDE 498
>gi|18253303|gb|AAL66415.1|AF368465_5 proton-translocating ATPase beta subunit [Streptococcus pneumoniae] (468 aa)
Score = 1532, Expect = 9.0e-168, Identities = 303/452 (67%), Positives = 363/452 (80%)
  Q:   300 GIIYQIFGPVVDVKFARNQ-MPNINDCLEVKLPNNKK--LVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPID-NKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           G I Q+ GPVVDV FA  + +P IN+ L V   + +K  +VLEVAL  GD + R I+M ST+GL RG+EV++T  PI  PVG   LGR+FNV+G+ ID   P  E  E  PIHKK P+FDE ST +EI ETGIKVIDLL PY+KGGK+GLFGGAGVGKTVL+QELIHNIA  HGG+S+FAGVGERTREGNDLY EM + GVI +TA+VFGQMNEPPGARMRVALT LT+AE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMGQLQERITSTK GS+TS+QA+YVPADD TDPAP+T FAHL++ T L+RK+  LGIYPA++PL SSSR L P IVG EHY VA  V+ +LQ++ ELQDIIAILG+DELS+E+K  V+RAR+I+ FLSQ F VAE+F+ + G YV   +T+ GF EI++GK D +PE  F  VG I+DV
  S:     4 GKIAQVIGPVVDVLFAAGEKLPEINNALVVYKNDERKTKIVLEVALELGDGMVRTIAMESTDGLTRGMEVLDTGRPISVPVGKETLGRVFNVLGDTIDLEAPFTEDAERQPIHKKAPTFDELSTSSEILETGIKVIDLLAPYLKGGKVGLFGGAGVGKTVLIQELIHNIAQEHGGISVFAGVGERTREGNDLYWEMKESGVIEKTAMVFGQMNEPPGARMRVALTGLTIAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGSVTSIQAIYVPADDYTDPAPATAFAHLNSTTNLERKLVQLGIYPAVDPLASSSRALAPEIVGEEHYAVAAEVKRVLQRYHELQDIIAILGMDELSDEEKTLVARARRIQFFLSQNFNVAEQFTGQPGSYVPVAETVRGFKEILDGKYDHLPEDAFRGVGSIEDV 459
>gi|20137394|sp|Q92G88|ATPB_RICCN ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) (473 aa)
Score = 1531, Expect = 9.8e-168, Identities = 306/451 (67%), Positives = 362/451 (80%)
  Q:   300 GIIYQIFGPVVDVKFARN-QMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVIN-------QTALVFGQMNEPPGARMRVALTALTMAEHFRENNK-QDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           G I QI   VVDVKF  N ++P I + LE    + +++VLEVA   GDD  RCI+M S EGL RG+EVI+T +PI  PVG+  LGR+ NVVGEPID K   +    S I+K  P F  QST+  I  TGIKVIDLL PY KGGKIGLFGGAGVGKTVL+ ELI+N+A  HGG ++FAGVGERTREGNDLYHEMID GVIN       + ALV+GQMNEPPGAR RVAL+ LT+AE FR+ N+ QDVL F+DNIFRF+QAGSEVSALLGRIPSAVGYQPTLA +MG+LQERITSTK GSITSVQA+YVPADDLTDPAP+T+FAHLDA TVL R+IA  GIYPA++PL+S+S++LDP IVG EHY VAR VQ +LQ ++ LQDII ILG+DELSEEDKLTV+RARKI+ FLSQPF VAE F+  +GK+V+  DTI+GF  ++EGK DD+PE  F  VG ID+
  S:     6 GKITQIISAVVDVKFTNNGELPKILNALEC-YNDKQRIVLEVAQHIGDDTVRCIAMDSMEGLVRGVEVIDTGSPIRIPVGTETLGRIMNVVGEPIDGKGDIKSSNISSIYKPAPDFTHQSTECNILVTGIKVIDLLAPYTKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYTVFAGVGERTREGNDLYHEMIDSGVINLAEPEKSKVALVYGQMNEPPGARARVALSGLTIAESFRDMNEGQDVLFFVDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGELQERITSTKYGSITSVQAIYVPADDLTDPAPATSFAHLDATTVLSRQIAEFGIYPAVDPLDSNSQVLDPMIVGEEHYSVARQVQQVLQTYKSLQDIITILGMDELSEEDKLTVARARKIQRFLSQPFHVAEVFTGAAGKFVNLADTIAGFKGLVEGKYDDLPEAAFYMVGTIDE 464
>gi|89210203|ref|ZP_01188595.1| ATP synthase F1, beta subunit [Halothermothrix orenii H 168] >gi|89160276|gb|EAR79932.1| ATP synthase F1, beta subunit [Halothermothrix orenii H 168] (487 aa)
Score = 1531, Expect = 1.1e-167, Identities = 298/451 (66%), Positives = 366/451 (81%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK-----------------KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           G + Q+ GPVVDV+F    +P I + +E+   N K                 +L+ EV    GD+  RC++M ST+GL RG+E  +   PI  PVG  VLGR+FNV+GEPID +   +  E  PIH+  PS++EQ T TE+FETGIKVIDLL PY KGGK+GLFGGAGVGKTVL+QELIHNIA  HGG S+F+GVGERTREGNDL+ E  +  ++++ ALVFGQMNEPPGARMRV LT LTMAE+FR+   QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTLA ++GQLQERITSTK GSITSVQA+YVPADDLTDPAP+TTFAHLDA TVL R+IA  GIYPA++PL+S+SR+L+P ++G EHYKVAR VQ +LQ++++LQDIIAILG+DELS+EDK+ V+RAR+I  FLSQPFFVAE+F++  GKYV  ++TI GF EI+EGK DD+PE+ F  VG ID+
  S:     8 GRVVQVIGPVVDVEFPGGHLPEIYNAIEIVGDNRKISQEGPHNEDNEPGEPIRLMAEVMHQLGDNRVRCVAMSSTDGLVRGMEARDLGEPITVPVGEEVLGRLFNVLGEPIDKQGPVDTEEKLPIHRPAPSYEEQETTTEVFETGIKVIDLLAPYAKGGKVGLFGGAGVGKTVLIQELIHNIAIEHGGYSVFSGVGERTREGNDLWLEFQEADILDKVALVFGQMNEPPGARMRVGLTGLTMAEYFRDKEGQDVLLFIDNIFRFIQAGSEVSALLGRMPSAVGYQPTLAVDVGQLQERITSTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRQIAEKGIYPAVDPLDSTSRILEPGVIGEEHYKVARQVQEVLQQYKDLQDIIAILGMDELSDEDKIIVNRARRIERFLSQPFFVAEQFTNTPGKYVPIKETIRGFKEILEGKHDDLPEEAFYMVGTIDE 475
>gi|89897658|ref|YP_521145.1| F0F1 ATP synthase subunit beta [Desulfitobacterium hafniense Y51] >gi|89337106|dbj|BAE86701.1| ATP synthase F1 beta subunit [Desulfitobacterium hafniense Y51] (456 aa)
Score = 1530, Expect = 1.4e-167, Identities = 296/444 (66%), Positives = 355/444 (79%)
  Q:   307 GPVVDVKFARNQMPNINDCLEVKLPNNK-KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           G VVDV+FA   +P I   ++V +P  K  L LEVA   G++  RC++M ST+GL RG+  +NT  PI  PVG A LGR+FNV+G+ IDN          PIH+  P+F +Q   T + ETGIKVIDLL PY KGGKIGLFGGAGVGKTVL+QELI+NIA  HGGLS+FAGVGERTREGNDL++EM + GVI++ A+VFGQMNEPPGAR+RV LT LTMAE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMG LQERITST++GSITSVQA+YVPADDLTDPAP+T FAHLDA TVL+R I+  GIYPA++PL+S+SR+L P I+G EHYKVAR VQ ILQK++ELQDIIAILG+DELSE++KL VSRAR+I  FLSQPF VAE F+   GKYV  ++TI GF EI+EGK D++PE  F  VG I++
  S:     2 GAVVDVEFASEALPEIYSAVKVTVPEQKIDLTLEVAQHLGNNTVRCVAMSSTDGLQRGMAALNTGAPITVPVGPATLGRIFNVLGKAIDNGEEVHTDTSYPIHRPAPAFVDQDPSTVMLETGIKVIDLLAPYSKGGKIGLFGGAGVGKTVLIQELINNIAMEHGGLSVFAGVGERTREGNDLWNEMRESGVIDKMAMVFGQMNEPPGARLRVGLTGLTMAEYFRDVQNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGALQERITSTRNGSITSVQAIYVPADDLTDPAPATAFAHLDATTVLNRAISEKGIYPAVDPLDSNSRILSPQIIGEEHYKVARDVQQILQKYKELQDIIAILGMDELSEDEKLVVSRARRIERFLSQPFHVAEVFTGSPGKYVPIKETIRGFKEIVEGKHDNLPEAAFHMVGTIEE 446
>gi|163792320|ref|ZP_02186297.1| F1-ATP Synthase Beta Chain [alpha proteobacterium BAL199] >gi|159182025|gb|EDP66534.1| F1-ATP Synthase Beta Chain [alpha proteobacterium BAL199] (474 aa)
Score = 1530, Expect = 1.4e-167, Identities = 295/451 (65%), Positives = 359/451 (79%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVI------NQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           G I Q+ G V+DVKF   ++P I + L  K+ +N  LVLEVA   G++  R I+M STEG  RG  V +T  PI  PVG   LGR+ NV+G+P+D +P  E     PIH+  P++ +QST++EI  TGIKVIDLL PY KGGKIGLFGGAGVGKTVL+ ELI+N+A  HGG S+FAGVGERTREGNDLYHEM++ GVI      ++ ALV+GQMNEPPGAR RV LT LT+AE+FR+   QDVL F+DNIFRF+QAGSEVSALLGR+PSAVGYQPTLA +MG LQERIT+TK GSITSVQA+YVPADDLTDPAP+T+FAHLDA TVL R+IA LGIYPA++PL+S+SRMLDP ++G EHY +AR VQ +LQ++  LQDIIAILG+DELSEED+LTV+RARKI+ FLSQPF VAE F+   GK VS +DTI GF  I+EG+ DD+PE  F  VGGI++
  S:     7 GKITQVIGAVIDVKF-DGELPAILNALHTKIGDNL-LVLEVAQHLGENTVRTIAMDSTEGAVRGQSVSDTGGPITVPVGPETLGRILNVIGDPVDERPPVETKLRFPIHRPAPAYIDQSTESEILITGIKVIDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEMVESGVIVPDGPGSKAALVYGQMNEPPGARARVGLTGLTLAEYFRDEEGQDVLFFVDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATDMGALQERITTTKKGSITSVQAIYVPADDLTDPAPATSFAHLDATTVLSRQIAELGIYPAVDPLDSTSRMLDPRVIGDEHYNIARRVQEVLQQYRSLQDIIAILGMDELSEEDRLTVARARKIQRFLSQPFHVAEIFTGSPGKLVSLEDTIKGFKAIVEGEYDDLPESAFYMVGGIEE 461
>gi|189499031|ref|YP_001958501.1| ATP synthase F1, beta subunit [Chlorobium phaeobacteroides BS1] >gi|189494472|gb|ACE03020.1| ATP synthase F1, beta subunit [Chlorobium phaeobacteroides BS1] (462 aa)
Score = 1530, Expect = 1.5e-167, Identities = 303/452 (67%), Positives = 362/452 (80%)
  Q:   299 KGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNK-PMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           +G I QI GPVVDV F    +P I D L V  P+  KLVLE     G++  R ISM +T+GL RG+ VINT  PI  PVG  VLGRM NVVG+PID K P+  +  YS IH+  P FD  STK+E+FETGIKVIDLL PY +GGK GLFGGAGVGKTVL+ ELI+NIA    G S+FAGVGERTREGNDL+ EM + GVI++TALVFGQMNEPPGAR RVALT L++AE+FR+   +DVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTL  EMG+LQ+RI ST  GS+TSVQA+YVPADDLTDPAP+T F HLDA TVL R IA LGIYPA++PL+S+SR+LDP+IVG EHY  A++V+++LQ++++LQDIIAILG+DELS+EDKLTVSRARKI+ FLSQPFFVAE F+   GKYV  +DTI GF+EII+GK DD+PE  F  VG I++
  S:     3 EGKISQIIGPVVDVDFQEGGLPAILDALTVARPDGTKLVLETQQHLGEERVRTISMDATDGLVRGMPVINTGKPIQVPVGPNVLGRMLNVVGDPIDGKGPVKSEKSYS-IHRPTPKFDVLSTKSEMFETGIKVIDLLEPYSRGGKTGLFGGAGVGKTVLIMELINNIAKQQSGFSVFAGVGERTREGNDLWEEMKESGVIDKTALVFGQMNEPPGARARVALTGLSIAEYFRDEENRDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLGTEMGELQDRIVSTNKGSVTSVQAIYVPADDLTDPAPATAFTHLDATTVLSRSIAELGIYPAVDPLDSTSRILDPNIVGDEHYNTAQAVKSLLQRYKDLQDIIAILGMDELSDEDKLTVSRARKIQRFLSQPFFVAEAFTGLEGKYVKLEDTIKGFNEIIDGKHDDLPESAFYLVGTIEE 454
>gi|119389907|pdb|2HLD|D Chain D, Crystal Structure Of Yeast Mitochondrial F1-Atpase >gi|119389908|pdb|2HLD|E Chain E, Crystal Structure Of Yeast Mitochondrial F1-Atpase >gi|119389909|pdb|2HLD|F Chain F, Crystal Structure Of Yeast Mitochondrial F1-Atpase >gi|119389916|pdb|2HLD|M Chain M, Crystal Structure Of Yeast Mitochondrial F1-Atpase >gi|119389917|pdb|2HLD|N Chain N, Crystal Structure Of Yeast Mitochondrial F1-Atpase >gi|119389918|pdb|2HLD|O Chain O, Crystal Structure Of Yeast Mitochondrial F1-Atpase >gi|119389925|pdb|2HLD|V Chain V, Crystal Structure Of Yeast Mitochondrial F1-Atpase >gi|119389926|pdb|2HLD|W Chain W, Crystal Structure Of Yeast Mitochondrial F1-Atpase >gi|119389927|pdb|2HLD|X Chain X, Crystal Structure Of Yeast Mitochondrial F1-Atpase (478 aa)
Score = 1530, Expect = 1.5e-167, Identities = 302/452 (66%), Positives = 357/452 (78%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNK-PMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVIN-----QTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           G +  + G +VDV F ++++P I + LE+K P  K LVLEVA   G++  R I+M  TEGL RG +V++T  PI  PVG   LGR+ NV+GEPID + P+  K+   PIH  PPSF EQST  EI ETGIKV+DLL PY +GGKIGLFGGAGVGKTV +QELI+NIA  HGG S+F GVGERTREGNDLY EM + GVIN     + ALVFGQMNEPPGAR RVALT LT+AE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGRIPSAVGYQPTLA +MG LQERIT+TK GS+TSVQAVYVPADDLTDPAP+TTFAHLDA TVL R I+ LGIYPA++PL+S SR+LD ++VG EHY VA  VQ  LQ ++ LQDIIAILG+DELSE+DKLTV RARKI+ FLSQPF VAE F+   GK V  +DT++ F  ++EGK D+IPE  F  VGGI+DV
  S:    11 GKVTAVIGAIVDVHFEQSELPAILNALEIKTPQGK-LVLEVAQHLGENTVRTIAMDGTEGLVRGEKVLDTGGPISVPVGRETLGRIINVIGEPIDERGPIKSKLR-KPIHADPPSFAEQSTSAEILETGIKVVDLLAPYARGGKIGLFGGAGVGKTVFIQELINNIAKAHGGFSVFTGVGERTREGNDLYREMKETGVINLEGESKVALVFGQMNEPPGARARVALTGLTIAEYFRDEEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGLLQERITTTKKGSVTSVQAVYVPADDLTDPAPATTFAHLDATTVLSRGISELGIYPAVDPLDSKSRLLDAAVVGQEHYDVASKVQETLQTYKSLQDIIAILGMDELSEQDKLTVERARKIQRFLSQPFAVAEVFTGIPGKLVRLKDTVASFKAVLEGKYDNIPEHAFYMVGGIEDV 466
>gi|157829067|ref|YP_001495309.1| F0F1 ATP synthase subunit beta [Rickettsia rickettsii str. 'Sheila Smith'] >gi|166222409|sp|A8GTS6|ATPB_RICRS ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|190358727|sp|B0BVB6|ATPB_RICRO ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|157801548|gb|ABV76801.1| F0F1 ATP synthase subunit beta [Rickettsia rickettsii str. 'Sheila Smith'] (473 aa)
Score = 1530, Expect = 1.5e-167, Identities = 307/454 (67%), Positives = 363/454 (79%)
  Q:   300 GIIYQIFGPVVDVKFARN-QMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVIN-------QTALVFGQMNEPPGARMRVALTALTMAEHFRENNK-QDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHK 753
           G I QI   VVDVKF  N ++P I + LE    + +++VLEVA   GDD  RCI+M S EGL RG+EVI+T +PI  PVG+  LGR+ NVVGEPID K   +    S I+K  P F  QST+  I  TGIKVIDLL PY KGGKIGLFGGAGVGKTVL+ ELI+N+A  HGG ++FAGVGERTREGNDLYHEMID GVIN       + ALV+GQMNEPPGAR RVAL+ LT+AE FR+ N+ QDVL F+DNIFRF+QAGSEVSALLGRIPSAVGYQPTLA +MG+LQERITSTK GSITSVQA+YVPADDLTDPAP+T+FAHLDA TVL R+IA  GIYPA++PL+S+S++LDP IVG EHY VAR VQ +LQ ++ LQDII ILG+DELSEEDKLTV+RARKI+ FLSQPF VAE F+  +GK+V+  DTI+GF  ++EGK DD+PE  F  VG ID+  K
  S:     6 GKITQIISAVVDVKFTNNGKLPEILNALEC-YNDTRRVVLEVAQHIGDDTVRCIAMDSMEGLVRGVEVIDTGSPIRIPVGTETLGRIMNVVGEPIDGKGDIKSSNISSIYKPAPDFTNQSTERNILVTGIKVIDLLAPYTKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYTVFAGVGERTREGNDLYHEMIDSGVINLAEPEKSKVALVYGQMNEPPGARARVALSGLTIAESFRDMNEGQDVLFFVDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGELQERITSTKHGSITSVQAIYVPADDLTDPAPATSFAHLDATTVLSRQIAEFGIYPAVDPLDSNSQVLDPMIVGEEHYSVARQVQQVLQTYKSLQDIITILGMDELSEEDKLTVARARKIQRFLSQPFHVAEVFTGAAGKFVNLADTIAGFKGLVEGKYDDLPEAAFYMVGTIDEAIK 467
>gi|1304067|dbj|BAA12667.1| proton ATPase beta subunit [Desulfovibrio vulgaris] >gi|5811568|dbj|BAA83613.1| F1F0-ATPase beta subunit [Desulfovibrio vulgaris] (471 aa)
Score = 1530, Expect = 1.6e-167, Identities = 293/461 (63%), Positives = 361/461 (78%)
  Q:   295 LKSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK---KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHKNY 755
           + ++ G I Q+ G VVDV+F    +PNI   L++K PNN    +LV EVA   GD+V R I+M +TEGL RG+E ++T  PIM PVG A LGR+ NVVG P+D     +  +Y PIH+  P F EQ+TK E+ ETGIKV+DLL+P  KGGK+GLFGGAGVGKTV++ E+I+NIA  HG +S+FAGVGERTREGNDLYHEM D GV+ + AL++GQMNEPPGAR RVALTAL  AE+FR+   QDVLLF+DNIFRF+QAGSEVSALLGR+PSAVGYQPTL  ++G LQERITST  GSITSVQAVYVPADDLTDPAP+TTF+HLD   VL R+IA LGIYPA++PL+S+SR+LDP++VG EHY VAR+VQ +LQK+++LQDIIAILG+DELS+EDKLTV+RAR+I+ FLSQPF VAE F+   G YV  +DTI  F  I+ G  D + E  F  VGGI+   + Y
  S:     1 MSANIGKIVQVIGAVVDVEFPSGNLPNILSALDIKNPNNSDAPQLVCEVAQHLGDNVVRTIAMDATEGLVRGMEAVDTGKPIMVPVGKASLGRIMNVVGRPVDEMGPIKTDKYLPIHRPAPEFTEQNTKVELLETGIKVVDLLIPLGKGGKMGLFGGAGVGKTVILMEMINNIAKQHGAISVFAGVGERTREGNDLYHEMKDAGVLEKAALIYGQMNEPPGARARVALTALACAEYFRDIENQDVLLFVDNIFRFTQAGSEVSALLGRMPSAVGYQPTLGTDLGGLQERITSTVKGSITSVQAVYVPADDLTDPAPATTFSHLDGTLVLSRQIAELGIYPAVDPLDSTSRILDPNVVGPEHYSVARAVQQVLQKYKDLQDIIAILGMDELSDEDKLTVARARRIQRFLSQPFHVAETFTGTPGVYVKLEDTIKAFRGILNGDFDHLAEGDFYMVGGIETALEKY 464
>gi|156530129|gb|ABU75161.1| AtpB [Eurycoma longifolia] (498 aa)
Score = 1529, Expect = 1.7e-167, Identities = 303/456 (66%), Positives = 359/456 (78%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           K + G I QI GPV+DV F   +MPNI + L VK    +     +  EV  L G+   R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIHK  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+SIF GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+  MG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+V
  S:    17 KKNLGHIAQIIGPVLDVVFLPGKMPNIYNALVVKGRDTVGQPINMTCEVQQLLGNSRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTSSPIHKPAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSIFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTXMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFKLILSGELDGLPEQAFYLVGNIDEV 483
>gi|86605139|ref|YP_473902.1| F0F1 ATP synthase subunit beta [Synechococcus sp. JA-3-3Ab] >gi|118573767|sp|Q2JX57|ATPB_SYNJA ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|86553681|gb|ABC98639.1| ATP synthase F1, beta subunit [Synechococcus sp. JA-3-3Ab] (477 aa)
Score = 1529, Expect = 1.7e-167, Identities = 295/454 (64%), Positives = 359/454 (79%)
  Q:   297 SDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK----KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           ++ G I Q+ GPV+D +F   ++P I + L+V+         K+  EV  L GD+  R ++M ST+GL RG+ V++T  PI  PVG A LGR+FNV+GEP+D     +  E++PIH+  P F E + K E FETGIKVIDLL P+ +GGK+GLFGGAGVGKTVL+QELIHNIA  H GLS+FAGVGERTREGNDLY+EM + GV+++ ALV+GQMNEPPGARMRV LTALTMAE+FR+ NKQDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTLA EMG LQERITSTK GSITSVQAVYVPADDLTDPAP+TTFAHLD+  VL R +A+ GIYPA++PL+SSS +L   IVG EHY  A++V+  LQ+++ELQDIIAILG+DELSEEDKL V+RAR+I  FLSQPFFVAE F+   GKYV  +DTI GF  I+ G+ D +PEQ F  VG I++
  S:     9 TNVGYITQVIGPVIDAEFPSGKLPEIYNALKVEATTESGLKVKVTFEVQQLLGDNRVRAVAMSSTDGLVRGMPVVDTGAPITVPVGEATLGRIFNVLGEPVDQGEPVQAKEFAPIHRSAPPFVELTVKPEPFETGIKVIDLLAPFKRGGKVGLFGGAGVGKTVLIQELIHNIAEEHSGLSVFAGVGERTREGNDLYNEMKESGVLDKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLATEMGNLQERITSTKQGSITSVQAVYVPADDLTDPAPATTFAHLDSTVVLSRSLAAKGIYPAVDPLDSSSTILQADIVGEEHYNTAQAVKQTLQRYKELQDIIAILGLDELSEEDKLVVARARRIERFLSQPFFVAEVFTGSPGKYVKLEDTIKGFQRILSGELDHLPEQAFYLVGTIEE 466
>gi|15604633|ref|NP_221151.1| F0F1 ATP synthase subunit beta [Rickettsia prowazekii str. Madrid E] >gi|6226556|sp|O50290|ATPB_RICPR ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|3861328|emb|CAA15227.1| ATP SYNTHASE BETA CHAIN (atpD) [Rickettsia prowazekii] (474 aa)
Score = 1529, Expect = 1.8e-167, Identities = 308/451 (68%), Positives = 362/451 (80%)
  Q:   300 GIIYQIFGPVVDVKFARN-QMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVIN-------QTALVFGQMNEPPGARMRVALTALTMAEHFRENNK-QDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           G I Q+   VVDVKF  N ++P I + LE    + +++VLEVA   GDD  RCI+M STEGL RGLEVI+T NPI  PVG+  LGR+ NVVGEPID K   +    S I+K  P F  QST+ +I  TGIKV+DLL PY KGGKIGLFGGAGVGKTVL+ ELI+N+A  HGG ++FAGVGERTREGNDLYHEMI  GVIN       + ALV+GQMNEPPGAR RVAL+ LT+AE FR+ N  QDVL F+DNIFRF+QAGSEVSALLGRIPSAVGYQPTLA +MG+LQERITSTK GSITSVQA+YVPADDLTDPAPST+FAHLDA TVL R+IA LGIYPA++PL+S+S++LDP IVG +HY VAR VQ +LQ ++ LQDIIAILG+DELSEEDKLTVSRARKI+ FLSQPF VAE F+   GK+V+  DTI GF  ++EG+ DD+PE  F  VG ID+
  S:     6 GKITQVISAVVDVKFTNNGKLPEILNALEC-YNDKQRIVLEVAQHIGDDTVRCIAMDSTEGLIRGLEVIDTGNPIRIPVGTETLGRIMNVVGEPIDGKGEIKSATISSIYKPAPDFINQSTERDILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYTVFAGVGERTREGNDLYHEMIASGVINLEEPEKSKVALVYGQMNEPPGARARVALSGLTIAESFRDMNAGQDVLFFVDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGELQERITSTKHGSITSVQAIYVPADDLTDPAPSTSFAHLDATTVLSRQIAELGIYPAVDPLDSNSQVLDPMIVGEKHYGVARQVQQVLQTYKSLQDIIAILGMDELSEEDKLTVSRARKIQRFLSQPFHVAEVFTGVEGKFVNLDDTIEGFKGLVEGQYDDLPEAAFYMVGTIDE 464
>gi|83952825|ref|ZP_00961555.1| ATP synthase subunit B [Roseovarius nubinhibens ISM] >gi|83835960|gb|EAP75259.1| ATP synthase subunit B [Roseovarius nubinhibens ISM] (474 aa)
Score = 1529, Expect = 1.9e-167, Identities = 304/457 (66%), Positives = 361/457 (78%)
  Q:   295 LKSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVIN-------QTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           + + KG I Q+ G VVDV+F  + +P I + L     N KKLVLEVA   G++  R I+M STEGL RG EV +T  PI  PVG+A LGR+ NVVGEP+D     +  E   IH++ P F EQST++E+  TGIKV+DLL PY KGGKIGLFGGAGVGKTVL+ ELI+NIA  H G S+FAGVGERTREGNDLYHEMI+  VIN       Q ALV+GQMNEPPGARMRVALT LT+AE FR+ +  DVL F+DNIFRF+QAGSEVSALLGRIPSAVGYQPTLA +MG +QERITSTKSGSITSVQAVYVPADDLTDPAP+T+FAHLDA TVL R I+ LGIYPA++PL+S+SR++DP+IVG EHY+VAR VQ ILQ+++ LQDIIAILG+DELSEEDKLTV+RARKI+ FLSQPF VA+ F+   G  V  +DTI  F  ++ G+ D +PE  F  VGGIDDV
  S:     1 MANAKGTITQVIGAVVDVQFG-DHLPEILNALTTD-NNGKKLVLEVAQHLGENTVRTIAMDSTEGLVRGQEVTDTDGPITVPVGNATLGRILNVVGEPVDEGAPIKATETRAIHQEAPEFQEQSTESEVLVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNIAKVHSGFSVFAGVGERTREGNDLYHEMIESNVINPDNLEESQVALVYGQMNEPPGARMRVALTGLTLAEQFRDQSGTDVLFFVDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGAMQERITSTKSGSITSVQAVYVPADDLTDPAPATSFAHLDATTVLSRAISELGIYPAVDPLDSTSRLMDPAIVGEEHYQVARDVQGILQRYKSLQDIIAILGMDELSEEDKLTVARARKIQRFLSQPFDVAKVFTGSDGVQVPLEDTIRSFKAVVAGEYDHLPEGAFYMVGGIDDV 462
>gi|119509845|ref|ZP_01628988.1| ATP synthase subunit B [Nodularia spumigena CCY9414] >gi|119465454|gb|EAW46348.1| ATP synthase subunit B [Nodularia spumigena CCY9414] (482 aa)
Score = 1529, Expect = 2.1e-167, Identities = 298/455 (65%), Positives = 363/455 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK----KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K++ G I QI GPVVDVKFA  ++P I + L +K  N      KL +EV  L GD+  R ++M ST+GL RGLEV++T  PI  PVG   LGR+FNV+GEP+DN+      +  PIH+  P F +  TK  +FETGIKV+DLL PY +GGKIGLFGGAGVGKTV++ ELI+NIAT HGG+S+FAGVGERTREGNDLY+EM++ GVIN+        ALV+GQMNEPPGARMRV L+ LTMAE+FR+ +KQDVLLF+DNIFRF QAGSEVSALLGR+PSAVGYQPTL  ++G LQERITST  GSITS+QAVYVPADDLTDPAP+TTFAHLD  TVL R +AS GIYPA++PL S+S ML P IVG +HY  AR+VQ+ LQ+++ELQDIIAILG+DELSEED+L V+RARK+  FLSQPFFVAE F+   GKYV  +DTI GF  I+ G+ D++PEQ F  VG I++
  S:     7 KTNIGYITQIIGPVVDVKFAGGKLPQIYNALTIKGSNEAGQEIKLTVEVQQLLGDNQVRTVAMSSTDGLIRGLEVVDTGAPISVPVGKVTLGRIFNVLGEPVDNQGPVNAEQTLPIHRPSPKFTDLETKPSVFETGIKVVDLLTPYRRGGKIGLFGGAGVGKTVIMMELINNIATQHGGVSVFAGVGERTREGNDLYNEMMESGVINKDNLNESKIALVYGQMNEPPGARMRVGLSGLTMAEYFRDVSKQDVLLFVDNIFRFVQAGSEVSALLGRMPSAVGYQPTLGTDVGALQERITSTTEGSITSIQAVYVPADDLTDPAPATTFAHLDGTTVLSRGLASKGIYPAVDPLGSTSTMLQPEIVGDDHYSTARAVQSTLQRYKELQDIIAILGLDELSEEDRLIVARARKVERFLSQPFFVAEVFTGSPGKYVKLEDTIKGFKMILSGELDELPEQAFYLVGDINE 472
>gi|78777600|ref|YP_393915.1| F0F1 ATP synthase subunit beta [Sulfurimonas denitrificans DSM 1251] >gi|118573775|sp|Q30QQ1|ATPB_THIDN ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|78498140|gb|ABB44680.1| ATP synthase F1, beta subunit [Sulfurimonas denitrificans DSM 1251] (468 aa)
Score = 1529, Expect = 2.1e-167, Identities = 298/451 (66%), Positives = 354/451 (78%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVKLP---NNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           G I Q+ GPVVDV F    +P IN+ +EV +       +LVLEVA   GD   R I+M  +EGL RG+    T +PI  PVG  VLGR+FNV+GE ID+           IH++PP+  EQST TE+FETGIKV+DLL PY KGGK+GLFGGAGVGKTV++ ELIHN+A GH GLS+FAGVGERTREGNDLYHEM D  V+++ AL +GQM+EPPGAR R+ALT LTMAE+FR+    DVL+F+DNIFRF+Q+GSE+SALLGRIPSAVGYQPTLA EMG LQ+RITSTK+GSITSVQAVYVPADDLTDPAP++ FAHLDA TVL+RKIA  GIYPA++PL+SSSR+LDP I+G EHY VAR VQ  LQK+++LQDIIAILG+DELSE+DK  V RARKI  FLSQPFFVAE F+   GKYVS  DTI GF  I+ G+CD +PE  F  VGGID+
  S:     7 GKISQVMGPVVDVDF-DGYLPIINEAIEVNINLEGTQTRLVLEVAAHLGDGRVRTIAMDMSEGLVRGMNATATGSPIKVPVGEKVLGRIFNVIGETIDDGEQVTDAPMWSIHRQPPALVEQSTTTEMFETGIKVVDLLAPYSKGGKVGLFGGAGVGKTVIIMELIHNVAMGHDGLSVFAGVGERTREGNDLYHEMKDSNVLDKVALCYGQMSEPPGARNRIALTGLTMAEYFRDEKGLDVLMFVDNIFRFAQSGSEMSALLGRIPSAVGYQPTLAREMGALQDRITSTKNGSITSVQAVYVPADDLTDPAPASVFAHLDATTVLNRKIAEKGIYPAVDPLDSSSRLLDPQILGEEHYNVARGVQQTLQKYKDLQDIIAILGMDELSEDDKNIVERARKIEKFLSQPFFVAEVFTGSPGKYVSLADTIKGFKMILSGECDHMPEGSFYMVGGIDE 459
>gi|157826257|ref|YP_001493977.1| F0F1 ATP synthase subunit beta [Rickettsia akari str. Hartford] >gi|166201729|sp|A8GPZ4|ATPB_RICAH ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|157800215|gb|ABV75469.1| F0F1 ATP synthase subunit beta [Rickettsia akari str. Hartford] (473 aa)
Score = 1528, Expect = 2.6e-167, Identities = 305/451 (67%), Positives = 362/451 (80%)
  Q:   300 GIIYQIFGPVVDVKFARN-QMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVIN-------QTALVFGQMNEPPGARMRVALTALTMAEHFRE-NNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           G I QI   VVDVKF  N ++P I + LE    + +++VLEVA   GDD  RCI+M STEGL RG+EV++T +PI  PVG+  LGR+ NVVGEPID K   +    S I+K  P F  QST+  I  TGIKV+DLL PY+KGGKIGLFGGAGVGKTVL+ ELI+N+A  HGG ++FAGVGERTREGNDLYHEMID GVI+       + ALV+GQMN PPGAR RVAL+ LT+AE FR+ N  QDVL F+DNIFRF+QAGSEVSALLGRIPSAVGYQPTLA +MG+LQERITSTK GSITSVQA+YVPADDLTDPAP+T+FAHLDA TVL R+IA  GIYPA++PL+S+S++LDP IVG EHY VAR VQ +LQ ++ LQDIIAILG+DELSEEDKLTVSRARKI+ FLSQPF VAE F+   GK+V+  DTI+GF  ++EGK DD+PE  F  VG ID+
  S:     6 GKITQIISAVVDVKFTNNGELPEILNALEC-YNDKQRIVLEVAQHIGDDTVRCIAMDSTEGLVRGVEVMDTGSPICIPVGTETLGRIMNVVGEPIDGKGDIKSSNISAIYKSAPDFTNQSTERNILVTGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYTVFAGVGERTREGNDLYHEMIDSGVIDLEKPENSKVALVYGQMNAPPGARARVALSGLTIAESFRDMNGGQDVLFFVDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGELQERITSTKHGSITSVQAIYVPADDLTDPAPATSFAHLDATTVLSRQIAEFGIYPAVDPLDSNSQVLDPMIVGEEHYSVARQVQQVLQTYKSLQDIIAILGMDELSEEDKLTVSRARKIQRFLSQPFHVAEVFTGSEGKFVNLADTIAGFKGLVEGKYDDLPEAAFYMVGTIDE 464
>gi|157804173|ref|YP_001492722.1| F0F1 ATP synthase subunit beta [Rickettsia canadensis str. McKiel] >gi|166222408|sp|A8F004|ATPB_RICCK ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|157785436|gb|ABV73937.1| F0F1 ATP synthase subunit beta [Rickettsia canadensis str. McKiel] (473 aa)
Score = 1527, Expect = 3.0e-167, Identities = 305/451 (67%), Positives = 361/451 (80%)
  Q:   300 GIIYQIFGPVVDVKFARN-QMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVIN-------QTALVFGQMNEPPGARMRVALTALTMAEHFRENNK-QDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           G I QI   VVDVKF  N ++P I + LE    +N+++VLEV    GDD  RCI+M STEGL RGLEV++T +PI  PVG+A LGR+ NVVGE ID K   +    S I+K  PSF  QS++  I  TGIKV+DLL PY KGGKIGLFGGAGVGKTVL+ ELI+N+A  HGG ++FAGVGERTREGNDLYHEMID GVIN       + ALV+GQM+EPPGAR RVAL+ LT+AE FR+ N+ QDVL F+DNIFRF+QAGSEVSALLGR+PSAVGYQPTLA +MG LQERITSTK GSITSVQA+YVPADDLTDPAP+T+FAHLDA TVL R+IA LGIYPA++PL+S+S++LDP IVG EHY VAR VQ +LQ ++ LQDIIAILG+DELSEEDKLTVSRARKI+ FLSQPF VAE F+   GK+V   DTI GF  ++EG+ D +PE  F  VG ID+
  S:     6 GKITQIISAVVDVKFTNNSKLPAILNALEC-YSDNQRIVLEVVQHIGDDTVRCIAMDSTEGLVRGLEVVDTGSPICIPVGTATLGRIMNVVGESIDGKGEIKSSNVSSIYKPAPSFTNQSSERTILVTGIKVVDLLAPYTKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYTVFAGVGERTREGNDLYHEMIDSGVINLEEPEKSKVALVYGQMDEPPGARARVALSGLTIAESFRDMNEGQDVLFFVDNIFRFTQAGSEVSALLGRVPSAVGYQPTLATDMGALQERITSTKHGSITSVQAIYVPADDLTDPAPATSFAHLDATTVLSRQIAELGIYPAVDPLDSNSQVLDPMIVGEEHYSVARQVQQVLQTYKSLQDIIAILGMDELSEEDKLTVSRARKIQRFLSQPFHVAEVFTGVEGKFVDLADTIEGFKGLVEGQYDGLPEAAFYMVGTIDE 464
>gi|118573739|sp|Q4UK18|ATPB_RICFE ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) (474 aa)
Score = 1527, Expect = 3.3e-167, Identities = 308/451 (68%), Positives = 365/451 (80%)
  Q:   300 GIIYQIFGPVVDVKFARN-QMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVIN-------QTALVFGQMNEPPGARMRVALTALTMAEHFRENNK-QDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           G I QI   VVDVKF  N ++P I + LE    + +++VLEVA   GDD  RCI+M STEGL RG+EVI+T +PI  PVG+  LGR+ NVVGEPID K   +    S I+K  P F  QST+  I  TGIKV+DLL PY KGGKIGLFGGAGVGKTVL+ ELI+N+A  HGG ++FAGVGERTREGNDLYHEMID GVI+       + ALV+GQMNEPPGAR RVAL+ LT+AE FR+ N+ QDVL F+DNIFRF+QAGSEVSALLGRIPSAVGYQPTLA +MG+LQERITSTK+GSITSVQA+YVPADDLTDPAP+T+FAHLDA TVL R+IA LGIYPA++PL+S+S++LDP IVG EHY VAR VQ ILQ ++ LQDIIAILG+DELSEEDKLTVSRARKI+ FLSQPF VAE F+   GK+V+  DTI+GF  ++EGK DD+PE  F  VG +D+
  S:     6 GKITQIISAVVDVKFTNNGELPEILNALEC-YNDKQRIVLEVAQHIGDDTVRCIAMDSTEGLVRGVEVIDTGSPIRIPVGTETLGRIMNVVGEPIDGKGDIKSSNISSIYKSAPDFTNQSTERNILVTGIKVVDLLAPYTKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYTVFAGVGERTREGNDLYHEMIDSGVIDLEKPENSKVALVYGQMNEPPGARARVALSGLTIAESFRDMNEGQDVLFFVDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGELQERITSTKNGSITSVQAIYVPADDLTDPAPATSFAHLDATTVLSRQIAELGIYPAVDPLDSNSQVLDPMIVGEEHYSVARQVQQILQTYKSLQDIIAILGMDELSEEDKLTVSRARKIQRFLSQPFHVAEVFTGAEGKFVNLADTIAGFKGLVEGKYDDLPEAAFYMVGTMDE 464
>gi|22651724|gb|AAM26934.1| ATP synthase beta subunit [Aldrovanda vesiculosa] (492 aa)
Score = 1527, Expect = 3.3e-167, Identities = 305/483 (63%), Positives = 370/483 (76%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHKNYVAANSNNKVNSSNKPLNSENKSN 778
           K + G I QI GPV+DV F+  +MP I + L VK    L     +  EV  L G++  R ++M +T+GL RG+EV++T   +  PVGS  LGR+FNV+GEPIDN    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+FAGVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ NKQDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P+IVG EHY++A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPF VAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+               ++ K +N E ++N
  S:    14 KKNLGRIIQIIGPVLDVAFSPGKMPYIYNALVVKGRDTLGEPINVTCEVQQLLGNNRVRAVAMSATDGLMRGMEVVDTGAALSVPVGSTTLGRIFNVLGEPIDNLGPVDTRTTSPIHRSAPAFIQLETKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFAGVGERTREGNDLYKEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPNIVGDEHYEIAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFVVAEVFTGSPGKYVGLAETIRGFQLILSGELDSLPEQAFYLVGNIDE---------------ATEKAMNLERRTN 492
>gi|157694077|ref|YP_001488539.1| F0F1 ATP synthase subunit beta [Bacillus pumilus SAFR-032] >gi|166990366|sp|A8FIB2|ATPB_BACP2 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|157682835|gb|ABV63979.1| H(+)-transporting two-sector ATPase, F(1) beta subunit [Bacillus pumilus SAFR-032] (473 aa)
Score = 1526, Expect = 4.4e-167, Identities = 295/452 (65%), Positives = 361/452 (79%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKK------LVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPID-NKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           G I QI GPVVDV+F    +P I + + V      +      L LEVAL  GDD  R I+M ST+G+ RG+E ++   PI  PVG+  LGR+FNV+G+ ID ++P+  + +  PIH++ PSFD+ ST+ EI ETGIKV+DLL PY+KGGKIGLFGGAGVGKTVL+QELI+NIA  HGG+S+FAGVGERTREGNDLY+EM D GVI +TA+VFGQMNEPPGARMRVALT LTMAEHFR+   QDVL FIDNI+RF+QAGSEVSALLGR+PSAVGYQPTLA EMGQLQERITST  GS+TS+QA+YVPADD TDPAP+TTFAHLDA T L+RK+  +GIYPA++PL S+SR L P IVG EHY +AR VQ  LQ+++ELQDIIAILG+DELSE+DKL V RAR+++ FLSQ F VAE+F+ + G YV  ++T+ GF EI+ GK D +PE  F  VG I++V
  S:     4 GRISQIMGPVVDVRFEDGHLPEIYNAIRVSHKAESESEVDIDLTLEVALHLGDDTVRTIAMASTDGVKRGMEAVDLGKPISVPVGNVTLGRVFNVLGDNIDLDEPLGVEAQRDPIHRQAPSFDQLSTEVEILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELINNIAQEHGGISVFAGVGERTREGNDLYYEMKDSGVIEKTAMVFGQMNEPPGARMRVALTGLTMAEHFRDELGQDVLFFIDNIYRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTNVGSVTSIQAIYVPADDYTDPAPATTFAHLDATTNLERKLTEMGIYPAVDPLASTSRALAPEIVGEEHYAIAREVQQTLQRYKELQDIIAILGMDELSEDDKLVVHRARRVQFFLSQNFHVAEQFTGQKGSYVPLKETVKGFKEILSGKYDHLPEDAFRLVGRIEEV 462
>gi|159466892|ref|XP_001691632.1| beta subunit of mitochondrial ATP synthase [Chlamydomonas reinhardtii] >gi|584796|sp|P38482|ATPBM_CHLRE ATP synthase subunit beta, mitochondrial precursor >gi|18123|emb|CAA43808.1| H(+)-transporting ATP synthase; beta subunit of mitochondrial ATP synthase [Chlamydomonas reinhardtii] >gi|158278978|gb|EDP04740.1| beta subunit of mitochondrial ATP synthase [Chlamydomonas reinhardtii] (574 aa)
Score = 1526, Expect = 4.4e-167, Identities = 306/475 (64%), Positives = 375/475 (78%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVI--------NQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV--HKNYVAANSNNKVNSSNKPLNSE 774
           G + Q+ GPVVDV+F   ++P+I   LEV+  +N +LVLEVA   GD+  RC++M ST+GL RG +V+NT +PI  PVG   LGR+ NV+GEP+D +   E  E   IH++ P F EQST+ EI  TGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+N+A  HGG S+FAGVGERTREGNDLY EMI+ GVI        ++  LV+GQMNEPPGAR RVALT LT+AE+FR+   QDVLLF+DNIFRF+QA SEVSALLGRIPSAVGYQPTLA ++G LQERIT+T  GSITSVQAVYVPADDLTDPAP+TTFAHLDA TVL R IA LGIYPA++PL+S+SRML+P+I+G EHY +AR VQ +LQ ++ LQDIIAILG+DELSEEDKLTV+RARKI+ FLSQPF VAE F+   GKYV  +DTIS F+ I++GK DD+PE  F  VGGI +V    + +A +   + + S K  +SE
  S:    38 GFVSQVIGPVVDVRF-DGELPSILSALEVQ-GHNVRLVLEVAQHMGDNTVRCVAMDSTDGLVRGQKVVNTGSPIKVPVGRGTLGRIMNVIGEPVDEQGPIECSEVWSIHREAPEFTEQSTEQEILVTGIKVVDLLAPYQRGGKIGLFGGAGVGKTVLIMELINNVAKAHGGFSVFAGVGERTREGNDLYREMIESGVIKLGDKRGESKCTLVYGQMNEPPGARARVALTGLTVAEYFRDVEGQDVLLFVDNIFRFTQANSEVSALLGRIPSAVGYQPTLATDLGGLQERITTTTKGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSRSIAELGIYPAVDPLDSTSRMLNPNIIGAEHYNIARGVQKVLQDYKNLQDIIAILGMDELSEEDKLTVARARKIQRFLSQPFQVAEVFTGTPGKYVDLKDTISAFTGILQGKYDDLPEMAFYMVGGIHEVVEKADKLAKDVAARKDESKKAKSSE 520
>gi|163751422|ref|ZP_02158647.1| ATP synthase subunit B [Shewanella benthica KT99] >gi|161328725|gb|EDP99873.1| ATP synthase subunit B [Shewanella benthica KT99] (458 aa)
Score = 1525, Expect = 5.4e-167, Identities = 294/451 (65%), Positives = 360/451 (79%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           G + Q+ G VVDV+F ++ +P I D LE+K   ++ LVLEV    G  V R I+MG+++GL RGLEV NT +PI  PVGS  LGR+ NV+GEPID        ++  IH++ P+F+EQS+ TE+ ETGIKVIDL+ P+ KGGK+GLFGGAGVGKTV + ELI+NIA  H GLS+FAGVGERTREGND Y+EM D GV+++  +V+GQMNEPPG R+RVALT LTMAE FR+  K DVL FIDNI+R++ AG+EVSALLGR+PSAVGYQPTLA EMG LQERITSTKSGSITSVQAVYVPADDLTDP+P+TTFAHLDA  VL R IAS+GIYPA++PL+S+SR LDP +VG EHY VA  VQT+LQ+++EL+DIIAILG+DELS+EDK TV+RARKI  +LSQPFFVAE F+   GKYVS +DTI GF  I+EG+ D +PEQ F  VG ID+
  S:     4 GTVVQVIGAVVDVEFPQDAVPQIYDALEIK---SEGLVLEVQQQIGGGVVRTIAMGTSDGLRRGLEVTNTGSPITVPVGSVTLGRIMNVLGEPIDEAGPIGGTDHYVIHREAPTFEEQSSSTELLETGIKVIDLICPFAKGGKVGLFGGAGVGKTVNMMELINNIAKAHSGLSVFAGVGERTREGNDFYYEMKDAGVLDKVTMVYGQMNEPPGNRLRVALTGLTMAERFRDEGK-DVLFFIDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKSGSITSVQAVYVPADDLTDPSPATTFAHLDATIVLSRNIASMGIYPAVDPLDSTSRQLDPLVVGQEHYDVANGVQTVLQRYKELKDIIAILGMDELSDEDKTTVARARKIEKYLSQPFFVAEVFTGSPGKYVSLKDTIRGFKGILEGEFDHLPEQAFYMVGSIDE 450
>gi|114328720|ref|YP_745877.1| F0F1 ATP synthase subunit beta [Granulibacter bethesdensis CGDNIH1] >gi|122326328|sp|Q0BQE8|ATPB_GRABC ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|114316894|gb|ABI62954.1| ATP synthase beta chain [Granulibacter bethesdensis CGDNIH1] (476 aa)
