>gi|26553515|ref|NP_757449.1| ATP synthase subunit epsilon [Mycoplasma penetrans HF-2] >gi|26453521|dbj|BAC43853.1| ATP synthase subunit epsilon [Mycoplasma penetrans HF-2] (135 aa)
Score = 539, Expect = 8.4e-54, Identities = 135/135 (100%), Positives = 135/135 (100%)
  Q:     1 MGANSNLKLNIITPSKVAYSDFVKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQIIDINNQTFEYIVDNGIYSVANCELNFLTSFCIKNTEEDKMQISQMREKTLNVLNSKNLNNFHFQFEVSLFKKISGIRKKN 135
           MGANSNLKLNIITPSKVAYSDFVKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQIIDINNQTFEYIVDNGIYSVANCELNFLTSFCIKNTEEDKMQISQMREKTLNVLNSKNLNNFHFQFEVSLFKKISGIRKKN
  S:     1 MGANSNLKLNIITPSKVAYSDFVKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQIIDINNQTFEYIVDNGIYSVANCELNFLTSFCIKNTEEDKMQISQMREKTLNVLNSKNLNNFHFQFEVSLFKKISGIRKKN 135
>gi|153956278|ref|YP_001397043.1| F0F1 ATP synthase subunit epsilon [Clostridium kluyveri DSM 555] >gi|189081358|sp|A5N3H6|ATPE_CLOK5 ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) >gi|146349136|gb|EDK35672.1| AtpC [Clostridium kluyveri DSM 555] (132 aa)
Score = 111, Expect = 3.8e-04, Identities = 31/93 (33%), Positives = 46/93 (49%)
  Q:     7 LKLNIITPSKVAYSDFVKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQIIDINNQTFEYIVDNGIYSVANCELNFLTSFC-------IKNTEEDKMQISQ 99
           LKL I+TP +  Y   V  V     +G+I IL  + P I  LK +  +I++ + +  +    NGI  + N EL  L   C       +K  EE K +  Q
  S:     5 LKLTILTPDREFYKGEVLEVITDSIQGNITILPGHMPLITTLKSTDTRIVEKSGKELKAFTSNGILEIKNNELKILCDVCEWPGEIDLKRAEEAKKRAEQ 104
>gi|91201499|emb|CAJ74559.1| similar to ATP synthase subunit epsilon [Candidatus Kuenenia stuttgartiensis] (134 aa)
Score = 109, Expect = 5.2e-04, Identities = 27/103 (26%), Positives = 49/103 (47%)
  Q:     9 LNIITPSKVAYSDFVKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQIIDINNQTFEYIVDNGIYSVANCELNFLTSFCIKNTEEDKMQISQMREKTLNVLNSK 111
           L IITP K  +   VK++     +G   IL ++ P I +L+ SI+ I D  + T  + VD G + +   +   L   C+   E D +++ + +      L+ +
  S:     7 LEIITPMKTVFKGLVKNITAMGTQGSFGILIDHAPFITELQTSILTIKDEKDSTVSFAVDGGFFEMVANKAIVLADSCVTKEEIDIVKVREEKRSAEEALSKE 109
>gi|67459657|ref|YP_247281.1| F0F1 ATP synthase subunit epsilon [Rickettsia felis URRWXCal2] >gi|75535947|sp|Q4UK19|ATPE_RICFE ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) >gi|67005190|gb|AAY62116.1| ATP synthase epsilon chain [Rickettsia felis URRWXCal2] (112 aa)
Score = 108, Expect = 7.6e-04, Identities = 29/95 (30%), Positives = 47/95 (49%)
  Q:     4 NSNLKLNIITPSKVAYSDFVKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQII--DINNQTFEYIVDNGIYSVANCELNFLTSFCIKNTEEDKMQIS 98
           N  + + IITP  +A+    K V    +EG   +L N+ P I  LK  ++Q+   DI N    Y+V +G+  V    +N  T   I  T  ++ +I+
  S:     2 NETILVKIITPLSIAFEKQAKMVTMPGEEGMFGVLPNHAPMIVSLKAGLVQVYIDDIYNPQITYLVSSGVTEVTGSYVNIATETAINVTNLNEAEIA 98
>gi|139390354|ref|YP_001122952.1| ATPase epsilon subunit [Aethionema cordifolium] >gi|134286147|dbj|BAF49776.1| ATPase epsilon subunit [Aethionema cordifolium] (132 aa)
Score = 104, Expect = 1.9e-03, Identities = 27/96 (28%), Positives = 48/96 (50%)
  Q:     7 LKLNIITPSKVAYSDFVKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQIIDINNQTFEYIVDNGIYSVANCELNFLTSFCIKNTEEDKMQISQMRE 102
           L L ++TP+++A+   VK +  S + G I +L N+ P    +   I++I  +NNQ     +  G   + N E+  L +   KN++ D  +  Q  E
  S:     3 LNLCVLTPNRIAWDSEVKEIILSTNSGQIGVLPNHAPVATAVDIGILKI-RLNNQWLTMALMGGFARIGNNEITILVNDAEKNSDIDPQEAQQTLE 97
>gi|87311749|ref|ZP_01093864.1| probable ATP synthase CF1 subunit e [Blastopirellula marina DSM 3645] >gi|87285533|gb|EAQ77452.1| probable ATP synthase CF1 subunit e [Blastopirellula marina DSM 3645] (130 aa)
Score = 104, Expect = 2.2e-03, Identities = 32/101 (31%), Positives = 49/101 (48%)
  Q:     5 SNLKLNIITPSKVAY---SDFVKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQIIDINNQTFEYIVDNGIYSVANCELNFLTSFCIKNTEEDKMQISQMREKTL 105
           + LK  ++TP   A    +DFV    F   +G+I I  ++ P IG+L    ++I+     T  Y VD G   VAN E+N LT   +   E  K+   Q  +  +
  S:     2 AQLKCIVVTPEATALETTADFVALPLF---DGEIGIAPSHSPMIGRLGYGEMRIVS-GGTTTRYYVDGGFVQVANNEVNVLTGKAVPAQEVSKVDAEQQLQAAM 101
>gi|15604632|ref|NP_221150.1| F0F1 ATP synthase subunit epsilon [Rickettsia prowazekii str. Madrid E] >gi|6225073|sp|Q9ZCF3|ATPE_RICPR ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) >gi|3861327|emb|CAA15226.1| ATP SYNTHASE EPSILON CHAIN (atpC) [Rickettsia prowazekii] (112 aa)
Score = 103, Expect = 2.6e-03, Identities = 28/109 (25%), Positives = 56/109 (51%)
  Q:     4 NSNLKLNIITPSKVAYSDFVKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQIIDINNQTFE--YIVDNGIYSVANCELNFLTSFCIKNTEEDKMQISQMREKTLNVLNSKN 112
           +  +++ IITPS +A+    K V    ++G   +L ++ P I  LK  ++QI   N   +E  Y++  G+  + +  +N +T   I  T   + +IS  R +   +L+ ++
  S:     2 HETIRVKIITPSSIAFEKQSKMVTMPGEDGMFGVLPHHVPMIVNLKAGLVQIYIYNIHNYENTYLISGGVTEITSHYINIVTEVAINVTNLSESEISTQRYELQKLLSHQH 112
>gi|139389270|ref|YP_001123036.1| ATPase epsilon subunit [Aethionema grandiflorum] >gi|134286232|dbj|BAF49860.1| ATPase epsilon subunit [Aethionema grandiflorum] (132 aa)
Score = 103, Expect = 2.8e-03, Identities = 27/96 (28%), Positives = 48/96 (50%)
  Q:     7 LKLNIITPSKVAYSDFVKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQIIDINNQTFEYIVDNGIYSVANCELNFLTSFCIKNTEEDKMQISQMRE 102
           L L ++TP+++A+   VK +  S + G I +L N+ P    +   I++I  +NNQ     +  G   + N E+  L +   KN++ D  +  Q  E
  S:     3 LNLCVLTPNRIAWDSEVKEIILSTNSGQIGVLPNHAPIATAVDIGILKI-RLNNQWLTMALMGGFARIGNNEITILVNDAEKNSDIDPQEAQQTLE 97
>gi|119189503|ref|XP_001245358.1| hypothetical protein CIMG_04799 [Coccidioides immitis RS] >gi|90304144|gb|EAS33775.1| hypothetical protein CIMG_04799 [Coccidioides immitis RS] (165 aa)
Score = 99, Expect = 7.6e-03, Identities = 28/99 (28%), Positives = 59/99 (59%)
  Q:     4 NSNLKLNIITPSKVAY-SDFVKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQIIDINNQTFEYIVDNGIYSV---ANCELNFLTSFCIKNTEEDKMQISQMRE 102
           +  L+L+++ P +  Y S  V  V  + + GD+ IL+++ P+I +L+  +I+II+ + QT ++ +  G   V   +N  +N +  F +++   D ++ SQ+ E
  S:    32 SDKLRLSLVLPHETIYKSADVVQVNIAAESGDMGILSSHVPSIEQLRPGLIEIIEESGQTKKFFLAGGFAVVQPDSNLSINAVEGFALEDFSADAVK-SQIGE 133
>gi|139387258|ref|YP_001123379.1| ATPase epsilon subunit [Capsella bursa-pastoris] >gi|139388100|ref|YP_001123292.1| ATPase epsilon subunit [Barbarea verna] >gi|139389102|ref|YP_001123820.1| ATPase epsilon subunit [Nasturtium officinale] >gi|139389424|ref|YP_001123121.1| ATPase epsilon subunit [Olimarabidopsis pumila] >gi|139389648|ref|YP_001123205.1| ATPase epsilon subunit [Arabis hirsuta] >gi|139389807|ref|YP_001123468.1| ATPase epsilon subunit [Crucihimalaya wallichii] >gi|139389956|ref|YP_001123556.1| ATPase epsilon subunit [Draba nemorosa] >gi|139390158|ref|YP_001123731.1| ATPase epsilon subunit [Lobularia maritima] >gi|134286318|dbj|BAF49945.1| ATPase epsilon subunit [Olimarabidopsis pumila] >gi|134286403|dbj|BAF50029.1| ATPase epsilon subunit [Arabis hirsuta] >gi|134286491|dbj|BAF50116.1| ATPase epsilon subunit [Barbarea verna] >gi|134286579|dbj|BAF50203.1| ATPase epsilon subunit [Capsella bursa-pastoris] >gi|134286669|dbj|BAF50292.1| ATPase epsilon subunit [Crucihimalaya wallichii] >gi|134286758|dbj|BAF50380.1| ATPase epsilon subunit [Draba nemorosa] >gi|134286935|dbj|BAF50555.1| ATPase epsilon subunit [Lobularia maritima] >gi|134287025|dbj|BAF50644.1| ATPase epsilon subunit [Nasturtium officinale] (132 aa)
