>gi|26453522|dbj|BAC43854.1| ribosomal protein L31 [Mycoplasma penetrans HF-2] (97 aa)
Score = 338, Expect = 1.6e-30, Identities = 97/97 (100%), Positives = 97/97 (100%)
  Q:     1 MIMKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQEPTKSENKNTKKQSKKVVHSLNSL 97
           MIMKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQEPTKSENKNTKKQSKKVVHSLNSL
  S:     1 MIMKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQEPTKSENKNTKKQSKKVVHSLNSL 97
>gi|161723285|ref|NP_757450.2| 50S ribosomal protein L31 [Mycoplasma penetrans HF-2] (95 aa)
Score = 326, Expect = 3.7e-29, Identities = 95/95 (100%), Positives = 95/95 (100%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQEPTKSENKNTKKQSKKVVHSLNSL 97
           MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQEPTKSENKNTKKQSKKVVHSLNSL
  S:     1 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQEPTKSENKNTKKQSKKVVHSLNSL 95
>gi|66880158|ref|ZP_00405143.1| COG0254: Ribosomal protein L31 [Mycoplasma genitalium G-37] (77 aa)
Score = 168, Expect = 8.5e-11, Identities = 37/70 (52%), Positives = 44/70 (62%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVK 72
           MKK  H +   V FNCASCNS F + ST   K+ +ID+C  CHPFYIG    Q V GRAEK ++K  A K
  S:     1 MKKAIHFQSQPVVFNCASCNSNFTIDSTAKQKDLAIDICGKCHPFYIGQLTKQTVHGRAEKLSQKFNAGK 70
>gi|13508099|ref|NP_110048.1| 50S ribosomal protein L31 [Mycoplasma pneumoniae M129] >gi|2500326|sp|P78020|RL31_MYCPN 50S ribosomal protein L31 >gi|1674167|gb|AAB96124.1| ribosomal protein L31 [Mycoplasma pneumoniae M129] (97 aa)
Score = 163, Expect = 3.2e-10, Identities = 43/87 (49%), Positives = 52/87 (59%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQEPTKSENKNTKKQSKK 89
           MKK+ H     VSF CASC+++F ++STL  KE +ID+C  CHPFYIG    Q V GRAEK + K  A K      ENK  KK   K
  S:     1 MKKDFHFPSQSVSFKCASCSNSFTIESTLKQKEITIDICGKCHPFYIGELTKQTVHGRAEKLSGKFNAGK---AFLENKTPKKAKGK 84
>gi|12045112|ref|NP_072923.1| 50S ribosomal protein L31 [Mycoplasma genitalium G37] >gi|1350719|sp|P47499|RL31_MYCGE 50S ribosomal protein L31 >gi|1045949|gb|AAC71477.1| ribosomal protein L31 [Mycoplasma genitalium G37] >gi|166079053|gb|ABY79671.1| ribosomal protein L31 [synthetic Mycoplasma genitalium JCVI-1.0] (97 aa)
Score = 162, Expect = 3.8e-10, Identities = 45/95 (47%), Positives = 56/95 (58%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQ-EPTKSENKNTKKQSKKVVH-SLNSL 97
           MKK  H +   V FNCASCNS F + ST   K+ +ID+C  CHPFYIG    Q V GRAEK ++K  A K     K++  N  K  K+  H S+N L
  S:     1 MKKAIHFQSQPVVFNCASCNSNFTIDSTAKQKDLAIDICGKCHPFYIGQLTKQTVHGRAEKLSQKFNAGKAFLENKTKKSNQAKVEKQTRHRSINEL 97
>gi|31541184|gb|AAP56486.1| RpmE [Mycoplasma gallisepticum R] (109 aa)
Score = 162, Expect = 3.9e-10, Identities = 43/95 (45%), Positives = 56/95 (58%)
  Q:     1 MIMKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQEPTKSENKNTKKQSKKVVHSLN 95
           +IMKK+ H  LN+VSF C+SCN+ F++ S +  KE  +DVCS CH FYIG +  Q VKGRAEK + K    K   +K    N+ K   K     N
  S:     6 IIMKKDIHPTLNKVSFLCSSCNNKFILLSVIKAKEVHMDVCSKCHSFYIGETTQQVVKGRAEKLSSKFNQGKAHISKKAEANSSKPQAKTTKRSN 100
>gi|161511512|ref|NP_852918.2| 50S ribosomal protein L31 [Mycoplasma gallisepticum R] (102 aa)
Score = 156, Expect = 2.1e-09, Identities = 42/93 (45%), Positives = 54/93 (58%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQEPTKSENKNTKKQSKKVVHSLN 95
           MKK+ H  LN+VSF C+SCN+ F++ S +  KE  +DVCS CH FYIG +  Q VKGRAEK + K    K   +K    N+ K   K     N
  S:     1 MKKDIHPTLNKVSFLCSSCNNKFILLSVIKAKEVHMDVCSKCHSFYIGETTQQVVKGRAEKLSSKFNQGKAHISKKAEANSSKPQAKTTKRSN 93
>gi|62257737|gb|AAX77735.1| unknown protein [synthetic construct] (119 aa)
Score = 155, Expect = 2.3e-09, Identities = 32/71 (45%), Positives = 43/71 (60%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQ 73
           M++E H K  EV+  C SC +TFV +ST   KE +ID+CS CHPFY G        GR +KF K+   +K+
  S:    40 MRQEIHPKYTEVTVTC-SCGNTFVTRSTAGKKEMNIDICSECHPFYTGKQRIVDTAGRVDKFKKRFGGMKK 109
>gi|118496890|ref|YP_897940.1| 50S ribosomal protein L31 [Francisella tularensis subsp. novicida U112] >gi|118422796|gb|ABK89186.1| 50S ribosomal protein L31 [Francisella tularensis subsp. novicida U112] (71 aa)
Score = 149, Expect = 1.3e-08, Identities = 32/71 (45%), Positives = 44/71 (61%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQ 73
           M++E H K  EV+  C SC +TFV +ST+  KE +ID+CS CHPFY G        GR +KF K+   +K+
  S:     1 MRQEIHPKYTEVTVTC-SCGNTFVTRSTVGKKEMNIDICSECHPFYTGKQRIVDTAGRVDKFKKRFGGMKK 70
>gi|56707517|ref|YP_169413.1| 50S ribosomal protein L31 [Francisella tularensis subsp. tularensis SCHU S4] >gi|110669988|ref|YP_666545.1| 50S ribosomal protein L31 [Francisella tularensis subsp. tularensis FSC198] >gi|162329652|ref|YP_001122507.2| 50S ribosomal protein L31 [Francisella tularensis subsp. tularensis WY96-3418] >gi|187931140|ref|YP_001891124.1| 50S ribosomal protein L31 [Francisella tularensis subsp. mediasiatica FSC147] >gi|73621792|sp|Q5NHS9|RL31_FRATT 50S ribosomal protein L31 >gi|56604009|emb|CAG44999.1| 50S ribosomal protein L31 [Francisella tularensis subsp. tularensis SCHU S4] >gi|110320321|emb|CAL08382.1| 50S ribosomal protein L31 [Francisella tularensis subsp. tularensis FSC 198] >gi|187712049|gb|ACD30346.1| 50S ribosomal protein L31 [Francisella tularensis subsp. mediasiatica FSC147] (71 aa)
Score = 147, Expect = 2.2e-08, Identities = 32/71 (45%), Positives = 43/71 (60%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQ 73
           M++E H K  EV+  C SC +TFV +ST   KE +ID+CS CHPFY G        GR +KF K+   +K+
  S:     1 MRQEIHPKYTEVTVTC-SCGNTFVTRSTAGKKEMNIDICSECHPFYTGKQRIVDTAGRVDKFKKRFGGMKK 70
>gi|145219224|ref|YP_001129933.1| 50S ribosomal protein L31 [Prosthecochloris vibrioformis DSM 265] >gi|145205388|gb|ABP36431.1| LSU ribosomal protein L31P [Prosthecochloris vibrioformis DSM 265] (75 aa)
Score = 147, Expect = 2.5e-08, Identities = 29/65 (44%), Positives = 43/65 (66%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK++ H K  EV+ NCA+C +TFV +ST ++    +D+CS+CHPFY G        GR ++FNK+
  S:     1 MKQDIHPKYTEVTVNCANCGNTFVTRSTRDS--IKVDICSNCHPFYTGKQTLVDTAGRVDRFNKR 63
>gi|161353780|ref|YP_513974.2| 50S ribosomal protein L31 [Francisella tularensis subsp. holarctica] >gi|162139938|ref|YP_763760.2| 50S ribosomal protein L31 [Francisella tularensis subsp. holarctica OSU18] >gi|167009572|ref|ZP_02274503.1| 50S ribosomal protein L31 [Francisella tularensis subsp. holarctica FSC200] >gi|118572989|sp|Q2A2S8|RL31_FRATH 50S ribosomal protein L31 (72 aa)
Score = 146, Expect = 2.6e-08, Identities = 32/71 (45%), Positives = 43/71 (60%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQ 73
           M++E H K  EV+  C SC +TFV +ST   KE +ID+CS CHPFY G        GR +KF K+   +K+
  S:     1 MRQEIHPKYTEVTVTC-SCGNTFVTRSTAGKKEMNIDICSECHPFYTGKQRIVDTAGRVDKFKKRFGGMKK 70
>gi|194324113|ref|ZP_03057887.1| ribosomal protein L31 [Francisella tularensis subsp. novicida FTE] >gi|151571450|gb|EDN37104.1| hypothetical protein FTDG_01512 [Francisella tularensis subsp. novicida GA99-3548] >gi|194321560|gb|EDX19044.1| ribosomal protein L31 [Francisella tularensis subsp. novicida FTE] (84 aa)
Score = 144, Expect = 5.0e-08, Identities = 32/71 (45%), Positives = 44/71 (61%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQ 73
           M++E H K  EV+  C SC +TFV +ST+  KE +ID+CS CHPFY G        GR +KF K+   +K+
  S:    14 MRQEIHPKYTEVTVTC-SCGNTFVTRSTVGKKEMNIDICSECHPFYTGKQRIVDTAGRVDKFKKRFGGMKK 83
>gi|134050314|gb|ABO47385.1| ribosomal protein L31 [Francisella tularensis subsp. tularensis WY96-3418] >gi|151568288|gb|EDN33942.1| hypothetical protein FTBG_01134 [Francisella tularensis subsp. tularensis FSC033] (84 aa)
Score = 142, Expect = 8.3e-08, Identities = 32/71 (45%), Positives = 43/71 (60%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQ 73
           M++E H K  EV+  C SC +TFV +ST   KE +ID+CS CHPFY G        GR +KF K+   +K+
  S:    14 MRQEIHPKYTEVTVTC-SCGNTFVTRSTAGKKEMNIDICSECHPFYTGKQRIVDTAGRVDKFKKRFGGMKK 83
>gi|156502744|ref|YP_001428809.1| 50S ribosomal protein L31 [Francisella tularensis subsp. holarctica FTNF002-00] >gi|115129936|gb|ABI83123.1| ribosomal protein L31 [Francisella tularensis subsp. holarctica OSU18] >gi|156253347|gb|ABU61853.1| ribosomal protein L31 [Francisella tularensis subsp. holarctica FTNF002-00] (85 aa)
Score = 142, Expect = 9.5e-08, Identities = 32/71 (45%), Positives = 43/71 (60%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQ 73
           M++E H K  EV+  C SC +TFV +ST   KE +ID+CS CHPFY G        GR +KF K+   +K+
  S:    14 MRQEIHPKYTEVTVTC-SCGNTFVTRSTAGKKEMNIDICSECHPFYTGKQRIVDTAGRVDKFKKRFGGMKK 83
>gi|167626761|ref|YP_001677261.1| 50S ribosomal protein L31 [Francisella philomiragia subsp. philomiragia ATCC 25017] >gi|167596762|gb|ABZ86760.1| ribosomal protein L31 [Francisella philomiragia subsp. philomiragia ATCC 25017] (82 aa)
Score = 141, Expect = 9.9e-08, Identities = 30/71 (42%), Positives = 43/71 (60%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQ 73
           M++E H K  EV+  C SC ++FV KST+   + +ID+CS CHPFY G        GR +KF K+   +K+
  S:    12 MRQEIHPKYTEVTVTC-SCGNSFVTKSTIGKNDLNIDICSECHPFYTGKQRIVDTAGRVDKFKKRFGGIKK 81
>gi|89144443|emb|CAJ79742.1| 50S ribosomal protein L31 [Francisella tularensis subsp. holarctica LVS] >gi|134253735|gb|EBA52829.1| 50S ribosomal protein L31 [Francisella tularensis subsp. holarctica 257] >gi|157122587|gb|EDO66716.1| 50S ribosomal protein L31 [Francisella tularensis subsp. holarctica FSC022] (83 aa)
Score = 141, Expect = 1.1e-07, Identities = 32/71 (45%), Positives = 43/71 (60%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQ 73
           M++E H K  EV+  C SC +TFV +ST   KE +ID+CS CHPFY G        GR +KF K+   +K+
  S:    12 MRQEIHPKYTEVTVTC-SCGNTFVTRSTAGKKEMNIDICSECHPFYTGKQRIVDTAGRVDKFKKRFGGMKK 81
>gi|151569979|gb|EDN35633.1| hypothetical protein FTCG_01316 [Francisella tularensis subsp. novicida GA99-3549] (67 aa)
Score = 141, Expect = 1.2e-07, Identities = 30/68 (44%), Positives = 41/68 (60%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVA 70
           M++E H K  EV+  C SC +TFV +ST+  KE +ID+CS CHPFY G        GR +K  + + A
  S:     1 MRQEIHPKYTEVTVTC-SCGNTFVTRSTVGKKEMNIDICSECHPFYTGKQRIVDTAGRVDKSRRDLAA 67
>gi|118602988|ref|YP_904203.1| 50S ribosomal protein L31P [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)] >gi|118567927|gb|ABL02732.1| LSU ribosomal protein L31P [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)] (91 aa)
Score = 138, Expect = 2.2e-07, Identities = 29/71 (40%), Positives = 40/71 (56%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQ 73
           MK + H   N+V   C SC + F  +STL+ +E  +DVCS+CHPFY G        GR EKF  +  + K+
  S:    22 MKTDIHPNYNDVEVTC-SCGNVFETRSTLDKRELYLDVCSNCHPFYTGKQKIMDSAGRVEKFKSRYASFKR 91
>gi|74316057|ref|YP_313797.1| 50S ribosomal protein L31 [Thiobacillus denitrificans ATCC 25259] >gi|148880091|sp|Q3SMP9|RL31_THIDA 50S ribosomal protein L31 >gi|74055552|gb|AAZ95992.1| Ribosomal protein L31 [Thiobacillus denitrificans ATCC 25259] (68 aa)
Score = 137, Expect = 3.3e-07, Identities = 29/65 (44%), Positives = 37/65 (56%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK   H   NEV+  C SC +TFV +STL      ++VC+SCHPFY G        GR EKF ++
  S:     1 MKAGIHPDYNEVTVTC-SCGNTFVTRSTLGKPALHVEVCASCHPFYTGKQKIVDTAGRVEKFRQR 64
>gi|194337414|ref|YP_002019208.1| ribosomal protein L31 [Pelodictyon phaeoclathratiforme BU-1] >gi|194309891|gb|ACF44591.1| ribosomal protein L31 [Pelodictyon phaeoclathratiforme BU-1] (75 aa)
Score = 136, Expect = 4.4e-07, Identities = 29/65 (44%), Positives = 42/65 (64%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK++ H K  EV+ NCA+C ++FV +ST  T    +D+C++CHPFY G        GR E+FNK+
  S:     1 MKQDIHPKYKEVTVNCANCGNSFVTRSTRPT--IKVDICNNCHPFYTGKQTLVDTAGRVERFNKR 63
>gi|21674394|ref|NP_662459.1| 50S ribosomal protein L31 [Chlorobium tepidum TLS] >gi|25009099|sp|Q8KC50|RL31_CHLTE 50S ribosomal protein L31 >gi|21647575|gb|AAM72801.1| ribosomal protein L31 [Chlorobium tepidum TLS] (75 aa)
Score = 136, Expect = 4.7e-07, Identities = 29/65 (44%), Positives = 40/65 (61%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK E H K  +V+ NCA+C +TF  +ST N     +D+CS CHPFY G  +     GR ++FNK+
  S:     1 MKPEIHPKYTKVTVNCANCGTTFETRSTRNNN-IKVDICSKCHPFYTGKQVLVDTAGRVDRFNKR 64
>gi|189345928|ref|YP_001942457.1| ribosomal protein L31 [Chlorobium limicola DSM 245] >gi|189340075|gb|ACD89478.1| ribosomal protein L31 [Chlorobium limicola DSM 245] (75 aa)
Score = 135, Expect = 5.1e-07, Identities = 30/77 (38%), Positives = 45/77 (58%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQEPTKSE 79
           MK++ H K  +V+ NCA+C + F  +ST NT    +D+C++CHPFY G  M     GR E+FNK+         K++
  S:     1 MKQDIHPKYTKVTVNCANCGNAFETRSTRNT--IKVDICNNCHPFYTGKQMLVDTAGRVERFNKRFAKSTASQAKAQ 75
>gi|110596933|ref|ZP_01385223.1| ribosomal protein L31 [Chlorobium ferrooxidans DSM 13031] >gi|110341620|gb|EAT60080.1| ribosomal protein L31 [Chlorobium ferrooxidans DSM 13031] (102 aa)
Score = 135, Expect = 5.5e-07, Identities = 27/66 (40%), Positives = 41/66 (62%)
  Q:     2 IMKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           +MK++ H K   V+ NCA+C ++F  +ST  T    +D+C++CHPFY G        GR E+FNK+
  S:    27 VMKQDIHPKYTSVTVNCANCGNSFETRSTRPT--IKVDICNNCHPFYTGKQTLVDTAGRVERFNKR 90
>gi|192361414|ref|YP_001980933.1| 50S ribosomal subunit protein L31 [Cellvibrio japonicus Ueda107] >gi|190687579|gb|ACE85257.1| 50S ribosomal subunit protein L31 [Cellvibrio japonicus Ueda107] (91 aa)
Score = 135, Expect = 6.1e-07, Identities = 31/72 (43%), Positives = 43/72 (59%)
  Q:     2 IMKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKV---VAVKQ 73
           +MK E H    EV+ NC SC + F  +STL  K+  +DVC+ CHPFY G        GR ++F K+    +AVK+
  S:    19 VMKPEIHPSYKEVTVNC-SCGNNFQTRSTLG-KDFHVDVCNECHPFYTGKQKEASTGGRVDRFTKRFGSRIAVKK 91
>gi|169182957|ref|ZP_02843469.1| ribosomal protein L31 [Thauera sp. MZ1T] >gi|169009971|gb|EDS56741.1| ribosomal protein L31 [Thauera sp. MZ1T] (72 aa)
Score = 134, Expect = 6.4e-07, Identities = 29/71 (40%), Positives = 42/71 (59%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQ 73
           MK + H K  +V+  C SC +TFV +STL   +  ++VCS+CHPFY G        GR E+F +K   V++
  S:     1 MKADIHPKYADVNVTC-SCGNTFVTRSTLGKPQYHVEVCSACHPFYTGKQKIVDTAGRVERFRQKYGNVQR 70
>gi|119897812|ref|YP_933025.1| 50S ribosomal protein L31 [Azoarcus sp. BH72] >gi|119670225|emb|CAL94138.1| 50S ribosomal protein L31 [Azoarcus sp. BH72] (72 aa)
Score = 134, Expect = 6.9e-07, Identities = 28/71 (39%), Positives = 39/71 (54%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQ 73
           MK + H K  EV+  C SC   F  +STL   E  ++VC++CHPFY G        GR E+F +K   V++
  S:     1 MKADIHPKYAEVNVTC-SCGHVFTTRSTLGKPELHVEVCAACHPFYTGKQKIVDTAGRVERFRQKYGNVQR 70
>gi|78188305|ref|YP_378643.1| 50S ribosomal protein L31 [Chlorobium chlorochromatii CaD3] >gi|158564306|sp|Q3ATS5|RL31_CHLCH 50S ribosomal protein L31 >gi|78170504|gb|ABB27600.1| LSU ribosomal protein L31P [Chlorobium chlorochromatii CaD3] (70 aa)
Score = 134, Expect = 7.6e-07, Identities = 29/71 (40%), Positives = 42/71 (59%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQ 73
           MK++ H K NEV+  CA+C ++FV +ST       +D+C++CHPFY G        GR E+FNK+     Q
  S:     1 MKQDIHPKYNEVTVVCANCGNSFVTRST--RPSIKVDICNNCHPFYTGKQSIVDTAGRVERFNKRFAKKAQ 69
>gi|71908612|ref|YP_286199.1| 50S ribosomal protein L31 [Dechloromonas aromatica RCB] >gi|148878593|sp|Q47BQ2|RL31_DECAR 50S ribosomal protein L31 >gi|71848233|gb|AAZ47729.1| LSU ribosomal protein L31P [Dechloromonas aromatica RCB] (74 aa)
Score = 133, Expect = 1.1e-06, Identities = 30/70 (42%), Positives = 41/70 (58%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVK 72
           MK + H    E+  NC SC +TF  KST++     ++VCS+CHPFY G        GR EKFN+K  A++
  S:     1 MKADIHPNYKEIQVNC-SCGNTFTTKSTMSKDAFHVEVCSACHPFYTGKQKIVDTAGRVEKFNQKFGAMR 69
>gi|68171955|ref|ZP_00545265.1| Ribosomal protein L31 [Ehrlichia chaffeensis str. Sapulpa] >gi|67998617|gb|EAM85360.1| Ribosomal protein L31 [Ehrlichia chaffeensis str. Sapulpa] (69 aa)
Score = 132, Expect = 1.2e-06, Identities = 30/64 (46%), Positives = 41/64 (64%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNK 66
           MKKE H K  E+   C+SCN+ FV  ST   ++ ++DVCS+CH FY G     + +GR E+FNK
  S:     1 MKKEIHPKYAEIHATCSSCNTEFVFGST--AEKVTLDVCSNCHAFYTGNRTDVKARGRVERFNK 62
>gi|34497202|ref|NP_901417.1| 50S ribosomal protein L31 [Chromobacterium violaceum ATCC 12472] >gi|73621786|sp|Q7NX81|RL31_CHRVO 50S ribosomal protein L31 >gi|34330335|gb|AAQ59421.2| 50S ribosomal protein L31 [Chromobacterium violaceum ATCC 12472] (71 aa)
Score = 132, Expect = 1.2e-06, Identities = 31/65 (47%), Positives = 37/65 (56%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK + H    E+S  C SC   FV KST+     SI+VCSSCHPFY G        GR +KFN+K
  S:     1 MKNDIHPNYKELSVTC-SCGQQFVTKSTMGKDAFSIEVCSSCHPFYTGKQKIVDTAGRVDKFNQK 64
>gi|148245058|ref|YP_001219752.1| 50S ribosomal protein L31 [Candidatus Vesicomyosocius okutanii HA] >gi|146326885|dbj|BAF62028.1| 50S ribosomal protein L31 [Candidatus Vesicomyosocius okutanii HA] (70 aa)
Score = 131, Expect = 1.5e-06, Identities = 31/71 (43%), Positives = 40/71 (56%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQ 73
           MK   H   N+V   C SC +TF  +ST++ KE  +DVCSSCHPFY G        GR EKF  +  + K+
  S:     1 MKTSIHPNYNDVQIIC-SCGNTFKTRSTIDKKELHLDVCSSCHPFYTGKQKIMDSAGRVEKFKSRYASFKR 70
>gi|56478394|ref|YP_159983.1| 50S ribosomal protein L31 [Azoarcus sp. EbN1] >gi|73621778|sp|Q5P0T2|RL31_AZOSE 50S ribosomal protein L31 >gi|56314437|emb|CAI09082.1| 50S ribosomal protein L31 [Azoarcus sp. EbN1] (72 aa)
Score = 131, Expect = 1.5e-06, Identities = 28/71 (39%), Positives = 39/71 (54%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQ 73
           MK + H K  EV   C SC +TF  +STL      ++VC++CHPFY G        GR E+F +K   V++
  S:     1 MKADIHPKYAEVQVTC-SCGNTFETRSTLGKPALHVEVCAACHPFYTGKQKIVDTAGRVERFRQKYGNVQR 70
>gi|193212053|ref|YP_001998006.1| ribosomal protein L31 [Chlorobaculum parvum NCIB 8327] >gi|193085530|gb|ACF10806.1| ribosomal protein L31 [Chlorobaculum parvum NCIB 8327] (74 aa)
Score = 129, Expect = 2.5e-06, Identities = 28/62 (45%), Positives = 38/62 (61%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKF 64
           MK E H K  +V+ NCA+C ++F  +ST N     +D+CSSCHPFY G  +     GR E+F
  S:     1 MKPEIHPKYTKVTVNCANCGTSFETRSTRNN--IKVDICSSCHPFYTGKQVLVDTAGRVERF 60
>gi|160916060|ref|ZP_02078267.1| hypothetical protein EUBDOL_02087 [Eubacterium dolichum DSM 3991] >gi|158431784|gb|EDP10073.1| hypothetical protein EUBDOL_02087 [Eubacterium dolichum DSM 3991] (67 aa)
Score = 129, Expect = 2.5e-06, Identities = 28/65 (43%), Positives = 37/65 (56%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MKK  H + + ++  C SC + F   ST   KE  +D CS+CHPF+ G       +GR EKFNKK
  S:     1 MKKGIHPEYHRITVKCTSCGAEFETGST--AKELRVDTCSNCHPFFTGRQRFAAAQGRIEKFNKK 63
>gi|119357865|ref|YP_912509.1| 50S ribosomal protein L31 [Chlorobium phaeobacteroides DSM 266] >gi|119355214|gb|ABL66085.1| LSU ribosomal protein L31P [Chlorobium phaeobacteroides DSM 266] (75 aa)
Score = 129, Expect = 2.7e-06, Identities = 28/77 (36%), Positives = 44/77 (57%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQEPTKSE 79
           MK++ H K  +V+ NCA+C ++F  +ST       +D+C++CHPFY G  M     GR E+FNK+         K++
  S:     1 MKQDLHPKYTKVTVNCANCGNSFETRST--RPSIKVDICNNCHPFYTGKQMLVDTAGRVERFNKRFAKSTAAQAKAQ 75
>gi|196158317|ref|YP_002127806.1| 50S ribosomal subunit protein L31 [Alteromonas macleodii 'Deep ecotype'] >gi|88774093|gb|EAR05351.1| 50S ribosomal subunit protein L31 [Alteromonas macleodii 'Deep ecotype'] >gi|196114096|gb|ACG67812.1| 50S ribosomal subunit protein L31 [Alteromonas macleodii 'Deep ecotype'] (70 aa)
Score = 129, Expect = 2.8e-06, Identities = 28/72 (38%), Positives = 45/72 (62%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQE 74
           MK++ H K  E++  C SC +   ++STL  K+ ++DVCSSCHPFY G   +    GR ++F K+  A+ ++
  S:     1 MKQDIHPKYEEITATC-SCGNVMKIRSTLG-KDINLDVCSSCHPFYTGKQRNVDTGGRVDRFKKRFGALGKK 70
>gi|119025458|ref|YP_909303.1| 50S ribosomal protein L31 [Bifidobacterium adolescentis ATCC 15703] >gi|154486884|ref|ZP_02028291.1| hypothetical protein BIFADO_00717 [Bifidobacterium adolescentis L2-32] >gi|118765042|dbj|BAF39221.1| 50S ribosomal protein L31 [Bifidobacterium adolescentis ATCC 15703] >gi|154084747|gb|EDN83792.1| hypothetical protein BIFADO_00717 [Bifidobacterium adolescentis L2-32] (70 aa)
Score = 128, Expect = 3.3e-06, Identities = 27/65 (41%), Positives = 36/65 (55%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H   + V   C SC +TFV +ST N    ++DVCS+CHPFY G        GR  +F K+
  S:     1 MKQGIHPDYHAVQVTC-SCGNTFVTRSTYNGDHMTVDVCSNCHPFYTGKQKILDTGGRVARFEKR 64
>gi|90413620|ref|ZP_01221610.1| 50S ribosomal protein L31 [Photobacterium profundum 3TCK] >gi|90325393|gb|EAS41882.1| 50S ribosomal protein L31 [Photobacterium profundum 3TCK] (70 aa)
Score = 128, Expect = 3.8e-06, Identities = 29/69 (42%), Positives = 42/69 (60%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAV 71
           MK+  H   + V+  C SC +TF+ +ST+ TK+ ++DVC  CHPFY G        GR +KFNK+  A+
  S:     1 MKQGIHPDYSAVNARC-SCGNTFIFQSTM-TKDVNLDVCDKCHPFYTGKQRQVSSGGRVDKFNKRFGAL 67
>gi|169824788|ref|YP_001692399.1| 50S ribosomal protein L31 [Finegoldia magna ATCC 29328] >gi|167831593|dbj|BAG08509.1| 50S ribosomal protein L31 [Finegoldia magna ATCC 29328] (67 aa)
Score = 127, Expect = 4.7e-06, Identities = 30/65 (46%), Positives = 40/65 (61%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MKK+ H + +E +  CASC +TF V ST   +  +++VCS CHPFY G     +  GR EKF KK
  S:     1 MKKDLHPEYHEATVTCASCGNTFKVGST--KENINVEVCSQCHPFYTGRQRFVEHGGRVEKFKKK 63
>gi|146313669|ref|YP_001178743.1| 50S ribosomal protein L31 [Enterobacter sp. 638] >gi|145320545|gb|ABP62692.1| LSU ribosomal protein L31P [Enterobacter sp. 638] (70 aa)
Score = 127, Expect = 4.7e-06, Identities = 25/65 (38%), Positives = 39/65 (60%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MKK+ H K + ++ NC SC +   ++ST+   + ++DVC  CHPFY G        GR ++FNK+
  S:     1 MKKDIHPKYDFITANC-SCGNAIKIRSTVG-HDLNLDVCGQCHPFYTGKQRDVATGGRVDRFNKR 63
>gi|71892362|ref|YP_278096.1| 50S ribosomal protein L31 [Candidatus Blochmannia pennsylvanicus str. BPEN] >gi|158562844|sp|Q491Y5|RL31_BLOPB 50S ribosomal protein L31 >gi|71796468|gb|AAZ41219.1| 50S ribosomal subunit protein L31 [Candidatus Blochmannia pennsylvanicus str. BPEN] (82 aa)
Score = 127, Expect = 4.9e-06, Identities = 32/65 (49%), Positives = 38/65 (58%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MKK  H K NE+S  C SC +    KSTLN +  +IDVC  CHPFY GT      +GR   FNK+
  S:     1 MKKNVHPKYNEISAYC-SCGNIINTKSTLN-RNLNIDVCHLCHPFYTGTQRILDTRGRVNIFNKR 63
>gi|158312863|ref|YP_001505371.1| 50S ribosomal protein L31 [Frankia sp. EAN1pec] >gi|158108268|gb|ABW10465.1| ribosomal protein L31 [Frankia sp. EAN1pec] (78 aa)
Score = 127, Expect = 4.9e-06, Identities = 27/65 (41%), Positives = 36/65 (55%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK + H + +E +  C +C STF  +ST      S +VCS CHPFY G      V GR EKF ++
  S:     1 MKADIHPQYHETTVTC-TCGSTFTTRSTKENGAISAEVCSQCHPFYTGKQKILDVGGRVEKFERR 64
>gi|153221024|ref|ZP_01952079.1| ribosomal protein L31 [Vibrio cholerae MAK 757] >gi|124119935|gb|EAY38678.1| ribosomal protein L31 [Vibrio cholerae MAK 757] (72 aa)
Score = 127, Expect = 5.0e-06, Identities = 28/69 (40%), Positives = 37/69 (53%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAV 71
           MK   H +   V+  C SC ++FV  STL      +DVC  CHPFY G      + GR E+FNK+  A+
  S:     1 MKAGIHPEYKAVNATC-SCGNSFVFNSTLGKDTMHLDVCDKCHPFYSGKQRIVDIGGRVERFNKRFGAL 68
>gi|111225295|ref|YP_716089.1| 50S ribosomal protein L31 [Frankia alni ACN14a] >gi|111152827|emb|CAJ64572.1| 50S ribosomal subunit protein L31 [Frankia alni ACN14a] (78 aa)
Score = 126, Expect = 5.6e-06, Identities = 27/65 (41%), Positives = 36/65 (55%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK + H   +E + NC +C STF  +ST      + +VCS CHPFY G      V GR EKF ++
  S:     1 MKADIHPTYHETTVNC-TCGSTFTTRSTKENGVVNAEVCSQCHPFYTGKQKILDVGGRVEKFERR 64
>gi|71280807|ref|YP_271014.1| 50S ribosomal protein L31 [Colwellia psychrerythraea 34H] >gi|158562842|sp|Q47W08|RL31_COLP3 50S ribosomal protein L31 >gi|71146547|gb|AAZ27020.1| ribosomal protein L31 [Colwellia psychrerythraea 34H] (70 aa)
Score = 126, Expect = 6.0e-06, Identities = 28/72 (38%), Positives = 43/72 (59%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQE 74
           MKK+ H    E +  C SC +    +ST+  K+  +DVCS+CHPFY G   + +  GR +KFNK+  A+ ++
  S:     1 MKKDIHPNYVEFNATC-SCGNVVTTRSTIG-KDIHLDVCSACHPFYTGKQKAAETGGRVDKFNKRFAAIGKK 70
>gi|24375606|ref|NP_719649.1| 50S ribosomal protein L31 [Shewanella oneidensis MR-1] >gi|31076965|sp|Q8E9Z0|RL31_SHEON 50S ribosomal protein L31 >gi|24350503|gb|AAN57093.1|AE015843_5 ribosomal protein L31 [Shewanella oneidensis MR-1] (70 aa)
Score = 125, Expect = 8.6e-06, Identities = 27/65 (41%), Positives = 38/65 (58%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK   H +  E++ NC +C +   V ST+  K+  +DVC +CHPFY GT       GR +KFNK+
  S:     1 MKPGIHPEYAEITANC-TCGNVIKVNSTVG-KDLHLDVCGACHPFYTGTQKVVDTGGRIDKFNKR 63
>gi|194100085|ref|YP_002003225.1| 50S ribosomal protein L31 [Neisseria gonorrhoeae NCCP11945] >gi|193935375|gb|ACF31199.1| 50S ribosomal protein L31 [Neisseria gonorrhoeae NCCP11945] (80 aa)
Score = 125, Expect = 8.7e-06, Identities = 29/65 (44%), Positives = 37/65 (56%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H    EV+  C SC + FV KS +  +  +I+VCS CHPFY GT       GR +KFN K
  S:    10 MKQGIHPNYREVNVTC-SCGNKFVTKSAMEKENFNIEVCSLCHPFYTGTQKIVDTTGRVDKFNNK 73
>gi|27364756|ref|NP_760284.1| 50S ribosomal protein L31 [Vibrio vulnificus CMCP6] >gi|31076950|sp|Q8DCN9|RL31_VIBVU 50S ribosomal protein L31 >gi|27360901|gb|AAO09811.1|AE016801_130 Ribosomal protein L31 [Vibrio vulnificus CMCP6] (73 aa)
Score = 125, Expect = 8.7e-06, Identities = 27/69 (39%), Positives = 38/69 (55%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAV 71
           MK   H +   V+  C SC ++FV  STL+ +   +DVC  CHPFY G        GR ++FNK+  A+
  S:     1 MKAGIHPEYKAVNATC-SCGNSFVFNSTLDKESIHLDVCDKCHPFYTGKQRIVDTGGRVDRFNKRFGAL 68
>gi|37681195|ref|NP_935804.1| 50S ribosomal protein L31 [Vibrio vulnificus YJ016] >gi|71153681|sp|Q7MH61|RL31_VIBVY 50S ribosomal protein L31 >gi|37199946|dbj|BAC95775.1| ribosomal protein L31 [Vibrio vulnificus YJ016] (73 aa)
Score = 124, Expect = 9.2e-06, Identities = 27/69 (39%), Positives = 37/69 (53%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAV 71
           MK   H +   V+  C SC ++FV  STL+     +DVC  CHPFY G        GR ++FNK+  A+
  S:     1 MKAGIHPEYKAVNATC-SCGNSFVFNSTLDKDSIHLDVCDKCHPFYTGKQRIVDTGGRVDRFNKRFGAL 68
>gi|54307479|ref|YP_128499.1| 50S ribosomal protein L31 [Photobacterium profundum SS9] >gi|73621813|sp|Q6LVH8|RL31_PHOPR 50S ribosomal protein L31 >gi|46911899|emb|CAG18697.1| putative ribosomal protein L31 [Photobacterium profundum SS9] (70 aa)
Score = 124, Expect = 9.4e-06, Identities = 28/69 (40%), Positives = 41/69 (59%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAV 71
           MK+  H   +  +  C SC +TF+ +ST+ TK+ ++DVC  CHPFY G        GR +KFNK+  A+
  S:     1 MKQGIHPDYSATNARC-SCGNTFIFQSTM-TKDVNLDVCDKCHPFYTGKQRQASSGGRVDKFNKRFGAL 67
>gi|114771531|ref|ZP_01448941.1| 50S ribosomal subunit protein L31 [alpha proteobacterium HTCC2255] (70 aa)
Score = 124, Expect = 1.0e-05, Identities = 27/72 (37%), Positives = 45/72 (62%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQE 74
           MK+  H K  E++  C SC +   ++ST+  K+ ++DVCS+CHPFY G   +    GR ++FNK+  A+ ++
  S:     1 MKEGIHPKYEEITATC-SCGNEMKIRSTVG-KDLNLDVCSACHPFYTGKQRNVDTGGRVDRFNKRFGALSKK 70
>gi|157373020|ref|YP_001481009.1| 50S ribosomal protein L31 [Serratia proteamaculans 568] >gi|157324784|gb|ABV43881.1| ribosomal protein L31 [Serratia proteamaculans 568] (71 aa)
Score = 124, Expect = 1.1e-05, Identities = 26/65 (40%), Positives = 38/65 (58%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H K  EV+ NC SC +   ++ST+   + ++DVC  CHPFY G        GR ++FNK+
  S:     1 MKQGIHPKYEEVTANC-SCGNVIKIRSTVG-HDLNLDVCGECHPFYTGKQRDVATGGRVDRFNKR 63
>gi|153835825|ref|ZP_01988492.1| ribosomal protein L31 [Vibrio harveyi HY01] >gi|156973049|ref|YP_001443956.1| 50S ribosomal protein L31 [Vibrio harveyi ATCC BAA-1116] >gi|148865855|gb|EDL66818.1| ribosomal protein L31 [Vibrio harveyi HY01] >gi|156524643|gb|ABU69729.1| hypothetical protein VIBHAR_00728 [Vibrio harveyi ATCC BAA-1116] (72 aa)
Score = 124, Expect = 1.1e-05, Identities = 28/72 (38%), Positives = 39/72 (54%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQE 74
           MK   H +   VS  C SC ++F  KSTL+ +   +DVC  CHPFY G        GR ++FNK+  A+  +
  S:     1 MKAGIHPEYKAVSATC-SCGNSFEFKSTLDKESIHLDVCDKCHPFYTGKQRIVDTGGRVDRFNKRFGALSSK 71
>gi|163803963|ref|ZP_02197789.1| 50S ribosomal protein L31 [Vibrio campbellii AND4] >gi|159172231|gb|EDP57136.1| 50S ribosomal protein L31 [Vibrio campbellii AND4] (72 aa)
Score = 124, Expect = 1.1e-05, Identities = 28/72 (38%), Positives = 38/72 (52%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQE 74
           MK   H     VS  C SC ++F  KSTL+ +   +DVC  CHPFY G        GR ++FNK+  A+  +
  S:     1 MKAGIHPDYKAVSATC-SCGNSFEFKSTLDKESIHLDVCDKCHPFYTGKQRIVDTGGRVDRFNKRFGALSSK 71
>gi|88858834|ref|ZP_01133475.1| 50S ribosomal subunit protein L31 [Pseudoalteromonas tunicata D2] >gi|88819060|gb|EAR28874.1| 50S ribosomal subunit protein L31 [Pseudoalteromonas tunicata D2] (75 aa)
Score = 124, Expect = 1.2e-05, Identities = 30/72 (41%), Positives = 42/72 (58%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQE 74
           MKK+ H K   +S +C SC + F  +STL  K+  +DVCS CHPFY G        GR ++FNK+  A+  +
  S:     5 MKKDIHPKYEVISASC-SCGNKFETRSTL-CKDIHLDVCSECHPFYTGKQKILDTGGRVDRFNKRFGALSSK 74
>gi|167754815|ref|ZP_02426942.1| hypothetical protein CLORAM_00319 [Clostridium ramosum DSM 1402] >gi|167704865|gb|EDS19444.1| hypothetical protein CLORAM_00319 [Clostridium ramosum DSM 1402] (67 aa)
Score = 123, Expect = 1.3e-05, Identities = 28/65 (43%), Positives = 34/65 (52%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MKK  H    +V   C SC + F   S L+  E  +D CS+CHPFY G        GR +KFNKK
  S:     1 MKKGIHPDYKKVKIVCTSCGNEFEGGSVLD--EVRVDTCSNCHPFYTGKQRFASADGRVDKFNKK 63
>gi|15642674|ref|NP_232307.1| 50S ribosomal protein L31 [Vibrio cholerae O1 biovar eltor str. N16961] >gi|121590917|ref|ZP_01678239.1| ribosomal protein L31 [Vibrio cholerae 2740-80] >gi|147674481|ref|YP_001218168.1| 50S ribosomal protein L31 [Vibrio cholerae O395] >gi|153213982|ref|ZP_01949175.1| ribosomal protein L31 [Vibrio cholerae 1587] >gi|153803419|ref|ZP_01958005.1| ribosomal protein L31 [Vibrio cholerae MZO-3] >gi|153819956|ref|ZP_01972623.1| ribosomal protein L31 [Vibrio cholerae NCTC 8457] >gi|153825158|ref|ZP_01977825.1| ribosomal protein L31 [Vibrio cholerae MZO-2] >gi|153829459|ref|ZP_01982126.1| ribosomal protein L31 [Vibrio cholerae 623-39] >gi|194533161|ref|YP_002068580.1| ribosomal protein L31 [Vibrio cholerae MO10] >gi|194536432|ref|YP_002071591.1| ribosomal protein L31 [Vibrio cholerae RC385] >gi|194537431|ref|YP_002072573.1| ribosomal protein L31 [Vibrio cholerae V51] >gi|17433251|sp|Q9KNQ2|RL31_VIBCH 50S ribosomal protein L31 >gi|9657273|gb|AAF95820.1| ribosomal protein L31 [Vibrio cholerae O1 biovar El Tor str. N16961] >gi|121547239|gb|EAX57363.1| ribosomal protein L31 [Vibrio cholerae 2740-80] >gi|124115552|gb|EAY34372.1| ribosomal protein L31 [Vibrio cholerae 1587] >gi|124121052|gb|EAY39795.1| ribosomal protein L31 [Vibrio cholerae MZO-3] >gi|125619213|gb|EAZ47743.1| ribosomal protein L31 [Vibrio cholerae MO10] >gi|125622044|gb|EAZ50367.1| ribosomal protein L31 [Vibrio cholerae V51] >gi|126509500|gb|EAZ72094.1| ribosomal protein L31 [Vibrio cholerae NCTC 8457] >gi|146316364|gb|ABQ20903.1| ribosomal protein L31 [Vibrio cholerae O395] >gi|148875042|gb|EDL73177.1| ribosomal protein L31 [Vibrio cholerae 623-39] >gi|149741304|gb|EDM55346.1| ribosomal protein L31 [Vibrio cholerae MZO-2] >gi|150421226|gb|EDN13509.1| ribosomal protein L31 [Vibrio cholerae RC385] >gi|150424053|gb|EDN15992.1| ribosomal protein L31 [Vibrio cholerae AM-19226] (72 aa)
Score = 123, Expect = 1.5e-05, Identities = 28/69 (40%), Positives = 36/69 (52%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAV 71
           MK   H +   V+  C SC ++FV  STL      +DVC  CHPFY G        GR E+FNK+  A+
  S:     1 MKAGIHPEYKAVNATC-SCGNSFVFNSTLGKDTMHLDVCDKCHPFYSGKQRIVDTGGRVERFNKRFGAL 68
>gi|117923452|ref|YP_864069.1| 50S ribosomal protein L31P [Magnetococcus sp. MC-1] >gi|117607208|gb|ABK42663.1| LSU ribosomal protein L31P [Magnetococcus sp. MC-1] (69 aa)
Score = 122, Expect = 1.7e-05, Identities = 25/65 (38%), Positives = 36/65 (55%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H K  E +F CASC++    +ST    + ++ +CS CHPFY G        GR E+F +K
  S:     1 MKEGIHPKYEEATFTCASCSNEIKTRST--AGDLTLGICSECHPFYTGKHKLVDTAGRVERFRRK 63
>gi|90416776|ref|ZP_01224706.1| ribosomal protein L31 [marine gamma proteobacterium HTCC2207] >gi|90331529|gb|EAS46765.1| ribosomal protein L31 [marine gamma proteobacterium HTCC2207] (69 aa)
Score = 122, Expect = 1.7e-05, Identities = 29/71 (40%), Positives = 39/71 (54%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQ 73
           MK E H   NE+   C SC +   V ST   +   +DVCS+CHPFY G     +  GR ++FNK+  A K+
  S:     1 MKSEIHPAYNELKATC-SCGNVITVGST-REQALYLDVCSACHPFYTGKQKVAETGGRIDRFNKRFGAAKK 69
>gi|171741093|ref|ZP_02916900.1| hypothetical protein BIFDEN_00159 [Bifidobacterium dentium ATCC 27678] >gi|171276707|gb|EDT44368.1| hypothetical protein BIFDEN_00159 [Bifidobacterium dentium ATCC 27678] (70 aa)
Score = 122, Expect = 1.9e-05, Identities = 26/65 (40%), Positives = 36/65 (55%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           M++  H   + V   C SC +TFV +ST  +   ++DVCSSCHPFY G        GR  +F K+
  S:     1 MQQGIHPDYHAVQVTC-SCGNTFVTRSTAKSDHMTVDVCSSCHPFYTGKQKILDTGGRVARFEKR 64
>gi|161869254|ref|YP_001598421.1| 50S ribosomal protein L31 [Neisseria meningitidis 053442] >gi|120867317|emb|CAM11088.1| 50S ribosomal protein L31 [Neisseria meningitidis FAM18] >gi|161594807|gb|ABX72467.1| 50S ribosomal protein L31 [Neisseria meningitidis 053442] (80 aa)
Score = 122, Expect = 1.9e-05, Identities = 28/65 (43%), Positives = 37/65 (56%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H   +EV+  C SC + F  KS +  +  +I+VCS CHPFY GT       GR +KFN K
  S:    10 MKQGIHPNYHEVNVTC-SCGNKFATKSAMEKENFNIEVCSLCHPFYTGTQKIVDTTGRVDKFNNK 73
>gi|59802424|ref|YP_209136.1| 50S ribosomal protein L31 [Neisseria gonorrhoeae FA 1090] >gi|73621808|sp|Q5F513|RL31_NEIG1 50S ribosomal protein L31 >gi|59719319|gb|AAW90724.1| putative 50S ribosomal protein L31 [Neisseria gonorrhoeae FA 1090] (71 aa)
Score = 122, Expect = 1.9e-05, Identities = 29/65 (44%), Positives = 37/65 (56%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H    EV+  C SC + FV KS +  +  +I+VCS CHPFY GT       GR +KFN K
  S:     1 MKQGIHPNYREVNVTC-SCGNKFVTKSAMEKENFNIEVCSLCHPFYTGTQKIVDTTGRVDKFNNK 64
>gi|167759401|ref|ZP_02431528.1| hypothetical protein CLOSCI_01748 [Clostridium scindens ATCC 35704] >gi|167662958|gb|EDS07088.1| hypothetical protein CLOSCI_01748 [Clostridium scindens ATCC 35704] (67 aa)
Score = 122, Expect = 2.0e-05, Identities = 26/65 (40%), Positives = 41/65 (63%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H   ++ +  C +C +TFV  ST  +++  +++CS CHPFY G   + Q +GR +KFNKK
  S:     1 MKEGIHPAYHQATVTC-NCGNTFVTGST--SEDIHVEICSKCHPFYTGQQKAAQARGRVDKFNKK 62
>gi|90580878|ref|ZP_01236680.1| 50S ribosomal protein L31 [Vibrio angustum S14] >gi|90437949|gb|EAS63138.1| 50S ribosomal protein L31 [Vibrio angustum S14] (70 aa)
Score = 121, Expect = 2.1e-05, Identities = 29/72 (40%), Positives = 41/72 (56%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQE 74
           MK+  H +   V+  C SC +TFV  ST+  K+ ++DVC  CHPFY G        GR +KFNK+  A+  +
  S:     1 MKQGIHPEYTAVNARC-SCGNTFVFNSTMG-KDINLDVCDKCHPFYTGKQRQVSSGGRVDKFNKRFGALTSK 70
>gi|157963588|ref|YP_001503622.1| 50S ribosomal protein L31 [Shewanella pealeana ATCC 700345] >gi|167625766|ref|YP_001676060.1| 50S ribosomal protein L31 [Shewanella halifaxensis HAW-EB4] >gi|157848588|gb|ABV89087.1| ribosomal protein L31 [Shewanella pealeana ATCC 700345] >gi|167355788|gb|ABZ78401.1| ribosomal protein L31 [Shewanella halifaxensis HAW-EB4] (70 aa)
Score = 121, Expect = 2.3e-05, Identities = 26/72 (36%), Positives = 40/72 (55%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQE 74
           MK   H    E++  C +C +   + ST+  K+  +DVC +CHPFY GT       GR +KFNK+  A+ ++
  S:     1 MKAGIHPDYAEITATC-TCGNVIKINSTVG-KDLHLDVCGACHPFYTGTQKVMDTGGRIDKFNKRFGALGKK 70
>gi|153809903|ref|ZP_01962571.1| hypothetical protein RUMOBE_00284 [Ruminococcus obeum ATCC 29174] >gi|149834081|gb|EDM89161.1| hypothetical protein RUMOBE_00284 [Ruminococcus obeum ATCC 29174] (70 aa)
Score = 120, Expect = 2.7e-05, Identities = 27/66 (40%), Positives = 40/66 (60%)
  Q:     2 IMKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           IM++  H    + +  C +C +TFV  ST   K+  +++CS CHPFY G   + Q +GR +KFNKK
  S:     3 IMREGIHPNYYQATVTC-NCGNTFVTGST--KKDIHVEICSKCHPFYTGQQKAAQARGRIDKFNKK 65
>gi|57168672|ref|ZP_00367804.1| ribosomal protein L31 [Campylobacter coli RM2228] >gi|57019953|gb|EAL56633.1| ribosomal protein L31 [Campylobacter coli RM2228] (66 aa)
Score = 120, Expect = 2.8e-05, Identities = 32/65 (49%), Positives = 39/65 (60%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MKKE H +  E   +CA C +TFV KS  N  E  +D+CSSCHPF+ G+       GR EKF KK
  S:     1 MKKEIHPEYVECKVSCA-CGNTFVTKS--NKSELRVDICSSCHPFFTGSEKIVDAAGRVEKFKKK 62
>gi|154509274|ref|ZP_02044916.1| hypothetical protein ACTODO_01799 [Actinomyces odontolyticus ATCC 17982] >gi|153798908|gb|EDN81328.1| hypothetical protein ACTODO_01799 [Actinomyces odontolyticus ATCC 17982] (135 aa)
Score = 120, Expect = 2.9e-05, Identities = 23/65 (35%), Positives = 35/65 (53%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H +  +    C +C ++F  +ST+ + E  +DVCS+CHPFY G        GR  KF  +
  S:    63 MKQGIHPEYVDTVVTC-TCGNSFHTRSTITSGEMRVDVCSACHPFYTGKQKILDTGGRVAKFEAR 126
>gi|149189180|ref|ZP_01867467.1| 50S ribosomal protein L31 [Vibrio shilonii AK1] >gi|148836934|gb|EDL53884.1| 50S ribosomal protein L31 [Vibrio shilonii AK1] (72 aa)
Score = 120, Expect = 3.0e-05, Identities = 27/72 (37%), Positives = 36/72 (50%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQE 74
           MK   H +   V+  C SC +TF   STL      +DVC  CHPFY G        GR ++FNK+  A+  +
  S:     1 MKAGIHPEYKAVTATC-SCGNTFEFNSTLGKDSIHLDVCDKCHPFYTGKQRIVDTGGRVDRFNKRFGALSSK 71
>gi|118594396|ref|ZP_01551743.1| ribosomal protein L31 [Methylophilales bacterium HTCC2181] >gi|118440174|gb|EAV46801.1| ribosomal protein L31 [Methylophilales bacterium HTCC2181] (66 aa)
Score = 120, Expect = 3.1e-05, Identities = 31/65 (47%), Positives = 39/65 (60%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MKK+ H    EV+  C SC +TF  +ST+  K+ SI+VCS CHPFY G        GR EKF +K
  S:     1 MKKDIHPNYPEVNVTC-SCGNTFKTQSTI-AKDLSIEVCSQCHPFYTGKQKILDTAGRVEKFKQK 63
>gi|24115230|ref|NP_709740.1| 50S ribosomal protein L31 [Shigella flexneri 2a str. 301] >gi|30064771|ref|NP_838942.1| 50S ribosomal protein L31 [Shigella flexneri 2a str. 2457T] >gi|73621822|sp|Q83PD4|RL31_SHIFL 50S ribosomal protein L31 >gi|24054517|gb|AAN45447.1| 50S ribosomal subunit protein L31 [Shigella flexneri 2a str. 301] >gi|30043031|gb|AAP18753.1| 50S ribosomal subunit protein L31 [Shigella flexneri 2a str. 2457T] (70 aa)
