>gi|26553517|ref|NP_757451.1| peptide chain release factor 1 [Mycoplasma penetrans HF-2] >gi|32171558|sp|Q8EWY5|RF1_MYCPE Peptide chain release factor 1 (RF-1) >gi|26453523|dbj|BAC43855.1| peptide chain release factor 1 [Mycoplasma penetrans HF-2] (359 aa)
Score = 1647, Expect = 0.0e+00, Identities = 359/359 (100%), Positives = 359/359 (100%)
  Q:     1 MIYNEKLYNSLLSMEEKFNDLNKELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQEAKI 359
           MIYNEKLYNSLLSMEEKFNDLNKELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQEAKI
  S:     1 MIYNEKLYNSLLSMEEKFNDLNKELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQEAKI 359
>gi|13357561|ref|NP_077833.1| peptide chain release factor 1 [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|170762199|ref|YP_001752083.1| peptide chain release factor 1 [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171920085|ref|ZP_02690833.2| peptide chain release factor 1 [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|183508605|ref|ZP_02689678.2| peptide chain release factor 1 [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186701604|ref|ZP_02553446.2| peptide chain release factor 1 [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|189039997|sp|B1AHY9|RF1_UREP2 Peptide chain release factor 1 (RF-1) >gi|13124459|sp|Q9PRE0|RF1_UREPA Peptide chain release factor 1 (RF-1) >gi|11277784|pir||D82945 translation releasing factor RF-1 UU003 [imported] - Ureaplasma urealyticum >gi|6898949|gb|AAF30410.1|AE002100_3 peptide chain release factor 1 [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168827776|gb|ACA33038.1| peptide chain release factor 1 [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171902439|gb|EDT48728.1| peptide chain release factor 1 [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|182676062|gb|EDT87967.1| peptide chain release factor 1 [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186700834|gb|EDU19116.1| peptide chain release factor 1 [Ureaplasma parvum serovar 6 str. ATCC 27818] (359 aa)
Score = 1122, Expect = 1.1e-120, Identities = 234/359 (65%), Positives = 290/359 (80%)
  Q:     1 MIYNEKLYNSLLSMEEKFNDLNKELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQEAKI 359
           M YN+KLY ++  +  K + L KELET     K++ EIN  +K+TT I E F +YK+ L+   +AEK++ +EKD E+IELAQ++L E K  I   E +LK++LLP DPNDDKNVIVEMRPAAGGDESSIFVG+LF  Y+ YA++  WK+K++E+  ++ G+ FISFMI+GE VYS+MKFESGVHRVQRVPATESKGRVHTSTITVAVLPE +EV++VIN ++L+IDTYRASGAGGQH+N+TESAVRITHIPTG+  ACQEGKSQIENRETAMKMLRAKLWE  +E+     ++LRK QVGTG+R+EKIRTYNYPQNRVTDHRINLTLNKLD +M+G L EIID+LI+ ++   M    I
  S:     1 MEYNKKLYEAIERVAIKNDALKKELETVVTDFKKIKEINIQLKKTTKIAEAFAKYKQKLDTGIAAEKILNTEKDLELIELAQMDLDEAKINIPIIENDLKIMLLPTDPNDDKNVIVEMRPAAGGDESSIFVGNLFDTYRAYAENNNWKMKIIEMTPNAVGFSFISFMISGEEVYSRMKFESGVHRVQRVPATESKGRVHTSTITVAVLPEQDEVDVVINPTELRIDTYRASGAGGQHVNRTESAVRITHIPTGVVAACQEGKSQIENRETAMKMLRAKLWEAAQEQQNAEFANLRKNQVGTGDRSEKIRTYNYPQNRVTDHRINLTLNKLDQIMMGELDEIIDALIADEQTGLMANLDI 359
>gi|171920548|ref|ZP_02695589.3| peptide chain release factor 1 [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|185178800|ref|ZP_02554523.2| peptide chain release factor 1 [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188024350|ref|ZP_02570606.2| peptide chain release factor 1 [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188039269|ref|ZP_02527990.2| peptide chain release factor 1 [Ureaplasma urealyticum serovar 8] >gi|188518435|ref|ZP_02556548.2| peptide chain release factor 1 [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|188524208|ref|ZP_02557610.2| peptide chain release factor 1 [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|188530768|ref|ZP_02546433.2| peptide chain release factor 1 [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gi|188568820|ref|ZP_02829012.2| peptide chain release factor 1 [Ureaplasma urealyticum serovar 2] >gi|195867475|ref|ZP_03079479.1| peptide chain release factor 1 [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|171903245|gb|EDT49534.1| peptide chain release factor 1 [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|184209423|gb|EDU06466.1| peptide chain release factor 1 [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188018616|gb|EDU56656.1| peptide chain release factor 1 [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188998234|gb|EDU67331.1| peptide chain release factor 1 [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|195660120|gb|EDX53500.1| peptide chain release factor 1 [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|195660951|gb|EDX54204.1| peptide chain release factor 1 [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (359 aa)