Score = 1525, Expect = 5.5e-167, Identities = 301/451 (66%), Positives = 363/451 (80%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNK-PMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVI---------NQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           G + QI G VVDV+F   ++P I + L+ ++  ++ L+LEVA   G+   R I+M ST+GL RG EV +   PI  PVG   LGR+ NV+GEPID + P+  K  YS IH++ PSF+EQ+   EI  TGIKV+DLL PY+KGGKIGLFGGAGVGKTVL+QELI+NIA  HGG+S+FAGVGERTREGNDLYHEMID GVI         ++ ALV+GQMNEPPGAR RVAL+ L++AE+FR+   QDVL F+DNIFRF+QAG+EVSALLGRIPSAVGYQPTLA +MG LQERITSTK GSITSVQA+YVPADDLTDPAP+T+FAHLDA TVL+R I+  GIYPA++PL+S+SR LDP IVG EHYKVAR VQ ILQ ++ LQDIIAILG+DELSEEDKLTV+RARKI  F+SQPF VAE F+   G +VS +DT+  F EI+EGK DD+PE  FL VG I+D
  S:     7 GRVTQILGAVVDVQF-DGELPFIQNALQTRI-GDRTLILEVAQELGERTVRAIAMDSTDGLVRGAEVEDLGRPITVPVGPGTLGRILNVIGEPIDERGPVDAKKTYS-IHREAPSFEEQAASAEILVTGIKVVDLLAPYLKGGKIGLFGGAGVGKTVLIQELINNIAKAHGGVSVFAGVGERTREGNDLYHEMIDAGVIKLGENTTEGSKVALVYGQMNEPPGARARVALSGLSIAEYFRDEEGQDVLFFVDNIFRFTQAGAEVSALLGRIPSAVGYQPTLATDMGALQERITSTKKGSITSVQAIYVPADDLTDPAPATSFAHLDATTVLNRAISEKGIYPAVDPLDSTSRSLDPRIVGEEHYKVARDVQRILQTYKSLQDIIAILGMDELSEEDKLTVARARKIERFMSQPFHVAEVFTGSPGVFVSIEDTVRSFKEIVEGKHDDLPEAAFLMVGTIED 464
>gi|34581172|ref|ZP_00142652.1| ATP synthase beta chain [Rickettsia sibirica 246] >gi|28262557|gb|EAA26061.1| ATP synthase beta chain [Rickettsia sibirica 246] (473 aa)
Score = 1524, Expect = 6.4e-167, Identities = 306/451 (67%), Positives = 362/451 (80%)
  Q:   300 GIIYQIFGPVVDVKFARN-QMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVIN-------QTALVFGQMNEPPGARMRVALTALTMAEHFRENNK-QDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           G I QI   VVDVKF  N ++P I + LE    + +++VLEVA   GDD  RCI+M S EGL RG+EVI+T +PI  PVG+  LGR+ NVVGEPID K   +    S I+K  P F  QST+  I  TGIKVIDLL PY KGGKIGLFGGAGVGKTVL+ ELI+N+A  HGG ++FAGVGERTREGNDLYHEMID GVIN       + ALV+GQMNEPPGAR RVAL+ LT+AE FR+ N+ QDVL F+DNIFRF+QAGSEVSALLGRIPSAVGYQPTLA +MG+LQERITSTK GSITSVQA+YVPADDLTDPAP+T+FAHLDA TVL R+IA  GIYPA++PL+S+S++LDP IVG EHY VAR VQ +LQ ++ LQDII ILG+DELSEEDKLTV+RARKI+ FLSQPF VAE F+  +GK+V+  DTI+GF  ++EGK DD+PE  F  VG ID+
  S:     6 GKITQIISAVVDVKFTNNGKLPEILNALEC-YNDKQRIVLEVAQHIGDDTVRCIAMDSMEGLVRGVEVIDTGSPIRIPVGTETLGRIMNVVGEPIDGKGDIKSSNISSIYKPAPDFTNQSTERNILVTGIKVIDLLAPYTKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYTVFAGVGERTREGNDLYHEMIDSGVINLAEPEKSKVALVYGQMNEPPGARARVALSGLTIAESFRDMNEGQDVLFFVDNIFRFTQAGSEVSALLGRIPSAVGYQPTLASDMGELQERITSTKYGSITSVQAIYVPADDLTDPAPATSFAHLDATTVLSRQIAEFGIYPAVDPLDSNSQVLDPMIVGEEHYSVARQVQQVLQTYKSLQDIITILGMDELSEEDKLTVARARKIQRFLSQPFHVAEVFTGAAGKFVNLADTIAGFKGLVEGKYDDLPEAAFYMVGTIDE 464
>gi|194397468|ref|YP_002038137.1| ATP synthase F1, beta subunit [Streptococcus pneumoniae G54] >gi|194357135|gb|ACF55583.1| ATP synthase F1, beta subunit [Streptococcus pneumoniae G54] (468 aa)
Score = 1524, Expect = 7.5e-167, Identities = 302/452 (66%), Positives = 361/452 (79%)
  Q:   300 GIIYQIFGPVVDVKFARNQ-MPNINDCLEVKLPNNKK--LVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPID-NKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           G I Q+ GPVVDV FA  + +P IN+ L V   + +K  +VLEVAL  GD + R I+M ST+GL RG+EV++T  PI  PVG   LGR+FNV+G+ ID   P  E  E  PIHKK P+FDE ST +EI ETGIKVIDLL PY+KGGK+GLFGGAGVGKTVL+QELIHNIA  HGG+S+F GVGERTREGNDLY EM + GVI +TA+VFGQMNEPPGARMRVALT LT+AE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMGQLQERITSTK GS+TS+QA+YVPADD TDPAP+T FAHLD+ T L+RK+  LGIYPA++PL SSSR L P IVG EHY VA  V+ +LQ++ ELQDIIAILG+DELS+E+K  V+RAR+I+ FLSQ   VAE+F+ + G YV   +T+ GF EI++GK D +PE  F  VG I+DV
  S:     4 GKIAQVIGPVVDVLFAAGEKLPEINNALVVYKNDERKTKIVLEVALELGDGMVRTIAMESTDGLTRGMEVLDTGRPISVPVGKETLGRVFNVLGDTIDLEAPFTEDAERQPIHKKAPTFDELSTSSEILETGIKVIDLLAPYLKGGKVGLFGGAGVGKTVLIQELIHNIAQEHGGISVFTGVGERTREGNDLYWEMKESGVIEKTAMVFGQMNEPPGARMRVALTGLTIAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGSVTSIQAIYVPADDYTDPAPATAFAHLDSTTNLERKLVQLGIYPAVDPLASSSRALAPEIVGEEHYAVAAEVKRVLQRYHELQDIIAILGMDELSDEEKTLVARARRIQFFLSQNXNVAEQFTGQPGSYVPVAETVRGFKEILDGKYDHLPEDAFRGVGSIEDV 459
>gi|71082935|ref|YP_265654.1| F0F1 ATP synthase subunit beta [Candidatus Pelagibacter ubique HTCC1062] >gi|91762641|ref|ZP_01264606.1| F1-ATP Synthase Beta Chain [Candidatus Pelagibacter ubique HTCC1002] >gi|118573715|sp|Q4FP38|ATPB_PELUB ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|71062048|gb|AAZ21051.1| F1-ATP Synthase Beta Chain [Candidatus Pelagibacter ubique HTCC1062] >gi|91718443|gb|EAS85093.1| F1-ATP Synthase Beta Chain [Candidatus Pelagibacter ubique HTCC1002] (472 aa)
Score = 1524, Expect = 7.5e-167, Identities = 305/452 (67%), Positives = 356/452 (78%)
  Q:   299 KGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVI------NQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           KG I QI G VVDVKF   ++P I   LE K  +N+ LVLEVA   G+   R I+M +TEGL RG EV  T  PI  PVG   LGR+ NV+GEPID K   +  E  PIH+  P F +QST+TEI  TGIKV+DLL PY KGGKIGLFGGAGVGKTVL+ ELI+N+A  HGG S+FAGVGERTREGNDLYHEMID GVI      ++ ALV+GQMNEPPGAR RVALT LT+AE+FR+   QDVL F+DNIFRF+QAGSEVSALLGRIPSAVGYQPTLA +MG LQERIT+T  GSITSVQA+YVPADDLTDPAP+T+FAHLDA TVL R+IA +GIYPA++PL+S+SR+LDP IVG EHY+VAR VQ ILQ ++ LQDIIAILG+DELSEEDKLTV+RARKI+ FLSQPFFVAE F+   GK V  + TI GF+ I  G+ D +PE  F  VG I++
  S:     3 KGKITQIIGAVVDVKF-DGELPEILSALECKNGDNR-LVLEVAQHLGESSVRTIAMDATEGLKRGDEVTATGAPIQVPVGPETLGRIINVIGEPIDEKGEVKTKEKWPIHRAAPEFSDQSTETEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGFSVFAGVGERTREGNDLYHEMIDSGVIKPEGPGSKAALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLFFVDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGNLQERITTTNKGSITSVQAIYVPADDLTDPAPATSFAHLDATTVLSRQIAEIGIYPAVDPLDSTSRILDPRIVGDEHYRVAREVQKILQTYKSLQDIIAILGMDELSEEDKLTVARARKIQRFLSQPFFVAEVFTGSPGKLVDLESTIKGFAAICNGEYDHLPEAAFYMVGTIEE 458
>gi|152990964|ref|YP_001356686.1| F0F1 ATP synthase subunit beta [Nitratiruptor sp. SB155-2] >gi|166201722|sp|A6Q4C0|ATPB_NITSB ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|151422825|dbj|BAF70329.1| F0F1-type ATP synthase, beta subunit [Nitratiruptor sp. SB155-2] (469 aa)
Score = 1524, Expect = 7.8e-167, Identities = 304/451 (67%), Positives = 365/451 (80%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKK---LVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDN-KPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           G I Q+ GPVVDV F  + +P IN+ LE++L    K   LVLEVA   GD+  R I+M  T+GL RG+EV  T + I  PVG  VLGR+FNV+G+ ID  +P+  K  +S IH+  P F+EQSTK EIFETGIKV+DLL PY KGGK GLFGGAGVGKTV++ ELIHN+A  H G S+FAGVGERTREGNDLY+EM +  V+++ AL +GQMNEPPGAR R+ALT LTMAE+FR+    DVL+FIDNIFR++QAG+E+SALLGRIPSAVGYQPTLA EMG+LQERITSTK GSITS+QAVYVPADDLTDPAP++ FAHLDA TVL+R+IA  GIYPA++PL+S+SRMLDP+IVG EHYKVAR VQ +LQK+++LQDIIAILG+DELSEEDKLTV RARKI  FLSQPFFVAE F+   GKYV+ ++TI GF  ++EGK DDIPE  F  VG ID+
  S:     6 GKIIQVMGPVVDVDF-EDYLPAINEALEMELEVEDKKIRLVLEVAAHLGDNRVRTIAMDMTDGLVRGMEVKATGDSIKVPVGEEVLGRIFNVIGDTIDEGEPLQAKTYWS-IHRSAPPFEEQSTKEEIFETGIKVVDLLAPYKKGGKTGLFGGAGVGKTVIIMELIHNVAYKHSGYSVFAGVGERTREGNDLYYEMKESNVLDKVALCYGQMNEPPGARNRIALTGLTMAEYFRDEMGLDVLMFIDNIFRYAQAGAEMSALLGRIPSAVGYQPTLASEMGRLQERITSTKKGSITSIQAVYVPADDLTDPAPASVFAHLDATTVLNRRIAEKGIYPAVDPLDSTSRMLDPNIVGEEHYKVARGVQAVLQKYKDLQDIIAILGMDELSEEDKLTVERARKIERFLSQPFFVAEVFTGAPGKYVTLEETIEGFKGLLEGKYDDIPEAAFYMVGNIDE 458
>gi|171779638|ref|ZP_02920594.1| hypothetical protein STRINF_01475 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gi|171281740|gb|EDT47174.1| hypothetical protein STRINF_01475 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] (468 aa)
Score = 1523, Expect = 8.3e-167, Identities = 305/452 (67%), Positives = 362/452 (80%)
  Q:   300 GIIYQIFGPVVDVKFAR-NQMPNINDCLEVKLPNNK--KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPID-NKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           G I Q+ GPVVDV FA  +++P IN+ L V    +K  K+VLEVAL  GD + R I+M ST+GL RGLEV +T  PI  PVG   LGR+FNV+G+ ID ++P  E      IHKK P+FDE ST +EI ETGIKVIDLL PY+KGGK+GLFGGAGVGKTVL+QELIHNIA  HGG+S+F GVGERTREGNDLY EM + GVI +TA+VFGQMNEPPGARMRVALT LT+AE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMGQLQERITSTK GS+TS+QA+YVPADD TDPAP+T FAHLD+ T L+RK+  +GIYPA++PL SSSR L P IVG EHY+VA  VQ +LQ++ ELQDIIAILG+DELS+E+K  V RAR+I+ FLSQ F VAE+F+   G YV   +T+ GF EI+EGK DD+PE  F  VG I+DV
  S:     4 GKIAQVVGPVVDVAFAAGDKLPEINNALIVYKNGDKSQKIVLEVALELGDGLVRTIAMESTDGLTRGLEVFDTGRPISVPVGKETLGRVFNVLGDTIDLDEPFAEDAPRETIHKKAPAFDELSTSSEILETGIKVIDLLAPYLKGGKVGLFGGAGVGKTVLIQELIHNIAQEHGGISVFTGVGERTREGNDLYWEMKESGVIEKTAMVFGQMNEPPGARMRVALTGLTIAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGSVTSIQAIYVPADDYTDPAPATAFAHLDSTTNLERKLTQMGIYPAVDPLASSSRALAPEIVGQEHYEVATEVQRVLQRYRELQDIIAILGMDELSDEEKTLVGRARRIQFFLSQNFNVAEQFTGMPGSYVPVAETVRGFKEILEGKYDDLPEDAFRNVGPIEDV 459
>gi|167472351|ref|ZP_02337055.1| F0F1 ATP synthase subunit beta [Rickettsia africae ESF-5] (473 aa)
Score = 1523, Expect = 8.3e-167, Identities = 306/451 (67%), Positives = 361/451 (80%)
  Q:   300 GIIYQIFGPVVDVKFARN-QMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVIN-------QTALVFGQMNEPPGARMRVALTALTMAEHFRENNK-QDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           G I QI   VVDVKF  N ++P I + LE    +  ++VLEVA   GDD  RCI+M S EGL RG+EVI+T +PI  PVG+  LGR+ NVVGEPID K   +    S I+K  P F  QST+  I  TGIKVIDLL PY KGGKIGLFGGAGVGKTVL+ ELI+N+A  HGG ++FAGVGERTREGNDLYHEMID GVIN       + ALV+GQMNEPPGAR RVAL+ LT+AE FR+ N+ QDVL F+DNIFRF+QAGSEVSALLGRIPSAVGYQPTLA +MG+LQERITSTK GSITSVQA+YVPADDLTDPAP+T+FAHLDA TVL R+IA  GIYPA++PL+S+S++LDP IVG EHY VAR VQ +LQ ++ LQDII ILG+DELSEEDKLTV+RARKI+ FLSQPF VAE F+  +GK+V+  DTI+GF  ++EGK DD+PE  F  VG ID+
  S:     6 GKITQIISAVVDVKFTNNGELPEILNALEC-YNDKHRIVLEVAQHIGDDTVRCIAMDSMEGLVRGVEVIDTGSPIRIPVGTETLGRIMNVVGEPIDGKGDIKSSNISSIYKPAPDFTNQSTERNILVTGIKVIDLLAPYTKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYTVFAGVGERTREGNDLYHEMIDSGVINLAEPEKSKVALVYGQMNEPPGARARVALSGLTIAESFRDMNEGQDVLFFVDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGELQERITSTKYGSITSVQAIYVPADDLTDPAPATSFAHLDATTVLSRQIAEFGIYPAVDPLDSNSQVLDPMIVGEEHYSVARQVQQVLQTYKSLQDIITILGMDELSEEDKLTVARARKIQRFLSQPFHVAEVFTGAAGKFVNLADTIAGFKGLVEGKYDDLPEAAFYMVGTIDE 464
>gi|162452720|ref|YP_001615087.1| F0F1 ATP synthase subunit beta [Sorangium cellulosum 'So ce 56'] >gi|189081348|sp|A9F3R4|ATPB_SORC5 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|161163302|emb|CAN94607.1| H(+)-transporting two-sector ATPase [Sorangium cellulosum 'So ce 56'] (474 aa)
Score = 1523, Expect = 9.7e-167, Identities = 301/452 (66%), Positives = 361/452 (79%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVKLPN----NKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEM-----IDGG-VINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           G I Q+ GPVVDV F   Q+P I + L++  P+       LVLEVA   G+   R I+M ST+GL RG+EV +T  PIM PVG+  LGR+ NVVG PID        + +PIH++PP F EQSTK E+FETGIKVIDL+ PY KGGKIGLFGGAGVGKTVL+ ELI+N+A  HGG+S+FAGVGERTREGNDL+ EM      DG  VI++ AL++GQMNEPPGAR RVAL+AL +AEHFR+   QDVLLF+DNIFRF+QAGSEVSALLGRIPSAVGYQPTL+ EMG  QERITST  GS+TSVQA+YVPADDLTDPAP+T FAHLDA TVL R I+ LGIYPA++PL+S+S MLDP IVG +HY VAR VQ  LQ++++LQDIIAILG+DELSE+DKL V+RARKI+ FLSQPFFVA +F+   GK V  +DTI+GF EI++GK D + EQ F  VGGI+DV
  S:     4 GKITQVIGPVVDVDFPAGQLPKILNALKLSNPSISAEPDNLVLEVAQHLGESSVRTIAMDSTDGLVRGMEVRDTGKPIMVPVGNECLGRILNVVGVPIDEAGPVHAKKVAPIHREPPPFIEQSTKVEVFETGIKVIDLIAPYRKGGKIGLFGGAGVGKTVLILELINNVAKAHGGVSVFAGVGERTREGNDLFLEMSESKLADGSPVISKAALIYGQMNEPPGARSRVALSALAVAEHFRDEEGQDVLLFVDNIFRFTQAGSEVSALLGRIPSAVGYQPTLSTEMGAFQERITSTTKGSVTSVQAIYVPADDLTDPAPATAFAHLDATTVLSRAISELGIYPAVDPLDSNSTMLDPQIVGEKHYSVARRVQQTLQRYKDLQDIIAILGMDELSEDDKLVVARARKIQKFLSQPFFVAAQFTGLEGKLVPLKDTIAGFEEILDGKLDHVAEQDFYLVGGIEDV 465
>gi|153811248|ref|ZP_01963916.1| hypothetical protein RUMOBE_01640 [Ruminococcus obeum ATCC 29174] >gi|149832746|gb|EDM87830.1| hypothetical protein RUMOBE_01640 [Ruminococcus obeum ATCC 29174] (463 aa)
Score = 1523, Expect = 9.8e-167, Identities = 305/453 (67%), Positives = 357/453 (78%)
  Q:   299 KGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           KG I Q+ GPVVDV F    +P+I D LEV+  N KK V+EV+   G+DV RCI + ++EGL R  EVI T + I  PVG   LGR+FNV+GE +D     +  E+  IH+ PPSF+EQ    EI ETGIKVIDLL PY KGGKIGLFGGAGVGKTVL+QELI NIAT HGG SIF GVGER+REGNDL+ EM + GV+ +TALVFGQMNEPPG+RMRVA T LTMAE+FR+   +DVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTLA EMG+LQERI ST SGS+TSVQAVYVPADDLTDPAP+TTFAHLDA TVL RKI   GIYPA++PLES+SR+L+  +VG EHY+VAR VQ ILQK++ELQDIIAILG++ELS+EDK TV RARKI+ FLSQPF VAE F+   GKYV  ++TI GF  II+G+ D+ PE  F  VG ID+V
  S:     3 KGKIVQVMGPVVDVVFEDGDLPDIKDALEVE-NNGKKCVMEVSQHLGNDVVRCIMLSASEGLQRDREVIATGSGIKVPVGDCTLGRLFNVLGETVDGGESLDDAEHWVIHRDPPSFEEQKPAVEILETGIKVIDLLAPYAKGGKIGLFGGAGVGKTVLIQELIQNIATEHGGYSIFTGVGERSREGNDLWSEMKESGVLKKTALVFGQMNEPPGSRMRVAETGLTMAEYFRDTEHRDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLATEMGELQERIASTTSGSVTSVQAVYVPADDLTDPAPATTFAHLDATTVLSRKIVEQGIYPAVDPLESTSRILEADVVGEEHYEVARRVQEILQKYKELQDIIAILGMEELSDEDKNTVFRARKIQKFLSQPFHVAENFTGIPGKYVPLKETIRGFKMIIDGEMDEYPENAFFNVGTIDEV 454
>gi|124806537|ref|XP_001350751.1| ATP synthase beta chain, mitochondrial precursor, putative [Plasmodium falciparum 3D7] >gi|23496878|gb|AAN36431.1|AE014849_50 ATP synthase beta chain, mitochondrial precursor, putative [Plasmodium falciparum 3D7] (535 aa)
Score = 1523, Expect = 1.0e-166, Identities = 312/485 (64%), Positives = 385/485 (79%)
  Q:   267 IKTNKSIVSDSHKIDIYEENEDLMKLNTLKSDK---GIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVI--------------NQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           ++ N   VS S  +++ ++N  +   NT  S+K   G I Q+ G VVDV+F  +  P+I + LEV+L +NKKL+LEVA   G+ V R I+M +T+GL RG EV ++ NPI  PVG   LGR+ NV+GEPID        +  PIH+ PP F +QST+  +  TGIKV+DL+ PY KGGKIGLFGGAGVGKTVL+ ELI+N+A  HGG S+FAGVGERTREGNDLYHEMI  GVI              ++ ALV+GQMNEPPGAR RVALT LT+AE+FR+   QDVLLFIDNI+RF+QAGSEVSALLGRIPSAVGYQPTLA ++G LQERIT+TK+GSITSVQAVYVPADDLTDPAP+TTF+HLDA TVL R IA LGIYPA++PL+S+SRML P IVG E Y+VAR+VQ ILQ ++ LQDIIAILGIDELSE+DKLTV+RARK++ FLSQPF VAE F+ K G++V  +DTI GFSE+++G CDD+PE  F  VGG+++V
  S:    25 LRMNCRYVSSSEHLNM-KKNISVGNKNTEVSNKIKIGKIAQVIGAVVDVEF-EDTPPSILNALEVEL-DNKKLILEVAQHLGNKVVRTIAMDATDGLVRGQEVKDSGNPICVPVGKETLGRIMNVIGEPIDECGHINHKKTLPIHRDPPLFTDQSTEPALLITGIKVVDLIAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKKHGGYSVFAGVGERTREGNDLYHEMITTGVIKKKKIGNNEFDFNGSKAALVYGQMNEPPGARARVALTGLTVAEYFRDEENQDVLLFIDNIYRFTQAGSEVSALLGRIPSAVGYQPTLATDLGALQERITTTKNGSITSVQAVYVPADDLTDPAPATTFSHLDATTVLSRSIAELGIYPAVDPLDSTSRMLTPDIVGAEQYQVARNVQQILQDYKSLQDIIAILGIDELSEQDKLTVARARKVQRFLSQPFAVAEVFTGKPGRFVELEDTIIGFSELLKGNCDDLPEMAFYMVGGLEEV 523
>gi|187777253|ref|ZP_02993726.1| hypothetical protein CLOSPO_00805 [Clostridium sporogenes ATCC 15579] >gi|187774181|gb|EDU37983.1| hypothetical protein CLOSPO_00805 [Clostridium sporogenes ATCC 15579] (462 aa)
Score = 1522, Expect = 1.2e-166, Identities = 306/441 (69%), Positives = 358/441 (81%)
  Q:   313 KFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHK 753
           KF    +P++ + LE+    +KK++ EV    GDD  R I+M STEGL RG+EV++T +P+  PVG  VLGR+FNV+G PID        E  PIH+  PSF+EQS + EIFETGIKVIDLL PY KGGKIGLFGGAGVGKTVL+QELI+NIA  HGGLS+F GVGERTREGNDLY+EM + GV+ +TALVFGQMNEPPGARMRVALT LTM+E+FR+   QDVLLFIDNIFRF+QAGSEVSALLGRIPSAVGYQPTLA EMG LQERITSTK+GSITSVQAVYVPADDLTDPAP+TTF HLDA TVL R IA LGIYPA++PLESSSRMLDP I+G EHY VA  V+ IL+++ ELQDIIAILGIDELSEEDKL V RAR+I+ FLSQPF VAE+F+   GKYV  ++T+ GF EI+EGK D+IPE  FL+ G +++V K
  S:    18 KFDSENLPDLFNALEIN-AGDKKVIAEVEQHIGDDTVRAIAMESTEGLRRGMEVLDTGSPVSVPVGKEVLGRLFNVLGNPIDEVGEFTSNESYPIHRSAPSFEEQSVEPEIFETGIKVIDLLAPYQKGGKIGLFGGAGVGKTVLIQELINNIAKEHGGLSVFTGVGERTREGNDLYYEMKESGVLEKTALVFGQMNEPPGARMRVALTGLTMSEYFRDQG-QDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGALQERITSTKNGSITSVQAVYVPADDLTDPAPATTFTHLDATTVLSRSIAELGIYPAVDPLESSSRMLDPRIIGEEHYDVAIKVKNILERYRELQDIIAILGIDELSEEDKLVVGRARRIQRFLSQPFTVAEQFTGMQGKYVPIKETVKGFKEILEGKHDNIPESAFLFQGTMEEVLK 456
>gi|160893773|ref|ZP_02074557.1| hypothetical protein CLOL250_01327 [Clostridium sp. L2-50] >gi|156864758|gb|EDO58189.1| hypothetical protein CLOL250_01327 [Clostridium sp. L2-50] (453 aa)
Score = 1522, Expect = 1.2e-166, Identities = 297/447 (66%), Positives = 358/447 (80%)
  Q:   307 GPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHK 753
           GPVVDV+F  N +PNI D LEV   + KK ++E A   G++  RCI + ++EGL R +EV+ T + I  PVG+  LGR+FNV G+ +D  P     E+  IH+ PPSF++QS   EI ETGIKVIDLL PY KGGKIGLFGGAGVGKTVL+QELI N+AT HGG SIF GVGER+REGNDL+ EM + GV+++TALVFGQMNEPPGARMRVA T LTMAE+FR+ N QDVLLFIDNIFRF QAGSEVS+LLGR+PSAVGYQPTLA E+G+LQERI STKSGS+TSVQAVYVPADDLTDPAP+TTFAHLDA TVL RKI   GIYPA++PLES+SR+L+  +VG EHY VAR VQ ILQK+ ELQDIIAILG++ELSEEDK+TV+RARK++ FLSQPF VAE F+   GKYV  ++T+ GF  I++G+ D+ PE  F  VGGI++V +
  S:     2 GPVVDVEFPDNDLPNIKDALEVD-NHGKKCIMEAAQHIGNNTVRCIMLAASEGLSRDMEVVPTGSGIKVPVGTDTLGRLFNVTGDTLDGGPNLADTEHWVIHRDPPSFEDQSPVVEILETGIKVIDLLAPYAKGGKIGLFGGAGVGKTVLIQELIQNVATEHGGYSIFTGVGERSREGNDLWTEMKESGVLSKTALVFGQMNEPPGARMRVAETGLTMAEYFRDVNHQDVLLFIDNIFRFVQAGSEVSSLLGRMPSAVGYQPTLANELGELQERIASTKSGSVTSVQAVYVPADDLTDPAPATTFAHLDATTVLSRKIVEQGIYPAVDPLESNSRILEVDVVGEEHYNVARGVQEILQKYRELQDIIAILGMEELSEEDKITVTRARKVQKFLSQPFHVAENFTGVPGKYVPLKETVKGFKAILDGEMDEYPEWAFFNVGGIEEVKE 447
>gi|146318826|ref|YP_001198538.1| F0F1 ATP synthase subunit beta [Streptococcus suis 05ZYH33] >gi|146321035|ref|YP_001200746.1| F0F1 ATP synthase subunit beta [Streptococcus suis 98HAH33] >gi|145689632|gb|ABP90138.1| F0F1-type ATP synthase, beta subunit [Streptococcus suis 05ZYH33] >gi|145691841|gb|ABP92346.1| F0F1-type ATP synthase, beta subunit [Streptococcus suis 98HAH33] (481 aa)
Score = 1522, Expect = 1.2e-166, Identities = 303/456 (66%), Positives = 364/456 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFA-RNQMPNINDCLEVKLPNN--KKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPID-NKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           +   G I Q+ GPVVDV FA  +++P IN+ L V   ++  +K+VLEVAL  GD V R I+M ST+GL RG+EV++T  PI  PVG   LGR+FNV+G+ ID  +  P   E  PIHKK P+FDE ST +EI ETGIKVIDLL PY+KGGK+GLFGGAGVGKTVL+QELIHNIA  HGG+S+F GVGERTREGNDLY EM + GVI +TA+VFGQMNEPPGARMRVALT LT+AE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMGQLQERITSTK GS+TS+QA+YVPADD TDPAP+T FAHLD+ T L+RK+  LGIYPA++PL SSSR L P IVG EHY VA  V+ +LQ+++ELQDIIAILG+DELS+E+K  V RAR+I+ FLSQ F VAE+F+   G YV   +T+ GF EI++GK D +PE  F  VG I+DV
  S:    13 RMSSGKITQVVGPVVDVAFAAEDKLPEINNALVVYKNDDSKQKVVLEVALELGDGVVRTIAMESTDGLTRGMEVLDTGRPISVPVGKETLGRVFNVLGDTIDLEESFPADFEREPIHKKAPAFDELSTSSEILETGIKVIDLLAPYLKGGKVGLFGGAGVGKTVLIQELIHNIAQEHGGISVFTGVGERTREGNDLYWEMKESGVIEKTAMVFGQMNEPPGARMRVALTGLTIAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGSVTSIQAIYVPADDYTDPAPATAFAHLDSTTNLERKLTQLGIYPAVDPLASSSRALAPQIVGEEHYAVAMEVKRVLQRYQELQDIIAILGMDELSDEEKTLVGRARRIQFFLSQNFNVAEQFTGMPGSYVPVAETVKGFKEILDGKHDHLPEDAFRNVGSIEDV 472
>gi|81096628|ref|ZP_00874965.1| ATP synthase F1, beta subunit [Streptococcus suis 89/1591] >gi|190358731|sp|A4W1V7|ATPB_STRS2 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|190358732|sp|A4VVJ9|ATPB_STRSY ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|80977307|gb|EAP40853.1| ATP synthase F1, beta subunit [Streptococcus suis 89/1591] (468 aa)
Score = 1522, Expect = 1.2e-166, Identities = 303/452 (67%), Positives = 363/452 (80%)
  Q:   300 GIIYQIFGPVVDVKFA-RNQMPNINDCLEVKLPNN--KKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPID-NKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           G I Q+ GPVVDV FA  +++P IN+ L V   ++  +K+VLEVAL  GD V R I+M ST+GL RG+EV++T  PI  PVG   LGR+FNV+G+ ID  +  P   E  PIHKK P+FDE ST +EI ETGIKVIDLL PY+KGGK+GLFGGAGVGKTVL+QELIHNIA  HGG+S+F GVGERTREGNDLY EM + GVI +TA+VFGQMNEPPGARMRVALT LT+AE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMGQLQERITSTK GS+TS+QA+YVPADD TDPAP+T FAHLD+ T L+RK+  LGIYPA++PL SSSR L P IVG EHY VA  V+ +LQ+++ELQDIIAILG+DELS+E+K  V RAR+I+ FLSQ F VAE+F+   G YV   +T+ GF EI++GK D +PE  F  VG I+DV
  S:     4 GKITQVVGPVVDVAFAAEDKLPEINNALVVYKNDDSKQKVVLEVALELGDGVVRTIAMESTDGLTRGMEVLDTGRPISVPVGKETLGRVFNVLGDTIDLEESFPADFEREPIHKKAPAFDELSTSSEILETGIKVIDLLAPYLKGGKVGLFGGAGVGKTVLIQELIHNIAQEHGGISVFTGVGERTREGNDLYWEMKESGVIEKTAMVFGQMNEPPGARMRVALTGLTIAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGSVTSIQAIYVPADDYTDPAPATAFAHLDSTTNLERKLTQLGIYPAVDPLASSSRALAPQIVGEEHYAVAMEVKRVLQRYQELQDIIAILGMDELSDEEKTLVGRARRIQFFLSQNFNVAEQFTGMPGSYVPVAETVKGFKEILDGKHDHLPEDAFRNVGSIEDV 459
>gi|22651730|gb|AAM26937.1| ATP synthase beta subunit [Drosera regia] (494 aa)
Score = 1522, Expect = 1.2e-166, Identities = 302/469 (64%), Positives = 364/469 (77%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHKNYVAANSNNKV 764
           K + G I QI GPV+D+ F   +MP I + L VK    L     +  EV  L G++  R ++M +T+GL RG++V++T   +  PVGSA LGR+FNV+GEPIDN    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+FAGVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ NKQDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPF VAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+  +  +     NK+
  S:    15 KKNLGRIIQIIGPVLDIAFPPGKMPYIYNALVVKGRDTLGQPINVTCEVQQLLGNNRVRAVAMSATDGLTRGMDVVDTGTALSVPVGSATLGRIFNVLGEPIDNLGPVDTRTTSPIHRSAPAFIQLETKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFAGVGERTREGNDLYKEMKESGVINEQNIPESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPKIVGDEHYETAQQVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFVVAEVFTGSPGKYVGLAETIRGFQLILSGELDGLPEQAFYLVGNIDEATEKAMNLEMENKL 494
>gi|167748908|ref|ZP_02421035.1| hypothetical protein ANACAC_03682 [Anaerostipes caccae DSM 14662] >gi|167651530|gb|EDR95659.1| hypothetical protein ANACAC_03682 [Anaerostipes caccae DSM 14662] (466 aa)
Score = 1522, Expect = 1.3e-166, Identities = 303/454 (66%), Positives = 358/454 (78%)
  Q:   298 DKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           +KG I Q+ GPVVDV+F    +P I D L V+L + KKLV+E A   G+++ RCI + S+EGL + +EV  T   I  PVG   LGRMFNV+G+ ID K   E  E   IH+ PP+F+EQS   EI ETGIKVIDLL PY KGGK+GLFGGAGVGKTVL+QELIHNIAT HGG SIF GVGER+REGNDL+ EM + GVI++TALVFGQMNEPPGARMRVA T LTMAE+FR+   Q+VLLFIDNIFR+ QAGSEVSALLGR+PSAVGYQPTLA E+G+LQERITSTK+GSITSVQAVYVPADDLTDPAP+TTFAHLDA TVL RKI   GIYPA++PLES+SR+L+  +VG EHY+VA  VQ +LQK++ELQDII+ILG++EL E+DKL V RARKI+ FLSQPF VAE F+   GKYV   +TI GF  II G+ D+ PE  F  VG ID+V
  S:     2 EKGKIVQVLGPVVDVEFDGGYLPLIKDALTVEL-DGKKLVMEAAQHMGNNIVRCILLASSEGLSKDMEVTATGAGITVPVGRQTLGRMFNVLGQNIDGKEQVEGEEQWVIHRDPPTFEEQSPVVEILETGIKVIDLLAPYAKGGKVGLFGGAGVGKTVLIQELIHNIATEHGGYSIFTGVGERSREGNDLWTEMNESGVIDKTALVFGQMNEPPGARMRVAQTGLTMAEYFRDREHQNVLLFIDNIFRYVQAGSEVSALLGRMPSAVGYQPTLANEVGELQERITSTKNGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSRKIVEQGIYPAVDPLESTSRILEAEVVGEEHYEVAMQVQELLQKYKELQDIISILGMEELDEDDKLAVYRARKIQKFLSQPFHVAENFTGMKGKYVPVSETIRGFKAIISGEMDEYPENAFFMVGTIDEV 454
>gi|84683667|ref|ZP_01011570.1| ATP synthase subunit B [Rhodobacterales bacterium HTCC2654] >gi|84668410|gb|EAQ14877.1| ATP synthase subunit B [Rhodobacterales bacterium HTCC2654] (474 aa)
Score = 1522, Expect = 1.3e-166, Identities = 299/457 (65%), Positives = 363/457 (79%)
  Q:   295 LKSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVI-------NQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           + + KG + Q+ G VVDV+F  + +P I + LE    N  +LVLEVA   G++  R I+M +TEGL RG EV +T  PI  PVG+A LGR+ NV G+P+D K   E  EY PIH   P FDEQ+T+ EI  TGIKVIDLL PY KGGKIGLFGGAGVGKTVL+QELI+NIA  H GLS+FAGVGERTREGNDLYHEMI+ GV+       ++ ALV+GQMNEPPGAR R+ALT LT+AE FR+    DVL F+DNIFRF+QAGSE+SALLGRIPSAVGYQPTLA +MG +QERITSTK+GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL+R I+ LGIYPA++PL+S+SR++DP ++G EHYKVAR VQ ILQ+++ LQDIIAILG+DELSEEDKLTV+RARKI+ FLSQPF VA+ F+   G  V  +DTI  F  +++G+ D +PE  F  VGGID+V
  S:     1 MANAKGKVTQVIGAVVDVQF-EDHLPAILNALETD-NNGNRLVLEVAQHLGENTVRTIAMDATEGLVRGHEVADTGKPISVPVGTATLGRILNVTGDPVDEKGPIEADEYRPIHADAPDFDEQATEAEILVTGIKVIDLLAPYSKGGKIGLFGGAGVGKTVLIQELINNIAKVHSGLSVFAGVGERTREGNDLYHEMIESGVLTPDNLPDSKIALVYGQMNEPPGARARIALTGLTLAEQFRDATGTDVLFFVDNIFRFTQAGSEMSALLGRIPSAVGYQPTLATDMGAMQERITSTKNGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLNRAISELGIYPAVDPLDSTSRLMDPLVIGDEHYKVARDVQGILQRYKSLQDIIAILGMDELSEEDKLTVARARKIQRFLSQPFDVAKVFTGSDGVQVPLEDTIKSFRAVVDGEYDHLPEGAFYMVGGIDEV 462
>gi|154503952|ref|ZP_02041012.1| hypothetical protein RUMGNA_01778 [Ruminococcus gnavus ATCC 29149] >gi|153795379|gb|EDN77799.1| hypothetical protein RUMGNA_01778 [Ruminococcus gnavus ATCC 29149] (464 aa)
Score = 1521, Expect = 1.4e-166, Identities = 304/454 (66%), Positives = 358/454 (78%)
  Q:   298 DKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           +KG I Q+ GPVVDV F    +P I D LEV+  N KK ++EVA   G++  RC+ + ++EGL++ +EV  T   I  PVG   LGR+FNV+GE IDN    E  E   IH++PP+F++QS   EI ETGIKVIDLL PY KGGKIGLFGGAGVGKTVL+QELI NIAT HGG SIF GVGER+REGNDL+ EM + GV+ +TALVFGQMNEPPGARMRVA T LTMAE+FR+   Q+VLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMG+LQERI STK+GS+TSVQAVYVPADDLTDPAP+TTFAHLDA TVL RKI   GIYPA++PLESSSR+L+  +VG EHY+VA  V  ILQK++ELQDIIAILG++ELS+EDK TV RARKI+ FLSQPFFVAE F+   GKYV  ++TI GF  II+G+ D  PE  F  VG IDDV
  S:     2 NKGRIVQVMGPVVDVVFEDGNLPYIKDALEVE-NNGKKCIMEVAQHLGNNEVRCLMLAASEGLHKDMEVTATGAGIKVPVGEKTLGRLFNVLGETIDNGEQIEDAEKWVIHREPPTFEDQSPVVEILETGIKVIDLLAPYAKGGKIGLFGGAGVGKTVLIQELIRNIATEHGGYSIFTGVGERSREGNDLWSEMKESGVLEKTALVFGQMNEPPGARMRVAETGLTMAEYFRDEQHQNVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGELQERIASTKNGSVTSVQAVYVPADDLTDPAPATTFAHLDATTVLSRKIVEQGIYPAVDPLESSSRILEADVVGEEHYEVANKVIAILQKYKELQDIIAILGMEELSDEDKATVMRARKIQRFLSQPFFVAETFTGIPGKYVPLKETIRGFKMIIDGEMDAYPESAFFNVGTIDDV 454
>gi|37522139|ref|NP_925516.1| F0F1 ATP synthase subunit beta [Gloeobacter violaceus PCC 7421] >gi|81709449|sp|Q7NHG7|ATPB_GLOVI ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|35213139|dbj|BAC90511.1| ATP synthase beta subunit [Gloeobacter violaceus PCC 7421] (478 aa)
Score = 1521, Expect = 1.7e-166, Identities = 296/459 (64%), Positives = 357/459 (77%)
  Q:   292 LNTLKSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK----KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           + T   + G I QI GPVVD +F    +P I + L ++   +     +L  EV  L GD   R +SM +T+G+ RG++ I+T  PI  PVG + LGR+FNV+GEPID     E V+   IH+  P F +  T+ EIFETGIKVIDLL PY KGGKIGLFGGAGVGKTVL+QELIHNIA  H G+S+F GVGERTREGNDLY+E  +  V+ Q ALV+GQMNEPPGARMRV LTALTMAE+FR+ +KQDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL  EMG LQERITST  GSITSVQAVYVPADDLTDPAP+TTFAHLDA TVL R++ASLGIYPA++PL S+S ML P++VG EHY +AR VQ+ LQ++++LQDIIAILG+DELS EDKL V+RARK++ FLSQPF VAE F+   GKYVS   TI+GF  +++G+ DD+PEQ F  VG +D+
  S:     2 VTTTAKNVGYITQIIGPVVDAEFPEGDLPAIYNALLIEGKTDSGLDIRLTCEVQQLLGDKKVRAVSMSTTDGMVRGMKAIDTGAPITVPVGKSTLGRIFNVLGEPIDELGPVEIVDKFSIHRSAPKFTDLVTQPEIFETGIKVIDLLAPYRKGGKIGLFGGAGVGKTVLIQELIHNIAKEHSGVSVFGGVGERTREGNDLYNEFKESNVLGQVALVYGQMNEPPGARMRVGLTALTMAEYFRDVSKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLGTEMGDLQERITSTNEGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSRQLASLGIYPAVDPLSSTSTMLQPAVVGEEHYNIARGVQSTLQRYKDLQDIIAILGLDELSPEDKLVVNRARKLQRFLSQPFHVAEIFTGSPGKYVSLDKTIAGFKRVLQGEFDDLPEQAFYLVGDLDE 464
>gi|163814609|ref|ZP_02205998.1| hypothetical protein COPEUT_00760 [Coprococcus eutactus ATCC 27759] >gi|158450244|gb|EDP27239.1| hypothetical protein COPEUT_00760 [Coprococcus eutactus ATCC 27759] (453 aa)
Score = 1521, Expect = 1.8e-166, Identities = 304/447 (68%), Positives = 361/447 (80%)
  Q:   307 GPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHK 753
           GPVVDV+F  N +P I D LEV   + KK V+EVA   G++  RCI + ++EGL R +EV+ T + I  PVG+  LGR+FNV+GE ID K      E+  IH++PP+F+ QS   EI ETGIKVIDLL PY KGGKIGLFGGAGVGKTVL+QELI NIA+ HGG SIF GVGER+REGNDL+ EM + GVI++TALVFGQMNEPPGARMRVA T LTMAE+FR+ N QDVLLFIDNIFRF+QAGSEVS+LLGR+PSAVGYQPTLA EMG+LQERI STK GS+TSVQAVYVPADDLTDPAP+TTFAHLDA TVL RKI   GIYPA++PLESSSR+L+  IVG EHY+VAR VQ ILQK++ELQDIIAILG++ELS+EDKLTV+RARK++ FLSQPF VAE F+   GKYVS +DTI GF  I++G+ D+ PE  F  VG I++V +
  S:     2 GPVVDVEFPDNDLPYIKDALEVD-NHGKKCVMEVAQHVGNNTVRCIMLSASEGLSRDMEVVATGSGIKVPVGNQTLGRLFNVLGETIDGKEDLSDTEHWVIHREPPTFENQSPVIEILETGIKVIDLLAPYSKGGKIGLFGGAGVGKTVLIQELIQNIASVHGGYSIFTGVGERSREGNDLWTEMSESGVIDKTALVFGQMNEPPGARMRVAETGLTMAEYFRDVNHQDVLLFIDNIFRFTQAGSEVSSLLGRMPSAVGYQPTLANEMGELQERIASTKEGSVTSVQAVYVPADDLTDPAPATTFAHLDANTVLSRKIVEQGIYPAVDPLESSSRILEADIVGEEHYEVARRVQEILQKYKELQDIIAILGMEELSDEDKLTVTRARKVQKFLSQPFHVAENFTGIPGKYVSLKDTIKGFKMIVDGEMDEYPEWAFFNVGTIEEVKE 447
>gi|153940743|ref|YP_001389519.1| F0F1 ATP synthase subunit beta [Clostridium botulinum F str. Langeland] >gi|170756277|ref|YP_001779784.1| ATP synthase F1, beta subunit [Clostridium botulinum B1 str. Okra] >gi|190358657|sp|B1IE34|ATPB_CLOBK ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|190358658|sp|A7G9Q9|ATPB_CLOBL ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|152936639|gb|ABS42137.1| ATP synthase F1, beta subunit [Clostridium botulinum F str. Langeland] >gi|169121489|gb|ACA45325.1| ATP synthase F1, beta subunit [Clostridium botulinum B1 str. Okra] (463 aa)
Score = 1520, Expect = 2.2e-166, Identities = 305/441 (69%), Positives = 356/441 (80%)
  Q:   313 KFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHK 753
           KF    +P++ + LE+    ++K++ EV    GDD  R I+M  TEGL RG+E ++T   +  PVG  VLGR+FNV+G+PID        E  PIH+  PSF+EQS + EIFETGIKVIDLL PY KGGKIGLFGGAGVGKTVL+QELI+NIA  HGGLS+F GVGERTREGNDLY+EM + GV+ +TALVFGQMNEPPGARMRVALT LTM+E+FR+   QDVLLFIDNIFRF+QAGSEVSALLGRIPSAVGYQPTLA EMG LQERITSTK+GSITSVQAVYVPADDLTDPAP+TTFAHLDA TVL R I  LGIYPA++PLESSSRMLDP I+G EHY+VA  V+ IL+++ ELQDIIAILGIDELSEEDKL V RARKI+ FLSQPF VAE+F+   GKYV  ++T+ GF EI+EGK D+IPE  FL+ G I+DV K
  S:    18 KFDSENLPDLFNALEIN-AGDRKVIAEVEQHIGDDTIRAIAMEDTEGLKRGMEALDTGKSVSVPVGKEVLGRLFNVLGKPIDGAGEFTSEESYPIHRPAPSFEEQSVEPEIFETGIKVIDLLAPYQKGGKIGLFGGAGVGKTVLIQELINNIAKEHGGLSVFTGVGERTREGNDLYYEMKESGVLEKTALVFGQMNEPPGARMRVALTGLTMSEYFRDQG-QDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGALQERITSTKNGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSRAITELGIYPAVDPLESSSRMLDPRIIGEEHYEVAIKVKNILERYRELQDIIAILGIDELSEEDKLVVGRARKIQRFLSQPFTVAEQFTGMQGKYVPIKETVRGFKEILEGKHDNIPESAFLFQGTIEDVLK 456
>gi|159045474|ref|YP_001534268.1| F0F1 ATP synthase subunit beta [Dinoroseobacter shibae DFL 12] >gi|190358233|sp|A8LJR4|ATPB2_DINSH ATP synthase subunit beta 2 (ATPase subunit beta 2) (ATP synthase F1 sector subunit beta 2) >gi|157913234|gb|ABV94667.1| ATP synthase F1, beta subunit [Dinoroseobacter shibae DFL 12] (474 aa)
Score = 1520, Expect = 2.3e-166, Identities = 306/457 (66%), Positives = 360/457 (78%)
  Q:   295 LKSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVI-------NQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           + + KG + Q+ G VVDV+F  + +P I + L  +  N KKLVLEVA   G++  R I+M +TEGL RG EV +T  PI  PVG+A LGR+ NV+GEPID K   E  E   IH+  P F EQST +EI  TGIKVIDLL PY KGGKIGLFGGAGVGKTVL+ ELI+NIA  H G S+FAGVGERTREGNDLYHEMI+  VI       +Q ALV+GQMNEPPGAR RVALT LT+AE FR+ +  DVL F+DNIFRF+QAGSEVSALLGRIPSAVGYQPTLA +MGQ+QERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R I+ LGIYPA++PL+SSSR+LDP IVG EHY+VAR VQ ILQ+++ LQDIIAILG+DELSEEDKLTV+RARKI+ FLSQPF VA+ F+   G  V  +DTIS F  ++ G+ D +PE  F  VGGID+V
  S:     1 MANAKGKVTQVIGAVVDVQF-EDTLPEILNALNTE-NNGKKLVLEVAQHLGENTVRTIAMDATEGLVRGAEVTDTGGPITIPVGNATLGRIMNVIGEPIDEKGPVEASESRAIHQPAPEFSEQSTGSEILVTGIKVIDLLAPYSKGGKIGLFGGAGVGKTVLIMELINNIAKVHSGYSVFAGVGERTREGNDLYHEMIESNVIKPDNLSESQVALVYGQMNEPPGARARVALTGLTLAEQFRDQSGTDVLFFVDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGQMQERITSTKGGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRAISELGIYPAVDPLDSSSRILDPGIVGEEHYQVARDVQGILQRYKSLQDIIAILGMDELSEEDKLTVARARKIQRFLSQPFDVAKVFTGSDGVQVPIEDTISSFKAVVAGEYDHLPEGAFYMVGGIDEV 462