Score = 120, Expect = 3.1e-05, Identities = 25/65 (38%), Positives = 40/65 (61%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MKK+ H K  E++ +C SC +   ++ST+   + ++DVCS CHPF+ G        GR ++FNK+
  S:     1 MKKDIHPKYEEITASC-SCGNVIKIRSTVG-HDLNLDVCSKCHPFFTGKQRDVATGGRVDRFNKR 63
>gi|82703206|ref|YP_412772.1| 50S ribosomal protein L31 [Nitrosospira multiformis ATCC 25196] >gi|148878602|sp|Q2Y791|RL31_NITMU 50S ribosomal protein L31 >gi|82411271|gb|ABB75380.1| LSU ribosomal protein L31P [Nitrosospira multiformis ATCC 25196] (75 aa)
Score = 120, Expect = 3.1e-05, Identities = 29/65 (44%), Positives = 36/65 (55%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK + H    E++  C SC STF  +ST+  K   I+VCS CHPFY G        GR EKF +K
  S:     1 MKPDIHPDYQEITVTC-SCGSTFQTRSTMG-KPLHIEVCSVCHPFYTGKQKIVDTAGRVEKFRQK 63
>gi|87122903|ref|ZP_01078770.1| 50S ribosomal protein L31 [Marinomonas sp. MED121] >gi|86161829|gb|EAQ63127.1| 50S ribosomal protein L31 [Marinomonas sp. MED121] (83 aa)
Score = 120, Expect = 3.4e-05, Identities = 26/67 (38%), Positives = 39/67 (58%)
  Q:     1 MIMKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           ++MKK+ H     ++  C +C +T  + +TL  K+  IDVCS CHPFY G        GR ++FNK+
  S:    11 IVMKKDIHPTYAAITATC-TCGNTLNLNTTLG-KDLHIDVCSQCHPFYTGQQKMLDTGGRVDRFNKR 75
>gi|117927848|ref|YP_872399.1| 50S ribosomal protein L31P [Acidothermus cellulolyticus 11B] >gi|117648311|gb|ABK52413.1| LSU ribosomal protein L31P [Acidothermus cellulolyticus 11B] (86 aa)
Score = 120, Expect = 3.4e-05, Identities = 26/65 (40%), Positives = 36/65 (55%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK + H +  E +  C SC +TF  +ST  +     +VCS+CHPFY G      V GR +KF K+
  S:     1 MKPDIHPEYRETTVIC-SCGNTFTTRSTAKSGVIHAEVCSNCHPFYTGKQKILDVGGRVQKFEKR 64
>gi|109900486|ref|YP_663741.1| ribosomal protein L31 [Pseudoalteromonas atlantica T6c] >gi|109702767|gb|ABG42687.1| LSU ribosomal protein L31P [Pseudoalteromonas atlantica T6c] (71 aa)
Score = 120, Expect = 3.4e-05, Identities = 29/69 (42%), Positives = 41/69 (59%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAV 71
           MK   H    ++   C SC +  VV+STL  K+ ++DVCS+CHPFY G   +    GR +KFNK+  A+
  S:     1 MKTGIHPDYQDMKATC-SCGNVIVVRSTLK-KDLNLDVCSACHPFYTGKQRNVDTGGRVDKFNKRFSAL 67
>gi|83648617|ref|YP_437052.1| ribosomal protein L31 [Hahella chejuensis KCTC 2396] >gi|83636660|gb|ABC32627.1| ribosomal protein L31 [Hahella chejuensis KCTC 2396] (119 aa)
Score = 119, Expect = 3.5e-05, Identities = 27/66 (40%), Positives = 37/66 (56%)
  Q:     2 IMKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           +MK+  H +  E++  C SC +    KSTL  +   IDVCSSCHPFY G        GR ++F K+
  S:    47 VMKQGIHPEYKEITATC-SCGNIIKTKSTL-CENIHIDVCSSCHPFYTGKQKVLDTGGRIDRFKKR 110
>gi|57505791|ref|ZP_00371716.1| ribosomal protein L31 [Campylobacter upsaliensis RM3195] >gi|57015821|gb|EAL52610.1| ribosomal protein L31 [Campylobacter upsaliensis RM3195] (66 aa)
Score = 119, Expect = 3.6e-05, Identities = 31/65 (47%), Positives = 39/65 (60%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MKKE H +  E   +CA C +TFV KS  N  E  +D+CS+CHPF+ G+       GR EKF KK
  S:     1 MKKELHPEYVECKVSCA-CGNTFVTKS--NKAELRVDICSNCHPFFTGSEKIVDAAGRVEKFKKK 62
>gi|78186237|ref|YP_374280.1| 50S ribosomal protein L31 [Pelodictyon luteolum DSM 273] >gi|148878607|sp|Q3B5Z4|RL31_PELLD 50S ribosomal protein L31 >gi|78166139|gb|ABB23237.1| LSU ribosomal protein L31P [Pelodictyon luteolum DSM 273] (75 aa)
Score = 119, Expect = 3.8e-05, Identities = 27/65 (41%), Positives = 38/65 (58%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK + H K  EV+  CA+C ++F  +ST       +DVCS+CHPFY G        GR ++FNK+
  S:     1 MKSDIHPKYTEVTVVCANCGNSFETRST--RPSIKVDVCSNCHPFYTGKQTLVDTAGRVDRFNKR 63
>gi|15804527|ref|NP_290567.1| 50S ribosomal protein L31 [Escherichia coli O157:H7 EDL933] >gi|15834117|ref|NP_312890.1| 50S ribosomal protein L31 [Escherichia coli O157:H7 str. Sakai] >gi|16131774|ref|NP_418371.1| 50S ribosomal subunit protein L31 [Escherichia coli str. K-12 substr. MG1655] >gi|74314436|ref|YP_312855.1| 50S ribosomal protein L31 [Shigella sonnei Ss046] >gi|82546285|ref|YP_410232.1| 50S ribosomal protein L31 [Shigella boydii Sb227] >gi|82778888|ref|YP_405237.1| 50S ribosomal protein L31 [Shigella dysenteriae Sd197] >gi|89110093|ref|AP_003873.1| 50S ribosomal subunit protein L31 [Escherichia coli W3110] >gi|110644272|ref|YP_672002.1| 50S ribosomal protein L31 [Escherichia coli 536] >gi|157158799|ref|YP_001465430.1| 50S ribosomal protein L31 [Escherichia coli E24377A] >gi|157163411|ref|YP_001460729.1| 50S ribosomal protein L31 [Escherichia coli HS] >gi|168711747|ref|ZP_02744024.1| ribosomal protein L31 [Escherichia coli O157:H7 str. EC4045] >gi|168716369|ref|ZP_02748646.1| ribosomal protein L31 [Escherichia coli O157:H7 str. EC4206] >gi|168736956|ref|ZP_02769233.1| ribosomal protein L31 [Escherichia coli O157:H7 str. EC4115] >gi|168748764|ref|ZP_02773786.1| 50S ribosomal protein L31 [Escherichia coli O157:H7 str. EC4113] >gi|168755623|ref|ZP_02780630.1| 50S ribosomal protein L31 [Escherichia coli O157:H7 str. EC4401] >gi|168761678|ref|ZP_02786685.1| 50S ribosomal protein L31 [Escherichia coli O157:H7 str. EC4501] >gi|168768241|ref|ZP_02793248.1| 50S ribosomal protein L31 [Escherichia coli O157:H7 str. EC4486] >gi|168775226|ref|ZP_02800233.1| 50S ribosomal protein L31 [Escherichia coli O157:H7 str. EC4196] >gi|168780856|ref|ZP_02805863.1| 50S ribosomal protein L31 [Escherichia coli O157:H7 str. EC4076] >gi|168786795|ref|ZP_02811802.1| 50S ribosomal protein L31 [Escherichia coli O157:H7 str. EC869] >gi|168794888|ref|ZP_02819895.1| ribosomal protein L31 [Escherichia coli O157:H7 str. EC4042] >gi|168799481|ref|ZP_02824488.1| ribosomal protein L31 [Escherichia coli O157:H7 str. EC508] >gi|170022053|ref|YP_001727007.1| ribosomal protein L31 [Escherichia coli ATCC 8739] >gi|170083406|ref|YP_001732726.1| 50S ribosomal subunit protein L31 [Escherichia coli str. K12 substr. DH10B] >gi|170680515|ref|YP_001746323.1| 50S ribosomal protein L31 [Escherichia coli SMS-3-5] >gi|187734169|ref|YP_001882632.1| 50S ribosomal protein L31 [Shigella boydii CDC 3083-94] >gi|188492631|ref|ZP_02999901.1| 50S ribosomal protein L31 [Escherichia coli 53638] >gi|191166464|ref|ZP_03028295.1| 50S ribosomal protein L31 [Escherichia coli B7A] >gi|191172693|ref|ZP_03034231.1| 50S ribosomal protein L31 [Escherichia coli F11] >gi|193067950|ref|ZP_03048915.1| ribosomal protein L31 [Escherichia coli E110019] >gi|194427491|ref|ZP_03060040.1| 50S ribosomal protein L31 [Escherichia coli B171] >gi|194433287|ref|ZP_03065568.1| 50S ribosomal protein L31 [Shigella dysenteriae 1012] >gi|194438343|ref|ZP_03070434.1| 50S ribosomal protein L31 [Escherichia coli 101-1] >gi|195937580|ref|ZP_03082962.1| 50S ribosomal protein L31 [Escherichia coli O157:H7 str. EC4024] >gi|67472021|sp|P0A7M9|RL31_ECOLI 50S ribosomal protein L31 >gi|67472022|sp|P0A7N0|RL31_ECO57 50S ribosomal protein L31 >gi|73621790|sp|P0C076|RL31_ECOL6 50S ribosomal protein L31 >gi|118572988|sp|Q0TAC8|RL31_ECOL5 50S ribosomal protein L31 >gi|119370875|sp|P0C203|RL31_ECOUT 50S ribosomal protein L31 >gi|126352238|sp|Q3YV42|RL31_SHISS 50S ribosomal protein L31 >gi|148878620|sp|Q31U54|RL31_SHIBS 50S ribosomal protein L31 >gi|148878621|sp|Q32AA9|RL31_SHIDS 50S ribosomal protein L31 >gi|83754085|pdb|2AW4|Z Chain Z, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli At 3.5 A Resolution. This File Contains The 50s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|83754141|pdb|2AWB|Z Chain Z, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli At 3.5 A Resolution. This File Contains The 50s Subunit Of The Second 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|116666594|pdb|1VS6|Z Chain Z, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With The Antibiotic Kasugamyin At 3.5a Resolution. This File Contains The 50s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|116666646|pdb|1VS8|Z Chain Z, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With The Antibiotic Kasugamyin At 3.5a Resolution. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|119390370|pdb|2J28|Z Chain Z, Model Of E. Coli Srp Bound To 70s Rncs >gi|168988756|pdb|2VHM|Z Chain Z, Structure Of Pdf Binding Helix In Complex With The Ribosome (Part 1 Of 4) >gi|168988787|pdb|2VHN|Z Chain Z, Structure Of Pdf Binding Helix In Complex With The Ribosome. (Part 2 Of 4) >gi|169404625|pdb|2RDO|Z Chain Z, 50s Subunit With Ef-G(Gdpnp) And Rrf Bound >gi|12518842|gb|AAG59131.1|AE005624_7 50S ribosomal subunit protein L31 [Escherichia coli O157:H7 EDL933] >gi|305039|gb|AAB03068.1| 50S ribosomal protein L31 [Escherichia coli] >gi|469093|emb|CAA55286.1| ribosomal protein L31 [Escherichia coli] >gi|1790371|gb|AAC76918.1| 50S ribosomal subunit protein L31 [Escherichia coli str. K-12 substr. MG1655] >gi|13364339|dbj|BAB38286.1| 50S ribosomal subunit protein L31 [Escherichia coli O157:H7 str. Sakai] >gi|73857913|gb|AAZ90620.1| 50S ribosomal subunit protein L31 [Shigella sonnei Ss046] >gi|81243036|gb|ABB63746.1| 50S ribosomal subunit protein L31 [Shigella dysenteriae Sd197] >gi|81247696|gb|ABB68404.1| 50S ribosomal subunit protein L31 [Shigella boydii Sb227] >gi|85676124|dbj|BAE77374.1| 50S ribosomal subunit protein L31 [Escherichia coli W3110] >gi|110345864|gb|ABG72101.1| 50S ribosomal protein L31 [Escherichia coli 536] >gi|157069091|gb|ABV08346.1| ribosomal protein L31 [Escherichia coli HS] >gi|157080829|gb|ABV20537.1| ribosomal protein L31 [Escherichia coli E24377A] >gi|169756981|gb|ACA79680.1| ribosomal protein L31 [Escherichia coli ATCC 8739] >gi|169891241|gb|ACB04948.1| 50S ribosomal subunit protein L31 [Escherichia coli str. K12 substr. DH10B] >gi|170518233|gb|ACB16411.1| 50S ribosomal protein L31 [Escherichia coli SMS-3-5] >gi|187431161|gb|ACD10435.1| 50S ribosomal protein L31 [Shigella boydii CDC 3083-94] >gi|187769182|gb|EDU33026.1| 50S ribosomal protein L31 [Escherichia coli O157:H7 str. EC4196] >gi|188016733|gb|EDU54855.1| 50S ribosomal protein L31 [Escherichia coli O157:H7 str. EC4113] >gi|188487830|gb|EDU62933.1| 50S ribosomal protein L31 [Escherichia coli 53638] >gi|189001607|gb|EDU70593.1| 50S ribosomal protein L31 [Escherichia coli O157:H7 str. EC4076] >gi|189357154|gb|EDU75573.1| 50S ribosomal protein L31 [Escherichia coli O157:H7 str. EC4401] >gi|189362698|gb|EDU81117.1| 50S ribosomal protein L31 [Escherichia coli O157:H7 str. EC4486] >gi|189367953|gb|EDU86369.1| 50S ribosomal protein L31 [Escherichia coli O157:H7 str. EC4501] >gi|189373403|gb|EDU91819.1| 50S ribosomal protein L31 [Escherichia coli O157:H7 str. EC869] >gi|189378098|gb|EDU96514.1| ribosomal protein L31 [Escherichia coli O157:H7 str. EC508] >gi|190903564|gb|EDV63282.1| 50S ribosomal protein L31 [Escherichia coli B7A] >gi|190906997|gb|EDV66598.1| 50S ribosomal protein L31 [Escherichia coli F11] >gi|192958570|gb|EDV89008.1| ribosomal protein L31 [Escherichia coli E110019] >gi|194414531|gb|EDX30804.1| 50S ribosomal protein L31 [Escherichia coli B171] >gi|194418571|gb|EDX34659.1| 50S ribosomal protein L31 [Shigella dysenteriae 1012] >gi|194422780|gb|EDX38776.1| 50S ribosomal protein L31 [Escherichia coli 101-1] (70 aa)
Score = 119, Expect = 3.8e-05, Identities = 25/65 (38%), Positives = 40/65 (61%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MKK+ H K  E++ +C SC +   ++ST+   + ++DVCS CHPF+ G        GR ++FNK+
  S:     1 MKKDIHPKYEEITASC-SCGNVMKIRSTVG-HDLNLDVCSKCHPFFTGKQRDVATGGRVDRFNKR 63
>gi|169351422|ref|ZP_02868360.1| hypothetical protein CLOSPI_02202 [Clostridium spiroforme DSM 1552] >gi|169291644|gb|EDS73777.1| hypothetical protein CLOSPI_02202 [Clostridium spiroforme DSM 1552] (89 aa)
Score = 119, Expect = 3.9e-05, Identities = 28/65 (43%), Positives = 34/65 (52%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MKK  H    +V   C SC + F   S L+  E  +D CS+CHPFY G        GR +KFNKK
  S:    23 MKKGIHPNYKKVKVVCTSCGNEFESGSVLD--EVRVDTCSNCHPFYTGKQRFASADGRVDKFNKK 85
>gi|15677786|ref|NP_274950.1| 50S ribosomal protein L31 [Neisseria meningitidis MC58] >gi|15793494|ref|NP_283316.1| 50S ribosomal protein L31 [Neisseria meningitidis Z2491] >gi|161723296|ref|YP_975856.2| 50S ribosomal protein L31 [Neisseria meningitidis FAM18] >gi|54039174|sp|P66190|RL31_NEIMB 50S ribosomal protein L31 >gi|54041866|sp|P66189|RL31_NEIMA 50S ribosomal protein L31 >gi|7227216|gb|AAF42285.1| 50S ribosomal protein L31 [Neisseria meningitidis MC58] >gi|121051481|emb|CAM07774.1| 50S ribosomal protein L31 [Neisseria meningitidis Z2491] (71 aa)
Score = 119, Expect = 3.9e-05, Identities = 28/65 (43%), Positives = 37/65 (56%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H   +EV+  C SC + F  KS +  +  +I+VCS CHPFY GT       GR +KFN K
  S:     1 MKQGIHPNYHEVNVTC-SCGNKFATKSAMEKENFNIEVCSLCHPFYTGTQKIVDTTGRVDKFNNK 64
>gi|170769671|ref|ZP_02904124.1| ribosomal protein L31 [Escherichia albertii TW07627] >gi|170121479|gb|EDS90410.1| ribosomal protein L31 [Escherichia albertii TW07627] (70 aa)
Score = 119, Expect = 4.1e-05, Identities = 25/65 (38%), Positives = 39/65 (60%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MKK+ H K  E++  C SC +   ++ST+   + ++DVCS CHPF+ G        GR ++FNK+
  S:     1 MKKDIHPKYEEITATC-SCGNVMKIRSTVG-HDLNLDVCSKCHPFFTGKQRDVATGGRVDRFNKR 63
>gi|53802366|ref|YP_112854.1| ribosomal protein L31 [Methylococcus capsulatus str. Bath] >gi|73621805|sp|Q60BZ1|RL31_METCA 50S ribosomal protein L31 >gi|53756127|gb|AAU90418.1| ribosomal protein L31 [Methylococcus capsulatus str. Bath] (67 aa)
Score = 119, Expect = 4.1e-05, Identities = 26/65 (40%), Positives = 38/65 (58%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK + H     V+ +C SC +TF  +ST+  K+  ++VCS+CHPFY G        GR +KF +K
  S:     1 MKPDIHPDYTTVTVSC-SCGNTFETRSTIG-KDFHVEVCSACHPFYTGKQKIVDTAGRVDKFRRK 63
>gi|86742402|ref|YP_482802.1| 50S ribosomal protein L31 [Frankia sp. CcI3] >gi|124056500|sp|Q2J6L9|RL31_FRASC 50S ribosomal protein L31 >gi|86569264|gb|ABD13073.1| LSU ribosomal protein L31P [Frankia sp. CcI3] (78 aa)
Score = 119, Expect = 4.2e-05, Identities = 25/65 (38%), Positives = 35/65 (53%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK + H   +E +  C +C +TF  +ST      + +VCS CHPFY G      V GR EKF ++
  S:     1 MKPDVHPTYHETTVTC-TCGNTFTTRSTKENGVVNAEVCSQCHPFYTGKQKILDVGGRVEKFERR 64
>gi|84390842|ref|ZP_00991534.1| 50S ribosomal protein L31 [Vibrio splendidus 12B01] >gi|84376645|gb|EAP93522.1| 50S ribosomal protein L31 [Vibrio splendidus 12B01] (72 aa)
Score = 119, Expect = 4.3e-05, Identities = 28/72 (38%), Positives = 37/72 (51%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQE 74
           MK   H +   VS  C SC +TF   STL  +   +DVC  CHPFY G        GR ++FNK+  A+  +
  S:     1 MKTGIHPEYKAVSATC-SCGNTFEFNSTLAKESIHLDVCDKCHPFYTGKQRIVDTGGRVDRFNKRFGALSSK 71
>gi|149377304|ref|ZP_01895050.1| ribosomal protein L31 [Marinobacter algicola DG893] >gi|149358401|gb|EDM46877.1| ribosomal protein L31 [Marinobacter algicola DG893] (73 aa)
Score = 119, Expect = 4.4e-05, Identities = 25/65 (38%), Positives = 37/65 (56%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H K  E++  C SC +    +ST  T++ ++DVCS CHPFY G        GR ++F K+
  S:     1 MKEGIHPKYAEITATC-SCGNVLKTRSTF-TQDLTLDVCSQCHPFYTGKQKVMDTGGRIDRFQKR 63
>gi|86147304|ref|ZP_01065618.1| 50S ribosomal protein L31 [Vibrio sp. MED222] >gi|85834869|gb|EAQ53013.1| 50S ribosomal protein L31 [Vibrio sp. MED222] (72 aa)
Score = 118, Expect = 4.5e-05, Identities = 28/72 (38%), Positives = 37/72 (51%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQE 74
           MK   H +   VS  C SC +TF   STL  +   +DVC  CHPFY G        GR ++FNK+  A+  +
  S:     1 MKVGIHPEYKAVSATC-SCGNTFEFNSTLAKESIHLDVCDKCHPFYTGKQRIVDTGGRVDRFNKRFGALSSK 71
>gi|153814374|ref|ZP_01967042.1| hypothetical protein RUMTOR_00584 [Ruminococcus torques ATCC 27756] >gi|145848770|gb|EDK25688.1| hypothetical protein RUMTOR_00584 [Ruminococcus torques ATCC 27756] (69 aa)
Score = 118, Expect = 4.6e-05, Identities = 26/66 (39%), Positives = 41/66 (62%)
  Q:     2 IMKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           IM++  H + ++ +  C +C +TFV  ST   +   +++CS CHPFY G   + Q +GR +KFNKK
  S:     3 IMREGIHPEYHQATVTC-NCGNTFVTGST--KENIHVEICSKCHPFYTGQQKAAQARGRVDKFNKK 65
>gi|94676890|ref|YP_588626.1| ribosomal protein L31 [Baumannia cicadellinicola str. Hc (Homalodisca coagulata)] >gi|94220040|gb|ABF14199.1| ribosomal protein L31 [Baumannia cicadellinicola str. Hc (Homalodisca coagulata)] (92 aa)
Score = 118, Expect = 4.6e-05, Identities = 27/65 (41%), Positives = 38/65 (58%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           M+K  H K  E+   C SC +     STL+ +  ++DVCS+CHPFY G       +GR E+FNK+
  S:    18 MQKNIHPKYFEIRAIC-SCGNIIPTYSTLD-QHLNLDVCSACHPFYTGKQRRVNTRGRVERFNKR 80
>gi|149911774|ref|ZP_01900379.1| putative ribosomal protein L31 [Moritella sp. PE36] >gi|149805162|gb|EDM65183.1| putative ribosomal protein L31 [Moritella sp. PE36] (70 aa)
Score = 118, Expect = 4.7e-05, Identities = 28/69 (40%), Positives = 39/69 (56%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAV 71
           MK+  H +   +   C SC + F V ST   K  ++DVCS+CHPFY G   +    GR +KFNK+  A+
  S:     1 MKQGIHPEYAAMEAKC-SCGNIFAVGST-RGKNITLDVCSNCHPFYTGKQRNVDTGGRVDKFNKRFGAL 67
>gi|121534880|ref|ZP_01666699.1| ribosomal protein L31 [Thermosinus carboxydivorans Nor1] >gi|121306479|gb|EAX47402.1| ribosomal protein L31 [Thermosinus carboxydivorans Nor1] (66 aa)
Score = 118, Expect = 4.7e-05, Identities = 27/65 (41%), Positives = 36/65 (55%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           M+++ H K  E    C  C +TF   S    KE  +DVCS CHPF+ G   +   +GR EKFNK+
  S:     1 MQEKIHPKYGEARVICG-CGNTFTTGSV--KKELRVDVCSKCHPFFTGQQRTVAARGRIEKFNKR 62
>gi|154482492|ref|ZP_02024940.1| hypothetical protein EUBVEN_00159 [Eubacterium ventriosum ATCC 27560] >gi|149736693|gb|EDM52579.1| hypothetical protein EUBVEN_00159 [Eubacterium ventriosum ATCC 27560] (66 aa)
Score = 118, Expect = 5.0e-05, Identities = 26/65 (40%), Positives = 38/65 (58%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           M+K  H    + +  C +C +TFV  ST    E  +++CS+CHPFY G   +   +GR +KFNKK
  S:     1 MRKGIHPDYQQATVTC-NCGNTFVTGST--KPELHVEICSACHPFYTGQQKAISARGRIDKFNKK 62
>gi|32475814|ref|NP_868808.1| 50S ribosomal protein L31 [Rhodopirellula baltica SH 1] >gi|73621818|sp|Q7ULT4|RL31_RHOBA 50S ribosomal protein L31 >gi|32446357|emb|CAD76185.1| 50S ribosomal protein L31 [Rhodopirellula baltica SH 1] (81 aa)
Score = 118, Expect = 5.0e-05, Identities = 28/68 (41%), Positives = 33/68 (48%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVA 70
           M+   H    E S  C  C +TF  +ST    E  ID+CS CHPFY G        GR +KF KK  A
  S:     1 MQDGIHPNYQETSVTCG-CGNTFTTRST--RPELKIDICSECHPFYTGKLKYVDTAGRIDKFQKKFAA 65
>gi|148977249|ref|ZP_01813876.1| 50S ribosomal protein L31 [Vibrionales bacterium SWAT-3] >gi|145963531|gb|EDK28794.1| 50S ribosomal protein L31 [Vibrionales bacterium SWAT-3] (72 aa)
Score = 118, Expect = 5.2e-05, Identities = 27/72 (37%), Positives = 37/72 (51%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQE 74
           MK   H +   V+  C SC +TF   STL  +   +DVC  CHPFY G        GR ++FNK+  A+  +
  S:     1 MKAGIHPEYKAVTATC-SCGNTFEFNSTLAKESIHLDVCDKCHPFYTGKQRIVDTGGRVDRFNKRFGALSSK 71
>gi|169832293|ref|YP_001718275.1| ribosomal protein L31 [Candidatus Desulforudis audaxviator MP104C] >gi|169639137|gb|ACA60643.1| ribosomal protein L31 [Candidatus Desulforudis audaxviator MP104C] (67 aa)
Score = 117, Expect = 6.0e-05, Identities = 26/65 (40%), Positives = 37/65 (56%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK++ H    +    C  C + F V ST   KE  +D+CS CHPFY G   + + +GRA+KF +K
  S:     1 MKEKLHPAYQKARIVCV-CGAQFEVGST--KKEMRVDICSKCHPFYTGMQRTVETRGRADKFRRK 62
>gi|134301003|ref|YP_001114499.1| 50S ribosomal protein L31 [Desulfotomaculum reducens MI-1] >gi|134053703|gb|ABO51674.1| LSU ribosomal protein L31P [Desulfotomaculum reducens MI-1] (66 aa)
Score = 117, Expect = 6.0e-05, Identities = 30/65 (46%), Positives = 38/65 (58%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK++ H    EV   C  C +TF   ST   KE  +++CS+CHPFY G     +V GRAEKF KK
  S:     1 MKEKIHPNYQEVEVKCV-CGNTFKTGST--KKEIKVEICSNCHPFYTGAQRQIEVGGRAEKFRKK 62
>gi|119470420|ref|ZP_01613148.1| 50S ribosomal subunit protein L31 [Alteromonadales bacterium TW-7] >gi|119446345|gb|EAW27621.1| 50S ribosomal subunit protein L31 [Alteromonadales bacterium TW-7] (71 aa)
Score = 117, Expect = 6.1e-05, Identities = 29/69 (42%), Positives = 39/69 (56%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAV 71
           MK+  H K   +S  C SC + F   STL  K+  +DVCS+CHPFY G        GR ++FNK+  A+
  S:     1 MKEGIHPKYEVISATC-SCGNKFETSSTL-CKDIHLDVCSACHPFYTGKQKVLDTGGRVDRFNKRFGAL 67
>gi|152978206|ref|YP_001343835.1| 50S ribosomal protein L31 [Actinobacillus succinogenes 130Z] >gi|150839929|gb|ABR73900.1| ribosomal protein L31 [Actinobacillus succinogenes 130Z] (71 aa)
Score = 117, Expect = 6.2e-05, Identities = 26/65 (40%), Positives = 38/65 (58%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H +  E++  C SC +    +STL  K+ ++DVC +CHPFY G        GR E+FNK+
  S:     1 MKQGIHPEYKEITATC-SCGNVIKTRSTLG-KDINLDVCGNCHPFYTGKQRVVDTGGRVERFNKR 63
>gi|157373676|ref|YP_001472276.1| 50S ribosomal protein L31 [Shewanella sediminis HAW-EB3] >gi|157316050|gb|ABV35148.1| ribosomal protein L31 [Shewanella sediminis HAW-EB3] (70 aa)
Score = 117, Expect = 6.3e-05, Identities = 27/72 (37%), Positives = 39/72 (54%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQE 74
           MK + H    E++  C +C +   V ST   K   +DVC +CHPFY GT       GR +KFNK+  A+ ++
  S:     1 MKADIHPAYAEITATC-TCGNVIKVNSTAG-KALHLDVCGACHPFYTGTQKIVDTGGRIDKFNKRFGALGKK 70
>gi|78044735|ref|YP_361358.1| 50S ribosomal protein L31 [Carboxydothermus hydrogenoformans Z-2901] >gi|158564305|sp|Q3A926|RL31_CARHZ 50S ribosomal protein L31 >gi|77996850|gb|ABB15749.1| ribosomal protein L31 [Carboxydothermus hydrogenoformans Z-2901] (65 aa)
Score = 117, Expect = 6.7e-05, Identities = 27/65 (41%), Positives = 37/65 (56%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK   H +  +    CA C  TF   ST   KE  +++CS CHPFY G+  + + +GRAE+F KK
  S:     1 MKPGIHPEYGKARVICA-CGETFETGST--KKEIRVEICSKCHPFYTGSQRTVEARGRAEQFKKK 62
>gi|28897029|ref|NP_796634.1| 50S ribosomal protein L31 [Vibrio parahaemolyticus RIMD 2210633] >gi|153840404|ref|ZP_01993071.1| ribosomal protein L31 [Vibrio parahaemolyticus AQ3810] >gi|31076906|sp|Q87T15|RL31_VIBPA 50S ribosomal protein L31 >gi|28805237|dbj|BAC58518.1| ribosomal protein L31 [Vibrio parahaemolyticus RIMD 2210633] >gi|149745932|gb|EDM57062.1| ribosomal protein L31 [Vibrio parahaemolyticus AQ3810] (73 aa)
Score = 117, Expect = 6.8e-05, Identities = 26/69 (37%), Positives = 36/69 (52%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAV 71
           MK   H +   V+  C SC ++F   STL  +   +DVC  CHPFY G        GR ++FNK+  A+
  S:     1 MKAGIHPEYKAVNATC-SCGNSFEFNSTLGKESIHLDVCDKCHPFYTGKQRIVDTGGRVDRFNKRFGAL 68
>gi|154502576|ref|ZP_02039636.1| hypothetical protein RUMGNA_00389 [Ruminococcus gnavus ATCC 29149] >gi|153796768|gb|EDN79188.1| hypothetical protein RUMGNA_00389 [Ruminococcus gnavus ATCC 29149] (66 aa)
Score = 117, Expect = 7.1e-05, Identities = 25/65 (38%), Positives = 40/65 (61%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           M++  H + ++ +  C +C +TFV  ST   +   +++CS CHPFY G   + Q +GR +KFNKK
  S:     1 MREGIHPEYHQATVTC-NCGNTFVTGST--NESIHVEICSKCHPFYTGQQKAAQARGRVDKFNKK 62
>gi|124545482|ref|ZP_01704675.1| ribosomal protein L31 [Shewanella putrefaciens 200] >gi|120560501|gb|ABM26428.1| ribosomal protein L31 [Shewanella sp. W3-18-1] >gi|124510825|gb|EAY54892.1| ribosomal protein L31 [Shewanella putrefaciens 200] >gi|145563350|gb|ABP74285.1| ribosomal protein L31 [Shewanella putrefaciens CN-32] (79 aa)
Score = 117, Expect = 7.2e-05, Identities = 26/72 (36%), Positives = 40/72 (55%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQE 74
           MK+  H +   ++ NC +C +   V ST   K+  +DVC +CHPFY GT       GR +KFNK+   + ++
  S:    10 MKQGIHPEYAVITANC-TCGNVIKVNSTAG-KDLHLDVCGACHPFYTGTQKVVDTGGRIDKFNKRFAVLAKK 79
>gi|152998121|ref|YP_001342956.1| ribosomal protein L31 [Marinomonas sp. MWYL1] >gi|150839045|gb|ABR73021.1| ribosomal protein L31 [Marinomonas sp. MWYL1] (71 aa)
Score = 117, Expect = 7.6e-05, Identities = 26/65 (40%), Positives = 39/65 (60%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MKK+ H   + V+  C +C +T  + STL + +  +DVCS+CHPFY G        GR ++FNK+
  S:     1 MKKDIHPNYSAVTATC-TCGNTLQLNSTLGS-DLHVDVCSNCHPFYTGQQKMVDTGGRVDRFNKR 63
>gi|89075189|ref|ZP_01161620.1| 50S ribosomal protein L31 [Photobacterium sp. SKA34] >gi|89049011|gb|EAR54578.1| 50S ribosomal protein L31 [Photobacterium sp. SKA34] (70 aa)
Score = 117, Expect = 7.6e-05, Identities = 28/69 (40%), Positives = 39/69 (56%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAV 71
           MK+  H +   V+  C SC +TF   ST+  K+ ++DVC  CHPFY G        GR +KFNK+  A+
  S:     1 MKQGIHPEYKAVNARC-SCGNTFAFNSTMG-KDINLDVCDKCHPFYTGKQRQVSSGGRVDKFNKRFGAL 67
>gi|153854180|ref|ZP_01995488.1| hypothetical protein DORLON_01479 [Dorea longicatena DSM 13814] >gi|149753229|gb|EDM63160.1| hypothetical protein DORLON_01479 [Dorea longicatena DSM 13814] (77 aa)
Score = 116, Expect = 7.9e-05, Identities = 28/66 (42%), Positives = 41/66 (62%)
  Q:     2 IMKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           IMK+  H    + +  C +C +TFV  ST  ++E  +++CS CHPFY G   + Q +GR +KFNKK
  S:    10 IMKEGIHPNYYQATVTC-NCGNTFVTGST--SEEIHVEICSKCHPFYTGQQKATQARGRVDKFNKK 72
>gi|153951925|ref|YP_001397413.1| 50S ribosomal protein L31 [Campylobacter jejuni subsp. doylei 269.97] >gi|152939371|gb|ABS44112.1| ribosomal protein L31 [Campylobacter jejuni subsp. doylei 269.97] (65 aa)
Score = 116, Expect = 7.9e-05, Identities = 30/65 (46%), Positives = 38/65 (58%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MKKE H +  E   +CA C +TF  KS  N  E  +D+CS+CHPF+ G+       GR EKF KK
  S:     1 MKKEIHPEYVECKVSCA-CGNTFATKS--NKAELRVDICSNCHPFFTGSEKIVDAAGRVEKFKKK 62
>gi|77456629|ref|YP_346134.1| 50S ribosomal protein L31 [Pseudomonas fluorescens PfO-1] >gi|126352236|sp|Q3KJB1|RL31_PSEPF 50S ribosomal protein L31 >gi|77380632|gb|ABA72145.1| LSU ribosomal protein L31P [Pseudomonas fluorescens PfO-1] (72 aa)
Score = 116, Expect = 7.9e-05, Identities = 26/62 (41%), Positives = 34/62 (54%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKF 64
           MK + H    EV+  C SC + F  +ST   K  +IDVC+ CHPFY G   +    GR +KF
  S:     1 MKADIHPNYPEVAVTC-SCGNKFETRSTFG-KALAIDVCNECHPFYTGKQKTLDTGGRVQKF 60
>gi|126176033|ref|YP_001052182.1| ribosomal protein L31 [Shewanella baltica OS155] >gi|149114839|ref|ZP_01841588.1| ribosomal protein L31 [Shewanella baltica OS223] >gi|152999027|ref|YP_001364708.1| 50S ribosomal protein L31 [Shewanella baltica OS185] >gi|160873620|ref|YP_001552936.1| 50S ribosomal protein L31 [Shewanella baltica OS195] >gi|125999238|gb|ABN63313.1| ribosomal protein L31 [Shewanella baltica OS155] >gi|146865288|gb|EDK50615.1| ribosomal protein L31 [Shewanella baltica OS223] >gi|151363645|gb|ABS06645.1| ribosomal protein L31 [Shewanella baltica OS185] >gi|160859142|gb|ABX47676.1| ribosomal protein L31 [Shewanella baltica OS195] (70 aa)
Score = 116, Expect = 8.1e-05, Identities = 27/72 (37%), Positives = 39/72 (54%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQE 74
           MK   H K   ++ NC +C +   V ST   K+  +DVC +CHPFY GT       GR +KFNK+   + ++
  S:     1 MKPGIHPKYAIITANC-TCGNVIKVNSTAG-KDLHLDVCGACHPFYTGTQKVVDTGGRIDKFNKRFAVLAKK 70
>gi|127511315|ref|YP_001092512.1| 50S ribosomal protein L31 [Shewanella loihica PV-4] >gi|126636610|gb|ABO22253.1| ribosomal protein L31 [Shewanella loihica PV-4] (70 aa)
Score = 116, Expect = 8.9e-05, Identities = 26/65 (40%), Positives = 35/65 (53%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK   H +  E++  C +C +   V ST   K   +DVC +CHPFY GT       GR +KFNK+
  S:     1 MKPGIHPEYAEITATC-TCGNVIKVNSTAG-KPLHLDVCGACHPFYTGTQKVMDTGGRIDKFNKR 63
>gi|30249039|ref|NP_841109.1| 50S ribosomal protein L31 [Nitrosomonas europaea ATCC 19718] >gi|73621809|sp|Q82VN1|RL31_NITEU 50S ribosomal protein L31 >gi|30138656|emb|CAD84947.1| Ribosomal protein L31 [Nitrosomonas europaea ATCC 19718] (74 aa)
Score = 116, Expect = 9.4e-05, Identities = 29/65 (44%), Positives = 39/65 (60%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H + +E++  C SC + F  +S L +K   I+VCSSCHPFY G        GR EKFN+K
  S:     1 MKEGIHPEYHEITVTC-SCGNEFKTRSVL-SKPLHIEVCSSCHPFYTGKQKIVDTAGRVEKFNQK 63
>gi|91229291|ref|ZP_01262908.1| 50S ribosomal protein L31 [Vibrio alginolyticus 12G01] >gi|91187416|gb|EAS73764.1| 50S ribosomal protein L31 [Vibrio alginolyticus 12G01] (73 aa)
Score = 116, Expect = 9.6e-05, Identities = 26/69 (37%), Positives = 35/69 (50%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAV 71
           MK   H +   V   C SC ++F   STL  +   +DVC  CHPFY G        GR ++FNK+  A+
  S:     1 MKAGIHPEYKAVKATC-SCGNSFEFNSTLGKESIHLDVCDKCHPFYTGKQRIVDTGGRVDRFNKRFGAL 68
>gi|92112737|ref|YP_572665.1| 50S ribosomal protein L31P [Chromohalobacter salexigens DSM 3043] >gi|148878592|sp|Q1QZZ2|RL31_CHRSD 50S ribosomal protein L31 >gi|91795827|gb|ABE57966.1| LSU ribosomal protein L31P [Chromohalobacter salexigens DSM 3043] (71 aa)
Score = 116, Expect = 9.7e-05, Identities = 27/65 (41%), Positives = 37/65 (56%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H +  +V+  C SC +TF   ST   ++  +DVCS CHPFY G        GR E+FNK+
  S:     1 MKQAIHPEYKKVTATC-SCGATFEFGSTAR-EDFYVDVCSQCHPFYTGKQKQATTGGRVERFNKR 63
>gi|113971823|ref|YP_735616.1| 50S ribosomal protein L31 [Shewanella sp. MR-4] >gi|114045969|ref|YP_736519.1| 50S ribosomal protein L31 [Shewanella sp. MR-7] >gi|117922103|ref|YP_871295.1| 50S ribosomal protein L31 [Shewanella sp. ANA-3] >gi|113886507|gb|ABI40559.1| ribosomal protein L31 [Shewanella sp. MR-4] >gi|113887411|gb|ABI41462.1| ribosomal protein L31 [Shewanella sp. MR-7] >gi|117614435|gb|ABK49889.1| ribosomal protein L31 [Shewanella sp. ANA-3] (70 aa)
Score = 116, Expect = 9.8e-05, Identities = 26/65 (40%), Positives = 36/65 (55%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK   H +   ++ NC +C +   V ST   K+  +DVC +CHPFY GT       GR +KFNK+
  S:     1 MKPGIHPEYAVITANC-TCGNVIKVNSTAG-KDLHLDVCGACHPFYTGTQKVVDTGGRIDKFNKR 63
>gi|166032749|ref|ZP_02235578.1| hypothetical protein DORFOR_02464 [Dorea formicigenerans ATCC 27755] >gi|166027106|gb|EDR45863.1| hypothetical protein DORFOR_02464 [Dorea formicigenerans ATCC 27755] (66 aa)
Score = 116, Expect = 9.9e-05, Identities = 26/65 (40%), Positives = 39/65 (60%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H    + +  C +C +TFV  ST   ++  +++CS CHPFY G   + Q +GR +KFNKK
  S:     1 MKEGIHPAYYQATVTC-NCGNTFVTGST--KEDIHVEICSKCHPFYTGQQKATQARGRVDKFNKK 62
>gi|88705208|ref|ZP_01102919.1| Ribosomal protein L31 [gamma proteobacterium KT 71] >gi|88700298|gb|EAQ97406.1| Ribosomal protein L31 [Congregibacter litoralis KT71] (71 aa)
Score = 115, Expect = 1.0e-04, Identities = 26/65 (40%), Positives = 38/65 (58%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK E H +  +V   C SC +T   +STL  ++ +IDVCS+CHPF+ G        GR ++F K+
  S:     1 MKAEIHPRYEDVKATC-SCGNTIQTRSTLG-QDFNIDVCSNCHPFFTGKQKIVDSGGRVDRFKKR 63
>gi|94264427|ref|ZP_01288217.1| Ribosomal protein L31 [delta proteobacterium MLMS-1] >gi|94271212|ref|ZP_01291907.1| Ribosomal protein L31 [delta proteobacterium MLMS-1] >gi|93450532|gb|EAT01682.1| Ribosomal protein L31 [delta proteobacterium MLMS-1] >gi|93455184|gb|EAT05402.1| Ribosomal protein L31 [delta proteobacterium MLMS-1] (95 aa)
Score = 115, Expect = 1.0e-04, Identities = 25/67 (37%), Positives = 38/67 (56%)
  Q:     1 MIMKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           M+MK   H + +++  +CA C +   + S L  KE  +++CS+CHPF+ G        GR EKF KK
  S:    25 MVMKAGIHPEYHKIEASCA-CGNKVEIGSAL--KEVKVEICSACHPFFTGKQKLIDSAGRVEKFLKK 88
>gi|29654228|ref|NP_819920.1| ribosomal protein L31 [Coxiella burnetii RSA 493] >gi|153206724|ref|ZP_01945565.1| ribosomal protein L31 [Coxiella burnetii 'MSU Goat Q177'] >gi|154707777|ref|YP_001424352.1| ribosomal protein L31 [Coxiella burnetii Dugway 5J108-111] >gi|161830870|ref|YP_001596801.1| ribosomal protein L31 [Coxiella burnetii RSA 331] >gi|165918531|ref|ZP_02218617.1| ribosomal protein L31 [Coxiella burnetii RSA 334] >gi|73621787|sp|Q83D39|RL31_COXBU 50S ribosomal protein L31 >gi|29541494|gb|AAO90434.1| ribosomal protein L31 [Coxiella burnetii RSA 493] >gi|120577087|gb|EAX33711.1| ribosomal protein L31 [Coxiella burnetii 'MSU Goat Q177'] >gi|154357063|gb|ABS78525.1| ribosomal protein L31 [Coxiella burnetii Dugway 5J108-111] >gi|161762737|gb|ABX78379.1| ribosomal protein L31 [Coxiella burnetii RSA 331] >gi|165917777|gb|EDR36381.1| ribosomal protein L31 [Coxiella burnetii RSA 334] (79 aa)
Score = 115, Expect = 1.0e-04, Identities = 26/65 (40%), Positives = 38/65 (58%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H    ++   C SC +TF+  STL+ +E  +++CS+CHPFY G        GR E+F KK
  S:     1 MKENIHPPYKQIKVTC-SCGNTFMTGSTLD-RELHLEICSACHPFYTGQQKMVDTAGRVERFRKK 63
>gi|193216765|ref|YP_002000007.1| ribosomal protein L31 [Mycoplasma arthritidis 158L3-1] >gi|193002088|gb|ACF07303.1| ribosomal protein L31 [Mycoplasma arthritidis 158L3-1] (71 aa)
Score = 115, Expect = 1.1e-04, Identities = 28/64 (43%), Positives = 38/64 (59%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNK 66
           MKKE H    EV   C SC    +  ST+  ++ S+DVCS+CH FY G   + + +GR E+FNK
  S:     1 MKKEIHPNFKEVKATCTSCGKEHIFGSTV--EKISLDVCSNCHAFYTGDRSTVKARGRVERFNK 62
>gi|119773587|ref|YP_926327.1| 50S ribosomal protein L31 [Shewanella amazonensis SB2B] >gi|119766087|gb|ABL98657.1| ribosomal protein L31 [Shewanella amazonensis SB2B] (70 aa)
Score = 115, Expect = 1.1e-04, Identities = 24/65 (36%), Positives = 37/65 (56%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK   H +  +++  C +C +   + ST+  K+  +DVC +CHPFY GT       GR +KFNK+
  S:     1 MKPGIHPEYAQITATC-TCGNVIKINSTVG-KDLHLDVCGACHPFYTGTQKVVDTGGRIDKFNKR 63
>gi|194246542|ref|YP_002004181.1| 50S ribosomal protein L31 [Candidatus Phytoplasma mali] >gi|193806899|emb|CAP18328.1| 50S ribosomal protein L31 [Candidatus Phytoplasma mali] (69 aa)
Score = 115, Expect = 1.2e-04, Identities = 25/65 (38%), Positives = 40/65 (61%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MKK+ H  L ++   CA+C    V+ +T+  +   I++C++CHPFY+G      V GR +KFNK+
  S:     1 MKKKLHPILKKIPLVCATCKKQHVIDTTV--ENIHIEICANCHPFYVGKQNFTTVAGRVDKFNKR 63
>gi|165936328|ref|ZP_02224897.1| ribosomal protein L31 [Yersinia pestis biovar Orientalis str. IP275] >gi|167419252|ref|ZP_02311005.1| ribosomal protein L31 [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|21956979|gb|AAM83891.1|AE013629_2 50S ribosomal subunit protein L31 [Yersinia pestis KIM] >gi|165915942|gb|EDR34550.1| ribosomal protein L31 [Yersinia pestis biovar Orientalis str. IP275] >gi|166963246|gb|EDR59267.1| ribosomal protein L31 [Yersinia pestis biovar Orientalis str. MG05-1020] (90 aa)
Score = 115, Expect = 1.2e-04, Identities = 24/65 (36%), Positives = 37/65 (56%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H K  +V+ +C SC +   + ST+   + ++DVC  CHPFY G        GR ++FNK+
  S:    20 MKQGIHPKYEQVTASC-SCGNVIKINSTVG-HDLNLDVCGECHPFYTGKQRDVASGGRVDRFNKR 82
>gi|161936274|ref|YP_964982.2| 50S ribosomal protein L31 [Shewanella sp. W3-18-1] >gi|162139380|ref|YP_001182084.2| 50S ribosomal protein L31 [Shewanella putrefaciens CN-32] (70 aa)
Score = 115, Expect = 1.2e-04, Identities = 26/72 (36%), Positives = 40/72 (55%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQE 74
           MK+  H +   ++ NC +C +   V ST   K+  +DVC +CHPFY GT       GR +KFNK+   + ++
  S:     1 MKQGIHPEYAVITANC-TCGNVIKVNSTAG-KDLHLDVCGACHPFYTGTQKVVDTGGRIDKFNKRFAVLAKK 70
>gi|189500981|ref|YP_001960451.1| ribosomal protein L31 [Chlorobium phaeobacteroides BS1] >gi|189496422|gb|ACE04970.1| ribosomal protein L31 [Chlorobium phaeobacteroides BS1] (75 aa)
Score = 115, Expect = 1.3e-04, Identities = 28/77 (36%), Positives = 42/77 (54%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQEPTKSE 79
           MKK+ H K   V+  CA+C ++F  +ST   +   +D+CS+CHPFY G  +     GR E+F K+        + SE
  S:     1 MKKDIHPKYTTVTVTCANCGNSFETRST--KESIKVDICSNCHPFYTGKQVLVDTAGRVERFKKRFAKKNASSSASE 75
>gi|77361641|ref|YP_341216.1| 50S ribosomal subunit protein L31 [Pseudoalteromonas haloplanktis TAC125] >gi|148878612|sp|Q3IJB4|RL31_PSEHT 50S ribosomal protein L31 >gi|76876552|emb|CAI87774.1| 50S ribosomal subunit protein L31 [Pseudoalteromonas haloplanktis TAC125] (71 aa)
Score = 115, Expect = 1.3e-04, Identities = 29/69 (42%), Positives = 38/69 (55%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAV 71
           MK+  H K   +S  C SC + F   STL  K   +DVCS+CHPFY G        GR ++FNK+  A+
  S:     1 MKEGIHPKYEVISATC-SCGNEFETSSTL-CKNIHLDVCSACHPFYTGKQKILDTGGRVDRFNKRFGAL 67
>gi|77972983|ref|ZP_00828537.1| COG0254: Ribosomal protein L31 [Yersinia frederiksenii ATCC 33641] (71 aa)
Score = 115, Expect = 1.3e-04, Identities = 24/65 (36%), Positives = 38/65 (58%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H K ++V+ +C SC +   + ST+   + ++DVC  CHPFY G        GR ++FNK+
  S:     1 MKQGIHPKYDQVTASC-SCGNVIKINSTVG-HDLNLDVCGECHPFYTGKQRDVATGGRVDRFNKR 63
>gi|170728745|ref|YP_001762771.1| ribosomal protein L31 [Shewanella woodyi ATCC 51908] >gi|169814092|gb|ACA88676.1| ribosomal protein L31 [Shewanella woodyi ATCC 51908] (70 aa)
Score = 115, Expect = 1.3e-04, Identities = 27/72 (37%), Positives = 39/72 (54%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQE 74
           MK   H +  E++  C +C +   V ST   K   +DVC +CHPFY GT       GR +KFNK+  A+ ++
  S:     1 MKPGIHPEYAEITATC-TCGNVIKVNSTAG-KSLHLDVCGACHPFYTGTQKIVDTGGRIDKFNKRFGALGKK 70
>gi|15791543|ref|NP_281366.1| 50S ribosomal protein L31 [Campylobacter jejuni subsp. jejuni NCTC 11168] >gi|57237163|ref|YP_178175.1| 50S ribosomal protein L31 [Campylobacter jejuni RM1221] >gi|86149509|ref|ZP_01067739.1| ribosomal protein L31 [Campylobacter jejuni subsp. jejuni CF93-6] >gi|86151409|ref|ZP_01069624.1| ribosomal protein L31 [Campylobacter jejuni subsp. jejuni 260.94] >gi|86153881|ref|ZP_01072084.1| ribosomal protein L31 [Campylobacter jejuni subsp. jejuni HB93-13] >gi|88597311|ref|ZP_01100546.1| ribosomal protein L31 [Campylobacter jejuni subsp. jejuni 84-25] >gi|121612224|ref|YP_999880.1| 50S ribosomal protein L31 [Campylobacter jejuni subsp. jejuni 81-176] >gi|148926324|ref|ZP_01810008.1| 50S ribosomal protein L31 [Campylobacter jejuni subsp. jejuni CG8486] >gi|157414472|ref|YP_001481728.1| 50S ribosomal protein L31 [Campylobacter jejuni subsp. jejuni 81116] >gi|167004846|ref|ZP_02270604.1| 50S ribosomal protein L31 [Campylobacter jejuni subsp. jejuni 81-176] >gi|17433255|sp|Q9PIX2|RL31_CAMJE 50S ribosomal protein L31 >gi|73621784|sp|Q5HX10|RL31_CAMJR 50S ribosomal protein L31 >gi|57165967|gb|AAW34746.1| ribosomal protein L31 [Campylobacter jejuni RM1221] >gi|85839777|gb|EAQ57036.1| ribosomal protein L31 [Campylobacter jejuni subsp. jejuni CF93-6] >gi|85841756|gb|EAQ59003.1| ribosomal protein L31 [Campylobacter jejuni subsp. jejuni 260.94] >gi|85842842|gb|EAQ60054.1| ribosomal protein L31 [Campylobacter jejuni subsp. jejuni HB93-13] >gi|87250223|gb|EAQ73181.1| ribosomal protein L31 [Campylobacter jejuni subsp. jejuni 81-176] >gi|88190372|gb|EAQ94346.1| ribosomal protein L31 [Campylobacter jejuni subsp. jejuni 84-25] >gi|112359542|emb|CAL34326.1| 50S ribosomal protein L31 [Campylobacter jejuni subsp. jejuni NCTC 11168] >gi|145844716|gb|EDK21821.1| 50S ribosomal protein L31 [Campylobacter jejuni subsp. jejuni CG8486] >gi|157385436|gb|ABV51751.1| 50S ribosomal protein L31 [Campylobacter jejuni subsp. jejuni 81116] (66 aa)