Score = 99, Expect = 8.2e-03, Identities = 26/96 (27%), Positives = 47/96 (48%)
  Q:     7 LKLNIITPSKVAYSDFVKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQIIDINNQTFEYIVDNGIYSVANCELNFLTSFCIKNTEEDKMQISQMRE 102
           L L ++TP+++ +   VK +  S + G I +L N+ P    +   I++I  +NNQ     +  G   + N E+  L +   KN++ D  +  Q  E
  S:     3 LNLCVLTPNRIVWDSEVKEIILSTNSGQIGVLPNHAPIATAVDIGILKI-RLNNQWLTMALMGGFARIGNNEITILVNDAEKNSDIDPQEAQQTLE 97
>gi|139388916|ref|YP_001123643.1| ATPase epsilon subunit [Lepidium virginicum] >gi|134286846|dbj|BAF50467.1| ATPase epsilon subunit [Lepidium virginicum] (132 aa)
Score = 99, Expect = 8.6e-03, Identities = 26/96 (27%), Positives = 47/96 (48%)
  Q:     7 LKLNIITPSKVAYSDFVKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQIIDINNQTFEYIVDNGIYSVANCELNFLTSFCIKNTEEDKMQISQMRE 102
           L L ++TP+++ +   VK +  S + G I +L N+ P    +   I++I  +NNQ     +  G   + N E+  L +   KN++ D  +  Q  E
  S:     3 LNLCVLTPNRIVWDSEVKEIILSTNSGQIGVLPNHAPIATAVDIGILKI-RLNNQWLTMALMGGFARIGNNEITILVNDAEKNSDIDPQEAQQTLE 97
>gi|157325536|ref|YP_001468314.1| ATP synthase CF1 epsilon subunit [Ipomoea purpurea] >gi|114598|sp|P07138|ATPE_IPOBA ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) >gi|58337|emb|CAA29394.1| unnamed protein product [Ipomoea batatas] >gi|157056764|gb|ABV02354.1| ATP synthase CF1 epsilon subunit [Ipomoea purpurea] (133 aa)
Score = 98, Expect = 1.1e-02, Identities = 26/96 (27%), Positives = 48/96 (50%)
  Q:     7 LKLNIITPSKVAYSDFVKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQIIDINNQTFEYIVDNGIYSVANCELNFLTSFCIKNTEEDKMQISQMRE 102
           LKL ++TP+++ +   VK +  S + G I IL N+ P    +   I++ I +N+Q     +  G   + N E+  L +   K ++ D ++  Q  E
  S:     3 LKLCVLTPNRIVWDSEVKEIILSTNSGQIGILPNHAPIATAVDIGILR-IRLNDQWVTMALMGGFARIGNNEITVLVNDAEKGSDIDSLEAQQTLE 97
>gi|22796619|emb|CAD23965.1| ATP synthase epsilon subunit [Ipomoea batatas] (132 aa)
Score = 98, Expect = 1.2e-02, Identities = 26/96 (27%), Positives = 48/96 (50%)
  Q:     7 LKLNIITPSKVAYSDFVKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQIIDINNQTFEYIVDNGIYSVANCELNFLTSFCIKNTEEDKMQISQMRE 102
           LKL ++TP+++ +   VK +  S + G I IL N+ P    +   I++ I +N+Q     +  G   + N E+  L +   K ++ D ++  Q  E
  S:     2 LKLCVLTPNRIVWDSEVKEIILSTNSGQIGILPNHAPIATAVDIGILR-IRLNDQWVTMALMGGFARIGNNEITVLVNDAEKGSDIDSLEAQQTLE 96
>gi|163943652|gb|ABY48985.1| ATP synthase CF1 epsilon subunit [Cuscuta epilinum] (133 aa)
Score = 97, Expect = 1.3e-02, Identities = 28/102 (27%), Positives = 50/102 (49%)
  Q:     7 LKLNIITPSKVAYSDFVKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQIIDINNQTFEYIVDNGIYSVANCELNFLTSFCIKNTEEDKMQISQMREKTLNVL 108
           LKL ++TP+++ +   V+ +  S + G I IL N+ P    L   I++ I +N Q     +  G   +AN E+  L +   K +E D  +  Q  +   ++L
  S:     3 LKLCVLTPNRIVWDSEVEEIILSTNSGQIGILPNHTPIATALDIGILK-IRLNGQWLTTALMGGFARIANNEITVLVNDAEKGSEIDPQEAQQTLKIAKDIL 103
>gi|157804172|ref|YP_001492721.1| F0F1 ATP synthase subunit epsilon [Rickettsia canadensis str. McKiel] >gi|157785435|gb|ABV73936.1| F0F1 ATP synthase subunit epsilon [Rickettsia canadensis str. McKiel] (104 aa)
Score = 97, Expect = 1.5e-02, Identities = 25/95 (26%), Positives = 46/95 (48%)
  Q:     4 NSNLKLNIITPSKVAYSDFVKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQII--DINNQTFEYIVDNGIYSVANCELNFLTSFCIKNTEEDKMQIS 98
           N  + + IITP  +A+    K V    D+G   +L ++ P +  LK  ++Q+   D++     Y++  G+  VA   +N  T   I  T   + +I+
  S:     2 NETIIVKIITPLSIAFEKQAKMVTLPGDDGMFGVLPSHTPMLVSLKTGLVQVYIDDMHKPKNTYLISGGVTEVAGSYINIATEIAINVTNLSEAEIA 98
>gi|190349051|gb|EDK41627.2| conserved hypothetical protein [Pichia guilliermondii ATCC 6260] (161 aa)
Score = 97, Expect = 1.6e-02, Identities = 29/96 (30%), Positives = 51/96 (53%)
  Q:     7 LKLNIITPSKVAYSDF-VKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQIIDINNQTFEYIVDNGIYSVANCELNFLTSFCIKNTEEDKMQISQMRE 102
           LKL++  P +  YS+  V+ V      GD+ IL N+ P + +L+  +++II    +T +Y V  GI +V     N LT   I+  + D+   S +++
  S:    32 LKLSLALPHQTLYSESEVQQVNLPSINGDLGILANHIPIVEQLRPGLLEIISKGGETEQYFVSGGIATVQPG--NKLTISAIEAFKPDQFDASAVKQ 126
>gi|182420261|ref|ZP_02951490.1| ATP synthase F1, epsilon subunit [Clostridium butyricum 5521] >gi|182375856|gb|EDT73448.1| ATP synthase F1, epsilon subunit [Clostridium butyricum 5521] (133 aa)
Score = 96, Expect = 1.8e-02, Identities = 26/77 (33%), Positives = 40/77 (51%)
  Q:     3 ANSNLKLNIITPSKVAYSDFVKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQIIDINNQTFEYIVDNGIYSVANCEL 79
           ANS L L I+TPS   Y   V+ V+  + +G+  +L N+E  I     +I + ID N + FE  +   I +V   E+
  S:     2 ANSFL-LKIVTPSHDVYEGMVQRVFLKNSDGEFEVLANHENMITSTVPNIAKFIDENGEAFELFISTAIVNVVKGEV 77
>gi|126276303|ref|XP_001386981.1| ATP synthase delta subunit [Pichia stipitis CBS 6054] >gi|126212850|gb|EAZ62958.1| ATP synthase delta subunit [Pichia stipitis CBS 6054] (161 aa)
Score = 96, Expect = 1.9e-02, Identities = 24/72 (33%), Positives = 41/72 (56%)
  Q:     3 ANSNLKLNIITPSKVAYSDF-VKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQIIDINNQTFEYIVDNGIYSV 74
           A+  LKL++  P +  YS+  V+ V      GD+ IL N+ P + +L+  +++II    +T +Y V  GI +V
  S:    28 ASDALKLSLALPHQTLYSESEVEQVNLPSVNGDLGILANHIPIVEQLRPGLLEIISKGGETEQYFVSGGIATV 100
>gi|22797149|emb|CAD23977.1| ATP synthase epsilon subunit [Polyosma cunninghamii] (132 aa)
Score = 96, Expect = 1.9e-02, Identities = 25/96 (26%), Positives = 48/96 (50%)
  Q:     7 LKLNIITPSKVAYSDFVKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQIIDINNQTFEYIVDNGIYSVANCELNFLTSFCIKNTEEDKMQISQMRE 102
           LKL ++TP+++ +   VK +  S + G I +L N+ P    +   I++ I +N+Q     +  G   + N E+  L +   K+++ D  +  Q  E
  S:     2 LKLCVLTPNRIVWDSEVKEIILSTNSGQIGVLPNHAPIATAVDIGILR-IRLNDQWLTMALMGGFARIGNNEITVLVNDAEKSSDIDPQEAQQTLE 96
>gi|163943654|gb|ABY48986.1| ATP synthase CF1 epsilon subunit [Cuscuta europaea] (133 aa)
Score = 96, Expect = 2.1e-02, Identities = 26/94 (27%), Positives = 46/94 (48%)
  Q:     6 NLKLNIITPSKVAYSDFVKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQIIDINNQTFEYIVDNGIYSVANCELNFLTSFCIKNTEEDKMQISQ 99
           NLKL ++TP+++ +   V+ +  S + G I IL N+ P    +   I++ I +N Q     +  G   + N E+  L +   K +E D  +  Q
  S:     2 NLKLCVLTPNRIVWDSEVEEIILSTNSGQIGILPNHTPIATAVDIGILK-IRLNGQWLTTALMGGFARIVNNEITVLVNDAEKGSEIDPQEAEQ 94
>gi|134300980|ref|YP_001114476.1| F0F1 ATP synthase subunit epsilon [Desulfotomaculum reducens MI-1] >gi|189081362|sp|A4J998|ATPE_DESRM ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) >gi|134053680|gb|ABO51651.1| ATP synthase F1, epsilon subunit [Desulfotomaculum reducens MI-1] (132 aa)
Score = 95, Expect = 2.1e-02, Identities = 30/125 (24%), Positives = 58/125 (46%)