Score = 1114, Expect = 1.0e-119, Identities = 231/354 (65%), Positives = 286/354 (80%)
  Q:     1 MIYNEKLYNSLLSMEEKFNDLNKELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           M YN+KLY ++  +  K   L +ELET     K++ EIN  +K+TT I E F +YK+ ++    AE+L+ +EKD E++ELAQ++L + K  I   E ELK++LLP DPNDDKNVIVEMRPAAGGDESSIFVG+LF  Y+ Y +S  WK+K++E+  ++ G+ FISFMI+GE VYS+MKFESGVHRVQRVPATESKGRVHTSTITVAVLPE +EV++VIN SDL+IDTYRASGAGGQH+N+TESAVRITHIPTG+  ACQEGKSQIENRETAMKMLRAKLWE  +E+     ++LRK QVGTG+R+EKIRTYNYPQNRVTDHRI+LTLNKLD +M+G L EIID+LI+ ++   M
  S:     1 MEYNKKLYEAIERVAVKNKTLKQELETITSDFKKIKEINIQLKKTTKIAEAFAKYKQKIDAGIVAEELLNTEKDLELVELAQMDLDDAKASIPVIENELKIMLLPTDPNDDKNVIVEMRPAAGGDESSIFVGNLFDTYRAYTESNNWKMKIIEMTPNAVGFSFISFMISGEEVYSRMKFESGVHRVQRVPATESKGRVHTSTITVAVLPEQDEVDVVINPSDLRIDTYRASGAGGQHVNRTESAVRITHIPTGVVAACQEGKSQIENRETAMKMLRAKLWEAAQEQQNAEFANLRKNQVGTGDRSEKIRTYNYPQNRVTDHRISLTLNKLDQIMMGELDEIIDALIADEQTNLM 354
>gi|188592638|ref|ZP_02694356.2| peptide chain release factor 1 [Ureaplasma urealyticum serovar 10] (359 aa)
Score = 1113, Expect = 1.2e-119, Identities = 231/354 (65%), Positives = 286/354 (80%)
  Q:     1 MIYNEKLYNSLLSMEEKFNDLNKELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           M YN+KLY ++  +  K   L +ELET     K++ EIN  +K+TT I E F +YK+ ++    AE+L+ +EKD E++ELAQ++L + K  I   E ELK++LLP DPNDDKNVIVEMRPAAGGDESSIFVG+LF  Y+ Y +S  WK+K++E+  ++ G+ FISFMI+GE VYS+MKFESGVHRVQRVPATESKGRVHTSTITVAVLPE +EV++VIN SDL+IDTYRASGAGGQH+N+TESAVRITHIPTG+  ACQEGKSQIENRETAMKMLRAKLWE  +E+     ++LRK QVGTG+R+EKIRTYNYPQNRVTDHRI+LTLNKLD +M+G L EIID+LI+ ++   M
  S:     1 MEYNKKLYEAIERVAVKNKTLKQELETITSDFKKIKEINIQLKKTTKIAEAFAKYKQKIDAGIVAEELLNTEKDLELVELAQMDLDDAKASIPVIENELKIMLLPTDPNDDKNVIVEMRPAAGGDESSIFVGNLFDTYRAYTESNNWKMKIIEMTPNAVGFSFISFMISGEEVYSRMKFESGVHRVQRVPATESKGRVHTSTITVAVLPEQDEVDVVINPSDLRIDTYRASGAGGQHVNRTESAVRITHIPTGVVAACQEGKSQIENRETAMKMLRAKLWEAAQEQQNAEFANLRKNQVGTGDRSEKIRTYNYPQNRVTDHRISLTLNKLDQIMMGELDEIIDALITDEQTNLM 354
>gi|31544341|ref|NP_852919.1| peptide chain release factor 1 [Mycoplasma gallisepticum R] >gi|31541185|gb|AAP56487.1| PrfA [Mycoplasma gallisepticum R] (363 aa)
Score = 1001, Expect = 1.1e-106, Identities = 219/355 (61%), Positives = 270/355 (76%)
  Q:     1 MIYNEKLYNSLLSMEEKFNDLNKELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQ 355
           M YN+++Y +L+++      LNKELE+     KR+  INK +K+   ++E F+ Y + +     AEK+I      E  ELA L+L   K  I   E +LKVLLLP DPNDDK VIVEMRPAAGGDESSIFVG++F  YK Y     WK+ ++E+  +S GY FISF INGE+VYSKMKFESGVHRVQRVPATE+KGRVHTSTIT+AVLP+ ++VE+ IN +DL+IDTYRASGAGGQH+N+TESAVRITHIPTGI  ACQEGKSQI NRETAMKMLR+KLWE  E+E    +S LRK QVG+G+RAEKIRTYNYPQNRVTDHRIN++LN LD  M+G + E+ID+L S ++  KM+
  S:     4 MEYNKQMYETLVAIRATAQKLNKELESLTNDFKRIHAINKELKQKKQLLEVFELYDKLVVSGLEAEKIINDNAMKEFHELAILDLDAAKEQIPDLEEKLKVLLLPADPNDDKEVIVEMRPAAGGDESSIFVGNMFDLYKEYCSKHNWKINVIEMLPTSVGYSFISFEINGEDVYSKMKFESGVHRVQRVPATEAKGRVHTSTITIAVLPQQDDVEIEINPADLRIDTYRASGAGGQHVNRTESAVRITHIPTGIVAACQEGKSQIANRETAMKMLRSKLWEAAEKEKNDALSALRKNQVGSGDRAEKIRTYNYPQNRVTDHRINMSLNSLDRFMMGEIDEMIDALRSKEQEEKMK 358
>gi|46576715|sp|Q7NBX3|RF1_MYCGA Peptide chain release factor 1 (RF-1) (360 aa)
Score = 1001, Expect = 1.2e-106, Identities = 219/355 (61%), Positives = 270/355 (76%)
  Q:     1 MIYNEKLYNSLLSMEEKFNDLNKELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQ 355
           M YN+++Y +L+++      LNKELE+     KR+  INK +K+   ++E F+ Y + +     AEK+I      E  ELA L+L   K  I   E +LKVLLLP DPNDDK VIVEMRPAAGGDESSIFVG++F  YK Y     WK+ ++E+  +S GY FISF INGE+VYSKMKFESGVHRVQRVPATE+KGRVHTSTIT+AVLP+ ++VE+ IN +DL+IDTYRASGAGGQH+N+TESAVRITHIPTGI  ACQEGKSQI NRETAMKMLR+KLWE  E+E    +S LRK QVG+G+RAEKIRTYNYPQNRVTDHRIN++LN LD  M+G + E+ID+L S ++  KM+
  S:     1 MEYNKQMYETLVAIRATAQKLNKELESLTNDFKRIHAINKELKQKKQLLEVFELYDKLVVSGLEAEKIINDNAMKEFHELAILDLDAAKEQIPDLEEKLKVLLLPADPNDDKEVIVEMRPAAGGDESSIFVGNMFDLYKEYCSKHNWKINVIEMLPTSVGYSFISFEINGEDVYSKMKFESGVHRVQRVPATEAKGRVHTSTITIAVLPQQDDVEIEINPADLRIDTYRASGAGGQHVNRTESAVRITHIPTGIVAACQEGKSQIANRETAMKMLRSKLWEAAEKEKNDALSALRKNQVGSGDRAEKIRTYNYPQNRVTDHRINMSLNSLDRFMMGEIDEMIDALRSKEQEEKMK 355
>gi|13508100|ref|NP_110049.1| peptide chain release factor 1 [Mycoplasma pneumoniae M129] >gi|2500138|sp|P75420|RF1_MYCPN Peptide chain release factor 1 (RF-1) >gi|1674166|gb|AAB96123.1| peptide chain release factor 1 [Mycoplasma pneumoniae M129] (359 aa)
Score = 976, Expect = 8.5e-104, Identities = 198/355 (55%), Positives = 274/355 (77%)
  Q:     1 MIYNEKLYNSLLSMEEKFNDLNKELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQ 355
           M ++++ ++S+  + E    L K+L    L+ +++  INK +K   P+V KFKE+KR ++    AE ++++ +  E+ + A+ EL   + ++ +YE  LK+LLLP D N+ KNVIVE+RPAAGGDES IF+ DLF+ Y+ +  + GWK+++ E+  SS G  F+SF +NG +V++K+KFESGVHRVQRVPATESKGRVHTST+TVAVLP+LE VE+ IN +DL++DTYRASGAGGQH+N+TESAVRITH+PTGI V+CQEGKSQ  NR+TAMKMLRAKLWEK + E     + LRK QVG+G+RAEKIRTYNYPQNRVTDHRI LT+NKL+ ++LG+L EII++L + ++  +++