Score = 114, Expect = 1.3e-04, Identities = 30/65 (46%), Positives = 38/65 (58%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MKKE H +  E   +CA C +TF  KS  N  E  +D+CS+CHPF+ G+       GR EKF KK
  S:     1 MKKEIHPEYVECKVSCA-CGNTFTTKS--NKAELRVDICSNCHPFFTGSEKIVDAAGRVEKFKKK 62
>gi|167629005|ref|YP_001679504.1| 50S ribosomal protein l31 [Heliobacterium modesticaldum Ice1] >gi|167591745|gb|ABZ83493.1| 50S ribosomal protein l31 [Heliobacterium modesticaldum Ice1] (65 aa)
Score = 114, Expect = 1.3e-04, Identities = 27/65 (41%), Positives = 39/65 (60%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H +++    +CA C  +F   ST   KE  +DVCS CHPF+ G S + +V GR ++F KK
  S:     1 MKEGIHPQVHRAKVHCA-CGESFETTST--RKEIKVDVCSKCHPFFTGKSRTVEVGGRVDRFKKK 62
>gi|156935930|ref|YP_001439846.1| 50S ribosomal protein L31 [Enterobacter sakazakii ATCC BAA-894] >gi|156534184|gb|ABU79010.1| hypothetical protein ESA_03824 [Enterobacter sakazakii ATCC BAA-894] (70 aa)
Score = 114, Expect = 1.4e-04, Identities = 25/65 (38%), Positives = 38/65 (58%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MKK+ H K  E++  C SC +    +ST+   + ++DVC +CHPF+ G        GR E+FNK+
  S:     1 MKKDIHPKYVEITATC-SCGNVIKTRSTVG-HDLNLDVCGNCHPFFTGKQRVVDTGGRVERFNKR 63
>gi|89093510|ref|ZP_01166458.1| ribosomal protein L31 [Oceanospirillum sp. MED92] >gi|89082200|gb|EAR61424.1| ribosomal protein L31 [Oceanospirillum sp. MED92] (71 aa)
Score = 114, Expect = 1.5e-04, Identities = 27/65 (41%), Positives = 37/65 (56%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK   H +  E++  C SC +    KSTL  K+  +DVCS+CHPFY G        GR ++FNK+
  S:     1 MKAGIHPEYTEINATC-SCGNVVKTKSTLG-KDLHLDVCSACHPFYTGKQKEATSGGRIDRFNKR 63
>gi|77163778|ref|YP_342303.1| ribosomal protein L31 [Nitrosococcus oceani ATCC 19707] >gi|148878603|sp|Q3JEH3|RL31_NITOC 50S ribosomal protein L31 >gi|76882092|gb|ABA56773.1| LSU ribosomal protein L31P [Nitrosococcus oceani ATCC 19707] (68 aa)
Score = 114, Expect = 1.6e-04, Identities = 25/65 (38%), Positives = 40/65 (61%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           M+++ H K +E++  C SC ++F  +ST   K+  I+VCS+CHPFY G        GR +KF ++
  S:     1 MRQDIHPKYSEITVTC-SCGNSFSTRSTAG-KDFHIEVCSACHPFYTGKQKLLDTAGRVDKFRQR 63
>gi|85060143|ref|YP_455845.1| 50S ribosomal protein L31 [Sodalis glossinidius str. 'morsitans'] >gi|148878622|sp|Q2NQY5|RL31_SODGM 50S ribosomal protein L31 >gi|84780663|dbj|BAE75440.1| 50S ribosomal protein L31 [Sodalis glossinidius str. 'morsitans'] (71 aa)
Score = 114, Expect = 1.6e-04, Identities = 23/65 (35%), Positives = 37/65 (56%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           M+K+ H    E++  C SC +    +ST+   + ++DVC +CHPFY G        GR ++FNK+
  S:     1 MQKDIHPNYQEITATC-SCGNVIKTRSTVG-HDLNLDVCGACHPFYTGKQRVVDTGGRVDRFNKR 63
>gi|152972731|ref|YP_001337877.1| 50S ribosomal protein L31 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] >gi|110180251|gb|ABG54363.1| ribosomal protein [Klebsiella pneumoniae] >gi|150957580|gb|ABR79610.1| 50S ribosomal subunit protein L31 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] (70 aa)
Score = 114, Expect = 1.6e-04, Identities = 23/65 (35%), Positives = 37/65 (56%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MKK  H   +E++  C SC +   ++ST+   + ++DVC  CHPF+ G        GR ++FNK+
  S:     1 MKKGIHPNYDEITATC-SCGNVMKIRSTVG-HDLNLDVCGKCHPFFTGKQRDVATGGRVDRFNKR 63
>gi|189424092|ref|YP_001951269.1| ribosomal protein L31 [Geobacter lovleyi SZ] >gi|189420351|gb|ACD94749.1| ribosomal protein L31 [Geobacter lovleyi SZ] (66 aa)
Score = 114, Expect = 1.6e-04, Identities = 26/65 (40%), Positives = 38/65 (58%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H   NEV+  CA C ++F+ +ST   KE   ++CS+CHPF+ G        GR E+F K+
  S:     1 MKEGIHPMYNEVTVKCA-CGNSFLTRST--RKEIFTEICSACHPFFTGKQKLVDTAGRVERFKKR 62
>gi|37528573|ref|NP_931918.1| 50S ribosomal protein L31 [Photorhabdus luminescens subsp. laumondii TTO1] >gi|73621812|sp|Q7MYC6|RL31_PHOLL 50S ribosomal protein L31 >gi|36788011|emb|CAE17130.1| 50S ribosomal protein L31 [Photorhabdus luminescens subsp. laumondii TTO1] (71 aa)
Score = 114, Expect = 1.7e-04, Identities = 26/65 (40%), Positives = 34/65 (52%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MKK  H K  E++  C SC S   V+ST      ++DVC  CHPFY G        GR ++F K+
  S:     1 MKKGIHPKYEEITATC-SCGSVIQVRSTAG-HALNLDVCGQCHPFYTGKQRDVATGGRVDRFKKR 63
>gi|54020206|ref|YP_115965.1| 50S ribosomal protein L31 [Mycoplasma hyopneumoniae 232] >gi|71893804|ref|YP_279250.1| 50S ribosomal protein L31 [Mycoplasma hyopneumoniae J] >gi|72080788|ref|YP_287846.1| 50S ribosomal protein L31 [Mycoplasma hyopneumoniae 7448] >gi|53987379|gb|AAV27580.1| 50s ribosomal protein L31 [Mycoplasma hyopneumoniae 232] >gi|71851931|gb|AAZ44539.1| 50S ribosomal protein L31 [Mycoplasma hyopneumoniae J] >gi|71913912|gb|AAZ53823.1| 50S ribosomal protein L31 [Mycoplasma hyopneumoniae 7448] (73 aa)
Score = 114, Expect = 1.7e-04, Identities = 24/64 (37%), Positives = 38/64 (59%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNK 66
           MKK  H    E+  +C++CNS F +KS +  ++ +ID+CS CHP + G     +  GR E+F +
  S:     1 MKKNIHPVQRELLLSCSTCNSEFRIKSVI--EKFTIDICSGCHPQFTGDRSLNRTTGRIERFRR 62
>gi|90022338|ref|YP_528165.1| 50S ribosomal protein L31 [Saccharophagus degradans 2-40] >gi|148878619|sp|Q21H76|RL31_SACD2 50S ribosomal protein L31 >gi|89951938|gb|ABD81953.1| LSU ribosomal protein L31P [Saccharophagus degradans 2-40] (70 aa)
Score = 113, Expect = 1.7e-04, Identities = 24/55 (43%), Positives = 33/55 (60%)
  Q:    20 SCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQE 74
           SC +    +STL  K+  IDVCS CHPFY G   +    GR ++FNK+  A+K +
  S:    17 SCGNVVKTRSTL-AKDIHIDVCSECHPFYTGKQKTADTGGRIDRFNKRFGAIKSK 70
>gi|56461562|ref|YP_156843.1| ribosomal protein L31 [Idiomarina loihiensis L2TR] >gi|73621798|sp|Q5QV44|RL31_IDILO 50S ribosomal protein L31 >gi|56180572|gb|AAV83294.1| Ribosomal protein L31 [Idiomarina loihiensis L2TR] (72 aa)
Score = 113, Expect = 1.8e-04, Identities = 27/72 (37%), Positives = 40/72 (55%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQE 74
           MK+  H K   +  +C SC  TF  +ST  +++  +DVCS CHPFY G        GR +KF K+  A+ ++
  S:     1 MKQGIHPKYETLKVSC-SCGHTFETRST-RSEDLHLDVCSECHPFYTGKQRVMDTGGRVDKFKKRFGALGKK 70
>gi|164688891|ref|ZP_02212919.1| hypothetical protein CLOBAR_02539 [Clostridium bartlettii DSM 16795] >gi|164602095|gb|EDQ95560.1| hypothetical protein CLOBAR_02539 [Clostridium bartlettii DSM 16795] (67 aa)
Score = 113, Expect = 1.9e-04, Identities = 27/66 (40%), Positives = 40/66 (60%)
  Q:     2 IMKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           +M+K+   K NEV   CA C +TF+  ST +  E  +++CS CHPFY G   + +  GR +KF K+
  S:     1 MMQKDIQPKYNEVEVRCA-CGNTFMAGSTKD--EIRVEICSECHPFYTGKQKNIEKGGRIDKFKKR 63
>gi|182435970|ref|YP_001823689.1| putative 50S ribosomal protein L31 [Streptomyces griseus subsp. griseus NBRC 13350] >gi|178464486|dbj|BAG19006.1| putative 50S ribosomal protein L31 [Streptomyces griseus subsp. griseus NBRC 13350] (74 aa)
Score = 113, Expect = 1.9e-04, Identities = 22/65 (33%), Positives = 34/65 (52%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK++ H +  E   +C +C ++F  +ST++      DVCS CHPFY G        GR  +F  +
  S:     1 MKRDIHPEYVETQVSC-TCGASFTTRSTIDNGTIRADVCSECHPFYTGKQKILDTGGRVARFEAR 64
>gi|183602947|ref|ZP_02964292.1| 50S ribosomal protein L31 [Bifidobacterium animalis subsp. lactis HN019] >gi|183217810|gb|EDT88476.1| 50S ribosomal protein L31 [Bifidobacterium animalis subsp. lactis HN019] (68 aa)
Score = 113, Expect = 2.0e-04, Identities = 24/65 (36%), Positives = 35/65 (53%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           M++  H   ++V+  C SC +TF  +ST      ++DVCS CHPFY G        GR  +F K+
  S:     1 MQQGIHPDYHKVTVTC-SCGNTFETRSTAKGDHMTVDVCSKCHPFYTGKQKILDTGGRVARFEKR 64
>gi|57241384|ref|ZP_00369330.1| ribosomal protein L31 [Campylobacter lari RM2100] >gi|57017720|gb|EAL54496.1| ribosomal protein L31 [Campylobacter lari RM2100] (66 aa)
Score = 113, Expect = 2.0e-04, Identities = 30/65 (46%), Positives = 38/65 (58%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MKKE H +  E   +CA C ++F  KS  N  E  +D+CSSCHPF+ G+       GR EKF KK
  S:     1 MKKEIHPEYVECKVSCA-CGNSFTTKS--NKPEIKVDICSSCHPFFTGSEKIVDAAGRVEKFKKK 62
>gi|78221598|ref|YP_383345.1| 50S ribosomal protein L31 [Geobacter metallireducens GS-15] >gi|148878597|sp|Q39YQ4|RL31_GEOMG 50S ribosomal protein L31 >gi|78192853|gb|ABB30620.1| LSU ribosomal protein L31P [Geobacter metallireducens GS-15] (66 aa)
Score = 113, Expect = 2.1e-04, Identities = 28/65 (43%), Positives = 38/65 (58%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H K NEV+  CA C ++F  +ST    E S ++CS+CHPF+ G        GR E+F KK
  S:     1 MKEGIHPKYNEVTVKCA-CGNSFQTRST--RTEISTEICSACHPFFTGKQKLVDTAGRVERFRKK 62
>gi|15828611|ref|NP_325971.1| 50S ribosomal protein L31 [Mycoplasma pulmonis UAB CTIP] >gi|17433228|sp|Q98R70|RL31_MYCPU 50S ribosomal protein L31 >gi|14089553|emb|CAC13313.1| 50S RIBOSOMAL PROTEIN L31 [Mycoplasma pulmonis] (69 aa)
Score = 113, Expect = 2.1e-04, Identities = 23/66 (34%), Positives = 41/66 (62%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKV 68
           M+K+ H+K+  +   C++C ++F + S+   K  +ID+CS CHPFY G     +  G+ +KF K++
  S:     1 MQKDIHLKMEPLKITCSTCFTSFDIVSS--RKTIAIDICSKCHPFYTGDRTLAKATGQIDKFQKRL 64
>gi|154148107|ref|YP_001405830.1| 50S ribosomal protein L31 [Campylobacter hominis ATCC BAA-381] >gi|153804116|gb|ABS51123.1| ribosomal protein L31 [Campylobacter hominis ATCC BAA-381] (66 aa)
Score = 113, Expect = 2.1e-04, Identities = 30/65 (46%), Positives = 37/65 (56%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MKK+ H    E +  CA C +TF  +S  N  E  +DVCS CHPF+ G+       GR EKFNKK
  S:     1 MKKDIHPNYVECTVACA-CGNTFKTRS--NKPEIKVDVCSKCHPFFTGSEKIVDSAGRVEKFNKK 62
>gi|95929015|ref|ZP_01311760.1| ribosomal protein L31 [Desulfuromonas acetoxidans DSM 684] >gi|95134916|gb|EAT16570.1| ribosomal protein L31 [Desulfuromonas acetoxidans DSM 684] (69 aa)
Score = 113, Expect = 2.2e-04, Identities = 26/65 (40%), Positives = 38/65 (58%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTK-ETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H K  EV+  C  C ++F  +ST +   E + ++CS+CHPFY GT       GR E+F K+
  S:     1 MKEGIHPKYEEVTVKC-HCGNSFQTRSTYDKGGELTTEICSACHPFYTGTQKLLDTAGRIERFRKR 65
>gi|73541808|ref|YP_296328.1| 50S ribosomal protein L31 type B [Ralstonia eutropha JMP134] >gi|148878579|sp|Q46ZE9|RL31B_RALEJ 50S ribosomal protein L31 type B >gi|72119221|gb|AAZ61484.1| LSU ribosomal protein L31P [Ralstonia eutropha JMP134] (86 aa)
Score = 113, Expect = 2.2e-04, Identities = 29/65 (44%), Positives = 38/65 (58%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET-----------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H    EV F   SC+ +F+ +ST+ TK+T            I+V S  HPFY GT       GR EKF +K
  S:     1 MKEGIHPNYREVVFQDMSCDFSFITRSTIQTKDTIVKDGKEYPLAKIEVSSESHPFYTGTQKIMDTAGRVEKFRQK 76
>gi|94967059|ref|YP_589107.1| 50S ribosomal protein L31P [Acidobacteria bacterium Ellin345] >gi|124056499|sp|Q1IVR7|RL31_ACIBL 50S ribosomal protein L31 >gi|94549109|gb|ABF39033.1| LSU ribosomal protein L31P [Acidobacteria bacterium Ellin345] (74 aa)
Score = 112, Expect = 2.2e-04, Identities = 25/75 (33%), Positives = 40/75 (53%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQEPTK 77
           MK  TH   +EV   CA C ++F  +ST +  +  +++CS+CHPF+ G        GR E+F +K     ++  K
  S:     1 MKTATHPSYDEVRVQCA-CGNSFATRST-HKGDIHVEICSACHPFFTGKQKLMDTAGRVERFRRKYAKADKQADK 73
>gi|194334660|ref|YP_002016520.1| ribosomal protein L31 [Prosthecochloris aestuarii DSM 271] >gi|194312478|gb|ACF46873.1| ribosomal protein L31 [Prosthecochloris aestuarii DSM 271] (72 aa)
Score = 112, Expect = 2.2e-04, Identities = 25/65 (38%), Positives = 39/65 (60%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK++ H K  +V+  CA+C   F  +ST ++    +D+CS+CHPFY G  +     GR E+F K+
  S:     1 MKQDIHPKYTKVTVTCANCGKDFETRSTRSS--IKVDICSNCHPFYTGKQVLVDTAGRVERFKKR 63
>gi|87309294|ref|ZP_01091430.1| 50S ribosomal protein L31 [Blastopirellula marina DSM 3645] >gi|87287933|gb|EAQ79831.1| 50S ribosomal protein L31 [Blastopirellula marina DSM 3645] (79 aa)
Score = 112, Expect = 2.3e-04, Identities = 27/66 (40%), Positives = 37/66 (56%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKV 68
           MK++ H +  E +  C  C ++F  +ST   KE  +DVCS+CHPFY G        GR EKF  K+
  S:     1 MKEKIHPRYEEAAVKCG-CGNSFTTRST--RKEIVVDVCSACHPFYTGKLKFVDSGGRIEKFKNKI 63
>gi|47458963|ref|YP_015825.1| 50S ribosomal protein L31 [Mycoplasma mobile 163K] >gi|73621806|sp|Q6KIG2|RL31_MYCMO 50S ribosomal protein L31 >gi|47458291|gb|AAT27614.1| ribosomal protein l31 [Mycoplasma mobile 163K] (70 aa)
Score = 112, Expect = 2.3e-04, Identities = 23/66 (34%), Positives = 40/66 (60%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKV 68
           MK   H +   ++  C++C    +  ST   K++S+DVCS+CHPF+ G    Q+  GR ++FN+++
  S:     1 MKPNIHPEYKNITLTCSTCEKKHIFGST--AKKSSVDVCSNCHPFFTGDRSIQRTTGRVDRFNRRL 64
>gi|59712880|ref|YP_205656.1| 50S ribosomal protein L31 [Vibrio fischeri ES114] >gi|163730285|ref|ZP_02137760.1| 50S ribosomal protein L31 [Vibrio fischeri MJ11] >gi|73621830|sp|Q5E2H8|RL31_VIBF1 50S ribosomal protein L31 >gi|59480981|gb|AAW86768.1| 50S ribosomal subunit protein L31 [Vibrio fischeri ES114] >gi|161396437|gb|EDQ20731.1| 50S ribosomal protein L31 [Vibrio fischeri MJ11] (72 aa)
Score = 112, Expect = 2.3e-04, Identities = 25/69 (36%), Positives = 32/69 (46%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAV 71
           MK   H +   V   C SC + F   S L      +DVC  CHPFY G        GR ++FNK+  A+
  S:     1 MKVGIHPEYTAVKATC-SCGNEFEFNSALGKDSIHLDVCDKCHPFYTGKQRIVDTGGRVDRFNKRFGAI 68
>gi|152991816|ref|YP_001357537.1| 50S ribosomal protein L31 [Sulfurovum sp. NBC37-1] >gi|151423677|dbj|BAF71180.1| 50S ribosomal protein L31 [Sulfurovum sp. NBC37-1] (66 aa)
Score = 112, Expect = 2.3e-04, Identities = 27/65 (41%), Positives = 36/65 (55%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           M+K  H +  E    CA C + F V+S  N  E SID+C+ CHPF+ G+       GR +KF KK
  S:     1 MRKGIHPEYMECKVTCA-CGNKFEVRS--NKPEMSIDICNECHPFFTGSEKILDAAGRVDKFKKK 62
>gi|68249354|ref|YP_248466.1| 50S ribosomal protein L31 [Haemophilus influenzae 86-028NP] >gi|81336221|sp|Q4QME1|RL31_HAEI8 50S ribosomal protein L31 >gi|68057553|gb|AAX87806.1| 50S ribosomal protein L31 [Haemophilus influenzae 86-028NP] (70 aa)
Score = 112, Expect = 2.4e-04, Identities = 26/65 (40%), Positives = 37/65 (56%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H +  EV+  C SC +    +STL  K+ ++DVC +CHPFY G        GR E+FN +
  S:     1 MKQGIHPEYKEVTATC-SCGNVIKTRSTLG-KDINLDVCGNCHPFYTGKQRVVDTGGRVERFNSR 63
>gi|163750998|ref|ZP_02158230.1| ribosomal protein L31 [Shewanella benthica KT99] >gi|161329288|gb|EDQ00286.1| ribosomal protein L31 [Shewanella benthica KT99] (70 aa)
Score = 112, Expect = 2.5e-04, Identities = 26/72 (36%), Positives = 38/72 (52%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQE 74
           MK   H    E++  C +C +   + ST   K   +DVC +CHPFY GT       GR +KFNK+  A+ ++
  S:     1 MKTGIHPDYAEITATC-TCGNVIKINSTAG-KSLHLDVCGACHPFYTGTQKIVDTGGRIDKFNKRFGALGKK 70
>gi|187251337|ref|YP_001875819.1| ribosomal protein L31 [Elusimicrobium minutum Pei191] >gi|186971497|gb|ACC98482.1| ribosomal protein L31 [Elusimicrobium minutum Pei191] (115 aa)
Score = 112, Expect = 2.5e-04, Identities = 27/65 (41%), Positives = 39/65 (60%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK++ H K  +V   CA C + F+ +ST+ T    +D+CS CHPF+ G       +GR +KFNKK
  S:     1 MKEKIHPKYEQVEVVCA-CGAKFMTRSTMKT--IKLDICSECHPFFTGKQKMLDTEGRVDKFNKK 62
>gi|119715985|ref|YP_922950.1| 50S ribosomal protein L31 [Nocardioides sp. JS614] >gi|119536646|gb|ABL81263.1| LSU ribosomal protein L31P [Nocardioides sp. JS614] (75 aa)
Score = 112, Expect = 2.5e-04, Identities = 24/65 (36%), Positives = 31/65 (47%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MKK+ H    E    C +C +TF  +ST  +     DVCS CHPFY G        GR  +F  +
  S:     1 MKKDIHPAYVETQVTC-TCGATFTTRSTATSGTIHADVCSQCHPFYTGKQKILDTGGRVARFEAR 64
>gi|161505405|ref|YP_001572517.1| hypothetical protein SARI_03560 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] >gi|160866752|gb|ABX23375.1| hypothetical protein SARI_03560 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] (99 aa)
Score = 112, Expect = 2.6e-04, Identities = 24/65 (36%), Positives = 34/65 (52%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MKK  H    E++  C SC +     ST+   + ++DVC  CHPF+ G        GR E+FNK+
  S:    30 MKKGIHPNYVEITATC-SCGNVIKTHSTVG-HDLNLDVCGKCHPFFTGKQRVVDTGGRVERFNKR 92
>gi|126701110|ref|YP_001090007.1| 50S ribosomal protein L31 [Clostridium difficile 630] >gi|145952641|ref|ZP_01801650.1| hypothetical protein CdifQ_04004017 [Clostridium difficile QCD-32g58] >gi|168697776|ref|ZP_02730053.1| 50S ribosomal protein L31 [Clostridium difficile QCD-37x79] >gi|168714953|ref|ZP_02747230.1| 50S ribosomal protein L31 [Clostridium difficile QCD-63q42] >gi|168726411|ref|ZP_02758688.1| 50S ribosomal protein L31 [Clostridium difficile QCD-76w55] >gi|168730143|ref|ZP_02762420.1| 50S ribosomal protein L31 [Clostridium difficile QCD-97b34] >gi|196124994|ref|ZP_03116743.1| 50S ribosomal protein L31 [Clostridium difficile ATCC 43255] >gi|196162305|ref|ZP_03122866.1| 50S ribosomal protein L31 [Clostridium difficile CIP 107932] >gi|196164012|ref|ZP_03124543.1| 50S ribosomal protein L31 [Clostridium difficile QCD-23m63] >gi|118572985|sp|Q180Y7|RL31_CLOD6 50S ribosomal protein L31 >gi|115252547|emb|CAJ70390.1| 50S ribosomal protein L31 [Clostridium difficile 630] (66 aa)
Score = 112, Expect = 2.7e-04, Identities = 28/65 (43%), Positives = 38/65 (58%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           M+KE   K N V   CA C +TFV  ST +  E  +++CS CHPFY G   + +  GR +KF K+
  S:     1 MQKEIQPKYNPVEVRCA-CGNTFVAGSTKD--EIKVEICSECHPFYTGKQKNIEKGGRIDKFKKR 62
>gi|91794702|ref|YP_564353.1| 50S ribosomal protein L31 [Shewanella denitrificans OS217] >gi|91716704|gb|ABE56630.1| ribosomal protein L31 [Shewanella denitrificans OS217] (70 aa)
Score = 112, Expect = 2.7e-04, Identities = 26/65 (40%), Positives = 34/65 (52%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK   H    E++  C +C +   V ST   K   +DVC +CHPFY GT       GR +KFNK+
  S:     1 MKPGIHPTYAEITATC-TCGNIIKVNSTAG-KSLHLDVCGACHPFYTGTQKVVDTGGRIDKFNKR 63
>gi|77956369|ref|ZP_00820474.1| COG0254: Ribosomal protein L31 [Yersinia bercovieri ATCC 43970] >gi|77960053|ref|ZP_00823951.1| COG0254: Ribosomal protein L31 [Yersinia mollaretii ATCC 43969] (72 aa)
Score = 112, Expect = 2.7e-04, Identities = 24/65 (36%), Positives = 37/65 (56%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H K + V+ +C SC +   + ST+   + ++DVC  CHPFY G        GR ++FNK+
  S:     1 MKQGIHPKYDLVTASC-SCGNVIKINSTVG-HDLNLDVCGECHPFYTGKQRDVATGGRVDRFNKR 63
>gi|16272699|ref|NP_438917.1| 50S ribosomal protein L31 [Haemophilus influenzae Rd KW20] >gi|42630408|ref|ZP_00155952.1| COG0254: Ribosomal protein L31 [Haemophilus influenzae R2846] >gi|42631076|ref|ZP_00156614.1| COG0254: Ribosomal protein L31 [Haemophilus influenzae R2866] >gi|145628357|ref|ZP_01784158.1| 50S ribosomal protein L31 [Haemophilus influenzae 22.1-21] >gi|145630501|ref|ZP_01786281.1| 50S ribosomal protein L31 [Haemophilus influenzae 22.4-21] >gi|145636686|ref|ZP_01792353.1| 50S ribosomal protein L31 [Haemophilus influenzae PittHH] >gi|145638445|ref|ZP_01794055.1| 50S ribosomal protein L31 [Haemophilus influenzae PittII] >gi|145640843|ref|ZP_01796425.1| 50S ribosomal protein L31 [Haemophilus influenzae R3021] >gi|148826598|ref|YP_001291351.1| 50S ribosomal protein L31 [Haemophilus influenzae PittEE] >gi|148827948|ref|YP_001292701.1| 50S ribosomal protein L31 [Haemophilus influenzae PittGG] >gi|1173025|sp|P44367|RL31_HAEIN 50S ribosomal protein L31 >gi|1573767|gb|AAC22417.1| ribosomal protein L31 (rpL31) [Haemophilus influenzae Rd KW20] >gi|144980132|gb|EDJ89791.1| 50S ribosomal protein L31 [Haemophilus influenzae 22.1-21] >gi|144983891|gb|EDJ91333.1| 50S ribosomal protein L31 [Haemophilus influenzae R3021] >gi|145270212|gb|EDK10148.1| 50S ribosomal protein L31 [Haemophilus influenzae PittHH] >gi|145272774|gb|EDK12681.1| 50S ribosomal protein L31 [Haemophilus influenzae PittII] >gi|145274357|gb|EDK14221.1| 50S ribosomal protein L31 [Haemophilus influenzae 22.4-21] >gi|148716758|gb|ABQ98968.1| 50S ribosomal protein L31 [Haemophilus influenzae PittEE] >gi|148719190|gb|ABR00318.1| 50S ribosomal protein L31 [Haemophilus influenzae PittGG] (70 aa)
Score = 112, Expect = 2.7e-04, Identities = 25/65 (38%), Positives = 37/65 (56%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H +  E++  C SC +    +STL  K+ ++DVC +CHPFY G        GR E+FN +
  S:     1 MKQGIHPEYKEITATC-SCGNVIKTRSTLG-KDINLDVCGNCHPFYTGKQRVVDTGGRVERFNSR 63
>gi|50123177|ref|YP_052344.1| 50S ribosomal protein L31 [Pectobacterium atrosepticum SCRI1043] >gi|73621791|sp|Q6CZ96|RL31_ERWCT 50S ribosomal protein L31 >gi|49613703|emb|CAG77154.1| 50S ribosomal protein L31 [Erwinia carotovora subsp. atroseptica SCRI1043] (71 aa)
Score = 112, Expect = 2.9e-04, Identities = 25/65 (38%), Positives = 36/65 (55%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MKK  H   +EV+  C SC +     ST+  ++ ++DVC  CHPFY G        GR ++FNK+
  S:     1 MKKGIHPNYSEVTVTC-SCGNVIKTHSTVG-RDLNLDVCGECHPFYTGKQRDVASGGRVDRFNKR 63
>gi|145632111|ref|ZP_01787846.1| 50S ribosomal protein L31 [Haemophilus influenzae 3655] >gi|145634831|ref|ZP_01790539.1| 50S ribosomal protein L31 [Haemophilus influenzae PittAA] >gi|144987018|gb|EDJ93548.1| 50S ribosomal protein L31 [Haemophilus influenzae 3655] >gi|145267997|gb|EDK07993.1| 50S ribosomal protein L31 [Haemophilus influenzae PittAA] (70 aa)
Score = 111, Expect = 2.9e-04, Identities = 25/65 (38%), Positives = 37/65 (56%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H +  E++  C SC +    +STL  K+ ++DVC +CHPFY G        GR E+FN +
  S:     1 MKQGIHPEYKEITATC-SCGNVIKTRSTLG-KDINLDVCGNCHPFYTGKQRVVDTGGRVERFNSR 63
>gi|123440509|ref|YP_001004503.1| 50S ribosomal protein L31 [Yersinia enterocolitica subsp. enterocolitica 8081] >gi|122087470|emb|CAL10251.1| 50S ribosomal protein L31 [Yersinia enterocolitica subsp. enterocolitica 8081] (72 aa)
Score = 111, Expect = 2.9e-04, Identities = 24/65 (36%), Positives = 37/65 (56%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H K + V+ +C SC +   + ST+   + ++DVC  CHPFY G        GR ++FNK+
  S:     1 MKQGIHPKYDLVTASC-SCGNVIKINSTVG-HDLNLDVCGECHPFYTGKQRDVATGGRVDRFNKR 63
>gi|77976268|ref|ZP_00831773.1| COG0254: Ribosomal protein L31 [Yersinia intermedia ATCC 29909] (71 aa)
Score = 111, Expect = 2.9e-04, Identities = 24/65 (36%), Positives = 37/65 (56%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H K + V+ +C SC +   + ST+   + ++DVC  CHPFY G        GR ++FNK+
  S:     1 MKQGIHPKYDLVTASC-SCGNVIKINSTVG-HDLNLDVCGECHPFYTGKQRDVATGGRVDRFNKR 63
>gi|110601337|ref|ZP_01389529.1| ribosomal protein L31 [Geobacter sp. FRC-32] >gi|110547970|gb|EAT61204.1| ribosomal protein L31 [Geobacter sp. FRC-32] (65 aa)
Score = 111, Expect = 3.0e-04, Identities = 26/65 (40%), Positives = 37/65 (56%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           M++  H K NEV+  C  C +TF  +ST    E S ++CS+CHPF+ G        GR E+F K+
  S:     1 MREGIHPKYNEVTVKCL-CGNTFQTRST--KPEISTEICSACHPFFTGKQKLVDTAGRVERFKKR 62
>gi|85711527|ref|ZP_01042585.1| Ribosomal protein L31 [Idiomarina baltica OS145] >gi|85694679|gb|EAQ32619.1| Ribosomal protein L31 [Idiomarina baltica OS145] (70 aa)
Score = 111, Expect = 3.1e-04, Identities = 26/65 (40%), Positives = 34/65 (52%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H K   +   C SC + F  +ST   ++  IDVCS CHPFY G        GR +KF K+
  S:     1 MKQGIHPKYEAIKVTC-SCGNEFETRST-RVEDLHIDVCSECHPFYTGKQRVMDTGGRVDKFKKR 63
>gi|62130188|gb|AAX67891.1| 50S ribosomal subunit protein L31 [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] (103 aa)
Score = 111, Expect = 3.1e-04, Identities = 24/65 (36%), Positives = 34/65 (52%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MKK  H    E++  C SC +     ST+   + ++DVC  CHPF+ G        GR E+FNK+
  S:    34 MKKGIHPNYVEITATC-SCGNVIKTHSTVG-HDLNLDVCGKCHPFFTGKQRVVDTGGRVERFNKR 96
>gi|118572984|sp|Q1LTT8|RL31_BAUCH 50S ribosomal protein L31 (75 aa)
Score = 111, Expect = 3.2e-04, Identities = 27/65 (41%), Positives = 38/65 (58%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           M+K  H K  E+   C SC +     STL+ +  ++DVCS+CHPFY G       +GR E+FNK+
  S:     1 MQKNIHPKYFEIRAIC-SCGNIIPTYSTLD-QHLNLDVCSACHPFYTGKQRRVNTRGRVERFNKR 63
>gi|119474650|ref|ZP_01615003.1| 50S ribosomal protein L31 [marine gamma proteobacterium HTCC2143] >gi|119450853|gb|EAW32086.1| 50S ribosomal protein L31 [marine gamma proteobacterium HTCC2143] (71 aa)
Score = 111, Expect = 3.3e-04, Identities = 26/65 (40%), Positives = 38/65 (58%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           M+ + H K  E++  C SC +    +STL  K+  +DVCS+CHPFY G        GR ++FNK+
  S:     1 MQNDIHPKYEEMTATC-SCGNQVKTRSTLG-KDMHLDVCSACHPFYTGKQKMLDSGGRVDRFNKR 63
>gi|152965224|ref|YP_001361008.1| ribosomal protein L31 [Kineococcus radiotolerans SRS30216] >gi|151359741|gb|ABS02744.1| ribosomal protein L31 [Kineococcus radiotolerans SRS30216] (82 aa)
Score = 111, Expect = 3.3e-04, Identities = 24/67 (35%), Positives = 35/67 (52%)
  Q:     1 MIMKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           + MK   H +  E +  C +C STF  +ST  + +   DVCS+CHPFY G        GR  +F ++
  S:     9 ITMKAGIHPEYVETTVTC-TCGSTFTTRSTEKSGQLRADVCSACHPFYTGKQKILDTGGRVARFQQR 74
>gi|167556912|ref|ZP_02349925.1| hypothetical protein Sententeri_08669 [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853] >gi|168222643|ref|ZP_02647875.1| hypothetical protein Senterenterica_19751 [Salmonella enterica subsp. enterica serovar Agona str. SL483] >gi|168227196|ref|ZP_02652427.1| hypothetical protein Sententeric_15586 [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433] >gi|168237724|ref|ZP_02662782.1| hypothetical protein Senteenterica_16176 [Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480] >gi|168821549|ref|ZP_02833549.1| hypothetical protein Salentericaenterica_19342 [Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537] (99 aa)
Score = 111, Expect = 3.4e-04, Identities = 24/65 (36%), Positives = 34/65 (52%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MKK  H    E++  C SC +     ST+   + ++DVC  CHPF+ G        GR E+FNK+
  S:    30 MKKGIHPNYVEITATC-SCGNVIKTHSTVG-HDLNLDVCGKCHPFFTGKQRVVDTGGRVERFNKR 92
>gi|153093534|gb|EDN74514.1| ribosomal protein L31 [Mannheimia haemolytica PHL213] (70 aa)
Score = 111, Expect = 3.5e-04, Identities = 25/65 (38%), Positives = 38/65 (58%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H +  E++  C SC +    +ST+  K+ ++DVC +CHPFY G        GR E+FNK+
  S:     1 MKQGIHPEYKEITATC-SCGNVVKTRSTVG-KDLNLDVCGNCHPFYTGKQRVVDTGGRVERFNKR 63
>gi|147679167|ref|YP_001213382.1| 50S ribosomal protein L31 [Pelotomaculum thermopropionicum SI] >gi|146275264|dbj|BAF61013.1| ribosomal protein L31 [Pelotomaculum thermopropionicum SI] (67 aa)
Score = 111, Expect = 3.6e-04, Identities = 27/65 (41%), Positives = 35/65 (53%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MKK  H    +   +C  C  TF   ST   KE  +++CS CHPFY G+    +  GRAE+F KK
  S:     1 MKKNIHPNYGKARVSCV-CGETFETGST--KKELRVEICSKCHPFYTGSQRMIETGGRAERFRKK 62
>gi|67158011|ref|ZP_00419101.1| Ribosomal protein L31 [Azotobacter vinelandii AvOP] >gi|67084994|gb|EAM04471.1| Ribosomal protein L31 [Azotobacter vinelandii AvOP] (70 aa)
Score = 111, Expect = 3.7e-04, Identities = 26/65 (40%), Positives = 34/65 (52%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK + H    E+   C SC +    +STL  K  SIDVCS CHPFY G        GR ++F ++
  S:     1 MKADIHPNYVEIEATC-SCGNVIKTRSTLG-KNISIDVCSECHPFYTGKQKVLDTGGRIDRFKQR 63
>gi|183597331|ref|ZP_02958824.1| hypothetical protein PROSTU_00584 [Providencia stuartii ATCC 25827] >gi|188023354|gb|EDU61394.1| hypothetical protein PROSTU_00584 [Providencia stuartii ATCC 25827] (71 aa)
Score = 111, Expect = 3.7e-04, Identities = 26/65 (40%), Positives = 35/65 (53%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MKK  H K  EV+  C SC +   + ST      ++DVC +CHPFY G        GR ++FNK+
  S:     1 MKKGIHPKYEEVTATC-SCGNVMKINSTAG-HSLNLDVCGNCHPFYTGKQRDVATGGRVDRFNKR 63
>gi|153869397|ref|ZP_01999018.1| Ribosomal protein L31 [Beggiatoa sp. PS] >gi|152074095|gb|EDN70990.1| Ribosomal protein L31 [Beggiatoa sp. PS] (72 aa)
Score = 111, Expect = 3.7e-04, Identities = 26/65 (40%), Positives = 39/65 (60%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK++TH    E++  C SC ++F   ST N K+  I++CS+CHPFY G        GR +KF ++
  S:     1 MKQKTHPSYKEITVTC-SCGNSFTTCST-NHKDLQIEICSACHPFYTGQQKIIDTAGRVDKFRRR 63
>gi|155675816|gb|ABU25216.1| ribosomal protein 31 [Pasteurella multocida] (70 aa)
Score = 111, Expect = 3.8e-04, Identities = 26/65 (40%), Positives = 37/65 (56%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H    EV+  C SC +    +ST+  K+ ++DVC +CHPFY G        GR E+FNK+
  S:     1 MKQGIHPNYVEVTATC-SCGNVIKTRSTVG-KDLNLDVCGNCHPFYTGKQRIVDTGGRVERFNKR 63
>gi|126666723|ref|ZP_01737700.1| ribosomal protein L31 [Marinobacter sp. ELB17] >gi|126628768|gb|EAZ99388.1| ribosomal protein L31 [Marinobacter sp. ELB17] (74 aa)
Score = 110, Expect = 3.8e-04, Identities = 23/65 (35%), Positives = 35/65 (53%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H K   ++  C SC +    +ST+  ++  +DVCS CHPFY G        GR ++F K+
  S:     1 MKEGIHPKYENIAATC-SCGNVIHTRSTVG-RDLQLDVCSQCHPFYTGKQKVMDTGGRIDRFQKR 63
>gi|90408133|ref|ZP_01216302.1| ribosomal protein L31 [Psychromonas sp. CNPT3] >gi|90310745|gb|EAS38861.1| ribosomal protein L31 [Psychromonas sp. CNPT3] (70 aa)
Score = 110, Expect = 3.8e-04, Identities = 24/65 (36%), Positives = 36/65 (55%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK   H +  E++  C SC +   + ST+  K+ ++D+C  CHPFY GT       GR +KF K+
  S:     1 MKNAIHPEYKEINATC-SCGNVVTIGSTV-CKDITLDICGECHPFYTGTQRVVDTGGRIDKFKKR 63
>gi|15603007|ref|NP_246079.1| 50S ribosomal protein L31 [Pasteurella multocida subsp. multocida str. Pm70] >gi|17433237|sp|Q9CLR7|RL31_PASMU 50S ribosomal protein L31 >gi|12721489|gb|AAK03226.1| RpL31 [Pasteurella multocida subsp. multocida str. Pm70] (70 aa)
Score = 110, Expect = 3.8e-04, Identities = 26/65 (40%), Positives = 37/65 (56%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H    EV+  C SC +    +ST+  K+ ++DVC +CHPFY G        GR E+FNK+
  S:     1 MKQGIHPNYVEVTATC-SCGNVIKTRSTVG-KDLNLDVCGNCHPFYTGKQRVVDTGGRVERFNKR 63
>gi|120553756|ref|YP_958107.1| ribosomal protein L31 [Marinobacter aquaeolei VT8] >gi|120323605|gb|ABM17920.1| LSU ribosomal protein L31P [Marinobacter aquaeolei VT8] (73 aa)
Score = 110, Expect = 3.9e-04, Identities = 23/65 (35%), Positives = 35/65 (53%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H K  +++  C SC +    +ST+   +  +DVCS CHPFY G        GR ++F K+
  S:     1 MKEGIHPKYEDITATC-SCGNVIKTRSTIG-HDLQLDVCSQCHPFYTGKQKVMDTGGRIDRFQKR 63
>gi|118572990|sp|Q2S9P7|RL31_HAHCH 50S ribosomal protein L31 (72 aa)
Score = 110, Expect = 4.0e-04, Identities = 27/65 (41%), Positives = 36/65 (55%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H +  E++  C SC +    KSTL  +   IDVCSSCHPFY G        GR ++F K+
  S:     1 MKQGIHPEYKEITATC-SCGNIIKTKSTL-CENIHIDVCSSCHPFYTGKQKVLDTGGRIDRFKKR 63
>gi|145637012|ref|ZP_01792676.1| 50S ribosomal protein L31 [Haemophilus influenzae PittHH] >gi|145642434|ref|ZP_01797989.1| formamidopyrimidine-DNA glycosylase [Haemophilus influenzae R3021] >gi|145269870|gb|EDK09809.1| 50S ribosomal protein L31 [Haemophilus influenzae PittHH] >gi|145272872|gb|EDK12763.1| formamidopyrimidine-DNA glycosylase [Haemophilus influenzae 22.4-21] (72 aa)
Score = 110, Expect = 4.0e-04, Identities = 26/65 (40%), Positives = 37/65 (56%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H    EV+  C SC +    +ST+  K+ ++DVC +CHPFY G        GR E+FNK+
  S:     1 MKQGIHPNYVEVTATC-SCGNVIKTRSTVG-KDLNLDVCGNCHPFYTGKQRVVDTGGRVERFNKR 63
>gi|71039456|gb|AAZ19764.1| LSU ribosomal protein L31P [Psychrobacter arcticus 273-4] (128 aa)
Score = 110, Expect = 4.0e-04, Identities = 25/66 (37%), Positives = 38/66 (57%)
  Q:     2 IMKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETS-----------IDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           IM+K+ H    EV F+  + +  F+ +ST+ TK T            +D+ S+ HPFY G       +GR   FNK+
  S:    35 IMRKDIHPNYQEVLFHDTNADVFFLTRSTVKTKTTREYEGSEYPYYPLDISSASHPFYTGEQRKTSTEGRVASFNKR 111
>gi|119946483|ref|YP_944163.1| 50S ribosomal protein L31 [Psychromonas ingrahamii 37] >gi|119865087|gb|ABM04564.1| LSU ribosomal protein L31P [Psychromonas ingrahamii 37] (70 aa)
Score = 110, Expect = 4.3e-04, Identities = 26/72 (36%), Positives = 37/72 (51%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQE 74
           MK   H +  E++  C SC +   V ST   K  ++D+C  CHPFY GT       GR EKF  +  A+ ++
  S:     1 MKNAIHPEYKEITATC-SCGNIVTVGSTAG-KNLTLDICGECHPFYTGTQRVVDTGGRIEKFKNRFGALGKK 70
>gi|113461613|ref|YP_719682.1| 50S ribosomal protein L31P [Haemophilus somnus 129PT] >gi|112823656|gb|ABI25745.1| LSU ribosomal protein L31P [Haemophilus somnus 129PT] (77 aa)
Score = 110, Expect = 4.4e-04, Identities = 26/65 (40%), Positives = 38/65 (58%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H +  E++  C SC +    +ST+  K  ++DVCS+CHPFY G        GR E+FNK+
  S:     8 MKQGIHPEYKEITATC-SCGNVIKTRSTVG-KNLNLDVCSNCHPFYTGKQRVVDTGGRVERFNKR 70
>gi|16120457|ref|NP_403770.1| 50S ribosomal protein L31 [Yersinia pestis CO92] >gi|45439975|ref|NP_991514.1| 50S ribosomal protein L31 [Yersinia pestis biovar Microtus str. 91001] >gi|51594460|ref|YP_068651.1| 50S ribosomal protein L31 [Yersinia pseudotuberculosis IP 32953] >gi|108806258|ref|YP_650174.1| 50S ribosomal protein L31 [Yersinia pestis Antiqua] >gi|108813903|ref|YP_649670.1| 50S ribosomal protein L31 [Yersinia pestis Nepal516] >gi|145601038|ref|YP_001165114.1| 50S ribosomal protein L31 [Yersinia pestis Pestoides F] >gi|150260797|ref|ZP_01917525.1| 50S ribosomal protein L31 [Yersinia pestis CA88-4125] >gi|153948951|ref|YP_001399118.1| 50S ribosomal protein L31 [Yersinia pseudotuberculosis IP 31758] >gi|161484910|ref|NP_667640.2| 50S ribosomal protein L31 [Yersinia pestis KIM] >gi|162421426|ref|YP_001608120.1| 50S ribosomal protein L31 [Yersinia pestis Angola] >gi|166011478|ref|ZP_02232376.1| ribosomal protein L31 [Yersinia pestis biovar Antiqua str. E1979001] >gi|166213675|ref|ZP_02239710.1| ribosomal protein L31 [Yersinia pestis biovar Antiqua str. B42003004] >gi|167402504|ref|ZP_02307958.1| ribosomal protein L31 [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167425901|ref|ZP_02317654.1| ribosomal protein L31 [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167469792|ref|ZP_02334496.1| ribosomal protein L31 [Yersinia pestis FV-1] >gi|170026305|ref|YP_001722810.1| ribosomal protein L31 [Yersinia pseudotuberculosis YPIII] >gi|186893449|ref|YP_001870561.1| ribosomal protein L31 [Yersinia pseudotuberculosis PB1/+] >gi|17865543|sp|P58471|RL31_YERPE 50S ribosomal protein L31 >gi|73621832|sp|Q66G80|RL31_YERPS 50S ribosomal protein L31 >gi|124067798|sp|Q1CBE3|RL31_YERPA 50S ribosomal protein L31 >gi|124067816|sp|Q1CD60|RL31_YERPN 50S ribosomal protein L31 >gi|45434830|gb|AAS60391.1| 50S ribosomal protein L31 [Yersinia pestis biovar Microtus str. 91001] >gi|51587742|emb|CAH19342.1| 50S ribosomal protein L31 [Yersinia pseudotuberculosis IP 32953] >gi|108777551|gb|ABG20070.1| LSU ribosomal protein L31P [Yersinia pestis Nepal516] >gi|108778171|gb|ABG12229.1| LSU ribosomal protein L31P [Yersinia pestis Antiqua] >gi|115345936|emb|CAL18798.1| 50S ribosomal protein L31 [Yersinia pestis CO92] >gi|145212734|gb|ABP42141.1| LSU ribosomal protein L31P [Yersinia pestis Pestoides F] >gi|149290205|gb|EDM40282.1| 50S ribosomal protein L31 [Yersinia pestis CA88-4125] >gi|152960446|gb|ABS47907.1| ribosomal protein L31 [Yersinia pseudotuberculosis IP 31758] >gi|162354241|gb|ABX88189.1| ribosomal protein L31 [Yersinia pestis Angola] >gi|165989624|gb|EDR41925.1| ribosomal protein L31 [Yersinia pestis biovar Antiqua str. E1979001] >gi|166205077|gb|EDR49557.1| ribosomal protein L31 [Yersinia pestis biovar Antiqua str. B42003004] >gi|167048120|gb|EDR59528.1| ribosomal protein L31 [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167055049|gb|EDR64848.1| ribosomal protein L31 [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|169752839|gb|ACA70357.1| ribosomal protein L31 [Yersinia pseudotuberculosis YPIII] >gi|186696475|gb|ACC87104.1| ribosomal protein L31 [Yersinia pseudotuberculosis PB1/+] (71 aa)
Score = 110, Expect = 4.5e-04, Identities = 24/65 (36%), Positives = 37/65 (56%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H K  +V+ +C SC +   + ST+   + ++DVC  CHPFY G        GR ++FNK+
  S:     1 MKQGIHPKYEQVTASC-SCGNVIKINSTVG-HDLNLDVCGECHPFYTGKQRDVASGGRVDRFNKR 63
>gi|15617167|ref|NP_240380.1| 50S ribosomal protein L31 [Buchnera aphidicola str. APS (Acyrthosiphon pisum)] >gi|11134603|sp|P57639|RL31_BUCAI 50S ribosomal protein L31 >gi|25295544|pir||B84997 50S ribosomal protein L31 [imported] - Buchnera sp. (strain APS) >gi|10039232|dbj|BAB13266.1| 50S ribosomal protein L31 [Buchnera aphidicola str. APS (Acyrthosiphon pisum)] (72 aa)
Score = 110, Expect = 4.7e-04, Identities = 26/72 (36%), Positives = 41/72 (56%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQE 74
           MKK+ H + ++++  C SC +   + ST+N    ++D+C+ CHPFY G        GR E+F K+    KQE
  S:     1 MKKKIHPRYSKITATC-SCGNIIEIFSTIN-HNLNLDICAKCHPFYTGKQRVIDTGGRVERFKKRFKFTKQE 70
>gi|114564910|ref|YP_752424.1| 50S ribosomal protein L31 [Shewanella frigidimarina NCIMB 400] >gi|114336203|gb|ABI73585.1| ribosomal protein L31 [Shewanella frigidimarina NCIMB 400] (70 aa)
Score = 110, Expect = 4.8e-04, Identities = 26/65 (40%), Positives = 34/65 (52%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK   H    E++  C +C +   V ST   K   +DVC +CHPFY GT       GR +KFNK+
  S:     1 MKTGIHPNYAEITATC-TCGNIIKVNSTAG-KNLHLDVCGACHPFYTGTQKVVDTGGRIDKFNKR 63
>gi|194341219|gb|EDX22185.1| 50S ribosomal protein L31 [Streptomyces sp. Mg1] (71 aa)
Score = 110, Expect = 4.9e-04, Identities = 24/72 (33%), Positives = 35/72 (48%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQE 74
           MK+E H +  E   +C +C ++F  +STL       +VCS CHPFY G        GR  +F  +     Q+
  S:     1 MKREVHPEYVETQVSC-TCGASFTTRSTLTEGTIRAEVCSECHPFYTGKQKILDTGGRVARFEARFGKAAQK 71
>gi|109639334|gb|ABG36531.1| 50S ribosomal protein L31 [Haemophilus ducreyi] (70 aa)
Score = 110, Expect = 4.9e-04, Identities = 25/65 (38%), Positives = 37/65 (56%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H +  E++  C SC +    +ST+  K  ++DVC +CHPFY G        GR E+FNK+
  S:     1 MKQGIHPEYKEITATC-SCGNVIKTRSTVE-KNLNLDVCGNCHPFYTGKQRVVDTGGRVERFNKR 63
>gi|52424503|ref|YP_087640.1| RpmE protein [Mannheimia succiniciproducens MBEL55E] >gi|52306555|gb|AAU37055.1| RpmE protein [Mannheimia succiniciproducens MBEL55E] (75 aa)
Score = 109, Expect = 5.2e-04, Identities = 24/65 (36%), Positives = 36/65 (55%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H +  E++  C SC +    +ST    + ++DVC +CHPFY G        GR E+FNK+
  S:     5 MKQGIHPEYKEITVTC-SCGNVIKTRSTAG-HDINLDVCGNCHPFYTGKQRVVDTGGRVERFNKR 67