  Q:     8 KLNIITPSKVAYSDFVKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQIIDINNQTFEYIVDNGIYSVANCELNFLTSFCIKNTEEDKMQISQMREKTLNVLNSKNLNNFHFQFEVSLFKKISGIR 132
           +L+I+TP KV +S+ +  V     +G++ IL  + P +  LK   ++ +    + F+  V  G   V N  +  L     +  + D  +    +++    LNSK       + E++L K I+ I+
  S:     6 RLDIVTPEKVVFSEEIDFVVAPGADGELGILPEHAPLVTALKVGTLR-VQQGGKFFKVAVSGGFMEVKNSRIVVLADTAERADQIDVERAKAAKQRAEQRLNSKGSEIDVHRAEIALHKAINRIK 129
>gi|146411981|ref|XP_001481962.1| conserved hypothetical protein [Pichia guilliermondii ATCC 6260] (161 aa)
Score = 94, Expect = 2.8e-02, Identities = 23/68 (33%), Positives = 39/68 (57%)
  Q:     7 LKLNIITPSKVAYSDF-VKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQIIDINNQTFEYIVDNGIYSV 74
           LKL++  P +  YS+  V+ V      GD+ IL N+ P + +L+  +++II    +T +Y V  GI +V
  S:    32 LKLSLALPHQTLYSESEVQQVNLPSINGDLGILANHIPIVEQLRPGLLEIISKGGETEQYFVSGGIATV 100
>gi|50410163|ref|XP_456939.1| hypothetical protein DEHA0A14432g [Debaryomyces hansenii CBS767] >gi|49652603|emb|CAG84917.1| unnamed protein product [Debaryomyces hansenii CBS767] (160 aa)
Score = 94, Expect = 3.0e-02, Identities = 23/68 (33%), Positives = 39/68 (57%)
  Q:     7 LKLNIITPSKVAYSDF-VKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQIIDINNQTFEYIVDNGIYSV 74
           LKL++  P +  YS+  V+ V      GD+ IL N+ P + +L+  +++II    +T +Y V  GI +V
  S:    31 LKLSLALPHQTLYSESEVEQVNLPSINGDLGILANHIPIVEQLRPGLLEIISKGGETEQYFVSGGIATV 99
>gi|169832273|ref|YP_001718255.1| ATP synthase F1, epsilon subunit [Candidatus Desulforudis audaxviator MP104C] >gi|169639117|gb|ACA60623.1| ATP synthase F1, epsilon subunit [Candidatus Desulforudis audaxviator MP104C] (137 aa)
Score = 94, Expect = 3.0e-02, Identities = 26/110 (23%), Positives = 52/110 (47%)
  Q:     3 ANSNLKLNIITPSKVAYSDFVKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQIIDINNQTFEYIVDNGIYSVANCELNFLTSFCIKNTEEDKMQISQMREKTLNVLNSKN 112
           A +  K++I+TP +V Y D  + V+    +GD+  L  + P I  L+  +++ I    Q   ++V  G   V +  +  L +   +  E D  +  + +E+    L +K+
  S:     2 AEATQKVSIVTPERVIYGDEARFVHVRGTDGDLGFLPGHTPLISSLRPGLLR-IQKEGQWSTFVVAGGFVEVRDSRVVVLANAAERPEEIDLARAEKAKERAEKRLAAKD 110
>gi|196232467|ref|ZP_03131320.1| ATP synthase F1, epsilon subunit [Chthoniobacter flavus Ellin428] >gi|196223539|gb|EDY18056.1| ATP synthase F1, epsilon subunit [Chthoniobacter flavus Ellin428] (137 aa)
Score = 93, Expect = 3.5e-02, Identities = 27/108 (25%), Positives = 53/108 (49%)
  Q:     5 SNLKLNIITPSKVAYSDFVKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQIIDINNQTFEYI-VDNGIYSVANCELNFLTSFCIKNTEEDKMQISQMREKTLNVLNSKN 112
           + L+L I+TP K+A+   V+SV     EG++ +L  + P + ++K    +++   N   +Y+ V  G  +V    +N LT   I+    D+       E+  + L  ++
  S:     2 ATLRLEIVTPDKLAFEGDVESVVIPGSEGELGVLPMHIPLMTQIKPG--EVVITQNGKKDYLAVGEGFATVTQTNVNILTDMAIEWQHIDETAAEAAIERAKSTLAGRH 108
>gi|15896118|ref|NP_349467.1| F0F1 ATP synthase subunit epsilon [Clostridium acetobutylicum ATCC 824] >gi|17372693|sp|Q9Z686|ATPE_CLOAB ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) >gi|15025910|gb|AAK80807.1|AE007784_4 FoF1-type ATP synthase epsilon subunit [Clostridium acetobutylicum ATCC 824] >gi|4323569|gb|AAD16427.1| ATP synthase subunit epsilon [Clostridium acetobutylicum] (133 aa)
Score = 93, Expect = 3.9e-02, Identities = 33/131 (25%), Positives = 62/131 (47%)
  Q:     5 SNLKLNIITPSKVAYSDFVKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQIIDINNQTFEYIVDNGIYSVANCELNFLTSFCIKNTEEDKMQISQMREKTLNVLNSKNLNNFHFQFEVSLFKKISGIRKKN 135
           +N+KL+I+TP K  Y   VK +     EG+I IL N+   +  L  +   +++ +    +     GI +V   E++F+        E D  +    +E+    L + N  +   + E+SL + ++ I+ KN
  S:     3 NNIKLSILTPQKTFYVGDVKEIITRTVEGEIGILPNHTDLVAFLTPTETILVEEDGSRKKVFTSTGILNVGESEVSFMCDASEWPDEIDIQRAETAKERAEKRLKTSNNIDVK-RAELSLSRALARIKTKN 132
>gi|68473261|ref|XP_719436.1| hypothetical protein CaO19.7678 [Candida albicans SC5314] >gi|46441253|gb|EAL00552.1| hypothetical protein CaO19.7678 [Candida albicans SC5314] (161 aa)
Score = 93, Expect = 4.1e-02, Identities = 29/95 (30%), Positives = 51/95 (53%)
  Q:     7 LKLNIITPSKVAYSDF-VKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQIIDINNQTFEYIVDNGIYSVANCELNFLTSFCIKNTEEDKMQISQMR 101
           LKL++  P +  Y+D  V+ V      GD+ IL N+ P + +L+  +++II  N  + +Y V  GI  V     N LT   I+  + D++ +S ++
  S:    32 LKLSLALPHQTLYNDSEVQQVNLPSVNGDLGILANHIPIVEQLRPGLLEIISKNGDSDQYFVSGGIAMVQPG--NKLTISAIEAFKTDQIDLSAVK 125
>gi|169335793|ref|ZP_02862986.1| hypothetical protein ANASTE_02218 [Anaerofustis stercorihominis DSM 17244] >gi|169258531|gb|EDS72497.1| hypothetical protein ANASTE_02218 [Anaerofustis stercorihominis DSM 17244] (146 aa)
Score = 93, Expect = 4.5e-02, Identities = 34/132 (25%), Positives = 57/132 (43%)
  Q:     4 NSNLKLNIITPSKVAYSDFVKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQIIDINNQTFEYIVDNGIYSVANCELNFLTSFCIKNTEEDKMQISQMREKTLNVLNSKNLNNFHF-QFEVSLFKKISGIRKKN 135
           + NL L I TP++  Y+D V+   F    G++ IL N+ P +      I+ I D+     E  +  G   V N ++  +T   +   E D  +  + + +    L++   N   F Q E  L K +  I   N
  S:     3 DQNLHLEIATPTRTFYNDEVEKFTFKATTGEMTILKNHVPIMTLADLGIMHITDLKGNKREATLFGGSVLVENNKILIVTDDALWPEEIDIRRAEEAKRRAEEKLHATKYNRREFVQAEHKLRKALVRIDLAN 135
>gi|28261723|ref|NP_783238.1| ATP synthase CF1 epsilon subunit [Atropa belladonna] >gi|68052217|sp|Q8S8W9|ATPE_ATRBE ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) >gi|20068337|emb|CAC88050.1| ATPase epsilon subunit [Atropa belladonna] (133 aa)
Score = 92, Expect = 5.0e-02, Identities = 24/96 (25%), Positives = 48/96 (50%)
  Q:     7 LKLNIITPSKVAYSDFVKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQIIDINNQTFEYIVDNGIYSVANCELNFLTSFCIKNTEEDKMQISQMRE 102
           L L+++TP+++ +   V+ +  S + G I IL+N+ P    +   I++ I +N+Q     +  G   + N E+  L +   K ++ D  +  Q  E
  S:     3 LNLSVLTPNRIVWDSEVEEIVLSTNSGQIGILSNHAPIATAVDIGILR-IRLNDQWLTMALMGGFARIGNNEITVLVNDAEKGSDIDPQEAQQTLE 97
>gi|149235065|ref|XP_001523411.1| ATP synthase delta chain, mitochondrial precursor [Lodderomyces elongisporus NRRL YB-4239] >gi|146452820|gb|EDK47076.1| ATP synthase delta chain, mitochondrial precursor [Lodderomyces elongisporus NRRL YB-4239] (160 aa)
Score = 92, Expect = 5.2e-02, Identities = 23/73 (31%), Positives = 41/73 (56%)
  Q:     2 GANSNLKLNIITPSKVAYSDF-VKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQIIDINNQTFEYIVDNGIYSV 74
            A+  LKL++  P +  YSD  V+ V      GD+ IL N+ P + +L+  ++++I  N ++ +Y V  G+  V
  S:    26 AASDALKLSLALPYQTLYSDQDVQQVNLPSVNGDLGILANHIPVVEQLRPGLLEVILKNGESEQYFVSGGLAMV 99
>gi|91204912|ref|YP_537267.1| F0F1 ATP synthase subunit epsilon [Rickettsia bellii RML369-C] >gi|157827762|ref|YP_001496826.1| F0F1 ATP synthase subunit epsilon [Rickettsia bellii OSU 85-389] >gi|166222489|sp|A8GY39|ATPE_RICB8 ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) >gi|119367775|sp|Q1RKD6|ATPE_RICBR ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) >gi|91068456|gb|ABE04178.1| ATP synthase epsilon chain [Rickettsia bellii RML369-C] >gi|157803066|gb|ABV79789.1| ATP synthase epsilon chain [Rickettsia bellii OSU 85-389] (108 aa)