  S:     1 MEFDKQFFSSVEKIVELAEQLEKDLNKPDLTFEQIKAINKELKHKQPLVVKFKEFKRLIDQALEAEAILENNELKELHDEAKKELERVRSVVPEYEEALKLLLLPIDENNQKNVIVELRPAAGGDESCIFLADLFNMYRNFCSNKGWKLQINEMIPSSVGLNFVSFEVNGVDVFAKLKFESGVHRVQRVPATESKGRVHTSTVTVAVLPQLEAVEVHINPADLRVDTYRASGAGGQHVNRTESAVRITHLPTGIVVSCQEGKSQFTNRDTAMKMLRAKLWEKAQNEQLSTQAGLRKSQVGSGDRAEKIRTYNYPQNRVTDHRIKLTVNKLNTIILGDLDEIIEALQADEKKQQLE 355
>gi|12045113|ref|NP_072924.1| peptide chain release factor 1 [Mycoplasma genitalium G37] >gi|1350577|sp|P47500|RF1_MYCGE Peptide chain release factor 1 (RF-1) >gi|1045950|gb|AAC71478.1| peptide chain release factor 1 [Mycoplasma genitalium G37] >gi|166078949|gb|ABY79567.1| peptide chain release factor 1 [synthetic Mycoplasma genitalium JCVI-1.0] (359 aa)
Score = 954, Expect = 2.9e-101, Identities = 199/356 (55%), Positives = 269/356 (75%)
  Q:     1 MIYNEKLYNSLLSMEEKFNDLNKELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           M ++++L+ ++  + E    L K+L    LS +++  INK +K   P++ KFKE ++ + + + AE+++ +    E+ E A+ EL + K  +   E E+K LLLP D N+ KNVIVE+RPAAGGDES IF+ DLF+ YK Y  S  W V++ E+  +S G  F+SF +NG +V++K+KFESGVHRVQRVP TE+KGRVHTST+TVAVLP+LEEVE+ IN SDL+IDTYRASGAGGQH+N+TESAVRITH+PTGI VACQEGKSQ  NR+ AMKMLRAKLWE  + +     +DLRK QVG+GERAEKIRTYNYPQNR+TDHRI LT+NKL+ V+LG+L EII++L + ++  ++++
  S:     1 MDFDKQLFFNVEKIVELTEQLEKDLNKPNLSFEQIKVINKELKHKQPLIVKFKELQKLVENANEAEQILNNSSLKELHEEAKKELEKIKASLPSLEEEIKFLLLPVDENNQKNVIVEIRPAAGGDESCIFLSDLFNMYKNYCTSKNWTVELNEIIPASVGINFVSFAVNGTDVFAKLKFESGVHRVQRVPLTEAKGRVHTSTVTVAVLPQLEEVEITINPSDLRIDTYRASGAGGQHVNRTESAVRITHLPTGIVVACQEGKSQFSNRDKAMKMLRAKLWENAQNKQLSTQADLRKSQVGSGERAEKIRTYNYPQNRITDHRIKLTINKLNTVILGDLDEIIEALQADEKKQQLEK 356
>gi|121534882|ref|ZP_01666701.1| peptide chain release factor 1 [Thermosinus carboxydivorans Nor1] >gi|121306481|gb|EAX47404.1| peptide chain release factor 1 [Thermosinus carboxydivorans Nor1] (356 aa)
Score = 914, Expect = 1.4e-96, Identities = 186/350 (53%), Positives = 265/350 (75%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGLSVKRMSEINKSIK---ETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVE-LVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           + + L ++E+K+ +L   +    + +   SE  K  K   + T IV KF+EYK+ L  +D A +++K + D++  E+ + EL+E K    + E EL++L+LPKDPND+KNVI+E+R  AGGDE+++F GDLF  Y RYA++ GW+V++L+   S   G+  + F I G+  YS+ K+ESGVHRVQRVP TE+ GR+HTST+TVAVLPE ++V+ +VIN SDL+IDTY ASGAGGQH+NKTESAVRITH+PTGI V CQ+ KSQI+NRE AM++LRAKL E  +EE R  ++  RK QVGTG+R+E+IRTYN+PQ RVTDHRI LTL+KLD ++ G+L E+I++L++ D+A ++++
  S:     1 MLDKLQAIEDKYLELENLISDPDI-IANQSEWQKHAKAHAKLTEIVTKFREYKKVLQGMDDAREMLKEKLDDDFREMVEAELAELKAKCVRLEEELRILMLPKDPNDEKNVIIEIRAGAGGDEAALFAGDLFRMYTRYAEAQGWRVELLDANSSDLGGFKEVVFSIQGDGAYSRFKYESGVHRVQRVPETEASGRIHTSTVTVAVLPEADDVDDVVINPSDLRIDTYCASGAGGQHVNKTESAVRITHLPTGIVVQCQDEKSQIKNREKAMRVLRAKLLEAAQEEQRAQLAQTRKSQVGTGDRSERIRTYNFPQGRVTDHRIGLTLHKLDFILNGDLDELINALVTADQAERLKQ 354
>gi|50365449|ref|YP_053874.1| peptide chain release factor 1 [Mesoplasma florum L1] >gi|61214613|sp|Q6F0I3|RF1_MESFL Peptide chain release factor 1 (RF-1) >gi|50364005|gb|AAT75990.1| peptide chain release factor 1 [Mesoplasma florum L1] (363 aa)
Score = 905, Expect = 1.5e-95, Identities = 192/352 (54%), Positives = 265/352 (75%)
  Q:     4 NEKLYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQES-SHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQ 355
           N K Y +L +M+++ + ++K+L++E +   VK+M E+NK       +VEKF EYK  +  I  A++++ +EKD E+IELA++ELSE +  +E     ++ LLLPKDPNDDKNVIVE+R AAGGDE++IF GDL   YK YA++  WK+ ML+   S + G+  +SFM+ G+ VYSK+KFESG HRVQRVP TE+KGR+ TST TVAVLPE+ +VE+ I NSDL+IDTYR+SGAGGQH+N T+SAVRITHIPTG+  A Q+G+SQ +N++ AM MLRA+++E + E+ +      RK  VGTG R+EKIRTYNYPQNRVTDHR+ LTLNKLD VM G + + I +L++ ++  K++
  S:     2 NPKTYEALETMQKRVDQIDKDLQSEEIVSDVKKMLELNKERANLIEVVEKFIEYKTIIQSIADAKEILGNEKDAEMIELAKMELSENEDAVEPIVAIIEELLLPKDPNDDKNVIVEIRGAAGGDEANIFAGDLLRMYKLYAETQNWKITMLDANSSEAGGFSQVSFMVKGDRVYSKLKFESGAHRVQRVPKTEAKGRIQTSTATVAVLPEMSDVEIEIKNSDLRIDTYRSSGAGGQHVNTTDSAVRITHIPTGVVAASQDGRSQHDNKDIAMTMLRARIYEAELEKQQAEADATRKNAVGTGARSEKIRTYNYPQNRVTDHRVGLTLNKLDQVMEGKIDDFIIALVNDEQRQKVE 356
>gi|78044074|ref|YP_361356.1| peptide chain release factor 1 [Carboxydothermus hydrogenoformans Z-2901] >gi|119361519|sp|Q3A928|RF1_CARHZ Peptide chain release factor 1 (RF-1) >gi|77996189|gb|ABB15088.1| peptide chain release factor 1 [Carboxydothermus hydrogenoformans Z-2901] (358 aa)