>gi|32034001|ref|ZP_00134257.1| COG0254: Ribosomal protein L31 [Actinobacillus pleuropneumoniae serovar 1 str. 4074] >gi|126208456|ref|YP_001053681.1| 50S ribosomal protein L31 [Actinobacillus pleuropneumoniae L20] >gi|165976411|ref|YP_001652004.1| 50S ribosomal protein L31 [Actinobacillus pleuropneumoniae serovar 3 str. JL03] >gi|190150307|ref|YP_001968832.1| 50S ribosomal protein L31 [Actinobacillus pleuropneumoniae serovar 7 str. AP76] >gi|126097248|gb|ABN74076.1| 50S ribosomal protein L31 [Actinobacillus pleuropneumoniae L20] >gi|165876512|gb|ABY69560.1| 50S ribosomal protein L31 [Actinobacillus pleuropneumoniae serovar 3 str. JL03] >gi|189915438|gb|ACE61690.1| 50S ribosomal protein L31 [Actinobacillus pleuropneumoniae serovar 7 str. AP76] (70 aa)
Score = 109, Expect = 5.2e-04, Identities = 25/65 (38%), Positives = 37/65 (56%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H +  E++  C SC +    +ST+  K  ++DVC +CHPFY G        GR E+FNK+
  S:     1 MKQGIHPEYTEITATC-SCGNVIKTRSTVG-KNLNLDVCGNCHPFYTGKQRVVDTGGRVERFNKR 63
>gi|73621803|sp|Q65VF5|RL31_MANSM 50S ribosomal protein L31 (71 aa)
Score = 109, Expect = 5.3e-04, Identities = 24/65 (36%), Positives = 36/65 (55%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H +  E++  C SC +    +ST    + ++DVC +CHPFY G        GR E+FNK+
  S:     1 MKQGIHPEYKEITVTC-SCGNVIKTRSTAG-HDINLDVCGNCHPFYTGKQRVVDTGGRVERFNKR 63
>gi|150388164|ref|YP_001318213.1| ribosomal protein L31 [Alkaliphilus metalliredigens QYMF] >gi|149948026|gb|ABR46554.1| ribosomal protein L31 [Alkaliphilus metalliredigens QYMF] (65 aa)
Score = 109, Expect = 5.4e-04, Identities = 28/65 (43%), Positives = 36/65 (55%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MKK+ H    ++  +C  C + F   ST   KE  ++VCS CHPFY G   S +  GR EKF KK
  S:     1 MKKDIHPAYQQIDVHCV-CGNKFKTGST--NKEIRVEVCSDCHPFYTGKQKSVEKGGRVEKFKKK 62
>gi|39998197|ref|NP_954148.1| 50S ribosomal protein L31 [Geobacter sulfurreducens PCA] >gi|73621794|sp|Q748A8|RL31_GEOSL 50S ribosomal protein L31 >gi|39985143|gb|AAR36498.1| ribosomal protein L31 [Geobacter sulfurreducens PCA] (65 aa)
Score = 109, Expect = 5.6e-04, Identities = 27/65 (41%), Positives = 37/65 (56%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H K N+V   CA C ++F  +ST    E S ++CS+CHPF+ G        GR E+F KK
  S:     1 MKEGIHPKYNDVMVKCA-CGNSFQTRST--KTEISTEICSACHPFFTGKQKLIDTAGRVERFRKK 62
>gi|28872249|ref|NP_794868.1| 50S ribosomal protein L31 [Pseudomonas syringae pv. tomato str. DC3000] >gi|31076908|sp|Q87V05|RL31_PSESM 50S ribosomal protein L31 >gi|28855503|gb|AAO58563.1| ribosomal protein L31 [Pseudomonas syringae pv. tomato str. DC3000] (75 aa)
Score = 109, Expect = 5.8e-04, Identities = 26/77 (33%), Positives = 37/77 (48%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQEPTKSE 79
           MK + H     +   C SC +    +STL T   S+DVC+ CHPFY G   +  + GR +KF  +  A      K +
  S:     1 MKADIHPVYEAIDATC-SCGNVIKTRSTL-TGPLSLDVCNECHPFYTGKQKTLDIGGRVDKFKSRFGAFGATKAKQD 75
>gi|170718684|ref|YP_001783877.1| ribosomal protein L31 [Haemophilus somnus 2336] >gi|168826813|gb|ACA32184.1| ribosomal protein L31 [Haemophilus somnus 2336] (70 aa)
Score = 109, Expect = 5.8e-04, Identities = 26/65 (40%), Positives = 38/65 (58%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H +  E++  C SC +    +ST+  K  ++DVCS+CHPFY G        GR E+FNK+
  S:     1 MKQGIHPEYKEITATC-SCGNVIKTRSTVG-KNLNLDVCSNCHPFYTGKQRVVDTGGRVERFNKR 63
>gi|70733945|ref|YP_257585.1| 50S ribosomal protein L31 [Pseudomonas fluorescens Pf-5] >gi|148878611|sp|Q4KJJ8|RL31_PSEF5 50S ribosomal protein L31 >gi|68348244|gb|AAY95850.1| ribosomal protein L31 [Pseudomonas fluorescens Pf-5] (73 aa)
Score = 109, Expect = 5.8e-04, Identities = 25/65 (38%), Positives = 35/65 (53%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK + H     ++  C SC +    +STL  K  S+DVC+ CHPFY G   +  V GR +KF  +
  S:     1 MKADIHPVYEAITATC-SCGNVIETRSTL-AKPLSLDVCNECHPFYTGKQKTLDVGGRVDKFKSR 63
>gi|126642459|ref|YP_001085443.1| 50S ribosomal protein L31 [Acinetobacter baumannii ATCC 17978] >gi|169632905|ref|YP_001706641.1| 50S ribosomal protein L31 [Acinetobacter baumannii SDF] >gi|169795197|ref|YP_001712990.1| 50S ribosomal protein L31 [Acinetobacter baumannii AYE] >gi|184158952|ref|YP_001847291.1| 50S ribosomal protein L31 [Acinetobacter baumannii ACICU] >gi|126388343|gb|ABO12841.1| 50S ribosomal protein L31 [Acinetobacter baumannii ATCC 17978] >gi|169148124|emb|CAM85987.1| 50S ribosomal protein L31 [Acinetobacter baumannii] >gi|169151697|emb|CAP00487.1| 50S ribosomal protein L31 [Acinetobacter baumannii] >gi|183210546|gb|ACC57944.1| 50S ribosomal protein L31 [Acinetobacter baumannii ACICU] (74 aa)
Score = 109, Expect = 5.9e-04, Identities = 22/71 (30%), Positives = 37/71 (52%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQ 73
           M+ + H K  ++   C SC +    +S L  +   +DVCS+CHPFY G   +    GR +KF ++   + +
  S:     1 MRADIHPKYEKLVATC-SCGNVIETRSALGKETIYLDVCSACHPFYTGKQKNVDTGGRIDKFKQRFAGMSR 70
>gi|119962116|ref|YP_947872.1| ribosomal protein L31 [Arthrobacter aurescens TC1] >gi|119948975|gb|ABM07886.1| ribosomal protein L31 [Arthrobacter aurescens TC1] (132 aa)
Score = 109, Expect = 6.1e-04, Identities = 24/66 (36%), Positives = 37/66 (56%)
  Q:     2 IMKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET------------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           IMK + H K   V FN  +  + F+ KST+++ +T             +++ S  HPFY G        GR E+FN +
  S:    47 IMKSDIHPKYEAVVFNDLASGTQFLTKSTVSSSKTIEWEDGNTYPVIDVEISSESHPFYTGKQRIMDSAGRVERFNAR 124
>gi|71894489|ref|YP_278597.1| 50S ribosomal protein L31 [Mycoplasma synoviae 53] >gi|148878601|sp|Q4A5T5|RL31_MYCS5 50S ribosomal protein L31 >gi|71851277|gb|AAZ43886.1| 50S ribosomal protein L31 [Mycoplasma synoviae 53] (71 aa)
Score = 109, Expect = 6.2e-04, Identities = 29/72 (40%), Positives = 40/72 (55%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQE 74
           MKK+ H +   V+  C +C + F +KST   KE  IDVCS CHP Y G     +  G  EKFN+++    Q+
  S:     1 MKKDLHPQYYSVAVKCETCKNEFTLKST--KKEFKIDVCSKCHPVYTGNRSQAKSTGMIEKFNRRLAKKDQQ 70
>gi|111022585|ref|YP_705557.1| 50S ribosomal protein L31 type B [Rhodococcus sp. RHA1] >gi|118572980|sp|Q0S4Y7|RL31B_RHOSR 50S ribosomal protein L31 type B >gi|110822115|gb|ABG97399.1| 50S ribosomal protein L31 type B [Rhodococcus sp. RHA1] (84 aa)
Score = 109, Expect = 6.3e-04, Identities = 26/73 (35%), Positives = 39/73 (53%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETS------------IDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQEP 75
           MK   H   + V F  AS  +TF+ +ST+ +  T+            +DV S  HPF+ G        GR EKF ++   V++ P
  S:     1 MKANIHPDYHPVVFQDASTGTTFLTRSTVTSDRTALWSDGNTYPLVVVDVTSESHPFWTGAQRVMDTAGRVEKFERR-YGVRKRP 84
>gi|13357560|ref|NP_077832.1| ribosomal protein L31 [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|167971170|ref|ZP_02553447.1| ribosomal protein L31 [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|168282010|ref|ZP_02689677.1| ribosomal protein L31 [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|168308157|ref|ZP_02690832.1| ribosomal protein L31 [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|170762277|ref|YP_001752082.1| ribosomal protein L31 [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|13124472|sp|Q9PRE1|RL31_UREPA 50S ribosomal protein L31 >gi|11357030|pir||C82945 ribosomal protein L31 UU002 [imported] - Ureaplasma urealyticum >gi|6898948|gb|AAF30409.1|AE002100_2 ribosomal protein L31 [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168827854|gb|ACA33116.1| ribosomal protein L31 [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171902480|gb|EDT48769.1| ribosomal protein L31 [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|182675981|gb|EDT87886.1| ribosomal protein L31 [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186701143|gb|EDU19425.1| ribosomal protein L31 [Ureaplasma parvum serovar 6 str. ATCC 27818] (95 aa)
Score = 109, Expect = 6.3e-04, Identities = 28/82 (34%), Positives = 43/82 (52%)
  Q:    16 FNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIG-TSMSQQVKGRAEKFNKKVVAVKQEPTKSENKNTKKQSKKVVHSLNSL 97
           +NC +C   F++ S     E +I+VCS+CH F+IG  + +  ++GRAEK N +  A      K   K   +   +   SLN L
  S:    13 YNCVTCKKEFIIDSAAKNTEVAIEVCSNCHTFFIGKQNATTTLRGRAEKLNNRFEAGLNNINKKPEKKKIQGKSEPRKSLNEL 95
>gi|146305574|ref|YP_001186039.1| 50S ribosomal protein L31P [Pseudomonas mendocina ymp] >gi|145573775|gb|ABP83307.1| LSU ribosomal protein L31P [Pseudomonas mendocina ymp] (70 aa)
Score = 108, Expect = 6.6e-04, Identities = 24/65 (36%), Positives = 34/65 (52%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK + H    E+   C SC +    +ST+  K  S+DVCS CHPFY G        GR ++F ++
  S:     1 MKADIHPNYVEIDATC-SCGNVIKTRSTIG-KNISLDVCSECHPFYTGKQKVLDTGGRIDRFKQR 63
>gi|23466256|ref|NP_696859.1| 50S ribosomal protein L31 [Bifidobacterium longum NCC2705] >gi|46190987|ref|ZP_00120805.2| COG0254: Ribosomal protein L31 [Bifidobacterium longum DJO10A] >gi|189440750|ref|YP_001955831.1| Ribosomal protein L31 [Bifidobacterium longum DJO10A] >gi|31076978|sp|Q8G3P6|RL31_BIFLO 50S ribosomal protein L31 >gi|23327004|gb|AAN25495.1| 50S ribosomal protein L31 [Bifidobacterium longum NCC2705] >gi|189429185|gb|ACD99333.1| Ribosomal protein L31 [Bifidobacterium longum DJO10A] (70 aa)
Score = 108, Expect = 6.6e-04, Identities = 23/65 (35%), Positives = 32/65 (49%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           M++  H   + V   C SC +TFV ++        +DVCS CHPFY G        GR  +F K+
  S:     1 MQQGIHPDYHPVEVTC-SCGNTFVTRTAGKEDHMFVDVCSQCHPFYTGKQKILDTGGRVARFEKR 64
>gi|195958913|ref|ZP_03095122.1| 50S ribosomal protein L31 type B [Borrelia sp. SV1] (81 aa)
Score = 108, Expect = 6.7e-04, Identities = 28/65 (43%), Positives = 40/65 (61%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET------------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           M+K+ H K N V F   S  + F+ +STLN+KET            ++++ S  HPFY G        GR +KFNK+
  S:     1 MRKDIHPKDNLVVFKDGSNGAMFLTRSTLNSKETIKYIDGKEYPLITVEITSKSHPFYTGQQKFVDAAGRIDKFNKR 77
>gi|188532284|ref|YP_001906081.1| 50S ribosomal protein L31 [Erwinia tasmaniensis] >gi|188027326|emb|CAO95169.1| 50S ribosomal protein L31 [Erwinia tasmaniensis] (70 aa)
Score = 108, Expect = 6.8e-04, Identities = 25/65 (38%), Positives = 36/65 (55%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MKK  H    EV+  C SC +    +ST+   + ++DVC +CHPFY G        GR ++FNK+
  S:     1 MKKGIHPNYAEVTAKC-SCGNEIKTRSTVG-HDLNLDVCGNCHPFYTGKQRDVASGGRVDRFNKR 63
>gi|83749752|ref|ZP_00946728.1| LSU ribosomal protein L31P [Ralstonia solanacearum UW551] >gi|83723572|gb|EAP70774.1| LSU ribosomal protein L31P [Ralstonia solanacearum UW551] (87 aa)
Score = 108, Expect = 6.8e-04, Identities = 31/65 (47%), Positives = 38/65 (58%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET------------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+ TH    EV F   S + +FV +ST+ TKET             I+V S  HPFY GT       GR EKF +K
  S:     1 MKENTHPNYREVVFQDMSSDFSFVTRSTIQTKETVVWKDGKEYPLAKIEVSSESHPFYTGTQKIMDTAGRVEKFRQK 77
>gi|167940914|ref|ZP_02527989.1| ribosomal protein L31 [Ureaplasma urealyticum serovar 8] >gi|167959363|ref|ZP_02546434.1| ribosomal protein L31 [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gi|167972245|ref|ZP_02554522.1| ribosomal protein L31 [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|167974270|ref|ZP_02556547.1| ribosomal protein L31 [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|167975334|ref|ZP_02557611.1| ribosomal protein L31 [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|167988934|ref|ZP_02570605.1| ribosomal protein L31 [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|168337742|ref|ZP_02694357.1| ribosomal protein L31 [Ureaplasma urealyticum serovar 10] >gi|168362411|ref|ZP_02695590.1| ribosomal protein L31 [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|168807954|ref|ZP_02829013.1| ribosomal protein L31 [Ureaplasma urealyticum serovar 2] >gi|195867469|ref|ZP_03079473.1| ribosomal protein L31 [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|171903593|gb|EDT49882.1| ribosomal protein L31 [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|184209337|gb|EDU06380.1| ribosomal protein L31 [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188018679|gb|EDU56719.1| ribosomal protein L31 [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188998150|gb|EDU67247.1| ribosomal protein L31 [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|195659967|gb|EDX53347.1| ribosomal protein L31 [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|195660945|gb|EDX54198.1| ribosomal protein L31 [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (95 aa)
Score = 108, Expect = 7.2e-04, Identities = 31/93 (33%), Positives = 46/93 (49%)
  Q:     5 KETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIG-TSMSQQVKGRAEKFNKKVVAVKQEPTKSENKNTKKQSKKVVHSLNSL 97
           K+ H       +NC +C   FV+ S     E +I+VCS+CH F+IG  + +  ++GRAEK N +  A      K   K   +   +   SLN L
  S:     2 KDIHPVSKPCVYNCVTCKKEFVINSAAKNTEVAIEVCSNCHTFFIGKQNATTTLRGRAEKLNNRFEAGLNNINKKPEKKKVQGKSEPRKSLNEL 95
>gi|41408561|ref|NP_961397.1| 50S ribosomal protein L31 [Mycobacterium avium subsp. paratuberculosis K-10] >gi|118465454|ref|YP_880754.1| 50S ribosomal protein L31 [Mycobacterium avium 104] >gi|73621807|sp|Q73X47|RL31_MYCPA 50S ribosomal protein L31 >gi|41396919|gb|AAS04780.1| RpmE [Mycobacterium avium subsp. paratuberculosis K-10] >gi|118166741|gb|ABK67638.1| ribosomal protein L31 [Mycobacterium avium 104] (80 aa)
Score = 108, Expect = 7.2e-04, Identities = 26/80 (32%), Positives = 38/80 (47%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQEPTKSENKN 82
           MK + H    E +  C  C +TF  +ST +     ++VCS CHPFY G        GR  +F K+    K    K+E+ +
  S:     1 MKADIHPTYAETTVLCG-CGNTFQTRSTKDGGRIVVEVCSQCHPFYTGKQKILDSGGRVARFEKRYGKRKAGAEKAESAD 79
>gi|167855179|ref|ZP_02477950.1| 50S ribosomal protein L31 [Haemophilus parasuis 29755] >gi|167853724|gb|EDS24967.1| 50S ribosomal protein L31 [Haemophilus parasuis 29755] (70 aa)
Score = 108, Expect = 7.6e-04, Identities = 25/65 (38%), Positives = 36/65 (55%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H    E++  C SC +    +ST   K+ ++DVC +CHPFY G        GR E+FNK+
  S:     1 MKQGIHPNYVEITATC-SCGNVIKTRSTAG-KDLNLDVCGNCHPFYTGKQRVVDTGGRVERFNKR 63
>gi|149200627|ref|ZP_01877630.1| ribosomal protein L31 [Lentisphaera araneosa HTCC2155] >gi|149136276|gb|EDM24726.1| ribosomal protein L31 [Lentisphaera araneosa HTCC2155] (53 aa)
Score = 108, Expect = 7.8e-04, Identities = 21/48 (43%), Positives = 34/48 (70%)
  Q:    20 SCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           +C +T+ +KST   KE  + +CS+CHPFY GT+ +  V+GR + FN++
  S:     3 ACGTTWNIKST--RKEVKVGICSNCHPFYTGTARNADVEGRIDAFNRR 48
>gi|145617380|ref|ZP_01773445.1| ribosomal protein L31 [Geobacter bemidjiensis Bem] >gi|144946169|gb|EDJ81229.1| ribosomal protein L31 [Geobacter bemidjiensis Bem] >gi|197089433|gb|ACH40704.1| ribosomal protein L31 [Geobacter bemidjiensis Bem] (73 aa)
Score = 108, Expect = 7.8e-04, Identities = 27/65 (41%), Positives = 36/65 (55%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H K NE++  C  C ++F  +ST    E S +VCS CHPFY G        GR E+F K+
  S:     1 MKEGIHPKYNEITVKCL-CGNSFESRST--KAEISTEVCSQCHPFYTGKQKLMDTAGRVERFRKR 62
>gi|148550162|ref|YP_001270264.1| ribosomal protein L31 [Pseudomonas putida F1] >gi|24986872|gb|AAN70652.1|AE016709_4 ribosomal protein L31 [Pseudomonas putida KT2440] >gi|148514220|gb|ABQ81080.1| LSU ribosomal protein L31P [Pseudomonas putida F1] (100 aa)
Score = 108, Expect = 7.8e-04, Identities = 26/62 (41%), Positives = 32/62 (51%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKF 64
           MK+  H     V+  C SC + F  +STL     SIDVC+ CHPFY G        GR +KF
  S:    30 MKEGIHPNYEVVAVTC-SCGNKFETRSTLGNV-LSIDVCNLCHPFYTGKQKVLDTGGRVQKF 89
>gi|24213720|ref|NP_711201.1| 50S ribosomal protein L31 [Leptospira interrogans serovar Lai str. 56601] >gi|45658474|ref|YP_002560.1| 50S ribosomal protein L31 [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] >gi|116328953|ref|YP_798673.1| 50S ribosomal protein L31 [Leptospira borgpetersenii serovar Hardjo-bovis L550] >gi|116330439|ref|YP_800157.1| 50S ribosomal protein L31 [Leptospira borgpetersenii serovar Hardjo-bovis JB197] >gi|31076974|sp|Q8F7C6|RL31_LEPIN 50S ribosomal protein L31 >gi|73621802|sp|Q72P39|RL31_LEPIC 50S ribosomal protein L31 >gi|24194538|gb|AAN48219.1|AE011286_3 ribosomal protein L31 [Leptospira interrogans serovar Lai str. 56601] >gi|45601717|gb|AAS71197.1| 50S ribosomal protein L31 [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] >gi|116121697|gb|ABJ79740.1| 50S Ribosomal protein L31 [Leptospira borgpetersenii serovar Hardjo-bovis L550] >gi|116124128|gb|ABJ75399.1| 50S Ribosomal protein L31 [Leptospira borgpetersenii serovar Hardjo-bovis JB197] (67 aa)
Score = 108, Expect = 7.9e-04, Identities = 23/65 (35%), Positives = 37/65 (56%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK E H        +CASC + +  ++++   + +I++CS+CHPF+ G S      GR +KF KK
  S:     1 MKTEIHPNYKAAKISCASCGTVYETRTSIG--DINIEICSACHPFFTGKSKLVDTTGRVDKFKKK 63
>gi|119505534|ref|ZP_01627606.1| ribosomal protein L31 [marine gamma proteobacterium HTCC2080] >gi|119458643|gb|EAW39746.1| ribosomal protein L31 [marine gamma proteobacterium HTCC2080] (71 aa)
Score = 108, Expect = 8.2e-04, Identities = 23/65 (35%), Positives = 37/65 (56%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK + H +  E++  C SC +    +ST+  ++  +DVCS CHPF+ G        GR ++FNK+
  S:     1 MKADIHPRYEEITARC-SCGNEIKTRSTV-CEDILLDVCSQCHPFFTGKQKILDTGGRVDRFNKR 63
>gi|33520035|ref|NP_878867.1| 50S ribosomal protein L31 [Candidatus Blochmannia floridanus] >gi|73621785|sp|Q7VRL2|RL31_BLOFL 50S ribosomal protein L31 >gi|33504381|emb|CAD83274.1| 50S ribosomal protein L31 [Candidatus Blochmannia floridanus] (73 aa)
Score = 107, Expect = 8.9e-04, Identities = 25/58 (43%), Positives = 34/58 (58%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGR 60
           MKK  H + N +S +C SC +   V+STL     ++DVC +CHPFY GT      +GR
  S:     1 MKKNIHPQYNVISASC-SCGNVIHVRSTLK-HNINLDVCDACHPFYTGTQRIIDTRGR 56
>gi|191162141|ref|ZP_03024022.1| ribosomal protein L31 [Geobacter sp. M21] >gi|190996931|gb|EDV72378.1| ribosomal protein L31 [Geobacter sp. M21] (72 aa)
Score = 107, Expect = 9.0e-04, Identities = 27/65 (41%), Positives = 35/65 (53%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H K NE+   C  C ++F  +ST    E S +VCS CHPFY G        GR E+F K+
  S:     1 MKEGIHPKYNEIIVKCL-CGNSFESRST--KAEISTEVCSQCHPFYTGKQKLMDTAGRVERFRKR 62
>gi|28899105|ref|NP_798710.1| 50S ribosomal protein L31 type B [Vibrio parahaemolyticus RIMD 2210633] >gi|31076896|sp|Q87MC5|RL31B_VIBPA 50S ribosomal protein L31 type B >gi|28807329|dbj|BAC60594.1| ribosomal protein, L31P family [Vibrio parahaemolyticus RIMD 2210633] (86 aa)
Score = 107, Expect = 9.6e-04, Identities = 28/65 (43%), Positives = 35/65 (53%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET------------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK   H     V F+  S +  FVV STL T  T            ++DV SS HPFY G     Q +GR   FN++
  S:     1 MKPGIHPDYRPVVFHDTSVDEYFVVGSTLKTDRTIEWKDGKTYPYFTLDVSSSSHPFYTGKQRVVQAEGRIANFNRR 77
>gi|194684521|emb|CAR46310.1| 50S ribosomal protein L31 [Proteus mirabilis HI4320] (70 aa)
Score = 107, Expect = 9.6e-04, Identities = 25/65 (38%), Positives = 34/65 (52%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MKK+ H K  E++  C SC +   + ST      ++DVC  CHPFY G        GR + FNK+
  S:     1 MKKDIHPKYEEITATC-SCGNVMKINSTAG-HNLNLDVCDKCHPFYTGKQRDVATGGRVDLFNKR 63
>gi|154174117|ref|YP_001407503.1| 50S ribosomal protein L31 [Campylobacter curvus 525.92] >gi|112803837|gb|EAU01181.1| ribosomal protein L31 [Campylobacter curvus 525.92] (66 aa)
Score = 107, Expect = 9.6e-04, Identities = 29/65 (44%), Positives = 36/65 (55%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MKKE H +  + +  CA C +TF  KS  N  E  ID+C  CHPF+ G+       GR EKF KK
  S:     1 MKKEIHPEYIDCTVTCA-CGNTFKTKS--NKSEIKIDICDKCHPFFTGSEKIVDSAGRVEKFKKK 62
>gi|167931684|ref|ZP_02518771.1| 50S ribosomal protein L31 type B [Borrelia burgdorferi 156a] >gi|167933208|ref|ZP_02520283.1| 50S ribosomal protein L31 type B [Borrelia burgdorferi ZS7] >gi|167944106|ref|ZP_02531180.1| 50S ribosomal protein L31 type B [Borrelia burgdorferi Bol26] >gi|168525832|ref|ZP_02719471.1| 50S ribosomal protein L31 type B [Borrelia burgdorferi 118a] >gi|168579240|ref|ZP_02723268.1| 50S ribosomal protein L31 type B [Borrelia burgdorferi 72a] >gi|168691865|ref|ZP_02724657.1| 50S ribosomal protein L31 type B [Borrelia burgdorferi 94a] >gi|195941417|ref|ZP_03086799.1| 50S ribosomal protein L31 type B [Borrelia burgdorferi 80a] >gi|195951730|ref|ZP_03092827.1| 50S ribosomal protein L31 type B [Borrelia burgdorferi 29805] >gi|195954700|ref|ZP_03093393.1| 50S ribosomal protein L31 type B [Borrelia burgdorferi CA-11.2a] >gi|195960344|ref|ZP_03096549.1| 50S ribosomal protein L31 type B [Borrelia burgdorferi 64b] (81 aa)
Score = 107, Expect = 1.0e-03, Identities = 29/65 (44%), Positives = 40/65 (61%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET------------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           M+K+ H K N V F   S  + F+ KSTLN+KET            ++++ S  HPFY G        GR +KFNK+
  S:     1 MRKDIHPKNNLVVFKDGSNGAMFLTKSTLNSKETIKYIDGKEYPLITVEITSKSHPFYTGQQKFVDAAGRIDKFNKR 77
>gi|167575356|ref|ZP_02368230.1| 50S ribosomal protein L31 type B [Borrelia valaisiana VS116] (81 aa)
Score = 107, Expect = 1.0e-03, Identities = 29/65 (44%), Positives = 40/65 (61%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET------------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MKK+ H K N V F   S  + F+ +STLN+KET            ++++ S  HPFY G        GR +KFNK+
  S:     1 MKKDIHPKNNLVVFKDGSNGAMFLTRSTLNSKETIKYIDGKEYPLITVEITSKSHPFYTGQQKFVDAAGRIDKFNKR 77
>gi|33152739|ref|NP_874092.1| 50S ribosomal protein L31 [Haemophilus ducreyi 35000HP] >gi|2500324|sp|Q59450|RL31_HAEDU 50S ribosomal protein L31 >gi|1388150|gb|AAB49622.1| ribosomal protein L31 >gi|2198845|gb|AAC45591.1| ribosomal protein L31 homolog [Haemophilus ducreyi] >gi|33148963|gb|AAP96481.1| 50S ribosomal protein L31 [Haemophilus ducreyi 35000HP] (70 aa)
Score = 107, Expect = 1.0e-03, Identities = 25/65 (38%), Positives = 37/65 (56%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H +  E++  C SC +    +ST+  K  ++DVC +CHPFY G        GR E+FNK+
  S:     1 MKQGIHPEYKEITATC-SCGNVIKTRSTVE-KNLNLDVCGNCHPFYTGKQRVVDTGGRVERFNKR 63
>gi|158321610|ref|YP_001514117.1| ribosomal protein L31 [Alkaliphilus oremlandii OhILAs] >gi|158141809|gb|ABW20121.1| ribosomal protein L31 [Alkaliphilus oremlandii OhILAs] (65 aa)
Score = 107, Expect = 1.0e-03, Identities = 27/65 (41%), Positives = 37/65 (56%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MKK+ H    EV  +CA C + F   ST   KE  +++CS CHPF+ G   + +  GR EKF K+
  S:     1 MKKDIHPVYQEVEVHCA-CGNNFKTGST--NKEIRVEICSQCHPFFTGKQKNVEKGGRVEKFKKR 62
>gi|163803794|ref|ZP_02197648.1| 50S ribosomal protein L31 type B [Vibrio campbellii AND4] >gi|159172413|gb|EDP57285.1| 50S ribosomal protein L31 type B [Vibrio campbellii AND4] (86 aa)
Score = 107, Expect = 1.1e-03, Identities = 27/65 (41%), Positives = 35/65 (53%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET------------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK   H +   V F+  S +  FVV STL T  T            ++DV S  HPFY G     Q +GR   FN++
  S:     1 MKTGIHPEYRPVIFHDTSVDEYFVVGSTLQTDRTIEWKDGKTYPYFTLDVSSQSHPFYTGKQRVVQAEGRIANFNRR 77
>gi|156975518|ref|YP_001446425.1| 50S ribosomal protein L31 type B [Vibrio harveyi ATCC BAA-1116] >gi|166230232|sp|A7N1X4|RL31B_VIBHB 50S ribosomal protein L31 type B >gi|156527112|gb|ABU72198.1| hypothetical protein VIBHAR_03250 [Vibrio harveyi ATCC BAA-1116] (86 aa)
Score = 107, Expect = 1.1e-03, Identities = 27/65 (41%), Positives = 35/65 (53%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET------------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK   H +   V F+  S +  FVV STL T  T            ++DV S  HPFY G     Q +GR   FN++
  S:     1 MKPGIHPEYRPVVFHDTSVDEYFVVGSTLQTDRTIEWKDGKTYPYFTLDVSSESHPFYTGKQRVVQAEGRIANFNRR 77
>gi|160940106|ref|ZP_02087451.1| hypothetical protein CLOBOL_04995 [Clostridium bolteae ATCC BAA-613] >gi|158436686|gb|EDP14453.1| hypothetical protein CLOBOL_04995 [Clostridium bolteae ATCC BAA-613] (104 aa)
Score = 106, Expect = 1.2e-03, Identities = 25/66 (37%), Positives = 37/66 (56%)
  Q:     2 IMKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           IMK+  H    +    C +C + FV  ST   ++  ++VCS CH FY G   + Q +GR +KFN+K
  S:    36 IMKEGIHPSYYQAKVVC-NCGNEFVTGST--KQDIHVEVCSKCHSFYTGQQKAAQARGRIDKFNRK 98
>gi|168334109|ref|ZP_02692322.1| 50S ribosomal protein L31 [Epulopiscium sp. 'N.t. morphotype B'] (65 aa)
Score = 106, Expect = 1.2e-03, Identities = 27/65 (41%), Positives = 37/65 (56%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           M  E   K  E++  C +C + F  +ST   +   ++VCS CHPFY G   S Q KGR +KFNK+
  S:     1 MNAEIQPKYEELTITC-NCGNNFQTRST--KENIRVEVCSKCHPFYTGKQRSAQAKGRIDKFNKR 62
>gi|160872608|ref|ZP_02062740.1| ribosomal protein L31 [Rickettsiella grylli] >gi|159121407|gb|EDP46745.1| ribosomal protein L31 [Rickettsiella grylli] (81 aa)
Score = 106, Expect = 1.2e-03, Identities = 25/65 (38%), Positives = 34/65 (52%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           M+++ H   N ++  C SC   F   STL     +I+VCS CHPFY G        GR +KF +K
  S:     1 MQQDIHPVYNAITVTC-SCGHRFDTHSTLGEPSLTIEVCSKCHPFYTGKQKIVDTSGRVDKFKQK 64
>gi|170719565|ref|YP_001747253.1| ribosomal protein L31 [Pseudomonas putida W619] >gi|169757568|gb|ACA70884.1| ribosomal protein L31 [Pseudomonas putida W619] (71 aa)
Score = 106, Expect = 1.2e-03, Identities = 24/62 (38%), Positives = 33/62 (53%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKF 64
           MK + H     V+  C SC + F  +STL +   +IDVC+ CHPFY G        GR ++F
  S:     1 MKADIHPNYEAVAVTC-SCGNKFETRSTLGST-LAIDVCNLCHPFYTGKQKVLDTGGRVQRF 60
>gi|15594574|ref|NP_212363.1| 50S ribosomal protein L31 type B [Borrelia burgdorferi B31] >gi|3914755|sp|O51247|RL31B_BORBU 50S ribosomal protein L31 type B >gi|2688127|gb|AAC66620.1| ribosomal protein L31 (rpmE) [Borrelia burgdorferi B31] (81 aa)
Score = 106, Expect = 1.2e-03, Identities = 29/65 (44%), Positives = 40/65 (61%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET------------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           M+K+ H K N V F   S  + F+ KSTLN+KET            ++++ S  HPFY G        GR +KFNK+
  S:     1 MRKDIHPKNNLVVFKDGSNGAMFLTKSTLNSKETIKYIDGKEYPLVTVEITSKSHPFYTGQQKFVDAAGRIDKFNKR 77
>gi|84494540|ref|ZP_00993659.1| 50S ribosomal protein L31 [Janibacter sp. HTCC2649] >gi|84384033|gb|EAP99913.1| 50S ribosomal protein L31 [Janibacter sp. HTCC2649] (71 aa)
Score = 106, Expect = 1.2e-03, Identities = 22/65 (33%), Positives = 32/65 (49%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MKK+ H    E +  C +C ++F  +ST  +     +VCS CHPFY G        GR  +F  +
  S:     1 MKKDIHPNYAETTVTC-TCGASFTTRSTAESGAIHAEVCSQCHPFYTGKQKILDTGGRVARFQAR 64
>gi|149907674|ref|ZP_01896421.1| 50S ribosomal protein L31 [Moritella sp. PE36] >gi|149809344|gb|EDM69273.1| 50S ribosomal protein L31 [Moritella sp. PE36] (86 aa)
Score = 106, Expect = 1.2e-03, Identities = 26/72 (36%), Positives = 40/72 (55%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET-----------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQE 74
           MK+  H    +V+F+  + +  F+V STL T  T            +DV S  HPFY G   + Q  GR  +FN++   +K +
  S:     1 MKQGIHPDYQKVAFHDIAVDKYFIVGSTLKTNRTVEIEGITYPYVPLDVSSESHPFYTGKQKTIQSDGRVAQFNRRFGGLKSQ 83
>gi|15639247|ref|NP_218696.1| 50S ribosomal protein L31 [Treponema pallidum subsp. pallidum str. Nichols] >gi|189025489|ref|YP_001933261.1| ribosomal protein L31 [Treponema pallidum subsp. pallidum SS14] >gi|6094053|sp|O66075|RL31_TREPA 50S ribosomal protein L31 >gi|2995614|gb|AAC08321.1| unknown [Treponema pallidum] >gi|3322528|gb|AAC65244.1| ribosomal protein L31 (rpmE) [Treponema pallidum subsp. pallidum str. Nichols] >gi|189018064|gb|ACD70682.1| ribosomal protein L31 [Treponema pallidum subsp. pallidum SS14] (67 aa)
Score = 106, Expect = 1.2e-03, Identities = 23/65 (35%), Positives = 36/65 (55%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MKK  H +  E    CA C +  V  ST+  K+  +++CS+CHPF+ G        GR ++FN++
  S:     1 MKKGLHPRYEETKVVCA-CGNVIVTASTV--KDLRVEICSACHPFFTGKQKLVDSAGRIDRFNRR 62
>gi|29829455|ref|NP_824089.1| 50S ribosomal protein L31 [Streptomyces avermitilis MA-4680] >gi|73621824|sp|Q82J69|RL31_STRAW 50S ribosomal protein L31 >gi|29606563|dbj|BAC70624.1| putative ribosomal protein L31 [Streptomyces avermitilis MA-4680] (73 aa)
Score = 106, Expect = 1.3e-03, Identities = 21/65 (32%), Positives = 35/65 (53%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK++ H +  E   +C +C ++F  +ST+++     +VCS CHPFY G        GR  +F  +
  S:     1 MKRDIHPEYVETQVSC-TCGASFTTRSTISSGTVRAEVCSECHPFYTGKQKILDTGGRVARFEAR 64
>gi|50085320|ref|YP_046830.1| 50S ribosomal protein L31 [Acinetobacter sp. ADP1] >gi|73621777|sp|Q6FAA5|RL31_ACIAD 50S ribosomal protein L31 >gi|49531296|emb|CAG69008.1| 50S ribosomal protein L31 [Acinetobacter sp. ADP1] (74 aa)
Score = 106, Expect = 1.3e-03, Identities = 22/65 (33%), Positives = 34/65 (52%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           M+ + H K   +   C SC +    +S L  +   +DVCS+CHPFY G   +    GR +KF ++
  S:     1 MRADIHPKYQTLVATC-SCGNVIETRSALGKETLYLDVCSACHPFYTGKQKNVDTGGRIDKFKQR 64
>gi|27904993|ref|NP_778119.1| 50S ribosomal protein L31 [Buchnera aphidicola str. Bp (Baizongia pistaciae)] >gi|31076916|sp|Q89A32|RL31_BUCBP 50S ribosomal protein L31 >gi|27904391|gb|AAO27224.1| 50S ribosomal protein L31 [Buchnera aphidicola str. Bp (Baizongia pistaciae)] (69 aa)
Score = 106, Expect = 1.3e-03, Identities = 27/65 (41%), Positives = 39/65 (60%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MKK+ H    +++  C SC +   + STL +K  ++DVCS CHPFY G   +    GR EKF+K+
  S:     1 MKKKIHPDYFKINVTC-SCGNNINIFSTL-SKNINVDVCSKCHPFYTGQQRTSDTGGRIEKFHKR 63
>gi|17545901|ref|NP_519303.1| 50S ribosomal protein L31 type B [Ralstonia solanacearum GMI1000] >gi|22096023|sp|Q8Y062|RL31B_RALSO 50S ribosomal protein L31 type B >gi|17428196|emb|CAD14884.1| probable 50s ribosomal protein l31 type b. [Ralstonia solanacearum] (87 aa)
Score = 106, Expect = 1.3e-03, Identities = 30/65 (46%), Positives = 38/65 (58%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET------------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+ TH    EV F   S + +FV +ST+ TKE+             I+V S  HPFY GT       GR EKF +K
  S:     1 MKENTHPNYREVVFQDMSSDFSFVTRSTIQTKESIVWKDGKEYPLAKIEVSSESHPFYTGTQKIMDTAGRVEKFRQK 77
>gi|93007031|ref|YP_581468.1| 50S ribosomal protein L31 type B [Psychrobacter cryohalolentis K5] >gi|148878578|sp|Q1Q8L9|RL31B_PSYCK 50S ribosomal protein L31 type B >gi|92394709|gb|ABE75984.1| LSU ribosomal protein L31P [Psychrobacter cryohalolentis K5] (93 aa)
Score = 106, Expect = 1.4e-03, Identities = 24/65 (36%), Positives = 37/65 (56%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETS-----------IDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           M+K+ H    EV F+  + +  F+ +ST+ TK T            +D+ S+ HPFY G       +GR   FNK+
  S:     1 MRKDIHPNYQEVLFHDTNADVFFLTRSTVKTKTTREYEGSEYPYYPLDISSASHPFYTGEQRKTSTEGRVASFNKR 76
>gi|50842732|ref|YP_055959.1| 50S ribosomal protein L31 [Propionibacterium acnes KPA171202] >gi|73621814|sp|Q6A8B4|RL31_PROAC 50S ribosomal protein L31 >gi|50840334|gb|AAT83001.1| 50S ribosomal protein L31 [Propionibacterium acnes KPA171202] (69 aa)
Score = 106, Expect = 1.4e-03, Identities = 23/65 (35%), Positives = 33/65 (50%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H    E +  C +C +TF  +ST  +   + DVCS CHPFY G        GR  +F ++
  S:     1 MKQGIHPDYRETTVVC-TCGNTFTTRSTSQSGTLNADVCSKCHPFYTGKQKILDAGGRVARFERR 64
>gi|28198655|ref|NP_778969.1| 50S ribosomal protein L31 type B [Xylella fastidiosa Temecula1] >gi|182681339|ref|YP_001829499.1| ribosomal protein L31 [Xylella fastidiosa M23] >gi|31076885|sp|Q87DD6|RL31B_XYLFT 50S ribosomal protein L31 type B >gi|28056746|gb|AAO28618.1| 50S ribosomal protein L31 [Xylella fastidiosa Temecula1] >gi|182631449|gb|ACB92225.1| ribosomal protein L31 [Xylella fastidiosa M23] (80 aa)
Score = 106, Expect = 1.4e-03, Identities = 26/65 (40%), Positives = 38/65 (58%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETS------------IDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK E H    EV F+  + N  F+ +ST+ TKET+            +++ S+ HPFY G        GR +KF K+
  S:     1 MKPEIHPIYREVVFHDVTSNFKFLTRSTMGTKETTLWEDGLEYPLVKVEISSASHPFYTGKHKLVDTSGRIDKFKKR 77
>gi|116628937|ref|YP_814109.1| 50S ribosomal protein L31 type B [Lactobacillus gasseri ATCC 33323] >gi|116094519|gb|ABJ59671.1| LSU ribosomal protein L31P [Lactobacillus gasseri ATCC 33323] (83 aa)
Score = 105, Expect = 1.5e-03, Identities = 28/65 (43%), Positives = 36/65 (55%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET-----------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           M+K  H    EV F  ++  + FV  STL  +ET            +++ S  HPFY G     Q  GR EKFNKK
  S:     1 MRKGIHPDYQEVVFMDSATGAKFVAGSTLKPEETIEFEGKTYPLVRVEISSDSHPFYTGKQKFAQADGRIEKFNKK 76
>gi|153836756|ref|ZP_01989423.1| ribosomal protein L31 [Vibrio parahaemolyticus AQ3810] >gi|149749902|gb|EDM60647.1| ribosomal protein L31 [Vibrio parahaemolyticus AQ3810] (86 aa)
Score = 105, Expect = 1.5e-03, Identities = 28/65 (43%), Positives = 35/65 (53%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET------------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK   H     V F+  S +  FVV STL T  T            ++DV SS HPFY G     Q +GR   FN++
  S:     1 MKLGIHPDYRPVVFHDTSVDEYFVVGSTLKTDRTIEWKDGKTYPYFTLDVSSSSHPFYTGKQRVVQAEGRIANFNRR 77
>gi|118474643|ref|YP_891489.1| 50S ribosomal protein L31 [Campylobacter fetus subsp. fetus 82-40] >gi|118413869|gb|ABK82289.1| ribosomal protein L31 [Campylobacter fetus subsp. fetus 82-40] (66 aa)
Score = 105, Expect = 1.6e-03, Identities = 28/65 (43%), Positives = 37/65 (56%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MKK+ H +  E +  CA C +TF  KS  N  E  +D+CS CHPF+ G+       GR +KF KK
  S:     1 MKKDIHPEYVECTVTCA-CGNTFTSKS--NKSEIRVDICSECHPFFTGSEKIVDSAGRVDKFKKK 62
>gi|42518355|ref|NP_964285.1| 50S ribosomal protein L31 type B [Lactobacillus johnsonii NCC 533] >gi|73621759|sp|Q74LB6|RL31B_LACJO 50S ribosomal protein L31 type B >gi|41582640|gb|AAS08251.1| 50S ribosomal protein L31 [Lactobacillus johnsonii NCC 533] (83 aa)
Score = 105, Expect = 1.7e-03, Identities = 28/65 (43%), Positives = 36/65 (55%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET-----------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           M+K  H    EV F  ++  + FV  STL  +ET            +++ S  HPFY G     Q  GR EKFNKK
  S:     1 MRKGIHPDYQEVVFMDSATGAKFVAGSTLKPEETIEFEGKTYPLVRVEISSDSHPFYTGKQKFAQADGRIEKFNKK 76
>gi|71735453|ref|YP_272689.1| 50S ribosomal protein L31 [Pseudomonas syringae pv. phaseolicola 1448A] >gi|148878610|sp|Q48PI0|RL31_PSE14 50S ribosomal protein L31 >gi|71556006|gb|AAZ35217.1| ribosomal protein L31 [Pseudomonas syringae pv. phaseolicola 1448A] (73 aa)
Score = 105, Expect = 1.7e-03, Identities = 24/65 (36%), Positives = 33/65 (50%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK + H     +   C SC +    +STL     S+DVC+ CHPFY G   +  V GR +KF  +
  S:     1 MKADIHPVYEAIDATC-SCGNVIKTRSTL-AAPLSLDVCNECHPFYTGKQKTLDVGGRVDKFKSR 63
>gi|186475712|ref|YP_001857182.1| ribosomal protein L31 [Burkholderia phymatum STM815] >gi|184192171|gb|ACC70136.1| ribosomal protein L31 [Burkholderia phymatum STM815] (87 aa)
Score = 105, Expect = 1.8e-03, Identities = 30/65 (46%), Positives = 37/65 (56%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETS-----------IDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H    EV F   S +  FV +ST+ T+ET+           I+V S  HPFY G        GR EKFNKK
  S:     1 MKEGIHPDYREVLFIDMSNDFKFVTRSTIQTRETAEFNGKTYPLAKIEVSSESHPFYTGQQKIMDTAGRVEKFNKK 76
>gi|152991301|ref|YP_001357023.1| 50S ribosomal protein L31 [Nitratiruptor sp. SB155-2] >gi|151423162|dbj|BAF70666.1| 50S ribosomal protein L31 [Nitratiruptor sp. SB155-2] (66 aa)
Score = 105, Expect = 1.8e-03, Identities = 26/65 (40%), Positives = 36/65 (55%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           M+K+ H +  E    CA C + FVV S  N  +  ID+C+ CHPF+ G+       GR +KF KK
  S:     1 MRKDIHPEYVECEVTCA-CGNHFVVMS--NKPQLKIDICNKCHPFFTGSEKIVDTTGRVDKFKKK 62
>gi|104779605|ref|YP_606103.1| 50S ribosomal protein L31 [Pseudomonas entomophila L48] >gi|95108592|emb|CAK13286.1| 50S ribosomal protein L31 [Pseudomonas entomophila L48] (71 aa)
Score = 105, Expect = 1.9e-03, Identities = 25/62 (40%), Positives = 33/62 (53%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKF 64
           MK + H     V+  C SC + F  +STL +   +IDVC+ CHPFY G        GR +KF
  S:     1 MKADIHPNYEVVAVTC-SCGNKFETRSTLGSV-LAIDVCNLCHPFYTGKQKVLDTGGRVQKF 60
>gi|21223719|ref|NP_629498.1| 50S ribosomal protein L31 [Streptomyces coelicolor A3(2)] >gi|17433245|sp|Q9K4E5|RL31_STRCO 50S ribosomal protein L31 >gi|8568781|emb|CAB94530.1| 50S ribosomal protein L31 [Streptomyces coelicolor A3(2)] (74 aa)
Score = 105, Expect = 1.9e-03, Identities = 21/65 (32%), Positives = 34/65 (52%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK++ H +  E   +C +C ++F  +ST+ +     +VCS CHPFY G        GR  +F  +
  S:     1 MKRDIHPEYVETQVSC-TCGASFTTRSTIESGTIRAEVCSECHPFYTGKQKILDTGGRVARFEAR 64
>gi|21672816|ref|NP_660883.1| 50S ribosomal protein L31 [Buchnera aphidicola str. Sg (Schizaphis graminum)] >gi|25009094|sp|Q8K907|RL31_BUCAP 50S ribosomal protein L31 >gi|21623467|gb|AAM68094.1| 50S ribosomal protein L31 [Buchnera aphidicola str. Sg (Schizaphis graminum)] (72 aa)
Score = 104, Expect = 1.9e-03, Identities = 24/72 (33%), Positives = 40/72 (55%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQE 74
           MKK+ H   +++   C SC +   + ST+N    ++D+C+ CHPFY G        GR E+F K+   +K++
  S:     1 MKKKIHPAYSQIIATC-SCGNIIEIFSTVNVN-LNLDICAKCHPFYTGKQRIIDTGGRVERFKKRFKLIKKD 70
>gi|110636911|ref|YP_677118.1| 50S ribosomal protein L31P [Cytophaga hutchinsonii ATCC 33406] >gi|110279592|gb|ABG57778.1| LSU ribosomal protein L31P [Cytophaga hutchinsonii ATCC 33406] (80 aa)
Score = 104, Expect = 1.9e-03, Identities = 27/65 (41%), Positives = 38/65 (58%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET------------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H    EV F+  S +  F+ +ST+ T +T             ++V S+ HPFY G  M     GR EKFNK+
  S:     1 MKQGIHPDYREVVFHDMSADVKFISRSTIKTGDTITMEDGKSYPLVKLEVSSASHPFYTGQKMFLDTAGRVEKFNKR 77
>gi|156741980|ref|YP_001432109.1| ribosomal protein L31 [Roseiflexus castenholzii DSM 13941] >gi|156233308|gb|ABU58091.1| ribosomal protein L31 [Roseiflexus castenholzii DSM 13941] (100 aa)
Score = 104, Expect = 2.0e-03, Identities = 23/84 (27%), Positives = 41/84 (48%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQEPTKSENKNTKKQ 86
           MKK  H K       C +C S + V ST   +   +DVCS+CHPFY G        G+ ++F +++   + +  +   +  +++
  S:     1 MKKGIHPKHYYTQVVCGTCGSVWPVIST--RENMRVDVCSNCHPFYTGEQRIVDTAGQVDRFMRRLRTSQDQQAEIARRRAERE 82
>gi|163857464|ref|YP_001631762.1| 50S ribosomal protein L31 [Bordetella petrii DSM 12804] >gi|163261192|emb|CAP43494.1| 50S ribosomal protein L31 [Bordetella petrii] (171 aa)
Score = 104, Expect = 2.0e-03, Identities = 28/66 (42%), Positives = 35/66 (53%)
  Q:     2 IMKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET-----------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           IMK+  H +  EV F      + FV +ST+NT+ET             DV S  HPFY G        GR EKF  +