>gi|170759729|ref|YP_001785485.1| ATP synthase F1, beta subunit [Clostridium botulinum A3 str. Loch Maree] >gi|190358659|sp|B1KSS8|ATPB_CLOBM ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|169406718|gb|ACA55129.1| ATP synthase F1, beta subunit [Clostridium botulinum A3 str. Loch Maree] (463 aa)
Score = 1519, Expect = 3.0e-166, Identities = 305/441 (69%), Positives = 356/441 (80%)
  Q:   313 KFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHK 753
           KF    +P++ + LE+    ++K++ EV    GDD  R I+M  TEGL RG+E ++T   +  PVG  VLGR+FNV+G+PID        E  PIH+  PSF+EQS + EIFETGIKVIDLL PY KGGKIGLFGGAGVGKTVL+QELI+NIA  HGGLS+F GVGERTREGNDLY+EM + GV+ +TALVFGQMNEPPGARMRVALT LTM+E+FR+   QDVLLFIDNIFRF+QAGSEVSALLGRIPSAVGYQPTLA EMG LQERITSTK+GSITSVQAVYVPADDLTDPAP+TTFAHLDA TVL R I  LGIYPA++PLESSSRMLDP I+G EHY+VA  V+ IL+++ ELQDIIAILGIDELSEEDKL V RARKI+ FLSQPF VAE+F+   GKYV  ++T+ GF EI+EGK D+IPE  FL+ G I+DV K
  S:    18 KFDSENLPDLFNALEIN-AGDRKVIAEVEQHIGDDTIRAIAMEDTEGLKRGMEALDTGKSVSVPVGKEVLGRLFNVLGKPIDGAGEFISEESYPIHRSAPSFEEQSVEPEIFETGIKVIDLLAPYQKGGKIGLFGGAGVGKTVLIQELINNIAKEHGGLSVFTGVGERTREGNDLYYEMKESGVLEKTALVFGQMNEPPGARMRVALTGLTMSEYFRDQG-QDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGALQERITSTKNGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSRSITELGIYPAVDPLESSSRMLDPRIIGEEHYEVAIKVKNILERYRELQDIIAILGIDELSEEDKLVVGRARKIQRFLSQPFTVAEQFTGMQGKYVPIKETVRGFKEILEGKHDNIPESAFLFQGTIEDVLK 456
>gi|186684534|ref|YP_001867730.1| ATP synthase F1, beta subunit [Nostoc punctiforme PCC 73102] >gi|186466986|gb|ACC82787.1| ATP synthase F1, beta subunit [Nostoc punctiforme PCC 73102] (482 aa)
Score = 1518, Expect = 3.2e-166, Identities = 300/455 (65%), Positives = 364/455 (80%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK----KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYS-PIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVIN-------QTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K++ G I QI GPVVDVKF   ++P I + L++   N       + +EV  L GD+  R ++M STEGL RG EV +T  PI  PVG A LGR+FNV+GEP+DN+  P   E S PIH+  P F +  TK  +FETGIKV+DLL PY +GGKIGLFGGAGVGKTV++ ELI+NIAT HGG+S+FAGVGERTREGNDLY+EMI+ GVIN       + ALV+GQMNEPPGARMRV L+ LT+AE+FR+ NKQDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL  ++G+LQERITST  GSITS+QAVYVPADDLTDPAP+TTFAHLD  TVL R +A+ GIYPA++PL S+S ML P+IVG EHY  AR+VQ+ LQ+++ELQDIIAILG+DELSEED+L V+RARK+  FLSQPFFVAE F+   GKYV  +DTI GF +I+ G+ D +PEQ F  VG I++
  S:     7 KTNIGYITQIIGPVVDVKFPGGKLPQIYNALKIVGTNESGQEINITVEVQQLLGDNQVRTVAMSSTEGLVRGFEVTDTGAPITVPVGKATLGRIFNVLGEPVDNRG-PVNAEASLPIHRSAPKFTDLETKPSVFETGIKVVDLLTPYRRGGKIGLFGGAGVGKTVIMMELINNIATQHGGVSVFAGVGERTREGNDLYNEMIESGVINNENLNESKIALVYGQMNEPPGARMRVGLSGLTVAEYFRDVNKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLGTDVGELQERITSTTEGSITSIQAVYVPADDLTDPAPATTFAHLDGTTVLSRGLAAKGIYPAVDPLGSTSTMLQPNIVGDEHYNTARAVQSTLQRYKELQDIIAILGLDELSEEDRLIVARARKVERFLSQPFFVAEVFTGSPGKYVKLEDTIKGFQKILSGELDALPEQAFYLVGDINE 472
>gi|148378162|ref|YP_001252703.1| ATP synthase F1, beta subunit [Clostridium botulinum A str. ATCC 3502] >gi|153930870|ref|YP_001382563.1| F0F1 ATP synthase subunit beta [Clostridium botulinum A str. ATCC 19397] >gi|153935797|ref|YP_001386115.1| F0F1 ATP synthase subunit beta [Clostridium botulinum A str. Hall] >gi|168177489|ref|ZP_02612153.1| ATP synthase F1, beta subunit [Clostridium botulinum NCTC 2916] >gi|168182234|ref|ZP_02616898.1| ATP synthase F1, beta subunit [Clostridium botulinum Bf] >gi|190358654|sp|A7FQH9|ATPB_CLOB1 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|190358656|sp|A5HY52|ATPB_CLOBH ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|148287646|emb|CAL81711.1| ATP synthase beta chain [Clostridium botulinum A str. ATCC 3502] >gi|152926914|gb|ABS32414.1| ATP synthase F1, beta subunit [Clostridium botulinum A str. ATCC 19397] >gi|152931711|gb|ABS37210.1| ATP synthase F1, beta subunit [Clostridium botulinum A str. Hall] >gi|182671405|gb|EDT83379.1| ATP synthase F1, beta subunit [Clostridium botulinum NCTC 2916] >gi|182674532|gb|EDT86493.1| ATP synthase F1, beta subunit [Clostridium botulinum Bf] (463 aa)
Score = 1518, Expect = 3.6e-166, Identities = 305/441 (69%), Positives = 356/441 (80%)
  Q:   313 KFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHK 753
           KF    +P++ + LE+    ++K++ EV    GDD  R I+M  TEGL RG+E ++T   +  PVG  VLGR+FNV+G+PID        E  PIH+  PSF+EQS + EIFETGIKVIDLL PY KGGKIGLFGGAGVGKTVL+QELI+NIA  HGGLS+F GVGERTREGNDLY+EM + GV+ +TALVFGQMNEPPGARMRVALT LTM+E+FR+   QDVLLFIDNIFRF+QAGSEVSALLGRIPSAVGYQPTLA EMG LQERITSTK+GSITSVQAVYVPADDLTDPAP+TTFAHLDA TVL R I  LGIYPA++PLESSSRMLDP I+G EHY+VA  V+ IL+++ ELQDIIAILGIDELSEEDKL V RARKI+ FLSQPF VAE+F+   GKYV  ++T+ GF EI+EGK D+IPE  FL+ G I+DV K
  S:    18 KFDSENLPDLFNALEIN-AGDRKVIAEVEQHIGDDTIRAIAMEDTEGLKRGMEALDTGKSVSVPVGKEVLGRLFNVLGKPIDGAGEFISEESYPIHRPAPSFEEQSVEPEIFETGIKVIDLLAPYQKGGKIGLFGGAGVGKTVLIQELINNIAKEHGGLSVFTGVGERTREGNDLYYEMKESGVLEKTALVFGQMNEPPGARMRVALTGLTMSEYFRDQG-QDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGALQERITSTKNGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSRSITELGIYPAVDPLESSSRMLDPRIIGEEHYEVAIKVKNILERYRELQDIIAILGIDELSEEDKLVVGRARKIQRFLSQPFTVAEQFTGMQGKYVPIKETVRGFKEILEGKHDNIPESAFLFQGTIEDVLK 456
>gi|190358736|sp|Q04G20|ATPB_OENOB ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) (466 aa)
Score = 1518, Expect = 3.8e-166, Identities = 291/451 (64%), Positives = 365/451 (80%)
  Q:   299 KGIIYQIFGPVVDVKFARNQ-MPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDN-KPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGID 749
           +G + Q+ GP+VDV+F  N+ +P+IN+ L+V+  +  +L +EV++  GD V R I+M ST+GL RG++V++T  PI  PVG A LGR+FNV+GEP+D   P+P  V+  PIH+  P +DE +T TE+ ETGIKVIDLL PY++GGK GLFGGAGVGKTVL+QELIHNIA GH G+S+F GVGERTREGND+Y+EM   GV+  TA+V+GQMNEPPGARMRV LT LTMAE FR+   +DVLLFIDNIFRF+QAGSEVSALLGRIPSAVGYQPTLA EMGQLQERITSTK GS+TS+QAVYVPADD TDPAP+TTFAHLDA T L+R +   GIYPA++PLES+S  L P IVG +HY+VA  VQ  LQ+++ELQDII+ILG+DELS+E+K  V+RAR+I+ FLSQPF VAE+F+   G+YV  +DT+ GF EI++GK DD+PE+ F  VG I+
  S:     3 EGTVLQVIGPIVDVQFPDNKKLPDINNALKVQRIDGSELTIEVSIDLGDSVVRTIAMDSTDGLTRGMKVLDTGAPIEVPVGEATLGRVFNVLGEPVDGGDPIPNSVDRHPIHRSAPKYDELATSTEVLETGIKVIDLLEPYLRGGKTGLFGGAGVGKTVLIQELIHNIAQGHNGISVFTGVGERTREGNDMYYEMKASGVLKNTAMVYGQMNEPPGARMRVGLTGLTMAEDFRDQEGKDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGQLQERITSTKKGSVTSIQAVYVPADDYTDPAPATTFAHLDATTNLERSLTQQGIYPAVDPLESTSSALTPDIVGEDHYEVATQVQHFLQRYKELQDIISILGMDELSDEEKTIVNRARRIQFFLSQPFSVAEQFTGVPGQYVPVEDTVRGFKEILDGKHDDLPEEAFRNVGTIE 455
>gi|156095717|ref|XP_001613893.1| ATP synthase beta chain, mitochondrial precursor, putative [Plasmodium vivax SaI-1] >gi|148802767|gb|EDL44166.1| ATP synthase beta chain, mitochondrial precursor, putative [Plasmodium vivax] (547 aa)
Score = 1518, Expect = 3.9e-166, Identities = 298/464 (64%), Positives = 370/464 (79%)
  Q:   293 NTLKSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVI--------------NQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHKNYV 756
           N   +  G I Q+ G VVDV+F  +  P+I + LE +L  +KK++LEVA   G+ V R I+M +T+GL RG +V+++  PI  PVG   LGR+ NV+GEPID     +  +  PIH++PP F +QST+  +  TGIKV+DL+ PY KGGKIGLFGGAGVGKTVL+ ELI+N+A  HGG S+FAGVGERTREGNDLYHEMI  GVI              ++ ALV+GQMNEPPGAR RVALT LT+AE+FR+   QDVLLF+DNI+RF+QAGSEVSALLGRIPSAVGYQPTL+ ++G LQERIT+TK+GSITSVQAVYVPADDLTDPAP+TTF+HLDA TVL R IA LGIYPA++PL+S+SRML P IVG E Y+VAR+VQ ILQ ++ LQDIIAILGIDELSE+DKLTV+RARK++ FLSQPF VAE F+ K G++V  +DTI GFSE+++G CDD+PE  F  VGG+++V    V
  S:    65 NKCSNKMGKISQVIGAVVDVEF-EDTPPSILNALETEL-EDKKIILEVAQHLGNKVVRTIAMDATDGLVRGQKVLDSGKPISVPVGKETLGRIMNVIGEPIDECGDIKCTKMLPIHREPPLFTDQSTEPALLITGIKVVDLIAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKKHGGYSVFAGVGERTREGNDLYHEMITTGVIKKKKIGNGQYDFNGSKAALVYGQMNEPPGARARVALTGLTVAEYFRDEENQDVLLFVDNIYRFTQAGSEVSALLGRIPSAVGYQPTLSTDLGALQERITTTKNGSITSVQAVYVPADDLTDPAPATTFSHLDATTVLSRSIAELGIYPAVDPLDSTSRMLTPDIVGAEQYEVARNVQQILQDYKSLQDIIAILGIDELSEQDKLTVARARKVQRFLSQPFAVAEVFTGKPGRFVELEDTIKGFSELLKGNCDDLPEMAFYMVGGLEEVRSKAV 540
>gi|82793401|ref|XP_728025.1| ATP synthase F1subunit beta [Plasmodium yoelii yoelii str. 17XNL] >gi|23484166|gb|EAA19590.1| ATP synthase F1, beta subunit [Plasmodium yoelii yoelii] (533 aa)
Score = 1517, Expect = 5.0e-166, Identities = 302/452 (66%), Positives = 367/452 (81%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVI--------------NQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           G I Q+ G VVDV F +N  P I + LEV+L +NKKL+LEVA   G+ V R I+M +T+GL RG +VI+   PI  PVG   LGR+ NV+GEPID     +  +  PIH+ PP F +QST+  +  TGIKV+DL+ PY KGGKIGLFGGAGVGKTVL+ ELI+N+A  HGG S+FAGVGERTREGNDLYHEM+  GVI              ++ ALV+GQMNEPPGAR RVALT LT+AE+FR+   QDVLLF+DNI+RF+QAGSEVSALLGRIPSAVGYQPTLA ++G LQERIT+TK+GSITSVQAVYVPADDLTDPAP+TTF+HLDA TVL R IA LGIYPA++PL+S+SRML P IVGIE Y+VAR++Q ILQ ++ LQDIIAILGIDELSE+DKLTV+RARK++ FLSQPF VAE F+ K G++V  +DTI GFSE+++G CDD+PE  F  VGG+D+V
  S:    59 GKISQVIGAVVDVXF-QNTPPAILNALEVEL-DNKKLILEVAQHLGNKVVRTIAMDATDGLIRGQDVIDCGIPISVPVGKETLGRIMNVIGEPIDECGDIKSKKLLPIHRDPPLFTDQSTEPALLITGIKVVDLIAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKKHGGYSVFAGVGERTREGNDLYHEMLTTGVIKKKKIKDNEYDFSGSKAALVYGQMNEPPGARARVALTGLTVAEYFRDEENQDVLLFVDNIYRFTQAGSEVSALLGRIPSAVGYQPTLATDLGALQERITTTKNGSITSVQAVYVPADDLTDPAPATTFSHLDATTVLSRSIAELGIYPAVDPLDSTSRMLTPDIVGIEQYEVARNIQQILQDYKSLQDIIAILGIDELSEQDKLTVARARKVQRFLSQPFAVAEVFTGKPGRFVELEDTIKGFSELLKGNCDDLPEMAFYMVGGLDEV 522
>gi|86609936|ref|YP_478698.1| F0F1 ATP synthase subunit beta [Synechococcus sp. JA-2-3B'a(2-13)] >gi|118573768|sp|Q2JIV9|ATPB_SYNJB ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|86558478|gb|ABD03435.1| ATP synthase F1, beta subunit [Synechococcus sp. JA-2-3B'a(2-13)] (477 aa)
Score = 1516, Expect = 5.2e-166, Identities = 294/454 (64%), Positives = 356/454 (78%)
  Q:   297 SDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKL----VLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           ++ G I Q+ GPV+D +F   ++P I + L+V+      L      EV  L GD+  R ++M ST+GL RG+ V++T  PI  PVG   LGR+FNV+GEP+D     +  E++PIH+  P   + + K E FETGIKVIDLL P+ KGGK+GLFGGAGVGKTVL+QELIHNIA  H GLS+FAGVGERTREGNDLY+EM + GV+++ ALV+GQMNEPPGARMRV LTALTMAE+FR+ NKQDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTLA EMG LQERITSTK GSITSVQAVYVPADDLTDPAP+TTFAHLD+  VL R +A+ GIYPA++PL+SSS +L   IVG EHY  AR+V+  LQ+++ELQDIIAILG+DELSEEDKL V+RAR+I  FLSQPFFVAE F+   GKYV   DTI GF  I+ G+ D++PEQ F  VG I++
  S:     9 TNVGYITQVIGPVIDAEFPSGKLPEIYNALKVEGTTESGLKVNVTFEVQQLLGDNRVRAVAMSSTDGLVRGMPVVDTGAPITVPVGQPTLGRIFNVLGEPVDQGEPVQAQEFAPIHRSAPPLVDLTIKPEPFETGIKVIDLLAPFKKGGKVGLFGGAGVGKTVLIQELIHNIAEEHSGLSVFAGVGERTREGNDLYNEMKESGVLDKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLATEMGNLQERITSTKQGSITSVQAVYVPADDLTDPAPATTFAHLDSTVVLSRSLAAKGIYPAVDPLDSSSTILQADIVGEEHYNTARAVKQTLQRYKELQDIIAILGLDELSEEDKLVVARARRIERFLSQPFFVAEVFTGSPGKYVKLADTIKGFQRILSGELDNLPEQAFYLVGTIEE 466
>gi|170077372|ref|YP_001734010.1| ATP synthase beta chain [Synechococcus sp. PCC 7002] >gi|169885041|gb|ACA98754.1| ATP synthase beta chain [Synechococcus sp. PCC 7002] (483 aa)
Score = 1516, Expect = 5.5e-166, Identities = 296/451 (65%), Positives = 359/451 (79%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVKLPN----NKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVIN-------QTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           G I QI GPV+D +F   +MP I + L+++  N       L  EV  L GD+  R ++M ST+GL RG+++++T  PI  PVG   LGR+FNV+GEP+D K      E SPIH+  P   E  T   +FETGIKV+DLL PY +GGKIGLFGGAGVGKTV++ ELI+NIAT HGG+S+FAGVGERTREGNDLY+EMI+ GVIN       + ALV+GQMNEPPGARMRV L+ LTMAE+FR+ NKQDVLLF+DNIFRF QAGSEVSALLGR+PSAVGYQPTL  ++G LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLD  TVL R +AS GIYPA++PL+S+S ML PSIVG +HY  AR+VQ+ LQ+++ELQDIIAILG+DELSEED+LTV RARKI  FLSQPFFVAE F+   GKYV+ ++TI GF  I+ G+ DD+PEQ F  VG I++
  S:    10 GKITQIIGPVIDAEFPSGKMPRIYNALKIQGKNPYGQEINLTCEVQQLLGDNQVRAVAMSSTDGLVRGMDILDTGAPISVPVGKKTLGRIFNVLGEPVDEKGEVGAEETSPIHRPAPKLTELDTAPSVFETGIKVVDLLTPYRRGGKIGLFGGAGVGKTVIMMELINNIATNHGGVSVFAGVGERTREGNDLYNEMIESGVINPDNLNDSKIALVYGQMNEPPGARMRVGLSGLTMAEYFRDVNKQDVLLFVDNIFRFVQAGSEVSALLGRMPSAVGYQPTLGTDVGDLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDGTTVLSRALASKGIYPAVDPLDSTSTMLQPSIVGEDHYNTARAVQSTLQRYKELQDIIAILGLDELSEEDRLTVDRARKIERFLSQPFFVAEVFTGSPGKYVTLEETIEGFKRILSGELDDLPEQAFYLVGNIEE 471
>gi|170017975|ref|YP_001728894.1| ATP synthase F1, beta subunit [Leuconostoc citreum KM20] >gi|169804832|gb|ACA83450.1| ATP synthase F1, beta subunit [Leuconostoc citreum KM20] (466 aa)
Score = 1516, Expect = 6.3e-166, Identities = 292/452 (64%), Positives = 361/452 (79%)
  Q:   300 GIIYQIFGPVVDVKF-ARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNK-PMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           G + Q+ GPVVDV F +  Q+P+IN+ L++   + + L +EV+L  GD + R I+M ST+GL RG+ V +T + I  PVG A LGR+FNV+GEP+DN   +  +     IH+  PS+D+ +  TEI ETGIKVIDLL PYV+GGKIGLFGGAGVGKTVL+QELIHNIA GH G+S+F GVGERTREGND+YHEM + GV+ QTA+V+GQMNEPPGARMRVALT LTMAE+FR++  +DVLLFIDNIFRF+QAGSEVSALLGRIPSAVGYQPTLA EMGQLQERITSTK GS+TS+QAVYVPADD TDPAP+TTFAHLDA T L+R +   GIYPA++PL S+S  LDP +VG EHY+VA  VQ  LQ++ ELQDII+ILG+DELS+E+K TV+RAR+I+ FLSQPF VAE F+  +G+YV   +T+  F EI++GK DD+PE  F  VG I+ V
  S:     4 GKVVQVIGPVVDVAFESGQQVPDINNALKIDKGDGQTLTVEVSLALGDGIVRTIAMDSTDGLQRGMSVTDTGDAIKVPVGEATLGRVFNVLGEPVDNNGEIAAETPRHSIHRDAPSYDDLANSTEILETGIKVIDLLAPYVRGGKIGLFGGAGVGKTVLIQELIHNIAQGHNGISVFTGVGERTREGNDMYHEMAESGVLKQTAMVYGQMNEPPGARMRVALTGLTMAENFRDSEGKDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGQLQERITSTKKGSVTSIQAVYVPADDYTDPAPATTFAHLDATTNLERALTQQGIYPAVDPLASTSSALDPQVVGQEHYEVATEVQRTLQRYRELQDIISILGMDELSDEEKTTVNRARRIQFFLSQPFSVAETFTGINGEYVPVAETVRSFKEILDGKYDDLPEDAFRNVGAIEQV 457
>gi|28378938|ref|NP_785830.1| F0F1 ATP synthase subunit beta [Lactobacillus plantarum WCFS1] >gi|81840957|sp|Q88UU3|ATPB_LACPL ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|28271775|emb|CAD64681.1| H(+)-transporting two-sector ATPase, beta subunit [Lactobacillus plantarum WCFS1] (467 aa)
Score = 1516, Expect = 6.5e-166, Identities = 300/452 (66%), Positives = 359/452 (79%)
  Q:   300 GIIYQIFGPVVDVKFARN-QMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKP-MPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           G + Q+ GPVVDV+F+ N ++P+IN+ L ++  N+  L +EV+L  GD V R ++M  T+GL RG+ V +T + I  PVG   LGR+FNV+GE ID  P      E +PIH+  P +DE +T TE+ ETGIKVIDLL PYV+GGKIGLFGGAGVGKTVL+QELIHNIA  H G+S+F GVGERTREGNDLY EM   GV+  TA+V+GQMNEPPGARMRVALT LT+AE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGRIPSAVGYQPTLA EMGQLQERITSTK GS+TS+QAVYVPADD TDPAP+TTFAHLDA T L+R +   GIYPA++PL SSS  LDPSIVG EHY+VA  VQ +LQ++ ELQDII+ILG+DELS+E+K TV+RAR+I+ FLSQ FFVAE F+ + G YV   DTI GF EI+EGK DD+PE  F  VG IDDV
  S:     4 GKVVQVIGPVVDVEFSLNDKLPDINNALIIQKDNDDTLTVEVSLELGDGVVRTVAMDGTDGLRRGMTVEDTGSSITVPVGKETLGRVFNVLGETIDGGPEFGPDAERNPIHRDAPKYDELTTSTEVLETGIKVIDLLAPYVRGGKIGLFGGAGVGKTVLIQELIHNIAQEHNGISVFTGVGERTREGNDLYFEMKASGVLKNTAMVYGQMNEPPGARMRVALTGLTIAEYFRDVQGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGQLQERITSTKKGSVTSIQAVYVPADDYTDPAPATTFAHLDATTNLERSLTEQGIYPAVDPLASSSIALDPSIVGEEHYQVATEVQRVLQRYRELQDIISILGMDELSDEEKTTVARARRIQFFLSQNFFVAENFTGQPGSYVPINDTIKGFKEILEGKYDDLPEDAFRQVGKIDDV 457
>gi|29377093|ref|NP_816247.1| F0F1 ATP synthase subunit beta [Enterococcus faecalis V583] >gi|81436390|sp|Q831A5|ATPB_ENTFA ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|29344559|gb|AAO82317.1| ATP synthase F1, beta subunit [Enterococcus faecalis V583] (468 aa)
Score = 1514, Expect = 8.9e-166, Identities = 305/451 (67%), Positives = 363/451 (80%)
  Q:   300 GIIYQIFGPVVDVKFARNQ-MPNINDCLEV--KLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPID-NKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           G I Q+ GPVVDV+F+ +Q +P+IN+ L V       +K+VLEVAL  GD V R I+M ST+GL RG+EVI+T   I  PVG   LGR+FNV+G+ ID   P P   E S IHKK P+FDE ST  EI ETGIKVIDLL PY+KGGK+GLFGGAGVGKTVL+QELIHNIA  HGG+S+F GVGERTREGNDLY+EM D GVI +TA+VFGQMNEPPGARMRVALT LT+AE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMGQLQERITSTK GSITS+QA+YVPADD TDPAP+T FAHLDA T L+RK+   GIYPA++PL SSS  L P IVG EHY+VA  VQ ILQ++ ELQDIIAILG+DELS+++K+ V RAR+++ FLSQ F VAE+F+ + G YV   +T+ GF EI+EGK D++PE+ F  VG I+D
  S:     4 GKIVQVIGPVVDVEFSLDQSLPDINNALVVYKNGEAKQKVVLEVALELGDGVIRSIAMESTDGLQRGMEVIDTGKSISVPVGKDTLGRVFNVLGDTIDLEAPFPADAERSGIHKKAPAFDELSTSNEILETGIKVIDLLAPYLKGGKVGLFGGAGVGKTVLIQELIHNIAQEHGGISVFTGVGERTREGNDLYYEMKDSGVIEKTAMVFGQMNEPPGARMRVALTGLTIAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGSITSIQAIYVPADDYTDPAPATAFAHLDATTNLERKLTEQGIYPAVDPLASSSSALAPEIVGEEHYEVATEVQHILQRYRELQDIIAILGMDELSDDEKVLVGRARRVQFFLSQNFNVAEQFTGQPGSYVPVAETVRGFKEILEGKHDNLPEEAFRSVGKIED 458
>gi|169826600|ref|YP_001696758.1| ATP synthase subunit beta [Lysinibacillus sphaericus C3-41] >gi|168991088|gb|ACA38628.1| ATP synthase subunit beta [Lysinibacillus sphaericus C3-41] (471 aa)
Score = 1514, Expect = 9.0e-166, Identities = 298/454 (65%), Positives = 358/454 (78%)
  Q:   298 DKGIIYQIFGPVVDVKFARNQMPNINDCLEVKL--PNNKK--LVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPID-NKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           +KG + Q+ GPVVDVKF   Q+P I + L VK+  PN +   L LEVAL  GDD  R I+M ST+GL RG EV ++   I  PVG   LGR+FNV+GE ID  + +P       IH++ P+F+E ST  EI ETGIKV+DLL PY+KGGKIGLFGGAGVGKTVL+QELI+NIA  H G+S+FAGVGERTREGNDL+ EM D GVI QTA+VFGQMNEPPGARMRVALT LTMAE+FR+    DVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMG+LQERITST  GS+TS+QA+YVPADD TDPAP+TTFAHLDA T L+RK++ +GIYPA++PL S+SR L P IVG EHY VA  VQ  +Q++ ELQDIIAILG+DELS+EDK TV RAR+I+ FLSQ F VAE+F+ + G YV  ++T+  F EI++GK D +PE  F  VG ID+V
  S:     2 NKGHVIQVMGPVVDVKFDNGQLPAIYNSLTVKIERPNEEPTILALEVALHLGDDSVRTIAMSSTDGLQRGAEVTDSGKAISVPVGEVTLGRVFNVLGEVIDLGEEIPADARRDSIHREAPTFEELSTTVEILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELINNIAQEHSGISVFAGVGERTREGNDLFFEMSDSGVIKQTAMVFGQMNEPPGARMRVALTGLTMAEYFRDEQGADVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGKLQERITSTNKGSVTSIQAIYVPADDYTDPAPATTFAHLDATTNLERKLSEMGIYPAVDPLASTSRALSPEIVGAEHYAVATGVQRTIQRYRELQDIIAILGMDELSDEDKQTVERARRIQFFLSQNFHVAEQFTGQKGSYVPVKETVRSFKEILDGKWDHLPEDAFRLVGSIDEV 460
>gi|148543702|ref|YP_001271072.1| F0F1 ATP synthase subunit beta [Lactobacillus reuteri F275] >gi|184153112|ref|YP_001841453.1| ATP synthase beta subunit [Lactobacillus reuteri F275] >gi|194468265|ref|ZP_03074251.1| ATP synthase F1, beta subunit [Lactobacillus reuteri 100-23] >gi|166990370|sp|A5VIR1|ATPB_LACRF ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|148530736|gb|ABQ82735.1| ATP synthase F1, beta subunit [Lactobacillus reuteri F275] >gi|183224456|dbj|BAG24973.1| ATP synthase beta subunit [Lactobacillus reuteri F275] >gi|194453118|gb|EDX42016.1| ATP synthase F1, beta subunit [Lactobacillus reuteri 100-23] (475 aa)
Score = 1514, Expect = 1.1e-165, Identities = 298/452 (65%), Positives = 360/452 (79%)
  Q:   300 GIIYQIFGPVVDVKFARNQ-MPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKP-MPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           G + Q+ GPVVDV+F  ++ +P IND L++K  + K L  EVAL  GD V R I+M  T+GL RG+EV NT   I  PVG   LGR+FNV+GEP+DN P      +  PIH+  P +D+ +  TEI ETGIKVIDLL PYV+GGKIGLFGGAGVGKTVL+QELIHNIA GH G+S+F GVGERTREGND+Y+EM   GV+ +TA+V+GQMNEPPGARMRVALT LT+AE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGRIPSAVGYQPTLA EMGQLQERITSTK GSITS+QAVYVPADD TDPAP+TTFAHLDA T L+R++  +GIYPA++PL S+S  L P IVG EHY+VA  VQ +LQ++ ELQDII+ILG+DELS+E+K  V+RAR+I+NFLSQ F VA +F+   GKYV  ++TI GF EI+ GK DD+PE+ F  VG I+DV
  S:     4 GKVLQVIGPVVDVEFPLDEKLPEINDALKIKESDGKTLTTEVALELGDGVVRTIAMDGTDGLQRGMEVENTGASISVPVGDDTLGRVFNVLGEPVDNGPKFGPDAKRMPIHRDAPKYDDLNNATEILETGIKVIDLLAPYVRGGKIGLFGGAGVGKTVLIQELIHNIAQGHNGISVFTGVGERTREGNDMYYEMKASGVLEKTAMVYGQMNEPPGARMRVALTGLTIAEYFRDVKGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGQLQERITSTKKGSITSIQAVYVPADDYTDPAPATTFAHLDATTNLERRLTQIGIYPAVDPLASTSTALTPEIVGKEHYEVATQVQHVLQRYHELQDIISILGMDELSDEEKTIVARARRIQNFLSQSFSVASQFTGLPGKYVPLKETIKGFKEILAGKYDDLPEEAFRLVGPIEDV 457
>gi|157964051|ref|YP_001504085.1| F0F1 ATP synthase subunit beta [Shewanella pealeana ATCC 700345] >gi|189081346|sp|A8HAG3|ATPB_SHEPA ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|157849051|gb|ABV89550.1| ATP synthase F1, beta subunit [Shewanella pealeana ATCC 700345] (458 aa)
Score = 1514, Expect = 1.1e-165, Identities = 295/451 (65%), Positives = 363/451 (80%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNK-PMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           G + Q+ G VVDV+F  + +P + D LE+K   ++ LVLEV    G  V R I+MGS++GL RGLEV+N+ +PI  PVGSA LGR+ NV+GEP+D   P+ E+  Y  IH++ PS+++QS  TE+ ETGIKVIDL+ P+ KGGK+GLFGGAGVGKTV + ELI+NIA  H GLS+FAGVGERTREGND Y+EM D GV+++ A+V+GQMNEPPG R+RVALT LTMAE FR+  K DVL F+DNI+R++ AG+EVSALLGR+PSAVGYQPTLA EMG LQERITSTK+GSITSVQAVYVPADDLTDP+P+TTFAHLDA  VL R IASLGIYPA++PL+S+SR LDP +VG EHY VA  VQT+LQ+++EL+DIIAILG+DELS+EDK TV RARKI  +LSQPFFVAE F+   GKYVS +DTI GF  I+EG+ D +PEQ F  VG ID+
  S:     4 GTVVQVIGAVVDVEFPHDAVPQVYDALEIK---SEGLVLEVQQQLGGGVVRTIAMGSSDGLRRGLEVVNSGSPITVPVGSATLGRIMNVLGEPVDEAGPIGEEDRYV-IHREAPSYEDQSNTTELLETGIKVIDLVCPFAKGGKVGLFGGAGVGKTVNMMELINNIAKAHSGLSVFAGVGERTREGNDFYYEMEDSGVLDKVAMVYGQMNEPPGNRLRVALTGLTMAEKFRDEGK-DVLFFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSRNIASLGIYPAVDPLDSTSRQLDPQVVGQEHYDVANGVQTVLQRYKELKDIIAILGMDELSDEDKTTVFRARKIEKYLSQPFFVAEVFTGSPGKYVSLKDTIRGFKGILEGEFDHLPEQAFYMVGSIDE 450
>gi|32265928|ref|NP_859960.1| F0F1 ATP synthase subunit beta [Helicobacter hepaticus ATCC 51449] >gi|81835987|sp|Q7VJ21|ATPB_HELHP ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|32261977|gb|AAP77026.1| FoF1-type ATP synthase [Helicobacter hepaticus ATCC 51449] (466 aa)
Score = 1513, Expect = 1.2e-165, Identities = 299/452 (66%), Positives = 363/452 (80%)
  Q:   299 KGIIYQIFGPVVDVKFARNQMPNINDCLEVKLP---NNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDN-KPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           +G I Q+ GPVVDV+F+ + +P IN+ ++V          LVLEVA   GD+  R I+M  TEGL RG EV     PI  PVG AVLGR+FNV G+ ID  KP+   +++ PIH++ PSF+ QST+TE+FETGIKV+DL+ PY KGGK+GLFGGAGVGKTV++ ELIHN+A  H G S+FAGVGERTREGNDLYHEM +GGV+++ AL +GQMNEPPGAR R+A T LTMAE+FR+    DVL+FIDNIFR++Q+GSE+SALLGRIPSAVGYQPTLA EMG+LQERITSTK GSITSVQAVYVPADDLTDPAP++ FAHLDA TVLDRKI+  GIYPA++PL S+SR+LDP IVG EH+KVA  VQ +LQK+++LQDIIAILG+DELSEEDK  V+RARKI  FLSQPFFVAE F+   GKYV+ ++T+ GF  I+EGK DDIPE  F  VG I +
  S:     2 QGKITQVMGPVVDVEFS-SYLPMINEAIDVNFDIEGRKNNLVLEVAAHLGDNRVRTIAMDMTEGLIRGQEVKARGKPIEVPVGEAVLGRIFNVTGDVIDGGKPLESDLKW-PIHREAPSFENQSTRTEMFETGIKVVDLIAPYSKGGKVGLFGGAGVGKTVVIMELIHNVAYKHSGYSVFAGVGERTREGNDLYHEMKEGGVLDKVALCYGQMNEPPGARNRIAFTGLTMAEYFRDEKGLDVLMFIDNIFRYAQSGSEMSALLGRIPSAVGYQPTLAGEMGKLQERITSTKKGSITSVQAVYVPADDLTDPAPASVFAHLDATTVLDRKISEKGIYPAVDPLGSTSRILDPQIVGEEHHKVATGVQQVLQKYKDLQDIIAILGMDELSEEDKQVVARARKIERFLSQPFFVAEIFTGSPGKYVTLEETLEGFKGILEGKYDDIPENAFYLVGNIQE 455
>gi|163789448|ref|ZP_02183887.1| F0F1 ATP synthase subunit beta [Carnobacterium sp. AT7] >gi|159875302|gb|EDP69367.1| F0F1 ATP synthase subunit beta [Carnobacterium sp. AT7] (468 aa)
Score = 1513, Expect = 1.3e-165, Identities = 303/452 (67%), Positives = 357/452 (78%)
  Q:   300 GIIYQIFGPVVDVKFARNQ-MPNINDCL--EVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNK-PMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           G I Q+ GPVVDV+F  N  MP IN+ L  E     N+ +VLE ALL G+ V R I+M ST+GL RG+ VI+T+  I  PVG   LGRMFNV+GE ID K P PE  +  PIH+  P+FDE S+ T I ETGIKVIDLL PY+KGGKIGLFGGAGVGKTVL+QELIHNIA  HGG+S+F GVGERTREGNDLY EM + GVI +TA+VFGQMNEPPGARMRVALT LT+AE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMGQLQERITST  GSITS+QA+YVPADD TDPAP+T FAHLDA T L+RK+   GIYPA++PL S+S  L P IVG EHYKVA  VQ +LQ++ ELQDIIAILG+DELS ++K+ VSRAR+I+ FLSQ F VAE F+   G YV  ++T+ GF EII+G+ D +PE  F  VG I++V
  S:     4 GHIVQVIGPVVDVEFPINDTMPEINNALIVEKNKSKNQTVVLETALLLGNGVIRTIAMESTDGLQRGMSVIDTEKSISVPVGEETLGRMFNVLGETIDQKEPFPEDAKRLPIHRNAPTFDELSSNTAILETGIKVIDLLAPYLKGGKIGLFGGAGVGKTVLIQELIHNIAEEHGGISVFTGVGERTREGNDLYFEMQESGVIKRTAMVFGQMNEPPGARMRVALTGLTIAEYFRDEVGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTSKGSITSIQAIYVPADDYTDPAPATVFAHLDATTNLERKLTEQGIYPAVDPLASTSSALSPEIVGEEHYKVATEVQQLLQRYRELQDIIAILGMDELSADEKIIVSRARRIQFFLSQNFHVAEAFTGLPGSYVPVEETVRGFKEIIDGRYDHLPEDAFRNVGRIEEV 459
>gi|126653441|ref|ZP_01725537.1| F0F1 ATP synthase subunit beta [Bacillus sp. B14905] >gi|126589797|gb|EAZ83930.1| F0F1 ATP synthase subunit beta [Bacillus sp. B14905] (471 aa)
Score = 1513, Expect = 1.5e-165, Identities = 297/454 (65%), Positives = 358/454 (78%)
  Q:   298 DKGIIYQIFGPVVDVKFARNQMPNINDCLEVKL--PNNKK--LVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPID-NKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           +KG + Q+ GPVVDVKF   Q+P I + L VK+  PN +   L LEVAL  GDD  R I+M ST+GL RG EV ++   I  PVG   LGR+FNV+GE ID  + +P       IH++ P+F+E ST  EI ETGIKV+DLL PY+KGGKIGLFGGAGVGKTVL+QELI+NIA  H G+S+FAGVGERTREGNDL+ EM D GVI QTA+VFGQMNEPPGARMRVALT LTMAE+FR+    DVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMG+LQERITST  GS+TS+QA+YVPADD TDPAP+TTFAHLDA T L+RK++ +GIYPA++PL S+SR L P IVG EHY +A  VQ  +Q++ ELQDIIAILG+DELS+EDK TV RAR+I+ FLSQ F VAE+F+ + G YV  ++T+  F EI++GK D +PE  F  VG ID+V
  S:     2 NKGHVIQVMGPVVDVKFNNGQLPAIYNSLTVKIERPNEEPTILALEVALHLGDDSVRTIAMSSTDGLQRGAEVTDSGKAISVPVGEVTLGRVFNVLGEVIDLGEEIPADARRDSIHREAPTFEELSTTVEILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELINNIAQEHSGISVFAGVGERTREGNDLFFEMSDSGVIKQTAMVFGQMNEPPGARMRVALTGLTMAEYFRDEQGADVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGKLQERITSTNKGSVTSIQAIYVPADDYTDPAPATTFAHLDATTNLERKLSEMGIYPAVDPLASTSRALSPEIVGAEHYAIATGVQRTIQRYRELQDIIAILGMDELSDEDKQTVERARRIQFFLSQNFHVAEQFTGQKGSYVPVKETVRSFKEILDGKWDHLPEDAFRLVGSIDEV 460
>gi|15791495|ref|NP_281318.1| F0F1 ATP synthase subunit beta [Campylobacter jejuni subsp. jejuni NCTC 11168] >gi|57237114|ref|YP_178126.1| F0F1 ATP synthase subunit beta [Campylobacter jejuni RM1221] >gi|86149745|ref|ZP_01067975.1| ATP synthase F1, beta subunit [Campylobacter jejuni subsp. jejuni CF93-6] >gi|86151230|ref|ZP_01069445.1| ATP synthase F1, beta subunit [Campylobacter jejuni subsp. jejuni 260.94] >gi|86154037|ref|ZP_01072238.1| ATP synthase F1, beta subunit [Campylobacter jejuni subsp. jejuni HB93-13] >gi|88597713|ref|ZP_01100946.1| ATP synthase F1, beta subunit [Campylobacter jejuni subsp. jejuni 84-25] >gi|121613266|ref|YP_999831.1| F0F1 ATP synthase subunit beta [Campylobacter jejuni subsp. jejuni 81-176] >gi|148926907|ref|ZP_01810585.1| ATP synthase F1 sector beta subunit [Campylobacter jejuni subsp. jejuni CG8486] >gi|157414420|ref|YP_001481676.1| F0F1 ATP synthase subunit beta [Campylobacter jejuni subsp. jejuni 81116] >gi|167004802|ref|ZP_02270560.1| ATP synthase F1 sector beta subunit [Campylobacter jejuni subsp. jejuni 81-176] >gi|122953061|sp|Q0PC30|ATPB_CAMJE ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|190358271|sp|A8FJR2|ATPB_CAMJ8 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|190358273|sp|A1VXJ0|ATPB_CAMJJ ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|81819580|sp|Q5HX59|ATPB_CAMJR ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|57165918|gb|AAW34697.1| ATP synthase F1, beta subunit [Campylobacter jejuni RM1221] >gi|85840013|gb|EAQ57272.1| ATP synthase F1, beta subunit [Campylobacter jejuni subsp. jejuni CF93-6] >gi|85841577|gb|EAQ58824.1| ATP synthase F1, beta subunit [Campylobacter jejuni subsp. jejuni 260.94] >gi|85842451|gb|EAQ59665.1| ATP synthase F1, beta subunit [Campylobacter jejuni subsp. jejuni HB93-13] >gi|87248948|gb|EAQ71910.1| ATP synthase F1, beta subunit [Campylobacter jejuni subsp. jejuni 81-176] >gi|88190017|gb|EAQ93993.1| ATP synthase F1, beta subunit [Campylobacter jejuni subsp. jejuni 84-25] >gi|112359494|emb|CAL34278.1| ATP synthase F1 sector beta subunit [Campylobacter jejuni subsp. jejuni NCTC 11168] >gi|145844484|gb|EDK21592.1| ATP synthase F1 sector beta subunit [Campylobacter jejuni subsp. jejuni CG8486] >gi|157385384|gb|ABV51699.1| ATP synthase F1 sector beta subunit [Campylobacter jejuni subsp. jejuni 81116] (465 aa)
Score = 1512, Expect = 1.7e-165, Identities = 299/452 (66%), Positives = 358/452 (79%)
  Q:   299 KGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPN---NKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           +G I Q+ GPVVDV F  + +P IN+ + V   +     KLVLEVA   GD+  R I+M  T+GL RGL+      PI  PVG  VLGR+FNV G+ ID        +   IH+ PP+F++QSTK+EIFETGIKV+DLL PY KGGK+GLFGGAGVGKTV++ ELIHN+A  H G S+FAGVGERTREGNDLY+EM +  V+++ AL +GQMNEPPGAR R+ALT LTMAE+FR+    DVL+FIDNIFRFSQ+GSE+SALLGRIPSAVGYQPTLA EMG+ QERITSTK GSITSVQAVYVPADDLTDPAP+T FAHLDA TVL+R IA  GIYPA++PL+S+SRMLDP+I+G EHYKVAR VQ++LQK+++LQDIIAILG+DELSEEDKL V RARKI  FLSQPFFVAE F+   GKY+S +DTI+GF  I+EGK D +PE  F  VG ID+
  S:     2 QGFISQVLGPVVDVDF-NDYLPQINEAIVVNFESEGKKHKLVLEVAAHLGDNRVRTIAMDMTDGLVRGLKAEALGAPISVPVGEKVLGRIFNVTGDLIDEGEEISFDKKWAIHRDPPAFEDQSTKSEIFETGIKVVDLLAPYAKGGKVGLFGGAGVGKTVIIMELIHNVAFKHSGYSVFAGVGERTREGNDLYNEMKESNVLDKVALCYGQMNEPPGARNRIALTGLTMAEYFRDEMGLDVLMFIDNIFRFSQSGSEMSALLGRIPSAVGYQPTLASEMGKFQERITSTKKGSITSVQAVYVPADDLTDPAPATVFAHLDATTVLNRAIAEKGIYPAVDPLDSTSRMLDPNIIGEEHYKVARGVQSVLQKYKDLQDIIAILGMDELSEEDKLVVERARKIEKFLSQPFFVAEVFTGSPGKYISLEDTIAGFKGILEGKYDHLPENAFYMVGNIDE 455
>gi|110602257|ref|ZP_01390383.1| ATP synthase F1, beta subunit [Geobacter sp. FRC-32] >gi|110547034|gb|EAT60334.1| ATP synthase F1, beta subunit [Geobacter sp. FRC-32] (470 aa)
Score = 1509, Expect = 3.4e-165, Identities = 298/456 (65%), Positives = 362/456 (79%)
  Q:   295 LKSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLP----NNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNK-PMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           +  + G I Q+ G V+DV+F   ++P I + L V  P    N   LVLEVA   G++  R I+M ST+GL RG  V++T   I  PVG   LGR+ NV+GEP+D   P+    EY  IH++ P F +QSTK E F TGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG S+FAGVGERTREGNDL+ EM + GV+++ ALV+GQMNEPPGAR RVAL+AL++AE+FR+   Q+VLLFIDNIFRF+QAGSEVSALLGRIPSAVGYQPTLA EMG+LQERITST  GSITSVQA+YVPADDLTDPAP+T FAHLDA TVL R+IA LGIYPA++PL+S+SR+LDP ++G EHY +AR VQ +LQK+++LQDIIAILG+DELSEEDKL V+RARKI+ FLSQPF VAE F+   GKYV  +DTI GF EI++GK DDIPEQ F  VG I++
  S:     1 MSQNIGKISQVIGAVIDVEFEPGKLPPIYNALRVTNPAIDDNENNLVLEVAQHLGENSVRTIAMDSTDGLVRGQAVLDTGKQISVPVGRKTLGRILNVIGEPVDEMGPVNADKEYG-IHREAPEFVDQSTKVEAFTTGIKVVDLLAPYARGGKIGLFGGAGVGKTVLIMELINNIAKQHGGFSVFAGVGERTREGNDLWMEMKESGVLDKAALVYGQMNEPPGARARVALSALSIAEYFRDEEGQNVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGELQERITSTNKGSITSVQAIYVPADDLTDPAPATAFAHLDATTVLSRQIAELGIYPAVDPLDSTSRILDPQVIGEEHYAIARQVQYVLQKYKDLQDIIAILGMDELSEEDKLVVARARKIQRFLSQPFHVAEAFTGSPGKYVELKDTIKGFKEIVDGKHDDIPEQAFYMVGTIEE 460
>gi|134300981|ref|YP_001114477.1| F0F1 ATP synthase subunit beta [Desulfotomaculum reducens MI-1] >gi|190358666|sp|A4J999|ATPB_DESRM ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|134053681|gb|ABO51652.1| ATP synthase F1, beta subunit [Desulfotomaculum reducens MI-1] (472 aa)
Score = 1508, Expect = 5.1e-165, Identities = 285/442 (64%), Positives = 356/442 (80%)
  Q:   313 KFARNQMPNINDCLEVKLPNNK------KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHKN 754
           +FA  Q+P+I   ++++  + +       L LEVA   G++  RCI+M STEGL RG++V++T   I  PVG  VLGR+ NV+GE  D     +  +Y PIH+  P+  +QSTK E+ ETGIKVIDL++P++KGGKIGLFGGAGVGKTV+V ELI+NIA  HGG+S+FAGVGERTREGNDLYHEM + GV+ +T +VFGQMNEPPGAR+RV LT LTMAE FR+    D LLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMGQLQERITST+ GS+TSVQA+YVPADDLTDPAP+  FAHLDA  VL R I+ LGIYPA++PL+S+SR+LDP +VG EHY+ AR VQ++LQ+++ELQDIIAILG+DELS+EDKLTV+RARK++ FLSQPF VAE F+ + GKYVS +DTI  F+EI+ GK D +PEQ F   G I++V +N