Score = 905, Expect = 1.5e-95, Identities = 188/350 (53%), Positives = 264/350 (75%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           +++ L  +EEK+ +L++ +    +    +R     K+  E   IV+ ++EYK+T+ +I+ AE+++  + D +  EL Q EL + K   E+ E +LK+LLLPKDPND+KNVI+E+R  AGG+E+++F GDLF  Y +YAD +GWKV++++   +   G+  + F I G+ VYS+MKFESGVHRVQRVP TES GR+HTST TVAVLPE EEVE+ IN +DL+ID + ASGAGGQH+NKTESAVRITHIPTGI V CQ+ KSQ +N+E AMK+LRA+L +K  +E    ++  RK QVGTG+R+E+IRTYN+PQNRVTDHRI LTL++LD V+ G+L EIID+LI+ D+A ++++
  S:     1 MFDKLDQLEEKYEELSRLISDPEVIADTQRWQGYVKAHAEIEEIVQVYREYKKTVKEIEDAERMLDEKLDPDFRELVQSELHDLKERREELEAKLKILLLPKDPNDEKNVIMEIRAGAGGEEAALFAGDLFRMYSKYADRMGWKVEIMDSHPTDLGGFKEVIFTIEGKGVYSRMKFESGVHRVQRVPTTESGGRIHTSTATVAVLPEAEEVEVEINPNDLRIDVFCASGAGGQHVNKTESAVRITHIPTGIVVTCQDEKSQHKNKERAMKILRARLLDKARQEQEAELASARKSQVGTGDRSERIRTYNFPQNRVTDHRIGLTLHRLDAVLEGDLDEIIDALITTDQAERLKQ 353
>gi|1526559|dbj|BAA08795.1| Peptide Termination Factor [Mycoplasma capricolum] (370 aa)
Score = 898, Expect = 1.1e-94, Identities = 190/350 (54%), Positives = 260/350 (74%)
  Q:     4 NEKLYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQ-ESSHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVK 353
           N K Y +L +M+++   + K+LE E +   +K+ +E+NK       +VEKF EYK+ ++ I  A+ ++++EKD+E+IELA++EL E    +E  +  ++ +LLPKDPND+KNVI+E+R AAGGDE++IF GDL   YK YA++  WK+ +LE     + GY  + FMI G+ VYSK+KFESG HRVQRVP TE+KGR+ TST TVAVLPE+ EVE+ I ++DL+IDTYRASGAGGQH+N T+SAVRITH+PTGI V  Q+G+SQ +N++ AM MLRAK++E + E+ +      RK  VGTG R+EK RTYNYPQNRVTDHR+ LTLNKLD VM GN+ E I +LI+ ++  K
  S:     2 NAKTYEALETMQKRLFQIQKDLEDENILKDIKKFTELNKEKANLEEVVEKFVEYKKAVDHIKDAKAILENEKDSELIELAKIELDENNDKVEHLQQVIEEMLLPKDPNDEKNVIIEIRGAAGGDEANIFAGDLLRMYKLYAETQNWKINILEASLGEAGGYSQVVFMIKGDRVYSKLKFESGAHRVQRVPKTEAKGRIQTSTATVAVLPEMSEVEIEIRSNDLRIDTYRASGAGGQHVNTTDSAVRITHLPTGIVVTSQDGRSQHDNKDIAMTMLRAKVYEAEVEKQQAQADATRKNAVGTGARSEKFRTYNYPQNRVTDHRVGLTLNKLDQVMEGNIDEFIIALINEEQRQK 354
>gi|110003948|emb|CAK98288.1| peptide chain release factor 1 protein [Spiroplasma citri] (358 aa)
Score = 893, Expect = 4.0e-94, Identities = 196/352 (55%), Positives = 263/352 (74%)
  Q:     4 NEKLYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQES-SHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQ 355
           N+K    L +M +++N +N+EL    +   VK+++ + K   +    V  +  YK  LN+I+ A+ ++++EKD E+IELA+ EL   +   E+   ELKV+LLPKDPNDDKNVI E+R AAGGDE +IF GDL+  Y +YA+   WKV+++E  ES + G+  ISFM+ G+ VYSKMKFESG HRVQR+P TESKGRVHTST TVAVLPE+EEV+  I  +DLKIDTYRASGAGGQH+N T+SAVRITH+PTG  V  Q+G+SQ +N+  AM+ LR+KL+E+++ +  +    LRK  VGTG+R+EKIRTYNYPQNRVTDHRINLTL KLD +M GNL EI+ +LI+ ++ +KM+
  S:     2 NQKTIERLETMLKRWNLINEELTKPEIVNDVKKLTSLAKEQAQLEETVALYLNYKNVLNNINEAKLILETEKDYELIELAKEELKTSEIRKEQLAAELKVILLPKDPNDDKNVIFEIRGAAGGDEGNIFAGDLYRMYIKYAEQQHWKVELIEANESEAGGFSTISFMVKGDRVYSKMKFESGAHRVQRIPKTESKGRVHTSTATVAVLPEIEEVDFEIKTADLKIDTYRASGAGGQHVNTTDSAVRITHLPTGFVVTSQDGRSQHDNKALAMQHLRSKLYEEQQRKINEERWTLRKDAVGTGDRSEKIRTYNYPQNRVTDHRINLTLQKLDQIMEGNLDEIVVALINEEQRLKME 356
>gi|83319336|ref|YP_424135.1| peptide chain release factor 1 [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|90110051|sp|P71496|RF1_MYCCT Peptide chain release factor 1 (RF-1) >gi|83283222|gb|ABC01154.1| peptide chain release factor 1 [Mycoplasma capricolum subsp. capricolum ATCC 27343] (363 aa)
Score = 891, Expect = 5.9e-94, Identities = 192/353 (54%), Positives = 263/353 (74%)
  Q:     4 NEKLYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQ-ESSHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           N K Y +L +M+++   + K+LE E +   +K+ +E+NK       +VEKF EYK+ ++ I  A+ ++++EKD+E+IELA++EL E    +E  +  ++ +LLPKDPND+KNVI+E+R AAGGDE++IF GDL   YK YA++  WK+ +LE     + GY  + FMI G+ VYSK+KFESG HRVQRVP TE+KGR+ TST TVAVLPE+ EVE+ I ++DL+IDTYRASGAGGQH+N T+SAVRITH+PTGI V  Q+G+SQ +N++ AM MLRAK++E + E+ +      RK  VGTG R+EKIRTYNYPQNRVTDHR+ LTLNKLD VM GN+ E I +LI+ ++  K+ E
  S:     2 NAKTYEALETMQKRLFQIQKDLEDENILKDIKKFTELNKEKANLEEVVEKFVEYKKAVDHIKDAKAILENEKDSELIELAKIELDENNDKVEHLQQVIEEMLLPKDPNDEKNVIIEIRGAAGGDEANIFAGDLLRMYKLYAETQNWKINILEASLGEAGGYSQVVFMIKGDRVYSKLKFESGAHRVQRVPKTEAKGRIQTSTATVAVLPEMSEVEIEIRSNDLRIDTYRASGAGGQHVNTTDSAVRITHLPTGIVVTSQDGRSQHDNKDIAMTMLRAKVYEAEVEKQQAQADATRKNAVGTGARSEKIRTYNYPQNRVTDHRVGLTLNKLDQVMEGNIDEFIIALINEEQRQKVAE 357
>gi|188159782|ref|ZP_02998884.1| peptide chain release factor 1 [Mycoplasma mycoides subsp. mycoides LC str. GM12] (364 aa)
Score = 887, Expect = 1.8e-93, Identities = 194/353 (54%), Positives = 261/353 (73%)
  Q:     4 NEKLYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQ-ESSHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           N K Y +L +M+++   + K+LE E +   +K+ +E+NK       +VEKF EYK+ +  I  A+ ++++EKD E+IELA++EL E    +E  +  ++ +LLPKDPNDDKNVIVE+R AAGGDE++IF GDL   YK YA++  WK+ +LE     + GY  + FMI G+ VYSK+KFESG HRVQRVP TE+KGR+ TST TVAVLPE+ EVE+ I ++DL+IDTYRASGAGGQH+N T+SAVRITH+PTGI V  Q+G+SQ +N++ AM MLRAK++E + E+ +      RK  VGTG R+EKIRTYNYPQNRVTDHR+ LTLNKLD VM GN+ E I +LI+ ++  K+ E