  S:    83 IMKEGIHPEYREVVFMDVQTGNKFVTRSTINTRETIDLDGKTYPLFKCDVTSESHPFYTGAQTRIVETGRVEKFRAR 159
>gi|118726296|ref|ZP_01574924.1| ribosomal protein L31 [Clostridium cellulolyticum H10] >gi|118664295|gb|EAV70929.1| ribosomal protein L31 [Clostridium cellulolyticum H10] (69 aa)
Score = 104, Expect = 2.0e-03, Identities = 28/72 (38%), Positives = 34/72 (47%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQE 74
           MK+  H   +E    CA C  TF   ST   K   +++CS CHPFY G        GR +KF KK   V  E
  S:     1 MKEGIHPDYSEAVVKCA-CGETFTTGST--KKSLHVEICSKCHPFYTGRQKLVDTGGRVDKFKKKYGIVDNE 69
>gi|157165671|ref|YP_001466040.1| 50S ribosomal protein L31 [Campylobacter concisus 13826] >gi|112801169|gb|EAT98513.1| ribosomal protein L31 [Campylobacter concisus 13826] (66 aa)
Score = 104, Expect = 2.1e-03, Identities = 28/65 (43%), Positives = 36/65 (55%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MKK+ H +  + +  CA C +TF  KS  N  E  ID+C  CHPF+ G+       GR EKF KK
  S:     1 MKKDIHPEYVDCTVTCA-CGNTFKTKS--NKSEIRIDICDKCHPFFTGSEKIVDSAGRVEKFKKK 62
>gi|161611071|ref|YP_265198.2| 50S ribosomal protein L31 type B [Psychrobacter arcticus 273-4] >gi|118572979|sp|Q4FQE4|RL31B_PSYA2 50S ribosomal protein L31 type B (93 aa)
Score = 104, Expect = 2.1e-03, Identities = 24/65 (36%), Positives = 37/65 (56%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETS-----------IDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           M+K+ H    EV F+  + +  F+ +ST+ TK T            +D+ S+ HPFY G       +GR   FNK+
  S:     1 MRKDIHPNYQEVLFHDTNADVFFLTRSTVKTKTTREYEGSEYPYYPLDISSASHPFYTGEQRKTSTEGRVASFNKR 76
>gi|27365191|ref|NP_760719.1| 50S ribosomal protein L31 type B [Vibrio vulnificus CMCP6] >gi|31076947|sp|Q8DBH7|RL31B_VIBVU 50S ribosomal protein L31 type B >gi|27361338|gb|AAO10246.1|AE016803_33 Ribosomal protein L31 family [Vibrio vulnificus CMCP6] (86 aa)
Score = 104, Expect = 2.2e-03, Identities = 27/65 (41%), Positives = 36/65 (55%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET------------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK   H +  +V F+  S +  FVV STL T  T            +I+V S  HPFY G     Q +GR   FN++
  S:     1 MKPGIHPEYRKVVFHDTSVDHYFVVGSTLQTDRTIEWEDGQTYPYFTIEVSSESHPFYTGKQRVVQKEGRVANFNRR 77
>gi|195962068|ref|ZP_03098273.1| 50S ribosomal protein L31 type B [Borrelia spielmanii A14S] (81 aa)
Score = 104, Expect = 2.2e-03, Identities = 28/65 (43%), Positives = 39/65 (60%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET------------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           M+K  H K N V F   S  + F+ +STLN+KET            ++++ S  HPFY G        GR +KFNK+
  S:     1 MRKGIHPKNNLVVFKDGSNGAMFLTRSTLNSKETIKYIDGKEYPLITVEITSKSHPFYTGQQKFVDAAGRIDKFNKR 77
>gi|91223453|ref|ZP_01258718.1| 50S ribosomal protein L31 [Vibrio alginolyticus 12G01] >gi|91191539|gb|EAS77803.1| 50S ribosomal protein L31 [Vibrio alginolyticus 12G01] (86 aa)
Score = 104, Expect = 2.2e-03, Identities = 28/72 (38%), Positives = 39/72 (54%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET------------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQE 74
           MK   H +   V F+  S +  FVV STL T+ T            ++DV S+ HP+Y G     Q +GR   FN++    K E
  S:     1 MKPGIHPEYRPVVFHDTSVDKYFVVGSTLKTERTIEWKDGKTYPYFTLDVSSASHPYYTGKQRVVQTEGRIANFNRRFGQFKSE 84
>gi|111115054|ref|YP_709672.1| 50S ribosomal protein L31 type B [Borrelia afzelii PKo] >gi|167942562|ref|ZP_02529636.1| 50S ribosomal protein L31 type B [Borrelia afzelii ACA-1] >gi|123341390|sp|Q0SNT2|RL31B_BORAP 50S ribosomal protein L31 type B >gi|110890328|gb|ABH01496.1| ribosomal protein L31 [Borrelia afzelii PKo] (81 aa)
Score = 104, Expect = 2.3e-03, Identities = 28/65 (43%), Positives = 39/65 (60%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET------------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           M+K  H K N V F   S  + F+ +STLN+KET            ++++ S  HPFY G        GR +KFNK+
  S:     1 MRKGVHPKNNLVVFKDGSNGAMFLTRSTLNSKETIKYIDGKEYPLITVEITSKSHPFYTGQQKFVDAAGRIDKFNKR 77
>gi|51598490|ref|YP_072678.1| 50S ribosomal protein L31 type B [Borrelia garinii PBi] >gi|195947869|ref|ZP_03089055.1| 50S ribosomal protein L31 type B [Borrelia garinii PBr] >gi|73621751|sp|Q662D5|RL31B_BORGA 50S ribosomal protein L31 type B >gi|51573061|gb|AAU07086.1| ribosomal protein L31 [Borrelia garinii PBi] (81 aa)
Score = 104, Expect = 2.4e-03, Identities = 28/65 (43%), Positives = 39/65 (60%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET------------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           M+K  H K N V F   S  + F+ +STLN+KET            ++++ S  HPFY G        GR +KFNK+
  S:     1 MRKGVHPKNNLVVFKDGSNGAMFLTRSTLNSKETIKYTDGKEYPLITVEITSRSHPFYTGQQKFVDAAGRIDKFNKR 77
>gi|161378115|ref|NP_747188.2| 50S ribosomal protein L31 [Pseudomonas putida KT2440] >gi|31076911|sp|Q88CU3|RL31_PSEPK 50S ribosomal protein L31 (71 aa)
Score = 104, Expect = 2.4e-03, Identities = 26/62 (41%), Positives = 32/62 (51%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKF 64
           MK+  H     V+  C SC + F  +STL     SIDVC+ CHPFY G        GR +KF
  S:     1 MKEGIHPNYEVVAVTC-SCGNKFETRSTLGNV-LSIDVCNLCHPFYTGKQKVLDTGGRVQKF 60
>gi|71900669|ref|ZP_00682793.1| Ribosomal protein L31 [Xylella fastidiosa Ann-1] >gi|71729548|gb|EAO31655.1| Ribosomal protein L31 [Xylella fastidiosa Ann-1] (80 aa)
Score = 104, Expect = 2.4e-03, Identities = 26/65 (40%), Positives = 38/65 (58%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETS------------IDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK E H    EV F+  + N  F+ +ST+ TKET+            +++ S+ HPFY G        GR +KF K+
  S:     1 MKPEIHPIYREVVFHDVTSNFKFLTRSTMRTKETTLWEDGREYPLVKVEISSASHPFYTGKHKLVDTSGRIDKFKKR 77
>gi|188159778|ref|ZP_02998881.1| 50S ribosomal protein L31 [Mycoplasma mycoides subsp. mycoides LC str. GM12] (92 aa)
Score = 103, Expect = 2.5e-03, Identities = 25/78 (32%), Positives = 41/78 (52%)
  Q:    11 LNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQEPTKSENKNTKKQSK 88
            ++  F C +C S +V   T  ++E  +DVCS+CHPFY G      V GR E+F  K         ++E ++  +++K
  S:    11 FDQAKFICTTCASEWVC-GTSKSEEVRVDVCSNCHPFYTGAQTYTNVAGRVEQFKSKFAKRDTIKAQAEKQSQAQKAK 87
>gi|194290040|ref|YP_002005947.1| 50S ribosomal protein L31, type B subfamily [Cupriavidus taiwanensis] >gi|193223875|emb|CAQ69884.1| 50S ribosomal protein L31, type B subfamily [Cupriavidus taiwanensis] (86 aa)
Score = 103, Expect = 2.5e-03, Identities = 28/65 (43%), Positives = 37/65 (56%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET-----------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H    EV F   S + +F+ +ST+ TK+T            I+V S  HPFY GT       GR EKF +K
  S:     1 MKEGIHPNYREVVFQDMSSDFSFITRSTIQTKDTIVKDGKEYPLAKIEVSSESHPFYTGTQKIMDTAGRVEKFRQK 76
>gi|124002383|ref|ZP_01687236.1| 50S ribosomal protein L31 type B [Microscilla marina ATCC 23134] >gi|123992212|gb|EAY31580.1| 50S ribosomal protein L31 type B [Microscilla marina ATCC 23134] (90 aa)
Score = 103, Expect = 2.5e-03, Identities = 29/77 (37%), Positives = 42/77 (54%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET------------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQEPTKSE 79
           MKK+ H +  +V F   SC   F  +ST+ TK+T             ++V S  HPFY G ++     GR EKFN++        T+ E
  S:     1 MKKDIHPEYRDVVFKDTSCGFHFTTRSTVETKDTITMEDGNTYPLVKLEVTSESHPFYTGKNVLLDTAGRVEKFNRRFKKKSDNKTEEE 89
>gi|55981042|ref|YP_144339.1| 50S ribosomal protein L31 [Thermus thermophilus HB8] >gi|161611244|ref|YP_004683.2| 50S ribosomal protein L31 [Thermus thermophilus HB27] >gi|73621827|sp|Q72JR0|RL31_THET2 50S ribosomal protein L31 >gi|73621828|sp|Q5SJE1|RL31_THET8 50S ribosomal protein L31 >gi|116668226|pdb|2J01|4 Chain 4, Structure Of The Thermus Thermophilus 70s Ribosome Complexed With Mrna, Trna And Paromomycin (Part 2 Of 4). This File Contains The 50s Subunit From Molecule I. >gi|116668287|pdb|2J03|4 Chain 4, Structure Of The Thermus Thermophilus 70s Ribosome Complexed With Mrna, Trna And Paromomycin (Part 4 Of 4). This File Contains The 50s Subunit From Molecule Ii. >gi|119389759|pdb|2HGJ|3 Chain 3, Crystal Structure Of The 70s Thermus Thermophilus Ribosome Showing How The 16s 3'-End Mimicks Mrna E And P Codons. This Entry 2hgj Contains 50s Ribosomal Subunit. The 30s Ribosomal Subunit Can Be Found In Pdb Entry 2hgi. >gi|119389816|pdb|2HGQ|3 Chain 3, Crystal Structure Of The 70s Thermus Thermophilus Ribosome With Translocated And Rotated Shine-Dalgarno Duplex. This Entry 2hgq Contains 50s Ribosomal Subunit. The 30s Ribosomal Subunit Can Be Found In Pdb Entry 2hgp. >gi|119389872|pdb|2HGU|3 Chain 3, 70s T.Th. Ribosome Functional Complex With Mrna And E- And P-Site Trnas At 4.5a. This Entry 2hgu Contains 50s Ribosomal Subunit. The 30s Ribosomal Subunit Can Be Found In Pdb Entry 2hgr. >gi|157836514|pdb|2V47|4 Chain 4, Structure Of The Ribosome Recycling Factor Bound To The Thermus Thermophilus 70s Ribosome With Mrna, Asl-Phe And Trna-Fmet (Part 2 Of 4). This File Contains The 50s Subunit For Molecule 1. >gi|157836570|pdb|2V49|4 Chain 4, Structure Of The Ribosome Recycling Factor Bound To The Thermus Thermophilus 70s Ribosome With Mrna, Asl-Phe And Trna-Fmet (Part 4 Of 4). This File Contains The 50s Subunit Of Molecule 2. >gi|55772455|dbj|BAD70896.1| 50S ribosomal protein L31 [Thermus thermophilus HB8] (71 aa)
Score = 103, Expect = 2.6e-03, Identities = 22/65 (33%), Positives = 32/65 (49%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H KL      C   N   V+++     E  ++VCS CHPFY G       +GR E+F ++
  S:     1 MKEGIHPKLVPARIICGCGN---VIETYSTKPEIYVEVCSKCHPFYTGQQRFVDTEGRVERFQRR 62
>gi|15838135|ref|NP_298823.1| 50S ribosomal protein L31 type B [Xylella fastidiosa 9a5c] >gi|71274703|ref|ZP_00650991.1| Ribosomal protein L31 [Xylella fastidiosa Dixon] >gi|71902373|ref|ZP_00684342.1| Ribosomal protein L31 [Xylella fastidiosa Ann-1] >gi|170730056|ref|YP_001775489.1| 50S ribosomal protein L31 [Xylella fastidiosa M12] >gi|17433254|sp|Q9PD45|RL31B_XYLFA 50S ribosomal protein L31 type B >gi|9106572|gb|AAF84343.1|AE003983_5 50S ribosomal protein L31 [Xylella fastidiosa 9a5c] >gi|71164435|gb|EAO14149.1| Ribosomal protein L31 [Xylella fastidiosa Dixon] >gi|71727892|gb|EAO30126.1| Ribosomal protein L31 [Xylella fastidiosa Ann-1] >gi|167964849|gb|ACA11859.1| 50S ribosomal protein L31 [Xylella fastidiosa M12] (80 aa)
Score = 103, Expect = 2.6e-03, Identities = 26/65 (40%), Positives = 39/65 (60%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETS------------IDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK E H    EV F+  + N  F+ +ST++TKET+            +++ S+ HPFY G        GR +KF K+
  S:     1 MKPEIHPIYREVVFHDVTSNFKFLTRSTMSTKETTLWEDGREYPLVKVEISSASHPFYTGKHKLVDTSGRIDKFKKR 77
>gi|16762339|ref|NP_457956.1| 50S ribosomal protein L31 [Salmonella enterica subsp. enterica serovar Typhi str. CT18] >gi|16767362|ref|NP_462977.1| 50S ribosomal protein L31 [Salmonella typhimurium LT2] >gi|29143827|ref|NP_807169.1| 50S ribosomal protein L31 [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] >gi|56415940|ref|YP_153015.1| 50S ribosomal protein L31 [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|161617233|ref|YP_001591198.1| 50S ribosomal protein L31 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|162139514|ref|YP_218972.2| 50S ribosomal protein L31 [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|167543173|ref|ZP_02338748.1| hypothetical protein Sentent_07856 [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23] >gi|167551406|ref|ZP_02345161.1| hypothetical protein Sentente_13034 [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] >gi|167991673|ref|ZP_02572772.1| hypothetical protein Sententer_01000008_0100009526 [Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701] >gi|168233042|ref|ZP_02658100.1| hypothetical protein Sententerica_18806 [Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191] >gi|168244144|ref|ZP_02669076.1| hypothetical protein Senterienterica_21051 [Salmonella enterica subsp. enterica serovar Heidelberg str. SL486] >gi|168262997|ref|ZP_02684970.1| hypothetical protein Salmentericaenterica_18083 [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] >gi|168467443|ref|ZP_02701280.1| ribosomal protein L31 [Salmonella enterica subsp. enterica serovar Newport str. SL317] >gi|168476822|ref|ZP_02705845.1| hypothetical protein Salmoentericaenterica_19370 [Salmonella enterica subsp. enterica serovar Virchow str. SL491] >gi|194444203|ref|YP_002043359.1| ribosomal protein L31 [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194451289|ref|YP_002048099.1| ribosomal protein L31 [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194470252|ref|ZP_03076236.1| ribosomal protein L31 [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|194734838|ref|YP_002117017.1| ribosomal protein L31 [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|54039175|sp|P66192|RL31_SALTI 50S ribosomal protein L31 >gi|54041867|sp|P66191|RL31_SALTY 50S ribosomal protein L31 >gi|73621820|sp|Q57HC1|RL31_SALCH 50S ribosomal protein L31 >gi|73621821|sp|Q5PK51|RL31_SALPA 50S ribosomal protein L31 >gi|25295540|pir||AE0938 50S ribosomal protein L31 [imported] - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) >gi|16422663|gb|AAL22936.1| 50S ribosomal subunit protein L31 [Salmonella typhimurium LT2] >gi|16504643|emb|CAD09527.1| 50S ribosomal protein L31 [Salmonella enterica subsp. enterica serovar Typhi] >gi|29139463|gb|AAO71029.1| 50S ribosomal protein L31 [Salmonella enterica subsp. enterica serovar Typhi Ty2] >gi|56130197|gb|AAV79703.1| 50S ribosomal protein L31 [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|161366597|gb|ABX70365.1| hypothetical protein SPAB_05074 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|194402866|gb|ACF63088.1| ribosomal protein L31 [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194409593|gb|ACF69812.1| ribosomal protein L31 [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194456616|gb|EDX45455.1| ribosomal protein L31 [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|194710340|gb|ACF89561.1| ribosomal protein L31 [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|195630205|gb|EDX48845.1| ribosomal protein L31 [Salmonella enterica subsp. enterica serovar Newport str. SL317] (70 aa)
Score = 103, Expect = 2.7e-03, Identities = 24/65 (36%), Positives = 34/65 (52%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MKK  H    E++  C SC +     ST+   + ++DVC  CHPF+ G        GR E+FNK+
  S:     1 MKKGIHPNYVEITATC-SCGNVIKTHSTVG-HDLNLDVCGKCHPFFTGKQRVVDTGGRVERFNKR 63
>gi|108800852|ref|YP_641049.1| 50S ribosomal protein L31P [Mycobacterium sp. MCS] >gi|119869992|ref|YP_939944.1| 50S ribosomal protein L31P [Mycobacterium sp. KMS] >gi|126436450|ref|YP_001072141.1| 50S ribosomal protein L31P [Mycobacterium sp. JLS] >gi|108771271|gb|ABG09993.1| LSU ribosomal protein L31P [Mycobacterium sp. MCS] >gi|119696081|gb|ABL93154.1| LSU ribosomal protein L31P [Mycobacterium sp. KMS] >gi|126236250|gb|ABN99650.1| LSU ribosomal protein L31P [Mycobacterium sp. JLS] (81 aa)
Score = 103, Expect = 2.8e-03, Identities = 24/65 (36%), Positives = 31/65 (47%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK   H    E +  C  C +TF  +ST  T    ++VCS CHPFY G        GR  +F K+
  S:     1 MKTGIHPDYVETTVQCG-CGNTFTTRSTKKTGNIVVEVCSQCHPFYTGKQKILDSGGRVARFEKR 64
>gi|114776737|ref|ZP_01451780.1| 50S ribosomal protein L31 [Mariprofundus ferrooxydans PV-1] >gi|114552823|gb|EAU55254.1| 50S ribosomal protein L31 [Mariprofundus ferrooxydans PV-1] (71 aa)
Score = 103, Expect = 2.9e-03, Identities = 26/65 (40%), Positives = 35/65 (53%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK + H +       C SC +TF  +ST    +  ++VCSSCHPFY G       +GR E+F KK
  S:     1 MKADIHPEYIASKVTC-SCGNTFETRSTHG--DIRVEVCSSCHPFYTGKQKVMDTEGRVERFYKK 62
>gi|66043666|ref|YP_233507.1| 50S ribosomal protein L31 [Pseudomonas syringae pv. syringae B728a] >gi|81308606|sp|Q4ZZF3|RL31_PSEU2 50S ribosomal protein L31 >gi|63254373|gb|AAY35469.1| Ribosomal protein L31 [Pseudomonas syringae pv. syringae B728a] (73 aa)
Score = 103, Expect = 2.9e-03, Identities = 24/65 (36%), Positives = 32/65 (49%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK + H     +   C SC +    +STL     S+DVC+ CHPFY G      V GR +KF  +
  S:     1 MKADIHPVYEAIDATC-SCGNVIKTRSTL-AAPLSLDVCNECHPFYTGKQKMLDVGGRVDKFKSR 63
>gi|15896142|ref|NP_349491.1| 50S ribosomal protein L31 [Clostridium acetobutylicum ATCC 824] >gi|17433222|sp|Q97F64|RL31_CLOAB 50S ribosomal protein L31 >gi|15025936|gb|AAK80831.1|AE007786_4 50S ribosomal protein L31 [Clostridium acetobutylicum ATCC 824] (70 aa)
Score = 103, Expect = 2.9e-03, Identities = 25/65 (38%), Positives = 36/65 (55%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           M+K+   + ++ +    +C +TF   ST   KE  +D+CS CHPF+ G      V GR EKF KK
  S:     1 MQKDIQPEYHQDAVVKCACGNTFTTGST--KKELKVDICSKCHPFFTGQQKIVDVGGRVEKFRKK 63
>gi|116620150|ref|YP_822306.1| 50S ribosomal protein L31P [Solibacter usitatus Ellin6076] >gi|116223312|gb|ABJ82021.1| LSU ribosomal protein L31P [Solibacter usitatus Ellin6076] (76 aa)
Score = 103, Expect = 2.9e-03, Identities = 25/70 (35%), Positives = 37/70 (52%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVK 72
           MK   H   NE+S  CA C  +   +ST +  +  +++CSSCHPF+ G        GR ++F KK  A +
  S:     1 MKAGIHPAYNEISVICA-CGHSLKTRST-HKGDMRVEICSSCHPFFTGKQKLMDTAGRIDRFEKKYKASR 68
>gi|50083679|ref|YP_045189.1| 50S ribosomal protein L31 type B [Acinetobacter sp. ADP1] >gi|73621742|sp|Q6FEZ1|RL31B_ACIAD 50S ribosomal protein L31 type B >gi|49529655|emb|CAG67367.1| 50S ribosomal protein L31 type B [Acinetobacter sp. ADP1] (82 aa)
Score = 103, Expect = 3.0e-03, Identities = 23/71 (32%), Positives = 42/71 (59%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET-----------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQ 73
           M++  H +  +V F+  + ++ F++ ST+ TK+T           ++D+ S+ HPFY G       +GR   FNK+    K+
  S:     1 MRQGIHPEYQQVLFHDTNADAYFIIGSTIQTKQTREYEGKVYPYVTLDISSASHPFYTGEVRQASNEGRVATFNKRFSRFKR 82
>gi|160945396|ref|ZP_02092622.1| hypothetical protein FAEPRAM212_02918 [Faecalibacterium prausnitzii M21/2] >gi|158443127|gb|EDP20132.1| hypothetical protein FAEPRAM212_02918 [Faecalibacterium prausnitzii M21/2] (66 aa)
Score = 103, Expect = 3.0e-03, Identities = 24/65 (36%), Positives = 33/65 (50%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H    + +  CA  N   V+K+     E  ++VCS CHPFY G        GR E+FNK+
  S:     1 MKQGIHPNYVDCTITCACGN---VIKTRSTKPEIHVEVCSKCHPFYTGKQKLVDTGGRVERFNKR 62
>gi|148266075|ref|YP_001232781.1| 50S ribosomal protein L31 [Geobacter uraniireducens Rf4] >gi|146399575|gb|ABQ28208.1| LSU ribosomal protein L31P [Geobacter uraniireducens Rf4] (65 aa)
Score = 103, Expect = 3.1e-03, Identities = 24/65 (36%), Positives = 35/65 (53%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H    EV+  C  C +TF  +ST    E S ++CS+CHPF+ G        GR E+F ++
  S:     1 MKEGIHPNYTEVTVKCL-CGNTFQTRST--KPEISTEICSACHPFFTGKQKLIDTAGRVERFKRR 62
>gi|15608438|ref|NP_215814.1| 50S ribosomal protein L31 [Mycobacterium tuberculosis H37Rv] >gi|15840748|ref|NP_335785.1| 50S ribosomal protein L31 [Mycobacterium tuberculosis CDC1551] >gi|31792491|ref|NP_854984.1| 50S ribosomal protein L31 [Mycobacterium bovis AF2122/97] >gi|121637227|ref|YP_977450.1| 50S ribosomal protein L31 [Mycobacterium bovis BCG str. Pasteur 1173P2] >gi|148661086|ref|YP_001282609.1| 50S ribosomal protein L31 [Mycobacterium tuberculosis H37Ra] >gi|148822516|ref|YP_001287270.1| 50S ribosomal protein L31 [Mycobacterium tuberculosis F11] >gi|167969625|ref|ZP_02551902.1| 50S ribosomal protein L31 [Mycobacterium tuberculosis H37Ra] >gi|194543608|ref|YP_002078637.1| 50S ribosomal protein L31 rpmE [Mycobacterium tuberculosis C] >gi|54039173|sp|P66188|RL31_MYCBO 50S ribosomal protein L31 >gi|54041865|sp|P66187|RL31_MYCTU 50S ribosomal protein L31 >gi|1322422|emb|CAA97731.1| PROBABLE 50S RIBOSOMAL PROTEIN L31 RPME [Mycobacterium tuberculosis H37Rv] >gi|13880940|gb|AAK45599.1| ribosomal protein L31 [Mycobacterium tuberculosis CDC1551] >gi|31618080|emb|CAD94191.1| PROBABLE 50S RIBOSOMAL PROTEIN L31 RPME [Mycobacterium bovis AF2122/97] >gi|121492874|emb|CAL71345.1| Probable 50S ribosomal protein l31 rpmE [Mycobacterium bovis BCG str. Pasteur 1173P2] >gi|124600615|gb|EAY59625.1| 50S ribosomal protein L31 rpmE [Mycobacterium tuberculosis C] >gi|134149709|gb|EBA41754.1| 50S ribosomal protein L31 rpmE [Mycobacterium tuberculosis str. Haarlem] >gi|148505238|gb|ABQ73047.1| 50S ribosomal protein L31 [Mycobacterium tuberculosis H37Ra] >gi|148721043|gb|ABR05668.1| 50S ribosomal protein L31 rpmE [Mycobacterium tuberculosis F11] (80 aa)
Score = 103, Expect = 3.1e-03, Identities = 23/65 (35%), Positives = 31/65 (47%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK + H    E +  C  C +TF  +ST       ++VCS CHPFY G        GR  +F K+
  S:     1 MKSDIHPAYEETTVVCG-CGNTFQTRSTKPGGRIVVEVCSQCHPFYTGKQKILDSGGRVARFEKR 64
>gi|161506847|ref|YP_001576801.1| 50S ribosomal protein L31 type B [Lactobacillus helveticus DPC 4571] >gi|160347836|gb|ABX26510.1| 50S ribosomal protein [Lactobacillus helveticus DPC 4571] (81 aa)
Score = 103, Expect = 3.1e-03, Identities = 27/65 (41%), Positives = 36/65 (55%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET-----------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H    +V F  ++  + F+  STL  +ET            ++V S  HPFY G     Q  GR EKFNKK
  S:     1 MKQGIHPDFQKVVFMDSATGAKFLAGSTLKPEETVDYEGETYPLVRVEVSSDSHPFYTGKQKFAQADGRIEKFNKK 76
>gi|167036126|ref|YP_001671357.1| 50S ribosomal protein L31 [Pseudomonas putida GB-1] >gi|166862614|gb|ABZ01022.1| ribosomal protein L31 [Pseudomonas putida GB-1] (71 aa)
Score = 102, Expect = 3.3e-03, Identities = 26/62 (41%), Positives = 32/62 (51%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKF 64
           MK+  H     V+  C SC + F  +STL     SIDVC+ CHPFY G        GR +KF
  S:     1 MKEGIHPNYEVVAVTC-SCGNKFETRSTLGNV-LSIDVCNLCHPFYTGKQKVLDTGGRVQKF 60
>gi|37680754|ref|NP_935363.1| 50S ribosomal protein L31 type B [Vibrio vulnificus YJ016] >gi|39931704|sp|Q7MIE7|RL31B_VIBVY 50S ribosomal protein L31 type B >gi|37199503|dbj|BAC95334.1| ribosomal protein L31 [Vibrio vulnificus YJ016] (86 aa)
Score = 102, Expect = 3.3e-03, Identities = 27/65 (41%), Positives = 36/65 (55%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET------------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK   H +  +V F+  S +  FVV STL T  T            +I+V S  HPFY G     Q +GR   FN++
  S:     1 MKPGIHPEYRKVVFHDTSVDHYFVVGSTLQTDRTIEWEDGQTYPYFTIEVSSESHPFYTGKQRVVQKEGRVANFNRR 77
>gi|167729172|emb|CAO80083.1| 50S ribosomal subunit protein L31 [Candidatus Cloacamonas acidaminovorans] (69 aa)
Score = 102, Expect = 3.5e-03, Identities = 28/65 (43%), Positives = 37/65 (56%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MKK  H K   V+  CA C +TF  +ST +  +  +++C+ CHPFY G        GR EKFNKK
  S:     1 MKKGIHPKYELVTVTCA-CGNTFQTRSTKD--KLQVEICNVCHPFYTGKQKIVDTAGRVEKFNKK 62
>gi|78778104|ref|YP_394419.1| 50S ribosomal protein L31 [Sulfurimonas denitrificans DSM 1251] >gi|148880092|sp|Q30P97|RL31_THIDN 50S ribosomal protein L31 >gi|78498644|gb|ABB45184.1| LSU ribosomal protein L31P [Sulfurimonas denitrificans DSM 1251] (66 aa)
Score = 102, Expect = 3.5e-03, Identities = 26/65 (40%), Positives = 37/65 (56%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MKK+ H KL E +  C SC ++F  K+     E  ID+C+ CHPF+ G+       GR +KF K+
  S:     1 MKKDIHPKLVECTVTC-SCGNSF--KNESQKSEMRIDICNECHPFFTGSERMVDTAGRIDKFKKR 62
>gi|49082450|gb|AAT50625.1| PA5049 [synthetic construct] (72 aa)
Score = 102, Expect = 3.8e-03, Identities = 23/65 (35%), Positives = 32/65 (49%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK + H     +   C SC +    +STL  K   +DVCS CHPFY G        GR ++F ++
  S:     1 MKADIHPTYEAIEATC-SCGNVIKTRSTL-CKPIHLDVCSECHPFYTGKQKVLDTGGRIDRFKQR 63
>gi|145297235|ref|YP_001140076.1| ribosomal protein L31 [Aeromonas salmonicida subsp. salmonicida A449] >gi|142850007|gb|ABO88328.1| ribosomal protein L31 [Aeromonas salmonicida subsp. salmonicida A449] (71 aa)
Score = 102, Expect = 3.8e-03, Identities = 25/65 (38%), Positives = 36/65 (55%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK   H +   ++  C SC +     ST+  K+ ++DVCS+CHPFY G        GR +KFNK+
  S:     1 MKAGIHPEYVAITAKC-SCGNVINTFSTMG-KDLNLDVCSACHPFYTGKQKEVSSGGRVDKFNKR 63
>gi|40062600|gb|AAR37529.1| ribosomal protein L31 [uncultured marine bacterium 311] (134 aa)
Score = 102, Expect = 3.8e-03, Identities = 31/86 (36%), Positives = 47/86 (54%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQEPTKSENKNTKKQSK 88
           M++E H +  E+   C SC +   +KSTL  ++  +DVCS+CHPFY G        GR E+F K+    K +P     ++T K+ K
  S:     1 MRQEIHPEYTEIKATC-SCGNVIAIKSTLK-EDIKLDVCSACHPFYTGKQKLVDTGGRVERFEKR-FGKKGKPKDQNKEDTIKEPK 83
>gi|156305261|ref|XP_001617543.1| hypothetical protein NEMVEDRAFT_v1g157359 [Nematostella vectensis] >gi|156194464|gb|EDO25443.1| predicted protein [Nematostella vectensis] (71 aa)
Score = 102, Expect = 3.9e-03, Identities = 22/65 (33%), Positives = 33/65 (50%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK + H     ++  C SC +    +STL  K   +DVC+ CHPFY G        GR ++F ++
  S:     1 MKADIHPNYVAITATC-SCGNVIETRSTLG-KALPLDVCNECHPFYTGKQKMLDTGGRVDRFKQR 63
>gi|83319835|ref|YP_424131.1| 50S ribosomal protein L31 [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|83283721|gb|ABC01653.1| ribosomal protein L31 [Mycoplasma capricolum subsp. capricolum ATCC 27343] (92 aa)
Score = 102, Expect = 3.9e-03, Identities = 23/78 (29%), Positives = 40/78 (51%)
  Q:    11 LNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQEPTKSENKNTKKQSK 88
            ++  F C +C + +V   T   +E  +DVCS+CHPFY G      V GR E+F  K         +++ ++  +++K
  S:    11 FDQAKFICTTCANEWVC-GTSKGEEVRVDVCSNCHPFYTGAQTYANVAGRVEQFRSKFAKRDTIKAEAQKQSAAQKAK 87
>gi|152985742|ref|YP_001351105.1| 50S ribosomal protein L31 [Pseudomonas aeruginosa PA7] >gi|150960900|gb|ABR82925.1| ribosomal protein L31 [Pseudomonas aeruginosa PA7] (71 aa)
Score = 102, Expect = 3.9e-03, Identities = 23/65 (35%), Positives = 32/65 (49%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK + H     +   C SC +    +STL  K   +DVCS CHPFY G        GR ++F ++
  S:     1 MKADIHPAYEAIEATC-SCGNVIKTRSTL-CKPIHLDVCSECHPFYTGKQKVLDTGGRIDRFKQR 63
>gi|163727086|ref|ZP_02134585.1| ribosomal protein L31 [Desulfatibacillum alkenivorans AK-01] >gi|161399633|gb|EDQ23902.1| ribosomal protein L31 [Desulfatibacillum alkenivorans AK-01] (76 aa)
Score = 101, Expect = 4.3e-03, Identities = 24/79 (30%), Positives = 39/79 (49%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQEPTKSENK 81
           MKK+ H K       CA C +T    ST++  + ++++CS CHPF+ G        GR E+F +K     Q     +++
  S:     1 MKKDIHPKYETTVIRCA-CGATVEAGSTVD--DLTVEICSQCHPFFTGKQKLVDTAGRIERFRRKYAKFNQAQEAKQDQ 76
>gi|116515289|ref|YP_802918.1| 50S ribosomal protein L31 [Buchnera aphidicola str. Cc (Cinara cedri)] >gi|116257143|gb|ABJ90825.1| 50S ribosomal protein L31 [Buchnera aphidicola str. Cc (Cinara cedri)] (69 aa)
Score = 101, Expect = 4.3e-03, Identities = 26/65 (40%), Positives = 37/65 (56%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MKK  H +  ++   C SC  T  + ST  + + S+DVCS CHPFY G   +   KGR ++F K+
  S:     1 MKKNIHPEYKKIFATC-SCGYTIPIFST-KSSDMSLDVCSQCHPFYTGKQRTMNKKGRIQRFKKR 63
>gi|186456515|ref|ZP_02966828.1| ribosomal protein L31 [bacterium Ellin514] >gi|184207288|gb|EDU04334.1| ribosomal protein L31 [bacterium Ellin514] (80 aa)
Score = 101, Expect = 4.3e-03, Identities = 23/66 (34%), Positives = 35/66 (53%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKV 68
           MK + H K  E    CA C +    +ST N+    + +C++CHPFY GT       GR +KF +++
  S:     1 MKADLHPKYQESELRCA-CGNIIKTRSTRNS--LLLGICNACHPFYTGTQKFVDTAGRVDKFQQRM 63
>gi|189502151|ref|YP_001957868.1| hypothetical protein Aasi_0758 [Candidatus Amoebophilus asiaticus 5a2] >gi|189497592|gb|ACE06139.1| hypothetical protein Aasi_0758 [Candidatus Amoebophilus asiaticus 5a2] (82 aa)
Score = 101, Expect = 4.3e-03, Identities = 28/65 (43%), Positives = 38/65 (58%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET------------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MKK  H    EV F   S N  F+ +STLN++ET             +++ S+ HPFY G  +     GR EKF +K
  S:     1 MKKGIHPTYREVVFLDTSSNFKFLTRSTLNSRETIKWEDGQEYPLIKVELSSASHPFYTGKKIFVDTAGRVEKFQQK 77
>gi|124515210|gb|EAY56721.1| Ribosomal protein L31 [Leptospirillum sp. Group II UBA] (68 aa)
Score = 101, Expect = 4.3e-03, Identities = 24/71 (33%), Positives = 38/71 (53%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQ 73
           MK   H +    +  CA C +TFV ++T+      +D+C+ CHPF+ GT      +GR ++F KK    K+
  S:     1 MKSGIHPEYKVATVVCA-CGNTFVTRTTIGN--VKLDICNECHPFFTGTQKIVDTEGRVDRFMKKYAQGKK 68
>gi|146296533|ref|YP_001180304.1| 50S ribosomal protein L31 [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145410109|gb|ABP67113.1| LSU ribosomal protein L31P [Caldicellulosiruptor saccharolyticus DSM 8903] (69 aa)
Score = 101, Expect = 4.3e-03, Identities = 23/65 (35%), Positives = 33/65 (50%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H+     +    +C  TF+  ST   KE  +++CS CHPF+ G        GR E+F KK
  S:     1 MKEGIHLTYYHDAVVRCACGETFITGST--KKEIHVEICSKCHPFFTGKQKFVDTTGRVERFMKK 63
>gi|134102729|ref|YP_001108390.1| 50S ribosomal protein L31 [Saccharopolyspora erythraea NRRL 2338] >gi|133915352|emb|CAM05465.1| 50S ribosomal protein L31 [Saccharopolyspora erythraea NRRL 2338] (70 aa)
Score = 101, Expect = 4.4e-03, Identities = 20/65 (30%), Positives = 33/65 (50%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK   H +      NC  C ++F  +ST  + + ++++CS+CHPFY G        GR  +F  +
  S:     1 MKSGIHPEYVTTQVNCG-CGNSFTTRSTRTSGQITVEICSNCHPFYTGKQKILDTGGRVARFEAR 64
>gi|38233449|ref|NP_939216.1| 50S ribosomal protein L31 type B [Corynebacterium diphtheriae NCTC 13129] >gi|73621755|sp|Q6NIC5|RL31B_CORDI 50S ribosomal protein L31 type B >gi|38199709|emb|CAE49369.1| 50S ribosomal protein L31 type B-2 [Corynebacterium diphtheriae] (88 aa)
Score = 101, Expect = 4.4e-03, Identities = 26/71 (36%), Positives = 36/71 (50%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETS------------IDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQ 73
           MKK+ H   + V F  A     F+ KST  +  T             +DV S  HPF+ G        GR EKFN++  A+ +
  S:     1 MKKDIHPDYHPVVFQDAGTGHQFLTKSTATSDRTVAWEDGNEYPLIVVDVTSESHPFWTGAQRVMDTAGRVEKFNQRYGALAR 83
>gi|58336604|ref|YP_193189.1| 50S ribosomal protein L31 type B [Lactobacillus acidophilus NCFM] >gi|73621758|sp|Q5FMB6|RL31B_LACAC 50S ribosomal protein L31 type B >gi|58253921|gb|AAV42158.1| ribosomal protein [Lactobacillus acidophilus NCFM] (81 aa)
Score = 101, Expect = 4.7e-03, Identities = 27/65 (41%), Positives = 36/65 (55%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET-----------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H    +V F  ++  + FV  ST+  +ET            ++V S  HPFY G     Q  GR EKFNKK
  S:     1 MKQGIHPDFQKVVFMDSATGAKFVAGSTMKPEETIEYEGETYPLVRVEVSSDSHPFYTGKQKFAQADGRIEKFNKK 76
>gi|94311075|ref|YP_584285.1| 50S ribosomal protein L31P [Ralstonia metallidurans CH34] >gi|148878580|sp|Q1LLG0|RL31B_RALME 50S ribosomal protein L31 type B >gi|93354927|gb|ABF09016.1| LSU ribosomal protein L31P [Ralstonia metallidurans CH34] (86 aa)
Score = 101, Expect = 4.7e-03, Identities = 29/65 (44%), Positives = 37/65 (56%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET-----------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H    EV F+  S +  FV +ST+ TK+T            I+V S  HPFY GT       GR EKF +K
  S:     1 MKEGIHPNYREVLFHDVSNDFKFVTRSTIQTKDTIEHEGKTYPLAKIEVSSESHPFYTGTQKIMDTAGRVEKFRQK 76
>gi|166154243|ref|YP_001654361.1| 50S ribosomal protein L31 type B [Chlamydia trachomatis 434/Bu] >gi|166155118|ref|YP_001653373.1| 50S ribosomal protein L31 type B [Chlamydia trachomatis L2b/UCH-1/proctitis] >gi|165930231|emb|CAP03716.1| LSU ribosomal protein L31P [Chlamydia trachomatis 434/Bu] >gi|165931106|emb|CAP06670.1| LSU ribosomal protein L31P [Chlamydia trachomatis L2b/UCH-1/proctitis] (108 aa)
Score = 101, Expect = 4.9e-03, Identities = 29/77 (37%), Positives = 41/77 (53%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSI-----------DVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQEPTKSE 79
           MKK TH +  +V F  +S    FV  ST  T +T +            + SS HPF+ G+      +GR +KF K+   +KQ   K E
  S:     1 MKKNTHPEYRQVLFVDSSTGYKFVCGSTYQTDKTEVFEGQEYPVCYVSISSSSHPFFTGSKKLVDAEGRVDKFLKRYSGIKQSAPKPE 88
>gi|32491028|ref|NP_871282.1| hypothetical protein WGLp279 [Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis] >gi|31076943|sp|Q8D2S5|RL31_WIGBR 50S ribosomal protein L31 >gi|25166234|dbj|BAC24425.1| rpmE [Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis] (71 aa)
Score = 101, Expect = 4.9e-03, Identities = 26/65 (40%), Positives = 38/65 (58%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MKK+ H    ++   C SC ++  +KST+  K+  +DVC+ CHPFY GT     + GR  KF K+
  S:     1 MKKKIHPMSLDILATC-SCGNSLKIKSTIK-KDILLDVCNKCHPFYTGTQKKLNIGGRVSKFKKR 63
>gi|15644432|ref|NP_229484.1| ribosomal protein L31 [Thermotoga maritima MSB8] >gi|148270114|ref|YP_001244574.1| ribosomal protein L31 [Thermotoga petrophila RKU-1] >gi|6226690|sp|O54311|RL31_THEMA 50S ribosomal protein L31 >gi|4982260|gb|AAD36751.1|AE001809_3 ribosomal protein L31 [Thermotoga maritima MSB8] >gi|147735658|gb|ABQ46998.1| LSU ribosomal protein L31P [Thermotoga petrophila RKU-1] (71 aa)
Score = 101, Expect = 4.9e-03, Identities = 26/65 (40%), Positives = 37/65 (56%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYI----GTSMSQQVKGRAEKFNKK 67
           MKK  H ++  V+  CA C +     +T++     IDVCS+CHPFY     G  +    +GR EKF +K
  S:     1 MKKGIHPEMKLVTVKCA-CGAEHTFYTTVDN--IRIDVCSNCHPFYTSGGKGGVLIVDTEGRVEKFRRK 66
>gi|104773510|ref|YP_618490.1| 50S ribosomal protein L31 type B [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|116513505|ref|YP_812411.1| 50S ribosomal protein L31 type B [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|148878576|sp|Q1GBQ0|RL31B_LACDA 50S ribosomal protein L31 type B >gi|103422591|emb|CAI97194.1| 50S ribosomal protein L31 [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|116092820|gb|ABJ57973.1| LSU ribosomal protein L31P [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (83 aa)
Score = 101, Expect = 5.0e-03, Identities = 28/65 (43%), Positives = 34/65 (52%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET-----------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MKK  H    EV F  A+    FV  STL + ET            +++ S  HPFY G        GR E+FNKK
  S:     1 MKKGIHPDYQEVCFMDAATGFKFVAGSTLKSSETVEFEGNTYPLIRVEISSDSHPFYTGKQKFAAADGRIERFNKK 76
>gi|120405294|ref|YP_955123.1| ribosomal protein L31 [Mycobacterium vanbaalenii PYR-1] >gi|119958112|gb|ABM15117.1| LSU ribosomal protein L31P [Mycobacterium vanbaalenii PYR-1] (74 aa)
Score = 101, Expect = 5.1e-03, Identities = 22/65 (33%), Positives = 33/65 (50%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK   H    E +  C  C ++F  +ST  + + +++VCS CHPFY G        GR  +F K+
  S:     1 MKSGIHPDYVETTVLCG-CGASFTTRSTKQSGQITVEVCSQCHPFYTGKQKILDSGGRVARFEKR 64
>gi|158520488|ref|YP_001528358.1| ribosomal protein L31 [Desulfococcus oleovorans Hxd3] >gi|158509314|gb|ABW66281.1| ribosomal protein L31 [Desulfococcus oleovorans Hxd3] (73 aa)
Score = 101, Expect = 5.2e-03, Identities = 24/74 (32%), Positives = 40/74 (54%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQEPT 76
           MK+E H + ++ +  CA C + F V ST   +   +++CS CHPF+ G        GR E+F +K    +Q+ +
  S:     1 MKQEIHPEYHQATARCA-CGNEFTVGST--KESIKVEICSQCHPFFTGKQKLVDTAGRIERFRRKYAKFEQQKS 71
>gi|196229466|ref|ZP_03128331.1| ribosomal protein L31 [Chthoniobacter flavus Ellin428] >gi|196226698|gb|EDY21203.1| ribosomal protein L31 [Chthoniobacter flavus Ellin428] (73 aa)
Score = 101, Expect = 5.3e-03, Identities = 21/65 (32%), Positives = 35/65 (53%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK + H    E +  CA C + +  +ST   ++  I +C++CHPF+ G        GR EKF+++
  S:     1 MKADIHPDYQETAIACA-CGTVYHTRST--KRDLKIGICAACHPFFTGEQKFVDTAGRIEKFSRR 62
>gi|15600242|ref|NP_253736.1| 50S ribosomal protein L31 [Pseudomonas aeruginosa PAO1] >gi|107104149|ref|ZP_01368067.1| hypothetical protein PaerPA_01005222 [Pseudomonas aeruginosa PACS2] >gi|116053197|ref|YP_793518.1| 50S ribosomal protein L31 [Pseudomonas aeruginosa UCBPP-PA14] >gi|194549229|ref|YP_002084257.1| 50S ribosomal protein L31 [Pseudomonas aeruginosa C3719] >gi|194555054|ref|YP_002090081.1| 50S ribosomal protein L31 [Pseudomonas aeruginosa 2192] >gi|17433241|sp|Q9HUD0|RL31_PSEAE 50S ribosomal protein L31 >gi|9951340|gb|AAG08434.1|AE004918_4 50S ribosomal protein L31 [Pseudomonas aeruginosa PAO1] >gi|115588418|gb|ABJ14433.1| 50S ribosomal protein L31 [Pseudomonas aeruginosa UCBPP-PA14] >gi|126170175|gb|EAZ55686.1| 50S ribosomal protein L31 [Pseudomonas aeruginosa C3719] >gi|126197447|gb|EAZ61510.1| 50S ribosomal protein L31 [Pseudomonas aeruginosa 2192] (71 aa)
Score = 101, Expect = 5.3e-03, Identities = 23/65 (35%), Positives = 32/65 (49%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK + H     +   C SC +    +STL  K   +DVCS CHPFY G        GR ++F ++
  S:     1 MKADIHPTYEAIEATC-SCGNVIKTRSTL-CKPIHLDVCSECHPFYTGKQKVLDTGGRIDRFKQR 63
>gi|126647332|ref|ZP_01719837.1| 50S ribosomal protein L31 [Algoriphagus sp. PR1] >gi|126576008|gb|EAZ80286.1| 50S ribosomal protein L31 [Algoriphagus sp. PR1] (82 aa)
Score = 100, Expect = 5.6e-03, Identities = 29/70 (41%), Positives = 36/70 (51%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET------------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVK 72
           MK + H    +V F   S    F+ KST+ T ET             I+V S  HPFY G  M     GR EKFN++    K
  S:     1 MKADIHPNYRDVVFYDTSSEFKFLTKSTIETSETIEWEDGKEYPVYKIEVSSQSHPFYTGKKMMLDTAGRVEKFNRRYAKKK 82
>gi|72162819|ref|YP_290476.1| 50S ribosomal protein L31 [Thermobifida fusca YX] >gi|134034937|sp|Q47M69|RL31_THEFY 50S ribosomal protein L31 >gi|71916551|gb|AAZ56453.1| LSU ribosomal protein L31P [Thermobifida fusca YX] (69 aa)
Score = 100, Expect = 5.6e-03, Identities = 22/65 (33%), Positives = 31/65 (47%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK   H   +     C +C ++FV +ST        ++CSSCHPFY G        GR  +F K+
  S:     1 MKPGIHPDYHVTQVTC-TCGNSFVTRSTAPNGVIRAEICSSCHPFYTGKQKILDTGGRVARFEKR 64
>gi|46196640|gb|AAS81056.1| LSU ribosomal protein L31P [Thermus thermophilus HB27] (97 aa)
Score = 100, Expect = 5.6e-03, Identities = 21/65 (32%), Positives = 32/65 (49%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           +K+  H KL      C   N   V+++     E  ++VCS CHPFY G       +GR E+F ++
  S:    27 VKEGIHPKLVPARIICGCGN---VIETYSTKPEIYVEVCSKCHPFYTGQQRFVDTEGRVERFQRR 88
>gi|126640468|ref|YP_001083452.1| 50S ribosomal protein L31 type B [Acinetobacter baumannii ATCC 17978] >gi|169634502|ref|YP_001708238.1| 50S ribosomal protein L31 type B [Acinetobacter baumannii SDF] >gi|169797356|ref|YP_001715149.1| 50S ribosomal protein L31 type B [Acinetobacter baumannii AYE] >gi|184156720|ref|YP_001845059.1| putative 50S ribosomal protein L31 type B [Acinetobacter baumannii ACICU] >gi|166230203|sp|A3M1Q6|RL31B_ACIBT 50S ribosomal protein L31 type B >gi|126386352|gb|ABO10850.1| 50S ribosomal protein L31 type B [Acinetobacter baumannii ATCC 17978] >gi|169150283|emb|CAM88180.1| 50S ribosomal protein L31 type B [Acinetobacter baumannii] >gi|169153294|emb|CAP02400.1| 50S ribosomal protein L31 type B [Acinetobacter baumannii] >gi|183208314|gb|ACC55712.1| putative 50S ribosomal protein L31 type B [Acinetobacter baumannii ACICU] (84 aa)