  S:    17 EFAPGQVPDIYSAVKIRTEDQEDKSTKWNLTLEVAQHLGNNRVRCIAMSSTEGLKRGMKVVSTGKAISVPVGRPVLGRLLNVLGEEADGLEPIKAEKYYPIHRPAPALVDQSTKAEMLETGIKVIDLMIPFLKGGKIGLFGGAGVGKTVIVMELINNIAKQHGGISVFAGVGERTREGNDLYHEMKEAGVLEKTIMVFGQMNEPPGARLRVGLTGLTMAEFFRDEEGADTLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTRKGSVTSVQAIYVPADDLTDPAPANAFAHLDATVVLSRAISELGIYPAVDPLDSTSRILDPQVVGKEHYECARGVQSVLQRYKELQDIIAILGMDELSDEDKLTVARARKLQRFLSQPFHVAETFTGRPGKYVSLKDTIRSFNEILAGKHDALPEQAFYMAGAIEEVMEN 464
>gi|116629873|ref|YP_815045.1| F0F1 ATP synthase subunit beta [Lactobacillus gasseri ATCC 33323] >gi|122273189|sp|Q042L5|ATPB_LACGA ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|116095455|gb|ABJ60607.1| F0F1-type ATP synthase, beta subunit [Lactobacillus gasseri ATCC 33323] (480 aa)
Score = 1507, Expect = 6.4e-165, Identities = 304/455 (66%), Positives = 364/455 (80%)
  Q:   299 KGIIYQIFGPVVDVKFARNQ-MPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKP-MPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHK 753
           KG I Q+ GPVVDV+F  ++ +P+IN+ L V   N   LVLEV L  GD V R ISM ST+GL RG+EV +T  PI  PVG   LGR+FNV+G+PID  P + + V+   IHK+ P +DE ST  EI ETGIKVIDLL PYV+GGK+GLFGGAGVGKT ++QELIHNIA  HGG+S+F GVGERTREGNDLY EM   GV+++TA+VFGQMNEPPGARMRVALT LT+AE+FR+    DVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMGQLQERITSTK GSITS+QAVYVPADD TDPAP+TTFAHLDA T L+R++   GIYPA++PLES+S  LDP +VG EHY+VA  VQ ILQ+++ELQDII++LG+DELS+++KL V RARKI+ FLSQ FFVAE+F+   G YV  ++TI GF  II+GK DD+PE  F  VG I+DV K
  S:     3 KGEIVQVIGPVVDVEFPLDKDLPDINNALRVTNNNGDTLVLEVTLELGDGVLRTISMESTDGLRRGMEVEDTGAPISVPVGKDTLGRVFNVLGDPIDGGPALGKDVKREGIHKEAPKYDELSTSEEILETGIKVIDLLEPYVRGGKVGLFGGAGVGKTTIIQELIHNIAQEHGGISVFTGVGERTREGNDLYFEMKASGVLSKTAMVFGQMNEPPGARMRVALTGLTIAEYFRDVEGLDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGSITSIQAVYVPADDYTDPAPATTFAHLDATTNLERRLVEQGIYPAVDPLESTSSALDPEVVGEEHYQVAVQVQHILQRYQELQDIISVLGMDELSDDEKLIVERARKIQFFLSQNFFVAEQFTGLPGSYVPIKETIKGFKMIIDGKLDDLPEDAFRNVGPIEDVVK 459
>gi|34556938|ref|NP_906753.1| F0F1 ATP synthase subunit beta [Wolinella succinogenes DSM 1740] >gi|1168583|sp|P42470|ATPB_WOLSU ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|587588|emb|CAA54207.1| ATPase beta-subunit [Wolinella succinogenes] >gi|34482653|emb|CAE09653.1| ATP SYNTHASE F1 SECTOR BETA SUBUNIT [Wolinella succinogenes] (467 aa)
Score = 1506, Expect = 8.3e-165, Identities = 299/453 (66%), Positives = 361/453 (79%)
  Q:   299 KGIIYQIFGPVVDVKFARNQMPNINDCLEVKLP---NNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDN-KPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           +G I Q+ GPVVDV F  + +P IN+ L+V      + KKLVLEVA   GD   R I+M  TEGL RG +V+     I  PVG  VLGR+FNVVG+ ID    + E V++S IH+  P+F+ QSTKTE+FETGIKV+DLL PY KGGK+GLFGGAGVGKTV++ ELIHN+A  H G S+FAGVGERTREGNDLYHEM + GV+++ AL +GQMNEPPGAR R+A T LTMAE+FR+    DVL+FIDNIFR++Q+G+E+SALLGRIPSAVGYQPTLA EMG+LQERITSTK GSITSVQAVYVPADDLTDPAP++ FAHLDA TVL+RKIA  GIYPA++PL+S+SR+LDP +VG +HYK A  VQ +LQK+++LQDIIAILG+DELSEEDK  V RAR+I  FLSQPFFVAE F+   GKYV+ Q+T+ GF  I+EGK D IPE  F  VGGID+V
  S:     2 EGRITQVMGPVVDVDF-DSYLPAINEALDVNYDIEGHPKKLVLEVAAHIGDSRVRTIAMDMTEGLTRGTKVVARGKSIEVPVGEQVLGRIFNVVGDVIDGGDELKEPVKWS-IHRTAPTFENQSTKTEMFETGIKVVDLLAPYSKGGKVGLFGGAGVGKTVVIMELIHNVAFKHSGYSVFAGVGERTREGNDLYHEMKESGVLDKVALCYGQMNEPPGARNRIAFTGLTMAEYFRDEKGLDVLMFIDNIFRYAQSGAEMSALLGRIPSAVGYQPTLASEMGKLQERITSTKKGSITSVQAVYVPADDLTDPAPASVFAHLDATTVLNRKIAEKGIYPAVDPLDSTSRILDPQVVGEDHYKTATGVQQVLQKYKDLQDIIAILGMDELSEEDKRVVERARRIEKFLSQPFFVAEVFTGSPGKYVTLQETLEGFKGILEGKYDQIPENAFYMVGGIDEV 456
>gi|57505327|ref|ZP_00371256.1| ATP synthase F1, beta subunit [Campylobacter upsaliensis RM3195] >gi|57016463|gb|EAL53248.1| ATP synthase F1, beta subunit [Campylobacter upsaliensis RM3195] (484 aa)
Score = 1506, Expect = 9.4e-165, Identities = 298/452 (65%), Positives = 360/452 (79%)
  Q:   299 KGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNN---KKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           +G I Q+ GPVVDV F  + +P IN+ + V   N+   +KL+LEVA   GD+  R I+M  T+GL RGL+     +PI  PVG  VLGR+FNV G+ ID        +   IH+ P +F++QSTK+EIFETGIKV+DLL PY KGGK+GLFGGAGVGKTV++ ELIHN+A  H G S+FAGVGERTREGNDLY+EM +  V+++ AL +GQMNEPPGAR R+ALT LTMAE+FR+    DVL+FIDNIFRFSQ+GSE+SALLGRIPSAVGYQPTLA EMG+ QERITSTK GSITSVQAVYVPADDLTDPAP+T FAHLDA TVL+R IA  GIYPA++PL+S+SRMLDP I+G EHYKVAR VQ++LQK+++LQDIIAILG+DELSEEDKL V RARKI  FLSQPFFVAE F+   GKY+S ++TISGF  I+EGK D++PE  F  VG ID+
  S:     2 QGFISQVLGPVVDVDF-DDYLPQINEAIRVDFNNDGKEQKLILEVAAHLGDNRVRTIAMDMTDGLVRGLKAEALGSPISVPVGEKVLGRIFNVTGDLIDEGEEISFDKRWSIHRDPSAFEDQSTKSEIFETGIKVVDLLAPYAKGGKVGLFGGAGVGKTVIIMELIHNVAFKHSGYSVFAGVGERTREGNDLYNEMKESNVLDKVALCYGQMNEPPGARNRIALTGLTMAEYFRDEMGLDVLMFIDNIFRFSQSGSEMSALLGRIPSAVGYQPTLASEMGKFQERITSTKKGSITSVQAVYVPADDLTDPAPATVFAHLDATTVLNRAIAEKGIYPAVDPLDSTSRMLDPQIIGEEHYKVARGVQSVLQKYKDLQDIIAILGMDELSEEDKLVVERARKIEKFLSQPFFVAEVFTGSPGKYISLEETISGFKSILEGKYDNLPENAFYMVGNIDE 455
>gi|24460025|dbj|BAC22613.1| F1-ATPase beta subunit [Synechococcus sp. PCC 7002] (483 aa)
Score = 1506, Expect = 9.4e-165, Identities = 295/451 (65%), Positives = 358/451 (79%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVKLPN----NKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVIN-------QTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           G I QI GPV+D +F   +MP I + L+++  N       L  EV  L GD+  R ++M ST+GL RG+++++T  PI  PVG   LGR+FNV+GEP+D K      E SPIH+  P   E  T   +FETGIKV+DLL PY +GGKIGLFGGAGVGKTV++ ELI+NIAT HGG+S+FAGVGERTREGNDLY+EMI+ GVIN       + ALV+GQMNEPPGARMRV L+ LTMAE+FR+ NKQDVLLF+DNIFRF QAGSEVSALLGR+PSAVGYQPTL  ++G LQERITSTK GSITS+QAVYV ADDLTDPAP+TTFAHLD  TVL R +AS GIYPA++PL+S+S ML PSIVG +HY  AR+VQ+ LQ+++ELQDIIAILG+DELSEED+LTV RARKI  FLSQPFFVAE F+   GKYV+ ++TI GF  I+ G+ DD+PEQ F  VG I++
  S:    10 GKITQIIGPVIDAEFPSGKMPRIYNALKIQGKNPYGQEINLTCEVQQLLGDNQVRAVAMSSTDGLVRGMDILDTGAPISVPVGKKTLGRIFNVLGEPVDEKGEVGAEETSPIHRPAPKLTELDTAPSVFETGIKVVDLLTPYRRGGKIGLFGGAGVGKTVIMMELINNIATNHGGVSVFAGVGERTREGNDLYNEMIESGVINPDNLNDSKIALVYGQMNEPPGARMRVGLSGLTMAEYFRDVNKQDVLLFVDNIFRFVQAGSEVSALLGRMPSAVGYQPTLGTDVGDLQERITSTKEGSITSIQAVYVLADDLTDPAPATTFAHLDGTTVLSRALASKGIYPAVDPLDSTSTMLQPSIVGEDHYNTARAVQSTLQRYKELQDIIAILGLDELSEEDRLTVDRARKIERFLSQPFFVAEVFTGSPGKYVTLEETIEGFKRILSGELDDLPEQAFYLVGNIEE 471
>gi|184154917|ref|YP_001843257.1| F1F0-ATPase beta subunit [Lactobacillus fermentum IFO 3956] >gi|183226261|dbj|BAG26777.1| F1F0-ATPase beta subunit [Lactobacillus fermentum IFO 3956] (473 aa)
Score = 1505, Expect = 1.0e-164, Identities = 289/454 (63%), Positives = 361/454 (79%)
  Q:   297 SDKGIIYQIFGPVVDVKFARNQ-MPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKP-MPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           S  G + Q+ GPVVD++F  ++ +P IN  L+++  ++K L +EVAL  GD V R I+M  T+GL RG+ V NT   I  PVG   LGR+FNV+GEP+DN P      +  PIH+  P +++ S  TE+ ETGIKVIDLL PYV+GGKIGLFGGAGVGKTVL+QELIHNIA GH G+S+F GVGERTREGND+Y+EM   GV+ +TA+V+GQMNEPPGARMRVALT LT+AE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGRIPSAVGYQPTLA EMGQLQERITSTK GSITS+QAVYVPADD TDPAP+TTFAHLDA T L+R++  +GIYPA++PL S+S  L P +VG EHY+VA  VQ +LQ++ ELQDII+ILG+DELS+E+K  V+RAR+I+NFLSQ F VAE+F+ + G YV  ++T+  F  I++G+ DD+PE+ F  VGGID+
  S:     2 STTGKVVQVIGPVVDIEFPLDEKLPEINTALKIQEADDKTLTVEVALELGDGVVRTIAMDGTDGLKRGMAVENTDASISVPVGDDTLGRVFNVLGEPVDNGPEFGPDAQRMPIHRDAPKYEDLSNTTEVLETGIKVIDLLAPYVRGGKIGLFGGAGVGKTVLIQELIHNIAQGHNGISVFTGVGERTREGNDMYYEMKASGVLEKTAMVYGQMNEPPGARMRVALTGLTIAEYFRDVKGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGQLQERITSTKKGSITSIQAVYVPADDYTDPAPATTFAHLDATTNLERRLTQIGIYPAVDPLASTSTALTPEVVGQEHYEVATGVQHVLQRYRELQDIISILGMDELSDEEKTIVARARRIQNFLSQSFAVAEQFTGQPGAYVPLEETVKDFKAILDGEYDDLPEEAFRLVGGIDE 457
>gi|28625015|emb|CAD56146.1| F1F0-ATPase subunit beta [Pediococcus parvulus] (470 aa)
Score = 1505, Expect = 1.0e-164, Identities = 301/452 (66%), Positives = 362/452 (80%)
  Q:   300 GIIYQIFGPVVDVKFARN-QMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDN--KPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           G + Q+ GPVVDV+F  +  +P+IN+ L VK P+   LV EVAL  GD V R I+M  T+GL RGLEV +T + I  PVG   LGR+FNV+GE IDN  K  PE V+ +PIH+ PP +D+ +   EI ETGIKVIDLL PY++GGK+GLFGGAGVGKTVL+QELIHNIA  H G+S+F GVGERTREGNDLY EM   GV+ +TA+V+GQMNEPPGARMRVALT LT+AE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGRIPSAVGYQPTLA EMGQLQERITSTK GSITS+QAVYVPADD TDPAP+TTFAHLDA T L+R +   GIYPA++PL S+S  LDPS+VG EHYKVA  VQ +LQ++ ELQDII+ILG+DELS+E+K  V+RAR+I+ FLSQ F VAE+F+ + G YV  ++T+ GF EI+EGK DD+PE  F  VG ID+V
  S:     4 GKVVQVIGPVVDVEFPLDGNLPDINNALNVKKPDGSILVAEVALELGDGVVRTIAMDGTDGLQRGLEVEDTGSSITVPVGDKTLGRVFNVLGETIDNGEKFGPE-VKRNPIHRDPPKYDDLNPSMEILETGIKVIDLLAPYIRGGKVGLFGGAGVGKTVLIQELIHNIAQEHNGISVFTGVGERTREGNDLYFEMKASGVLEKTAMVYGQMNEPPGARMRVALTGLTLAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGQLQERITSTKKGSITSIQAVYVPADDYTDPAPATTFAHLDATTNLERSLTQQGIYPAVDPLASTSSALDPSVVGEEHYKVATDVQHVLQRYRELQDIISILGMDELSDEEKTIVARARRIQFFLSQNFSVAEQFTGQPGSYVPVEETVKGFKEILEGKYDDLPEDAFRQVGNIDEV 457
>gi|42518865|ref|NP_964795.1| F0F1 ATP synthase subunit beta [Lactobacillus johnsonii NCC 533] >gi|81832255|sp|Q74K15|ATPB_LACJO ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|41583151|gb|AAS08761.1| ATP synthase beta chain [Lactobacillus johnsonii NCC 533] (480 aa)
Score = 1505, Expect = 1.2e-164, Identities = 305/455 (67%), Positives = 364/455 (80%)
  Q:   299 KGIIYQIFGPVVDVKFARNQ-MPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKP-MPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHK 753
           KG I Q+ GPVVDV+F  ++ +P+IN+ L V   N   LVLEV L  GD V R ISM ST+GL RG+EV +T  PI  PVG   LGR+FNV+G+PID  P + + V+   IHK+ P +DE ST  EI ETGIKVIDLL PYV+GGK+GLFGGAGVGKT ++QELIHNIA  HGG+S+F GVGERTREGNDLY EM   GV+++TA+VFGQMNEPPGARMRVALT LT+AE+FR+    DVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMGQLQERITSTK GSITS+QAVYVPADD TDPAP+TTFAHLDA T L+R++   GIYPA++PLES+S  LDP IVG EHY+VA  VQ ILQ+++ELQDII++LG+DELS+++KL V RARKI+ FLSQ FFVAE+F+   G YV  ++TI GF  II+GK DD+PE  F  VG I+DV K
  S:     3 KGEIVQVIGPVVDVEFPLDKDLPDINNALRVTNNNGDTLVLEVTLELGDGVLRTISMESTDGLRRGMEVEDTGAPISVPVGKDTLGRVFNVLGDPIDGGPALGKDVKREGIHKEAPKYDELSTSEEILETGIKVIDLLEPYVRGGKVGLFGGAGVGKTTIIQELIHNIAQEHGGISVFTGVGERTREGNDLYFEMKASGVLSKTAMVFGQMNEPPGARMRVALTGLTIAEYFRDVEGLDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGSITSIQAVYVPADDYTDPAPATTFAHLDATTNLERRLVEQGIYPAVDPLESTSSALDPEIVGEEHYEVAVKVQHILQRYQELQDIISVLGMDELSDDEKLIVERARKIQFFLSQNFFVAEQFTGIPGSYVPIKETIKGFKMIIDGKLDDLPEDAFRNVGPIEDVIK 459
>gi|57504649|ref|ZP_00370727.1| ATP synthase F1, beta subunit [Campylobacter coli RM2228] >gi|57019418|gb|EAL56113.1| ATP synthase F1, beta subunit [Campylobacter coli RM2228] (465 aa)
Score = 1505, Expect = 1.2e-164, Identities = 298/452 (65%), Positives = 358/452 (79%)
  Q:   299 KGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPN---NKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           +G I Q+ GPVVDV F  + +P IN+ + V   +    +KLVLEVA   GD+  R I+M  T+GL RGL+      PI  PVG  VLGR+FNV G+ ID        +   IH+ PP+F++QSTK+EIFETGIKV+DLL PY KGGK+GLFGGAGVGKTV++ ELIHN+A  H G S+FAGVGERTREGNDLY+EM +  V+++ AL +GQMNEPPGAR R+ALT LTMAE+FR+    DVL+FIDNIFRFSQ+GSE+SALLGRIPSAVGYQPTLA EMG+ QERITSTK GSITSVQAVYVPADDLTDPAP+T FAHLDA TVL+R IA  GIYPA++PL+S+SRMLDP I+G EHYKVAR VQ++LQK+++LQDIIAILG+DELSEEDKL V RARKI  FLSQPFFVAE F+   GKY+S ++TI+GF  I+EGK D +PE  F  VG ID+
  S:     2 QGFISQVLGPVVDVDF-NDYLPQINEAIVVNFESEGKKQKLVLEVAAHLGDNRVRTIAMDMTDGLVRGLKAEALGAPISVPVGEKVLGRIFNVTGDLIDEGEEISFDKKWAIHRDPPAFEDQSTKSEIFETGIKVVDLLAPYAKGGKVGLFGGAGVGKTVIIMELIHNVAFKHSGYSVFAGVGERTREGNDLYNEMKESNVLDKVALCYGQMNEPPGARNRIALTGLTMAEYFRDEMGLDVLMFIDNIFRFSQSGSEMSALLGRIPSAVGYQPTLASEMGKFQERITSTKKGSITSVQAVYVPADDLTDPAPATVFAHLDATTVLNRSIAEKGIYPAVDPLDSTSRMLDPQIIGEEHYKVARGVQSVLQKYKDLQDIIAILGMDELSEEDKLIVERARKIEKFLSQPFFVAEVFTGSPGKYISLEETIAGFKGILEGKYDHLPENAFYMVGNIDE 455
>gi|116490723|ref|YP_810267.1| F0F1 ATP synthase subunit beta [Oenococcus oeni PSU-1] >gi|116091448|gb|ABJ56602.1| F0F1-type ATP synthase, beta subunit [Oenococcus oeni PSU-1] (504 aa)
Score = 1504, Expect = 1.3e-164, Identities = 298/484 (61%), Positives = 377/484 (77%)
  Q:   266 EIKTNKSIVSDSHKIDIYEENEDLMKLNTLKSDK-----GIIYQIFGPVVDVKFARNQ-MPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDN-KPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGID 749
           E KT K+  S + K+          +     S++     G + Q+ GP+VDV+F  N+ +P+IN+ L+V+  +  +L +EV++  GD V R I+M ST+GL RG++V++T  PI  PVG A LGR+FNV+GEP+D   P+P  V+  PIH+  P +DE +T TE+ ETGIKVIDLL PY++GGK GLFGGAGVGKTVL+QELIHNIA GH G+S+F GVGERTREGND+Y+EM   GV+  TA+V+GQMNEPPGARMRV LT LTMAE FR+   +DVLLFIDNIFRF+QAGSEVSALLGRIPSAVGYQPTLA EMGQLQERITSTK GS+TS+QAVYVPADD TDPAP+TTFAHLDA T L+R +   GIYPA++PLES+S  L P IVG +HY+VA  VQ  LQ+++ELQDII+ILG+DELS+E+K  V+RAR+I+ FLSQPF VAE+F+   G+YV  +DT+ GF EI++GK DD+PE+ F  VG I+
  S:     3 EKKTTKATASSTSKVAKRTRGSKSTQTKASVSNEKDLAEGTVLQVIGPIVDVQFPDNKKLPDINNALKVQRIDGSELTIEVSIDLGDSVVRTIAMDSTDGLTRGMKVLDTGAPIEVPVGEATLGRVFNVLGEPVDGGDPIPNSVDRHPIHRSAPKYDELATSTEVLETGIKVIDLLEPYLRGGKTGLFGGAGVGKTVLIQELIHNIAQGHNGISVFTGVGERTREGNDMYYEMKASGVLKNTAMVYGQMNEPPGARMRVGLTGLTMAEDFRDQEGKDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGQLQERITSTKKGSVTSIQAVYVPADDYTDPAPATTFAHLDATTNLERSLTQQGIYPAVDPLESTSSALTPDIVGEDHYEVATQVQHFLQRYKELQDIISILGMDELSDEEKTIVNRARRIQFFLSQPFSVAEQFTGVPGQYVPVEDTVRGFKEILDGKHDDLPEEAFRNVGTIE 493
>gi|153951038|ref|YP_001397361.1| F0F1 ATP synthase subunit beta [Campylobacter jejuni subsp. doylei 269.97] >gi|190358272|sp|A7H1I1|ATPB_CAMJD ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|152938484|gb|ABS43225.1| ATP synthase F1, beta subunit [Campylobacter jejuni subsp. doylei 269.97] (484 aa)
Score = 1504, Expect = 1.5e-164, Identities = 299/452 (66%), Positives = 363/452 (80%)
  Q:   299 KGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPN---NKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDN-KPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           +G I Q+ GPVVDV F  + +P IN+ + V   +     KLVLEVA   GD+  R I+M  T+GL RGL+      PI  PVG  VLGR+FNV G+ ID  + +P   +++ IH+ PP+F++QSTK+EIFETGIKV+DLL PY KGGK+GLFGGAGVGKTV++ ELIHN+A  H G S+FAGVGERTREGNDLY+EM +  V+++ AL +GQMNEPPGAR R+ALT LTMAE+FR+    DVL+FIDNIFRFSQ+GSE+SALLGRIPSAVGYQPTLA EMG+ QERITSTK GSITSVQAVYVPADDLTDPAP+T FAHLDA TVL+R IA  GIYPA++PL+S+SRMLDP+I+G EHYKVAR VQ++LQK+++LQDIIAILG+DELSEEDKL V RARKI  FLSQPFFVAE F+   GKY++ +DTI+GF  I+EGK D +PE  F  VG ID+
  S:     2 QGFISQVLGPVVDVDF-NDYLPQINEAIVVNFESEGKKHKLVLEVAAHLGDNRVRTIAMDMTDGLVRGLKAEALGAPISVPVGEKVLGRIFNVTGDLIDEGEEIPFDKKWA-IHRDPPAFEDQSTKSEIFETGIKVVDLLAPYAKGGKVGLFGGAGVGKTVIIMELIHNVAFKHSGYSVFAGVGERTREGNDLYNEMKESNVLDKVALCYGQMNEPPGARNRIALTGLTMAEYFRDEMGLDVLMFIDNIFRFSQSGSEMSALLGRIPSAVGYQPTLASEMGKFQERITSTKKGSITSVQAVYVPADDLTDPAPATVFAHLDATTVLNRAIAEKGIYPAVDPLDSTSRMLDPNIIGEEHYKVARGVQSVLQKYKDLQDIIAILGMDELSEEDKLVVERARKIEKFLSQPFFVAEVFTGSPGKYINLEDTIAGFKGILEGKYDHLPENAFYMVGNIDE 455
>gi|32490757|ref|NP_871011.1| F0F1 ATP synthase subunit beta [Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis] >gi|81844477|sp|Q8D3J3|ATPB_WIGBR ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|25165963|dbj|BAC24154.1| atpD [Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis] (462 aa)
Score = 1503, Expect = 1.9e-164, Identities = 299/458 (65%), Positives = 359/458 (78%)
  Q:   298 DKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHKNY 755
           D G I QI GPV+DVKF  + +P IN  LE+K+  NKKL++EV    GD + RCI MGS++GL RGL+V N    I  PVG   LGR+ NV+G+PID K      EY PIH K PS++E S+  E+ ETGIK+IDL+ P+ KGGKIGLFGGAGVGKTV + ELI NIA  H G S+F+GVGERTREGND Y+EMI   VI++ +LV+GQMNEPPG R+RVALT LT+AE FR+    DVL F+DNI+R++ AG+EVSALLGRIPSAVGYQPTL+ EMG LQERITSTKSGSITSVQA+YVPADDLTDP+P+TTF HLDA  VL R+IASLGIYPAI+PL+S+SR LDP IVG +HY VAR +Q+ILQ++++L+DIIAILGIDELSEEDK+ VSRARKI+ FLSQPFFVAE F+  SGKYV+ +DTI GF+ II G+ D IPEQ F   G I DV   Y
  S:     2 DTGKIVQIIGPVIDVKFEISFIPKINFALEIKI-KNKKLIMEVMQQIGDGIVRCILMGSSDGLKRGLKVFNLNKGIEVPVGKPTLGRIMNVLGDPIDRKGKILSSEYRPIHNKSPSYNEISSSDELLETGIKIIDLICPFAKGGKIGLFGGAGVGKTVNMMELIRNIAIEHSGYSVFSGVGERTREGNDFYNEMISSNVIDKVSLVYGQMNEPPGNRLRVALTGLTLAEKFRDEG-NDVLFFVDNIYRYTLAGTEVSALLGRIPSAVGYQPTLSEEMGILQERITSTKSGSITSVQAIYVPADDLTDPSPATTFVHLDATVVLSRQIASLGIYPAIDPLDSTSRQLDPLIVGEDHYLVARKIQSILQRYKDLKDIIAILGIDELSEEDKILVSRARKIQRFLSQPFFVAEIFTGFSGKYVTLKDTIDGFNSIINGEYDYIPEQAFYMTGNISDVLDKY 457
>gi|7708298|emb|CAB90074.1| ATP synthase beta subunit [Erica sicula] (475 aa)
Score = 1503, Expect = 2.0e-164, Identities = 304/454 (66%), Positives = 362/454 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK----KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGID 749
           K + G I QI GPV+DV F   +MPNI + L V+  +       ++ EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIH+  P+F E  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ NKQDVLLFIDNIFRF QAGSEVSALLGRIPSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG +HYK+A+ V+  LQ+++ELQDIIAILG+DELSEED+LTVSRARKI+ FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID
  S:     2 KKNLGRIVQIIGPVLDVAFPPGKMPNIYNALVVQGRDTAGQPINVICEVQQLVGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPLDTRTTSPIHRSAPAFIELETKLCIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYKEMKETGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNKQDVLLFIDNIFRFVQAGSEVSALLGRIPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGHKHYKIAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVSRARKIKRFLSQPFFVAEVFTGSGGKYVGLAETIGGFQLILSGELDGLPEQAFYLVGTID 466
>gi|153815545|ref|ZP_01968213.1| hypothetical protein RUMTOR_01781 [Ruminococcus torques ATCC 27756] >gi|145847187|gb|EDK24105.1| hypothetical protein RUMTOR_01781 [Ruminococcus torques ATCC 27756] (462 aa)
Score = 1503, Expect = 2.0e-164, Identities = 302/461 (65%), Positives = 360/461 (78%)
  Q:   298 DKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHKNYVAA 758
           +KG I Q+ GPVVDV F    +P I D LEV+  N KK V+EVA   G++  RC+ + ++EGL++ +EV  T   I  PVG   LGR+FNV+GE +D+       +   IH+ PP+F++QS   EI ETGIKVIDLL PY KGGKIGLFGGAGVGKTVL+QELI NIAT HGG SIF GVGER+REGNDL+ EM + GV+ +TALVFGQMNEPPGARMRVA T LTMAE+FR+   ++VLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMG+LQERI STK+GS+TSVQAVYVPADDLTDPAP+TTFAHLDA TVL RK+   GIYPA++PLESSSR+L+  IVG EHY+VA  V  ILQK++ELQDIIAILG++ELS+EDK TV RARKI+ FLSQPFFVAE F+   GKYV  ++TI GF  II+G+ D+ PE  F  VG IDDV +   AA
  S:     2 NKGKIIQVMGPVVDVVFQDGNLPFIKDALEVE-NNGKKCVMEVAQHLGNNEVRCLMLAASEGLHKDMEVTATGAGIKVPVGEKTLGRLFNVLGETVDDGEQITDADQWVIHRDPPTFEDQSPVVEILETGIKVIDLLAPYAKGGKIGLFGGAGVGKTVLIQELIRNIATEHGGYSIFTGVGERSREGNDLWTEMKESGVLEKTALVFGQMNEPPGARMRVAETGLTMAEYFRDEEHRNVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGELQERIASTKNGSVTSVQAVYVPADDLTDPAPATTFAHLDATTVLSRKVVEQGIYPAVDPLESSSRILEAEIVGEEHYEVANKVIAILQKYKELQDIIAILGMEELSDEDKATVMRARKIQKFLSQPFFVAETFTGVPGKYVPLKETIRGFKMIIDGEMDEYPESAFFNVGSIDDVIEKAKAA 461
>gi|119368014|dbj|BAF40502.1| ATP synthase beta subunit [Passiflora quadrangularis] (487 aa)
Score = 1503, Expect = 2.0e-164, Identities = 304/455 (66%), Positives = 363/455 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K++ G I QI GPV+DV F R +MPNI + L +K    +     +  EV  L G++  R ++M +TEGL RG+EVI+T  P+  PVG A LGR+FNV+GEPID     +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTAL+MAE+FR+ NKQDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK+GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHYK A+SV+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:     9 KTNLGHIAQIIGPVLDVAFLRGKMPNIYNALVIKGRDSIGQQSNVTCEVQQLLGNNRVRAVAMSATEGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPIDELGPVDTRTTSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEKNITESKVALVYGQMNEPPGARMRVGLTALSMAEYFRDVNKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKTGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPQIVGSEHYKTAQSVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFQLILSGELDSLPEQAFYLVGNIDE 474
>gi|183220215|ref|YP_001838211.1| ATP synthase F1, beta subunit [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] >gi|189910333|ref|YP_001961888.1| Beta subunit of the H(+)-transporting two-sector ATPase, F1 sector [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] >gi|167775009|gb|ABZ93310.1| Beta subunit of the H(+)-transporting two-sector ATPase, F1 sector [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] >gi|167778637|gb|ABZ96935.1| ATP synthase F1, beta subunit [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] (468 aa)
Score = 1500, Expect = 4.2e-164, Identities = 295/454 (64%), Positives = 361/454 (79%)
  Q:   298 DKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKK---LVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDN-KPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           +KG I QI G V+D+ F    MP I + +E++   N K   +  EV    GD+  R IS+ ST+GL RGLEV +T  PI  PVG+  LGR+FNV+GE ID    +P+ V+  PIH+  P+++E   KTEIFETGIKVIDLL PY+KGGK GLFGGAGVGKTVL+QELI+NIA  HGG S+FAGVGERTREGNDL++EM + GVI++T L FGQMNEPPGAR+RVAL+ALTMAE+FR+ +  D+LLF+DNIFRFSQAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITST  GSITSVQA+YVPADDLTDPAP+T F HLDA TVL R I+  GIYPA++PL+S+SR+++P IVG EHY  AR VQ ILQ++++LQDIIAILG+DELSE+DK+ V+RAR++  FLSQPF VAE+F+ + GKYV  +DTI  F  IIEGK D +PEQ F  VG ID+V
  S:     2 NKGKIKQIIGSVMDISFESGNMPEIYNAVEIQTKVNGKDVTITAEVQQHIGDNTVRAISLQSTDGLKRGLEVTDTGIPISVPVGTKTLGRIFNVLGEAIDELGDLPKDVKKMPIHRNAPTYEEIKPKTEIFETGIKVIDLLAPYIKGGKTGLFGGAGVGKTVLIQELINNIAKQHGGFSVFAGVGERTREGNDLWNEMKESGVIDKTVLCFGQMNEPPGARLRVALSALTMAENFRDESGSDILLFVDNIFRFSQAGSEVSALLGRMPSAVGYQPTLSTEMGGLQERITSTTRGSITSVQAIYVPADDLTDPAPATAFTHLDATTVLSRAISEKGIYPAVDPLDSTSRIMNPQIVGEEHYSTAREVQRILQRYKDLQDIIAILGMDELSEDDKILVARARRLEKFLSQPFHVAEQFTGRPGKYVKLEDTIRSFKGIIEGKYDSLPEQAFYMVGSIDEV 459
>gi|21684964|emb|CAD22547.1| F1F0-ATPase subunit beta [Oenococcus oeni] (504 aa)
Score = 1500, Expect = 4.5e-164, Identities = 297/484 (61%), Positives = 376/484 (77%)
  Q:   266 EIKTNKSIVSDSHKIDIYEENEDLMKLNTLKSDK-----GIIYQIFGPVVDVKFARNQ-MPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDN-KPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGID 749
           E KT K+  S + K+          +     S++     G + Q+ GP+VDV+F  N+ +P+IN+ L+V+  +  +L +EV++  GD V R I+M ST+GL RG++V++T  PI  PVG A LGR+FNV+GEP+D   P+P  V+  PIH+  P +DE +T  E+ ETGIKVIDLL PY++GGK GLFGGAGVGKTVL+QELIHNIA GH G+S+F GVGERTREGND+Y+EM   GV+  TA+V+GQMNEPPGARMRV LT LTMAE FR+   +DVLLFIDNIFRF+QAGSEVSALLGRIPSAVGYQPTLA EMGQLQERITSTK GS+TS+QAVYVPADD TDPAP+TTFAHLDA T L+R +   GIYPA++PLES+S  L P IVG +HY+VA  VQ  LQ+++ELQDII+ILG+DELS+E+K  V+RAR+I+ FLSQPF VAE+F+   G+YV  +DT+ GF EI++GK DD+PE+ F  VG I+
  S:     3 EKKTTKATASSTSKVAKRTRGSKSTQTKASVSNEKDLAEGTVLQVIGPIVDVQFPDNKKLPDINNALKVQRIDGSELTIEVSIDLGDSVVRTIAMDSTDGLTRGMKVLDTGAPIEVPVGEATLGRVFNVLGEPVDGGDPIPNSVDRHPIHRSAPKYDELATSAEVLETGIKVIDLLEPYLRGGKTGLFGGAGVGKTVLIQELIHNIAQGHNGISVFTGVGERTREGNDMYYEMKASGVLKNTAMVYGQMNEPPGARMRVGLTGLTMAEDFRDQEGKDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGQLQERITSTKKGSVTSIQAVYVPADDYTDPAPATTFAHLDATTNLERSLTQQGIYPAVDPLESTSSALTPDIVGEDHYEVATQVQHFLQRYKELQDIISILGMDELSDEEKTIVNRARRIQFFLSQPFSVAEQFTGVPGQYVPVEDTVRGFKEILDGKHDDLPEEAFRNVGTIE 493
>gi|119416492|emb|CAI34837.1| ATP synthase beta chain, mitochondrial precursor [Polytomella sp. Pringsheim 198.80] (574 aa)
Score = 1499, Expect = 5.3e-164, Identities = 301/479 (62%), Positives = 374/479 (78%)
  Q:   298 DKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVI--------NQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHK--NYVAANSNNKVNSSNKPLNSENK 776
           D G + Q+ GPVVDV+F   ++P+I   LEV+  ++ +LVLEVA   GD+  RCI+M ST+GL RG +V++T +PI  PVG   LGR+ NV+GEP+D +   +  +   IH++ P F EQST+ EI  TGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+N+A  HGG S+FAGVGERTREGNDLY EMI+ GVI        ++  LV+GQMNEPPGAR RVALT LT+AE+FR+   QDVLLF+DNIFRF+QA SEVSALLGRIPSAVGYQPTLA ++G LQERIT+T  GSITSVQAVYVPADDLTDP P+TTFAHLDA TVL R IA LGIYPA++PL+S+SRM +P+++G EHY VAR VQ +LQ ++ LQDIIAILG+DELSEEDKLTV+RARKI+ FLSQPF VAE F+   GKYV   DTISGF  ++ GK DD+PE  F  VG I +V +  + +A +  ++  + NK ++ E K
  S:    36 DAGYVSQVIGPVVDVRF-DGELPSILSSLEVE-GHSVRLVLEVAQHMGDNTVRCIAMDSTDGLVRGQKVVDTGSPIKVPVGRGTLGRIMNVIGEPVDEQGPIDAADIWSIHREAPEFTEQSTEQEILVTGIKVVDLLAPYQRGGKIGLFGGAGVGKTVLIMELINNVAKAHGGFSVFAGVGERTREGNDLYREMIESGVIKLGAERGNSKCTLVYGQMNEPPGARARVALTGLTVAEYFRDIEGQDVLLFVDNIFRFTQANSEVSALLGRIPSAVGYQPTLATDLGGLQERITTTTKGSITSVQAVYVPADDLTDPGPATTFAHLDATTVLSRSIAELGIYPAVDPLDSTSRMRNPNVIGAEHYNVARGVQKVLQDYKNLQDIIAILGMDELSEEDKLTVARARKIQRFLSQPFQVAEVFTGTPGKYVDLADTISGFQGVLTGKYDDLPEMAFYMVGDIKEVKEKADKMAKDIASRKEADNKKVSEELK 522
>gi|7708276|emb|CAB90063.1| ATP synthase beta subunit [Dischidia lanceolata] (490 aa)
Score = 1499, Expect = 6.1e-164, Identities = 304/455 (66%), Positives = 360/455 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           KS  G I QI GPV+DV FA  +MPNI + L VK    L     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL  EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:    16 KSXPGRIVQIIGPVLDVAFAPGKMPNIYNALVVKGRDXLGQPINVTCEVQQLLGNNRVRAVAMSATDGLMRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDARTTSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEEKIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLGTEMGSLQERITSTKGGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPGIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFQLILSGELDGLPEQAFYLVGNIDE 481
>gi|196189320|gb|EDX84284.1| ATP synthase F1, beta subunit [Synechococcus sp. PCC 7335] (486 aa)
Score = 1498, Expect = 6.5e-164, Identities = 296/456 (64%), Positives = 359/456 (78%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPN----NKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVIN-------QTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           K++ G I QI GPV+DVKF   ++P I + ++V   N       +  EV  L GD   R +SM ST+GL RG+E  +  +PI  PVG A LGR+FNV+GEP+D K   +     PIH+  P   +  TK  +FETGIKV+DLL PY +GGK+GLFGGAGVGKTVL+QELI+NIA  H G+S+F GVGERTREGNDLY+E I+ GVIN       + ALV+GQMNEPPGARMRVAL+ALTMAE+FR+ NKQDVLLF+DNIFRF QAGSEVSALLGR+PSAVGYQPTL  +MG LQERI ST  GSITS+QAVYVPADDLTDPAP+TTFAHLDA T L R +AS GIYPA++PL+S+S ML P IVG EHY  AR+VQ+ LQ+++ELQDIIAILG+DELSEED+  V+RARKI  FLSQPFFVAE F+  SGKYV+ +DTI GF+ I++G+ DD+PEQ F   GGI++V
  S:     7 KTNTGYITQIIGPVLDVKFPNGELPKIYNAIKVTGTNPAGQEVTVTCEVQQLLGDSQVRAVSMSSTDGLVRGMEAEDLGSPINVPVGKATLGRIFNVLGEPVDEKGPVDAESSLPIHRPAPELVDLETKPAVFETGIKVVDLLAPYRRGGKVGLFGGAGVGKTVLIQELINNIAKEHSGVSVFGGVGERTREGNDLYNEFIESGVINADDLSQSKVALVYGQMNEPPGARMRVALSALTMAEYFRDVNKQDVLLFVDNIFRFVQAGSEVSALLGRMPSAVGYQPTLGTDMGDLQERIASTTDGSITSIQAVYVPADDLTDPAPATTFAHLDATTTLSRALASKGIYPAVDPLDSTSTMLQPDIVGEEHYGTARAVQSTLQRYKELQDIIAILGLDELSEEDRQVVARARKIEKFLSQPFFVAEVFTGMSGKYVTLEDTIKGFNMILDGELDDVPEQAFYLKGGIEEV 473
>gi|115531922|ref|YP_784078.1| ATP synthase CF1 beta subunit [Pelargonium x hortorum] >gi|122164272|sp|Q06FV3|ATPB_PELHO ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|112382076|gb|ABI17269.1| ATP synthase CF1 beta subunit [Pelargonium x hortorum] (498 aa)
Score = 1497, Expect = 8.7e-164, Identities = 306/458 (66%), Positives = 366/458 (79%)
  Q:   293 NTLKSDK-GIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           +TL+  K G I QI GPV+DV F R +MP I + L V+    +     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIHK PP+F E  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ NKQDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY++A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+  +GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:    13 STLQKKKLGRIVQIIGPVLDVAFPRGKMPYIYNALVVQGRDTVGQQIHVTCEVQQLLGNNRVRAVAMSATDGLMRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDNRTTSPIHKSPPAFIELDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQKVAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKKGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGNEHYEIAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSTGKYVGLSETIRGFHLILSGEFDGLPEQAFYLVGNIDE 482
>gi|22537026|ref|NP_687877.1| F0F1 ATP synthase subunit beta [Streptococcus agalactiae 2603V/R] >gi|76786779|ref|YP_329608.1| F0F1 ATP synthase subunit beta [Streptococcus agalactiae A909] >gi|76799295|ref|ZP_00781462.1| ATP synthase F1, beta subunit [Streptococcus agalactiae 18RS21] >gi|77406467|ref|ZP_00783523.1| ATP synthase F1, beta subunit [Streptococcus agalactiae H36B] >gi|77407968|ref|ZP_00784718.1| ATP synthase F1, beta subunit [Streptococcus agalactiae COH1] >gi|77410721|ref|ZP_00787080.1| ATP synthase F1, beta subunit [Streptococcus agalactiae CJB111] >gi|77414099|ref|ZP_00790267.1| ATP synthase F1, beta subunit [Streptococcus agalactiae 515] >gi|81845446|sp|Q8E072|ATPB_STRA5 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|118573760|sp|Q3K1J5|ATPB_STRA1 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|22533883|gb|AAM99749.1|AE014231_7 ATP synthase F1, beta subunit [Streptococcus agalactiae 2603V/R] >gi|76561836|gb|ABA44420.1| ATP synthase F1, beta subunit [Streptococcus agalactiae A909] >gi|76585355|gb|EAO61946.1| ATP synthase F1, beta subunit [Streptococcus agalactiae 18RS21] >gi|77159851|gb|EAO70994.1| ATP synthase F1, beta subunit [Streptococcus agalactiae 515] >gi|77163257|gb|EAO74209.1| ATP synthase F1, beta subunit [Streptococcus agalactiae CJB111] >gi|77173426|gb|EAO76545.1| ATP synthase F1, beta subunit [Streptococcus agalactiae COH1] >gi|77174936|gb|EAO77749.1| ATP synthase F1, beta subunit [Streptococcus agalactiae H36B] (468 aa)
Score = 1497, Expect = 1.0e-163, Identities = 296/435 (68%), Positives = 352/435 (80%)
  Q:   317 NQMPNINDCLEVKLPNNK--KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPID-NKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           +++P IN+ L V    +K  K+VLEVAL  GD + R I+M ST+GL RGLEV++T   I  PVG   LGR+FNV+G+ ID  +P  E  E  PIHKK PSFDE ST +EI ETGIKVIDLL PY+KGGK+GLFGGAGVGKTVL+QELIHNIA  HGG+S+F GVGERTREGNDLY EM + GVI +TA+VFGQMNEPPGARMRVALT LT+AE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMGQLQERITSTK GS+TS+QA+YVPADD TDPAP+T FAHLD+ T L+RK+  +GIYPA++PL SSSR L P IVG EHY+VA  VQ +LQ++ ELQDIIAILG+DELS+E+K  V RAR+I+ FLSQ F VAE F+ + G YV  ++T+ GF EI++GK D IPE  F  VGGI+DV
  S:    22 DKLPEINNALIVYKNGDKSQKVVLEVALELGDGLVRTIAMESTDGLTRGLEVLDTGRAISVPVGKDTLGRVFNVLGDAIDLEEPFAEDAERQPIHKKAPSFDELSTSSEILETGIKVIDLLAPYLKGGKVGLFGGAGVGKTVLIQELIHNIAQEHGGISVFTGVGERTREGNDLYWEMKESGVIEKTAMVFGQMNEPPGARMRVALTGLTIAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGSVTSIQAIYVPADDYTDPAPATAFAHLDSTTNLERKLTQMGIYPAVDPLASSSRALTPEIVGDEHYEVATEVQRVLQRYRELQDIIAILGMDELSDEEKTLVGRARRIQFFLSQNFNVAETFTGQPGSYVPVEETVRGFKEILDGKHDQIPEDAFRMVGGIEDV 459
>gi|90961576|ref|YP_535492.1| F0F1 ATP synthase subunit beta [Lactobacillus salivarius UCC118] >gi|118573690|sp|Q1WUC6|ATPB_LACS1 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|90820770|gb|ABD99409.1| ATP synthase beta chain [Lactobacillus salivarius UCC118] (468 aa)
Score = 1496, Expect = 1.2e-163, Identities = 298/463 (64%), Positives = 363/463 (78%)
  Q:   300 GIIYQIFGPVVDVKFARNQ-MPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKP-MPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHKNYVAANSNN 762
           G + Q+ GPVVDV+F  ++ +P+I+D L+VK  +  +LV+EVAL  GD + R ++M ST+GL RG EV  T   I  PVG   LGR+FNV+G  IDN P   E    +PIH+  P +D+ ST  EI ETGIKVIDLL PY+KGGKIGLFGGAGVGKTVL+QELIHNIA  H G+S+F GVGERTREGNDLY EM + GV+ +TA+VFGQMNEPPGARMRVALT LT+AE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGRIPSAVGYQPTLA EMGQLQERITSTK GS+TS+QAVYVPADD TDPAP+TTFAHLDA T L+R +   GIYPA++PL S+S  L P IVG EHY+VA  VQ +LQ++ ELQDII+ILG+DELS+E+K+ V+RAR+I+ FLSQ F VAE+F+   G YV  ++T+ GF EI+EGK D++PE+ F  VGGI+DV +       NN
  S:     4 GKVVQVIGPVVDVQFPLSESLPDIDDALKVKREDGTELVIEVALELGDGIMRTVAMDSTDGLKRGAEVEGTGASISVPVGKDTLGRVFNVLGNTIDNGPEFDEDHPRNPIHRDAPKYDQLSTGIEILETGIKVIDLLAPYIKGGKIGLFGGAGVGKTVLIQELIHNIAQEHNGISVFTGVGERTREGNDLYFEMKESGVLEKTAMVFGQMNEPPGARMRVALTGLTLAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGQLQERITSTKKGSVTSIQAVYVPADDYTDPAPATTFAHLDATTNLERSLTQQGIYPAVDPLASTSSALTPEIVGEEHYEVATEVQHVLQRYRELQDIISILGMDELSDEEKIIVARARRIQFFLSQNFHVAEQFTGNPGSYVPVEETVKGFKEILEGKYDNLPEEAFRLVGGIEDVVEKAKKLAGNN 468