  S:     2 NAKTYEALETMQKRLLQILKDLEDENILKDIKKFTELNKEKSNLEEVVEKFVEYKQAVEHIKDAKVILENEKDQELIELAKIELDENNDKVEHLQQVIEEMLLPKDPNDDKNVIVEIRGAAGGDEANIFAGDLLRMYKLYAETQNWKINILEASVGEAGGYSQVVFMIKGDRVYSKLKFESGAHRVQRVPKTEAKGRIQTSTATVAVLPEMSEVEIEIRSNDLRIDTYRASGAGGQHVNTTDSAVRITHLPTGIVVTSQDGRSQHDNKDIAMTMLRAKVYEAEVEKQQAQADATRKNAVGTGARSEKIRTYNYPQNRVTDHRVGLTLNKLDQVMEGNIDEFIIALINEEQRQKVAE 357
>gi|42560702|ref|NP_975153.1| peptide chain release factor 1 [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|61214633|sp|Q6MU89|RF1_MYCMS Peptide chain release factor 1 (RF-1) >gi|42492198|emb|CAE76795.1| peptide chain release factor 1 [Mycoplasma mycoides subsp. mycoides SC str. PG1] (364 aa)
Score = 884, Expect = 4.4e-93, Identities = 193/353 (54%), Positives = 260/353 (73%)
  Q:     4 NEKLYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQ-ESSHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           N K Y +L +M+++   + K+LE E +   +K+ +E+NK       +VEKF EYK+ +  I  A+ ++++EKD E+IELA++EL E    +E  +  ++ +LLPKDPNDDKNVIVE+R AAGGDE++IF GDL   YK YA++  WK+ +LE     + GY  + FMI G+ VYSK+KFESG HRVQRVP TE+KGR+ TST TVAVLPE+ EVE+ I ++DL+IDTYRASGAGGQH+N T+SAVRITH+PTGI V  Q+G+SQ +N++ AM MLR K++E + E+ +      RK  VGTG R+EKIRTYNYPQNRVTDHR+ LTLNKLD VM GN+ E I +LI+ ++  K+ E
  S:     2 NAKTYEALETMQKRLLQILKDLEDENILKDIKKFTELNKEKSNLEEVVEKFVEYKKAVEHIKDAKAILENEKDQELIELAKIELDENNDKVEHLQQVIEEMLLPKDPNDDKNVIVEIRGAAGGDEANIFAGDLLRMYKLYAETQNWKINILEASVGEAGGYSQVVFMIKGDRVYSKLKFESGAHRVQRVPKTEAKGRIQTSTATVAVLPEMSEVEIEIRSNDLRIDTYRASGAGGQHVNTTDSAVRITHLPTGIVVTSQDGRSQHDNKDIAMTMLRTKVYEAEVEKQQAQADATRKNAVGTGARSEKIRTYNYPQNRVTDHRVGLTLNKLDQVMEGNIDEFIIALINEEQRQKVAE 357
>gi|126701107|ref|YP_001090004.1| peptide chain release factor 1 [Clostridium difficile 630] >gi|145952638|ref|ZP_01801647.1| hypothetical protein CdifQ_04004014 [Clostridium difficile QCD-32g58] >gi|168697773|ref|ZP_02730050.1| peptide chain release factor 1 [Clostridium difficile QCD-37x79] >gi|168714956|ref|ZP_02747233.1| peptide chain release factor 1 [Clostridium difficile QCD-63q42] >gi|168726408|ref|ZP_02758685.1| peptide chain release factor 1 [Clostridium difficile QCD-76w55] >gi|168730146|ref|ZP_02762423.1| peptide chain release factor 1 [Clostridium difficile QCD-97b34] >gi|196124991|ref|ZP_03116740.1| peptide chain release factor 1 [Clostridium difficile ATCC 43255] >gi|196162309|ref|ZP_03122870.1| peptide chain release factor 1 [Clostridium difficile CIP 107932] >gi|196164015|ref|ZP_03124546.1| peptide chain release factor 1 [Clostridium difficile QCD-23m63] >gi|119361524|sp|Q180Y2|RF1_CLOD6 Peptide chain release factor 1 (RF-1) >gi|115252544|emb|CAJ70387.1| peptide chain release factor 1 [Clostridium difficile 630] (354 aa)
Score = 872, Expect = 1.2e-91, Identities = 180/341 (52%), Positives = 260/341 (76%)
  Q:    14 MEEKFNDLNKELETEGLSVKRMSEINKSIKETT---PIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           +E+ + DL++++    + +       K IKE     PIV K++EYK  L+ I  ++++++ E D E+ ELA++EL+E +  +   E E+K+LLLPKDPNDDKNVIVE+R  AGGDE+++F GDLF  Y RYA+   WK+++L   ++   GY  +SFMI G+  YS++K+ESGVHRVQR+P+TES GR+HTST TVAVLPE+E+VE+ IN +DL+ID +R+SG GGQ +N T+SAVR+THIPTG  V+CQ+GKSQ++N+E A+K+L+A+L++K   E  K+I+  RK QVGTG+R+E+IRTYN+PQ R++DHRINLTL KLD  + G++ E+ID+LI+ D+  KM
  S:     8 LEDTYKDLSEKIGDPDV-INDQKVWQKYIKEHADLEPIVMKYREYKSVLDSIKESKEILQEESDEELRELAKMELAEMEEKVAPLEEEIKILLLPKDPNDDKNVIVEIRGGAGGDEAALFAGDLFRMYSRYAERRRWKIELLSASDTGVGGYKEVSFMIKGKGAYSRLKYESGVHRVQRIPSTESGGRIHTSTSTVAVLPEVEDVEVEINPNDLRIDVFRSSGNGGQSVNTTDSAVRVTHIPTGEVVSCQDGKSQLKNKEQALKILKARLYDKALAEQHKDIAAERKSQVGTGDRSERIRTYNFPQGRISDHRINLTLYKLDAFLDGDIDEMIDALITVDQTEKM 351
>gi|29377042|ref|NP_816196.1| peptide chain release factor 1 [Enterococcus faecalis V583] >gi|46576782|sp|Q831F6|RF1_ENTFA Peptide chain release factor 1 (RF-1) >gi|29344508|gb|AAO82266.1| peptide chain release factor 1 [Enterococcus faecalis V583] (357 aa)
Score = 867, Expect = 3.8e-91, Identities = 179/352 (50%), Positives = 262/352 (74%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQEAK 358
           +Y+ L S+E+++ +L + L    +    KR  E++K    T   VE ++ YK+ +  I  AE+L+    D E+ E+A+ ELS+ K   E  E  +K+LLLPKDPNDDKN+I+E+R AAGGDE+++F GDLF+ Y++YA++ GWK ++LE   +   GY  +  MI+G+NV+SK+K+ESG HRVQRVP+TES+GR+HTST TV V+PE EEVE+ + + D+++D Y ASGAGGQH+NKT SAVR+TH+PTGI VA Q+ +SQ++NRE AMK+LRA+++++ ++E +      RK  VGTG+R+E+IRTYN+PQNRVTDHRI LT+ KLD ++ G L EIID+L+ +D+  K++E +
  S:     1 MYDQLQSIEDRYEELGELLSDPAVISDTKRFMELSKEEANTRETVEVYRRYKQVVEGISDAEELLSENLDAEMAEMAKEELSDLKKEKEVLEDRIKILLLPKDPNDDKNIIMEIRGAAGGDEAALFAGDLFNMYQKYAEAQGWKAEVLEANVTGIGGYKEVIMMISGDNVFSKLKYESGAHRVQRVPSTESQGRIHTSTATVVVMPEAEEVEIELADKDIRVDIYHASGAGGQHVNKTASAVRLTHLPTGIVVAMQDERSQLKNREKAMKVLRARVYDQIQQEAQSEYDANRKSAVGTGDRSERIRTYNFPQNRVTDHRIGLTIQKLDQILAGKLDEIIDALVLYDQTSKLEEMQ 355