Score = 92, Expect = 5.6e-02, Identities = 22/94 (23%), Positives = 46/94 (48%)
  Q:     4 NSNLKLNIITPSKVAYSDFVKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQII--DINNQTFEYIVDNGIYSVANCELNFLTSFCIKNTEEDKMQI 97
           +  + + IITP  + + +  K +    +EG+  +L  + P I  LK  ++++   D++     Y++ NG+  V    +N  T   I  T+  + +I
  S:     2 SETINVKIITPLNIVFEEQAKMITLPGEEGEFGVLQGHAPMIVSLKAGLLKVYIDDMHKPKITYLIANGVTEVTGSYINIATETAINITDLSEAEI 97
>gi|116254138|ref|YP_769976.1| F0F1 ATP synthase subunit epsilon [Rhizobium leguminosarum bv. viciae 3841] >gi|119367768|sp|Q1MAZ3|ATPE_RHIL3 ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) >gi|115258786|emb|CAK09892.1| putative ATP synthase epsilon chain [Rhizobium leguminosarum bv. viciae 3841] (135 aa)
Score = 92, Expect = 5.7e-02, Identities = 23/123 (18%), Positives = 54/123 (43%)
  Q:     6 NLKLNIITPSKVAYSDFVKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQIIDINNQTFEYIVDNGIYSVANCELNFLTSFCIKNTEEDKMQISQMREKTLNVLNSKNLNNF-----HFQFEVSLFKKI 128
           N    +++P ++  S+ V  V     EG++ ++ N+ PT+  +K  ++ +   + +  +Y+V  G   +       L    +   E  K ++++  E     L    L+       HF  E++  + +
  S:     4 NFNFELVSPERLLLSEMVTEVVIPATEGEMTVMANHAPTMTTIKPGVVSVRSASGKKQDYVVFGGFADILPTGCTLLAESAVPVEELQKDELTRRIEAARQELEHAELHEHKSKLEHFIMEMTHLRGV 131
>gi|157826256|ref|YP_001493976.1| F0F1 ATP synthase subunit epsilon [Rickettsia akari str. Hartford] >gi|166222488|sp|A8GPZ3|ATPE_RICAH ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) >gi|157800214|gb|ABV75468.1| F0F1 ATP synthase subunit epsilon [Rickettsia akari str. Hartford] (112 aa)
Score = 92, Expect = 5.8e-02, Identities = 27/95 (28%), Positives = 45/95 (47%)
  Q:     4 NSNLKLNIITPSKVAYSDFVKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQII--DINNQTFEYIVDNGIYSVANCELNFLTSFCIKNTEEDKMQIS 98
           N  + + IITP  +A     K V    ++G   +L+N+   I  LK  ++Q+   DI N    Y+V +G+  V    +N  T   I  T   + +I+
  S:     2 NETILVKIITPLSIALERQAKMVTIPGEDGMFGVLSNHATMIVSLKAGLVQVYIDDIYNPQITYLVSSGVTEVTGSYVNIATETAINVTNLSEAEIA 98
>gi|86359450|ref|YP_471342.1| F0F1 ATP synthase subunit epsilon [Rhizobium etli CFN 42] >gi|119367767|sp|Q2K3H1|ATPE_RHIEC ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) >gi|86283552|gb|ABC92615.1| ATP synthase protein, epsilon subunit [Rhizobium etli CFN 42] (135 aa)
Score = 92, Expect = 5.8e-02, Identities = 24/123 (19%), Positives = 54/123 (43%)
  Q:     6 NLKLNIITPSKVAYSDFVKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQIIDINNQTFEYIVDNGIYSVANCELNFLTSFCIKNTEEDKMQISQMREKTLNVLNSKNLNNF-----HFQFEVSLFKKI 128
           N    +++P ++  S+ V  V     EG++ ++ N+ PT+  +K  ++ +   + +  +Y+V  G   +       L    +   E  K ++++  E     L    L+       HF  E++  + I
  S:     4 NFNFELVSPERLLLSEMVTEVVVPATEGEMTVMANHAPTMTTIKPGVVSVRSASGKKQDYVVFGGFADILPTGCTLLAESAVPVEELHKDELTRRIEAARKELEHAELHEHKSRLEHFIMELTHLRGI 131
>gi|86135197|ref|ZP_01053779.1| ATP synthase F1, epsilon subunit [Tenacibaculum sp. MED152] >gi|85822060|gb|EAQ43207.1| ATP synthase F1, epsilon subunit [Polaribacter dokdonensis MED152] (97 aa)
Score = 92, Expect = 5.8e-02, Identities = 24/105 (22%), Positives = 50/105 (47%)
  Q:     7 LKLNIITPSKVAYSDFVKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQIIDINNQTFEYIVDNGIYSVANCELNFLTSFCIKNTEEDKMQISQMREKTLNVLNSK 111
           + L I++P  + +S  V ++    + G+  +LNN+ P +  LK  +++I               ++S  + ELN L    + + ++DK+   Q+   TL   ++K
  S:     1 MYLEIVSPEAILFSSEVDAITVPGEHGEFQMLNNHAPIVANLKEGMVKI--------------HVHSQQHLELNDLNGLLVPHVDDDKILTLQINSGTLEFNDNK 91
>gi|168333945|ref|ZP_02692177.1| ATP synthase F1, epsilon subunit [Epulopiscium sp. 'N.t. morphotype B'] (129 aa)
Score = 91, Expect = 6.5e-02, Identities = 30/130 (23%), Positives = 61/130 (46%)
  Q:     5 SNLKLNIITPSKVAYSDFVKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQIIDINNQTFEYIVDNGIYSVANCELNFLTSFCIKNTEEDKMQISQMREKTLNVLNSKNLNNFHFQFEVSLFKKISGIRKK 134
           + +KL IITP++  +++ V  V     EG++ ++ ++EP +  L   II+   +  +  E    +G   V   ++  LT       E +K +    +E+    +   N +  H + E++L K +  +R K
  S:     3 NQIKLEIITPTRQVFNEMVDMVVLKTTEGEMGVMYDHEPVVTLLSYGIIR-YKVGGEKKEATTMSGFAEVTKDKVTILTDASELEGEINKERAESAKERAEGHMGDANSD--HRRAEIALQKALIRLRLK 129
>gi|161610763|ref|YP_067725.2| F0F1 ATP synthase subunit epsilon [Rickettsia typhi str. Wilmington] >gi|60389548|sp|Q68VU9|ATPE_RICTY ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) (110 aa)
Score = 91, Expect = 7.0e-02, Identities = 25/95 (26%), Positives = 49/95 (51%)
  Q:     4 NSNLKLNIITPSKVAYSDFVKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQII--DINNQTFEYIVDNGIYSVANCELNFLTSFCIKNTEEDKMQIS 98
           N  +++ IITPS +A+    K V    ++G   +L N+ P I  L   ++Q+   +++N    Y++  G+  + +  +N +T   I  T   + +IS
  S:     2 NETIQVKIITPSSIAFEKQSKMVTMPGEDGMFGVLPNHVPMIVNLTAGLVQVYINNMHNSENTYLISGGVTEITSNYINIVTEAAINVTNLSESEIS 98
>gi|167358069|ref|ZP_02292729.1| ATP synthase F1, epsilon subunit [Rhizobium leguminosarum bv. trifolii WSM1325] >gi|167075060|gb|EDR78876.1| ATP synthase F1, epsilon subunit [Rhizobium leguminosarum bv. trifolii WSM1325] (135 aa)
Score = 91, Expect = 7.3e-02, Identities = 23/123 (18%), Positives = 54/123 (43%)
  Q:     6 NLKLNIITPSKVAYSDFVKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQIIDINNQTFEYIVDNGIYSVANCELNFLTSFCIKNTEEDKMQISQMREKTLNVLNSKNLNNF-----HFQFEVSLFKKI 128
           N    +++P ++  S+ V  V     EG++ ++ N+ PT+  +K  ++ +   + +  +Y+V  G   +       L    +   E  K ++++  E     L    L+       HF  E++  + +
  S:     4 NFNFELVSPERLLLSEMVTEVVIPATEGEMTVMANHAPTMTTIKPGVVSVRSASGKKQDYVVFGGFADILPTGCTLLAESAVPVEELHKDELTRRIEAARKELEHAELHEHKSKLEHFIMELTHLRGV 131
>gi|98971623|gb|ABF59714.1| ATP synthase protein epsilon subunit [Rhizobium leguminosarum bv. trifolii] (135 aa)
Score = 90, Expect = 8.0e-02, Identities = 17/90 (18%), Positives = 46/90 (51%)
  Q:     6 NLKLNIITPSKVAYSDFVKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQIIDINNQTFEYIVDNGIYSV--ANCELNFLTSFCIKNTEEDKM 95
           N    +++P ++  S+ V  V     EG++ ++ N+ PT+  +K  ++ +   + +  +Y+V  G   +    C L   ++  ++  ++D++
  S:     4 NFNFELVSPERLLLSEMVTEVVIPATEGEMTVMANHAPTMTTIKPGVVSVRSASGKKQDYVVFGGFADILPTGCTLLAESAVPVEELQKDEL 95
>gi|51460280|gb|AAU04243.1| H(+)-transporting two-sector ATPase F(1) epsilon subunit; ATP synthase.; Chloroplast ATPase.; F(0)F(1)-ATPase.; F(1)-ATPase.; H(+)-transporting ATP synthase.; H(+)-transporting ATPase.; Mitochondrial ATPase. [Rickettsia typhi str. Wilmington] (121 aa)
Score = 90, Expect = 9.2e-02, Identities = 25/95 (26%), Positives = 49/95 (51%)
  Q:     4 NSNLKLNIITPSKVAYSDFVKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQII--DINNQTFEYIVDNGIYSVANCELNFLTSFCIKNTEEDKMQIS 98
           N  +++ IITPS +A+    K V    ++G   +L N+ P I  L   ++Q+   +++N    Y++  G+  + +  +N +T   I  T   + +IS
  S:    13 NETIQVKIITPSSIAFEKQSKMVTMPGEDGMFGVLPNHVPMIVNLTAGLVQVYINNMHNSENTYLISGGVTEITSNYINIVTEAAINVTNLSESEIS 109
>gi|15893157|ref|NP_360871.1| F0F1 ATP synthase subunit epsilon [Rickettsia conorii str. Malish 7] >gi|20137395|sp|Q92G89|ATPE_RICCN ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) >gi|15620368|gb|AAL03772.1| ATP synthase epsilon chain [EC:3.6.1.34] [Rickettsia conorii str. Malish 7] (112 aa)