>gi|28849147|dbj|BAC65129.1| adenosine triphosphatase [Acetabularia acetabulum] (491 aa)
Score = 1496, Expect = 1.2e-163, Identities = 308/470 (65%), Positives = 364/470 (77%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVKLPN----NKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQT-------ALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHKNYVAANSNNKVNSSNK 769
           G I QI GPV+DV+F   QMPNI + L V+  N    N  +  EV  L GD   R +SM +T+GL RG+EV++T NP+  PVG   LGR+FNV+GE +DN    E  +  PIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM +  VIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ NKQDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTLA EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +AS GIYPA++PL+S+S ML P IVG EHY  A++V+  LQ+++ELQDIIAILG+DELSEED+L V+RARKI  FLSQPFFVAE F+   GKYVS  +TI GFS I+ G+ DD+PEQ F  VG ID+      +   N    + +K
  S:     9 GRITQIIGPVLDVEFPPGQMPNIYNALVVRGTNQAGQNVAVTCEVQQLLGDHCVRAVSMSATDGLMRGMEVLDTGNPLTVPVGQVTLGRIFNVLGETVDNLGTVEIKDGLPIHRTAPAFVDLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESRVINEANLSESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLASEMGGLQERITSTKDGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLASKGIYPAVDPLDSTSTMLQPWIVGEEHYNCAQNVKQTLQRYKELQDIIAILGLDELSEEDRLIVARARKIERFLSQPFFVAEVFTGSPGKYVSLNETIQGFSLILSGELDDLPEQAFYLVGNIDEAIAKAASIQQNRGSKAPSK 489
>gi|116493065|ref|YP_804800.1| F0F1 ATP synthase subunit beta [Pediococcus pentosaceus ATCC 25745] >gi|122265471|sp|Q03EL4|ATPB_PEDPA ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|116103215|gb|ABJ68358.1| F0F1-type ATP synthase, beta subunit [Pediococcus pentosaceus ATCC 25745] (469 aa)
Score = 1494, Expect = 2.2e-163, Identities = 293/452 (64%), Positives = 358/452 (79%)
  Q:   300 GIIYQIFGPVVDVKFARNQ-MPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDN-KPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           G + Q+ GPV+DV+F  ++ +P IN+ L++K  +   LV EV L  GD V R I+M  T+GL RGL+V +T + I  PVG   LGR+FNV+G+ ID  K +   ++  PIH+ PP +DE +  TE+ ETGIKVIDLL PY++GGKIGLFGGAGVGKTVL+QELIHNIA  H G+S+F GVGERTREGNDLY EM   GV+ +TA+V+GQMNEPPGARMRVALT LT+AEHFR+   QDVLLFIDNIFRF+QAGSEVSALLGRIPSAVGYQPTLA EMGQLQERITSTK GS+TS+QAVYVPADD TDPAP+TTFAHLDA T L+R +   GIYPA++PL S+S  LDP IVG EHY+VA  VQ +LQ+++ELQDII+ILG+DELS+E+K  V+RAR+I+ FLSQ F VA +F+   G YV  +DTISGF  I++GK DD+PE+ F  VG IDDV
  S:     4 GKVVQVIGPVIDVEFPLDEELPTINNALKIKKADGTVLVSEVTLELGDGVVRTIAMDGTDGLQRGLDVEDTGDSIKVPVGKETLGRVFNVLGDTIDGGKELGPDIKRDPIHRDPPDYDELNPSTEVLETGIKVIDLLAPYIRGGKIGLFGGAGVGKTVLIQELIHNIAQEHNGISVFTGVGERTREGNDLYFEMKGSGVLERTAMVYGQMNEPPGARMRVALTGLTIAEHFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGQLQERITSTKKGSVTSIQAVYVPADDYTDPAPATTFAHLDATTNLERALTQQGIYPAVDPLASTSTALDPQIVGEEHYEVATEVQHVLQRYKELQDIISILGMDELSDEEKTVVARARRIQLFLSQDFSVAAQFTGLPGHYVKIEDTISGFKGILDGKYDDLPEEAFRLVGSIDDV 457
>gi|62085212|gb|AAX63009.1| ATP synthase beta subunit [Celastrus scandens] (482 aa)
Score = 1493, Expect = 3.0e-163, Identities = 303/455 (66%), Positives = 361/455 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK----KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K + G I QI GPV+DV F+  +MPNI + L VK  +       L+ EV  L G++  R ++M +TEGL RG+ VI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIHK  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:     8 KKNLGRIAQIIGPVLDVTFSPGKMPNIYNALAVKGRDTSGHAINLICEVQQLLGNNQVRAVAMSATEGLMRGMSVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHKSAPAFIQLETKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKKGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFKLILSGELDGLPEQAFYLVGNIDE 473
>gi|25010936|ref|NP_735331.1| F0F1 ATP synthase subunit beta [Streptococcus agalactiae NEM316] >gi|81845628|sp|Q8E5U8|ATPB_STRA3 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|23095315|emb|CAD46525.1| H+-transporting ATP synthase beta chain [Streptococcus agalactiae NEM316] (468 aa)
Score = 1493, Expect = 3.1e-163, Identities = 295/435 (67%), Positives = 351/435 (80%)
  Q:   317 NQMPNINDCLEVKLPNNK--KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPID-NKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           +++P IN+ L V    +K  K+VLEV L  GD + R I+M ST+GL RGLEV++T   I  PVG   LGR+FNV+G+ ID  +P  E  E  PIHKK PSFDE ST +EI ETGIKVIDLL PY+KGGK+GLFGGAGVGKTVL+QELIHNIA  HGG+S+F GVGERTREGNDLY EM + GVI +TA+VFGQMNEPPGARMRVALT LT+AE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMGQLQERITSTK GS+TS+QA+YVPADD TDPAP+T FAHLD+ T L+RK+  +GIYPA++PL SSSR L P IVG EHY+VA  VQ +LQ++ ELQDIIAILG+DELS+E+K  V RAR+I+ FLSQ F VAE F+ + G YV  ++T+ GF EI++GK D IPE  F  VGGI+DV
  S:    22 DKLPEINNALIVYKNGDKSQKVVLEVTLELGDGLVRTIAMESTDGLTRGLEVLDTGRAISVPVGKDTLGRVFNVLGDAIDLEEPFAEDAERQPIHKKAPSFDELSTSSEILETGIKVIDLLAPYLKGGKVGLFGGAGVGKTVLIQELIHNIAQEHGGISVFTGVGERTREGNDLYWEMKESGVIEKTAMVFGQMNEPPGARMRVALTGLTIAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGSVTSIQAIYVPADDYTDPAPATAFAHLDSTTNLERKLTQMGIYPAVDPLASSSRALTPEIVGDEHYEVATEVQRVLQRYRELQDIIAILGMDELSDEEKTLVGRARRIQFFLSQNFNVAETFTGQPGSYVPVEETVRGFKEILDGKHDQIPEDAFRMVGGIEDV 459
>gi|119487855|ref|ZP_01621352.1| ATP synthase F1, beta subunit [Lyngbya sp. PCC 8106] >gi|119455431|gb|EAW36569.1| ATP synthase F1, beta subunit [Lyngbya sp. PCC 8106] (482 aa)
Score = 1492, Expect = 4.0e-163, Identities = 302/456 (66%), Positives = 365/456 (80%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK----KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDN-KPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVIN-------QTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           +++ G I Q+ GPVVDVKF+  +MP I + L +K  N       +  EV  L GD   R +SM +T+GL RG+EVI+T   I  PVG A LGR+FNV+GEP+DN  P+  +  +S IH+  P+F E  TK  +FETGIKV+DLL PY +GGKIGLFGGAGVGKTV++ EL++NIA  HGG+S+F GVGERTREGNDLY EMI+ GVIN       + ALV+GQMNEPPGARMRV L+AL MAE+FR+ +KQDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL  +MG+LQERITSTK GSITSVQAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML  S+VG EHY+ AR+VQ  LQ+++ELQDIIAILG+DELSEED+ TVSRARKI  FLSQPFFVAE F+   G+YV  +DT+ GF  I+ G+ DD+PEQ F  VGGID V
  S:     7 RTNVGYITQVIGPVVDVKFSAGKMPEIYNALTIKGQNEAGQEVSVTCEVQQLLGDHQIRAVSMSTTDGLVRGMEVIDTGTAISVPVGPATLGRIFNVLGEPVDNLGPVNAETTFS-IHRSAPAFTELETKPAVFETGIKVLDLLAPYRRGGKIGLFGGAGVGKTVIMMELVNNIAKAHGGVSVFGGVGERTREGNDLYQEMIESGVINLEDRTKSKIALVYGQMNEPPGARMRVGLSALAMAEYFRDVSKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLGTDMGELQERITSTKEGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSRALAAKGIYPAVDPLDSTSTMLQSSVVGDEHYQTARAVQATLQRYKELQDIIAILGLDELSEEDRRTVSRARKIERFLSQPFFVAEVFTGAPGQYVELKDTLKGFQMILAGELDDLPEQAFYMVGGIDQV 473
>gi|161507276|ref|YP_001577230.1| F0F1 ATP synthase subunit beta [Lactobacillus helveticus DPC 4571] >gi|172048219|sp|A8YUK1|ATPB_LACH4 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|160348265|gb|ABX26939.1| ATP synthase beta subunit [Lactobacillus helveticus DPC 4571] (479 aa)
Score = 1490, Expect = 5.6e-163, Identities = 297/455 (65%), Positives = 361/455 (79%)
  Q:   299 KGIIYQIFGPVVDVKFARNQ-MPNINDCLEVKLPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVE-YSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHK 753
           +G I Q+ GPV+DVKF  ++ +PNIN+ L V    N+ +VLEV +  GD V R I+M ST+GL RG++V +T  PI  PVG   LGR+FNV+G+PID  P   K      IHK+ P +++ +T  EI ETGIKVIDLL PYV+GGK+GLFGGAGVGKT ++QELIHNIA  HGG+S+F GVGERTREGNDLY EM   GV+++TA+VFGQMNEPPGARMRVALT LT+AE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMGQLQERITSTK GSITS+QAVYVPADD TDPAPSTTFAHLDA T L+R +   GIYPA++PLESSS  LDP +VG EHY+VA  VQ +LQ++ ELQDII++LG+DELS+E+KL V+RARK++ FLSQ FFVAE+F+   G YV  ++TI GF  I++G  DD+PE  F  VG I+DV K
  S:     3 EGEIVQVIGPVIDVKFPIDKNLPNINNALRVIKSENESIVLEVTVELGDGVLRTIAMESTDGLRRGMKVEDTGGPISVPVGEDTLGRVFNVLGQPIDGGPAFSKDHPRESIHKEAPKYEDLTTSREILETGIKVIDLLEPYVRGGKVGLFGGAGVGKTTIIQELIHNIAQEHGGISVFTGVGERTREGNDLYFEMKASGVLSKTAMVFGQMNEPPGARMRVALTGLTLAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGSITSIQAVYVPADDYTDPAPSTTFAHLDATTNLERSLVEQGIYPAVDPLESSSSALDPEVVGKEHYEVATRVQHVLQRYHELQDIISVLGMDELSDEEKLIVARARKVQFFLSQNFFVAEQFTGVPGSYVPIKETIKGFKLILDGHLDDLPEDSFRGVGPIEDVLK 459
>gi|4995183|emb|CAB44042.1| H(+)-transporting ATP synthase [Hermannia erodioides] (484 aa)
Score = 1490, Expect = 5.7e-163, Identities = 304/455 (66%), Positives = 361/455 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K + G I QI GPV+DV F   +MPNI + L VK    L     +  EV  L G++  R ++M +TEGL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIHK+ P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:     6 KRNLGRISQIIGPVLDVAFPPGKMPNIYNALVVKGRDTLGQQINVTCEVQQLLGNNRVRAVAMSATEGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHKRAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNLAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFKLILSGELDGLPEQAFYLVGNIDE 471
>gi|195977927|ref|YP_002123171.1| ATP synthase beta chain AtpD [Streptococcus equi subsp. zooepidemicus str. MGCS10565] >gi|195974632|gb|ACG62158.1| ATP synthase beta chain AtpD [Streptococcus equi subsp. zooepidemicus str. MGCS10565] (468 aa)
Score = 1490, Expect = 6.3e-163, Identities = 295/435 (67%), Positives = 348/435 (80%)
  Q:   317 NQMPNINDCLEVKLPNNKK--LVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPID-NKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           +++P IN+ L V    +KK  +VLEVAL  GD + R I+M ST+GL RGLEV++T   I  PVG   LGR+FNV+GE ID   P  + V   PIHKK P+FDE ST +EI ETGIKVIDLL PY+KGGK+GLFGGAGVGKTVL+QELIHNIA  HGG+S+F GVGERTREGNDLY EM + GVI +TA+VFGQMNEPPGARMRVALT LT+AE+FR+   QDVLLFIDNIFRF+QAGSEVSALLGR+PSAVGYQPTLA EMGQLQERITSTK GS+TS+QA+YVPADD TDPAP+T FAHLD+ T L+RK+  +GIYPA++PL SSSR L P IVG EHY VA  VQ +LQ++ ELQDIIAILG+DELSEE+K  V RAR+I+ FLSQ F VAE+F+   G YV   +T+ GF EI+EGK D +PE  F  VG I+DV
  S:    22 DKLPEINNALIVYKDGDKKQKIVLEVALELGDGMVRTIAMESTDGLTRGLEVLDTGRAISVPVGKETLGRVFNVLGETIDLEAPFADDVNREPIHKKAPAFDELSTSSEILETGIKVIDLLAPYLKGGKVGLFGGAGVGKTVLIQELIHNIAQEHGGISVFTGVGERTREGNDLYWEMKESGVIEKTAMVFGQMNEPPGARMRVALTGLTIAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGSVTSIQAIYVPADDYTDPAPATAFAHLDSTTNLERKLTQMGIYPAVDPLASSSRALSPEIVGEEHYAVATEVQRVLQRYRELQDIIAILGMDELSEEEKTLVGRARRIQFFLSQNFNVAEQFTGLPGSYVPVAETVRGFKEILEGKHDHLPEDAFRAVGPIEDV 459
>gi|57868946|gb|AAW57469.1| ATP synthase beta subunit [Cleyera japonica] (485 aa)
Score = 1490, Expect = 6.5e-163, Identities = 302/455 (66%), Positives = 361/455 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K + G I QI GPV+DV F+  +MPNI + L VK    L     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:    14 KKNLGRIVQIIGPVLDVAFSPGKMPNIYNALVVKGRDTLGQPINVTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFQLILSGELDGLPEQAFYLVGNIDE 479
>gi|156530119|gb|ABU75156.1| AtpB [Castela erecta] (488 aa)
Score = 1490, Expect = 6.6e-163, Identities = 304/456 (66%), Positives = 362/456 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK----KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           K + G I QI GPV+DV F   +MPNI + L VK  +       +  EV  L G++  R ++M +TEGL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIHK+ P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+V
  S:    15 KKNLGHIAQIIGPVLDVAFPPGKMPNIYNALVVKSRDTVGQLINVTCEVQQLLGNNRVRAVAMSATEGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHKRAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFKLILSGELDGLPEQAFYLVGNIDEV 481
>gi|14718015|gb|AAK72749.1| ATP synthase beta subunit [Coccoloba uvifera] (469 aa)
Score = 1490, Expect = 6.9e-163, Identities = 300/451 (66%), Positives = 357/451 (79%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK----KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           G + QI GP +DV F   +MPNI + L VK  +       +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ NKQDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHYK A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:     2 GRVAQIIGPXLDVAFPPGKMPNIYNALVVKGRDTAGQPINVTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKQGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRALAAKGIYPAVDPLDSTSTMLQPRIVGEEHYKTAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFQLILSGELDGLPEQAFYLVGNIDE 463
>gi|124361816|gb|ABN09350.1| ATP synthase beta subunit [Halesia carolina] (465 aa)
Score = 1489, Expect = 7.5e-163, Identities = 302/451 (66%), Positives = 360/451 (79%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVK------LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           G+I QI GPV+DV F   +MPNI + L VK       P N  +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:     1 GLIVQIIGPVLDVAFPPGKMPNIYNALVVKGRDIGGQPIN--VTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFQLILSGELDGLPEQAFYLVGNIDE 462
>gi|124361808|gb|ABN09346.1| ATP synthase beta subunit [Adinandra dumosa] >gi|124361810|gb|ABN09347.1| ATP synthase beta subunit [Cleyera japonica] (465 aa)
Score = 1489, Expect = 7.5e-163, Identities = 301/451 (66%), Positives = 359/451 (79%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           G I QI GPV+DV F+  +MPNI + L VK    L     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:     1 GRIVQIIGPVLDVAFSPGKMPNIYNALVVKGRDTLGQPINVTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFQLILSGELDGLPEQAFYLVGNIDE 462
>gi|15644358|ref|NP_229410.1| F0F1 ATP synthase subunit beta [Thermotoga maritima MSB8] >gi|148270311|ref|YP_001244771.1| F0F1 ATP synthase subunit beta [Thermotoga petrophila RKU-1] >gi|170289062|ref|YP_001739300.1| ATP synthase F1, beta subunit [Thermotoga sp. RQ2] >gi|166222424|sp|A5ILX2|ATPB_THEP1 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|3913124|sp|O50550|ATPB_THEMA ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|4982182|gb|AAD36677.1|AE001805_2 ATP synthase F1, subunit beta [Thermotoga maritima MSB8] >gi|2687836|emb|CAA75784.1| F1F0-ATPase beta subunit [Thermotoga maritima] >gi|147735855|gb|ABQ47195.1| ATP synthase F1, beta subunit [Thermotoga petrophila RKU-1] >gi|170176565|gb|ACB09617.1| ATP synthase F1, beta subunit [Thermotoga sp. RQ2] (468 aa)
Score = 1489, Expect = 7.6e-163, Identities = 303/458 (66%), Positives = 367/458 (80%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNN-KKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHK 753
           K  KG I  I GPVVDVKF   ++P+I + LEV  P   +K+VLEV  L GD V R ++M ST+GL +GLEV++T  PI APVG  VLGR+ NV+GEP+D     +  E  PIH+  P   EQST+ EI ETGIKVIDLL P+ KGGKIG FGGAGVGKTVLV ELI NIA  H G S+FAGVGERTREGN+L+ EM + GV+  T LVFGQMNEPPGAR RVALTALT+AE+FR+   +DVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTLA +MG+LQERITST+ GSITSVQA+YVPADD+TDPAP+TTFAHLDA  VL R+IA LG+YPA++PL+SSS++LDP+IVG EHY+VAR VQ +LQ++++LQDIIAILG++ELS EDKL V RAR+I+ FLSQPF VAE+F+ + G+YV  ++TI GF EI++GK DD+PEQ FL  G ID+V +
  S:     3 KGSKGFIVSIMGPVVDVKFPEEELPDIYNALEVVNPQTGQKVVLEVEQLIGDGVVRTVAMDSTDGLTKGLEVVDTGAPITAPVGKEVLGRILNVIGEPVDEAGEIKAKERWPIHRPAPELVEQSTEIEILETGIKVIDLLAPFPKGGKIGFFGGAGVGKTVLVMELIRNIAIEHKGFSVFAGVGERTREGNELWLEMQESGVLGNTVLVFGQMNEPPGARFRVALTALTIAEYFRDVEGRDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLATDMGELQERITSTRRGSITSVQAIYVPADDITDPAPATTFAHLDATVVLSRRIAELGLYPAVDPLDSSSKILDPAIVGREHYEVARGVQEVLQRYKDLQDIIAILGVEELSPEDKLVVHRARRIQRFLSQPFHVAERFTGRPGRYVPIEETIRGFKEILDGKLDDVPEQAFLMAGNIDEVKE 461
>gi|61968315|gb|AAX57084.1| ATP synthase beta subunit [Savia dictyocarpa] (479 aa)
Score = 1489, Expect = 8.3e-163, Identities = 303/455 (66%), Positives = 361/455 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K + G I QI GPV+DV F   +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVINT  P+  PVG A LGR+FNV+GEP+D+    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ NKQDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYVS  +TI GF  I+ G+ D +PEQ F  VG ID+
  S:     5 KKNLGRIAQIIGPVLDVAFPPGKMPNIYNALVVKGRDTVGQQINVTCEVQQLLGNNRVRAVAMSATDGLMRGMEVINTGAPLSVPVGGATLGRIFNVLGEPVDDLGPVDTRATSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYREMKESGVINEENLAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKKGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPQIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVSLAETIRGFKLILSGELDSLPEQAFYLVGNIDE 470
>gi|24940190|emb|CAD43377.1| ATP synthase beta subunit [Lappula squarrosa] (484 aa)
Score = 1488, Expect = 9.6e-163, Identities = 301/455 (66%), Positives = 363/455 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K++ G I QI GPV+DV F+  +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK+GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:     9 KNNLGRIVQIIGPVLDVAFSPGKMPNIYNALVVKGRDTVGQPINVTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEENIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGTLQERITSTKAGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFQLILSGELDGLPEQAFYLVGNIDE 474
>gi|156530143|gb|ABU75168.1| AtpB [Leitneria floridana] (487 aa)
Score = 1488, Expect = 1.1e-162, Identities = 303/456 (66%), Positives = 361/456 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK----KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           K + G I QI GPV+DV F   +MPNI + L VK  +       +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIHK  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+V
  S:    16 KKNLGHIAQIIGPVLDVAFPPGKMPNIYNALVVKGRDTAGQPINMTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHKAAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFKLILSGELDGLPEQAFYLVGNIDEV 482
>gi|62085198|gb|AAX63003.1| ATP synthase beta subunit [Tetracoccus dioicus] (482 aa)
Score = 1488, Expect = 1.2e-162, Identities = 305/455 (67%), Positives = 364/455 (80%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK----KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K ++G I QI GPV+DV F R +MPNI + L VK  +       +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+D     +    SPIH+  P+F E  TK EIFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ NKQDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL RK+A+ GIYPA++PL+S+S ML P+IVG +HY+ AR V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:     2 KKNRGRIVQIIGPVLDVVFPRGKMPNIYNALVVKGRDTTGQQINVTCEVQQLLGNNRVRTVAMSATDGLMRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDELGPVDTRTTSPIHRSAPAFIELDTKLEIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKNHGGVSVFGGVGERTREGNDLYKEMKESGVINEENIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKKGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRKLAAKGIYPAVDPLDSTSTMLQPNIVGSDHYETARKVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTSSPGKYVGLAETIRGFKLILSGELDSLPEQAFYLVGNIDE 467
>gi|194476695|ref|YP_002048874.1| ATP synthase subunit B [Paulinella chromatophora] >gi|171191702|gb|ACB42664.1| ATP synthase subunit B [Paulinella chromatophora] (488 aa)
Score = 1488, Expect = 1.2e-162, Identities = 300/453 (66%), Positives = 358/453 (79%)
  Q:   299 KGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPN----NKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVIN-------QTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           KGI+ Q+ GPV+DV+F   ++P I + L V   N    N  L  EV  L GD   R ++M ST+GL RG+E ++T  PI  PVG A LGR+FNV+GEP+D +        +PIH+  P   E  TK ++FETGIKVIDLL PY +GGK+GLFGGAGVGKTVL+QELI+NIA  HGG+S+F GVGERTREGNDLY E  + GVIN       + AL +GQMNEPPGARMRV L+ALTMAEHFR+ NKQDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL  ++GQLQERITST  GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +AS GIYPA++PL+S+S ML PSIVG EHY+ AR+VQ  LQ+++ELQDIIAILG+DELSE D+LTV RARKI  FLSQPFFVAE F+ +SG+YV  ++TI GF+ I+ G+ DD+PE  F  VG ID V
  S:    12 KGIVRQVIGPVLDVEFPAGKLPKIYNALRVAGKNSAGQNVALTAEVQQLLGDHRVRAVAMSSTDGLVRGMEAMDTGAPIAVPVGEATLGRIFNVLGEPVDEQGPVNTTTTAPIHRAAPKLTELQTKPKVFETGIKVIDLLAPYRQGGKVGLFGGAGVGKTVLIQELINNIAKEHGGVSVFGGVGERTREGNDLYEEFKESGVINSKDLSKSKVALCYGQMNEPPGARMRVGLSALTMAEHFRDVNKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLGTDVGQLQERITSTLEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLASKGIYPAVDPLDSTSTMLQPSIVGDEHYRTARAVQANLQRYKELQDIIAILGLDELSEADRLTVDRARKIEKFLSQPFFVAEVFTGQSGEYVKLEETIKGFNMILAGELDDLPEAAFYLVGTIDQV 475
>gi|7708215|emb|CAB90045.1| ATP synthase beta subunit [Corynocarpus laevigata] (487 aa)
Score = 1488, Expect = 1.2e-162, Identities = 303/455 (66%), Positives = 360/455 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K D G I QI GPV+DV F   +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEPIDN    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:     7 KKDPGRIAQIIGPVLDVAFPPGKMPNIYNALVVKGRDTVGQQINVTCEVQQLLGNNRVRAVAMSATDGLMRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPIDNLGPVDTRTTSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFKLILSGELDGLPEQAFYLVGNIDE 472
>gi|24940162|emb|CAD43366.1| ATP synthase beta subunit [Borago officinalis] (483 aa)
Score = 1488, Expect = 1.2e-162, Identities = 302/455 (66%), Positives = 361/455 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K + G I QI GPV+DV F   +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTKSGSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:     9 KKNLGRIVQIIGPVLDVAFRLGKMPNIYNALVVKGRDTVGQPINVTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEENIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGTLQERITSTKSGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFQLILSGELDGLPEQAFYLVGNIDE 474
>gi|8517661|emb|CAB94382.1| ATP synthase beta subunit [Silene nutans] (488 aa)
Score = 1487, Expect = 1.2e-162, Identities = 302/455 (66%), Positives = 361/455 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK----KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K + G I QI GPV+DV F + +MPNI + L VK  +       +  EV  L G++  R ++M +TEGL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN         SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY++A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:    15 KKNLGRIAQIIGPVLDVXFLQXKMPNIYNALVVKGRDTASQPINVTCEVQQLLGNNRVRAVAMSATEGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVGTHTTSPIHRSAPAFTQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYEIAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLGETIRGFQLILSGELDGLPEQAFYLVGNIDE 480
>gi|156530115|gb|ABU75154.1| AtpB [Castela coccinea] (485 aa)
Score = 1487, Expect = 1.3e-162, Identities = 303/456 (66%), Positives = 362/456 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK----KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           K + G I QI GPV+DV F   +MPNI + L VK  +       +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIHK+ P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+V
  S:    17 KKNLGHIAQIIGPVLDVAFPPGKMPNIYNALVVKSRDTVGQPINVTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHKRAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFKLILSGELDGLPEQAFYLVGNIDEV 483
>gi|62085210|gb|AAX63008.1| ATP synthase beta subunit [Celastrus orbiculatus] (486 aa)
Score = 1487, Expect = 1.3e-162, Identities = 302/455 (66%), Positives = 361/455 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK----KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K + G I QI GPV+DV F+  +MPNI + L VK  +       L+ EV  L G++  R ++M +T+GL RG+ VI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIHK  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:     9 KKNLGRIAQIIGPVLDVAFSPGKMPNIYNALVVKGRDTSGHTINLICEVQQLLGNNQVRAVAMSATDGLMRGMGVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHKSAPAFIQLETKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKKGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFKLILSGELDGLPEQAFYLVGNIDE 474
>gi|4995191|emb|CAB44036.1| H(+)-transporting ATP synthase [Heliocarpus americanus] (482 aa)
Score = 1487, Expect = 1.4e-162, Identities = 305/461 (66%), Positives = 366/461 (79%)
  Q:   291 KLNTL-KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           +++TL K + G I QI GPV+DV F   +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIHK  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+V
  S:     2 RISTLEKENLGRISQIIGPVLDVAFPPGKMPNIYNALVVKGRDIVGQQINVTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTSTTSPIHKSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNLAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGTLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFKLILSGELDSLPEQAFYLVGNIDEV 474
>gi|11467034|ref|NP_041941.1| ATP synthase CF1 beta subunit [Euglena gracilis] >gi|399080|sp|P31476|ATPB_EUGGR ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|415784|emb|CAA50128.1| ATP Synthase, beta subunit [Euglena gracilis] (480 aa)
Score = 1487, Expect = 1.4e-162, Identities = 302/459 (65%), Positives = 364/459 (79%)
  Q:   293 NTLKSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK----KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVIN-------QTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           ++L+ + GII QI GPV+D+ F   +MPNI + L ++         K+V EV  L GD+V R I+M +T+GL RG++VI+T  P+  PVG   LGR+FNV+GE +D   + +     PIH+  PSF E  T+  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN       + AL++GQMNEPPGARMRV LTALTMAE+FR+ NKQDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTLA EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +AS GIYPA++PL+S+S ML P IVG EHY  A+SV+  LQ+++ELQDIIAILG+DELSEED+L VSRARK+  FLSQPFFVAE F+   GKYV+  +TI GF  I+ G  D++PEQ F  VG I++V
  S:     3 SSLRLNTGIILQIIGPVMDISFPSGKMPNIYNSLLIEGKTESGDRLKVVCEVQQLLGDNVVRAIAMSATDGLQRGIKVIDTGAPLSVPVGVTTLGRIFNVLGESVDKMGLIDYSITLPIHRAAPSFVELDTQLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYQEMKESGVINDRNFKESKVALIYGQMNEPPGARMRVGLTALTMAEYFRDVNKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLATEMGGLQERITSTKVGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRNLASKGIYPAVDPLDSTSTMLQPWIVGEEHYNTAQSVKKTLQRYKELQDIIAILGLDELSEEDRLVVSRARKVERFLSQPFFVAEVFTGSPGKYVTLAETIEGFKAILSGDLDEVPEQAFYLVGNIEEV 472
>gi|7708171|emb|CAB90030.1| ATP synthase beta subunit [Borago officinalis] (489 aa)
Score = 1487, Expect = 1.4e-162, Identities = 302/455 (66%), Positives = 361/455 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K + G I QI GPV+DV F   +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTKSGSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:    15 KKNLGRIVQIIGPVLDVAFRLGKMPNIYNALVVKGRDTVGQPINVTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEENIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGTLQERITSTKSGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFQLILSGELDGLPEQAFYLVGNIDE 480
>gi|146188928|emb|CAJ34343.1| atp synthase subunit beta [Soyauxia talbotii] (481 aa)
Score = 1487, Expect = 1.5e-162, Identities = 301/455 (66%), Positives = 360/455 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K + G I QI GPV+DV F   +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:     8 KKNLGRIAQIIGPVLDVAFPPGKMPNIYNALVVKGRDTVGQQINVTCEVQQLLGNNRVRAVAMSATDGLMRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFQLILSGELDGLPEQAFYLVGNIDE 473
>gi|14718222|gb|AAK72849.1| ATP synthase beta subunit [Shepherdia canadensis] (476 aa)
Score = 1487, Expect = 1.5e-162, Identities = 304/455 (66%), Positives = 359/455 (78%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K + G I QI GP +DV F   +MPNI + L VK    L     L  EV  L G++  R ++M +TEGL RG+EVI+T  P+  PVG A LGR+FNV+GEPIDN    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:     6 KKNLGRIAQIIGPXLDVXFPPGKMPNIYNALIVKGRDTLGQEINLTCEVQQLLGNNRVRAVAMSATEGLMRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPIDNLGPVDTRTTSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFKLILSGELDGLPEQAFYLVGNIDE 471
>gi|20269402|gb|AAM17928.1| ATP synthase beta subunit [Clethra arborea] (490 aa)
Score = 1487, Expect = 1.5e-162, Identities = 303/455 (66%), Positives = 360/455 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK------LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K   G I QI GPV+DV F   +MPNI + L VK       P N  +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:    17 KKKPGCIVQIIGPVLDVAFPTGKMPNIYNALIVKGRDTAGQPMN--VTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGTLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFQLILSGELDSLPEQAFYLVGNIDE 482
>gi|156530107|gb|ABU75150.1| AtpB [Brucea ferruginea] (467 aa)
Score = 1486, Expect = 1.6e-162, Identities = 302/452 (66%), Positives = 359/452 (79%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           G I QI GPV+DV F   +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIHK  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+V
  S:     1 GHIAQIIGPVLDVAFPPGKMPNIYNALIVKGRDTVGQPINMTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHKPAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFKLILSGELDGLPEQAFYLVGNIDEV 463
>gi|20269410|gb|AAM17932.1| ATP synthase beta subunit [Eurya sp. Chung & Anderberg 1406] (490 aa)
Score = 1486, Expect = 1.7e-162, Identities = 301/455 (66%), Positives = 361/455 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K + G I QI GPV+DV F+  +MPNI + L VK    L     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSE+D+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:    17 KKNLGRIVQIIGPVLDVAFSPGKMPNIYNALVVKGRDTLGQPINVTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEDDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFQLILSGELDGLPEQAFYLVGNIDE 482
>gi|108796901|ref|YP_636199.1| CF1 beta subunit of ATP synthase [Pseudendoclonium akinetum] >gi|118573722|sp|Q3ZJ68|ATPB_PSEAK ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|56159599|gb|AAV80623.1| CF1 beta subunit of ATP synthase [Pseudendoclonium akinetum] (481 aa)
Score = 1486, Expect = 1.7e-162, Identities = 298/451 (66%), Positives = 357/451 (79%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK----KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           G I QI GPV+D  FA  Q+PNI + L +K  N       +  EV  L GD   R ++M +T+GL RG+ +++T  P+  PVG   LGR+FNV+GEP+D     +  E  PIH+K P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVI +        ALV+GQMNEPPGARMRV LTALTMAE+FR+ NKQDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTLA EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +AS GIYPA++PL+S+S ML P IVG EHY  A++V+  LQ+++ELQDIIAILG+DELSEED+  V+RARKI  FLSQPFFVAE F+   GKYVS ++TI GF++I+ G+ DD+PEQ F  VG +D+
  S:    12 GSITQIIGPVIDAAFAPGQLPNIYNALVIKGTNQAGQEVAVTCEVQQLLGDHCVRAVAMNATDGLMRGMNIVDTGKPLTVPVGKVTLGRIFNVLGEPVDGLEAVDSKESLPIHRKAPAFVDLDTKLAIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVIQEKNMSASKVALVYGQMNEPPGARMRVGLTALTMAEYFRDINKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLATEMGGLQERITSTKDGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLASKGIYPAVDPLDSTSTMLQPWIVGEEHYSCAQNVKETLQRYKELQDIIAILGLDELSEEDRKVVARARKIERFLSQPFFVAEVFTGSPGKYVSLKETIQGFNKILTGELDDLPEQAFYLVGTLDE 473
>gi|42559024|gb|AAS20198.1| ATP synthase beta subunit [Flagellaria indica] (479 aa)
Score = 1486, Expect = 1.7e-162, Identities = 303/467 (64%), Positives = 366/467 (78%)
  Q:   298 DKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHKNYVAANSNNKV 764
           +KG I QI GPV+DV F   ++PNI + L VK    + +   +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIH+  P+F E  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ NKQ+VLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY++A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+  +GKYV    TI GF  I+ G+ D +PEQ F  VG ID+     +     NK+
  S:     2 NKGSIIQIIGPVLDVNFPSGKLPNIYNALVVKGRDTVGHQINVTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTSATSPIHRSAPAFIELDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYKEMKESGVINEKNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNKQNVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKKGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRVLAAKGIYPAVDPLDSTSTMLQPRIVGDEHYEIAQRVKETLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSAGKYVGLAXTIRGFQLILSGELDGLPEQAFYLVGNIDEATAKAMNLEGENKL 479