>gi|167754864|ref|ZP_02426991.1| hypothetical protein CLORAM_00368 [Clostridium ramosum DSM 1402] >gi|167704914|gb|EDS19493.1| hypothetical protein CLORAM_00368 [Clostridium ramosum DSM 1402] (358 aa)
Score = 862, Expect = 1.5e-90, Identities = 183/352 (51%), Positives = 262/352 (74%)
  Q:     4 NEKLYNSLLSMEEKFNDLNKELETE--GLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLE-VQESSHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQ 355
           NE + + L +ME ++ +L   L     G  +K+M+E+ K         + ++EYK     I  A++L K E D EI E+A++EL+E +  + +   +L++ L+PKDPND+K+VI+E+R AAGGDE +IF GDL+  Y +YA+S GWKV+++E V   + GY  ISFM+ GE+VY K+KFESG HRVQRVP TE++GRVHTST TV V+PE+EEV++ IN SDL+IDTYRASGAGGQHINKT+SAVRITH+PTGI  A Q+G+SQ +N++ AMK L +++++  ++++ + +   RK +VG+G+RAEKIRTYNYPQNRVTDHRI LT+ +LD ++ G L +II +LI+ D+ +KM+
  S:     2 NESMLDRLKTMENRYEELGHMLMDPDIGSDIKKMTEVTKEQSSLQAAYDLYQEYKEVEAGISDAKELAK-ESDPEIKEMAKMELAELETRLPEIISKLEIELIPKDPNDNKDVIMEIRGAAGGDEGNIFAGDLYRMYVKYAESQGWKVEVMEAVDAEAGGYSLISFMVKGEDVYGKLKFESGSHRVQRVPKTETQGRVHTSTATVLVMPEMEEVDVEINKSDLRIDTYRASGAGGQHINKTDSAVRITHLPTGIVAASQDGRSQHDNKDKAMKALVSRIYDFYQQQHDEQVGSERKSKVGSGDRAEKIRTYNYPQNRVTDHRIGLTIQQLDRIVDGKLDDIITALINEDQRLKME 355
>gi|167769908|ref|ZP_02441961.1| hypothetical protein ANACOL_01249 [Anaerotruncus colihominis DSM 17241] >gi|167667899|gb|EDS12029.1| hypothetical protein ANACOL_01249 [Anaerotruncus colihominis DSM 17241] (358 aa)
Score = 858, Expect = 4.7e-90, Identities = 174/352 (49%), Positives = 259/352 (73%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGLS--VKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSA-EKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQEAK 358
           +++ L S+  ++ ++++ L    ++   ++ + + K     TPIVEK++ Y+   +  D A E L +S  D E+ ELAQ +L E + ++++   ELK+LLLP+DPNDDKNVIVE+R  AGG+E+++F G L+  Y  YA+ LGW+ +++   E+   GY  I F I GE  YS++K+ESGVHRVQRVP TE++GR+HTST+TVAVLPE EEVE  ++  DL+ID +R+SGAGGQH+NKT SA+R+TH+PTG+ V CQ+ +SQ +N++ A+K+LRA+L + K  E    I+  R+ QVGTG+R+E+IRTYNYPQ RVTDHRI LTL KLD+V+ G+L+E+ D+L++ D+A K++ A+
  S:     1 MFDKLDSVAARYEEISRRLMEPDVTGDPEQYASLMKEYSRLTPIVEKYRAYRTAKDACDEAREVLDESGVDREMRELAQEQLDENRAVLDQTAQELKILLLPRDPNDDKNVIVEIRGGAGGEEAALFAGVLYRMYTMYAEGLGWQCEVISANETELGGYKEICFSITGEGAYSRLKYESGVHRVQRVPETETQGRIHTSTVTVAVLPEAEEVEFELDPRDLQIDVFRSSGAGGQHVNKTSSAIRVTHLPTGMVVECQDERSQYKNKDRALKVLRARLLDIKVREQNDKIATERRLQVGTGDRSERIRTYNYPQGRVTDHRIGLTLYKLDSVLNGDLAELFDALMTFDQAEKLKSAE 356
>gi|69249626|ref|ZP_00605024.1| Peptide chain release factor 1 [Enterococcus faecium DO] >gi|68194105|gb|EAN08645.1| Peptide chain release factor 1 [Enterococcus faecium DO] (357 aa)
Score = 853, Expect = 1.7e-89, Identities = 182/349 (52%), Positives = 262/349 (75%)
  Q:     7 LYNSLLSMEEKFNDLNKEL-ETEGLS-VKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQ 355
           +Y+ L ++E+++ +L + L + E +S  KR  +++K    T   VE ++ YK  +  I   E+L+  + D+E+ ELA+ ELSE K   E  E ++K+LLLPKDPNDDKN+I+E+R AAGGDE+++F GDLF+ Y++YA++ GWK +++E   +   GY  +  MI G+NVYSK+K+ESG HRVQRVP+TES+GR+HTST TV V+PE EEVE+ I + D++ D Y ASGAGGQH+NKT SAVR+TH+PTGI VA Q+ +SQI+NRE AMK+LRA++++K ++E +      RK  VGTG+R+E+IRTYN+PQNRVTDHRI LT+ KLD ++ G L EI+D+LI +D+  K++
  S:     1 MYDQLQAIEDRYEELGELLSDPEVISDTKRFMQLSKEEANTRETVEVYRRYKEVVQGITDTEELLGEKLDDEMAELAKEELSELKKEKEVLEEKIKILLLPKDPNDDKNIIMEIRGAAGGDEAALFAGDLFNMYQKYAEAQGWKTEVMEANVTGIGGYKEVIMMITGDNVYSKLKYESGAHRVQRVPSTESQGRIHTSTATVVVMPEAEEVEIDIEDKDIRTDIYHASGAGGQHVNKTASAVRLTHLPTGIVVAMQDERSQIKNREKAMKILRARVYDKIQQEAQSEYDANRKSAVGTGDRSERIRTYNFPQNRVTDHRIGLTIQKLDQILAGKLDEIVDALIMYDQTSKLE 352
>gi|151571190|gb|EDN36844.1| peptide chain release factor 1 [Francisella tularensis subsp. novicida GA99-3549] (361 aa)
Score = 845, Expect = 1.3e-88, Identities = 181/341 (53%), Positives = 247/341 (72%)
  Q:    11 LLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           L S+ E+  +++  L   G+     +  +++K      PIV+ FKEY + L D  +A +++ +EKD E++E+A+ EL      IEK E EL++LLLP+DPNDD NV +E+R   GGDE+SIF GDLF  Y +YA+  GWK++++   E  HG Y  I   I G+ VYS++KFESG HRVQRVPATES+GR+HTS  TVAV+PE +EVE + IN +D+K+DT+RASGAGGQH+NKT+SA+RITHIPTG+ V CQ+ +SQ +NR  AM ML++KL + + ++ +K  SD RK  VG+G+R+E+IRTYNYPQ RVTDHRINLTL KLD VM G+L  II  L+   +A
  S:     9 LQSLIERHEEVSALLSEAGIISDQNKFRDLSKEYSHLEPIVKAFKEYTQALKDKQAAYEML-NEKDAELVEMAKEELKLANEAIEKLESELQILLLPRDPNDDANVFLEIRAGTGGDEASIFSGDLFKMYSKYAEQRGWKIEVISASEGEHGGYKEIISRIYGDGVYSQLKFESGAHRVQRVPATESQGRIHTSACTVAVMPEADEVEGIDINPADIKVDTFRASGAGGQHVNKTDSAIRITHIPTGVVVECQDQRSQHKNRAAAMSMLKSKLLQAEIDKQQKEQSDTRKSLVGSGDRSERIRTYNYPQGRVTDHRINLTLYKLDEVMEGSLDSIIQPLVLEHQA 352