Score = 100, Expect = 5.7e-03, Identities = 23/65 (35%), Positives = 39/65 (60%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET-----------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           M+K+ H    +V F+  + +  F++ ST+ TK+T           ++D+ S+ HPFY G       +GR   FNK+
  S:     1 MRKDIHPAYQQVLFHDTNADVYFLIGSTIQTKQTKEYQGQVYPYVTLDISSASHPFYTGEVRQASNEGRVASFNKR 76
>gi|157736423|ref|YP_001489106.1| 50S ribosomal protein L31 [Arcobacter butzleri RM4018] >gi|157698277|gb|ABV66437.1| 50S ribosomal protein L31 [Arcobacter butzleri RM4018] (67 aa)
Score = 100, Expect = 6.0e-03, Identities = 27/65 (41%), Positives = 34/65 (52%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MKK+ H      +  CA C ++F  KS  N +   ID+CSSCHPF+ G        GR EKF  K
  S:     1 MKKDIHPDYKVCTVTCA-CGNSFETKS--NVETLKIDICSSCHPFFTGEQKLVDAAGRVEKFKAK 62
>gi|117620477|ref|YP_858620.1| ribosomal protein L31 [Aeromonas hydrophila subsp. hydrophila ATCC 7966] >gi|117561884|gb|ABK38832.1| ribosomal protein L31 [Aeromonas hydrophila subsp. hydrophila ATCC 7966] (75 aa)
Score = 100, Expect = 6.1e-03, Identities = 27/69 (39%), Positives = 36/69 (52%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAV 71
           MK   H     ++  C SC +     STL  K+ ++DVCS CHPFY G        GR +KFNK+  A+
  S:     5 MKAGIHPDYVAITAKC-SCGNVINTFSTLG-KDLNLDVCSECHPFYTGKQKEVSSGGRVDKFNKRFGAM 71
>gi|15827564|ref|NP_301827.1| 50S ribosomal protein L31 [Mycobacterium leprae TN] >gi|1173026|sp|P45834|RL31_MYCLE 50S ribosomal protein L31 >gi|699331|gb|AAA63092.1| rpmE [Mycobacterium leprae] >gi|13093114|emb|CAC31514.1| 50S ribosomal protein L31 [Mycobacterium leprae] (84 aa)
Score = 100, Expect = 6.2e-03, Identities = 28/80 (35%), Positives = 35/80 (43%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKV----VAVKQEPTKSENKN 82
           MK   H    E +  C  C +TF  +ST       ++VCS CHPFY G        GR  +F K+     V V Q     E  N
  S:     1 MKANIHPAYAETTVVCG-CGNTFQTRSTKPGGRIVVEVCSQCHPFYTGKQKILDSGGRVARFEKRYGKRKVGVDQVAAYPEQNN 83
>gi|162457311|ref|YP_001619678.1| 50S ribosomal protein L31 [Sorangium cellulosum 'So ce 56'] >gi|161167893|emb|CAN99198.1| 50S ribosomal protein L31 [Sorangium cellulosum 'So ce 56'] (68 aa)
Score = 100, Expect = 6.6e-03, Identities = 25/65 (38%), Positives = 33/65 (50%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK   H +    +  CA C +    +ST  +  T  DVCS+CHPFY G      V GR ++F KK
  S:     1 MKPGIHPEYKASTITCA-CGAVVETRSTRGSFTT--DVCSACHPFYTGKHKIMDVAGRVDRFRKK 62
>gi|90961327|ref|YP_535243.1| 50S ribosomal protein L31 type B [Lactobacillus salivarius UCC118] >gi|90820521|gb|ABD99160.1| LSU ribosomal protein L31P [Lactobacillus salivarius UCC118] (82 aa)
Score = 100, Expect = 6.6e-03, Identities = 25/65 (38%), Positives = 37/65 (56%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET------------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H   +EV F  ++    F+  ST N++ET             +++ S  HPFY G     Q  GR ++FNKK
  S:     1 MKQGIHPDYHEVVFMDSATGYKFLSGSTKNSEETIEWEDGNTYPLIRVEISSDSHPFYTGRQKFTQADGRVDRFNKK 77
>gi|118619170|ref|YP_907502.1| 50S ribosomal protein L31 [Mycobacterium ulcerans Agy99] >gi|183984070|ref|YP_001852361.1| 50S ribosomal protein L31 RpmE [Mycobacterium marinum M] >gi|118571280|gb|ABL06031.1| 50S ribosomal protein L31 RpmE [Mycobacterium ulcerans Agy99] >gi|183177396|gb|ACC42506.1| 50S ribosomal protein L31 RpmE [Mycobacterium marinum M] (81 aa)
Score = 100, Expect = 6.7e-03, Identities = 22/65 (33%), Positives = 30/65 (46%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK + H    E +  C  C +TF  +ST        +VCS CHPFY G        GR  +F ++
  S:     1 MKSDIHPTYEETTVVCG-CGNTFQTRSTKQGGRIVAEVCSQCHPFYTGKQKILDSGGRVARFERR 64
>gi|42560698|ref|NP_975149.1| 50S ribosomal protein L31 [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|42492194|emb|CAE76791.1| 50S ribosomal protein L31 [Mycoplasma mycoides subsp. mycoides SC str. PG1] (92 aa)
Score = 100, Expect = 7.0e-03, Identities = 25/78 (32%), Positives = 39/78 (50%)
  Q:    11 LNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQEPTKSENKNTKKQSK 88
            ++  F C +C S +V   T   +E  +DVCS+CHPFY G      V GR E+F  K         + E ++  +++K
  S:    11 FDQAKFICTTCASEWVC-GTSKGEEVRVDVCSNCHPFYTGAQTYTNVAGRVEQFKSKFAKRDTIKAQVEKQSQVQKAK 87
>gi|52082241|ref|YP_081032.1| 50S ribosomal protein L31 [Bacillus licheniformis ATCC 14580] >gi|52787633|ref|YP_093462.1| 50S ribosomal protein L31 [Bacillus licheniformis ATCC 14580] >gi|73621779|sp|Q65DU5|RL31_BACLD 50S ribosomal protein L31 >gi|52005452|gb|AAU25394.1| ribosomal protein L31 [Bacillus licheniformis ATCC 14580] >gi|52350135|gb|AAU42769.1| RpmE [Bacillus licheniformis DSM 13] (66 aa)
Score = 100, Expect = 7.1e-03, Identities = 23/65 (35%), Positives = 33/65 (50%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK   H +  + +  CA C + F   S    +E  +++CS CHPFY G        GR ++FNKK
  S:     1 MKAGIHPEFKKATVKCA-CGNEFETGSV--KEEVRVEICSECHPFYTGRQKFASADGRVDRFNKK 62
>gi|170288940|ref|YP_001739178.1| ribosomal protein L31 [Thermotoga sp. RQ2] >gi|170176443|gb|ACB09495.1| ribosomal protein L31 [Thermotoga sp. RQ2] (71 aa)
Score = 99, Expect = 7.3e-03, Identities = 26/65 (40%), Positives = 36/65 (55%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYI----GTSMSQQVKGRAEKFNKK 67
           MKK  H ++  V+  CA C +     +T++     IDVCS CHPFY     G  +    +GR EKF +K
  S:     1 MKKGIHPEMKLVTVKCA-CGAEHTFYTTVDN--IRIDVCSKCHPFYTSGGKGGVLIVDTEGRVEKFRRK 66
>gi|118445016|ref|YP_879018.1| 50S ribosomal protein L31 [Clostridium novyi NT] >gi|118135472|gb|ABK62516.1| ribosomal protein L31 [Clostridium novyi NT] (69 aa)
Score = 99, Expect = 7.3e-03, Identities = 26/65 (40%), Positives = 33/65 (50%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H + +  +    +C +TF   ST    E  +DVCS CHPFY G        GR EKF KK
  S:     1 MKQGLHPEYHHDAVVKCACGNTFTTGST--NAELKVDVCSKCHPFYTGKQKILDTGGRIEKFMKK 63
>gi|89897681|ref|YP_521168.1| 50S ribosomal protein L31 [Desulfitobacterium hafniense Y51] >gi|109648004|ref|ZP_01371907.1| ribosomal protein L31 [Desulfitobacterium hafniense DCB-2] >gi|148878596|sp|Q24ML8|RL31_DESHY 50S ribosomal protein L31 >gi|89337129|dbj|BAE86724.1| 50S ribosomal protein L31 [Desulfitobacterium hafniense Y51] >gi|109641094|gb|EAT50649.1| ribosomal protein L31 [Desulfitobacterium hafniense DCB-2] (65 aa)
Score = 99, Expect = 7.4e-03, Identities = 23/65 (35%), Positives = 33/65 (50%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK++TH K  + +  C  C       ST   K+  +++CS CHPFY G        GR ++F KK
  S:     1 MKEKTHPKYEQTTITCV-CGEVIPTGST--KKDIKVEICSKCHPFYTGVQRFVDAGGRVDRFKKK 62
>gi|42527012|ref|NP_972110.1| 50S ribosomal protein L31 [Treponema denticola ATCC 35405] >gi|73621829|sp|Q73MK4|RL31_TREDE 50S ribosomal protein L31 >gi|41817436|gb|AAS12021.1| ribosomal protein L31 [Treponema denticola ATCC 35405] (67 aa)
Score = 99, Expect = 7.7e-03, Identities = 22/65 (33%), Positives = 34/65 (52%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MKK+ H K  E +  CA  N   V+ +    K+  +++CS CHPF+ G        GR ++F K+
  S:     1 MKKDIHPKYEETTVTCACGN---VINTRSTVKDIKVEICSQCHPFFTGKQKLVDTAGRIDRFKKR 62
>gi|114321898|ref|YP_743581.1| 50S ribosomal protein L31P [Alkalilimnicola ehrlichei MLHE-1] >gi|122310696|sp|Q0A4Z6|RL31B_ALHEH 50S ribosomal protein L31 type B >gi|114228292|gb|ABI58091.1| LSU ribosomal protein L31P [Alkalilimnicola ehrlichei MLHE-1] (84 aa)
Score = 99, Expect = 8.0e-03, Identities = 26/65 (40%), Positives = 36/65 (55%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET------------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H K  EV F   S +  F+ +ST+ T ET             ++V S  HPFY G   +    GR ++F KK
  S:     1 MKQGIHPKYREVVFQDISSDFAFITRSTVRTNETIQWEDGKEYPLFKVEVSSKSHPFYTGKQRALSSGGRVDQFQKK 77
>gi|159039555|ref|YP_001538808.1| ribosomal protein L31 [Salinispora arenicola CNS-205] >gi|157918390|gb|ABV99817.1| ribosomal protein L31 [Salinispora arenicola CNS-205] (74 aa)
Score = 99, Expect = 8.2e-03, Identities = 25/75 (33%), Positives = 34/75 (45%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQEPTK 77
           MK   H +       C SC +TF  +ST       ++ CS+CHPFY G        GR  KF +K   V+ +  K
  S:     1 MKPNIHPEYVTTEVTC-SCGNTFTTRSTAKGGSIHVETCSACHPFYTGKQRVLDTAGRVAKFQQKYAKVQAKKGK 74
>gi|89095597|ref|ZP_01168491.1| 50S ribosomal protein L31 [Bacillus sp. NRRL B-14911] >gi|89089343|gb|EAR68450.1| 50S ribosomal protein L31 [Bacillus sp. NRRL B-14911] (70 aa)
Score = 99, Expect = 8.2e-03, Identities = 23/65 (35%), Positives = 33/65 (50%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK   H    +++  CA C + F   S  +  E  ++ CS CHPFY G     +  GR ++FNKK
  S:     1 MKAGIHPNYKKITVTCA-CGNQFETGSVKD--EVRVETCSECHPFYTGRQKFAEAGGRVDRFNKK 62
>gi|121536016|ref|ZP_01667806.1| ribosomal protein L31 [Thermosinus carboxydivorans Nor1] >gi|121305406|gb|EAX46358.1| ribosomal protein L31 [Thermosinus carboxydivorans Nor1] (67 aa)
Score = 99, Expect = 8.4e-03, Identities = 26/65 (40%), Positives = 34/65 (52%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK++ H    + +  CA C + FV  ST   K   +DVCS CHPF+ G        GR E+F KK
  S:     1 MKEKIHPNYYQTTVTCA-CGNNFVTGST--KKNLKVDVCSKCHPFFTGIQKIVDTTGRLERFAKK 62
>gi|73749011|ref|YP_308250.1| 50S ribosomal protein L31 [Dehalococcoides sp. CBDB1] >gi|148878594|sp|Q3ZYN3|RL31_DEHSC 50S ribosomal protein L31 >gi|73660727|emb|CAI83334.1| ribosomal protein L31 [Dehalococcoides sp. CBDB1] (68 aa)
Score = 99, Expect = 8.5e-03, Identities = 23/65 (35%), Positives = 35/65 (53%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK++ H K N  +    +C +TF V ST +     +++C+ CHPFY G        GR EKF ++
  S:     1 MKEKIHPKYNTATNVICACGNTFTVGSTKDN--IKVELCAQCHPFYTGEKRMVDTAGRVEKFRQR 63
>gi|145596157|ref|YP_001160454.1| ribosomal protein L31 [Salinispora tropica CNB-440] >gi|145305494|gb|ABP56076.1| LSU ribosomal protein L31P [Salinispora tropica CNB-440] (74 aa)
Score = 99, Expect = 8.6e-03, Identities = 25/75 (33%), Positives = 35/75 (46%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQEPTK 77
           MK  +H +       C SC +TF  +ST       ++ CS+CHPFY G        GR  KF +K   V+ +  K
  S:     1 MKPNSHPEYVTTEVAC-SCGNTFTTRSTAKGGSIHVETCSACHPFYTGKQRVLDTAGRVAKFQQKYAKVQAKKGK 74
>gi|57233953|ref|YP_182038.1| 50S ribosomal protein L31 [Dehalococcoides ethenogenes 195] >gi|163812077|ref|ZP_02203756.1| ribosomal protein L31 [Dehalococcoides sp. VS] >gi|152112313|sp|Q3Z6W1|RL31_DEHE1 50S ribosomal protein L31 >gi|57224401|gb|AAW39458.1| ribosomal protein L31 [Dehalococcoides ethenogenes 195] >gi|157404265|gb|EDO70306.1| ribosomal protein L31 [Dehalococcoides sp. VS] (68 aa)
Score = 99, Expect = 9.3e-03, Identities = 23/65 (35%), Positives = 36/65 (55%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK++ H K N  +    +C +TF V ST ++    +++C+ CHPFY G        GR EKF ++
  S:     1 MKEKIHPKYNTATNVSCACGNTFTVGSTKDS--IKVELCAQCHPFYTGEKRMVDTAGRVEKFRQR 63
>gi|88799632|ref|ZP_01115208.1| ribosomal protein L31 [Reinekea sp. MED297] >gi|88777717|gb|EAR08916.1| ribosomal protein L31 [Reinekea sp. MED297] (71 aa)
Score = 99, Expect = 9.3e-03, Identities = 24/65 (36%), Positives = 33/65 (50%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           M+ E H K  E++  C SC +    +ST       +DVCS+CHPFY G        GR +KF  +
  S:     1 MQTEIHPKYEELTATC-SCGNVIKTRST-RAGTMHLDVCSACHPFYTGKQKIVDAGGRIDKFKSR 63
>gi|113868371|ref|YP_726860.1| 50S ribosomal protein L31 type B [Ralstonia eutropha H16] >gi|123133840|sp|Q0K929|RL31B_RALEH 50S ribosomal protein L31 type B >gi|113527147|emb|CAJ93492.1| LSU ribosomal protein L31 [Ralstonia eutropha H16] (86 aa)
Score = 98, Expect = 9.6e-03, Identities = 27/65 (41%), Positives = 36/65 (55%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKE-----------TSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H    EV F   S + +F+ +ST+ TK+             I+V S  HPFY GT       GR EKF +K
  S:     1 MKEGIHPNYREVVFQDMSSDFSFITRSTIQTKDKIVKDGKEYPLAKIEVSSESHPFYTGTQKIMDTAGRVEKFRQK 76
>gi|91776643|ref|YP_546399.1| 50S ribosomal protein L31P [Methylobacillus flagellatus KT] >gi|122399503|sp|Q1GYX9|RL31B_METFK 50S ribosomal protein L31 type B >gi|91710630|gb|ABE50558.1| LSU ribosomal protein L31P [Methylobacillus flagellatus KT] (80 aa)
Score = 98, Expect = 9.6e-03, Identities = 26/65 (40%), Positives = 34/65 (52%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET------------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK   H +  EV F     + +F+ +ST+  KET             I+V S  HPFY G        GR EKF +K
  S:     1 MKPGIHPEYREVVFQDIGADFSFLTRSTIAAKETIKWTDGKEYPLVKIEVSSQSHPFYTGKQKILDTAGRVEKFRQK 77
>gi|134093949|ref|YP_001099024.1| 50S ribosomal protein L31 type B [Herminiimonas arsenicoxydans] >gi|166230220|sp|A4G310|RL31B_HERAR 50S ribosomal protein L31 type B >gi|133737852|emb|CAL60897.1| 50S ribosomal protein L31 type B [Herminiimonas arsenicoxydans] (88 aa)
Score = 98, Expect = 9.8e-03, Identities = 29/77 (37%), Positives = 40/77 (51%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKE-----------TSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQEPTKSE 79
           MK   H +  EV F+  S +  F+ +ST+NT+E             I+V S  HPFY G        GR +KF KK   V  +   +E
  S:     1 MKAGIHPEYREVLFHDVSNDFKFITRSTINTREKIEFEGTEYPLVKIEVSSESHPFYTGKHKIVDTAGRVDKFRKKFGTVGSKTQMAE 88
>gi|168185909|ref|ZP_02620544.1| ribosomal protein L31 [Clostridium botulinum C str. Eklund] >gi|169295943|gb|EDS78076.1| ribosomal protein L31 [Clostridium botulinum C str. Eklund] (69 aa)
Score = 98, Expect = 1.0e-02, Identities = 26/65 (40%), Positives = 33/65 (50%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H + +  +    +C +TF   ST    E  +DVCS CHPFY G        GR EKF KK
  S:     1 MKEGLHPEYHHDAVVKCACGNTFTTGST--NTELKVDVCSKCHPFYTGKQKILDTGGRIEKFMKK 63
>gi|145222894|ref|YP_001133572.1| ribosomal protein L31 [Mycobacterium gilvum PYR-GCK] >gi|145215380|gb|ABP44784.1| LSU ribosomal protein L31P [Mycobacterium gilvum PYR-GCK] (70 aa)
Score = 98, Expect = 1.0e-02, Identities = 22/65 (33%), Positives = 32/65 (49%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK   H    E +  C  C ++F  +ST  +   +++VCS CHPFY G        GR  +F K+
  S:     1 MKSGIHPDYVETTVLCG-CGASFTTRSTKKSGNITVEVCSQCHPFYTGKQKILDSGGRVARFEKR 64
>gi|51891209|ref|YP_073900.1| ribosomal protein L31 [Symbiobacterium thermophilum IAM 14863] >gi|51854898|dbj|BAD39056.1| ribosomal protein L31 [Symbiobacterium thermophilum IAM 14863] (69 aa)
Score = 98, Expect = 1.1e-02, Identities = 23/67 (34%), Positives = 40/67 (59%)
  Q:     1 MIMKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKG--RAEKFNKK 67
           M+MK   H K  + +  C  C +T+ V ST   +   +++C++CHPFY G+  + +V+   R ++F KK
  S:     1 MLMKAGIHPKTQKTTITCG-CGATYEVLST--KENIRVEICANCHPFYTGSRGATRVEAGSRIDRFRKK 66
>gi|118581062|ref|YP_902312.1| 50S ribosomal protein L31 [Pelobacter propionicus DSM 2379] >gi|118503772|gb|ABL00255.1| LSU ribosomal protein L31P [Pelobacter propionicus DSM 2379] (66 aa)
Score = 98, Expect = 1.1e-02, Identities = 22/65 (33%), Positives = 36/65 (55%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H   ++ +  C  C +TF  +ST   KE + ++CS+CHPF+ G        GR E+F ++
  S:     1 MKEGIHPMYSDATVKCL-CGNTFQTRST--RKEINTEICSACHPFFTGKQKLIDTAGRVERFKRR 62
>gi|16080760|ref|NP_391588.1| 50S ribosomal protein L31 [Bacillus subtilis subsp. subtilis str. 168] >gi|154687822|ref|YP_001422983.1| 50S ribosomal protein L31 [Bacillus amyloliquefaciens FZB42] >gi|417666|sp|Q03223|RL31_BACSU 50S ribosomal protein L31 >gi|143435|gb|AAA02901.1| ribosomal protein L31 >gi|853770|emb|CAA89878.1| ribosomal protein L31 [Bacillus subtilis] >gi|2636232|emb|CAB15724.1| ribosomal protein L31 [Bacillus subtilis subsp. subtilis str. 168] >gi|154353673|gb|ABS75752.1| RpmE [Bacillus amyloliquefaciens FZB42] (66 aa)
Score = 98, Expect = 1.1e-02, Identities = 23/65 (35%), Positives = 32/65 (49%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK   H    + +  CA C + F   S    +E  +++CS CHPFY G        GR ++FNKK
  S:     1 MKAGIHPNFKKATVKCA-CGNEFETGSV--KEEVRVEICSECHPFYTGRQKFASADGRVDRFNKK 62
>gi|20806668|ref|NP_621839.1| 50S ribosomal protein L31 [Thermoanaerobacter tengcongensis MB4] >gi|22096087|sp|Q8RDA2|RL31_THETN 50S ribosomal protein L31 >gi|20515118|gb|AAM23443.1| Ribosomal protein L31 [Thermoanaerobacter tengcongensis MB4] (69 aa)
Score = 98, Expect = 1.1e-02, Identities = 19/48 (39%), Positives = 28/48 (58%)
  Q:    20 SCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           +C +TF+  ST   KE  +++CS CHPF+ G        GR E+F K+
  S:    18 ACGNTFITGST--KKEIRVEICSKCHPFFTGQQKIVDTGGRVERFRKR 63
>gi|24379714|ref|NP_721669.1| 50S ribosomal protein L31 type B [Streptococcus mutans UA159] >gi|31076958|sp|Q8DTN5|RL31B_STRMU 50S ribosomal protein L31 type B >gi|24377673|gb|AAN58975.1|AE014964_9 50S ribosomal protein L31 [Streptococcus mutans UA159] (80 aa)
Score = 98, Expect = 1.2e-02, Identities = 26/65 (40%), Positives = 35/65 (53%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET-----------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MKK+ H +   V F   S    F+  ST  +KET            +++ S  HPFY G     Q  GR ++FNKK
  S:     1 MKKDIHPEYRPVVFMDTSTGYQFLSGSTKTSKETVEFEGETYPLIRVEISSDSHPFYTGRQKFTQADGRVDRFNKK 76
>gi|52840887|ref|YP_094686.1| 50S ribosomal protein L31 [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] >gi|54293633|ref|YP_126048.1| 50S ribosomal protein L31 [Legionella pneumophila str. Lens] >gi|54296673|ref|YP_123042.1| 50S ribosomal protein L31 [Legionella pneumophila str. Paris] >gi|148360697|ref|YP_001251904.1| 50S ribosomal protein L31 [Legionella pneumophila str. Corby] >gi|73621799|sp|Q5X7A1|RL31_LEGPA 50S ribosomal protein L31 >gi|73621800|sp|Q5ZXT1|RL31_LEGPH 50S ribosomal protein L31 >gi|73621801|sp|Q5WYQ0|RL31_LEGPL 50S ribosomal protein L31 >gi|52627998|gb|AAU26739.1| 50S ribosomal protein L31 [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] >gi|53750458|emb|CAH11852.1| 50S ribosomal protein L31 [Legionella pneumophila str. Paris] >gi|53753465|emb|CAH14920.1| 50S ribosomal protein L31 [Legionella pneumophila str. Lens] >gi|148282470|gb|ABQ56558.1| hypothetical protein LPC_2644 [Legionella pneumophila str. Corby] (75 aa)
Score = 98, Expect = 1.2e-02, Identities = 26/65 (40%), Positives = 32/65 (49%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK   H     V   C SC   F  +STL  K+ +I+VCS CHPFY G        GR +KF  +
  S:     1 MKASVHPDYQTVKVTC-SCGEVFETRSTL-CKDLNIEVCSMCHPFYTGKQKLVDTGGRVQKFRDR 63
>gi|110835101|ref|YP_693960.1| 50S ribosomal protein L31 [Alcanivorax borkumensis SK2] >gi|118572983|sp|Q0VMB0|RL31_ALCBS 50S ribosomal protein L31 >gi|110648212|emb|CAL17688.1| 50S ribosomal protein L31 [Alcanivorax borkumensis SK2] (72 aa)
Score = 98, Expect = 1.2e-02, Identities = 22/65 (33%), Positives = 34/65 (52%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK E H      ++ C SC +    +ST    + ++DVCS+CHPFY G        G+ +KF ++
  S:     1 MKAEIHPDYQTATYTC-SCGNVIETRST-KGGDMALDVCSACHPFYTGKQKQADSGGQIDKFKQR 63
>gi|42521714|ref|NP_967094.1| 50S ribosomal protein L31 [Bdellovibrio bacteriovorus HD100] >gi|73621750|sp|Q6MRL0|RL31B_BDEBA 50S ribosomal protein L31 type B >gi|39574244|emb|CAE77748.1| 50S ribosomal protein L31 [Bdellovibrio bacteriovorus HD100] (81 aa)
Score = 98, Expect = 1.2e-02, Identities = 24/65 (36%), Positives = 40/65 (61%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET------------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H K+N V F   SC+ +F+  STL++ ET             +++ S+ HPF+ G       +GR ++F K+
  S:     1 MKQNLHPKVNTVVFKDISCDFSFLGTSTLHSSETVKWEDGKEYPLIKVEISSASHPFFTGKQRVMDTEGRIDRFKKR 77
>gi|148656816|ref|YP_001277021.1| ribosomal protein L31 [Roseiflexus sp. RS-1] >gi|148568926|gb|ABQ91071.1| LSU ribosomal protein L31P [Roseiflexus sp. RS-1] (100 aa)
Score = 98, Expect = 1.2e-02, Identities = 21/84 (25%), Positives = 40/84 (47%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQEPTKSENKNTKKQ 86
           MKK  H +       C +C + + V ST   +   +DVCS CHPFY G        G+ ++F +++   + +  +   +  +++
  S:     1 MKKGIHPQNYNTQVVCGTCGTVWPVIST--RQNMRVDVCSRCHPFYTGEQRIVDTAGQVDRFMRRLRTSQDQQAEIARRRAERE 82
>gi|54023020|ref|YP_117262.1| 50S ribosomal protein L31 [Nocardia farcinica IFM 10152] >gi|73621810|sp|Q5Z0Z3|RL31_NOCFA 50S ribosomal protein L31 >gi|54014528|dbj|BAD55898.1| putative ribosomal protein L31 [Nocardia farcinica IFM 10152] (76 aa)
Score = 98, Expect = 1.2e-02, Identities = 21/65 (32%), Positives = 31/65 (47%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK   H    + +  C  C +TF  +ST  +   +++VCS CHPFY G        GR  +F  +
  S:     1 MKAGIHPAYVDTTVVCG-CGNTFQTRSTKESGHITVEVCSQCHPFYTGKQKILDTGGRVARFEAR 64
>gi|148652319|ref|YP_001279412.1| 50S ribosomal protein L31 type B [Psychrobacter sp. PRwf-1] >gi|172048497|sp|A5WCS1|RL31B_PSYWF 50S ribosomal protein L31 type B >gi|148571403|gb|ABQ93462.1| LSU ribosomal protein L31P [Psychrobacter sp. PRwf-1] (92 aa)
Score = 97, Expect = 1.2e-02, Identities = 24/65 (36%), Positives = 37/65 (56%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETS-----------IDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           M+K+ H +  EV F+  + +  F+ +ST  TK T            +D+ S+ HPFY G       +GR   FNK+
  S:     1 MRKDIHPEYQEVLFHDTNADVFFLTRSTAKTKATREYEGKEYPYYPLDISSASHPFYTGEQRKTSNEGRVASFNKR 76
>gi|22536714|ref|NP_687565.1| 50S ribosomal protein L31 type B [Streptococcus agalactiae 2603V/R] >gi|25010650|ref|NP_735045.1| 50S ribosomal protein L31 type B [Streptococcus agalactiae NEM316] >gi|54039009|sp|P66199|RL31B_STRA5 50S ribosomal protein L31 type B >gi|54041870|sp|P66198|RL31B_STRA3 50S ribosomal protein L31 type B >gi|22533556|gb|AAM99437.1|AE014216_13 ribosomal protein L31 [Streptococcus agalactiae 2603V/R] >gi|23095004|emb|CAD46225.1| 50S ribosomal protein L31 [Streptococcus agalactiae NEM316] (86 aa)
Score = 97, Expect = 1.2e-02, Identities = 26/65 (40%), Positives = 35/65 (53%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET-----------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MKK+ H     V F   +    F+  ST +TKET            +++ S  HPFY G     Q  GR ++FNKK
  S:     1 MKKDIHPDYRPVVFLDTTTGYKFLSGSTKSTKETVEFEGETYPLIRVEISSDSHPFYTGRQKFTQADGRVDRFNKK 76
>gi|188587464|ref|YP_001919009.1| LSU ribosomal protein L31P [Natranaerobius thermophilus JW/NM-WN-LF] >gi|179352151|gb|ACB86421.1| LSU ribosomal protein L31P [Natranaerobius thermophilus JW/NM-WN-LF] (66 aa)
Score = 97, Expect = 1.3e-02, Identities = 25/65 (38%), Positives = 36/65 (55%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+E H +  +    CA C ++F   ST   +E  +++CSSCHPF+ G        GR EKF +K
  S:     1 MKREIHPEYKKAKVVCA-CGNSFETGST--KEELKVEICSSCHPFFTGKQKLVDSGGRVEKFKRK 62
>gi|146328954|ref|YP_001209331.1| ribosomal protein L31 [Dichelobacter nodosus VCS1703A] >gi|146232424|gb|ABQ13402.1| ribosomal protein L31 [Dichelobacter nodosus VCS1703A] (82 aa)
Score = 97, Expect = 1.3e-02, Identities = 27/65 (41%), Positives = 34/65 (52%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET------------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MKK+ H     V F  AS     + +ST+ TKET             IDV S  HPFY G        GR ++F +K
  S:     1 MKKDIHPAYRPVVFYDASAEFKILTRSTVETKETIQWEDGNEYPLVRIDVSSKSHPFYTGKQNIVDTAGRVDRFRRK 77
>gi|157694101|ref|YP_001488563.1| 50S ribosomal protein L31 [Bacillus pumilus SAFR-032] >gi|194016653|ref|ZP_03055267.1| ribosomal protein L31 [Bacillus pumilus ATCC 7061] >gi|157682859|gb|ABV64003.1| ribosomal protein L31 [Bacillus pumilus SAFR-032] >gi|194012126|gb|EDW21694.1| ribosomal protein L31 [Bacillus pumilus ATCC 7061] (66 aa)
Score = 97, Expect = 1.3e-02, Identities = 24/65 (36%), Positives = 32/65 (49%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK   H    + +  CA C + F   S    +E  I++CS CHPFY G        GR ++FNKK
  S:     1 MKTGIHPNYKKATVKCA-CGNEFETGSV--KEEVRIEICSECHPFYTGRQKFASADGRVDRFNKK 62
>gi|90409434|ref|ZP_01217501.1| 50S ribosomal protein L31 [Psychromonas sp. CNPT3] >gi|90309460|gb|EAS37678.1| 50S ribosomal protein L31 [Psychromonas sp. CNPT3] (86 aa)
Score = 97, Expect = 1.3e-02, Identities = 24/65 (36%), Positives = 37/65 (56%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET-----------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MKK  H    +++F+  + +  F+V STL T +T           ++D+ S  HPFY G     Q  GR   FN++
  S:     1 MKKGIHPNYQKIAFHDIAVDKYFIVGSTLKTAKTIEIEGIIYPYVALDISSQSHPFYTGKQKMLQSDGRVALFNRR 76
>gi|183980325|ref|YP_001848616.1| 50S ribosomal protein L31 RpmE_1 [Mycobacterium marinum M] >gi|183173651|gb|ACC38761.1| 50S ribosomal protein L31 RpmE_1 [Mycobacterium marinum M] (90 aa)
Score = 97, Expect = 1.3e-02, Identities = 26/65 (40%), Positives = 37/65 (56%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSID----------------VCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK +TH   + V F  A+  + F+ +STL T   SID                V +  HPF+ GT  +    GR EKF ++
  S:     1 MKSDTHPDYHPVVFEDATTGTRFLTRSTL-TSSRSIDWETPSGVHTYPLVVVEVSADSHPFWTGTRRTLDTAGRVEKFYRR 80
>gi|150021051|ref|YP_001306405.1| ribosomal protein L31 [Thermosipho melanesiensis BI429] >gi|149793572|gb|ABR31020.1| ribosomal protein L31 [Thermosipho melanesiensis BI429] (69 aa)
Score = 97, Expect = 1.3e-02, Identities = 30/65 (46%), Positives = 37/65 (56%)
  Q:     3 MKKETH--MKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQV---KGRAEKFNKK 67
           MKK  H  MKL  V   C + +  + VK  +      IDVCSSCHPFY G   +  +   +GR EKF KK
  S:     1 MKKGIHPEMKLVTVKCACGAEHKFYTVKENVR-----IDVCSSCHPFYKGAGAAGMIVDTEGRIEKFKKK 65
>gi|118619874|ref|YP_908206.1| 50S ribosomal protein L31 type B [Mycobacterium ulcerans Agy99] >gi|118571984|gb|ABL06735.1| 50S ribosomal protein L31 RpmE_1 [Mycobacterium ulcerans Agy99] (90 aa)
Score = 97, Expect = 1.3e-02, Identities = 26/65 (40%), Positives = 37/65 (56%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSID----------------VCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK +TH   + V F  A+  + F+ +STL T   SID                V +  HPF+ GT  +    GR EKF ++
  S:     1 MKSDTHPDYHPVVFEDATTGTRFLTRSTL-TSSRSIDWKTPSGVHTYPLVVVEVSADSHPFWTGTRRTLDTAGRVEKFYRR 80
>gi|147669777|ref|YP_001214595.1| 50S ribosomal protein L31 [Dehalococcoides sp. BAV1] >gi|146270725|gb|ABQ17717.1| LSU ribosomal protein L31P [Dehalococcoides sp. BAV1] (68 aa)
Score = 97, Expect = 1.3e-02, Identities = 23/65 (35%), Positives = 35/65 (53%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK++ H K N  +    +C +TF V ST +     +++C+ CHPFY G        GR EKF ++
  S:     1 MKEKIHPKYNTATNVSCACGNTFTVGSTKDN--IKVELCAQCHPFYTGEKRMVDTAGRVEKFRQR 63
>gi|163847870|ref|YP_001635914.1| ribosomal protein L31 [Chloroflexus aurantiacus J-10-fl] >gi|187599418|ref|ZP_02985652.1| ribosomal protein L31 [Chloroflexus sp. Y-400-fl] >gi|163669159|gb|ABY35525.1| ribosomal protein L31 [Chloroflexus aurantiacus J-10-fl] >gi|187488850|gb|EDU26817.1| ribosomal protein L31 [Chloroflexus sp. Y-400-fl] (99 aa)
Score = 97, Expect = 1.3e-02, Identities = 21/87 (24%), Positives = 44/87 (50%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKV-VAVKQEPTKSENKNTKKQSKK 89
           MK+  H K       C +C + + + ST       +++C++CHPFY G        G+ ++F +++ VA +++  +   +  + Q +K
  S:     1 MKQGIHPKYYTDGIVCGTCGTVWKIGST--RPNLRVEICANCHPFYTGEQRIVDTAGQVDRFMRRLNVAQERQNERESRRAARTQPEK 86
>gi|87121530|ref|ZP_01077418.1| ribosomal protein, L31P family protein [Marinomonas sp. MED121] >gi|86163062|gb|EAQ64339.1| ribosomal protein, L31P family protein [Marinomonas sp. MED121] (84 aa)
Score = 97, Expect = 1.3e-02, Identities = 25/65 (38%), Positives = 36/65 (55%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET-----------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK   H K  +V F+    ++ FV+ ST+ T+ T           +IDV S  HPFY G   + Q  GR  +F  +
  S:     1 MKPNIHPKYQKVVFHDTVADTYFVIGSTIKTERTIEYQGSTYPYVTIDVSSVSHPFYTGEQRTSQKDGRISRFKSR 76
>gi|145589490|ref|YP_001156087.1| ribosomal protein L31 [Polynucleobacter sp. QLW-P1DMWA-1] >gi|189042643|sp|A4SYF9|RL31B_POLSQ 50S ribosomal protein L31 type B >gi|145047896|gb|ABP34523.1| LSU ribosomal protein L31P [Polynucleobacter sp. QLW-P1DMWA-1] (115 aa)
Score = 97, Expect = 1.3e-02, Identities = 27/65 (41%), Positives = 36/65 (55%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET------------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK   H +  E+ F   S N +F  +ST++T+ET             I+  S  HPFY GT       GR EKF +K
  S:     1 MKPGIHPEYREIVFVDVSNNFSFKTRSTMSTRETIKWEDGNEYPLAKIETSSESHPFYTGTQKIMDTAGRVEKFRQK 77
>gi|19552098|ref|NP_600100.1| 50S ribosomal protein L31 type B [Corynebacterium glutamicum ATCC 13032] >gi|62389761|ref|YP_225163.1| 50S ribosomal protein L31 type B [Corynebacterium glutamicum ATCC 13032] >gi|145295042|ref|YP_001137863.1| 50S ribosomal protein L31 type B [Corynebacterium glutamicum R] >gi|166230218|sp|A4QCL4|RL31B_CORGB 50S ribosomal protein L31 type B >gi|23821999|sp|Q8NS12|RL31B_CORGL 50S ribosomal protein L31 type B >gi|21323638|dbj|BAB98265.1| Ribosomal protein L31 [Corynebacterium glutamicum ATCC 13032] >gi|41325096|emb|CAF19577.1| PROBABLE 50S RIBOSOMAL SUBUNIT PROTEIN L31 [Corynebacterium glutamicum ATCC 13032] >gi|140844962|dbj|BAF53961.1| hypothetical protein [Corynebacterium glutamicum R] (88 aa)
Score = 97, Expect = 1.3e-02, Identities = 25/76 (32%), Positives = 37/76 (48%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETS------------IDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQEPTKS 78
           MKK+ H   + V F  A     F+ KST ++  T             +DV S  HPF+ G        GR EKF ++   + +   K+
  S:     1 MKKDIHPDYHAVVFQDAGTGFQFLTKSTASSDRTVSWEDGNEYPLIVVDVTSESHPFWTGAQRVMDTAGRVEKFERRFGGMARRKKKA 88
>gi|167038494|ref|YP_001666072.1| 50S ribosomal protein L31 [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|167038763|ref|YP_001661748.1| 50S ribosomal protein L31 [Thermoanaerobacter sp. X514] >gi|166853003|gb|ABY91412.1| ribosomal protein L31 [Thermoanaerobacter sp. X514] >gi|166857328|gb|ABY95736.1| ribosomal protein L31 [Thermoanaerobacter pseudethanolicus ATCC 33223] (69 aa)
Score = 97, Expect = 1.3e-02, Identities = 19/48 (39%), Positives = 28/48 (58%)
  Q:    20 SCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           +C +TF+  ST   KE  +++CS CHPF+ G        GR E+F K+
  S:    18 ACGNTFITGST--KKEIRVEICSKCHPFFTGQQKIVDTGGRVERFRKR 63
>gi|88857453|ref|ZP_01132096.1| putative ribosomal protein [Pseudoalteromonas tunicata D2] >gi|88820650|gb|EAR30462.1| putative ribosomal protein [Pseudoalteromonas tunicata D2] (84 aa)
Score = 97, Expect = 1.4e-02, Identities = 25/65 (38%), Positives = 35/65 (53%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET-----------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK   H    +V F+  + +  F++ STL+T  T            IDV S  HPFY G     +  GR  KFN++
  S:     1 MKPNIHPSYQQVVFHDTAADKFFIIGSTLSTSRTIELKGITYPYVPIDVSSESHPFYTGKQKVNKSDGRVAKFNQR 76
>gi|196236233|ref|ZP_03135032.1| ribosomal protein L31 [Thermus aquaticus Y51MC23] >gi|196219725|gb|EDY14345.1| ribosomal protein L31 [Thermus aquaticus Y51MC23] (77 aa)
Score = 97, Expect = 1.5e-02, Identities = 21/65 (32%), Positives = 31/65 (47%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           +K+  H KL      C   N   V+ +     E  ++VCS CHPFY G       +GR E+F ++
  S:     7 VKEGIHPKLVPARIICGCGN---VIHTYSTKPEIHVEVCSKCHPFYTGQQRFVDTEGRVERFQRR 68
>gi|187923810|ref|YP_001895452.1| ribosomal protein L31 [Burkholderia phytofirmans PsJN] >gi|187715004|gb|ACD16228.1| ribosomal protein L31 [Burkholderia phytofirmans PsJN] (88 aa)
Score = 97, Expect = 1.5e-02, Identities = 28/65 (43%), Positives = 35/65 (53%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETS-----------IDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H    EV F   S +  FV +ST+ T+ET+           I+V S  HPFY G        GR EKF  K
  S:     1 MKEGIHPDYREVLFIDVSNDFKFVTRSTIQTRETAEFEGKTYPLAKIEVSSESHPFYTGQQKIMDTAGRVEKFRNK 76
>gi|91783449|ref|YP_558655.1| 50S ribosomal protein L31 type B [Burkholderia xenovorans LB400] >gi|118572977|sp|Q13Z86|RL31B_BURXL 50S ribosomal protein L31 type B >gi|91687403|gb|ABE30603.1| LSU ribosomal protein L31P [Burkholderia xenovorans LB400] (88 aa)
Score = 97, Expect = 1.5e-02, Identities = 28/65 (43%), Positives = 35/65 (53%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETS-----------IDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H    EV F   S +  FV +ST+ T+ET+           I+V S  HPFY G        GR EKF  K
  S:     1 MKEGIHPDYREVLFIDVSNDFKFVTRSTIQTRETAEFEGKTYPLAKIEVSSESHPFYTGQQKIMDTAGRVEKFRNK 76
>gi|76786901|ref|YP_329317.1| 50S ribosomal protein L31 type B [Streptococcus agalactiae A909] >gi|158564309|sp|Q3K2D6|RL31B_STRA1 50S ribosomal protein L31 type B >gi|76561958|gb|ABA44542.1| ribosomal protein L31 [Streptococcus agalactiae A909] (86 aa)
Score = 96, Expect = 1.6e-02, Identities = 26/65 (40%), Positives = 35/65 (53%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET-----------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MKK+ H     V F   +    F+  ST +TKET            +++ S  HPFY G     Q  GR ++FNKK
  S:     1 MKKDIHPDYRPVVFLDTTTGYKFLSGSTKSTKETVEFEGETYPLIRVEISSDSHPFYTGRQKFTQADGRVDRFNKK 76
>gi|83814102|ref|YP_445288.1| ribosomal protein L31 [Salinibacter ruber DSM 13855] >gi|126352237|sp|Q2S3E3|RL31_SALRD 50S ribosomal protein L31 >gi|83755496|gb|ABC43609.1| ribosomal protein L31 [Salinibacter ruber DSM 13855] (84 aa)
Score = 96, Expect = 1.6e-02, Identities = 22/65 (33%), Positives = 33/65 (50%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           M+ + H + +EV+   A   S    +ST+ T     +V S+ HPFY G        GR EKFN++
  S:     1 MQHDLHPEYSEVTIQLAD-GSEITTRSTMETDSYETEVDSTNHPFYTGRRQFVDTAGRVEKFNRR 64
>gi|50365453|ref|YP_053878.1| 50S ribosomal protein L31 [Mesoplasma florum L1] >gi|73621804|sp|Q6F0H9|RL31_MESFL 50S ribosomal protein L31 >gi|50364009|gb|AAT75994.1| 50S ribosomal protein L31 [Mesoplasma florum L1] (92 aa)
Score = 96, Expect = 1.7e-02, Identities = 28/79 (35%), Positives = 40/79 (50%)
  Q:    11 LNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQEPTKSENKNTKKQSKK 89
             E  F C +C + F+  +T   +E  IDVCS+CHPF+ G        GR E+F  K  A K+    +  KN++ Q  K
  S:    11 FEEAKFICTTCANEFICGTT-KREEMRIDVCSNCHPFFSGAQNFANTTGRVEQFKSK-FARKEAINATAQKNSEDQKSK 87
>gi|39938591|ref|NP_950357.1| 50S ribosomal protein L31 [Onion yellows phytoplasma OY-M] >gi|73621811|sp|Q6YRB0|RL31_ONYPE 50S ribosomal protein L31 >gi|39721700|dbj|BAD04190.1| ribosomal protein L31 [Onion yellows phytoplasma OY-M] (93 aa)
Score = 96, Expect = 1.7e-02, Identities = 25/86 (29%), Positives = 41/86 (47%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQEPTKSENKNTKKQSK 88
           MK   H +   V  +CA+C     + +T+ +    I+ CS+CHPFY G        G  +KFNK+    + +  K+ + N   Q +
  S:     1 MKANIHPQFETVEVSCATCGKQHPIGTTVTS--IKIETCSNCHPFYTGAQTFVVKAGPVDKFNKRYGITQDQKVKTVSSNADNQKE 84
>gi|76798391|ref|ZP_00780633.1| ribosomal protein L31 [Streptococcus agalactiae 18RS21] >gi|77405426|ref|ZP_00782519.1| ribosomal protein L31 [Streptococcus agalactiae H36B] >gi|77408512|ref|ZP_00785249.1| ribosomal protein L31 [Streptococcus agalactiae COH1] >gi|77411594|ref|ZP_00787936.1| ribosomal protein L31 [Streptococcus agalactiae CJB111] >gi|77413704|ref|ZP_00789887.1| ribosomal protein L31 [Streptococcus agalactiae 515] >gi|76586263|gb|EAO62779.1| ribosomal protein L31 [Streptococcus agalactiae 18RS21] >gi|77160249|gb|EAO71377.1| ribosomal protein L31 [Streptococcus agalactiae 515] >gi|77162379|gb|EAO73348.1| ribosomal protein L31 [Streptococcus agalactiae CJB111] >gi|77172869|gb|EAO76001.1| ribosomal protein L31 [Streptococcus agalactiae COH1] >gi|77175919|gb|EAO78695.1| ribosomal protein L31 [Streptococcus agalactiae H36B] (94 aa)
Score = 96, Expect = 1.7e-02, Identities = 26/65 (40%), Positives = 35/65 (53%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET-----------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MKK+ H     V F   +    F+  ST +TKET            +++ S  HPFY G     Q  GR ++FNKK
  S:     9 MKKDIHPDYRPVVFLDTTTGYKFLSGSTKSTKETVEFEGETYPLIRVEISSDSHPFYTGRQKFTQADGRVDRFNKK 84
>gi|170692327|ref|ZP_02883490.1| ribosomal protein L31 [Burkholderia graminis C4D1M] >gi|170142757|gb|EDT10922.1| ribosomal protein L31 [Burkholderia graminis C4D1M] (88 aa)
Score = 96, Expect = 1.7e-02, Identities = 28/65 (43%), Positives = 35/65 (53%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETS-----------IDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H    EV F   S +  FV +ST+ T+ET+           I+V S  HPFY G        GR EKF  K
  S:     1 MKEGIHPNYREVLFIDVSNDFRFVTRSTIQTRETAEFNGKTYPLAKIEVSSESHPFYTGQQKIMDTAGRVEKFRNK 76
>gi|118045572|ref|ZP_01514230.1| ribosomal protein L31 [Chloroflexus aggregans DSM 9485] >gi|117997807|gb|EAV11990.1| ribosomal protein L31 [Chloroflexus aggregans DSM 9485] (99 aa)
Score = 96, Expect = 1.7e-02, Identities = 19/83 (22%), Positives = 41/83 (49%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQEPTKSENKNTKK 85
           MK   H K       CA+C + + + ST       +++C++CHPFY G        G+ ++F +++   ++  ++ E + + +
  S:     1 MKPGIHPKYYTDGIVCATCGTVWKIGST--RPNLRVEICANCHPFYTGEQRIVDTAGQVDRFMRRLNVAQERQSELEARRSSR 81
>gi|152983163|ref|YP_001352310.1| 50S ribosomal protein L31 [Janthinobacterium sp. Marseille] >gi|166230221|sp|A6SVL3|RL31B_JANMA 50S ribosomal protein L31 type B >gi|151283240|gb|ABR91650.1| 50S ribosomal protein L31 [Janthinobacterium sp. Marseille] (88 aa)
Score = 96, Expect = 1.8e-02, Identities = 28/77 (36%), Positives = 40/77 (51%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET-----------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQEPTKSE 79
           MK+  H    +V F   S +  F+ +ST+ T+ET            I+V S  HPFY G        GR +KF KK   V  + + +E
  S:     1 MKEGIHPDYRDVVFQDMSNDFKFITRSTIQTRETIEFEGASYPLVKIEVSSESHPFYTGKHKIVDTAGRVDKFRKKFGTVGSKTSVAE 88
>gi|148377823|ref|YP_001256699.1| 50S ribosomal protein L31 [Mycoplasma agalactiae PG2] >gi|148291869|emb|CAL59260.1| 50S ribosomal protein L31 [Mycoplasma agalactiae PG2] (70 aa)
Score = 96, Expect = 1.8e-02, Identities = 25/66 (37%), Positives = 36/66 (54%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKV 68
           MKK+ H + N V   C++C+  F   +T   K  SIDVCS CH  Y G     +  G  +KFN+++
  S:     1 MKKDIHPQYNTVEATCSTCSKKFTFGTT--KKSISIDVCSGCHVVYTGDRAKTKATGMIDKFNQRL 64
>gi|167766743|ref|ZP_02438796.1| hypothetical protein CLOSS21_01249 [Clostridium sp. SS2/1] >gi|167711497|gb|EDS22076.1| hypothetical protein CLOSS21_01249 [Clostridium sp. SS2/1] (66 aa)
Score = 96, Expect = 1.8e-02, Identities = 22/65 (33%), Positives = 36/65 (55%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           M++  H    +    C +C + FV  ST   ++  +++CS CH FY G   + Q +GR +KFN+K
  S:     1 MREGIHPNYYQAKVVC-NCGNEFVTGST--KEDIHVEICSKCHSFYTGQQKATQARGRIDKFNRK 62
>gi|139438904|ref|ZP_01772364.1| Hypothetical protein COLAER_01368 [Collinsella aerofaciens ATCC 25986] >gi|133775615|gb|EBA39435.1| Hypothetical protein COLAER_01368 [Collinsella aerofaciens ATCC 25986] (141 aa)
Score = 96, Expect = 1.8e-02, Identities = 22/65 (33%), Positives = 35/65 (53%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H +  E +  C SC +TF   +T++  E  +++C+ CHPFY G        GR ++F  K
  S:     1 MKQGIHPQYVECTVTC-SCGNTFKTHATVS--EMKVELCNECHPFYTGQQKFVDTGGRVQRFADK 62
>gi|54026947|ref|YP_121189.1| 50S ribosomal protein L31 type B [Nocardia farcinica IFM 10152] >gi|73621763|sp|Q5YPR6|RL31B_NOCFA 50S ribosomal protein L31 type B >gi|54018455|dbj|BAD59825.1| putative ribosomal protein L31 [Nocardia farcinica IFM 10152] (88 aa)