>gi|57868956|gb|AAW57474.1| ATP synthase beta subunit [Bruinsmia styracoides] (492 aa)
Score = 1486, Expect = 1.8e-162, Identities = 301/455 (66%), Positives = 360/455 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK----KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K   G+I QI GPV+DV F   +MPNI + L VK  +       +  EV  L G++  R ++M +T+GL RG+EVINT  P+  PVG A LGR+FNV+GEP+DN    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N Q+VLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG +HY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ DD+PEQ F  VG ID+
  S:    12 KKKPGLIVQIIGPVLDVAFPPGKMPNIYNALVVKCQDTGGQPINVTCEVQQLLGNNRVRAVAMSATDGLTRGMEVINTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYKEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNAQNVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKKGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEKHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFQLILSGELDDLPEQAFYLVGNIDE 477
>gi|124361812|gb|ABN09348.1| ATP synthase beta subunit [Barringtonia asiatica] (465 aa)
Score = 1486, Expect = 1.8e-162, Identities = 301/451 (66%), Positives = 358/451 (79%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           G I QI GPV+DV F   +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEPIDN    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:     1 GRIVQIIGPVLDVAFPPGKMPNIYNALVVKGRDTVGQPINVTCEVQQLLGNNRVRAVAMSATDGLMRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPIDNLGPVDTRTTSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFQLILSGELDGLPEQAFYLVGNIDE 462
>gi|7708516|emb|CAB89943.1| ATP synthase beta subunit [Nemopanthus mucronatus] (475 aa)
Score = 1486, Expect = 1.8e-162, Identities = 301/455 (66%), Positives = 360/455 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK----KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K + G I QI GPV+DV F   +MPNI + L VK  +       +  EV  L G++  R ++M +TEGL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSE+D+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:     2 KKNLGRILQIIGPVLDVAFGPGKMPNIYNALVVKGRDTAGQPINVTCEVQQLLGNNRVRAVAMSATEGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGTLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEDDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFQLILSGELDGLPEQAFYLVGNIDE 467
>gi|62902839|gb|AAY19334.1| ATP synthase beta subunit [Quetzalia occidentalis] (480 aa)
Score = 1486, Expect = 1.8e-162, Identities = 303/451 (67%), Positives = 360/451 (79%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           G I QI GPV+DV F+  +MPNI + L VK      N   +V EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIHK  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:     4 GRIAQIIGPVLDVAFSPGKMPNIYNALVVKGRDTAGNQINVVCEVQQLLGNNQVRAVAMSATDGLMRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTGTTSPIHKSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKKGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFKLILSGELDGLPEQAFYLVGNIDE 465
>gi|56675904|emb|CAB90001.2| ATP synthase beta subunit [Salacia pallescens] (482 aa)
Score = 1486, Expect = 1.9e-162, Identities = 301/455 (66%), Positives = 362/455 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK----KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K + G I QI GPV+DV F+  +MPNI + L VK  +       ++ EV  L G++  R ++M +T+GL RG++VI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIHK  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:     7 KKNLGRIAQIIGPVLDVAFSPGKMPNIYNALVVKGRDTSGHTINVICEVQQLLGNNQVRAVAMSATDGLMRGMDVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHKSAPAFIQLETKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKKGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFKLILSGELDGLPEQAFYLVGNIDE 472
>gi|62085217|gb|AAX63011.1| ATP synthase beta subunit [Denhamia celastroides] (481 aa)
Score = 1486, Expect = 1.9e-162, Identities = 301/455 (66%), Positives = 362/455 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK----KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K + G I QI GPV+DV F+  +MPNI + L VK  +       ++ EV  L G++  R ++M +T+GL RG++VI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIHK  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:     7 KKNLGRIAQIIGPVLDVAFSPGKMPNIYNALVVKGRDTSGHTINVICEVQQLLGNNQVRAVAMSATDGLMRGMDVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHKSAPAFIQLETKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKKGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFKLILSGELDGLPEQAFYLVGNIDE 472
>gi|66276259|gb|AAY44144.1| ATP synthase beta subunit [Begonia oxyloba] (488 aa)
Score = 1486, Expect = 1.9e-162, Identities = 307/474 (64%), Positives = 369/474 (77%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHKNYVAANSNNKVNSSNK 769
           K + G I QI GPV+DV F   +MPNI + L VK    L     +  EV  L G++  R ++M +T+GL RG+EVI+T+ P+  PVG A LGR+FNV+GEPIDN    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+      A  +N ++ S +K
  S:     8 KKNLGRIAQIIGPVLDVAFPPGKMPNIYNALVVKGRDTLGQQINVTCEVQQLLGNNRVRAVAMSATDGLMRGMEVIDTRAPLSVPVGGATLGRIFNVLGEPIDNLGPVDTRTTSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFKLILSGELDGLPEQAFYLVGNIDEA----TAKATNLEMESKSK 488
>gi|66276287|gb|AAY44158.1| ATP synthase beta subunit [Neoalsomitra sarcophylla] (484 aa)
Score = 1486, Expect = 1.9e-162, Identities = 305/469 (65%), Positives = 363/469 (77%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHKNYVAANSNNKV 764
           K   G I QI GPV+DV F   +MPNI + L VK    L     +  EV  L G++  R ++M +T+GL RG+EVI+T+ P+  PVG A LGR+FNV+GEPIDN    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+           NK+
  S:     4 KKSLGRIAQIIGPVLDVAFPPGKMPNIYNALVVKGRDTLGQQINVTCEVQQLLGNNRVRAVAMSATDGLMRGMEVIDTRAPLSVPVGGATLGRIFNVLGEPIDNLGPVDTRTTSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFQLILSGELDGLPEQAFYLVGNIDEATAKATNLEMENKL 483
>gi|66276279|gb|AAY44154.1| ATP synthase beta subunit [Gynostemma pentaphyllum] (488 aa)
Score = 1486, Expect = 1.9e-162, Identities = 304/455 (66%), Positives = 361/455 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K + G I QI GPV+DV F   +MPNI + L VK    L     +  EV  L G++  R ++M +T+GL RG+EVI+TK P+  PVG A LGR+FNV+GEPIDN    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:     8 KKNLGRIAQIIGPVLDVAFPPGKMPNIYNALVVKGRDTLGQQINVTCEVQQLLGNNRVRAVAMSATDGLMRGMEVIDTKAPLSVPVGGATLGRIFNVLGEPIDNLGPVDTRTTSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFKLILSGELDGLPEQAFYLVGNIDE 473
>gi|156530219|gb|ABU75206.1| AtpB [Soulamea sp. Robertson 2529] (470 aa)
Score = 1486, Expect = 1.9e-162, Identities = 302/452 (66%), Positives = 359/452 (79%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           G I QI GPV+DV F   +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIHK  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+V
  S:     3 GHIAQIIGPVLDVAFPPGKMPNIYNALVVKGRDTVGQPINMTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHKPAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNISKSKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFKLILSGELDGLPEQAFYLVGNIDEV 465
>gi|7708464|emb|CAB89921.1| ATP synthase beta subunit [Koelreuteria paniculata] (489 aa)
Score = 1486, Expect = 2.0e-162, Identities = 303/456 (66%), Positives = 362/456 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK----KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           K + G I QI GPV+DV F   +MPNI + L V+  N       +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIHK  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK+GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+V
  S:     9 KQNLGRIAQIIGPVLDVDFLPGEMPNIYNALVVRGRNTVGQPINVTCEVQQLLGNNRVRAVAMSATDGLMRGMEVIDTGTPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHKSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNLAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKAGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFKLILSGELDGLPEQAFYLVGNIDEV 475
>gi|156530117|gb|ABU75155.1| AtpB [Castela erecta] (493 aa)
Score = 1486, Expect = 2.0e-162, Identities = 304/456 (66%), Positives = 362/456 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK----KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           K + G I QI GPV+DV F   +MPNI + L VK  +       +  EV  L G++  R ++M +TEGL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIHK+ P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+V
  S:    12 KKNLGHIAQIIGPVLDVAFPPGKMPNIYNALVVKSRDTVGQLINVTCEVQQLLGNNRVRAVAMSATEGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHKRAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFKLILSGELDGLPEQAFYLVGNIDEV 478
>gi|8452718|emb|CAB89961.2| ATP synthase beta subunit [Parnassia palustris] (490 aa)
Score = 1485, Expect = 2.1e-162, Identities = 301/455 (66%), Positives = 362/455 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK----KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           + + G I QI GPV+DV F+  +MPNI + L VK  +       +V EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:    17 RKNLGRIAQIIGPVLDVAFSPGKMPNIYNALVVKGRDTAGQQINVVCEVQQLLGNNQVRAVAMSATDGLTRGMEVIDTGVPLNVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFXGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKKGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFKLILSGELDGLPEQAFYLVGNIDE 482
>gi|7708552|emb|CAB89959.1| ATP synthase beta subunit [Plumeria obtusa] (484 aa)
Score = 1485, Expect = 2.1e-162, Identities = 302/455 (66%), Positives = 361/455 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K++ G I QI GPV+DV F   +MPNI + L VK    L     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:    15 KNNLGHIVQIIGPVLDVAFPPGKMPNIYNALVVKGRDTLGQPINVTCEVQQLLGNNRVRAVAMSATDGLMRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDARTTSPIHRSAPAFVQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEENIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPGIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFQLILSGELDGLPEQAFYLVGNIDE 480
>gi|3913123|sp|O50341|ATPB_FERIS ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|2687832|emb|CAA75783.1| F1F0-ATPase beta subunit [Fervidobacterium islandicum] (472 aa)
Score = 1485, Expect = 2.2e-162, Identities = 306/455 (67%), Positives = 365/455 (80%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNN-KKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K   G I +I GPVVDVKF    +P+I D L V  P   KKL+LEV  L GD++ R ++M ST+GL RGLEV NT  PI APVG  VLGRMFNV+GEPID +   + +EY PIH+  PS  EQ T+ EI ETG+KVIDLL P+ KGGKIG FGGAGVGKTVLV E+I NIA  H G SIFAGVGERTREGNDLY EM + GV+N T LVFGQMNEPPGAR RVALTALT+AE+FR+   +DVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ +MG+LQERITSTK GSITSVQA+YVPADD+TDPAP+TTF HLDA  VL R++A+LG+YPA++PL+S+S++LDP+IVG EHY+VAR VQ +LQ++++LQDIIAILG++ELSEEDKL V RARKI+ FL+QP  VAE+FS   G YV  ++TI GF EI+EG+ DD+PE  F  VG ID+
  S:     3 KKSVGKIVRIIGPVVDVKFQEGDLPDIYDALVVINPQTGKKLILEVEQLIGDNIVRTVAMDSTDGLVRGLEVENTGEPIKAPVGRGVLGRMFNVIGEPIDEQGELKDIEYWPIHRPAPSMTEQKTEIEILETGLKVIDLLAPFPKGGKIGFFGGAGVGKTVLVMEMIRNIAIEHHGFSIFAGVGERTREGNDLYLEMTEAGVLNNTVLVFGQMNEPPGARFRVALTALTIAEYFRDVEGRDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTDMGELQERITSTKKGSITSVQAIYVPADDITDPAPATTFTHLDATIVLSRQLAALGLYPAVDPLDSTSKILDPNIVGKEHYEVARGVQEVLQRYKDLQDIIAILGMEELSEEDKLIVQRARKIQRFLTQPTHVAERFSGIPGVYVPIKETIRGFKEILEGRYDDLPEAAFYMVGTIDE 458
>gi|24940256|emb|CAD43386.1| ATP synthase beta subunit [Patagonula americana] (489 aa)
Score = 1485, Expect = 2.3e-162, Identities = 301/455 (66%), Positives = 361/455 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K + G I QI GPV+DV F   +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK+GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:     9 KKNLGRIVQIIGPVLDVAFPPGKMPNIYNALVVKGRDTVGQPINVTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHRPAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEENIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKAGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFQLILSGELDGLPEQAFYLVGNIDE 474
>gi|65332616|gb|AAY42232.1| ATP synthase beta subunit [Anisophyllea sororia] (479 aa)
Score = 1485, Expect = 2.3e-162, Identities = 302/466 (64%), Positives = 362/466 (77%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHKNYVAANSNNKVN 765
           G I QI GPV+DV F   +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEPIDN    +    SPIH+  P+F + +TK  IFETGIKV+DLL PY +GGK+GLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ NKQDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+L V+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+           +K+N
  S:     3 GRIAQIIGPVLDVAFPPGKMPNIYNALVVKGRDTVGQQINVTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPIDNLGPVDTRTTSPIHRSAPAFIQLATKLSIFETGIKVVDLLAPYRRGGKVGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLIVARARKIERFLSQPFFVAEVFTGSPGKYVGLSETIRGFQLILSGELDSLPEQAFYLVGNIDEATAKATNLEMGSKLN 479
>gi|14717958|gb|AAK72721.1| ATP synthase beta subunit [Bauera rubioides] (481 aa)
Score = 1485, Expect = 2.3e-162, Identities = 302/455 (66%), Positives = 359/455 (78%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K   G I QI GPV+DV F   +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEPIDN    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:     8 KKTLGRIAQIIGPVLDVAFPPGKMPNIYNALVVKGRDTIGQQINVTCEVQQLLGNNRVRAVAMSATDGLMRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPIDNLGPVDTRTTSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEENIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGTLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFKLILSGELDGLPEQAFYLVGNIDE 473
>gi|57868930|gb|AAW57461.1| ATP synthase beta subunit [Impatiens auricoma] (493 aa)
Score = 1485, Expect = 2.3e-162, Identities = 302/451 (66%), Positives = 360/451 (79%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK----KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           G I QI GPV+DV F+  +MPNI + L VK  +       +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEPIDN    +    SPIHK  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY++A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:    17 GRIVQIIGPVLDVAFSPGKMPNIYNALVVKGRDTAGQPINVTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPIDNLGPVDTSTTSPIHKSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNFGESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKQGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYEIAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLSETIRGFQLILSGELDGLPEQAFYLVGNIDE 478
>gi|156530141|gb|ABU75167.1| AtpB [Holacantha emoryi] (475 aa)
Score = 1485, Expect = 2.4e-162, Identities = 302/452 (66%), Positives = 360/452 (79%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           G I QI GPV+DV F   +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIHK+ P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+V
  S:     3 GHIAQIIGPVLDVAFPPGKMPNIYNALVVKGRDTVGQPINVTCEVQQLLGNNRVRAVAMSATDGLRRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHKRAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKETLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFKLILSGELDGLPEQAFYLVGNIDEV 465
>gi|194267333|gb|ACF35653.1| ATP synthase beta subunit [Floydia praealta] (487 aa)
Score = 1485, Expect = 2.4e-162, Identities = 304/461 (65%), Positives = 364/461 (78%)
  Q:   290 MKLNTLKSDKGI----------IYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           MK+N   S  G+          I QI GPV+DV F   +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:     1 MKINPTTSGPGVSALEEKNLGRIAQIIGPVLDVAFPPGKMPNIYNALVVKGRDTVGQQINVTCEVQQLLGNNRVRAVAMSATDGLMRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKGGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFQLILSGELDGLPEQAFYLVGNIDE 482
>gi|7708616|emb|CAB89980.1| ATP synthase beta subunit [Rheum pinchonii] (484 aa)
Score = 1485, Expect = 2.4e-162, Identities = 301/455 (66%), Positives = 360/455 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK----KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K + G + QI GPV+DV F   +MPNI + L VK  +       +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ NKQDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG  HYK+A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:     8 KINLGRVAQIIGPVLDVAFPPGKMPNIYNALVVKGRDTSGHPINVTCEVQQLLGNNRVRTVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEENIPESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKQGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRALAAKGIYPAVDPLDSTSTMLQPRIVGEAHYKIAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFQLILSGELDGLPEQAFYLVGNIDE 473
>gi|61968201|gb|AAX57027.1| ATP synthase beta subunit [Amanoa strobilacea] (479 aa)
Score = 1485, Expect = 2.5e-162, Identities = 302/455 (66%), Positives = 362/455 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDN-KPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K ++G I QI GPV+DV F   +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVI+T +P+  PVG   LGR+FNV+GEP+D+  P+  +  Y PIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM D GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ NKQDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK G+ITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A  GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ GK D +PEQ F  VG ID+
  S:     5 KKNQGRIAQIIGPVLDVAFPPGKMPNIYNALIVKGRDTVGQQINVTCEVQQLLGNNRVRAVAMSATDGLMRGMEVIDTGDPLSVPVGGVTLGRIFNVLGEPVDDLGPIDTRATY-PIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKDSGVINEENIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGAITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAVKGIYPAVDPLDSTSTMLQPQIVGPEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSRGKYVGLAETIRGFQLILSGKLDSLPEQAFYLVGNIDE 470
>gi|4206604|gb|AAD11733.1| ATP synthase beta subunit [Ptaeroxylon obliquum] (483 aa)
Score = 1485, Expect = 2.6e-162, Identities = 302/456 (66%), Positives = 361/456 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           K + G   QI GPV+DV F   +MPNIN+ L VK    +     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIHK  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG +HY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+V
  S:     9 KKNPGNFAQIIGPVMDVAFPPGKMPNINNALVVKGRDTVGQPINVACEVQQLLGNNRVRAVAMSATDGLMRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHKSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEDHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFKLILSGELDGLPEQAFYLVGNIDEV 475
>gi|21633383|gb|AAM52166.1| ATP synthase beta subunit [Wilsonia backhousei] (478 aa)
Score = 1485, Expect = 2.6e-162, Identities = 303/455 (66%), Positives = 360/455 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKK--LVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K   G I QI GPV+DV F   QMPNI + L V+  +N++  +  EV  L G++  R ++M  T GL RG+EVI+T  PI  PVG A LGR+FNV+GEP+DN    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:     5 KKTLGRIVQIIGPVLDVAFPPGQMPNIYNALVVQGRDNEQTNVTCEVQQLVGNNRVRAVAMSDTAGLMRGMEVIDTGAPISVPVGGATLGRIFNVLGEPVDNLGPVDTKTTSPIHRSAPAFVQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEEDIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEIFTGSPGKYVGLAETIRGFQLILSGELDGLPEQAFYLVGNIDE 468
>gi|14717935|gb|AAK72710.1| ATP synthase beta subunit [Androstachys johnsonii] (485 aa)
Score = 1484, Expect = 2.8e-162, Identities = 302/455 (66%), Positives = 365/455 (80%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK----KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K ++G I QI GPV+DV F R +MPNI + L VK  +       +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+D+    +    SPIH+  P+F E  TK +IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ NKQDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL RK+A+ GIYPA++PL+S+S ML P+IVG +HY++A+ V+  LQ+++ELQDIIAILG+DELSEED+L V+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:    10 KKNRGRIVQIIGPVLDVVFPRGKMPNIYNALVVKGRDTTGQQINVTCEVQQLLGNNRVRTVAMSATDGLMRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDDLGPVDTRTTSPIHRSAPAFIELDTKLKIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKNHGGVSVFGGVGERTREGNDLYKEMKESGVINEENIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKKGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRKLAAKGIYPAVDPLDSTSTMLQPNIVGDDHYEIAQKVKQTLQRYKELQDIIAILGLDELSEEDRLNVARARKIERFLSQPFFVAEVFTSSPGKYVGLAETIRGFQLILSGELDSLPEQAFYLVGNIDE 475
>gi|7524904|ref|NP_045906.1| ATP synthase CF1 beta subunit [Chlorella vulgaris] >gi|416678|sp|P32978|ATPB_CHLVU ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|391651|dbj|BAA01769.1| ATPase F1 beta subunit ['Chlorella' ellipsoidea] >gi|2224498|dbj|BAA57982.1| ATP synthase CF1 beta chain [Chlorella vulgaris] (481 aa)
Score = 1484, Expect = 2.8e-162, Identities = 301/461 (65%), Positives = 363/461 (78%)
  Q:   290 MKLNTLKSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK----KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQT-------ALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           M ++T     G I QI GPV+DV F   +MPNI + L V   N       +  EV  L GD   R ++M +T+GL RG+EV+++  P+  PVG+A LGR+FNV+GEP+DN       +  PIH+  P+F +  TK  IFE+GIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN++       ALV+GQMNEPPGARMRV LTALTMAE FR+ NKQDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTLA EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +AS GIYPA++PL+S+S ML P IVG +HY+ A++V+  LQ+++ELQDIIAILG+DELSEED+L V+RARKI  FLSQPFFVAE F+   GKYVS  +TI GF+ I+ G+ DD+PEQ F  VG +D+
  S:     1 MSVSTETKSSGRITQIIGPVLDVSFPAGKMPNIYNALTVGGKNEAGQEISVTCEVQQLLGDHCVRAVAMSATDGLMRGMEVLDSGKPLNVPVGAATLGRIFNVLGEPVDNLGPVNTKDQLPIHRSAPAFVDLDTKLSIFESGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINESNISESKVALVYGQMNEPPGARMRVGLTALTMAEFFRDINKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLATEMGGLQERITSTKDGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRNLASKGIYPAVDPLDSTSTMLQPWIVGDQHYQCAQNVKQTLQRYKELQDIIAILGLDELSEEDRLIVARARKIERFLSQPFFVAEVFTGSPGKYVSLAETIQGFNLILSGELDDLPEQAFYLVGNLDE 472
>gi|14717920|gb|AAK72703.1| ATP synthase beta subunit [Abatia parviflora] (471 aa)
Score = 1484, Expect = 2.9e-162, Identities = 300/451 (66%), Positives = 358/451 (79%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           G I QI GPV+DV F   +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:     2 GHIAQIIGPVLDVAFLPGKMPNIYNALVVKGQDTVGQQINVTCEVQQLLGNNRVRAVAMSATDGLMRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEENIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPQIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFKLILSGELDSLPEQAFYLVGNIDE 463
>gi|194267385|gb|ACF35678.1| ATP synthase beta subunit [Grevillea caleyi] (487 aa)
Score = 1484, Expect = 3.0e-162, Identities = 300/455 (65%), Positives = 362/455 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           + ++G I QI GPV+DV F   +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY++A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:    17 EKNQGRIAQIIGPVLDVAFPPGKMPNIYNALVVKGRDTVGQQINVTCEVQQLLGNNRVRAVAMSATDGLMRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYEIAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFQLILSGELDGLPEQAFYLVGNIDE 482
>gi|14718242|gb|AAK72859.1| ATP synthase beta subunit [Tapiscia sinensis] (472 aa)
Score = 1484, Expect = 3.0e-162, Identities = 302/455 (66%), Positives = 361/455 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K ++G I QI GPV+DV F   +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIHK  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:     5 KKNRGRIAQIIGPVLDVDFPPGKMPNIYNALVVKGRDTIGQQINVTCEVQQLLGNNRVRAVAMSATDGLMRGIEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHKSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGTLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKETLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFKLILSGELDGLPEQAFYLVGNIDE 470
>gi|7708474|emb|CAB89923.1| ATP synthase beta subunit [Lavandula bipinnata] (483 aa)
Score = 1484, Expect = 3.0e-162, Identities = 302/455 (66%), Positives = 362/455 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDN-KPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K + G I QI GPV+DV F   QMPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN  P+  +  + PIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:    12 KKNLGRIIQIIGPVLDVAFPPGQMPNIYNALVVKGRDTVGQPINVTCEVQQLLGNNRVRAVAMSATDGLMRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTF-PIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEENIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIKGFQLILSGELDGLPEQAFYLVGNIDE 477
>gi|157363033|ref|YP_001469800.1| F0F1 ATP synthase subunit beta [Thermotoga lettingae TMO] >gi|190358709|sp|A8F3K2|ATPB_THELT ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|157313637|gb|ABV32736.1| ATP synthase F1, beta subunit [Thermotoga lettingae TMO] (469 aa)
Score = 1484, Expect = 3.0e-162, Identities = 300/452 (66%), Positives = 366/452 (80%)
  Q:   299 KGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNN-KKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           KG I +I GPVVDVKF   ++P+I + LEV  P N +KL+LEV  L GD+  R +++ ST+GL RGLEV++T  PI+APVG  VLGR+ NVVG+PID K   +  +Y PIH+  P   EQ T+ E+ ETGIKVIDLL P+ KGGKIG FGGAGVGKTVLV ELI NIA    G S+FAGVGERTREGNDL+ EM + GV+  T LVFGQMNEPPGAR RV LTALT+AE+FR+   +DVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTLA +MG+LQERITST+ GSITSVQA+YVPADD+TDPAP+TTF+HLDA  VL RKIA LGIYPA++PL+S+S++LDP+++G EHY+VAR VQ +LQ++++LQDIIAILG++EL+EEDKL V RARKI+ FLSQPFFVAE+F+  +GKYV   +T+ GF EI+EGK D +PEQ F  VG ID+
  S:     4 KGYIVRIIGPVVDVKFDEKELPDIYNALEVTNPQNGEKLILEVEQLIGDNTVRAVALDSTDGLTRGLEVVDTGKPIVAPVGKGVLGRILNVVGKPIDEKGDIQAEDYWPIHRPAPKITEQKTEIEVLETGIKVIDLLAPFPKGGKIGFFGGAGVGKTVLVMELIRNIAIEQKGFSVFAGVGERTREGNDLWLEMQEAGVLENTVLVFGQMNEPPGARFRVGLTALTIAEYFRDVEGRDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLATDMGELQERITSTQKGSITSVQAIYVPADDITDPAPATTFSHLDASVVLSRKIAELGIYPAVDPLDSTSKILDPAVIGWEHYQVARGVQEVLQRYKDLQDIIAILGMEELTEEDKLIVQRARKIQRFLSQPFFVAERFTGANGKYVPISETVKGFKEILEGKHDSLPEQAFFMVGTIDE 456
>gi|150020193|ref|YP_001305547.1| F0F1 ATP synthase subunit beta [Thermosipho melanesiensis BI429] >gi|166222423|sp|A6LJR1|ATPB_THEM4 ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|149792714|gb|ABR30162.1| ATP synthase F1, beta subunit [Thermosipho melanesiensis BI429] (469 aa)
Score = 1484, Expect = 3.1e-162, Identities = 308/455 (67%), Positives = 364/455 (80%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNN-KKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K  KG I ++ GPVVDV+F   ++P+I D LEV  P   KKL+LEV  L GD+  R +++ +T+GL RGLEV NT  PI  PVG   LGRMFNV+GEPID K   + VEY PIH+ PPS  EQST  EI ETGIKVIDLL P+ KGGKIG FGGAGVGKTVLV ELI NIA  H G S+FAGVGERTREGN+LY +M +  V++ T LVFGQMNEPPGAR RVAL+ALTMAE+FR+   +DVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTLA +MG+LQERITSTK GSITSVQA+YVPADD+TDPAP+TTF HLDA  VL R+ A+LG+YPA++PL+S+S+MLDP++VG EHY+VAR VQ +LQ++++LQDIIAILG++ELSEEDKL V RARKI  FLSQP  VAEKFS+  GKYV   +TI GF EI+EGK DD+PE  F  VG ID+
  S:     3 KRSKGKILRVIGPVVDVQFEEGELPDIYDALEVINPQTGKKLILEVEQLIGDNAVRTVALDTTDGLMRGLEVENTGEPIKVPVGKGALGRMFNVIGEPIDGKEDVKDVEYWPIHRTPPSITEQSTSVEILETGIKVIDLLAPFPKGGKIGFFGGAGVGKTVLVMELIRNIAIEHHGFSMFAGVGERTREGNELYLDMQEAEVLDNTVLVFGQMNEPPGARFRVALSALTMAEYFRDVEGRDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLATDMGELQERITSTKKGSITSVQAIYVPADDITDPAPATTFTHLDATVVLSRRRAALGLYPAVDPLDSTSKMLDPNVVGQEHYEVARGVQEVLQRYKDLQDIIAILGMEELSEEDKLIVQRARKIERFLSQPVHVAEKFSNIPGKYVPISETIRGFKEILEGKYDDLPEMAFYMVGTIDE 458
>gi|62085099|gb|AAX62956.1| ATP synthase beta subunit [Austrobuxus megacarpus] (482 aa)
Score = 1484, Expect = 3.2e-162, Identities = 304/455 (66%), Positives = 364/455 (80%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK----KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K++ G I QI GPV+DV F R +MPNI + L VK  N+      +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+D     +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ NKQDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A  GIYPA++PL+S+S ML P+IVG EHY+ A+SV+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F++  GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:     2 KTNPGRIVQIIGPVLDVAFPRGKMPNIYNALVVKGRNSTGQQINVTCEVQQLLGNNRVRTVAMSATDGLMRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDELGPVDTRTTSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKEHGGVSVFGGVGERTREGNDLYKEMKESGVINEENIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKKGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRPLAVKGIYPAVDPLDSTSTMLQPTIVGKEHYETAQSVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTNSPGKYVGLAETIRGFQLILSGELDSLPEQAFYLVGNIDE 467
>gi|7688335|emb|CAB89745.1| ATP synthase beta subunit [Tetramerista sp. Coode 7925] (477 aa)
Score = 1484, Expect = 3.2e-162, Identities = 303/456 (66%), Positives = 362/456 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK----KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           K + G I QI GPV+DV F+  +MPNI + L VK  N       +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LG++FNV+GEP+DN    +    SPIHK  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+V
  S:     3 KKNLGRIVQIIGPVLDVAFSPGKMPNIYNALVVKGRNTVGQPINVTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGQIFNVLGEPVDNLGPVDTRTTSPIHKSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNFAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFQLILSGELDGLPEQAFYLVGNIDEV 469
>gi|156530217|gb|ABU75205.1| AtpB [Soulamea amara] (473 aa)
Score = 1484, Expect = 3.4e-162, Identities = 303/456 (66%), Positives = 361/456 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           K + G I QI GPV+DV F   +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIHK  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+V
  S:     2 KKNLGHIAQIIGPVLDVAFPPGKMPNIYNALVVKGRDTVGQPINMTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHKPAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFKLILSGELDGLPEQAFYLVGNIDEV 468
>gi|124361804|gb|ABN09344.1| ATP synthase beta subunit [Madhuca macrophylla] (465 aa)
Score = 1484, Expect = 3.4e-162, Identities = 301/451 (66%), Positives = 358/451 (79%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           G I QI GPV+DV F   +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEPIDN    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:     1 GRIIQIIGPVLDVAFPPGKMPNIYNALVVKGRDTVGKPINVTCEVQQLLGNNRVRAVAMSATDGLMRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPIDNLGPVDTRTTSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQKVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFQLILSGELDGLPEQAFYLVGNIDE 462
>gi|18077601|emb|CAD11917.1| ATP synthase beta subunit [Paracryphia alticola] (489 aa)
Score = 1484, Expect = 3.4e-162, Identities = 301/455 (66%), Positives = 362/455 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K ++G I QI GPV+DV F   +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY++A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:     9 KKNQGRIAQIIGPVLDVAFPPGKMPNIYNALVVKGRDTVGQPINVTCEVQQLLGNNRVRAVAMSATDGLMRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYEIAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFQLILSGELDGLPEQAFYLVGNIDE 474
>gi|156530221|gb|ABU75207.1| AtpB [Soulamea terminalioides] (482 aa)
Score = 1484, Expect = 3.4e-162, Identities = 303/456 (66%), Positives = 361/456 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           K + G I QI GPV+DV F   +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIHK  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+V
  S:    14 KKNLGHIAQIIGPVLDVAFPPGKMPNIYNALVVKGRDTVGQPINMTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHKPAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFKLILSGELDGLPEQAFYLVGNIDEV 480