>gi|118726906|ref|ZP_01575521.1| peptide chain release factor 1 [Clostridium cellulolyticum H10] >gi|118663721|gb|EAV70367.1| peptide chain release factor 1 [Clostridium cellulolyticum H10] (359 aa)
Score = 844, Expect = 1.7e-88, Identities = 178/348 (51%), Positives = 261/348 (75%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGLSVKRMSEINKSIKETT---PIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           +++ L + E+++ +++ +L    + +    E  K +KE +    IV+K++EY +   +I+ A +L++   D +  E+ Q E  E +  +E  + +LK+L++PKDPNDDKNVIVE+R  AGG+E+++F G LF A  +YA+   WK ++L+   +   G+  + F I G+  YS++KFESGVHRVQRVP+TES GR+HTSTITVAVLPE+EEV++ IN SDL+IDTYRASGAGGQHINKT+SA+RITH+PTGI V+CQ+ +SQ +N++ AMK+LR+KL+E  +E+    ++  RK QVGTG+R+E+IRTYNYPQ RVTDHRINLTL KL+ V+ G+L E+ID+LI+ D++ K+
  S:     1 MFDKLQAAEDRYEEISHKLSDPDV-INNQDEYKKYMKECSDLEEIVQKYREYTKVTKEIEEARELLEQTLDKDFREMVQQEFQEAQEKLEVIKRQLKILIVPKDPNDDKNVIVEIRGGAGGEEAALFAGVLFRAMAKYAEKKRWKYEILDSNPTELGGFKEVVFTIEGKGAYSRLKFESGVHRVQRVPSTESSGRIHTSTITVAVLPEVEEVDVDINPSDLRIDTYRASGAGGQHINKTDSAIRITHMPTGIVVSCQDERSQHKNKDKAMKILRSKLYEIAQEQQINEVAQDRKNQVGTGDRSERIRTYNYPQGRVTDHRINLTLYKLEQVLDGDLDELIDALITTDQSEKL 351
>gi|187931103|ref|YP_001891087.1| peptide chain release factor 1 [Francisella tularensis subsp. mediasiatica FSC147] >gi|187712012|gb|ACD30309.1| peptide chain release factor 1 [Francisella tularensis subsp. mediasiatica FSC147] (361 aa)
Score = 844, Expect = 2.0e-88, Identities = 181/341 (53%), Positives = 246/341 (72%)
  Q:    11 LLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           L S+ E+  +++  L   G+     +  +++K      PIV+ FKEY + L D  +A +++ +EKD E++E+A+ EL      IEK E EL++ LLP+DPNDD NV +E+R   GGDE+SIF GDLF  Y +YA+  GWK++++   E  HG Y  I   I G+ VYS++KFESG HRVQRVPATES+GR+HTS  TVAV+PE +EVE + IN +D+K+DT+RASGAGGQH+NKT+SA+RITHIPTG+ V CQ+ +SQ +NR  AM ML++KL + + ++ +K  SD RK  VG+G+R+E+IRTYNYPQ RVTDHRINLTL KLD VM G+L  II  LI   +A
  S:     9 LQSLIERHEEVSALLSEAGIISDQNKFRDLSKEYSHLEPIVKAFKEYTQALEDKQAAYEML-NEKDAELVEMAKEELKLANEAIEKLESELQIFLLPRDPNDDANVFLEIRAGTGGDEASIFSGDLFKMYSKYAEQRGWKIEVISASEGEHGGYKEIISRIYGDGVYSQLKFESGAHRVQRVPATESQGRIHTSACTVAVMPEADEVEGIDINPADIKVDTFRASGAGGQHVNKTDSAIRITHIPTGVVVECQDQRSQHKNRAAAMSMLKSKLLQAEIDKQQKEQSDTRKSLVGSGDRSERIRTYNYPQGRVTDHRINLTLYKLDEVMEGSLDSIIQPLILEHQA 352
>gi|118498113|ref|YP_899163.1| peptide chain release factor 1 [Francisella tularensis subsp. novicida U112] >gi|194323340|ref|ZP_03057124.1| peptide chain release factor 1 [Francisella tularensis subsp. novicida FTE] >gi|166223559|sp|A0Q844|RF1_FRATN Peptide chain release factor 1 (RF-1) >gi|118424019|gb|ABK90409.1| protein chain release factor A [Francisella tularensis subsp. novicida U112] >gi|194322704|gb|EDX20184.1| peptide chain release factor 1 [Francisella tularensis subsp. novicida FTE] (361 aa)
Score = 843, Expect = 2.2e-88, Identities = 181/341 (53%), Positives = 247/341 (72%)
  Q:    11 LLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           L S+ E+  +++  L   G+     +  +++K      PIV+ FKEY + L D  +A +++ +EKD E++E+A+ EL      IEK E EL++LLLP+DPNDD NV +E+R   GGDE+SIF GDLF  Y +YA+  GWK++++   E  HG Y  I   I G+ VYS++KFESG HRVQRVPATES+GR+HTS  TVAV+PE +EVE + IN +D+K+DT+RASGAGGQH+NKT+SA+RITHIPTG+ V CQ+ +SQ +NR  AM ML++KL + + ++ +K  SD RK  VG+G+R+E+IRTYNYPQ RVTDHRINLTL KLD VM G+L  II  L+   +A
  S:     9 LQSLIERHEEVSALLSEAGIISDQNKFRDLSKEYSHLEPIVKAFKEYTQALEDKQAAYEML-NEKDAELVEMAKEELKLANEAIEKLESELQILLLPRDPNDDANVFLEIRAGTGGDEASIFSGDLFKMYSKYAEQRGWKIEVISASEGEHGGYKEIISRIYGDGVYSQLKFESGAHRVQRVPATESQGRIHTSACTVAVMPEADEVEGIDINPADIKVDTFRASGAGGQHVNKTDSAIRITHIPTGVVVECQDQRSQHKNRAAAMLMLKSKLLQAEIDKQQKEQSDTRKSLVGSGDRSERIRTYNYPQGRVTDHRINLTLYKLDEVMEGSLDSIIQPLVLEHQA 352
>gi|89256990|ref|YP_514352.1| peptide chain release factor 1 [Francisella tularensis subsp. holarctica] >gi|115315350|ref|YP_764073.1| peptide chain release factor 1 [Francisella tularensis subsp. holarctica OSU18] >gi|134301375|ref|YP_001121343.1| peptide chain release factor 1 [Francisella tularensis subsp. tularensis WY96-3418] >gi|156503190|ref|YP_001429255.1| peptide chain release factor 1 [Francisella tularensis subsp. holarctica FTNF002-00] >gi|167009371|ref|ZP_02274302.1| peptide chain release factor 1 [Francisella tularensis subsp. holarctica FSC200] >gi|166223558|sp|A7NE96|RF1_FRATF Peptide chain release factor 1 (RF-1) >gi|166223560|sp|A4IWC1|RF1_FRATW Peptide chain release factor 1 (RF-1) >gi|119361542|sp|Q2A1Q0|RF1_FRATH Peptide chain release factor 1 (RF-1) >gi|119361543|sp|Q0BKE8|RF1_FRATO Peptide chain release factor 1 (RF-1) >gi|89144821|emb|CAJ80160.1| peptide chain release factor 1 [Francisella tularensis subsp. holarctica LVS] >gi|115130249|gb|ABI83436.1| peptide chain release factor 1 [Francisella tularensis subsp. holarctica OSU18] >gi|134049152|gb|ABO46223.1| peptide chain release factor 1 [Francisella tularensis subsp. tularensis WY96-3418] >gi|134254055|gb|EBA53149.1| peptide chain release factor 1 [Francisella tularensis subsp. holarctica 257] >gi|156253793|gb|ABU62299.1| peptide chain release factor 1 [Francisella tularensis subsp. holarctica FTNF002-00] (361 aa)