Score = 89, Expect = 1.1e-01, Identities = 26/95 (27%), Positives = 47/95 (49%)
  Q:     4 NSNLKLNIITPSKVAYSDFVKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQII--DINNQTFEYIVDNGIYSVANCELNFLTSFCIKNTEEDKMQIS 98
           N+ + + IITP  +A     K V  S +EG   +L ++ P I  LK  ++Q+   D++     Y++  G+  V    +N  T   I  T   +++I+
  S:     2 NATILVKIITPLSIALEKQAKMVTMSGEEGMFGVLPSHVPMIVSLKAGLVQVYIDDMHKSENTYLISGGVTEVTANYINIATETAINVTNLSEVEIA 98
>gi|170784770|ref|YP_001718686.1| ATP synthase CF1 epsilon subunit [Trachelium caeruleum] >gi|156598814|gb|ABU85660.1| ATP synthase CF1 epsilon subunit [Trachelium caeruleum] >gi|157267518|gb|ABV26511.1| ATP synthase CF1 epsilon subunit [Trachelium caeruleum] (133 aa)
Score = 89, Expect = 1.1e-01, Identities = 25/96 (26%), Positives = 46/96 (47%)
  Q:     7 LKLNIITPSKVAYSDFVKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQIIDINNQTFEYIVDNGIYSVANCELNFLTSFCIKNTEEDKMQISQMRE 102
           L L ++TP+++ +   VK +  S D G I +L N+ P    +   I++ I +N+Q     +  G   + N E+  L +   K+ + D  +  Q  E
  S:     3 LNLCVLTPNRIIWDSEVKEIILSTDSGQIGVLPNHAPIATAVDIGILR-IRLNDQWVTVALMGGFARIGNNEITVLVNDAEKSLDIDPQEAQQTLE 97
>gi|115522307|ref|YP_779218.1| F0F1 ATP synthase subunit epsilon [Rhodopseudomonas palustris BisA53] >gi|122298000|sp|Q07UZ6|ATPE_RHOP5 ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) >gi|115516254|gb|ABJ04238.1| ATP synthase F1, epsilon subunit [Rhodopseudomonas palustris BisA53] (135 aa)
Score = 89, Expect = 1.1e-01, Identities = 24/95 (25%), Positives = 43/95 (45%)
  Q:     5 SNLKLNIITPSKVAYSDFVKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQIIDINNQTFEYIVDNGIYSVANCELNFLTSFCIKNTEEDKMQISQ 99
           +    ++++P K+A+S  V  V     EGD  +L N+ P +  ++  I+ +I   NQ  + +V  GI  V+   L  L        + D    +Q
  S:     2 ATFHFDLVSPEKLAFSGEVDQVDVPGIEGDFGVLANHAPVVAVIRPGILTVITGGNQQ-KIVVLGGIAEVSEKGLTVLADVATSVADLDAAMFAQ 95
>gi|121534928|ref|ZP_01666747.1| ATP synthase F1, epsilon subunit [Thermosinus carboxydivorans Nor1] >gi|121306527|gb|EAX47450.1| ATP synthase F1, epsilon subunit [Thermosinus carboxydivorans Nor1] (136 aa)
Score = 89, Expect = 1.2e-01, Identities = 19/50 (38%), Positives = 32/50 (64%)
  Q:     7 LKLNIITPSKVAYSDFVKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQII 56
           ++L+I+TP ++AYSD V  V     +GDI IL  + P I  L+ + ++I+
  S:     5 VRLDIVTPERLAYSDDVNMVIARATDGDIGILPGHAPLIAGLEIAPLRIL 54
>gi|34581173|ref|ZP_00142653.1| ATP synthase epsilon chain [Rickettsia sibirica 246] >gi|28262558|gb|EAA26062.1| ATP synthase epsilon chain [Rickettsia sibirica 246] (112 aa)
Score = 88, Expect = 1.4e-01, Identities = 26/95 (27%), Positives = 46/95 (48%)
  Q:     4 NSNLKLNIITPSKVAYSDFVKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQII--DINNQTFEYIVDNGIYSVANCELNFLTSFCIKNTEEDKMQIS 98
           N+ + + IITP  +A     K V  S +EG   +L ++ P I  LK  ++Q+   D++     Y++  G+  V    +N  T   I  T   + +I+
  S:     2 NATILVKIITPLSIALEKQAKMVTMSGEEGMFGVLPSHVPMIVSLKAGLVQVYIDDMHKSENTYLISGGVTEVTANYINIATETAINVTNLSEAEIA 98
>gi|167472350|ref|ZP_02337054.1| ATP synthase epsilon chain [Rickettsia africae ESF-5] (112 aa)
Score = 88, Expect = 1.6e-01, Identities = 26/95 (27%), Positives = 47/95 (49%)
  Q:     4 NSNLKLNIITPSKVAYSDFVKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQII--DINNQTFEYIVDNGIYSVANCELNFLTSFCIKNTEEDKMQIS 98
           N+ + + IITP  +A     K V  S +EG   +L ++ P I  LK  ++Q+   D++     Y++ +G+  V    +N  T   I  T   + +I+
  S:     2 NATILVKIITPLSIALEKQAKMVTMSGEEGMFGVLPSHVPMIVSLKAGLVQVYIDDMHKSENTYLISSGVTEVTANYINIATETAINVTNFSEAEIA 98
>gi|11497534|ref|NP_054942.1| ATP synthase CF1 epsilon subunit [Spinacia oleracea] >gi|114606|sp|P00833|ATPE_SPIOL ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) >gi|343356|gb|AAA84627.1| ATPase epsilon subunit >gi|7636115|emb|CAB88735.1| ATP synthase epsilon subunit [Spinacia oleracea] (134 aa)
Score = 88, Expect = 1.7e-01, Identities = 24/96 (25%), Positives = 47/96 (48%)
  Q:     7 LKLNIITPSKVAYSDFVKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQIIDINNQTFEYIVDNGIYSVANCELNFLTSFCIKNTEEDKMQISQMRE 102
           L L ++TP++  ++  VK +  S + G I +L N+ PT   +   I++ I +N+Q     +  G   + N E+  L +   + ++ D  +  Q  E
  S:     3 LNLCVLTPNRSIWNSEVKEIILSTNSGQIGVLPNHAPTATAVDIGILR-IRLNDQWLTLALMGGFARIGNNEITILVNDAERGSDIDPQEAQQTLE 97
>gi|33519492|ref|NP_878324.1| ATP synthase epsilon subunit [Candidatus Blochmannia floridanus] >gi|60389740|sp|Q7VQV5|ATPE_BLOFL ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) >gi|33517155|emb|CAD83537.1| ATP synthase epsilon subunit [Candidatus Blochmannia floridanus] (138 aa)
Score = 88, Expect = 1.7e-01, Identities = 26/125 (20%), Positives = 61/125 (48%)
  Q:     8 KLNIITPSKVAYSDFVKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQIIDINNQTFEYIVDNGIYSVANCELNFLTSFCIKNTEEDKMQI---SQMREKTLNVLNSKNLNNFHFQFEVSLFKKISGIR 132
           +LN+++  K  +S  +K +Y    EG++ I   + P +  +K  +++I  + N  + Y+   GI  V    +  L    I+  + D+ ++    ++ E+ +  +   +++      E+S  K I+ +R
  S:     7 QLNVVSVEKSIFSGVIKKIYVMGVEGELGIFPGHSPLLTLIKPGLLKIFQVYNNEYLYL-SGGILEVQPTVITILADVAIRAKDLDEKKVRDSKRLSEEKIKKMRHGDVDYIKISMEIS--KAIAQLR 131
>gi|85713720|ref|ZP_01044710.1| H+-transporting two-sector ATPase, delta/epsilon subunit [Nitrobacter sp. Nb-311A] >gi|85699624|gb|EAQ37491.1| H+-transporting two-sector ATPase, delta/epsilon subunit [Nitrobacter sp. Nb-311A] (136 aa)
Score = 87, Expect = 1.8e-01, Identities = 22/96 (22%), Positives = 41/96 (42%)
  Q:     5 SNLKLNIITPSKVAYSDFVKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQIIDINNQTFEYIVDNGIYSVANCELNFLTSFCIKNTEEDKMQISQM 100
           +    ++++P K+A+S  V  V     EGD  +L  + P +  ++  I+ +        + IV  G+  V+   L  L        E D+ Q + M
  S:     2 ATFHFDLVSPEKLAFSGEVDQVDIPGVEGDFGVLAGHAPVVATIRPGILTVTAAGGTRQKIIVLGGLAEVSEKGLTVLADVATSIEELDRAQFTDM 97
>gi|90421697|ref|YP_530067.1| F0F1 ATP synthase subunit epsilon [Rhodopseudomonas palustris BisB18] >gi|119367771|sp|Q21CY8|ATPE_RHOPB ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) >gi|90103711|gb|ABD85748.1| ATP synthase F1, epsilon subunit [Rhodopseudomonas palustris BisB18] (135 aa)
Score = 87, Expect = 1.8e-01, Identities = 23/95 (24%), Positives = 44/95 (46%)
  Q:     5 SNLKLNIITPSKVAYSDFVKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQIIDINNQTFEYIVDNGIYSVANCELNFLTSFCIKNTEEDKMQISQ 99
           +  + ++++P K+A+S  V  V     EGD  +L  + P +  ++  ++ I    NQ  + +V  G+  V++  L  L        E D  Q +Q
  S:     2 ATFQFDLVSPEKLAFSGQVDQVDIPGVEGDFGVLAGHAPVVAVIRPGLLTITAGGNQQ-KIVVLGGLAEVSDKGLTVLADVATSVAELDTAQFAQ 95
>gi|157829066|ref|YP_001495308.1| F0F1 ATP synthase subunit epsilon [Rickettsia rickettsii str. 'Sheila Smith'] >gi|165933792|ref|YP_001650581.1| F0F1 ATP synthase subunit epsilon [Rickettsia rickettsii str. Iowa] >gi|166222490|sp|A8GTS5|ATPE_RICRS ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) >gi|189081374|sp|B0BVB5|ATPE_RICRO ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) >gi|157801547|gb|ABV76800.1| F0F1 ATP synthase subunit epsilon [Rickettsia rickettsii str. 'Sheila Smith'] >gi|165908879|gb|ABY73175.1| ATP synthase epsilon chain [Rickettsia rickettsii str. Iowa] (112 aa)