>gi|65332604|gb|AAY42226.1| ATP synthase beta subunit [Anisophyllea meniaudi] (479 aa)
Score = 1484, Expect = 3.4e-162, Identities = 302/466 (64%), Positives = 361/466 (77%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHKNYVAANSNNKVN 765
           G I QI GPV+DV F   +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEPIDN         SPIH+  P+F + +TK  IFETGIKV+DLL PY +GGK+GLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ NKQDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+L V+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+           +K+N
  S:     3 GRIAQIIGPVLDVAFPPGKMPNIYNALVVKGRDTVGQQINVTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPIDNLGPVNTRTTSPIHRSAPAFIQLATKLSIFETGIKVVDLLAPYRRGGKVGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLIVARARKIERFLSQPFFVAEVFTGSPGKYVGLSETIRGFQLILSGELDGLPEQAFYLVGNIDEATAKATNLEMGSKLN 479
>gi|21684891|emb|CAD11572.1| ATP synthase beta subunit [Paepalanthus fasciculatus] (485 aa)
Score = 1484, Expect = 3.4e-162, Identities = 301/452 (66%), Positives = 363/452 (80%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK----KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQT-------ALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           G I QI GPV+DV F+  +MPNI + L VK  +N      +  EV  L G++  R ++M +T+GL RG+EVI+T +P+  PVG A LGR+FNV+G+PIDN    +    SPIH+  P+F +  T+  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY++A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+V
  S:    15 GRIAQIIGPVLDVVFSPGKMPNIYNALVVKGRDNADQQINVTCEVQQLLGNNRIRAVAMSATDGLTRGMEVIDTGSPLSVPVGGATLGRIFNVLGDPIDNLGPVDSSATSPIHRSAPAFIQLDTRLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINENNLAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGNEHYEIAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFQLILSGELDSLPEQAFYLVGNIDEV 477
>gi|170784769|ref|YP_001718685.1| ATP synthase CF1 beta subunit [Trachelium caeruleum] >gi|156598793|gb|ABU85650.1| ATP synthase CF1 beta subunit [Trachelium caeruleum] >gi|157267517|gb|ABV26510.1| ATP synthase CF1 beta subunit [Trachelium caeruleum] (498 aa)
Score = 1483, Expect = 3.5e-162, Identities = 307/459 (66%), Positives = 365/459 (79%)
  Q:   292 LNTLKSDK-GIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           ++TL+ +K G I QI GPV+DV F   +MPNI + L VK    L     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEPIDN    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM D GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ NKQDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IV  EHY+ A+SV+  LQ+++ELQDII ILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+  +GKYV   +TI GF  I+ GK D +PEQ F  VG ID+
  S:    12 VSTLEKNKPGRIGQIIGPVLDVAFPPGKMPNIYNALVVKGRDTLGQPINVTCEVQQLLGNNRVRAVAMSATDGLMRGMEVIDTGTPLSVPVGGATLGRIFNVLGEPIDNLGPVDTRTTSPIHRSAPAFIDLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYKEMKDSGVINEQKFAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKKGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVSDEHYQTAQSVKQTLQRYKELQDIITILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSTGKYVGLVETIRGFELILSGKLDVLPEQAFYMVGNIDE 482
>gi|61968227|gb|AAX57040.1| ATP synthase beta subunit [Bridelia ferruginea] (479 aa)
Score = 1483, Expect = 3.5e-162, Identities = 302/451 (66%), Positives = 361/451 (80%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK----KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDN-KPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           G I QI GPV+DV F   +MPNI + L VK  +       +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+D+  P+  +  Y PIH+  P+F E  T+  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM D GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ NKQDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG +HY+ A+SV+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:     9 GRIAQIIGPVLDVAFPPGKMPNIYNALAVKGRDTAGQQINVTCEVQQLVGNNRVRAVAMSATDGLMRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDDLGPVDTRATY-PIHRSAPAFIELDTELSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKDSGVINKENIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKKGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPEIVGTKHYETAQSVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFQLILSGELDSLPEQAFYLVGNIDE 470
>gi|66276263|gb|AAY44146.1| ATP synthase beta subunit [Combretocarpus rotundatus] (479 aa)
Score = 1483, Expect = 3.6e-162, Identities = 304/466 (65%), Positives = 363/466 (77%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK----KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHKNYVAANSNNKVN 765
           G I QI GPV+D+ F   +MPNI + L +K  +       +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG   LGR+FNV+GEPIDN    +    SPIH+  P+F E  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM D GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ NKQ+VLLFIDNIFRF QAGSEVSALLGRIPSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R++A+ GIYPA++PL+S+S ML P IVG EHYK A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV+  +TI GF  I+ G+ D +PEQ F  VG ID+           +K+N
  S:     3 GRITQIIGPVLDITFPPGKMPNIYNALIIKGRDTGGQQINVTCEVQRLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGTTLGRIFNVLGEPIDNLGPVDTRTTSPIHRSAPAFIELDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKDSGVINEENIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNKQNVLLFIDNIFRFVQAGSEVSALLGRIPSAVGYQPTLSTEMGSLQERITSTKKGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRRLAAKGIYPAVDPLDSTSTMLQPQIVGDEHYKTAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVNLSETIRGFQLILSGELDSLPEQAFYLVGNIDEATAKATNLEKESKLN 479
>gi|7708139|emb|CAB89935.1| ATP synthase beta subunit [Aextoxicon punctatum] (488 aa)
Score = 1483, Expect = 3.6e-162, Identities = 303/469 (64%), Positives = 364/469 (77%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK----KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHKNYVAANSNNKV 764
           K + G   QI GPV+DV F R +MPNI + L VK  +       +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+     +     NK+
  S:     9 KKNLGRFAQIIGPVLDVAFPRGKMPNIYNALVVKSRDTVGQPINVTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFQLILSGELDGLPEQAFYLVGNIDEATAKAMNLEMENKL 488
>gi|3850952|gb|AAC72168.1| ATP synthase beta subunit [Roupala macrophylla] (490 aa)
Score = 1483, Expect = 3.6e-162, Identities = 300/451 (66%), Positives = 356/451 (78%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           G I QI GPV+DV F   +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN         SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:    13 GRIAQIIGPVLDVAFPPGKMPNIYNALVVKGRDTVGQQINVTCEVQQLLGNNRVRAVAMSATDGLMRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGXXXXXXXSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRXPSAVGYQPTLSTEMGSLQERITSTKGGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFQLILSGELDGLPEQAFYLVGNIDE 474
>gi|24940188|emb|CAD43376.1| ATP synthase beta subunit [Hydrophyllum canadense] (489 aa)
Score = 1483, Expect = 3.7e-162, Identities = 307/483 (63%), Positives = 370/483 (76%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK----KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHKNYVAANSNNKVNSSNKPLNSENKSN 778
           K   G I QI GPV+DV F   +MPNI + L VK  +       +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTKSGSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY++A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+               ++ K +N E +SN
  S:     9 KKTLGRIVQIIGPVLDVAFPPGKMPNIYNALVVKGRDTAGQPINVTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEENIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKSGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYEIAQRVKETLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFQLILSGELDGLPEQAFYLVGNIDE---------------ATAKAMNLETESN 487
>gi|33327761|gb|AAQ09244.1| ATP synthase beta subunit [Piper betle] >gi|56675690|emb|CAB89720.2| ATP synthase beta subunit [Piper betle] (498 aa)
Score = 1483, Expect = 3.7e-162, Identities = 301/455 (66%), Positives = 362/455 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK----KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           + ++G I QI GPV+DV F   +MPNI + L VK P+       +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:    17 RKNQGRIVQIIGPVLDVAFPPGKMPNIYNALIVKGPDTAGKQINVTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGTPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYIEMKESGVINEQNLAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLPETIRGFQLILSGELDGLPEQAFYLVGNIDE 482
>gi|20269400|gb|AAM17927.1| ATP synthase beta subunit [Chimaphila umbellata] (482 aa)
Score = 1483, Expect = 3.8e-162, Identities = 302/455 (66%), Positives = 358/455 (78%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK----KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K + G I QI GPV+DV F   +MPNI + L VK  N       +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG   LGR+FNV+GEPIDN    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY E+ + GVIN+        AL++GQMNEPPGARMRV LTALTMAE+FR+ NKQDVLLFIDNIFRF QAGSEVSALLGRIPSAVGYQPTL  EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML   IVG EHYK+A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:    16 KKNLGRIVQIIGPVLDVAFPSGKMPNIYNALVVKGRNTVGQPINVTCEVQQLLGNNRVRTVAMSATDGLTRGMEVIDTGAPLSVPVGGVTLGRIFNVLGEPIDNLGPVDTRTTSPIHRSAPAFIQLETKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYKEIKESGVINEQNIAESKVALIYGQMNEPPGARMRVGLTALTMAEYFRDVNKQDVLLFIDNIFRFVQAGSEVSALLGRIPSAVGYQPTLGTEMGSLQERITSTKKGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQRRIVGDEHYKIAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEIFTGSRGKYVGLAETIRGFPLILSGELDGLPEQAFYLVGNIDE 481
>gi|62902859|gb|AAY19344.1| ATP synthase beta subunit [Elaeocarpus reticulatus] (488 aa)
Score = 1483, Expect = 3.8e-162, Identities = 304/469 (64%), Positives = 364/469 (77%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHKNYVAANSNNKV 764
           K + G I QI GPV+DV F   +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEPIDN    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+         + NK+
  S:     8 KKNLGRIAQIIGPVLDVAFPPGKMPNIYNALVVKGRDTVGQQINVTCEVQQLLGNNRVRAVAMSATDGLMRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPIDNLGPVDTRTTSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEENIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFKLILSGELDGLPEQAFYLVGNIDEATAKATNLGTENKL 487
>gi|56675873|emb|CAD43384.2| ATP synthase beta subunit [Omphalodes verna] (487 aa)
Score = 1483, Expect = 3.8e-162, Identities = 301/455 (66%), Positives = 362/455 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K + G I QI GPV+DV F+  +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK+GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:     9 KKNLGRIVQIIGPVLDVAFSPGKMPNIYNALVVKGRDTVGQPINVTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEENIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGTLQERITSTKAGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFQLILSGELDGLPEQAFYLVGNIDE 474
>gi|24940248|emb|CAD43382.1| ATP synthase beta subunit [Nonea versicolor] (489 aa)
Score = 1483, Expect = 3.8e-162, Identities = 301/455 (66%), Positives = 363/455 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK----KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K + G I QI GPV+DV F+  +MPNI + L VK  +       +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK+GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY++A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:     9 KKNLGRIVQIIGPVLDVAFSPGKMPNIYNALVVKGRDTGGQPINVTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEENIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGTLQERITSTKAGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYEIAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFQLILSGELDGLPEQAFYLVGNIDE 474
>gi|3850922|gb|AAC72153.1| ATP synthase beta subunit [Petrophile circinata] (490 aa)
Score = 1483, Expect = 3.8e-162, Identities = 302/451 (66%), Positives = 358/451 (79%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           G I QI GPV+DV F   +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVINT  P+  PVG A LGR+FNV+GEPIDN    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:    13 GRIAQIIGPVLDVAFPPGKMPNIYNALVVKGRDTVGQQINVTCEVQQLLGNNRVRAVAMSATDGLMRGMEVINTGAPLSVPVGGATLGRIFNVLGEPIDNLGPVDTRTTSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFQLILSGELDSLPEQAFYLVGNIDE 474
>gi|62085227|gb|AAX63016.1| ATP synthase beta subunit [Maytenus senegalensis] (483 aa)
Score = 1483, Expect = 3.8e-162, Identities = 301/455 (66%), Positives = 362/455 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK----KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K + G I QI GPV+DV F+  +MPNI + L VK  +       ++ EV  L G++  R ++M +T+GL RG++VI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIHK  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:     9 KKNLGRIAQIIGPVLDVAFSPGKMPNIYNALVVKGRDTSGHTINVICEVQQLLGNNQVRAVAMSATDGLMRGMDVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHKSAPAFIQLETKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKKGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFKLILSGELDGLPEQAFYLVGNIDE 474
>gi|62085225|gb|AAX63015.1| ATP synthase beta subunit [Maytenus arbutifolia] (484 aa)
Score = 1483, Expect = 3.8e-162, Identities = 301/455 (66%), Positives = 362/455 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK----KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K + G I QI GPV+DV F+  +MPNI + L VK  +       ++ EV  L G++  R ++M +T+GL RG++VI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIHK  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:     9 KKNLGRIAQIIGPVLDVAFSPGKMPNIYNALVVKGRDTSGHTINVICEVQQLLGNNQVRAVAMSATDGLMRGMDVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHKSAPAFIQLETKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKKGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFKLILSGELDGLPEQAFYLVGNIDE 474
>gi|14718163|gb|AAK72820.1| ATP synthase beta subunit [Paropsia madagascariensis] (477 aa)
Score = 1483, Expect = 3.9e-162, Identities = 301/455 (66%), Positives = 361/455 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K++ G I QI GPV+DV F   +MPNI + L +K    +     +  EV  L G++  R ++M +TEGL RG+EVI+T  P+  PVG A LGR+FNV+GEPID+    +    SPIH+  P+F +  T+  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ NKQDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+SV+  LQ+++ELQDII ILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:     4 KTNLGHIAQIIGPVLDVAFPPGKMPNIYNALVIKGRDTIGQQINVACEVQQLLGNNRVRAVAMSATEGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPIDDLGPVDTRTTSPIHRSAPAFIQLDTRLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYIEMKESGVINEENITESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPQIVGKEHYETAQSVKQTLQRYKELQDIITILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFQLILSGELDSLPEQAFYLVGNIDE 469
>gi|3850920|gb|AAC72152.1| ATP synthase beta subunit [Franklandia fucifolia] (481 aa)
Score = 1483, Expect = 3.9e-162, Identities = 300/451 (66%), Positives = 359/451 (79%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           G I QI GPV+DV F   +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVI+T+ P+  PVG A LGR+FNV+GEP+DN    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:     4 GCIAQIIGPVLDVSFPPGKMPNIYNALVVKGRDTVGQQINVTCEVQQLLGNNRVRAVAMSATDGLMRGMEVIDTRAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHRSAPAFIQXDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFQLILSGELDRLPEQAFYLVGNIDE 465
>gi|189162278|ref|YP_001936524.1| ATP synthase CF1 beta subunit [Fagopyrum esculentum subsp. ancestrale] >gi|166065364|gb|ABY79739.1| ATP synthase CF1 beta subunit [Fagopyrum esculentum subsp. ancestrale] (498 aa)
Score = 1483, Expect = 3.9e-162, Identities = 302/469 (64%), Positives = 365/469 (77%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK----KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHKNYVAANSNNKV 764
           KS+ G + QI GPV+DV F   +MPNI + L +K  +       +  EV  L G++  R ++M +T+GL RG+EV++T  P+  PVG A LGR+FNV+GEP+DN    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ NKQDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHYK A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARK+  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+     +     NK+
  S:    17 KSNLGRVAQIIGPVLDVAFPPGKMPNIYNALVIKGRDTAGQPINVTCEVQQLLGNNRVRAVAMSATDGLTRGMEVVDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNISESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKQGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRALAAKGIYPAVDPLDSTSTMLQPRIVGEEHYKTAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKMERFLSQPFFVAEVFTGSPGKYVGLAETIRGFQLILSGELDGLPEQAFYLVGNIDEATAKAMNLEMENKL 496
>gi|61968333|gb|AAX57093.1| ATP synthase beta subunit [Putranjiva zeylanica] (478 aa)
Score = 1483, Expect = 3.9e-162, Identities = 303/455 (66%), Positives = 359/455 (78%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK----KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVIN-------QTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K   G I QI GPV+DV F   +MPNI + L VK  N       +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+D+    +    SPIHK  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+N+A  HGG+S+F GVGERTREGNDLY EM + GVIN       + ALV+GQMNEPPGARMRV LTALTMAE+FR+ NKQDVLLFIDNIFRF QAGSEVSALLGRIPSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:     5 KKKLGRITQIIGPVLDVAFPPGKMPNIYNALVVKSQNTVGQQINVTCEVQQLLGNNRVRTVAMSATDGLMRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDDLGPVDTRTTSPIHKSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNVAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINGENIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNKQDVLLFIDNIFRFVQAGSEVSALLGRIPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPKIVGKEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEIFTGSLGKYVGLAETIRGFQLILSGELDGLPEQAFYLVGNIDE 470
>gi|20269416|gb|AAM17935.1| ATP synthase beta subunit [Halesia carolina] (471 aa)
Score = 1483, Expect = 3.9e-162, Identities = 303/455 (66%), Positives = 361/455 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK------LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K + G I QI GPV+DV F   +MPNI + L VK       P N  +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:     1 KKNXGRIVQIIGPVLDVAFPPGKMPNIYNALVVKGRDIAGQPIN--VTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYEXAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFQLILSGELDGLPEQAFYLVGNIDE 466
>gi|62902815|gb|AAY19322.1| ATP synthase beta subunit [Lepuropetalon spathulatum] (488 aa)
Score = 1483, Expect = 4.0e-162, Identities = 304/469 (64%), Positives = 366/469 (78%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK----KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHKNYVAANSNNKV 764
           K + G I QI GPV+DV F+  +MPNI + L VK  +       +V EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+         + NK+
  S:     8 KKNLGRIAQIIGPVLDVAFSPGKMPNIYNALVVKGRDTAGQQINVVCEVQQLLGNNQVRAVAMSATDGLTRGMEVIDTGAPLNVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKKGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFKLILSGELDGLPEQAFYLVGNIDEATAKATNLETENKL 487
>gi|4206584|gb|AAD11723.1| ATP synthase beta subunit [Chorilaena quercifolia] (466 aa)
Score = 1483, Expect = 4.2e-162, Identities = 300/452 (66%), Positives = 359/452 (79%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK----KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           G I QI GPV+DV F   +MPNI + L VK  +       +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIHK  P+F +  T+  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG +D+V
  S:     1 GHIAQIIGPVLDVAFPPGKMPNIYNALVVKSRDTAGQPINVTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHKSAPAFIQLDTRLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFKLILSGELDVLPEQAFYLVGNVDEV 463
>gi|24298790|dbj|BAC22105.1| F-ATPase beta-subunit [Thermotoga neapolitana] (468 aa)
Score = 1483, Expect = 4.2e-162, Identities = 302/458 (65%), Positives = 366/458 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNN-KKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHK 753
           K  KG I  + GPVVDVKF   ++P+I + LEV  P   +K+VLEV  L GD V R ++M ST+GL +GLEV++T  PI APVG  VLGR+ NV+GEP+D     +  E  PIH+  P   EQST+ EI ETGIKVIDLL P+ KGGKIG FGGAGVGKTVLV ELI NIA  H G S+FAGVGERTREGN+L+ EM + GV+  T LVFGQMNEPPGAR RVALTALT+AE+FR+   +DVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTLA +MG+LQERITST+ GSITSVQA+YVPADD+TDPAP+TTFAHLDA  VL R+IA LG+YPA++PL+SSS++LDP++VG EHY+VAR VQ +LQ++++LQDIIAILG+ ELS EDKL V RAR+I+ FLSQPF VAE+F+ + GKYV  ++TI GF EI++GK DD+PEQ FL  G ID+V +
  S:     3 KGSKGYIVGVMGPVVDVKFPEEELPDIFNALEVVNPQTGQKIVLEVEQLIGDGVVRTVAMDSTDGLMKGLEVVDTGEPITAPVGKEVLGRILNVIGEPVDEAGEIKSKERWPIHRPAPELIEQSTEIEILETGIKVIDLLAPFPKGGKIGFFGGAGVGKTVLVMELIRNIAIEHKGFSVFAGVGERTREGNELWLEMQESGVLGNTILVFGQMNEPPGARFRVALTALTIAEYFRDVEGRDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLATDMGELQERITSTRRGSITSVQAIYVPADDITDPAPATTFAHLDATVVLSRRIAELGLYPAVDPLDSSSKILDPAVVGREHYEVARGVQEVLQRYKDLQDIIAILGVKELSPEDKLVVHRARRIQRFLSQPFHVAERFTGRPGKYVPLEETIRGFKEILDGKLDDVPEQAFLMAGTIDEVKE 461
>gi|62085232|gb|AAX63018.1| ATP synthase beta subunit [Ruptiliocarpon caracolito] (490 aa)
Score = 1483, Expect = 4.2e-162, Identities = 303/469 (64%), Positives = 365/469 (77%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK----KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHKNYVAANSNNKV 764
           K + G I QI GPV+DV F+  +MPNI + L VK  +       +  EV  L G++  R ++M +T+GL RG+EVI+   P+  PVG A LGR+FNV+GEP+DN    +    SPIHK  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY++A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+  +GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+           NK+
  S:     9 KKNLGRIAQIIGPVLDVAFSPGKMPNIYNALVVKGRDTAGHQINVTCEVQQLLGNNQVRAVAMSATDGLMRGMEVIDMGTPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHKSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEENIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKKGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYEIAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSTGKYVGLAETIRGFKLILSGELDGLPEQAFYLVGNIDEATAKATNLEMENKL 488
>gi|7708628|emb|CAB89991.1| ATP synthase beta subunit [Saintpaulia ionantha] (483 aa)
Score = 1483, Expect = 4.3e-162, Identities = 303/456 (66%), Positives = 364/456 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDN-KPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           K + G I QI GPV+DV F   +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN  P+  +  + PIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+  SGKYV   +TI GF  I+ G+ D +PEQ F  VG ID+V
  S:     7 KKNLGRIVQIIGPVLDVAFPPGKMPNIYNALVVKGRDTVGQPINVTCEVQQLLGNNRVRAVAMSATDGLMRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTF-PIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEENIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSSGKYVDLAETIRGFQSILSGELDGLPEQAFYLVGNIDEV 473
>gi|57868922|gb|AAW57457.1| ATP synthase beta subunit [Cornus sericea] (486 aa)
Score = 1483, Expect = 4.3e-162, Identities = 301/455 (66%), Positives = 361/455 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK----KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K + G I QI GPV+DV F   +MPNI + L VK  +       +  EV  L G++  R ++M +TEGL RG+EV++T  P+  PVG A LGR+FNV+GEP+DN    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY++A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:    14 KKNLGRIAQIIGPVLDVAFPPGKMPNIYNALVVKGRDTAGQPINVTCEVQQLLGNNRVRAVAMSATEGLTRGMEVVDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYEIAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFQLILSGELDGLPEQAFYLVGNIDE 479
>gi|118917362|dbj|BAF40469.1| ATP synthase beta subunit [Jatropha integerrima] (486 aa)
Score = 1483, Expect = 4.4e-162, Identities = 301/455 (66%), Positives = 361/455 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K + G I QI GPV+DV F+  +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+D+    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVINQ        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:     9 KKNLGCIAQIIGPVLDVAFSPGKMPNIYNALVVKGRDTVGQEINVTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDDLGPVDTRATSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINQENIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPQIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFKLILSGELDSLPEQAFYLVGNIDE 474
>gi|56675896|emb|CAB89996.2| ATP synthase beta subunit [Barringtonia asiatica] (484 aa)
Score = 1483, Expect = 4.4e-162, Identities = 302/455 (66%), Positives = 360/455 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K + G I QI GPV+DV F   +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEPIDN    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:     4 KQNSGRIVQIIGPVLDVAFPPGKMPNIYNALVVKGRDTVGQPINVTCEVQQLLGNNRVRAVAMSATDGLMRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPIDNLGPVDTRTTSPIHRSAPAFIQLDTKLAIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFQLILSGELDGLPEQAFYLVGNIDE 469
>gi|21684893|emb|CAD11573.1| ATP synthase beta subunit [Flagellaria indica] (491 aa)
Score = 1483, Expect = 4.4e-162, Identities = 303/469 (64%), Positives = 368/469 (78%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHKNYVAANSNNKV 764
           + +KG I QI GPV+DV F   ++PNI + L VK    + +   +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIH+  P+F E  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ NKQ+VLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY++A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+  +GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+     +     NK+
  S:    11 EKNKGSIIQIIGPVLDVNFPSGKLPNIYNALVVKGRDTVGHQINVTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTSATSPIHRSAPAFIELDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYKEMKESGVINEKNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNKQNVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKKGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRVLAAKGIYPAVDPLDSTSTMLQPRIVGDEHYEIAQRVKETLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSAGKYVGLAETIRGFQLILSGELDGLPEQAFYLVGNIDEATAKAMNLEGENKL 490
>gi|5001595|gb|AAD37044.1|AF092118_1 ATP synthase beta subunit [Daphniphyllum sp. SH1999] (480 aa)
Score = 1483, Expect = 4.4e-162, Identities = 301/451 (66%), Positives = 357/451 (79%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           G I QI GPV+DV F   QMPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN         SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:     3 GRIAQIIGPVLDVAFPPGQMPNIYNALVVKGRDTVGQQINVTCEVQQLLGNNRVRAVAMSATDGLMRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVXXXTTSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFQLILSGELDGLPEQAFYLVGNIDE 464
>gi|32526541|emb|CAD39202.1| ATP synthase subunit B [Pennantia corymbosa] (489 aa)
Score = 1483, Expect = 4.4e-162, Identities = 301/455 (66%), Positives = 362/455 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK----KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K + G I QI GPV+DV F+  +MPNI + L VK  +       +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY++A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:     9 KENLGRIAQIIGPVLDVAFSPGKMPNIYNALVVKGRDTGGQPINVTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGTLQERITSTKQGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYEIAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFQLILSGELDGLPEQAFYLVGNIDE 474
>gi|24940170|emb|CAD43369.1| ATP synthase beta subunit [Cryptantha virgata] (488 aa)
Score = 1483, Expect = 4.5e-162, Identities = 301/455 (66%), Positives = 363/455 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K++ G I QI GPV+DV F+  +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK+GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:     9 KNNLGRIVQIIGPVLDVAFSPGKMPNIYNALVVKGRDTVGQPINVTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEENIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGTLQERITSTKAGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFQLILSGELDGLPEQAFYLVGNIDE 474
>gi|24940172|emb|CAD43370.1| ATP synthase beta subunit [Cynoglossum officinale] (489 aa)
Score = 1483, Expect = 4.5e-162, Identities = 301/455 (66%), Positives = 363/455 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K++ G I QI GPV+DV F+  +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK+GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:     9 KNNLGRIVQIIGPVLDVAFSPGKMPNIYNALVVKGRDTVGQPINVTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEENIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGTLQERITSTKAGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFQLILSGELDGLPEQAFYLVGNIDE 474
>gi|156530101|gb|ABU75147.1| AtpB [Ailanthus integrifolia] (468 aa)
Score = 1483, Expect = 4.5e-162, Identities = 302/452 (66%), Positives = 359/452 (79%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           G I QI GPV+DV F   +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIHK  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+V
  S:     4 GHIAQIIGPVLDVAFPPGKMPNIYNALVVKGRDTVGQPINVTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRATSPIHKPAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFKLILSGELDGLPEQAFYLVGNIDEV 466
>gi|32526543|emb|CAD39203.1| ATP synthase subunit B [Pennantia cunninghamii] (489 aa)
Score = 1482, Expect = 4.6e-162, Identities = 301/455 (66%), Positives = 362/455 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK----KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K + G I QI GPV+DV F+  +MPNI + L VK  +       +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY++A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:     9 KENLGRIVQIIGPVLDVAFSPGKMPNIYNALVVKGRDTGGQPINVTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGTLQERITSTKQGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYEIAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFQLILSGELDGLPEQAFYLVGNIDE 474
>gi|156530097|gb|ABU75145.1| AtpB [Ailanthus altissima var. tanakai] (490 aa)
Score = 1482, Expect = 4.7e-162, Identities = 303/456 (66%), Positives = 361/456 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           K + G I QI GPV+DV F   +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIHK  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+V
  S:    16 KKNLGHIAQIIGPVLDVAFPPGKMPNIYNALVVKGRDTVGQPINVTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRATSPIHKPAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFKLILSGELDGLPEQAFYLVGNIDEV 482
>gi|7708197|emb|CAB90035.1| ATP synthase beta subunit [Coffea arabica] (490 aa)
Score = 1482, Expect = 4.7e-162, Identities = 302/455 (66%), Positives = 360/455 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K + G I QI GPV+DV F   +MPNI + L VK    +     +  EV  L G++  R ++M ST+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:    10 KKNMGRIVQIIGPVLDVAFPAGKMPNIYNALVVKGRDTVGQPINVTCEVQQLLGNNRVRAVAMSSTDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGAVDTRTTSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINKENIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFQLILSGELDSLPEQAFYLVGNIDE 475
>gi|52082860|gb|AAU26011.1| ATPase beta subunit [Piper hispidum] (470 aa)
Score = 1482, Expect = 4.8e-162, Identities = 300/451 (66%), Positives = 359/451 (79%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           G I QI GPV+DV F+  +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:     1 GRIVQIIGPVLDVAFSPGKMPNIYNALIVKGQDTVGQQINVTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYIEMKESGVINEQNLAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLPETIRGFQLILSGELDGLPEQAFYLVGNIDE 462