Score = 96, Expect = 1.8e-02, Identities = 23/65 (35%), Positives = 34/65 (52%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETS------------IDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK   H   + V F  +S    F+ +ST  ++ T             +DV +  HPF+ G       +GR EKFN+K
  S:     1 MKAGIHPDYHPVVFEDSSTGKRFLTRSTATSERTVEWTDGNTYPLLVVDVTADSHPFWTGAQRLLDTQGRVEKFNRK 77
>gi|116493296|ref|YP_805031.1| 50S ribosomal protein L31P [Pediococcus pentosaceus ATCC 25745] >gi|122265240|sp|Q03DY3|RL31B_PEDPA 50S ribosomal protein L31 type B >gi|116103446|gb|ABJ68589.1| LSU ribosomal protein L31P [Pediococcus pentosaceus ATCC 25745] (81 aa)
Score = 96, Expect = 1.8e-02, Identities = 25/65 (38%), Positives = 34/65 (52%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET------------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MKK  H   + V F  ++    F+  ST+ + ET             +++ S  HPFY G    QQ  G   KFNKK
  S:     1 MKKGIHPDYHPVVFQDSATGFKFLSGSTVGSAETIKWEDGNEYPLIRVEITSDSHPFYTGRQKFQQADGTVAKFNKK 77
>gi|68536620|ref|YP_251325.1| 50S ribosomal protein L31 type B [Corynebacterium jeikeium K411] >gi|148878575|sp|Q4JU00|RL31B_CORJK 50S ribosomal protein L31 type B >gi|68264219|emb|CAI37707.1| 50S ribosomal protein L31 [Corynebacterium jeikeium K411] (87 aa)
Score = 96, Expect = 1.8e-02, Identities = 24/65 (36%), Positives = 33/65 (50%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETS------------IDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MKK+ H   + V F  AS    F+ +ST  +  T             +DV S  HPF+ G        GR EKF ++
  S:     1 MKKDIHPDYHPVVFKDASTGHQFITRSTATSDRTVEWEDGNEYPLIVVDVTSESHPFWTGAQRVMDTAGRVEKFQRR 77
>gi|81429239|ref|YP_396240.1| 50S ribosomal protein L31 type B [Lactobacillus sakei subsp. sakei 23K] >gi|78610882|emb|CAI55934.1| 50S ribosomal protein L31 [Lactobacillus sakei subsp. sakei 23K] (87 aa)
Score = 96, Expect = 1.9e-02, Identities = 25/65 (38%), Positives = 36/65 (55%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET------------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H   ++V F  +S    F+  ST N+ ET             +++ S  HPFY G     Q  GR ++FNKK
  S:     1 MKQGIHPDYHKVVFMDSSTGFKFISGSTANSAETVEWEDGNTYPLIRVEISSDSHPFYTGKQKFTQADGRVDRFNKK 77
>gi|169628532|ref|YP_001702181.1| 50S ribosomal protein L31 [Mycobacterium abscessus] >gi|169240499|emb|CAM61527.1| 50S ribosomal protein L31 [Mycobacterium abscessus] (74 aa)
Score = 96, Expect = 1.9e-02, Identities = 22/65 (33%), Positives = 30/65 (46%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK   H    E +  C  C +TF  +ST  +    ++VCS CHPFY G        GR  +F  +
  S:     1 MKSGIHPNYVETNVVCG-CGNTFTTRSTKESGHIVVEVCSQCHPFYTGKQKILDSGGRVARFEAR 64
>gi|89211618|ref|ZP_01189973.1| Ribosomal protein L31 [Halothermothrix orenii H 168] >gi|89158765|gb|EAR78458.1| Ribosomal protein L31 [Halothermothrix orenii H 168] (68 aa)
Score = 96, Expect = 1.9e-02, Identities = 25/65 (38%), Positives = 35/65 (53%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MKK  H ++ +    CA C + +   ST   ++  ++VCS CHPFY G        GR E+FNKK
  S:     1 MKKGIHPEIKKTKIVCA-CGAEYETNST--KEDIHVEVCSRCHPFYTGKQRKATKGGRIERFNKK 62
>gi|182420295|ref|ZP_02951524.1| ribosomal protein L31 [Clostridium butyricum 5521] >gi|182375890|gb|EDT73482.1| ribosomal protein L31 [Clostridium butyricum 5521] (69 aa)
Score = 96, Expect = 2.0e-02, Identities = 21/65 (32%), Positives = 35/65 (53%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           M++  H + +  +    +C +TF   S    +E  +++CS CHPF+ G      V GR +KFNK+
  S:     1 MREGIHPEYHHDAVVKCACGNTFTTGSV--KEELKVEICSKCHPFFTGKQKIVDVGGRVDKFNKR 63
>gi|116670674|ref|YP_831607.1| 50S ribosomal protein L31P [Arthrobacter sp. FB24] >gi|166230207|sp|A0JWT7|RL31B_ARTS2 50S ribosomal protein L31 type B >gi|116610783|gb|ABK03507.1| LSU ribosomal protein L31P [Arthrobacter sp. FB24] (85 aa)
Score = 96, Expect = 2.0e-02, Identities = 25/65 (38%), Positives = 36/65 (55%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET------------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK  TH K   V FN  +    F+ KST+++K+T             +++ S  HPFY G        GR E+FN +
  S:     1 MKSNTHPKYEAVVFNDLASGVKFLTKSTVSSKKTIEWEDGNTYPVIDVEISSESHPFYTGKQRIMDSAGRVERFNAR 77
>gi|171911190|ref|ZP_02926660.1| 50S ribosomal protein L31 [Verrucomicrobium spinosum DSM 4136] (81 aa)
Score = 95, Expect = 2.2e-02, Identities = 22/65 (33%), Positives = 35/65 (53%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MKKE H + +E +  C +C + +   ST+  K   I +C+ CHPF+ G        GR +KF ++
  S:     1 MKKEIHPETHETTITC-TCGAVYHTLSTV--KNLRIGICAQCHPFFTGEQRFVDTAGRVDKFAQR 62
>gi|110683032|gb|ABG86402.1| ribosomal protein L31 [Clostridium perfringens SM101] (82 aa)
Score = 95, Expect = 2.2e-02, Identities = 21/65 (32%), Positives = 34/65 (52%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           M++  H + +  +    +C +TF   S     E  +++CS CHPF+ G      V GR +KFNK+
  S:    15 MRQGIHPEYHHDTVVKCACGNTFTTGSV--KPELKVEICSKCHPFFTGKQKIVDVGGRVDKFNKR 77
>gi|110003943|emb|CAK98283.1| probable 50s ribosomal protein l31 [Spiroplasma citri] (101 aa)
Score = 95, Expect = 2.2e-02, Identities = 34/90 (37%), Positives = 48/90 (53%)
  Q:     2 IMKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAE----KFNKKVVAVKQEPTKSENKNTKKQSKKVV 91
           + ++  H K  +    C +C + ++  ST   +E  +D CSSCHPFY G+       GR E    KFNKK   VKQ   K  +K  K+ +KK V
  S:     1 MAREGIHPKYFDTKIMCTTCGTEYMSGST-KGEELKVDTCSSCHPFYTGSQQFANAAGRVERFKSKFNKKEELVKQ--AKKASKVQKELNKKTV 91
>gi|25027502|ref|NP_737556.1| 50S ribosomal protein L31 type B [Corynebacterium efficiens YS-314] >gi|31076976|sp|Q8FR21|RL31B_COREF 50S ribosomal protein L31 type B >gi|23492784|dbj|BAC17756.1| putative 50S ribosomal protein L31 [Corynebacterium efficiens YS-314] (88 aa)
Score = 95, Expect = 2.2e-02, Identities = 24/76 (31%), Positives = 35/76 (46%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET------------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQEPTKS 78
           MK E H   + V F  A     F+ +ST  +  T             +DV S  HPF+ G        GR EKF ++   + +   K+
  S:     1 MKNEIHPDYHPVVFQDAGTGFQFLTRSTATSDRTIAWEDGNEYPLIVVDVTSESHPFWTGAQRVMDTAGRVEKFERRFGGMARRKKKA 88
>gi|170758640|ref|YP_001785464.1| ribosomal protein L31 [Clostridium botulinum A3 str. Loch Maree] >gi|169405629|gb|ACA54040.1| ribosomal protein L31 [Clostridium botulinum A3 str. Loch Maree] (72 aa)
Score = 95, Expect = 2.4e-02, Identities = 23/65 (35%), Positives = 33/65 (50%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           M++  H + N       +C +TF   ST   KE  +++CS CHPF+ G        GR +KF KK
  S:     1 MREGIHPEYNHDVLVKCACGNTFTTGST--NKELKVEICSKCHPFFTGKQKIVDAGGRVDKFMKK 63
>gi|171323811|ref|ZP_02912329.1| ribosomal protein L31 [Geobacillus sp. WCH70] >gi|171090122|gb|EDT36434.1| ribosomal protein L31 [Geobacillus sp. WCH70] (66 aa)
Score = 95, Expect = 2.5e-02, Identities = 24/65 (36%), Positives = 33/65 (50%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK   H +  +V   CA C + F   S  +  E  +++CS CHPF+ G        GR +KFNKK
  S:     1 MKPGIHPEYKKVIVRCA-CGNEFESGSVKD--ELRVEICSECHPFFTGRQKFVSAAGRVDKFNKK 62
>gi|194477030|ref|YP_002049209.1| 50S ribosomal protein L31 [Paulinella chromatophora] >gi|171192037|gb|ACB42999.1| 50S ribosomal protein L31 [Paulinella chromatophora] (90 aa)
Score = 95, Expect = 2.5e-02, Identities = 21/71 (29%), Positives = 34/71 (47%)
  Q:    21 CNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQEPTKSENKNTKKQSKKVV 91
           CN   V+       E  +DV S  HPFY GT      +GR ++F +K   +  +  K++ K  +K++   V
  S:    18 CNGEVVMTIGSTQPELHVDVWSGNHPFYTGTQKILDTEGRVDRFMRKYGMINTQDVKTKEKTIEKEATAQV 88
>gi|118469064|ref|YP_889203.1| ribosomal protein L31 [Mycobacterium smegmatis str. MC2 155] >gi|118170351|gb|ABK71247.1| ribosomal protein L31 [Mycobacterium smegmatis str. MC2 155] (75 aa)
Score = 95, Expect = 2.5e-02, Identities = 21/65 (32%), Positives = 31/65 (47%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK   H +  + +  C  C  +F  +ST  +    ++VCS CHPFY G        GR  +F K+
  S:     1 MKTGIHPEYVDTTVQCG-CGHSFTTRSTKQSGTIVVEVCSQCHPFYTGKQKILDSGGRVARFEKR 64
>gi|89093010|ref|ZP_01165961.1| ribosomal protein, L31P family protein [Oceanospirillum sp. MED92] >gi|89082660|gb|EAR61881.1| ribosomal protein, L31P family protein [Oceanospirillum sp. MED92] (86 aa)
Score = 95, Expect = 2.5e-02, Identities = 24/65 (36%), Positives = 36/65 (55%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET------------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MKK  H   + V F   SC   F ++ST  + +T            ++DV S+ HP Y G     + +GR  +FNK+
  S:     1 MKKGIHPDYDYVIFRDTSCGRDFRIRSTCKSDQTVVWEDGKTYPLVTLDVSSASHPTYTGEKRQAKAEGRIAQFNKR 77
>gi|119484804|ref|ZP_01619286.1| 50S ribosomal protein L31 [Lyngbya sp. PCC 8106] >gi|119457622|gb|EAW38746.1| 50S ribosomal protein L31 [Lyngbya sp. PCC 8106] (85 aa)
Score = 95, Expect = 2.6e-02, Identities = 20/68 (29%), Positives = 33/68 (48%)
  Q:    21 CNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQEPTKSENKNTKKQSK 88
           CN   V+       +  +DV S  HP+Y GT      +GR E+F +K   V +   ++E  ++ +Q K
  S:    18 CNGELVMTVASTQPKIYVDVWSGNHPYYTGTQKIIDTEGRVERFLRKYGMVSETQPEAEQSDSDQQEK 85
>gi|160903237|ref|YP_001568818.1| ribosomal protein L31 [Petrotoga mobilis SJ95] >gi|160360881|gb|ABX32495.1| ribosomal protein L31 [Petrotoga mobilis SJ95] (71 aa)
Score = 94, Expect = 2.8e-02, Identities = 25/65 (38%), Positives = 37/65 (56%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQ--QVKGRAEKFNKK 67
           MK+  H ++  ++  CA C +   + ST++     +DVCS CHPFY G   SQ    +GR +KF  K
  S:     1 MKQGIHPEMKLITVKCA-CGAEHTMYSTVDN--FRLDVCSECHPFYRGELGSQILDTEGRVQKFKNK 64
>gi|50843595|ref|YP_056822.1| 50S ribosomal protein L31 type B [Propionibacterium acnes KPA171202] >gi|73621765|sp|Q6A5U9|RL31B_PROAC 50S ribosomal protein L31 type B >gi|50841197|gb|AAT83864.1| 50S ribosomal protein L31 type B [Propionibacterium acnes KPA171202] (81 aa)
Score = 94, Expect = 2.9e-02, Identities = 22/65 (33%), Positives = 36/65 (55%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKE------------TSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H   + V F   S ++ F+ +ST+ +                +D+ S+ HPFY G +      GR EKFN++
  S:     1 MKQGIHPDYHPVVFRDISADTAFLTRSTVTSSTEIKWQDGNTYPVIDVDITSASHPFYTGKAKIVDTAGRVEKFNRR 77
>gi|15604740|ref|NP_219524.1| 50S ribosomal protein L31 type B [Chlamydia trachomatis D/UW-3/CX] >gi|7674270|sp|O84025|RL31B_CHLTR 50S ribosomal protein L31 type B >gi|3328412|gb|AAC67612.1| L31 Ribosomal Protein [Chlamydia trachomatis D/UW-3/CX] (108 aa)
Score = 94, Expect = 3.0e-02, Identities = 31/77 (40%), Positives = 42/77 (54%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSI------DVC-----SSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQEPTKSE 79
           MKK TH +  +V F  +S    FV  ST  T +T +       VC     SS HPF+ G+      +GR +KF K+   +KQ   K E
  S:     1 MKKNTHPEYRQVLFVDSSTGYKFVCGSTYQTDKTEVFEGQEYPVCYVSVSSSSHPFFTGSKKLVDAEGRVDKFLKRYSGIKQSAPKPE 88
>gi|171463383|ref|YP_001797496.1| ribosomal protein L31 [Polynucleobacter necessarius STIR1] >gi|171192921|gb|ACB43882.1| ribosomal protein L31 [Polynucleobacter necessarius STIR1] (115 aa)
Score = 94, Expect = 3.0e-02, Identities = 28/65 (43%), Positives = 35/65 (53%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET------------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK   H +  E+ F   S N +F  +ST+ TKET             I+  S  HPFY GT       GR EKF +K
  S:     1 MKPGIHPEYREIVFVDVSNNFSFKTRSTMATKETIKWEDGNEYPLAKIETSSESHPFYTGTQKIMDTAGRVEKFRQK 77
>gi|170782320|ref|YP_001710653.1| 50S ribosomal protein L31 [Clavibacter michiganensis subsp. sepedonicus] >gi|169156889|emb|CAQ02057.1| 50S ribosomal protein L31 [Clavibacter michiganensis subsp. sepedonicus] (85 aa)
Score = 94, Expect = 3.2e-02, Identities = 23/65 (35%), Positives = 36/65 (55%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET------------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK + H K   V F   +  +TF+ +ST+++ +T             +++ S  HPFY G        GR EKFN +
  S:     1 MKTDIHPKYAPVVFRDLASGATFLTRSTVSSSKTIVWEDGNEYAVIDVEISSESHPFYTGKQRIMDSAGRVEKFNSR 77
>gi|126653463|ref|ZP_01725559.1| 50S ribosomal protein L31 [Bacillus sp. B14905] >gi|126589819|gb|EAZ83952.1| 50S ribosomal protein L31 [Bacillus sp. B14905] (67 aa)
Score = 94, Expect = 3.2e-02, Identities = 23/65 (35%), Positives = 32/65 (49%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H    E +  C SC +TF   S    +   ++ C+ CHPFY G        GR ++FNKK
  S:     1 MKQGIHPDYKEATVTC-SCGNTFKTGSV--KENIVVEFCNECHPFYTGRQKFASADGRVDRFNKK 62
>gi|125718091|ref|YP_001035224.1| 50S ribosomal protein L31 type B [Streptococcus sanguinis SK36] >gi|166230231|sp|A3CNB9|RL31B_STRSV 50S ribosomal protein L31 type B >gi|125498008|gb|ABN44674.1| 50S ribosomal protein L31 type B, putative [Streptococcus sanguinis SK36] (80 aa)
Score = 94, Expect = 3.3e-02, Identities = 24/65 (36%), Positives = 34/65 (52%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET-----------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           M+K+ H +   V F   S    F+  ST  + ET            +++ S  HPFY G     Q  GR ++FNKK
  S:     1 MRKDIHPEYRPVVFMDTSTGYQFLSGSTKRSNETVEFEGETYPLIRVEISSDSHPFYTGRQKFTQADGRVDRFNKK 76
>gi|149195115|ref|ZP_01872207.1| Ribosomal protein L31 [Caminibacter mediatlanticus TB-2] >gi|149134828|gb|EDM23312.1| Ribosomal protein L31 [Caminibacter mediatlanticus TB-2] (66 aa)
Score = 94, Expect = 3.4e-02, Identities = 26/65 (40%), Positives = 35/65 (53%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MKK  H +  E +  C +C  TF V ST  T    I+VC+ CHPF+ G   +    G+ +KF KK
  S:     1 MKKGIHPEYVECTVTC-TCGHTFKVLSTKPT--LRIEVCNECHPFFTGKERNIDRGGKVDKFKKK 62
>gi|187935142|ref|YP_001884692.1| ribosomal protein L31 [Clostridium botulinum B str. Eklund 17B] >gi|188589119|ref|YP_001919879.1| ribosomal protein L31 [Clostridium botulinum E3 str. Alaska E43] >gi|187723295|gb|ACD24516.1| ribosomal protein L31 [Clostridium botulinum B str. Eklund 17B] >gi|188499400|gb|ACD52536.1| ribosomal protein L31 [Clostridium botulinum E3 str. Alaska E43] (69 aa)
Score = 94, Expect = 3.4e-02, Identities = 22/65 (33%), Positives = 35/65 (53%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H + +  +    +C ++F   S    +E  +++CS CHPF+ G      V GR EKFNK+
  S:     1 MKQGIHPEYHTDAVVKCACGNSFTTGSV--KEELKVEICSKCHPFFTGKQKIVDVGGRVEKFNKR 63
>gi|153886687|ref|ZP_02007841.1| ribosomal protein L31 [Ralstonia pickettii 12D] >gi|187928118|ref|YP_001898605.1| ribosomal protein L31 [Ralstonia pickettii 12J] >gi|151576861|gb|EDN41263.1| ribosomal protein L31 [Ralstonia pickettii 12D] >gi|187725008|gb|ACD26173.1| ribosomal protein L31 [Ralstonia pickettii 12J] (86 aa)
Score = 94, Expect = 3.4e-02, Identities = 27/65 (41%), Positives = 33/65 (50%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKE-----------TSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H    EV F   S +  F+ +ST+ TKE             I+V S  HPFY G        GR EKF  K
  S:     1 MKEGIHPNYREVVFQDMSSDFKFITRSTIQTKEMITLDGKEYPLAKIEVSSESHPFYTGQQKVLDTAGRVEKFRNK 76
>gi|56421916|ref|YP_149234.1| 50S ribosomal protein L31 [Geobacillus kaustophilus HTA426] >gi|73621793|sp|Q5KUH0|RL31_GEOKA 50S ribosomal protein L31 >gi|56381758|dbj|BAD77666.1| 50S ribosomal protein L31 [Geobacillus kaustophilus HTA426] (66 aa)
Score = 94, Expect = 3.4e-02, Identities = 24/65 (36%), Positives = 34/65 (52%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H +  +V   CA C + F   S  +  E  +++CS CHPF+ G        GR +KFNKK
  S:     1 MKQGIHPEYKKVIVRCA-CGNEFESGSVKD--ELRVEICSECHPFFTGKQKFVTAAGRVDKFNKK 62
>gi|163815258|ref|ZP_02206635.1| hypothetical protein COPEUT_01418 [Coprococcus eutactus ATCC 27759] >gi|158449453|gb|EDP26448.1| hypothetical protein COPEUT_01418 [Coprococcus eutactus ATCC 27759] (68 aa)
Score = 94, Expect = 3.5e-02, Identities = 23/65 (35%), Positives = 35/65 (53%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           M+K  H    +    C +C + FV  ST   +E  +++CS CH FY G   + + +GR + FNKK
  S:     1 MRKGIHPDYYQAKVVC-NCGNEFVTGST--KEEIHVEICSKCHSFYTGQQKAIKARGRIDMFNKK 62
>gi|66047147|ref|YP_236988.1| 50S ribosomal protein L31 type B [Pseudomonas syringae pv. syringae B728a] >gi|81307976|sp|Q4ZPH2|RL31B_PSEU2 50S ribosomal protein L31 type B >gi|63257854|gb|AAY38950.1| Ribosomal protein L31 [Pseudomonas syringae pv. syringae B728a] (93 aa)
Score = 93, Expect = 3.6e-02, Identities = 22/65 (33%), Positives = 37/65 (56%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET------------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK + H +   V F+  + ++ F++ ST++T  T            ++DV S+ HP Y G       +GR   FNK+
  S:     1 MKPDIHPQYRTVLFHDTAADAYFLIGSTVDTDRTQQHTDGTTYPYVALDVSSASHPMYTGQQRKATTEGRIAGFNKR 77
>gi|154498369|ref|ZP_02036747.1| hypothetical protein BACCAP_02358 [Bacteroides capillosus ATCC 29799] >gi|150272680|gb|EDM99858.1| hypothetical protein BACCAP_02358 [Bacteroides capillosus ATCC 29799] (67 aa)
Score = 93, Expect = 3.7e-02, Identities = 21/65 (32%), Positives = 33/65 (50%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H    + +  CA  N   V+++    ++  ++VCS CHPF+ G        GR  +FNKK
  S:     1 MKEGIHPNYQQTTIKCACGN---VIETGSTKQDIRVEVCSKCHPFFTGKQKMVDTGGRVSRFNKK 62
>gi|18311187|ref|NP_563121.1| 50S ribosomal protein L31 [Clostridium perfringens str. 13] >gi|110801256|ref|YP_696883.1| 50S ribosomal protein L31 [Clostridium perfringens ATCC 13124] >gi|161763553|ref|YP_699479.2| 50S ribosomal protein L31 [Clostridium perfringens SM101] >gi|168205558|ref|ZP_02631563.1| ribosomal protein L31 [Clostridium perfringens E str. JGS1987] >gi|168210134|ref|ZP_02635759.1| ribosomal protein L31 [Clostridium perfringens B str. ATCC 3626] >gi|168215834|ref|ZP_02641459.1| ribosomal protein L31 [Clostridium perfringens NCTC 8239] >gi|169344210|ref|ZP_02865192.1| ribosomal protein L31 [Clostridium perfringens C str. JGS1495] >gi|22096074|sp|Q8XIB6|RL31_CLOPE 50S ribosomal protein L31 >gi|118572986|sp|Q0TNA7|RL31_CLOP1 50S ribosomal protein L31 >gi|118572987|sp|Q0SQX8|RL31_CLOPS 50S ribosomal protein L31 >gi|18145870|dbj|BAB81911.1| 50S ribosomal protein L31 [Clostridium perfringens str. 13] >gi|110675903|gb|ABG84890.1| ribosomal protein L31 [Clostridium perfringens ATCC 13124] >gi|169297669|gb|EDS79769.1| ribosomal protein L31 [Clostridium perfringens C str. JGS1495] >gi|170662876|gb|EDT15559.1| ribosomal protein L31 [Clostridium perfringens E str. JGS1987] >gi|170711806|gb|EDT23988.1| ribosomal protein L31 [Clostridium perfringens B str. ATCC 3626] >gi|182381976|gb|EDT79455.1| ribosomal protein L31 [Clostridium perfringens NCTC 8239] (68 aa)
Score = 93, Expect = 3.7e-02, Identities = 21/65 (32%), Positives = 34/65 (52%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           M++  H + +  +    +C +TF   S     E  +++CS CHPF+ G      V GR +KFNK+
  S:     1 MRQGIHPEYHHDTVVKCACGNTFTTGSV--KPELKVEICSKCHPFFTGKQKIVDVGGRVDKFNKR 63
>gi|138896957|ref|YP_001127410.1| 50S ribosomal protein L31 [Geobacillus thermodenitrificans NG80-2] >gi|196249775|ref|ZP_03148471.1| ribosomal protein L31 [Geobacillus sp. G11MC16] >gi|134268470|gb|ABO68665.1| Ribosomal protein L31 [Geobacillus thermodenitrificans NG80-2] >gi|196210651|gb|EDY05414.1| ribosomal protein L31 [Geobacillus sp. G11MC16] (66 aa)
Score = 93, Expect = 3.7e-02, Identities = 24/65 (36%), Positives = 33/65 (50%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H    +V   CA C + F   S  +  E  +++CS CHPF+ G        GR +KFNKK
  S:     1 MKQGIHPAYKKVIVRCA-CGNEFESGSVKD--ELRVEICSECHPFFTGKQKFVSAAGRVDKFNKK 62
>gi|168213691|ref|ZP_02639316.1| ribosomal protein L31 [Clostridium perfringens CPE str. F4969] >gi|170714824|gb|EDT27006.1| ribosomal protein L31 [Clostridium perfringens CPE str. F4969] (68 aa)
Score = 93, Expect = 3.8e-02, Identities = 21/65 (32%), Positives = 34/65 (52%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           M++  H + +  +    +C +TF   S     E  +++CS CHPF+ G      V GR +KFNK+
  S:     1 MRQGIHPEYHHDTVVKCACGNTFTTGSV--KPELKVEICSKCHPFFTGKQKIVDVGGRVDKFNKR 63
>gi|56751902|ref|YP_172603.1| 50S ribosomal protein L31 [Synechococcus elongatus PCC 6301] >gi|81301013|ref|YP_401221.1| 50S ribosomal protein L31 [Synechococcus elongatus PCC 7942] >gi|73621825|sp|Q5N0T7|RL31_SYNP6 50S ribosomal protein L31 >gi|148880088|sp|Q31L35|RL31_SYNP7 50S ribosomal protein L31 >gi|56686861|dbj|BAD80083.1| 50S ribosomal protein L31 [Synechococcus elongatus PCC 6301] >gi|81169894|gb|ABB58234.1| LSU ribosomal protein L31P [Synechococcus elongatus PCC 7942] (77 aa)
Score = 93, Expect = 3.8e-02, Identities = 21/59 (35%), Positives = 29/59 (49%)
  Q:    21 CNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQEPTKSE 79
           CN   V+       E  +DV S  HPFY GT      +GR E+F +K   ++ +  KSE
  S:    18 CNGEEVMTVGSTQPELHVDVWSGNHPFYTGTQKIIDTEGRVERFLRKYGMLEGDQAKSE 76
>gi|150015291|ref|YP_001307545.1| 50S ribosomal protein L31 [Clostridium beijerinckii NCIMB 8052] >gi|149901756|gb|ABR32589.1| ribosomal protein L31 [Clostridium beijerinckii NCIMB 8052] (69 aa)
Score = 93, Expect = 3.8e-02, Identities = 21/65 (32%), Positives = 35/65 (53%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           M++  H + +  +    +C +TF   S    +E  +++CS CHPF+ G      V GR +KFNK+
  S:     1 MREGIHPEYHHNTVVKCACGNTFTTGSV--KEELKVEICSKCHPFFTGKQKIVDVGGRVDKFNKR 63
>gi|153956303|ref|YP_001397068.1| RpmE [Clostridium kluyveri DSM 555] >gi|146349161|gb|EDK35697.1| RpmE [Clostridium kluyveri DSM 555] (70 aa)
Score = 93, Expect = 3.8e-02, Identities = 24/65 (36%), Positives = 33/65 (50%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MKK  H +    S    +C +TF   ST   KE  +++CS CHPF+ G        GR ++F KK
  S:     1 MKKGIHPEYYHDSVVKCACGNTFTTGST--QKELKVEICSKCHPFFTGKQKLVDAGGRVDRFLKK 63
>gi|172058729|ref|YP_001815189.1| ribosomal protein L31 [Exiguobacterium sibiricum 255-15] >gi|171991250|gb|ACB62172.1| ribosomal protein L31 [Exiguobacterium sibiricum 255-15] (81 aa)
Score = 93, Expect = 3.8e-02, Identities = 25/65 (38%), Positives = 35/65 (53%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET------------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H   N+V F  ++    F+  ST ++ ET             +DV S  HPFY G        GR ++FNKK
  S:     1 MKQGIHPNYNKVVFMDSTTEYKFLTGSTRSSNETITWEDGNEYPLIRVDVSSDSHPFYTGRQKFNAADGRVDRFNKK 77
>gi|116617568|ref|YP_817939.1| 50S ribosomal protein L31P [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|122272231|sp|Q03Z06|RL31B_LEUMM 50S ribosomal protein L31 type B >gi|116096415|gb|ABJ61566.1| LSU ribosomal protein L31P [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (88 aa)
Score = 93, Expect = 3.8e-02, Identities = 25/65 (38%), Positives = 35/65 (53%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETS-----------IDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           M+ E H    +V F  AS    F+  ST+ + +T+           +D+ S  HPFY G     Q  G  +KFNKK
  S:     1 MQAEIHPDYRQVVFIDASTGKKFLSASTVTSNDTTDFEGKEYPAIRMDITSDSHPFYTGKQKFTQADGAVDKFNKK 76
>gi|189218444|ref|YP_001939085.1| Ribosomal protein L31 [Methylokorus infernorum V4] >gi|189185302|gb|ACD82487.1| Ribosomal protein L31 [Methylacidiphilum infernorum V4] (80 aa)
Score = 93, Expect = 3.9e-02, Identities = 28/86 (32%), Positives = 42/86 (48%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQEPTKSENKNTKKQSK 88
           MKK+ H    E + +CA C + +  KST       I +C+SCHP + G        GR EKF ++   +       E+ N KK++K
  S:     1 MKKDIHPNYQETTISCA-CGAVYTTKST--KPSIRIGICASCHPLFTGQQKFVDTAGRVEKFARRFGKIS---FIGESSNKKKKTK 80
>gi|169334992|ref|ZP_02862185.1| hypothetical protein ANASTE_01398 [Anaerofustis stercorihominis DSM 17244] >gi|169257730|gb|EDS71696.1| hypothetical protein ANASTE_01398 [Anaerofustis stercorihominis DSM 17244] (69 aa)
Score = 93, Expect = 3.9e-02, Identities = 23/65 (35%), Positives = 33/65 (50%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H K  +    CA C +TF   S  +  E  +++CS CHPFY G        GR ++F K+
  S:     4 MKEGIHPKYGKCKVTCA-CGNTFETGSVKD--EIRVEICSKCHPFYTGKQKLVDTGGRVDRFKKR 65
>gi|148272898|ref|YP_001222459.1| 50S ribosomal protein L31 [Clavibacter michiganensis subsp. michiganensis NCPPB 382] >gi|147830828|emb|CAN01770.1| 50S ribosomal protein L31 [Clavibacter michiganensis subsp. michiganensis NCPPB 382] (85 aa)
Score = 93, Expect = 3.9e-02, Identities = 23/65 (35%), Positives = 36/65 (55%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET------------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK + H K   V F   +  +TF+ +ST+++ +T             +++ S  HPFY G        GR EKFN +
  S:     1 MKTDIHPKYAPVVFRDLASGATFLTRSTVSSSKTIEWEDGNTYAVIDVEISSESHPFYTGKQRIMDSAGRVEKFNSR 77
>gi|148378141|ref|YP_001252682.1| ribosomal protein L31 [Clostridium botulinum A str. ATCC 3502] >gi|153932645|ref|YP_001382542.1| ribosomal protein L31 [Clostridium botulinum A str. ATCC 19397] >gi|153935369|ref|YP_001386094.1| ribosomal protein L31 [Clostridium botulinum A str. Hall] >gi|153939409|ref|YP_001389498.1| ribosomal protein L31 [Clostridium botulinum F str. Langeland] >gi|168177467|ref|ZP_02612131.1| ribosomal protein L31 [Clostridium botulinum NCTC 2916] >gi|168182256|ref|ZP_02616920.1| ribosomal protein L31 [Clostridium botulinum Bf] >gi|170756997|ref|YP_001779762.1| ribosomal protein L31 [Clostridium botulinum B1 str. Okra] >gi|148287625|emb|CAL81690.1| 50S ribosomal protein L31 [Clostridium botulinum A str. ATCC 3502] >gi|152928689|gb|ABS34189.1| ribosomal protein L31 [Clostridium botulinum A str. ATCC 19397] >gi|152931283|gb|ABS36782.1| ribosomal protein L31 [Clostridium botulinum A str. Hall] >gi|152935305|gb|ABS40803.1| ribosomal protein L31 [Clostridium botulinum F str. Langeland] >gi|169122209|gb|ACA46045.1| ribosomal protein L31 [Clostridium botulinum B1 str. Okra] >gi|182670349|gb|EDT82323.1| ribosomal protein L31 [Clostridium botulinum NCTC 2916] >gi|182674653|gb|EDT86614.1| ribosomal protein L31 [Clostridium botulinum Bf] (72 aa)
Score = 93, Expect = 4.0e-02, Identities = 23/65 (35%), Positives = 33/65 (50%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           M++  H + N       +C +TF   ST   KE  +++CS CHPF+ G        GR +KF KK
  S:     1 MREGIHPEYNHDVVVKCACGNTFTTGST--NKELKVEICSKCHPFFTGKQKIVDAGGRVDKFMKK 63
>gi|76788734|ref|YP_327820.1| 50S ribosomal protein L31 type B [Chlamydia trachomatis A/HAR-13] >gi|148878574|sp|Q3KN00|RL31B_CHLTA 50S ribosomal protein L31 type B >gi|76167264|gb|AAX50272.1| LSU ribosomal protein L31P [Chlamydia trachomatis A/HAR-13] (108 aa)
Score = 93, Expect = 4.0e-02, Identities = 30/77 (38%), Positives = 42/77 (54%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSI------DVC-----SSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQEPTKSE 79
           MKK TH +  +V F  +S    F+  ST  T +T +       VC     SS HPF+ G+      +GR +KF K+   +KQ   K E
  S:     1 MKKNTHPEYRQVLFVDSSTGYKFICGSTYQTDKTEVFEGQEYPVCYVSVSSSSHPFFTGSKKLVDAEGRVDKFLKRYSGIKQSAPKPE 88
>gi|104780390|ref|YP_606888.1| 50S ribosomal protein L31 type B [Pseudomonas entomophila L48] >gi|123255897|sp|Q1IE31|RL31B_PSEE4 50S ribosomal protein L31 type B >gi|95109377|emb|CAK14077.1| 50S ribosomal protein L31 type B [Pseudomonas entomophila L48] (85 aa)
Score = 93, Expect = 4.1e-02, Identities = 23/65 (35%), Positives = 35/65 (53%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET------------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK   H     V F+  + +  F++ ST++T  T            ++DV S+ HP Y G      V+GR   FNK+
  S:     1 MKAGIHPAYRPVLFHDTAADVYFLIGSTVDTDRTQVHSDGQTYPYVALDVSSASHPVYTGQQRKTTVEGRVAGFNKR 77
>gi|163840832|ref|YP_001625237.1| 50S ribosomal protein L31P [Renibacterium salmoninarum ATCC 33209] >gi|162954308|gb|ABY23823.1| LSU ribosomal protein L31P [Renibacterium salmoninarum ATCC 33209] (84 aa)
Score = 93, Expect = 4.1e-02, Identities = 22/65 (33%), Positives = 36/65 (55%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET------------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK + H K   V FN  +  + F+ +ST+++ +T             +++ S  HPFY G        GR E+FN +
  S:     1 MKSDIHPKYEAVVFNDLASGAKFLTRSTVSSDKTIEWEDGKTYPVIDVEISSESHPFYTGKQRIMDSAGRVERFNAR 77
>gi|117621340|ref|YP_856442.1| ribosomal protein L31 [Aeromonas hydrophila subsp. hydrophila ATCC 7966] >gi|166230205|sp|A0KJJ1|RL31B_AERHH 50S ribosomal protein L31 type B >gi|117562747|gb|ABK39695.1| ribosomal protein L31 [Aeromonas hydrophila subsp. hydrophila ATCC 7966] (89 aa)
Score = 93, Expect = 4.2e-02, Identities = 22/65 (33%), Positives = 38/65 (58%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET------------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           M+ + H +  +V F+  + N+ F+V STL T  T            ++DV S+ HPFY G       +G+  +F ++
  S:     1 MRPDIHPEYRQVLFHDLTANTYFLVGSTLKTDRTKLWEDGNTYPYVTLDVSSASHPFYTGKQKQVSKEGQVARFGQR 77
>gi|46581316|ref|YP_012124.1| 50S ribosomal protein L31 [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] >gi|120601503|ref|YP_965903.1| 50S ribosomal protein L31 [Desulfovibrio vulgaris subsp. vulgaris DP4] >gi|73621789|sp|Q727E3|RL31_DESVH 50S ribosomal protein L31 >gi|46450737|gb|AAS97384.1| ribosomal protein L31 [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] >gi|120561732|gb|ABM27476.1| LSU ribosomal protein L31P [Desulfovibrio vulgaris subsp. vulgaris DP4] (71 aa)
Score = 93, Expect = 4.3e-02, Identities = 24/72 (33%), Positives = 35/72 (48%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQE 74
           MK   H  + + + NCA C     V ST   +   +++CS+CHPFY G        GR ++F KK     +E
  S:     1 MKDNIHPTVYKATMNCA-CGYQAEVLST-KGENVHVEICSNCHPFYTGKQRLIDTAGRIDRFRKKYAKFGEE 70
>gi|196193940|gb|EDX88899.1| ribosomal protein L31 [Alcanivorax sp. DG881] (72 aa)
Score = 93, Expect = 4.3e-02, Identities = 22/65 (33%), Positives = 33/65 (50%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK E H      +++C SC +    +ST       +DVCS+CHPFY G        G+ +KF ++
  S:     1 MKAEIHPDYQTATYSC-SCGNVIESRST-KGGAMDLDVCSACHPFYTGKQKQADSGGQIDKFKQR 63
>gi|111018485|ref|YP_701457.1| 50S ribosomal protein L31 [Rhodococcus sp. RHA1] >gi|118572994|sp|Q0SGN7|RL31_RHOSR 50S ribosomal protein L31 >gi|110818015|gb|ABG93299.1| 50S ribosomal protein L31 type B [Rhodococcus sp. RHA1] (80 aa)
Score = 93, Expect = 4.3e-02, Identities = 22/65 (33%), Positives = 29/65 (44%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK   H      +  C  C +TF   ST  T   +++VCS CHPFY G        GR  +F  +
  S:     1 MKSGIHPNYVATTVVCG-CGNTFETHSTKETGRINVEVCSQCHPFYTGKQKILDTGGRVARFEAR 64
>gi|187777274|ref|ZP_02993747.1| hypothetical protein CLOSPO_00826 [Clostridium sporogenes ATCC 15579] >gi|187774202|gb|EDU38004.1| hypothetical protein CLOSPO_00826 [Clostridium sporogenes ATCC 15579] (72 aa)
Score = 93, Expect = 4.4e-02, Identities = 23/65 (35%), Positives = 33/65 (50%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           M++  H + N       +C +TF   ST   KE  +++CS CHPF+ G        GR +KF KK
  S:     1 MREGIHPEYNHDVVVKCACGNTFTTGST--NKELKVEICSKCHPFFTGKQKIVDAGGRVDKFMKK 63
>gi|88811942|ref|ZP_01127195.1| 50S ribosomal protein L31 [Nitrococcus mobilis Nb-231] >gi|88790826|gb|EAR21940.1| 50S ribosomal protein L31 [Nitrococcus mobilis Nb-231] (85 aa)
Score = 93, Expect = 4.4e-02, Identities = 25/65 (38%), Positives = 37/65 (56%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETS------------IDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MKK+ H +   V F   S +  F+ +STL TKET+            ++V S  HPF+ G        GR ++F K+
  S:     1 MKKDIHPEYRPVVFQDLSSDFAFLTRSTLRTKETTKWKDGEEYPLCKVEVSSKSHPFFTGKQRVASSGGRVDQFRKR 77
>gi|15674775|ref|NP_268949.1| 50S ribosomal protein L31 type B [Streptococcus pyogenes M1 GAS] >gi|19745816|ref|NP_606952.1| 50S ribosomal protein L31 type B [Streptococcus pyogenes MGAS8232] >gi|21910005|ref|NP_664273.1| 50S ribosomal protein L31 type B [Streptococcus pyogenes MGAS315] >gi|28896298|ref|NP_802648.1| 50S ribosomal protein L31 type B [Streptococcus pyogenes SSI-1] >gi|50913912|ref|YP_059884.1| 50S ribosomal protein L31 type B [Streptococcus pyogenes MGAS10394] >gi|71903190|ref|YP_279993.1| 50S ribosomal protein L31 type B [Streptococcus pyogenes MGAS6180] >gi|71910359|ref|YP_281909.1| 50S ribosomal protein L31 type B [Streptococcus pyogenes MGAS5005] >gi|94988230|ref|YP_596331.1| 50S ribosomal protein L31 type B [Streptococcus pyogenes MGAS9429] >gi|94990112|ref|YP_598212.1| 50S ribosomal protein L31 type B [Streptococcus pyogenes MGAS10270] >gi|94992104|ref|YP_600203.1| 50S ribosomal protein L31 type B [Streptococcus pyogenes MGAS2096] >gi|94994025|ref|YP_602123.1| 50S ribosomal protein L31 type B [Streptococcus pyogenes MGAS10750] >gi|139474081|ref|YP_001128797.1| 50S ribosomal protein L31 type B [Streptococcus pyogenes str. Manfredo] >gi|158564177|sp|Q1JCP9|RL31B_STRPB 50S ribosomal protein L31 type B >gi|166230230|sp|A2RFF4|RL31B_STRPG 50S ribosomal protein L31 type B >gi|54039011|sp|P66203|RL31B_STRP3 50S ribosomal protein L31 type B >gi|54039012|sp|P66204|RL31B_STRP8 50S ribosomal protein L31 type B >gi|54041872|sp|P66202|RL31B_STRP1 50S ribosomal protein L31 type B >gi|73621772|sp|Q5XD12|RL31B_STRP6 50S ribosomal protein L31 type B >gi|118572981|sp|Q1JHR8|RL31B_STRPD 50S ribosomal protein L31 type B >gi|118572982|sp|Q1J7J5|RL31B_STRPF 50S ribosomal protein L31 type B >gi|148878587|sp|Q1JMM5|RL31B_STRPC 50S ribosomal protein L31 type B >gi|152112312|sp|Q48UG8|RL31B_STRPM 50S ribosomal protein L31 type B >gi|13621901|gb|AAK33670.1| 50S ribosomal protein L31 [Streptococcus pyogenes M1 GAS] >gi|19747961|gb|AAL97451.1| 50S ribosomal protein L31 [Streptococcus pyogenes MGAS8232] >gi|21904195|gb|AAM79076.1| 50S ribosomal protein L31 [Streptococcus pyogenes MGAS315] >gi|28811549|dbj|BAC64481.1| 50S ribosomal protein L31 [Streptococcus pyogenes SSI-1] >gi|50902986|gb|AAT86701.1| LSU ribosomal protein L31P [Streptococcus pyogenes MGAS10394] >gi|71802285|gb|AAX71638.1| LSU ribosomal protein L31P [Streptococcus pyogenes MGAS6180] >gi|71853141|gb|AAZ51164.1| LSU ribosomal protein L31P [Streptococcus pyogenes MGAS5005] >gi|94541738|gb|ABF31787.1| LSU ribosomal protein L31P [Streptococcus pyogenes MGAS9429] >gi|94543620|gb|ABF33668.1| LSU ribosomal protein L31P [Streptococcus pyogenes MGAS10270] >gi|94545612|gb|ABF35659.1| LSU ribosomal protein L31P [Streptococcus pyogenes MGAS2096] >gi|94547533|gb|ABF37579.1| LSU ribosomal protein L31P [Streptococcus pyogenes MGAS10750] >gi|134272328|emb|CAM30583.1| 50S ribosomal protein L31 [Streptococcus pyogenes str. Manfredo] (86 aa)
Score = 93, Expect = 4.5e-02, Identities = 24/65 (36%), Positives = 34/65 (52%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET-----------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           M+K+ H     V F   +    F+  ST  +KET            +++ S  HPFY G     Q  GR ++FNKK
  S:     1 MRKDIHPDYRPVVFLDTTTGYQFLSGSTKASKETVEFEGETYPLIRVEISSDSHPFYTGRQKFTQADGRVDRFNKK 76
>gi|162446943|ref|YP_001620075.1| large subunit ribosomal protein L31 [Acholeplasma laidlawii PG-8A] >gi|161985050|gb|ABX80699.1| large subunit ribosomal protein L31 [Acholeplasma laidlawii PG-8A] (85 aa)
Score = 93, Expect = 4.5e-02, Identities = 28/72 (38%), Positives = 40/72 (55%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSI-------------DVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQE 74
           MK   H K   V F  A     F+++S++NTK+T +             +V S  HPFY G        GR +KFNK++   K+E
  S:     1 MKANIHPKTRLVIFEDAQTKKQFLIESSVNTKDTEVYEKDGKTYPVVRLEVTSETHPFYTGEQTFVAQAGRVDKFNKRLEKAKKE 85
>gi|153003605|ref|YP_001377930.1| ribosomal protein L31 [Anaeromyxobacter sp. Fw109-5] >gi|152027178|gb|ABS24946.1| ribosomal protein L31 [Anaeromyxobacter sp. Fw109-5] (120 aa)
Score = 92, Expect = 4.7e-02, Identities = 26/79 (32%), Positives = 38/79 (48%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAV--KQEPTKSENK 81
           MK+  H    +    CA  N   V+++     +  I++C+ CHPF+ G        GR EKF  +  A   K EP K+E K
  S:     1 MKEAIHPDYKDSKVLCACGN---VIETRSTRGDFHIEICAQCHPFFTGKQKIMDTAGRIEKFKTRYAATPAKAEPKKAEAK 78
>gi|68304929|gb|AAY89940.1| predicted ribosomal protein L31 [uncultured bacterium BAC13K9BAC] (80 aa)
Score = 92, Expect = 4.7e-02, Identities = 27/65 (41%), Positives = 37/65 (56%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET------------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MKK+ H     V F+  +CN +F++ ST+ T ET             I+  S  HPFY G    +  +GR  KF KK
  S:     1 MKKDIHPDYKPVIFHDVTCNKSFLLSSTVKTTETMKYEDGNEYPVYKIETSSESHPFYTGKGRIETKEGRVAKFKKK 77
>gi|85057884|ref|YP_456800.1| 50S ribosomal protein L31 [Aster yellows witches'-broom phytoplasma AYWB] >gi|158564268|sp|Q2NIM2|RL31_AYWBP 50S ribosomal protein L31 >gi|84789989|gb|ABC65721.1| LSU ribosomal protein L31P [Aster yellows witches'-broom phytoplasma AYWB] (90 aa)
Score = 92, Expect = 4.9e-02, Identities = 25/86 (29%), Positives = 39/86 (45%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQEPTKSENKNTKKQSK 88
           MK   H +   V  +CA+C     + +T+N+    I+ CS+CH FY G        G  +KFNK+    + +  K    N   Q +
  S:     1 MKANIHPQFKTVEVSCATCGKQHPIGTTVNS--IKIETCSNCHTFYTGVQTFVVKAGPVDKFNKRYGITQDQKVKKFPSNADNQKE 84
>gi|188990345|ref|YP_001902355.1| 50S ribosomal protein L31 [Xanthomonas campestris pv. campestris] >gi|167732105|emb|CAP50297.1| 50S ribosomal protein L31 [Xanthomonas campestris pv. campestris] (92 aa)
Score = 92, Expect = 4.9e-02, Identities = 22/65 (33%), Positives = 37/65 (56%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET------------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK   H   N+V F+  + +   + +ST+++KET             +++ S+ HPFY G        GR +KF K+
  S:    13 MKDNVHPSYNDVVFHDVTSDFKILTRSTMSSKETVKWEDGQDYPLIKVEISSASHPFYTGKHKVIDTGGRIDKFQKR 89
>gi|157364474|ref|YP_001471241.1| ribosomal protein L31 [Thermotoga lettingae TMO] >gi|157315078|gb|ABV34177.1| ribosomal protein L31 [Thermotoga lettingae TMO] (71 aa)
Score = 92, Expect = 4.9e-02, Identities = 27/65 (41%), Positives = 39/65 (60%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQV---KGRAEKFNKK 67
           MK++ H ++  V+  CA C +     +TL  +   IDVCS+CHP Y G S +  V   +GR EKF +K
  S:     1 MKEKIHPEMKLVTVKCA-CGAEHKFYTTL--ENVRIDVCSNCHPLYKGMSGASLVIDSEGRIEKFRRK 65
>gi|116627614|ref|YP_820233.1| 50S ribosomal protein L31 type B [Streptococcus thermophilus LMD-9] >gi|161611288|ref|YP_139252.2| 50S ribosomal protein L31 type B [Streptococcus thermophilus LMG 18311] >gi|161936371|ref|YP_141154.2| 50S ribosomal protein L31 type B [Streptococcus thermophilus CNRZ1066] >gi|122267788|sp|Q03L85|RL31B_STRTD 50S ribosomal protein L31 type B >gi|73621773|sp|Q5M0C3|RL31B_STRT1 50S ribosomal protein L31 type B >gi|73621774|sp|Q5M4X0|RL31B_STRT2 50S ribosomal protein L31 type B >gi|116100891|gb|ABJ66037.1| LSU ribosomal protein L31P [Streptococcus thermophilus LMD-9] (80 aa)
Score = 92, Expect = 5.0e-02, Identities = 24/65 (36%), Positives = 34/65 (52%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET-----------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MKK+ H     V F   +    F+  ST ++ ET            +++ S  HPFY G     Q  GR ++FNKK
  S:     1 MKKDIHPDYRPVVFMDTTTGYQFLSGSTKHSNETVEFEGETYPLIRVEISSDSHPFYTGRQKFTQADGRVDRFNKK 76
>gi|195977878|ref|YP_002123122.1| 50S ribosomal protein L31 type B [Streptococcus equi subsp. zooepidemicus str. MGCS10565] >gi|195974583|gb|ACG62109.1| 50S ribosomal protein L31 type B [Streptococcus equi subsp. zooepidemicus str. MGCS10565] (86 aa)
Score = 92, Expect = 5.2e-02, Identities = 24/65 (36%), Positives = 34/65 (52%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET-----------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           M+K+ H     V F   +    F+  ST  +KET            +++ S  HPFY G     Q  GR ++FNKK