Score = 87, Expect = 1.8e-01, Identities = 26/95 (27%), Positives = 46/95 (48%)
  Q:     4 NSNLKLNIITPSKVAYSDFVKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQII--DINNQTFEYIVDNGIYSVANCELNFLTSFCIKNTEEDKMQIS 98
           N+ + + IITP  +A     K V  S +EG   +L ++ P I  LK  ++Q+   D++     Y++  G+  V    +N  T   I  T   + +I+
  S:     2 NATILVKIITPLSIALEKQAKIVTMSGEEGMFGVLPSHVPMIVSLKAGLVQVYIDDMHKSENTYLISGGVTEVTANYINIATETAINVTNLSEAEIA 98
>gi|149390360|ref|YP_001294358.1| ATP synthase CF1 epsilon subunit [Dioscorea elephantipes] >gi|148668052|gb|ABR01436.1| ATP synthase CF1 epsilon subunit [Dioscorea elephantipes] (134 aa)
Score = 87, Expect = 1.9e-01, Identities = 24/96 (25%), Positives = 46/96 (47%)
  Q:     7 LKLNIITPSKVAYSDFVKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQIIDINNQTFEYIVDNGIYSVANCELNFLTSFCIKNTEEDKMQISQMRE 102
           L L ++TP+++ +   VK +  S + G I +L N+ P    +   +++I  +N+Q     +  G   + N E+  L +    NT+ D  +  Q  E
  S:     3 LNLCVLTPNRIIWDSEVKEIILSTNSGQIGVLPNHAPIATAVDIGLLRI-RLNDQWLTVALMGGFARIGNNEITILGNDAEMNTDIDPQEAQQTLE 97
>gi|188587433|ref|YP_001918978.1| ATP synthase F1, epsilon subunit [Natranaerobius thermophilus JW/NM-WN-LF] >gi|179352120|gb|ACB86390.1| ATP synthase F1, epsilon subunit [Natranaerobius thermophilus JW/NM-WN-LF] (141 aa)
Score = 86, Expect = 2.3e-01, Identities = 16/47 (34%), Positives = 29/47 (61%)
  Q:     3 ANSNLKLNIITPSKVAYSDFVKSVYFSDDEGDIVILNNYEPTIGKLK 49
           A    +L I+TP ++ YSD V S+    ++G + IL+++ P + KL+
  S:     2 ARKEFQLEIVTPERIVYSDKVVSITAQAEDGRLGILHDHRPLVTKLQ 48
>gi|149173274|ref|ZP_01851905.1| probable ATP synthase CF1 subunit e [Planctomyces maris DSM 8797] >gi|148848080|gb|EDL62412.1| probable ATP synthase CF1 subunit e [Planctomyces maris DSM 8797] (133 aa)
Score = 86, Expect = 2.3e-01, Identities = 24/101 (23%), Positives = 45/101 (44%)
  Q:     6 NLKLNIITPSKVAYSDFVKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQIIDINNQTFEYIVDNGIYSVANCELNFLTSFCIKNTEEDKMQISQMREKTLN 106
           + +L ++TP        V+S+  +  +G I IL    P +G+L    +    I+     Y VD G   V    ++ LT   +  ++ D  +  +M ++ LN
  S:     4 DFRLLLVTPETTLLDQPVQSLRCTLFDGQIGILPGRMPMVGRLGYGELSFESIDGTESRYFVDGGFLQVQGTVISILTESAVPLSKLDAAEAEKMLDEALN 104
>gi|169198976|ref|ZP_02858261.1| ATP synthase F1, epsilon subunit [Rhizobium leguminosarum bv. trifolii WSM2304] >gi|169086351|gb|EDS67067.1| ATP synthase F1, epsilon subunit [Rhizobium leguminosarum bv. trifolii WSM2304] (135 aa)
Score = 86, Expect = 2.6e-01, Identities = 22/123 (17%), Positives = 54/123 (43%)
  Q:     6 NLKLNIITPSKVAYSDFVKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQIIDINNQTFEYIVDNGIYSVANCELNFLTSFCIKNTEEDKMQISQMREKTLNVLNSKNLNNF-----HFQFEVSLFKKI 128
           N    +++P ++  S+ V  V     EG++ ++ ++ PT+  +K  ++ +   + +  +Y+V  G   +       L    +   E  K ++++  E     L    L+       HF  E++  + +
  S:     4 NFNFELVSPERLLLSEMVTEVVIPATEGEMTVMAHHAPTMTTIKPGVVSVRSASGKKQDYVVFGGFADILPTGCTLLAESAVPVEELHKDELTRRIEAARKELEDTELHEHKSKLEHFIMELTHLRGV 131
>gi|150020192|ref|YP_001305546.1| F0F1 ATP synthase subunit epsilon [Thermosipho melanesiensis BI429] >gi|149792713|gb|ABR30161.1| H+-transporting two-sector ATPase, delta/epsilon subunit [Thermosipho melanesiensis BI429] (104 aa)
Score = 86, Expect = 2.9e-01, Identities = 24/65 (36%), Positives = 36/65 (55%)
  Q:     6 NLKLNIITPSKVAYSDFVKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQIIDINNQTFEYIVDNG 70
           NL+L I  P+ +   + V  V     EG++ IL N  P I KL+   I I+   ++ FEYI+D+G
  S:    13 NLRLKIFYPNGLFLDEEVDIVTVRTVEGEMGILKNRAPIIAKLRVDKI-IVKKFDKKFEYIIDDG 76
>gi|163737804|ref|ZP_02145221.1| hypothetical protein RGBS107_19773 [Phaeobacter gallaeciensis BS107] >gi|163742890|ref|ZP_02150274.1| ATP synthase F1, epsilon subunit [Phaeobacter gallaeciensis 2.10] >gi|161383854|gb|EDQ08239.1| ATP synthase F1, epsilon subunit [Phaeobacter gallaeciensis 2.10] >gi|161389330|gb|EDQ13682.1| hypothetical protein RGBS107_19773 [Phaeobacter gallaeciensis BS107] (137 aa)
Score = 85, Expect = 3.2e-01, Identities = 22/97 (22%), Positives = 48/97 (49%)
  Q:     7 LKLNIITPSKVAYSDFVKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQIIDINNQTFEYIVDNGIYSVANCELNFLTSFCIKNTEEDKMQISQMREK 103
           ++ ++++P +   S  V +V     EGD+  + N+ PTI  L+  +++ ++    T EY+V  G   +    L+ L    I   +  + Q+ ++ E+
  S:     5 MQFDLVSPERRLASLPVTAVMIPGAEGDMTAMANHAPTITTLRPGVLR-VESPQGTSEYLVTGGFAEIGADGLSVLAEKAIPMDQLTRAQLDELIEE 100
>gi|85712586|ref|ZP_01043633.1| F0F1-type ATP synthase, epsilon subunit [Idiomarina baltica OS145] >gi|85693577|gb|EAQ31528.1| F0F1-type ATP synthase, epsilon subunit [Idiomarina baltica OS145] (138 aa)
Score = 85, Expect = 3.5e-01, Identities = 21/101 (20%), Positives = 46/101 (45%)
  Q:     3 ANSNLKLNIITPSKVAYSDFVKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQIIDINNQTFEYIVDNGIYSVANCELNFLTSFCIKNTEEDKMQISQMREK 103
           A   L L I++  +  ++  V++V  S  EG++ I   + P + K+K  +++ +    Q     V  G+  V   ++  L    ++  E D+ +    R++
  S:     2 ATQTLNLEIVSAERRLFTGVVQTVQVSGSEGELGIYPGHAPLLTKIKPGMVRFLSEEGQEELLYVAGGVLEVQPGQVIVLADVAVRGHELDEQEAEAARKR 102
>gi|114567887|ref|YP_755041.1| ATP synthase F1, epsilon subunit [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|119367804|sp|Q0AUD4|ATPE_SYNWW ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) >gi|114338822|gb|ABI69670.1| ATP synthase F1, epsilon subunit [Syntrophomonas wolfei subsp. wolfei str. Goettingen] (137 aa)
Score = 84, Expect = 4.3e-01, Identities = 25/130 (19%), Positives = 55/130 (42%)
  Q:     3 ANSNLKLNIITPSKVAYSDFVKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQIIDINNQTFEYIVDNGIYSVANCELNFLTSFCIKNTEEDKMQISQMREKTLNVLNSKNLNNFHFQFEVSLFKKISGIR 132
           A S   L ++TP ++ Y D ++ +     EG++ I+ N+ P +  L   +++            +  G   V +     L       +E D ++    +E+    L  ++    H + +++L + I+ IR
  S:     2 AESTFMLEVVTPERILYRDEIQFMVAPGIEGELGIMKNHAPLVAALNIGVLRYQTSTGVDKRMAISGGFMEVIDNGTRVLAETAEHGSEIDVLRAKAAKERAEKRLEVRSEEINHARAKMALQRAIARIR 131
>gi|154488031|ref|ZP_02029148.1| hypothetical protein BIFADO_01600 [Bifidobacterium adolescentis L2-32] >gi|154083504|gb|EDN82549.1| hypothetical protein BIFADO_01600 [Bifidobacterium adolescentis L2-32] (92 aa)
Score = 84, Expect = 4.4e-01, Identities = 20/71 (28%), Positives = 33/71 (46%)
  Q:     3 ANSNLKLNIITPSKVAYSDFVKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQIIDINNQTFEYIVDNGIYS 73
           A S L++NI+      +    KSV     EG + IL ++EP +  +K   I ++D       + V +G  S
  S:     2 AGSTLQVNIVAADHPVWHGTAKSVTIPASEGGMGILPDHEPVLTVIKEGTIVVVDPEGNRLSFEVTDGFIS 72
>gi|50551323|ref|XP_503135.1| hypothetical protein [Yarrowia lipolytica] >gi|49649003|emb|CAG81333.1| unnamed protein product [Yarrowia lipolytica CLIB122] (137 aa)
Score = 84, Expect = 4.5e-01, Identities = 19/65 (29%), Positives = 33/65 (50%)
  Q:    10 NIITPSKVAYSDFVKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQIIDINNQTFEYIVDNGIYSV 74
           N+I    +     V  V      G++ IL N+ PTI +LK  ++++I+ N +T  Y +  G  +V
  S:    12 NLILTQSIYNQKEVTQVNIPSTAGELGILANHVPTIQQLKPGVVEVIETNGETKSYFISGGFATV 76
>gi|15889876|ref|NP_355557.1| F0F1 ATP synthase subunit epsilon [Agrobacterium tumefaciens str. C58] >gi|22095474|sp|Q8UC77|ATPE_AGRT5 ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) >gi|15157823|gb|AAK88342.1| ATP synthase epsilon chain [Agrobacterium tumefaciens str. C58] (136 aa)
Score = 84, Expect = 4.5e-01, Identities = 19/91 (20%), Positives = 45/91 (49%)
  Q:     6 NLKLNIITPSKVAYSDFVKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQIIDINNQTFEYIVDNGIYSV--ANCELNFLTSFCIKNTEEDKMQ 96
           + K ++++P ++  S+ V  V      G++ +L N+ PT+  +K  ++ +   + +T +Y+V  G   +    C L   ++    +   D +Q
  S:     4 SFKFDLVSPERLLVSETVTEVVIPATLGEMTVLANHAPTMTTIKPGLVTVKFASGETHKYVVFGGFADILPTGCTLLAESAVSADDMSPDTLQ 96
>gi|147679146|ref|YP_001213361.1| F0F1 ATP synthase subunit epsilon [Pelotomaculum thermopropionicum SI] >gi|146275243|dbj|BAF60992.1| F0F1-type ATP synthase, epsilon subunit [Pelotomaculum thermopropionicum SI] (134 aa)
Score = 84, Expect = 4.6e-01, Identities = 23/86 (26%), Positives = 43/86 (50%)
  Q:     8 KLNIITPSKVAYSDFVKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQIIDINNQTFEYIVDNGIYSVANCELNFLTSFCIKNTEED 93
           +L I+TP +  +S+ V  +     EG++ +L N+ P I  L   I++ I    +TF+ +V  G   V + ++  L +   +  E D
  S:     7 RLEIVTPQRKVFSEDVSFLVAPGTEGELGVLPNHAPLITSLNIGIMR-IQQEGKTFKVVVTGGFMEVRDNKVTVLANAAERAEEID 91
>gi|163943646|gb|ABY48982.1| ATP synthase CF1 epsilon subunit [Cuscuta rostrata] (86 aa)
Score = 84, Expect = 4.7e-01, Identities = 22/78 (28%), Positives = 40/78 (51%)
  Q:     7 LKLNIITPSKVAYSDFVKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQIIDINNQTFEYIVDNGIYSVANCELNFLTS 84
           LKL ++TP+K+ +   V+ +  S + G I IL N+ P    L   ++++   N Q F   +  G+  +AN  +  L +
  S:     4 LKLCVLTPNKIVWDSEVEQIILSTNSGQIGILPNHIPIATALDIGLLRLKS-NGQWFSIALMGGVARIANNAITILVN 80
>gi|148378163|ref|YP_001252704.1| F0F1 ATP synthase subunit epsilon [Clostridium botulinum A str. ATCC 3502] >gi|153931834|ref|YP_001382564.1| F0F1 ATP synthase subunit epsilon [Clostridium botulinum A str. ATCC 19397] >gi|153934961|ref|YP_001386116.1| F0F1 ATP synthase subunit epsilon [Clostridium botulinum A str. Hall] >gi|166222449|sp|A7FQI0|ATPE_CLOB1 ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) >gi|166222450|sp|A5HY53|ATPE_CLOBH ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) >gi|148287647|emb|CAL81712.1| ATP synthase epsilon chain [Clostridium botulinum A str. ATCC 3502] >gi|152927878|gb|ABS33378.1| ATP synthase F1, epsilon subunit [Clostridium botulinum A str. ATCC 19397] >gi|152930875|gb|ABS36374.1| ATP synthase F1, epsilon subunit [Clostridium botulinum A str. Hall] (133 aa)
Score = 84, Expect = 4.8e-01, Identities = 33/129 (25%), Positives = 60/129 (46%)
  Q:     6 NLKLNIITPSKVAYSDFVKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQIIDINNQTFEYIVDNGIYSVANCELNFLTSFCIKNTEEDKMQISQMREKTLNVLNSKNLNNFHFQFEVSLFKKISGIRKK 134
           N++L I TP K      +K V     +GD+ IL N+   I  LK +I + ID+N         +G+  V + ++  +     K  + D  +    R++    L +K   +   + E++LF+ I+ I+ K
  S:     4 NIELTIFTPEKNIKIGEIKEVITEGLDGDLAILPNHVNMITYLKPTITKYIDLNGNKNNIFTSSGVLKVEDNKVYIICDASEKPEDIDIKRAENARKRAEERLRNKKEIDVK-RAELALFRSIARIKIK 131
>gi|156618910|ref|YP_001430046.1| ATP synthase CF1 epsilon chain [Cuscuta gronovii] >gi|159106800|ref|YP_001531220.1| ATP synthase CF1 epsilon subunit [Cuscuta obtusiflora] >gi|156555948|emb|CAM98332.1| ATP synthase CF1 epsilon chain [Cuscuta gronovii] >gi|158142524|gb|ABW20565.1| ATP synthase CF1 epsilon subunit [Cuscuta obtusiflora] (85 aa)
Score = 84, Expect = 4.9e-01, Identities = 22/76 (28%), Positives = 39/76 (51%)
  Q:     7 LKLNIITPSKVAYSDFVKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQIIDINNQTFEYIVDNGIYSVANCELNFL 82
           LKL ++TP+++ +   V+ +  S   G I IL N+ P    L   I++ ++ N Q F   +  G+  +AN  +  L
  S:     4 LKLCVLTPNQIVWDSEVEQIILSTSSGQIGILPNHIPIATALDIGILR-LNSNGQWFSIALMGGVARIANNAITIL 78
>gi|190893715|ref|YP_001980257.1| ATP synthase protein, epsilon subunit [Rhizobium etli CIAT 652] >gi|190698994|gb|ACE93079.1| ATP synthase protein, epsilon subunit [Rhizobium etli CIAT 652] (135 aa)
Score = 84, Expect = 5.1e-01, Identities = 18/97 (18%), Positives = 45/97 (46%)
  Q:     6 NLKLNIITPSKVAYSDFVKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQIIDINNQTFEYIVDNGIYSVANCELNFLTSFCIKNTEEDKMQISQMRE 102
           N    +++P ++  S+ V  V     EG++ ++ ++ PT+  +K  I+ +   + +  +Y+V  G   +       L    +   E +K ++++  E
  S:     4 NFNFELVSPERLLLSEMVTEVVIPATEGEMTVMAHHAPTMTTIKPGIVSVRSGSGKKQDYVVFGGFADILPTGCTLLAESAVPVEELNKDELTRRIE 100
>gi|154174884|ref|YP_001408808.1| F0F1 ATP synthase subunit epsilon [Campylobacter curvus 525.92] >gi|166222443|sp|A7H016|ATPE_CAMC5 ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) >gi|112803731|gb|EAU01075.1| ATP synthase F1, epsilon subunit [Campylobacter curvus 525.92] (129 aa)
Score = 83, Expect = 5.2e-01, Identities = 22/53 (41%), Positives = 27/53 (50%)
  Q:     7 LKLNIITPSKVAYSDFVKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQIIDIN 59
           L L I+TP    +SD V SV     EG+  +L N+   I  LK  II I D N
  S:     4 LHLEIVTPQGQVFSDDVSSVVLPGSEGEFGVLPNHASLISLLKAGIIDIEDKN 56
>gi|170092345|ref|XP_001877394.1| predicted protein [Laccaria bicolor S238N-H82] >gi|164647253|gb|EDR11497.1| predicted protein [Laccaria bicolor S238N-H82] (163 aa)
Score = 83, Expect = 5.9e-01, Identities = 21/71 (29%), Positives = 40/71 (56%)
  Q:     4 NSNLKLNIITPSKVAY-SDFVKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQIIDINNQTFEYIVDNGIYSV 74
           +  LKL++  P K  + S  V  V    + GD+ IL+N+ P+I  ++  +I++I+ N  + ++ V  G  +V
  S:    29 SDKLKLSLALPHKSIFTSQDVVQVNIPAESGDMGILSNHVPSIEAIRPGVIEVIESNAGSQKFFVSGGFATV 100
>gi|189345586|ref|YP_001942115.1| H+transporting two-sector ATPase delta/epsilon subunit [Chlorobium limicola DSM 245] >gi|189339733|gb|ACD89136.1| H+transporting two-sector ATPase delta/epsilon subunit [Chlorobium limicola DSM 245] (88 aa)
Score = 83, Expect = 6.4e-01, Identities = 20/80 (25%), Positives = 40/80 (50%)
  Q:     4 NSNLKLNIITPSKVAYSDFVKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQIIDINNQTFEYIVDNGIYSVANCELNFLT 83
           +   +++I+TP K+ +S  V SV     +G   +L N+ P +  LK   ++I+  +     + V +G + V+  +   LT
  S:     5 DKGFEIDIVTPQKLFFSGEVTSVTAPGQDGLFQVLKNHAPLLSALKNGKVKIVLADKSVKNFTVADGFFEVSGNKAILLT 84
>gi|56697993|ref|YP_168364.1| F0F1 ATP synthase subunit epsilon [Silicibacter pomeroyi DSS-3] >gi|81676123|sp|Q5LNP2|ATPE_SILPO ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) >gi|56679730|gb|AAV96396.1| ATP synthase F1, epsilon subunit [Silicibacter pomeroyi DSS-3] (136 aa)
Score = 83, Expect = 6.5e-01, Identities = 20/96 (20%), Positives = 48/96 (50%)
  Q:     5 SNLKLNIITPSKVAYSDFVKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQIIDINNQTFEYIVDNGIYSVANCELNFLTSFCIKNTEEDKMQISQM 100