>gi|195183481|dbj|BAG66956.1| ATP synthase beta subunit [Corynostylis arborea] (489 aa)
Score = 1482, Expect = 4.8e-162, Identities = 302/451 (66%), Positives = 359/451 (79%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           G I QI GPV+DV F   +MPNI + L VK    L     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+D+    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ NKQDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYVS  +TI GF  I+ G+ D +PEQ F  VG ID+
  S:    13 GRIAQIIGPVLDVAFRPGKMPNIYNALVVKGRDTLGQQINVTCEVQQLLGNNRVRAVAMSATDGLMRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDDLGPVDTCTTSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYKEMKESGVINEEKIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPEIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVSLAETIRGFQLILSGELDSLPEQAFYLVGNIDE 474
>gi|7708638|emb|CAB89989.1| ATP synthase beta subunit [Sarracenia flava] (482 aa)
Score = 1482, Expect = 4.9e-162, Identities = 301/455 (66%), Positives = 358/455 (78%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK----KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K   G I QI GPV+DV F   +MPNI + L VK  N          EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LG++FNV+GEP+DN    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:     8 KKKTGCIVQIIGPVLDVAFRPGKMPNIYNALLVKGRNTGGQPINXTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGQIFNVLGEPVDNLGPVDTRTTSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEKNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFQLILSGELDGLPEQAFYLVGNIDE 473
>gi|14718046|gb|AAK72764.1| ATP synthase beta subunit [Eucryphia lucida] (482 aa)
Score = 1482, Expect = 5.1e-162, Identities = 302/455 (66%), Positives = 359/455 (78%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K + G I QI GPV+DV F   +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEPIDN    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:     9 KKNLGRIAQIIGPVLDVAFPPGKMPNIYNALVVKGRDTVGQQINVTCEVQQLLGNNRVRAVAMSATDGLMRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPIDNLGPVDTRTTSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELIXNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEENIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFKLILSGELDGLPEQAFYLVGNIDE 474
>gi|157689150|gb|ABV65131.1| ATP synthase CF1 beta subunit [Bulnesia arborea] (491 aa)
Score = 1482, Expect = 5.1e-162, Identities = 303/455 (66%), Positives = 358/455 (78%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK----KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQT-------ALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K   G I QI GPV+DV F   +MP I + L VK  N       +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG   LGR+FNV+GEP+DN    +    SPIHK  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+T       ALV+GQMNEPPGARMRV LTALTMAE+FR+ NKQDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:    17 KKXLGHIVQIIGPVLDVAFPPGKMPKIYNALVVKAENTVGQEINVTCEVQQLLGNNRVRAVAMSATDGLMRGMEVIDTGAPLSVPVGGVTLGRIFNVLGEPVDNLGPVDTSTTSPIHKSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINETNLSESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKQGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPQIVGEEHYETAQQVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFQLILSGELDSLPEQAFYLVGNIDE 482
>gi|7708189|emb|CAB90039.1| ATP synthase beta subunit [Carpenteria californica] (481 aa)
Score = 1482, Expect = 5.2e-162, Identities = 301/455 (66%), Positives = 360/455 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK----KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K + G I QI GPV+DV F   +MPNI + L VK  +       +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:     6 KKNPGRIAQIIGPVLDVAFPSGKMPNIYNALVVKGQDTAGQPINVACEVQQLLGNNRVRAVAMSATDGLMRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKETLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFQLILSGELDGLPEQAFYLVGNIDE 471
>gi|62085188|gb|AAX62998.1| ATP synthase beta subunit [Poliothyrsis sp. Alford 44] (484 aa)
Score = 1482, Expect = 5.2e-162, Identities = 301/455 (66%), Positives = 361/455 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K + G I QI GPV+DV F+  +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVINT  P+  PVG A LGR+FNV+GEP+D+    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:     9 KKNVGHIAQIIGPVLDVAFSPGKMPNIYNALVVKGRDTVGEQINVTCEVQQLLGNNRVRAVAMSATDGLMRGMEVINTGAPLSVPVGGATLGRIFNVLGEPVDDLGPVDTRTTSPIHRSAPAFIQLETKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEENIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPQIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFKLILSGELDSLPEQAFYLVGNIDE 474
>gi|194267356|gb|ACF35664.1| ATP synthase beta subunit [Gevuina avellana] (492 aa)
Score = 1482, Expect = 5.3e-162, Identities = 301/451 (66%), Positives = 358/451 (79%)
  Q:   300 GIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           G I QI GPV+DV F   +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVINT  P+  PVG A LGR+FNV+GEP+DN    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:    21 GRIAQIIGPVLDVAFPPGKMPNIYNALIVKGRDTVGQQINVTCEVQQLLGNNRVRAVAMSATDGLMRGMEVINTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFQLILSGELDGLPEQAFYLVGNIDE 482
>gi|66276255|gb|AAY44142.1| ATP synthase beta subunit [Anisophyllea corneri] (486 aa)
Score = 1482, Expect = 5.3e-162, Identities = 304/470 (64%), Positives = 363/470 (77%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHKNYVAANSNNKVN 765
           K + G I QI GPV+DV F   +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEPIDN    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ NKQDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+L V+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+           +K+N
  S:     6 KKNLGRIAQIIGPVLDVAFPPGKMPNIYNALVVKGRDTVGQQINVTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPIDNLGPVDTRTTSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKKGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLIVARARKIERFLSQPFFVAEVFTGSPGKYVGLSETIRGFQLILSGELDSLPEQAFYLVGNIDEATAKATNLEMGSKLN 486
>gi|14718013|gb|AAK72748.1| ATP synthase beta subunit [Cneorum pulverulentum] (476 aa)
Score = 1482, Expect = 5.5e-162, Identities = 302/456 (66%), Positives = 361/456 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK----KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           K + G I QI GPV+DV F   +MPNI + L VK  +       +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIHK  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG +HY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+V
  S:     6 KKNLGHIAQIIGPVLDVAFPPGKMPNIYNALVVKSRDTVGQPINVTCEVQQLLGNNRVRAVAMSATDGLMRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPIDTRTTSPIHKSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEDHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFKLILSGEFDGLPEQAFYLVGNIDEV 472
>gi|21633361|gb|AAM52155.1| ATP synthase beta subunit [Seddera hirsuta] (485 aa)
Score = 1482, Expect = 5.5e-162, Identities = 302/455 (66%), Positives = 362/455 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKL--VLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K + G I QI GPV+DV F   +MPNI + L V+  +N+++    EV  L G++  R ++M  T+GL RG+EVI+T  PI  PVG A LGR+FNV+GEP+DN    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:    12 KKNLGRIVQIIGPVLDVAFPPGKMPNIYNALVVQGRDNEQMNVACEVQQLLGNNRVRAVAMSDTDGLMRGMEVIDTGAPISVPVGGATLGRIFNVLGEPVDNLGPVDTKTTSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEENIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFQLILSGELDGLPEQAFYLVGNIDE 475
>gi|4206574|gb|AAD11718.1| ATP synthase beta subunit [Phellodendron amurense] (477 aa)
Score = 1482, Expect = 5.5e-162, Identities = 302/456 (66%), Positives = 361/456 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           K + G I QI GPV+DV F   +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIHK  P+F +  T+  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+V
  S:     3 KKNLGHIAQIIGPVLDVAFPPGKMPNIYNALVVKGRDPVGQPINVTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHKSAPAFIQLDTRLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFKLILSGELDGLPEQAFYLVGNIDEV 469
>gi|61968331|gb|AAX57092.1| ATP synthase beta subunit [Drypetes madagascariensis] (478 aa)
Score = 1482, Expect = 5.6e-162, Identities = 304/455 (66%), Positives = 362/455 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK----KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDN-KPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVIN-------QTALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K   G I QI GPV+DV F   +MPNI + L VK  N       +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+D+  P+  ++  SPIHK  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+N+A  HGG+S+F GVGERTREGNDLY EM + GVIN       + ALV+GQMNEPPGARMRV LTALTMAE+FR+ NKQDVLLFIDNIFRF QAGSEVSALLGRIPSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:     5 KKKLGRITQIIGPVLDVTFPPGKMPNIYNALVVKSQNTVGQQINVTCEVQQLLGNNRVRTVAMSATDGLMRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDDLGPVDTRIT-SPIHKSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNVAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINGENIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNKQDVLLFIDNIFRFVQAGSEVSALLGRIPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPKIVGKEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEIFTGSLGKYVGLAETIRGFQLILSGELDGLPEQAFYLVGNIDE 470
>gi|18077607|emb|CAD11920.1| ATP synthase beta subunit [Valdivia gayana] (490 aa)
Score = 1482, Expect = 5.6e-162, Identities = 301/455 (66%), Positives = 361/455 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK----KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K + G I QI GPV+DV F   +MPNI + L VK  +       +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY++A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:    10 KKNSGRIAQIIGPVLDVAFPPGKMPNIYNALVVKGRDTGGQPINVTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIGESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYEIAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFQLILSGELDGLPEQAFYLVGNIDE 475
>gi|4995057|emb|CAB43981.1| H(+)-transporting ATP synthase [Abroma augustum] (488 aa)
Score = 1482, Expect = 5.6e-162, Identities = 302/455 (66%), Positives = 360/455 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K + G I QI GPV+DV F   +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIHK  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:     8 KRNLGRISQIIGPVLDVAFPPGKMPNIYNALVVKGRDTIGQQINVTCEVQQLLGNNRVRAVAMSATDGLMRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHKPAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNLAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFKLILSGELDGLPEQAFYLVGNIDE 473
>gi|108773232|ref|YP_635746.1| CF1 beta subunit of ATP synthase [Chara vulgaris] >gi|118573519|sp|Q1ACK1|ATPB_CHAVU ATP synthase subunit beta (ATPase subunit beta) (ATP synthase F1 sector subunit beta) >gi|77157888|gb|ABA61929.1| CF1 beta subunit of ATP synthase [Chara vulgaris] (493 aa)
Score = 1482, Expect = 5.7e-162, Identities = 305/465 (65%), Positives = 366/465 (78%)
  Q:   286 NEDLMKLNTLKSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK----KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDN-KPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           N DL      + ++G I QI GPV+D+ F   QMPNI +CL VK  N       +  EV  L GD+  R ++M +T+GL RG+EVI+T +P+  PVG   LGR+FNV+GEP+DN  P+   + + PIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM +  VIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ NKQDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+L V+RARKI  FLSQPFFVAE F+   GKYVS  DTI GF  I+ G+ D +PEQ F  VG I++
  S:     5 NLDLQNSLVAEKNRGKITQIIGPVMDISFLPGQMPNIYNCLTVKGKNASGDFIDVTCEVQQLLGDNKVRAVAMSATDGLMRGMEVIDTGSPLSVPVGETTLGRIFNVLGEPVDNLGPVDTSITF-PIHRAAPAFTQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESKVINEENISESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGTLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRNLAAKGIYPAVDPLDSTSTMLQPWIVGEEHYETAQGVKETLQRYKELQDIIAILGLDELSEEDRLIVARARKIERFLSQPFFVAEVFTGSPGKYVSLIDTIKGFQMILSGELDHLPEQAFYLVGDIEE 480
>gi|14718038|gb|AAK72760.1| ATP synthase beta subunit [Durio zibethinus] (478 aa)
Score = 1482, Expect = 5.7e-162, Identities = 302/455 (66%), Positives = 359/455 (78%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K + G I QI GPV+DV F   +MPNI + L VK    +     +  EV  L G+   R ++M +T+GL RG+EVINT  P+  PVG A LGR+FNV+GEP+DN    +    SPIHK  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ NKQ+VLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DE+SEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:     5 KXNLGRISQIIGPVLDVAFPPGKMPNIYNALVVKGRDTIGQQINVSCEVQQLLGNXRVRAVAMSATDGLMRGMEVINTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHKPAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNLAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNKQNVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGKEHYETAQRVKQTLQRYKELQDIIAILGLDEVSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFQLILSGELDGLPEQAFYLVGNIDE 470
>gi|7708503|emb|CAB89932.1| ATP synthase beta subunit [Myriophyllum exalbescens] (488 aa)
Score = 1482, Expect = 5.7e-162, Identities = 302/455 (66%), Positives = 359/455 (78%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK----KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K + G I QI GPV+DV F+   MPNI   L VK  +N      +  EV  L G++  R I+M +T+GL RG+EVI+T  P+  PVG   LGR+FNV+GEP+DN    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY++A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G  D +PEQ F  VG ID+
  S:     7 KKNXGRITQIIGPVLDVAFSPGNMPNIYSALVVKGRDNAGQQINMTCEVQQLLGNNRVRAIAMSATDGLTRGMEVIDTGAPLSVPVGGVTLGRIFNVLGEPVDNLGPVDTRTISPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGTLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYEIAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLSETIRGFQLILSGNFDGLPEQAFYLVGNIDE 472
>gi|57868926|gb|AAW57459.1| ATP synthase beta subunit [Ilex repanda] (493 aa)
Score = 1482, Expect = 5.7e-162, Identities = 302/455 (66%), Positives = 361/455 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK----KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K + G I QI GPV+DV FA  +MPNI + L VK  +       +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:    13 KKNLGRIAQIIGPVLDVAFAPGKMPNIYNALVVKGRDTAGQPINVTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGTLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQKVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFQLILSGELDGLPEQAFYLVGNIDE 478
>gi|14718167|gb|AAK72822.1| ATP synthase beta subunit [Pelliciera rhizophorae] (486 aa)
Score = 1482, Expect = 5.7e-162, Identities = 302/455 (66%), Positives = 361/455 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K + G I QI GPV+DV F+  +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIHK  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:    10 KKNLGRIVQIIGPVLDVAFSPGKMPNIYNALVVKGRDTVGQPINVTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHKSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNFAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQKVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFQLILSGELDGLPEQAFYLVGNIDE 475
>gi|156530087|gb|ABU75140.1| AtpB [Meliaceae sp. NBGB 19514782] (488 aa)
Score = 1481, Expect = 6.0e-162, Identities = 303/456 (66%), Positives = 360/456 (78%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           K   G I QI GPV+DV F   +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIHK  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+V
  S:    17 KKKLGHIAQIIGPVLDVAFPPGKMPNIYNALVVKGRDTVGQPINVTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHKPAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFKLILSGELDGLPEQAFYLVGNIDEV 483
>gi|7708656|emb|CAB90003.1| ATP synthase beta subunit [Stachyurus praecox] (489 aa)
Score = 1481, Expect = 6.0e-162, Identities = 301/455 (66%), Positives = 360/455 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K + G I QI GPV+DV F   +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:     9 KKNXGRIAQIIGPVLDVSFPPGKMPNIYNALVVKGRDTVGQQINVTCEVQQLLGNNRVRAVAMSATDGLMRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGTLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFKLILSGELDGLPEQAFYLVGNIDE 474
>gi|62902810|gb|AAY19320.1| ATP synthase beta subunit [Empleuridium juniperinum] (488 aa)
Score = 1481, Expect = 6.0e-162, Identities = 303/469 (64%), Positives = 365/469 (77%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK----KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHKNYVAANSNNKV 764
           K + G I QI GPV+DV F+  +MPNI + L VK  +       ++ EV  L G++  R ++M +T+GL RG++VI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIHK  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+           NK+
  S:     8 KKNLGRIAQIIGPVLDVAFSTGKMPNIYNALVVKGRDTSGHTMNVICEVQQLLGNNQVRAVAMSATDGLMRGMDVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHKSAPAFIQLETKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKKGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLSETIRGFKLILSGELDGLPEQAFYLVGNIDEATTKATNLEMENKL 487
>gi|62085229|gb|AAX63017.1| ATP synthase beta subunit [Paxistima canbyi] (483 aa)
Score = 1481, Expect = 6.1e-162, Identities = 301/455 (66%), Positives = 361/455 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK----KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K + G I QI GPV+DV F+  +MPNI + L VK  +       ++ EV  L G++  R ++M +T+GL RG++VI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIHK  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D  PEQ F  VG ID+
  S:     9 KKNLGRIAQIIGPVLDVAFSPGKMPNIYNALVVKGRDTSGHTINVICEVQQLLGNNQVRAVAMSATDGLMRGMDVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHKSAPAFIQLETKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKKGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFKLILSGELDGFPEQAFYLVGNIDE 474
>gi|24940268|emb|CAD43390.1| ATP synthase beta subunit [Trichodesma scotti] (489 aa)
Score = 1481, Expect = 6.2e-162, Identities = 301/455 (66%), Positives = 363/455 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K++ G I QI GPV+DV F+  +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK+GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:     9 KNNLGRIVQIIGPVLDVAFSPGKMPNIYNALVVKGRDTVGQPINVTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEENIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGTLQERITSTKAGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFQLILSGELDGLPEQAFYLVGNIDE 474
>gi|6017824|gb|AAF01646.1| ATP synthase beta subunit [Rheum rhaponticum] (498 aa)
Score = 1481, Expect = 6.2e-162, Identities = 303/469 (64%), Positives = 365/469 (77%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK----KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHKNYVAANSNNKV 764
           K++ G + QI GPV+DV F   +MPNI + L VK  +       +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ NKQDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG  HYK+A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+     +     NK+
  S:    17 KNNLGRVAQIIGPVLDVAFPPGKMPNIYNALVVKGRDTSGHPINVTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEENIPESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKQGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRALAAKGIYPAVDPLDSTSTMLQPRIVGEAHYKIAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFQLILSGELDGLPEQAFYLVGNIDEATAKAMNFEMENKL 496
>gi|24940258|emb|CAD43387.1| ATP synthase beta subunit [Pentaglottis sempervirens] (489 aa)
Score = 1481, Expect = 6.2e-162, Identities = 301/455 (66%), Positives = 362/455 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK----KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K + G I QI GPV+DV F+  +MPNI + L VK  +       +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK+GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:     9 KKNLGRIVQIIGPVLDVAFSPGKMPNIYNALVVKGRDTAGQPINVTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEENIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGTLQERITSTKAGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFQLILSGELDGLPEQAFYLVGNIDE 474
>gi|56675900|emb|CAB90089.2| ATP synthase beta subunit [Hymenanthera alpina] (486 aa)
Score = 1481, Expect = 6.3e-162, Identities = 301/455 (66%), Positives = 360/455 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K   G I QI GPV+DV F   +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY++A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:     9 KQKLGRIAQIIGPVLDVAFPPGKMPNIYNALVVKGRDTIGQQINVTCEVQQLLGNNRVRTVAMSATDGLMRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHRSAPAFVQLETKLLIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEENLAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPQIVGEEHYEIAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFQLILSGELDSLPEQAFYLVGNIDE 474
>gi|6688636|emb|CAB65223.1| ATP synthase beta subunit [Melanophylla alnifolia] (498 aa)
Score = 1481, Expect = 6.4e-162, Identities = 302/455 (66%), Positives = 361/455 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK----KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K + G I QI GPV+DV F   +MPNI + L VK  +N      +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN         SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK+GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:    17 KKNLGRIAQIIGPVLDVAFPPGKMPNIYNALVVKGRDNVGQQINVTCEVQQLLGNNRVRAVAMSATDGLMRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVNTRTTSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKAGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFQLILSGELDGLPEQAFYLVGNIDE 482
>gi|14718124|gb|AAK72801.1| ATP synthase beta subunit [Melanophylla alnifolia] (494 aa)
Score = 1481, Expect = 6.4e-162, Identities = 302/455 (66%), Positives = 361/455 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK----KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K + G I QI GPV+DV F   +MPNI + L VK  +N      +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN         SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK+GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:    13 KKNLGRIAQIIGPVLDVAFPPGKMPNIYNALVVKGRDNVGQQINVTCEVQQLLGNNRVRAVAMSATDGLMRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVNTRTTSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKAGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFQLILSGELDGLPEQAFYLVGNIDE 478
>gi|62902819|gb|AAY19324.1| ATP synthase beta subunit [Parnassia faberi] (488 aa)
Score = 1481, Expect = 6.4e-162, Identities = 305/475 (64%), Positives = 371/475 (78%)
  Q:   290 MKLNTL-KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK----KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHKNYVAANSNNKV 764
           ++++TL + + G I QI GPV+DV F+  +MPNI + L VK  +       +V EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+           NK+
  S:     1 LEVSTLERKNLGRIAQIIGPVLDVAFSPGKMPNIYNALVVKGRDTAGQQINVVCEVQQLLGNNQVRAVAMSATDGLTRGMEVIDTGVPLNVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKKGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFKLILSGELDGLPEQAFYLVGNIDEATVKATTLEMENKL 487
>gi|6688901|emb|CAB65316.1| ATP synthase beta subunit [Olea europaea] >gi|6688960|emb|CAB65348.1| ATP synthase beta subunit [Phyla lanceolata] (497 aa)
Score = 1481, Expect = 6.4e-162, Identities = 301/455 (66%), Positives = 365/455 (80%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDN-KPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K + G I QI GPV+DV F+  +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVI+T+ P+  PVG A LGR+FNV+GEP+DN  P+  +  + PIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY++A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:    17 KKNLGRIVQIIGPVLDVAFSPGKMPNIYNALVVKGRDTIGQPINVTCEVQQLLGNNRVRAVAMSATDGLMRGMEVIDTRAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTF-PIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEENIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGTLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYEIAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFQLILSGELDGLPEQAFYLVGNIDE 482
>gi|24940270|emb|CAD43391.1| ATP synthase beta subunit [Wigandia caracasana] (486 aa)
Score = 1481, Expect = 6.5e-162, Identities = 301/455 (66%), Positives = 361/455 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K + G I QI GPV+DV F   +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK+GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:     9 KKNXGRIVQIIGPVLDVAFLPGKMPNIYNALVVKGRDTVGQPINVTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHRPAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEENIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKTGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFQLILSGELDGLPEQAFYLVGNIDE 474
>gi|194267337|gb|ACF35655.1| ATP synthase beta subunit [Roupala montana] (497 aa)
Score = 1481, Expect = 6.6e-162, Identities = 304/468 (64%), Positives = 366/468 (78%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDVHKN--YVAANSNNK 763
           + + G I QI GPV+DV F   +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY++A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+      Y+   SN K
  S:    17 EKNPGRIAQIIGPVLDVAFPPGKMPNIYNALVVKGRDTVGQQINVTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYEIAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFQLILSGELDGLPEQAFYLVGNIDEATAKAMYLEVESNLK 497
>gi|62085163|gb|AAX62986.1| ATP synthase beta subunit [Microdesmis puberula] (482 aa)
Score = 1481, Expect = 7.0e-162, Identities = 301/455 (66%), Positives = 360/455 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K + G I QI GPV+DV F   +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:     8 KKNLGRIAQIIGPVLDVAFPPGKMPNIYNALVVKGRDTVGQQINVTCEVQQLLGNNRVRAVAMSATDGLMRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRATSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEENIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPQIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFKLILSGELDSLPEQAFYLVGNIDE 473
>gi|21633359|gb|AAM52154.1| ATP synthase beta subunit [Cladostigma hildebrandtioides] (490 aa)
Score = 1481, Expect = 7.1e-162, Identities = 302/455 (66%), Positives = 362/455 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNKKL--VLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K + G I QI GPV+DV F   +MPNI + L V+  +N+++    EV  L G++  R ++M  T+GL RG+EVI+T  PI  PVG A LGR+FNV+GEP+DN    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:    17 KKNLGRIVQIIGPVLDVAFPPGKMPNIYNALVVQGRDNEQMNVACEVQQLLGNNRVRAVAMSDTDGLMRGMEVIDTGAPISVPVGGATLGRIFNVLGEPVDNLGPVDTKTTSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEENIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFQLILSGELDGLPEQAFYLVGNIDE 480
>gi|9799484|gb|AAF98992.1| ATP synthase beta subunit [Paeonia brownii] (490 aa)
Score = 1481, Expect = 7.1e-162, Identities = 302/455 (66%), Positives = 361/455 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K ++G I QI GPV+DV F   +MPNI + L VK    +     +  EV  L G++  R ++M +TEGL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:    17 KKNQGRISQIIGPVLDVAFPPGKMPNIYNALVVKGQDSIGQPINVTCEVQQLLGNNRVRTVAMSATEGLMRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGTLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLTETIRGFQLILSGELDGLPEQAFYLVGNIDE 482
>gi|156530145|gb|ABU75169.1| AtpB [Nothospondias staudtii] (495 aa)
Score = 1481, Expect = 7.2e-162, Identities = 303/456 (66%), Positives = 361/456 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDDV 751
           K + G I QI GPV+DV F   +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIHK  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+V
  S:    14 KKNLGHIAQIIGPVLDVAFPPGKMPNIYNALVVKGRDTVGQPINMTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTRSPIHKPAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFKLILSGELDGLPEQAFYLVGNIDEV 480
>gi|14718066|gb|AAK72774.1| ATP synthase beta subunit [Greyia radlkoferi] (483 aa)
Score = 1481, Expect = 7.2e-162, Identities = 301/455 (66%), Positives = 360/455 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K + G I QI GPV+DV F   +MPNI + L VK    +     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:    10 KKNLGRIAQIIGPVLDVAFPPGKMPNIYNALVVKGRDTVGQQINVTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTSTTSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQQVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFKLILSGELDGLPEQAFYLVGNIDE 475
>gi|62085219|gb|AAX63012.1| ATP synthase beta subunit [Dillenia philippinensis] (482 aa)
Score = 1481, Expect = 7.2e-162, Identities = 302/455 (66%), Positives = 360/455 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK----KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K   G I QI GPV+DV F   +MPNI + L VK  +       +  EV  L G++  R ++M +T+GL RG+EVI+T+ P+  PVG A LGR+FNV+GEPIDN    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY+ A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:     8 KKSLGRIAQIIGPVLDVAFPPGKMPNIYNALLVKGRDTAGQQINVTCEVQQLLGNNRVRAVAMSATDGLMRGMEVIDTEAPLSVPVGGATLGRIFNVLGEPIDNLGPVDTRTTSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKRGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYETAQKVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLTETIRGFQLILSGELDGLPEQAFYLVGNIDE 473
>gi|18075921|emb|CAD11922.1| ATP synthase beta subunit [Escallonia calcottiae] >gi|18075923|emb|CAD11923.1| ATP synthase beta subunit [Escallonia illinita] >gi|18075925|emb|CAD11924.1| ATP synthase beta subunit [Escallonia myrtoidea] >gi|18075927|emb|CAD11925.1| ATP synthase beta subunit [Escallonia pulverulenta] (490 aa)
Score = 1481, Expect = 7.2e-162, Identities = 301/455 (66%), Positives = 361/455 (79%)
  Q:   296 KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVKLPNNK----KLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           K + G I QI GPV+DV F   +MPNI + L VK  +       +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEP+DN    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA TVL R +A+ GIYPA++PL+S+S ML P IVG EHY++A+ V+  LQ+++ELQDIIAILG+DELSEED+LTV+RARKI  FLSQPFFVAE F+   GKYV   +TI GF  I+ G+ D +PEQ F  VG ID+
  S:     9 KKNSGRIAQIIGPVLDVAFPPGKMPNIYNALVVKGRDTGGQPINVTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHRSAPAFIQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIGESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYEIAQRVKQTLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFQLILSGELDGLPEQAFYLVGNIDE 474
>gi|14718244|gb|AAK72860.1| ATP synthase beta subunit [Terminalia catappa] (481 aa)
Score = 1481, Expect = 7.4e-162, Identities = 304/460 (66%), Positives = 365/460 (79%)
  Q:   291 KLNTL-KSDKGIIYQIFGPVVDVKFARNQMPNINDCLEVK----LPNNKKLVLEVALLEGDDVARCISMGSTEGLYRGLEVINTKNPIMAPVGSAVLGRMFNVVGEPIDNKPMPEKVEYSPIHKKPPSFDEQSTKTEIFETGIKVIDLLVPYVKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGLSIFAGVGERTREGNDLYHEMIDGGVINQ-------TALVFGQMNEPPGARMRVALTALTMAEHFRENNKQDVLLFIDNIFRFSQAGSEVSALLGRIPSAVGYQPTLAFEMGQLQERITSTKSGSITSVQAVYVPADDLTDPAPSTTFAHLDAKTVLDRKIASLGIYPAINPLESSSRMLDPSIVGIEHYKVARSVQTILQKFEELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSHKSGKYVSTQDTISGFSEIIEGKCDDIPEQYFLYVGGIDD 750
           +++TL K + G I QI GPV+DV F   +MPNI + L VK    L     +  EV  L G++  R ++M +T+GL RG+EVI+T  P+  PVG A LGR+FNV+GEPID+    +    SPIH+  P+F +  TK  IFETGIKV+DLL PY +GGKIGLFGGAGVGKTVL+ ELI+NIA  HGG+S+F GVGERTREGNDLY EM + GVIN+        ALV+GQMNEPPGARMRV LTALTMAE+FR+ N+QDVLLFIDNIFRF QAGSEVSALLGR+PSAVGYQPTL+ EMG LQERITSTK GSITS+QAVYVPADDLTDPAP+TTFAHLDA