  S:     1 MRKDIHPDYRPVVFLDTTTGYKFLSGSTKTSKETIEFEGETYPLVRVEISSDSHPFYTGRQKFTQADGRVDRFNKK 76
>gi|15901159|ref|NP_345763.1| 50S ribosomal protein L31 type B [Streptococcus pneumoniae TIGR4] >gi|15903220|ref|NP_358770.1| 50S ribosomal protein L31 type B [Streptococcus pneumoniae R6] >gi|116515764|ref|YP_816622.1| 50S ribosomal protein L31 type B [Streptococcus pneumoniae D39] >gi|148985198|ref|ZP_01818437.1| ribosomal protein L31 [Streptococcus pneumoniae SP3-BS71] >gi|148989323|ref|ZP_01820703.1| ribosomal protein L31 [Streptococcus pneumoniae SP6-BS73] >gi|148994110|ref|ZP_01823450.1| ribosomal protein L31 [Streptococcus pneumoniae SP9-BS68] >gi|148998939|ref|ZP_01826374.1| ribosomal protein L31 [Streptococcus pneumoniae SP11-BS70] >gi|149007034|ref|ZP_01830703.1| ribosomal protein L31 [Streptococcus pneumoniae SP18-BS74] >gi|149012360|ref|ZP_01833429.1| 50S ribosomal protein L31 type B [Streptococcus pneumoniae SP19-BS75] >gi|149019297|ref|ZP_01834659.1| ribosomal protein L31 [Streptococcus pneumoniae SP23-BS72] >gi|168484485|ref|ZP_02709437.1| ribosomal protein L31 [Streptococcus pneumoniae CDC1873-00] >gi|168487689|ref|ZP_02712197.1| ribosomal protein L31 [Streptococcus pneumoniae CDC1087-00] >gi|168489126|ref|ZP_02713325.1| ribosomal protein L31 [Streptococcus pneumoniae SP195] >gi|168491218|ref|ZP_02715361.1| ribosomal protein L31 [Streptococcus pneumoniae CDC0288-04] >gi|168493218|ref|ZP_02717361.1| ribosomal protein L31 [Streptococcus pneumoniae CDC3059-06] >gi|168575754|ref|ZP_02721669.1| ribosomal protein L31 [Streptococcus pneumoniae MLV-016] >gi|169834464|ref|YP_001694748.1| ribosomal protein L31 [Streptococcus pneumoniae Hungary19A-6] >gi|194398450|ref|YP_002037901.1| ribosomal protein L31 [Streptococcus pneumoniae G54] >gi|122278492|sp|Q04K26|RL31B_STRP2 50S ribosomal protein L31 type B >gi|54039010|sp|P66201|RL31B_STRR6 50S ribosomal protein L31 type B >gi|54041871|sp|P66200|RL31B_STRPN 50S ribosomal protein L31 type B >gi|14972785|gb|AAK75403.1| ribosomal protein L31 [Streptococcus pneumoniae TIGR4] >gi|15458809|gb|AAK99980.1| 50S ribosomal protein L31 [Streptococcus pneumoniae R6] >gi|116076340|gb|ABJ54060.1| ribosomal protein L31 [Streptococcus pneumoniae D39] >gi|147755249|gb|EDK62301.1| ribosomal protein L31 [Streptococcus pneumoniae SP11-BS70] >gi|147761338|gb|EDK68304.1| ribosomal protein L31 [Streptococcus pneumoniae SP18-BS74] >gi|147763686|gb|EDK70621.1| 50S ribosomal protein L31 type B [Streptococcus pneumoniae SP19-BS75] >gi|147922643|gb|EDK73761.1| ribosomal protein L31 [Streptococcus pneumoniae SP3-BS71] >gi|147925301|gb|EDK76380.1| ribosomal protein L31 [Streptococcus pneumoniae SP6-BS73] >gi|147927463|gb|EDK78492.1| ribosomal protein L31 [Streptococcus pneumoniae SP9-BS68] >gi|147931167|gb|EDK82146.1| ribosomal protein L31 [Streptococcus pneumoniae SP23-BS72] >gi|168996966|gb|ACA37578.1| ribosomal protein L31 [Streptococcus pneumoniae Hungary19A-6] >gi|172042288|gb|EDT50334.1| ribosomal protein L31 [Streptococcus pneumoniae CDC1873-00] >gi|183569542|gb|EDT90070.1| ribosomal protein L31 [Streptococcus pneumoniae CDC1087-00] >gi|183572411|gb|EDT92939.1| ribosomal protein L31 [Streptococcus pneumoniae SP195] >gi|183574494|gb|EDT95022.1| ribosomal protein L31 [Streptococcus pneumoniae CDC0288-04] >gi|183576800|gb|EDT97328.1| ribosomal protein L31 [Streptococcus pneumoniae CDC3059-06] >gi|183578387|gb|EDT98915.1| ribosomal protein L31 [Streptococcus pneumoniae MLV-016] >gi|194358117|gb|ACF56565.1| ribosomal protein L31 [Streptococcus pneumoniae G54] (80 aa)
Score = 92, Expect = 5.2e-02, Identities = 24/65 (36%), Positives = 34/65 (52%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET-----------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MKK+ H +   V F   +    F+  ST  + ET            +++ S  HPFY G     Q  GR ++FNKK
  S:     1 MKKDIHPEYRPVVFMDTTTGYQFLSGSTKRSNETVEFEGETYPLIRVEISSDSHPFYTGRQKFTQADGRVDRFNKK 76
>gi|172040223|ref|YP_001799937.1| 50S ribosomal protein L31 [Corynebacterium urealyticum DSM 7109] >gi|171851527|emb|CAQ04503.1| 50S ribosomal protein L31 [Corynebacterium urealyticum DSM 7109] (89 aa)
Score = 92, Expect = 5.4e-02, Identities = 22/77 (28%), Positives = 38/77 (49%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETS------------IDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQEPTKSE 79
           MKK+ H   + V F  ++    F+ +ST  +  T             +D+ S  HPF+ G        GR EKF ++   + +   K++
  S:     1 MKKDIHPDYHPVVFKDSATGKQFLTRSTATSDRTVEWEDGNEYPLIVVDITSESHPFWTGAQRVMDTAGRVEKFQRRYGGMARRKKKTQ 89
>gi|33592360|ref|NP_880004.1| 50S ribosomal protein L31 type B [Bordetella pertussis Tohama I] >gi|39931829|sp|Q7VYS7|RL31B_BORPE 50S ribosomal protein L31 type B >gi|33572005|emb|CAE41528.1| 50S ribosomal protein L31 [Bordetella pertussis Tohama I] (88 aa)
Score = 92, Expect = 5.6e-02, Identities = 26/65 (40%), Positives = 34/65 (52%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET-----------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H +  EV F      + FV +ST++T+ET             DV S  HPFY G        GR EKF  +
  S:     1 MKEGIHPEYREVVFMDVQTGNKFVTRSTIHTRETVEIDGKTYPLFKCDVTSESHPFYTGAQTRIVETGRVEKFRAR 76
>gi|154248868|ref|YP_001409693.1| ribosomal protein L31 [Fervidobacterium nodosum Rt17-B1] >gi|154152804|gb|ABS60036.1| ribosomal protein L31 [Fervidobacterium nodosum Rt17-B1] (70 aa)
Score = 92, Expect = 5.6e-02, Identities = 25/65 (38%), Positives = 39/65 (60%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGT---SMSQQVKGRAEKFNKK 67
           MKK  H ++  ++  CA C +   + +T   ++  IDVCS+CHP Y G+   S+    +GR +KF KK
  S:     1 MKKGIHPEMRLLTVRCA-CGAEHKIWTT--KEQLKIDVCSNCHPLYKGSGGASLIVDTEGRVQKFKKK 65
>gi|194684678|emb|CAR46624.1| 50S ribosomal protein L31 type B [Proteus mirabilis HI4320] (82 aa)
Score = 92, Expect = 5.9e-02, Identities = 24/65 (36%), Positives = 37/65 (56%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET-----------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H +   V F+  S ++ F V ST+ T +T           ++DV S  HPFY G   +   +G   +FNK+
  S:     1 MKENIHPQYRTVIFHDTSVDAYFKVGSTIQTDKTIEYEGQRYPYVTLDVSSQSHPFYTGKQKTHSQEGNVARFNKR 76
>gi|83654832|gb|ABC38895.1| ribosomal protein L31 [Burkholderia thailandensis E264] (138 aa)
Score = 92, Expect = 5.9e-02, Identities = 26/65 (40%), Positives = 32/65 (49%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET-----------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H    EV F   S    F+ +ST+ T+ET            I+V S  H FY G        GR EKF  K
  S:    52 MKQGIHPDYREVVFQDMSNGFKFITRSTIQTRETIELDGKTYPLAKIEVSSESHSFYTGQQKIMDTAGRVEKFKNK 127
>gi|182434340|ref|YP_001822059.1| putative 50S ribosomal protein L31 [Streptomyces griseus subsp. griseus NBRC 13350] >gi|178462856|dbj|BAG17376.1| putative 50S ribosomal protein L31 [Streptomyces griseus subsp. griseus NBRC 13350] (84 aa)
Score = 92, Expect = 6.0e-02, Identities = 20/65 (30%), Positives = 34/65 (52%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET------------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK   H     V F   + +  F+ +ST+ +  T             +++ S+ HPFY GT+      GR E+F ++
  S:     1 MKPGIHPSYGPVVFRDKAADFAFLTRSTMTSDRTVAWEDGNTYPVVDVEISSASHPFYTGTARVLDTAGRVERFERR 77
>gi|163789891|ref|ZP_02184327.1| 50S ribosomal protein L31 [Carnobacterium sp. AT7] >gi|159874831|gb|EDP68899.1| 50S ribosomal protein L31 [Carnobacterium sp. AT7] (91 aa)
Score = 91, Expect = 6.3e-02, Identities = 25/65 (38%), Positives = 35/65 (53%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET------------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MKK  H +  +V F   +    F+  ST N+ ET             +++ S  HPFY G     Q  GR ++FNKK
  S:     1 MKKAIHPEYRQVVFMDTTTGYKFLSGSTKNSSETVEWEDGSTYPMIRVEISSDSHPFYTGRQKFTQADGRVDRFNKK 77
>gi|126697060|ref|YP_001091946.1| 50S ribosomal protein L31 [Prochlorococcus marinus str. MIT 9301] >gi|126544103|gb|ABO18345.1| 50S ribosomal protein L31 [Prochlorococcus marinus str. MIT 9301] (86 aa)
Score = 91, Expect = 6.7e-02, Identities = 22/69 (31%), Positives = 35/69 (50%)
  Q:    21 CNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQEPTKSENKNTKKQSKK 89
           CN   V+ +     E  +DV S  HPF+ GT      +GR ++F KK        ++S+++  +K SKK
  S:    18 CNGEVVMTTGSTQPELHVDVWSGNHPFFTGTQKILDTEGRVDRFMKKYGMGSANSSESKDQKEEKDSKK 86
>gi|116333157|ref|YP_794684.1| ribosomal protein L31 [Lactobacillus brevis ATCC 367] >gi|122270154|sp|Q03T19|RL31B_LACBA 50S ribosomal protein L31 type B >gi|116098504|gb|ABJ63653.1| LSU ribosomal protein L31P [Lactobacillus brevis ATCC 367] (83 aa)
Score = 91, Expect = 6.8e-02, Identities = 24/65 (36%), Positives = 33/65 (50%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET------------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H    EV F  +S    F+  ST  + ET             +++ S  HPFY G     Q  G  ++FNKK
  S:     1 MKQGIHPDYREVVFQDSSTGFQFLSGSTATSDETVEWEDGNTYPLIRVEITSDSHPFYTGKQKFTQADGAVDRFNKK 77
>gi|121999029|ref|YP_001003816.1| ribosomal protein L31 [Halorhodospira halophila SL1] >gi|166230219|sp|A1WZA2|RL31B_HALHL 50S ribosomal protein L31 type B >gi|121590434|gb|ABM63014.1| LSU ribosomal protein L31P [Halorhodospira halophila SL1] (87 aa)
Score = 91, Expect = 6.8e-02, Identities = 24/65 (36%), Positives = 37/65 (56%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET------------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MKK+ H +  EV F   S + +F+ +ST+ T ET             I+V S  HPF+ G        G+ ++F K+
  S:     1 MKKDIHPEYREVVFQDISTDFSFLTRSTVKTDETITWQDGNEYPLVKIEVSSRSHPFFTGKQRVVHSGGQVDRFRKR 77
>gi|15834911|ref|NP_296670.1| 50S ribosomal protein L31 type B [Chlamydia muridarum Nigg] >gi|13878741|sp|Q9PL17|RL31B_CHLMU 50S ribosomal protein L31 type B >gi|7190333|gb|AAF39159.1| ribosomal protein L31 [Chlamydia muridarum Nigg] (108 aa)
Score = 91, Expect = 6.9e-02, Identities = 32/77 (41%), Positives = 42/77 (54%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSI------DVC-----SSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQEPTKSE 79
           MKK TH +  +V F  +S    FV  ST  T +T +       VC     SS HPF+ G+      +GR +KF K+   VKQ   K E
  S:     1 MKKNTHPEYRQVLFVDSSTGYKFVCGSTYQTDKTEVFEGQEYPVCYVSVSSSSHPFFTGSKKLVDAEGRVDKFLKRYSGVKQMAPKPE 88
>gi|37524068|ref|NP_927412.1| 50S ribosomal protein L31 [Photorhabdus luminescens subsp. laumondii TTO1] >gi|39931734|sp|Q7NA98|RL31B_PHOLL 50S ribosomal protein L31 type B >gi|36783491|emb|CAE12331.1| 50S ribosomal protein L31 [Photorhabdus luminescens subsp. laumondii TTO1] (84 aa)
Score = 91, Expect = 7.0e-02, Identities = 24/65 (36%), Positives = 35/65 (53%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET-----------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK + H     V F+  S N+ F + ST+ T+ T           ++DV S  HPFY G   +   +G   +F KK
  S:     1 MKPDIHPNYRVVVFHDTSANAYFTIGSTIRTERTITLNGEEYPYVTVDVSSESHPFYTGKQKTLSQEGSTARFQKK 76
>gi|91201019|emb|CAJ74076.1| strongly similar to 50S ribosomal protein L31 [Candidatus Kuenenia stuttgartiensis] (76 aa)
Score = 91, Expect = 7.1e-02, Identities = 22/66 (33%), Positives = 33/66 (50%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKV 68
           MK   H    E    C  C  TF  ++T    + ++D+CS CHPFY G        G+ ++FNK++
  S:     1 MKSSIHPNYIEAVVTCG-CGETFKTRAT--KPKIAVDICSKCHPFYTGKQRFIDSAGQIDRFNKRL 63
>gi|116749147|ref|YP_845834.1| ribosomal protein L31 [Syntrophobacter fumaroxidans MPOB] >gi|116698211|gb|ABK17399.1| LSU ribosomal protein L31P [Syntrophobacter fumaroxidans MPOB] (76 aa)
Score = 91, Expect = 7.2e-02, Identities = 25/74 (33%), Positives = 36/74 (48%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQEPT 76
           MK+  H   +E    CA C +     ST   KE  +++CS CHPFY G        GR E+F +K    +++ T
  S:     1 MKEGIHPVYHETVIRCA-CGAEIPTGST--KKEIRVEICSKCHPFYTGKQKLVDSAGRIERFRRKYEKFQKKET 71
>gi|29831187|ref|NP_825821.1| 50S ribosomal protein L31 type B [Streptomyces avermitilis MA-4680] >gi|39931880|sp|Q82EH1|R31B2_STRAW 50S ribosomal protein L31 type B 2 >gi|29608301|dbj|BAC72356.1| putative ribosomal protein L31 [Streptomyces avermitilis MA-4680] (82 aa)
Score = 91, Expect = 7.3e-02, Identities = 19/65 (29%), Positives = 36/65 (55%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET------------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           M++  H     V F   + N  F+ +ST+ +++T             +++ +  HPFY GT+      GR E+F ++
  S:     1 MREGIHPAYAPVVFRDRAANHAFLTRSTMTSEKTVEWTDGHTYPVVDVEISNVSHPFYTGTARVLDTAGRVERFERR 77
>gi|21221854|ref|NP_627633.1| 50S ribosomal protein L31 type B [Streptomyces coelicolor A3(2)] >gi|17433172|sp|Q9X8K6|R31B2_STRCO 50S ribosomal protein L31 type B 2 >gi|4808366|emb|CAB42780.1| putative 50S ribosomal protein L31 [Streptomyces coelicolor A3(2)] (84 aa)
Score = 91, Expect = 7.3e-02, Identities = 20/65 (30%), Positives = 35/65 (53%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET------------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           M+K  H +   V F   + +  F+ +ST+ ++ T             ++V    HPFY GT+      GR E+F ++
  S:     1 MRKGIHPEYRPVVFRDRAADYAFLTRSTMTSERTVEWEDGRTYPVVDVEVSHVSHPFYTGTARVLDTAGRVERFERR 77
>gi|148243243|ref|YP_001228400.1| 50S ribosomal protein L31 [Synechococcus sp. RCC307] >gi|147851553|emb|CAK29047.1| 50S ribosomal protein L31 [Synechococcus sp. RCC307] (92 aa)
Score = 91, Expect = 7.4e-02, Identities = 17/47 (36%), Positives = 25/47 (53%)
  Q:    21 CNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           CN   V+ +   T E  +DV S  HPF+ GT      +GR ++F +K
  S:    18 CNGEVVMTTGSTTPELHVDVWSGNHPFFTGTQKILDTEGRVDRFMRK 64
>gi|83591215|ref|YP_431224.1| 50S ribosomal protein L31 [Moorella thermoacetica ATCC 39073] >gi|148878600|sp|Q2RFV8|RL31_MOOTA 50S ribosomal protein L31 >gi|83574129|gb|ABC20681.1| LSU ribosomal protein L31P [Moorella thermoacetica ATCC 39073] (66 aa)
Score = 91, Expect = 7.8e-02, Identities = 21/65 (32%), Positives = 32/65 (49%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMS-QQVKGRAEKFNKK 67
           MK   H         CA  N   V+++    K+  +++CS CHPFY G+     +  GR E+F +K
  S:     1 MKPNIHPDYGPARIICACGN---VIETRSTKKDIRVEICSQCHPFYTGSRQRVVERGGRIERFRQK 63
>gi|33596470|ref|NP_884113.1| 50S ribosomal protein L31 type B [Bordetella parapertussis 12822] >gi|33602237|ref|NP_889797.1| 50S ribosomal protein L31 type B [Bordetella bronchiseptica RB50] >gi|39931841|sp|Q7W9B8|RL31B_BORPA 50S ribosomal protein L31 type B >gi|39931850|sp|Q7WHE7|RL31B_BORBR 50S ribosomal protein L31 type B >gi|33566239|emb|CAE37148.1| 50S ribosomal protein L31 [Bordetella parapertussis] >gi|33576676|emb|CAE33753.1| 50S ribosomal protein L31 [Bordetella bronchiseptica RB50] (88 aa)
Score = 91, Expect = 7.9e-02, Identities = 25/65 (38%), Positives = 34/65 (52%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET-----------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H +  EV F      + F+ +ST++T+ET             DV S  HPFY G        GR EKF  +
  S:     1 MKEGIHPEYREVVFMDVQTGNKFITRSTIHTRETVEMDGKTYPLFKCDVTSESHPFYTGAQTRIVETGRVEKFRAR 76
>gi|73621797|sp|Q7VFD3|RL31_HELHP 50S ribosomal protein L31 >gi|32263296|gb|AAP78341.1| ribosomal protein L31 [Helicobacter hepaticus ATCC 51449] (68 aa)
Score = 90, Expect = 8.0e-02, Identities = 24/66 (36%), Positives = 31/66 (46%)
  Q:     2 IMKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           +MKK  H +       C +      V ST    E  ID+ S CHPFY G+     + GR EKF +K
  S:     1 MMKKGIHPEYIPCKVTCVTSGKQLEVLST--KSELRIDISSFCHPFYTGSDKITDITGRVEKFRQK 64
>gi|23100455|ref|NP_693922.1| 50S ribosomal protein L31 [Oceanobacillus iheyensis HTE831] >gi|31076968|sp|Q8EM58|RL31B_OCEIH 50S ribosomal protein L31 type B >gi|22778688|dbj|BAC14956.1| 50S ribosomal protein L31 [Oceanobacillus iheyensis HTE831] (81 aa)
Score = 90, Expect = 8.2e-02, Identities = 25/65 (38%), Positives = 37/65 (56%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET------------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MKK+ H +  +V F   S N  F+  ST  + ET             +++ S  HPFY G   + +V GR ++F KK
  S:     1 MKKDIHPEYKKVVFLDTSTNFKFLSGSTKGSDETIEWEDGNTYPLIKVEISSDSHPFYTGKQKADKVGGRVDRFKKK 77
>gi|172038957|ref|YP_001805458.1| 50S ribosomal protein L31 [Cyanothece sp. ATCC 51142] >gi|171700411|gb|ACB53392.1| 50S ribosomal protein L31 [Cyanothece sp. ATCC 51142] (104 aa)
Score = 90, Expect = 8.7e-02, Identities = 20/58 (34%), Positives = 31/58 (53%)
  Q:    21 CNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAV-KQEPTKS 78
           CN   V+       E +++V S  HPFY GT      +GR ++F K+   + K++P KS
  S:    18 CNGEVVMTVGSTQPEINVEVWSGNHPFYTGTQKIIDTEGRVDRFQKRYAMIGKKKPEKS 76
>gi|157150375|ref|YP_001450147.1| ribosomal protein L31 [Streptococcus gordonii str. Challis substr. CH1] >gi|157075169|gb|ABV09852.1| ribosomal protein L31 [Streptococcus gordonii str. Challis substr. CH1] (94 aa)
Score = 90, Expect = 8.7e-02, Identities = 24/65 (36%), Positives = 34/65 (52%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET-----------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           M+K+ H +   V F   S    F+  ST  + ET            +++ S  HPFY G     Q  GR ++FNKK
  S:    15 MRKDIHPEYRPVVFMDTSTGYQFLSGSTKRSNETVEFEGETYPLIRVEISSDSHPFYTGRQKFTQADGRVDRFNKK 90
>gi|134097362|ref|YP_001103023.1| 50S ribosomal protein L31 type B [Saccharopolyspora erythraea NRRL 2338] >gi|166230228|sp|A4F7S3|RL31B_SACEN 50S ribosomal protein L31 type B >gi|133909985|emb|CAM00097.1| 50S ribosomal protein L31 type B-2 [Saccharopolyspora erythraea NRRL 2338] (86 aa)
Score = 90, Expect = 8.8e-02, Identities = 22/65 (33%), Positives = 34/65 (52%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKE------------TSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK   H +   V F   S  + F+ +ST  ++E              +DV S+ HPF+ G       +GR EKF ++
  S:     1 MKPGIHPEYGPVVFRDRSTGTQFLTRSTATSEERVEWSDGNSYPLIVVDVTSASHPFWTGGRQVLDTQGRVEKFRRR 77
>gi|29375747|ref|NP_814901.1| ribosomal protein L31 [Enterococcus faecalis V583] >gi|73621756|sp|Q836E3|RL31B_ENTFA 50S ribosomal protein L31 type B >gi|29343208|gb|AAO80971.1| ribosomal protein L31 [Enterococcus faecalis V583] (89 aa)
Score = 90, Expect = 9.2e-02, Identities = 24/65 (36%), Positives = 34/65 (52%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET------------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK++ H     V F  ++    F+  ST  + ET             ++V S  HPFY G     Q  GR ++FNKK
  S:     1 MKQDIHPNYQPVVFMDSTTGFKFLSGSTKGSSETVEWEDGNTYPLLRVEVTSDSHPFYTGRQKFTQADGRVDRFNKK 77
>gi|15640894|ref|NP_230525.1| 50S ribosomal protein L31 type B [Vibrio cholerae O1 biovar eltor str. N16961] >gi|121585714|ref|ZP_01675509.1| ribosomal protein, L31P family [Vibrio cholerae 2740-80] >gi|121728352|ref|ZP_01681382.1| ribosomal protein, L31P family [Vibrio cholerae V52] >gi|147673049|ref|YP_001216357.1| 50S ribosomal protein L31 type B [Vibrio cholerae O395] >gi|153819002|ref|ZP_01971669.1| ribosomal protein, L31P family [Vibrio cholerae NCTC 8457] >gi|153827525|ref|ZP_01980192.1| ribosomal protein, L31P family [Vibrio cholerae MZO-2] >gi|153830567|ref|ZP_01983234.1| ribosomal protein, L31P family [Vibrio cholerae 623-39] >gi|194533692|ref|YP_002069108.1| ribosomal protein, L31P family [Vibrio cholerae MO10] >gi|194534385|ref|YP_002069621.1| ribosomal protein, L31P family [Vibrio cholerae RC385] >gi|194537881|ref|YP_002073020.1| ribosomal protein, L31P family [Vibrio cholerae V51] >gi|172047428|sp|A5F342|RL31B_VIBC3 50S ribosomal protein L31 type B >gi|17433164|sp|Q9KTM4|RL31B_VIBCH 50S ribosomal protein L31 type B >gi|9655332|gb|AAF94040.1| ribosomal protein, L31P family [Vibrio cholerae O1 biovar El Tor str. N16961] >gi|121550077|gb|EAX60093.1| ribosomal protein, L31P family [Vibrio cholerae 2740-80] >gi|121629407|gb|EAX61837.1| ribosomal protein, L31P family [Vibrio cholerae V52] >gi|125619744|gb|EAZ48271.1| ribosomal protein, L31P family [Vibrio cholerae MO10] >gi|125622494|gb|EAZ50814.1| ribosomal protein, L31P family [Vibrio cholerae V51] >gi|126510435|gb|EAZ73029.1| ribosomal protein, L31P family [Vibrio cholerae NCTC 8457] >gi|146314932|gb|ABQ19471.1| ribosomal protein, L31P family [Vibrio cholerae O395] >gi|148873965|gb|EDL72100.1| ribosomal protein, L31P family [Vibrio cholerae 623-39] >gi|149738544|gb|EDM52899.1| ribosomal protein, L31P family [Vibrio cholerae MZO-2] >gi|150419099|gb|EDN11539.1| ribosomal protein, L31P family [Vibrio cholerae RC385] >gi|150424414|gb|EDN16351.1| ribosomal protein, L31P family [Vibrio cholerae AM-19226] (85 aa)
Score = 90, Expect = 9.2e-02, Identities = 25/65 (38%), Positives = 34/65 (52%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET-----------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK   H    +V F+  + +  FVV STL T  T           +I+V S  HPFY G     Q +GR   F ++
  S:     1 MKAGIHPDYRKVVFHDTTVDHYFVVGSTLQTDRTIEWEGKTYPYITIEVSSESHPFYTGKQRVVQKEGRVANFTRR 76
>gi|76581212|gb|ABA50687.1| ribosomal protein L31 [Burkholderia pseudomallei 1710b] (116 aa)
Score = 90, Expect = 9.5e-02, Identities = 26/65 (40%), Positives = 32/65 (49%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET-----------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H    EV F   S    F+ +ST+ T+ET            I+V S  H FY G        GR EKF  K
  S:    30 MKQGIHPDYREVVFQDMSNGFKFITRSTIQTRETIEFEGKTYPLAKIEVSSESHSFYTGQQKIMDTAGRVEKFKNK 105
>gi|114567905|ref|YP_755059.1| ribosomal protein L31 [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|114338840|gb|ABI69688.1| LSU ribosomal protein L31P [Syntrophomonas wolfei subsp. wolfei str. Goettingen] (67 aa)
Score = 90, Expect = 9.5e-02, Identities = 24/65 (36%), Positives = 35/65 (53%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQ-QVKGRAEKFNKK 67
           MK + H K ++    CA C + F V ST  ++   +++CS CHPFY G         GR ++F KK
  S:     1 MKAKIHPKYHQAKARCA-CGNEFEVGST--SENIRVEICSKCHPFYTGAKGRLVDTTGRVDRFKKK 63
>gi|118572996|sp|Q67TD7|RL31_SYMTH 50S ribosomal protein L31 (67 aa)
Score = 90, Expect = 9.6e-02, Identities = 22/65 (33%), Positives = 38/65 (58%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKG--RAEKFNKK 67
           MK   H K  + +  C  C +T+ V ST   +   +++C++CHPFY G+  + +V+   R ++F KK
  S:     1 MKAGIHPKTQKTTITCG-CGATYEVLST--KENIRVEICANCHPFYTGSRGATRVEAGSRIDRFRKK 64
>gi|167464107|ref|ZP_02329196.1| 50S ribosomal protein L31 [Paenibacillus larvae subsp. larvae BRL-230010] (65 aa)
Score = 90, Expect = 9.6e-02, Identities = 22/65 (33%), Positives = 33/65 (50%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H   +  +  CA C +TF   S    +   +++CS+CHPF+ G        GR +KF KK
  S:     1 MKQGIHPTYHATTVTCA-CGNTFETGSV--KENLRVEICSNCHPFFTGKQKFVDAGGRVDKFKKK 62
>gi|73621780|sp|Q66V72|RL31_BACME 50S ribosomal protein L31 >gi|51704741|gb|AAU09404.1| putative ribosomal protein L31 [Bacillus megaterium] (66 aa)
Score = 90, Expect = 9.9e-02, Identities = 23/65 (35%), Positives = 31/65 (47%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK   H     V   C +C + F   S    +E  ++ CS CHPFY G     +  GR ++FNKK
  S:     1 MKTGIHPNYKTVMVKC-TCGNEFESGSV--KEEIRVETCSECHPFYTGRQKFAEAGGRVDRFNKK 62
>gi|55736795|gb|AAV60437.1| 50S ribosomal protein L31 [Streptococcus thermophilus LMG 18311] >gi|55738698|gb|AAV62339.1| 50S ribosomal protein L31 [Streptococcus thermophilus CNRZ1066] (92 aa)
Score = 90, Expect = 1.0e-01, Identities = 24/65 (36%), Positives = 34/65 (52%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET-----------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MKK+ H     V F   +    F+  ST ++ ET            +++ S  HPFY G     Q  GR ++FNKK
  S:    13 MKKDIHPDYRPVVFMDTTTGYQFLSGSTKHSNETVEFEGETYPLIRVEISSDSHPFYTGRQKFTQADGRVDRFNKK 88
>gi|34556871|ref|NP_906686.1| 50S ribosomal protein L31 [Wolinella succinogenes DSM 1740] >gi|73621831|sp|Q7MSH1|RL31_WOLSU 50S ribosomal protein L31 >gi|34482586|emb|CAE09586.1| hypothetical protein [Wolinella succinogenes] (67 aa)
Score = 90, Expect = 1.0e-01, Identities = 25/65 (38%), Positives = 29/65 (44%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MKK  H         C +    F V ST    E  ID+ S CHPFY G+       GR EKF +K
  S:     1 MKKGIHPNYVPCKVTCVTSGKEFEVLST--KPELRIDISSFCHPFYTGSDKVVDTAGRVEKFKQK 63
>gi|78484470|ref|YP_390395.1| ribosomal protein L31 [Thiomicrospira crunogena XCL-2] >gi|148878588|sp|Q31JF2|RL31B_THICR 50S ribosomal protein L31 type B >gi|78362756|gb|ABB40721.1| LSU ribosomal protein L31P [Thiomicrospira crunogena XCL-2] (83 aa)
Score = 89, Expect = 1.0e-01, Identities = 27/65 (41%), Positives = 37/65 (56%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKST----------LNTKE---TSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           M+   H + NEV F   S   TF+ +ST          L+ KE     I+V S+ HPF+ G       +GR EKF +K
  S:     1 MQAGIHPEYNEVVFQDISTGETFLTRSTIEKTSGDTITLDGKEYPLVRIEVSSASHPFFTGKQSLVDTEGRVEKFRQK 78
>gi|161546620|ref|NP_861275.2| 50S ribosomal protein L31 [Helicobacter hepaticus ATCC 51449] (67 aa)
Score = 89, Expect = 1.1e-01, Identities = 24/65 (36%), Positives = 30/65 (46%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MKK  H +       C +      V ST    E  ID+ S CHPFY G+     + GR EKF +K
  S:     1 MKKGIHPEYIPCKVTCVTSGKQLEVLST--KSELRIDISSFCHPFYTGSDKITDITGRVEKFRQK 63
>gi|163762576|ref|ZP_02169641.1| transcription termination factor NusA [Bacillus selenitireducens MLS10] >gi|160357315|gb|EDP83963.1| transcription termination factor NusA [Bacillus selenitireducens MLS10] (83 aa)
Score = 89, Expect = 1.1e-01, Identities = 24/65 (36%), Positives = 35/65 (53%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET------------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H K ++V F   S    F+  ST ++ ET            +++V S  HPFY G        GR ++F KK
  S:     4 MKEGIHPKYHQVVFKDVSSGFMFLTGSTRSSSETIEWEDGNTYPLLTVEVSSDSHPFYTGKQKFADAGGRVDRFKKK 80
>gi|91788132|ref|YP_549084.1| 50S ribosomal protein L31P [Polaromonas sp. JS666] >gi|91697357|gb|ABE44186.1| LSU ribosomal protein L31P [Polaromonas sp. JS666] (93 aa)
Score = 89, Expect = 1.1e-01, Identities = 29/65 (44%), Positives = 35/65 (53%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET------------SIDVCSSCHPFYIGTSMS-QQVKGRAEKFNKK 67
           MK+  H    EV F   S N  FV +S +NTKE              +D  S  HPFY GT  S   + GR EKF  +
  S:     1 MKEGIHPNYREVCFLDLSNNFKFVTRSCVNTKEMVKMEDGRELPLYKLDTSSESHPFYTGTQKSVDNMGGRVEKFRNR 78
>gi|28871325|ref|NP_793944.1| 50S ribosomal protein L31 type B [Pseudomonas syringae pv. tomato str. DC3000] >gi|31076909|sp|Q87XJ5|RL31B_PSESM 50S ribosomal protein L31 type B >gi|28854576|gb|AAO57639.1| ribosomal protein L31 [Pseudomonas syringae pv. tomato str. DC3000] (93 aa)
Score = 89, Expect = 1.1e-01, Identities = 22/68 (32%), Positives = 37/68 (54%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET------------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVA 70
           MK + H     V F+  + ++ F++ ST++T  T            ++DV S+ HP Y G       +GR   FNK+  +
  S:     1 MKPDIHPAYRTVLFHDTAADAYFLIGSTVDTDRTQQHTDGTTYPYVALDVSSASHPMYTGQQRKTTTEGRIAGFNKRFAS 80
>gi|184154680|ref|YP_001843020.1| 50S ribosomal protein L31 [Lactobacillus fermentum IFO 3956] >gi|183226024|dbj|BAG26540.1| 50S ribosomal protein L31 [Lactobacillus fermentum IFO 3956] (81 aa)
Score = 89, Expect = 1.1e-01, Identities = 25/65 (38%), Positives = 34/65 (52%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET------------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H   + V F  ++    F+  ST  +KET             ++V S  HPFY G     Q  G  +KFNKK
  S:     1 MKQGIHPDYHLVVFEDSATGYKFISGSTATSKETVEWEDGNEYPLVRVEVTSDSHPFYTGKQKFTQADGAVDKFNKK 77
>gi|177671008|ref|ZP_02944096.1| ribosomal protein L31 [Micrococcus luteus NCTC 2665] >gi|172072053|gb|EDT58091.1| ribosomal protein L31 [Micrococcus luteus NCTC 2665] (85 aa)
Score = 89, Expect = 1.1e-01, Identities = 20/65 (30%), Positives = 35/65 (53%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETS------------IDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK E H   + V FN  +     + ++T N+ +T+            +++ ++ HPFY G        GR E+FN +
  S:     1 MKSEIHPDYHYVIFNDLASGEKILTRTTANSDKTAEWTDGNTYPVIDVEISAASHPFYTGKQRIMDTAGRVERFNAR 77
>gi|124024024|ref|YP_001018331.1| 50S ribosomal protein L31 [Prochlorococcus marinus str. MIT 9303] >gi|123964310|gb|ABM79066.1| 50S ribosomal protein L31 [Prochlorococcus marinus str. MIT 9303] (93 aa)
Score = 89, Expect = 1.1e-01, Identities = 22/69 (31%), Positives = 35/69 (50%)
  Q:    21 CNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKV------VAVKQEPTKSENKNTKKQSKK 89
           CN   V+ +     E  +DV S  HPF+ GT      +GR ++F +K        A  ++ T ++N N    SK+
  S:    18 CNGEVVMTTGSTQPELHVDVWSGNHPFFTGTQKILDTEGRVDRFMRKYGMGSADAAADEKKTDAKNNNKDNTSKE 92
>gi|171780026|ref|ZP_02920930.1| hypothetical protein STRINF_01814 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gi|171281374|gb|EDT46809.1| hypothetical protein STRINF_01814 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] (80 aa)
Score = 89, Expect = 1.2e-01, Identities = 24/65 (36%), Positives = 35/65 (53%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET-----------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H +   V F   +    F+  ST ++KET            +++ S  HPFY G     Q  GR ++FNKK
  S:     1 MKQNIHPEYRPVVFMDTTTGYKFLSGSTKSSKETVEFEGETYPLIRVEISSDSHPFYTGRQKFTQADGRVDRFNKK 76
>gi|194367026|ref|YP_002029636.1| ribosomal protein L31 [Stenotrophomonas maltophilia R551-3] >gi|194349830|gb|ACF52953.1| ribosomal protein L31 [Stenotrophomonas maltophilia R551-3] (80 aa)
Score = 89, Expect = 1.2e-01, Identities = 22/65 (33%), Positives = 37/65 (56%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET------------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK + H    +V F+  + +   + +ST++TKET             +++ S+ HPFY G        GR +KF K+
  S:     1 MKADIHPNYRDVVFHDVTSDFKILTRSTMSTKETIKWEDGNDYPLVKVEISSASHPFYTGKHKVIDTSGRIDKFQKR 77
>gi|187604007|ref|ZP_02990218.1| ribosomal protein L31 [Exiguobacterium sp. AT1b] >gi|187484069|gb|EDU22062.1| ribosomal protein L31 [Exiguobacterium sp. AT1b] (80 aa)
Score = 89, Expect = 1.2e-01, Identities = 25/65 (38%), Positives = 34/65 (52%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET------------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H +  +V F  ++    F+  ST  + ET             +DV S  HPFY G        GR E+FNKK
  S:     1 MKQGIHPEYRKVVFMDSTTEFKFITGSTRYSNETITMEDGNEYPLIRVDVSSDSHPFYTGRQKFASADGRIERFNKK 77
>gi|21232665|ref|NP_638582.1| 50S ribosomal protein L31 type B [Xanthomonas campestris pv. campestris str. ATCC 33913] >gi|66767277|ref|YP_242039.1| 50S ribosomal protein L31 type B [Xanthomonas campestris pv. campestris str. 8004] >gi|23822004|sp|Q8P5U9|RL31B_XANCP 50S ribosomal protein L31 type B >gi|81306742|sp|Q4UY54|RL31B_XANC8 50S ribosomal protein L31 type B >gi|21114473|gb|AAM42506.1| 50S ribosomal protein L31 [Xanthomonas campestris pv. campestris str. ATCC 33913] >gi|66572609|gb|AAY48019.1| 50S ribosomal protein L31 [Xanthomonas campestris pv. campestris str. 8004] (80 aa)
Score = 89, Expect = 1.2e-01, Identities = 22/65 (33%), Positives = 37/65 (56%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET------------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK   H   N+V F+  + +   + +ST+++KET             +++ S+ HPFY G        GR +KF K+
  S:     1 MKDNVHPSYNDVVFHDVTSDFKILTRSTMSSKETVKWEDGQDYPLIKVEISSASHPFYTGKHKVIDTGGRIDKFQKR 77
>gi|37523989|ref|NP_927366.1| 50S ribosomal protein L31 [Gloeobacter violaceus PCC 7421] >gi|73621795|sp|Q7ND16|RL31_GLOVI 50S ribosomal protein L31 >gi|35214995|dbj|BAC92361.1| 50S ribosomal protein L31 [Gloeobacter violaceus PCC 7421] (74 aa)
Score = 89, Expect = 1.2e-01, Identities = 19/64 (29%), Positives = 33/64 (51%)
  Q:     4 KKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           K   H +  E    C  C + +  +ST     T++++C++CHPF+ G       +GR ++F KK
  S:     3 KAGIHPRYEEARIVCG-CGAIYETRST-KPGVTNVEICANCHPFFTGQQKIVDAEGRVDRFLKK 64
>gi|94501001|ref|ZP_01307526.1| 50S ribosomal protein L31 [Oceanobacter sp. RED65] >gi|94426941|gb|EAT11924.1| 50S ribosomal protein L31 [Oceanobacter sp. RED65] (71 aa)
Score = 89, Expect = 1.2e-01, Identities = 20/49 (40%), Positives = 28/49 (57%)
  Q:    19 ASCNSTFVVKSTLNTKET-SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           A+C+   VVK+      T  +DVCS+CHPFY G        GR ++F K+
  S:    14 ATCSCGNVVKTRSTKPGTMHLDVCSACHPFYTGKQKVMDTGGRIDRFKKR 63
>gi|116496000|ref|YP_807734.1| ribosomal protein L31 [Lactobacillus casei ATCC 334] >gi|191639479|ref|YP_001988645.1| 50S ribosomal protein L31 [Lactobacillus casei] >gi|116106150|gb|ABJ71292.1| LSU ribosomal protein L31P [Lactobacillus casei ATCC 334] >gi|190713781|emb|CAQ67787.1| 50S ribosomal protein L31 [Lactobacillus casei BL23] (83 aa)
Score = 89, Expect = 1.2e-01, Identities = 24/65 (36%), Positives = 35/65 (53%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET------------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK+  H   + V F  ++    F+  ST  +KET             +++ S  HPFY G     Q  GR ++FNKK
  S:     1 MKQGIHPDYHPVVFMDSATGFKFISGSTKTSKETVKWEDGKEYPLVRVEISSDSHPFYTGKQKFTQADGRVDRFNKK 77
>gi|125974657|ref|YP_001038567.1| 50S ribosomal protein L31P [Clostridium thermocellum ATCC 27405] >gi|125714882|gb|ABN53374.1| LSU ribosomal protein L31P [Clostridium thermocellum ATCC 27405] (70 aa)
Score = 89, Expect = 1.2e-01, Identities = 20/65 (30%), Positives = 36/65 (55%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           +K+  H K  +    CA C +T+   ST   ++ ++++CS+CHPF+ G        GR ++F K+
  S:     4 LKEGIHPKYYQTVIKCA-CGATYETGST--KEKINVEICSNCHPFFTGKQKLVDTGGRVDRFKKR 65
>gi|196181017|gb|EDX76006.1| ribosomal protein L31 [Microcoleus chthonoplastes PCC 7420] (81 aa)
Score = 89, Expect = 1.3e-01, Identities = 22/66 (33%), Positives = 33/66 (50%)
  Q:    21 CNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKKVVAVKQEPTKSENKNTKKQ 86
           CN   V+       E  +DV S  HPFY GT      +GR E+F +K   +  E   SE +++K++
  S:    18 CNGEVVMTVGSTQPEIHVDVWSGNHPFYTGTQKIIDTEGRVERFMRKYGML--EGNASEQQSSKEK 81
>gi|115375190|ref|ZP_01462457.1| ribosomal protein L31 [Stigmatella aurantiaca DW4/3-1] >gi|115367841|gb|EAU66809.1| ribosomal protein L31 [Stigmatella aurantiaca DW4/3-1] (93 aa)
Score = 89, Expect = 1.3e-01, Identities = 23/65 (35%), Positives = 32/65 (49%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK E H         CA C +    KST  +   S+++CS+CHPF+ G        GR ++F KK
  S:     1 MKPELHPVYPPSRITCA-CGNIVETKSTRGS--FSVEICSNCHPFFTGKYKLVDTAGRIDRFRKK 62
>gi|15805851|ref|NP_294549.1| 50S ribosomal protein L31 [Deinococcus radiodurans R1] >gi|17433257|sp|Q9RW44|RL31_DEIRA 50S ribosomal protein L31 >gi|28948943|pdb|1NKW|Y Chain Y, Crystal Structure Of The Large Ribosomal Subunit From Deinococcus Radiodurans >gi|29726811|pdb|1NWX|Y Chain Y, Complex Of The Large Ribosomal Subunit From Deinococcus Radiodurans With Abt-773 >gi|29726842|pdb|1NWY|Y Chain Y, Complex Of The Large Ribosomal Subunit From Deinococcus Radiodurans With Azithromycin >gi|34811578|pdb|1PNU|Y Chain Y, Crystal Structure Of A Streptomycin Dependent Ribosome From Escherichia Coli, 50s Subunit Of 70s Ribosome. This File, 1pnu, Contains Only Molecules Of The 50s Ribosomal Subunit. The 30s Subunit, Mrna, P-Site Trna, And A-Site Trna Are In The Pdb File 1pns. >gi|34811631|pdb|1PNY|Y Chain Y, Crystal Structure Of The Wild Type Ribosome From E. Coli, 50s Subunit Of 70s Ribosome. This File, 1pny, Contains Only Molecules Of The 50s Ribosomal Subunit. The 30s Subunit Is In The Pdb File 1pnx. >gi|51247396|pdb|1SM1|Y Chain Y, Complex Of The Large Ribosomal Subunit From Deinococcus Radiodurans With Quinupristin And Dalfopristin >gi|56966369|pdb|1VOR|1 Chain 1, Crystal Structure Of Five 70s Ribosomes From Escherichia Coli In Complex With Protein Y. This File Contains The 50s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Five 70s Ribosomes And Is Described In Remark 400. >gi|56966422|pdb|1VOU|1 Chain 1, Crystal Structure Of Five 70s Ribosomes From Escherichia Coli In Complex With Protein Y. This File Contains The 50s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Five 70s Ribosomes And Is Described In Remark 400. >gi|56966475|pdb|1VOW|1 Chain 1, Crystal Structure Of Five 70s Ribosomes From Escherichia Coli In Complex With Protein Y. This File Contains The 50s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Five 70s Ribosomes And Is Described In Remark 400. >gi|56966528|pdb|1VOY|1 Chain 1, Crystal Structure Of Five 70s Ribosomes From Escherichia Coli In Complex With Protein Y. This File Contains The 50s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Five 70s Ribosomes And Is Described In Remark 400. >gi|56966581|pdb|1VP0|1 Chain 1, Crystal Structure Of Five 70s Ribosomes From Escherichia Coli In Complex With Protein Y. This File Contains The 50s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Five 70s Ribosomes And Is Described In Remark 400. >gi|61680359|pdb|1XBP|Y Chain Y, Inhibition Of Peptide Bond Formation By Pleuromutilins: The Structure Of The 50s Ribosomal Subunit From Deinococcus Radiodurans In Complex With Tiamulin >gi|66361045|pdb|1YL3|4 Chain 4, Crystal Structure Of 70s Ribosome With Thrs Operator And Trnas. Large Subunit. The Coordinates For The Small Subunit Are In The Pdb Entry 1yl4. >gi|88192282|pdb|2B66|4 Chain 4, 50s Ribosomal Subunit From A Crystal Structure Of Release Factor Rf1, Trnas And Mrna Bound To The Ribosome. This File Contains The 50s Subunit From A Crystal Structure Of Release Factor Rf1, Trnas And Mrna Bound To The Ribosome And Is Described In Remark 400 >gi|88192345|pdb|2B9N|4 Chain 4, 50s Ribosomal Subunit From A Crystal Structure Of Release Factor Rf2, Trnas And Mrna Bound To The Ribosome. This File Contains The 50s Subunit From A Crystal Structure Of Release Factor Rf1, Trnas And Mrna Bound To The Ribosome And Is Described In Remark 400. >gi|88192400|pdb|2B9P|4 Chain 4, 50s Ribosomal Subunit From A Crystal Structure Of The Ribosome In Complex With Trnas And Mrna With A Stop Codon In The A-Site. This File Contains The 50s Subunit From A Crystal Structure Of The Ribosome In Complex With Trnas And Mrna With A Stop Codon In The A-Site And Is Described In Remark 400. >gi|6458537|gb|AAF10400.1|AE001936_9 ribosomal protein L31 [Deinococcus radiodurans R1] (73 aa)
Score = 89, Expect = 1.3e-01, Identities = 23/65 (35%), Positives = 34/65 (52%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTK-ETSIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           M+K+ H K    +  C       VV  T++T+ E  +DV S  HPF+ G       +GR +KFNK+
  S:     1 MQKDLHPK----AVPCKIIYQGQVVMETMSTRPEIHVDVWSGVHPFWTGEERFLDTEGRVDKFNKR 62
>gi|163784023|ref|ZP_02178982.1| ribosomal protein L31 [Hydrogenivirga sp. 128-5-R1-1] >gi|159880708|gb|EDP74253.1| ribosomal protein L31 [Hydrogenivirga sp. 128-5-R1-1] (65 aa)
Score = 89, Expect = 1.3e-01, Identities = 21/48 (43%), Positives = 29/48 (60%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKETSIDVCSSCHPFYIG 50
           MKK+ H K+   +F C SC + F + ST       I+VC+ CHPFY+G
  S:     1 MKKDIHPKIEPTTFIC-SCGNKFELLST-KGGTVYIEVCNQCHPFYVG 46
>gi|49073336|gb|AAT49311.1| PA3601 [synthetic construct] (88 aa)
Score = 89, Expect = 1.3e-01, Identities = 23/65 (35%), Positives = 35/65 (53%)
  Q:     3 MKKETHMKLNEVSFNCASCNSTFVVKSTLNTKET------------SIDVCSSCHPFYIGTSMSQQVKGRAEKFNKK 67
           MK   H +   V F+  S +  F++ ST  T +T            ++DV S+ HP Y G     + +GR   FNK+
  S:     1 MKPGIHPEYRPVLFHDTSADVYFLIGSTAETDKTHTHTDGKTYPYVTLDVSSASHPVYTGEQRKTKSEGRVAGFNKR 77