           + ++ ++++P ++  S  V +V     +GD+  + ++ PTI  L+  +++ ++    T EY+V  G   +    L+ L    I  TE  +  + ++
  S:     3 NTMQFDLVSPERLLASLQVSAVQIPGADGDMTAMPDHAPTITTLRPGVLK-VEGPEGTSEYLVTGGFAQIGADSLSVLAEKAIPVTEVTRAHLDEL 97
>gi|158321579|ref|YP_001514086.1| ATP synthase F1, epsilon subunit [Alkaliphilus oremlandii OhILAs] >gi|166990378|sp|A8MJV8|ATPE_ALKOO ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) >gi|158141778|gb|ABW20090.1| ATP synthase F1, epsilon subunit [Alkaliphilus oremlandii OhILAs] (134 aa)
Score = 82, Expect = 6.7e-01, Identities = 29/131 (22%), Positives = 57/131 (43%)
  Q:     5 SNLKLNIITPSKVAYSDFVKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQIIDINNQTFEYIVDNGIYSVANCELNFLTSFCIKNTEEDKMQISQMREKTLNVLNSKNLNNFHFQFEVSLFKKISGIRKKN 135
           S  +L I+TPS+  Y D V+       EGD+ I++N+   +  LK   ++ I  + Q  E  +  G   V +     +T       E D  +  + +E+    L++        + E++L + ++ +   N
  S:     3 STFRLQIVTPSRTFYDDEVEMAIVRSTEGDLGIMSNHMLMVAPLKIGKVR-IKKDGQFREAAISEGFVQVESEYTRIITDTAEWPEEIDVQRAEEAKERAEKRLSASQGEIDRLRAEIALKRALNRLSVAN 132
>gi|134274665|emb|CAM82775.1| putative ATP synthase [Nidula niveotomentosa] (179 aa)
Score = 82, Expect = 6.9e-01, Identities = 21/71 (29%), Positives = 40/71 (56%)
  Q:     4 NSNLKLNIITPSKVAY-SDFVKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQIIDINNQTFEYIVDNGIYSV 74
           N  L+L+ + P K  Y S  V  V    + GD+ IL+N+ P+I  L+  ++++++  + T ++ V  G  +V
  S:    46 NDKLRLSFVLPHKAIYNSQDVVQVNIPAESGDMGILSNHVPSIEPLRPGVVEVLE-GSGTQKFFVSGGFATV 116
>gi|32490758|ref|NP_871012.1| hypothetical protein WGLp009 [Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis] >gi|31339980|sp|Q8D3J2|ATPE_WIGBR ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) >gi|25165964|dbj|BAC24155.1| atpC [Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis] (138 aa)
Score = 82, Expect = 6.9e-01, Identities = 28/129 (21%), Positives = 57/129 (44%)
  Q:     4 NSNLKLNIITPSKVAYSDFVKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQIIDINNQTFEYIVDNGIYSVANCELNFLTSFCIKNTEEDKMQISQMREKTLNVLNSKNLNNFHFQFEVSLFKKISGIR 132
           N   +L +I+     +S+ VK    +  EG++ IL  + P I K+K  +I II   N      +  GI  + +  +  L    I+  E D+ +  + ++    ++      + + +  + L K I+ +R
  S:     3 NKFYQLTVISAENFIFSNLVKKSNITGSEGNLGILPGHAPLITKIKPGLIHIISSKNIEEYIYLSGGILEINSNVVTVLADTAIRGKEIDEKKAIESKKNAEELILKSKERHEYIRAVIELSKAIAKLR 131
>gi|119026444|ref|YP_910289.1| F0F1 ATP synthase subunit epsilon [Bifidobacterium adolescentis ATCC 15703] >gi|118766028|dbj|BAF40207.1| ATP synthase epsilon chain [Bifidobacterium adolescentis ATCC 15703] (92 aa)
Score = 82, Expect = 7.5e-01, Identities = 19/71 (26%), Positives = 33/71 (46%)
  Q:     3 ANSNLKLNIITPSKVAYSDFVKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQIIDINNQTFEYIVDNGIYS 73
           A S +++NI+      +    KSV     EG + IL ++EP +  +K   I ++D       + V +G  S
  S:     2 AGSTMQVNIVAADHPVWHGTAKSVTIPASEGGMGILPDHEPVLTVIKEGTIVVVDPEGNRLSFEVTDGFIS 72
>gi|193211719|ref|YP_001997672.1| H+transporting two-sector ATPase delta/epsilon subunit [Chlorobaculum parvum NCIB 8327] >gi|193085196|gb|ACF10472.1| H+transporting two-sector ATPase delta/epsilon subunit [Chlorobaculum parvum NCIB 8327] (87 aa)
Score = 82, Expect = 7.6e-01, Identities = 21/83 (25%), Positives = 41/83 (49%)
  Q:     1 MGANSNLKLNIITPSKVAYSDFVKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQIIDINNQTFEYIVDNGIYSVANCELNFLT 83
           M ++ N  L+I+TP K+ +S  V SV     +G   +L  + P +  LK   +++   +     + + +G + V+N +   LT
  S:     1 MASSENFTLDIVTPQKLFFSGEVNSVIAPGLDGLFQVLKGHAPLVAALKNGKVRLSLPDRSENTFQISDGFFEVSNNKAILLT 83
>gi|56122451|gb|AAV74349.1| AtpE [Acorus gramineus] (110 aa)
Score = 82, Expect = 8.1e-01, Identities = 23/97 (23%), Positives = 47/97 (48%)
  Q:     6 NLKLNIITPSKVAYSDFVKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQIIDINNQTFEYIVDNGIYSVANCELNFLTSFCIKNTEEDKMQISQMRE 102
           NLKL ++TP+++ +   VK +  S + G I IL N+ P    +   +++ I ++++     +  G   + N E+  L +     T+ D  +  +  E
  S:     2 NLKLCLLTPNRIIWDSEVKEIILSTNSGQIGILPNHAPIATAVDIGLLR-IRLDDRWLAVALMGGFARIGNNEITILGNDAEMGTDIDPQEAQRALE 97
>gi|171909874|ref|ZP_02925344.1| ATP synthase F1, epsilon subunit [Verrucomicrobium spinosum DSM 4136] (140 aa)
Score = 82, Expect = 8.5e-01, Identities = 16/43 (37%), Positives = 26/43 (60%)
  Q:     6 NLKLNIITPSKVAYSDFVKSVYFSDDEGDIVILNNYEPTIGKL 48
           +LKL I+TP K  +SD V +V     EG++ +L ++ P +  L
  S:     2 SLKLEIVTPEKRVFSDTVDTVVLPGSEGELGVLESHVPLVTAL 44
>gi|152978009|ref|YP_001343638.1| F0F1 ATP synthase subunit epsilon [Actinobacillus succinogenes 130Z] >gi|171472935|sp|A6VL56|ATPE_ACTSZ ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) >gi|150839732|gb|ABR73703.1| ATP synthase F1, epsilon subunit [Actinobacillus succinogenes 130Z] (142 aa)
Score = 82, Expect = 8.6e-01, Identities = 27/128 (21%), Positives = 57/128 (44%)
  Q:     5 SNLKLNIITPSKVAYSDFVKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQIIDINNQTFEYIVDNGIYSVANCELNFLTSFCIKNTEEDKMQISQMREKTLNVLNSKNLNNFHFQFEVSLFKKISGIR 132
           +   L +++  +  +   VKS+  +  EG++ IL  + P +  +K  I++I   +N      V  G   V    +  L    I+  E D+ +I   + K  + + +K+ +  H      L K+++ +R
  S:     2 ATFNLTVVSAEEKIFEGAVKSIQATGSEGELGILAGHIPLLTGIKPGIVKITREDNSEEVLYVSGGFLEVQPNIVTVLADVAIRGIELDQERILNAKRKAEDNIVAKHADVDHNLLVAKLSKELAKLR 129
>gi|169595170|ref|XP_001791009.1| hypothetical protein SNOG_00319 [Phaeosphaeria nodorum SN15] >gi|160701031|gb|EAT91814.2| hypothetical protein SNOG_00319 [Phaeosphaeria nodorum SN15] (165 aa)
Score = 81, Expect = 9.6e-01, Identities = 20/72 (27%), Positives = 40/72 (55%)
  Q:     3 ANSNLKLNIITPSKVAY-SDFVKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQIIDINNQTFEYIVDNGIYSV 74
           A+  +KL++  P +  Y S  V  V    + GD+ +L N+ P+I +LK  +++II+    + ++ +  G  +V
  S:    31 ASDKIKLSLALPHQSIYKSQDVVQVNLPAETGDMGVLANHVPSIEQLKPGLVEIIEEQGGSKQFFLSGGFATV 103
>gi|149922446|ref|ZP_01910879.1| hypothetical protein PPSIR1_07688 [Plesiocystis pacifica SIR-1] >gi|149816726|gb|EDM76217.1| hypothetical protein PPSIR1_07688 [Plesiocystis pacifica SIR-1] (183 aa)
Score = 81, Expect = 9.9e-01, Identities = 18/61 (29%), Positives = 35/61 (57%)
  Q:    19 YSDFVKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQIIDIN-----NQTFEYIVDNGIYSVANCEL 79
           YSD+VK++YF DD+  I   ++ +  +GK+K S  ++  +       +  + +   G Y+ A  +L
  S:    98 YSDWVKAIYFDDDKYQITFFDSKKENLGKVKGSCAKLDSVEAAACMTEVIKAVTAEGAYTEAQFKL 163
>gi|163732294|ref|ZP_02139740.1| ATP synthase F1, epsilon subunit [Roseobacter litoralis Och 149] >gi|161394592|gb|EDQ18915.1| ATP synthase F1, epsilon subunit [Roseobacter litoralis Och 149] (138 aa)
Score = 81, Expect = 1.0e+00, Identities = 20/88 (22%), Positives = 44/88 (50%)
  Q:     7 LKLNIITPSKVAYSDFVKSVYFSDDEGDIVILNNYEPTIGKLKRSIIQIIDINNQTFEYIVDNGIYSVANCELNFLTSFCIKNTEEDK 94
           ++ ++++P ++  S  V +V     +GD+  + ++ PTI  L+  ++ + +  + T EY+V  G   +    ++ L    I  TE  K
  S:     5 VQFDLVSPERLLASVQVTAVQIPGADGDMTAMPDHAPTITTLRPGLL-VTEGPDGTSEYVVTGGFAEITASSISVLAERAIPKTEVTK 91