Score = 842, Expect = 2.9e-88, Identities = 180/341 (52%), Positives = 246/341 (72%)
  Q:    11 LLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           L S+ E+  +++  L   G+     +  +++K      PIV+ FKEY + L D  +A +++ +EKD E++E+A+ EL      IEK E EL++ LLP+DPNDD NV +E+R   GGDE+SIF GDLF  Y +YA+  GWK++++   E  HG Y  I   I G+ VYS++KFESG HRVQRVPATES+GR+HTS  TVAV+PE +EVE + IN +D+K+DT+RASGAGGQH+NKT+SA+RITHIPTG+ V CQ+ +SQ +NR  AM ML++KL + + ++ +K  SD RK  VG+G+R+E+IRTYNYPQ RVTDHRINLTL KLD VM G+L  II  L+   +A
  S:     9 LQSLIERHEEVSALLSEAGIISDQNKFRDLSKEYSHLEPIVKAFKEYTQALEDKQAAYEML-NEKDAELVEMAKEELKLANEAIEKLESELQIFLLPRDPNDDANVFLEIRAGTGGDEASIFSGDLFKMYSKYAEQRGWKIEVISASEGEHGGYKEIISRIYGDGVYSQLKFESGAHRVQRVPATESQGRIHTSACTVAVMPEADEVEGIDINPADIKVDTFRASGAGGQHVNKTDSAIRITHIPTGVVVECQDQRSQHKNRAAAMSMLKSKLLQAEIDKQQKEQSDTRKSLVGSGDRSERIRTYNYPQGRVTDHRINLTLYKLDEVMEGSLDSIIQPLVLEHQA 352
>gi|151572644|gb|EDN38298.1| peptide chain release factor 1 [Francisella tularensis subsp. novicida GA99-3548] (361 aa)
Score = 842, Expect = 3.1e-88, Identities = 181/341 (53%), Positives = 247/341 (72%)
  Q:    11 LLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           L S+ E+  +++  L   G+     +  +++K      PIV+ FKEY + L D  +A +++ +EKD E++E+A+ EL      IEK E EL++LLLP+DPNDD NV +E+R   GGDE+SIF GDLF  Y +YA+  GWK++++   E  HG Y  I   I G+ VYS++KFESG HRVQRVPATES+GR+HTS  TVAV+PE +EVE + IN +D+K+DT+RASGAGGQH+NKT+SA+RITHIPTG+ V CQ+ +SQ +NR  AM ML++KL + + ++ +K  SD RK  VG+G+R+E+IRTYNYPQ RVTDHRINLTL KLD VM G+L  II  L+   +A
  S:     9 LQSLIERHEEVSALLSEVGIISDQNKFRDLSKEYSHLEPIVKAFKEYTQALEDKQAAYEML-NEKDAELVEMAKEELKLANEAIEKLESELQILLLPRDPNDDANVFLEIRAGTGGDEASIFSGDLFKMYSKYAEQRGWKIEVISASEGEHGGYKEIISRIYGDGVYSQLKFESGAHRVQRVPATESQGRIHTSACTVAVMPEADEVEGIDINPADIKVDTFRASGAGGQHVNKTDSAIRITHIPTGVVVECQDQRSQHKNRAAAMSMLKSKLLQAEIDKQQKEQSDTRKSLVGSGDRSERIRTYNYPQGRVTDHRINLTLYKLDEVMEGSLDSIIQPLVLEHQA 352
>gi|134301001|ref|YP_001114497.1| peptide chain release factor 1 [Desulfotomaculum reducens MI-1] >gi|134053701|gb|ABO51672.1| bacterial peptide chain release factor 1 (bRF-1) [Desulfotomaculum reducens MI-1] (356 aa)
Score = 842, Expect = 3.2e-88, Identities = 167/349 (47%), Positives = 258/349 (73%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGLSVKRM--SEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQ 355
           +Y+ L ++E++F  L  ++    +   R    ++ KS  +   +V+ F++YK+   D+   +++++ + + +  E+ +LE+ E    IE+ E +LK+LLLPKDPNDDKNVI+E+R   GGDE+++F GDLF  Y RYA+  GW+ ++++  E+   G+  ++F+I G+  +S +KFESGVHRVQRVPATES GR+HTS  TVAVLPE EEV++ IN +D++ID + ASG GGQ +N T+SAVRITHIPTG  V+CQ+ KSQ +N++ AM++LRA+L +K ++E +K I+  RK  VG+G+R+E+IRTYN+PQNR+TDHRI LTL++L+ V+ G+L E+ID+LI+ D+A +++
  S:     1 MYDKLQALEDRFEQLESQISDPEVMADRAKWQQLVKSHSDLAEVVDVFRQYKKAKEDLQENKQMLEDKLEPDFREMVELEIEELTSKIEEQENKLKILLLPKDPNDDKNVIMEIRGGTGGDEAALFAGDLFRMYSRYAEKKGWRTEIIDANETDLGGFKEVTFVIEGKGAFSTLKFESGVHRVQRVPATESGGRIHTSAATVAVLPEAEEVDIDINANDIRIDLFCASGPGGQCVNTTQSAVRITHIPTGTVVSCQDEKSQHKNKDKAMRVLRARLLDKAQDEQQKAIAGARKSMVGSGDRSERIRTYNFPQNRITDHRIGLTLHRLEYVLQGDLDELIDALITTDQAERLK 352
>gi|160947003|ref|ZP_02094206.1| hypothetical protein PEPMIC_00965 [Peptostreptococcus micros ATCC 33270] >gi|158447387|gb|EDP24382.1| hypothetical protein PEPMIC_00965 [Peptostreptococcus micros ATCC 33270] (365 aa)
Score = 842, Expect = 3.2e-88, Identities = 180/348 (51%), Positives = 261/348 (75%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGLSVKRMSEINKSIKE---TTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           L++ L  + EKF +L K++    + +K M+   K  KE     PIVEK++EY +   +++  ++++K   D+E+ EL + E+SE +  IEK E +LK+LLLPKDPND+KNV +E+R   GGDE+ +F  DL   Y+ +AD   WK +++ + E    G   + F++ G   YSK+K+ESGVHRVQRVPATES GR+HTS  TVAVLPE+E+V++VIN +DL+ID YRASG GGQ +N T+SAVRITHIPTG+ V CQ+ KSQ++N+E AMK+L+++L+EK +EE  K+I+D RK Q+G+G+R+E+IRTYN+PQ RVTDHRIN+T+ +LD+ + G++SE+ID+LI+ D+A KM
  S:    10 LFDKLELLVEKFEELEKKIIDPEI-MKDMNVWQKLAKEHGDMKPIVEKYREYSKHKKELEENKEMLKESLDDEMKELVKEEISELEDSIEKEEQDLKILLLPKDPNDEKNVFMEVRAGTGGDEAGLFAEDLLRMYRMFADKQKWKTEIMSISEQGVGGIKEVVFLVKGHGAYSKLKYESGVHRVQRVPATESSGRIHTSAATVAVLPEVEDVDVVINQNDLRIDVYRASGNGGQCVNTTDSAVRITHIPTGVVVTCQDEKSQLKNKEKAMKILKSRLYEKYQEEQNKDIADARKSQIGSGDRSERIRTYNFPQGRVTDHRINMTIYQLDSFLNGDISEMIDALITSDQAKKM 360
>gi|158321600|ref|YP_001514107.1| peptide chain release factor 1 [Alkaliphilus oremlandii OhILAs] >gi|166977358|sp|A8MJX9|RF1_ALKOO Peptide chain release factor 1 (RF-1) >gi|158141799|gb|ABW20111.1| peptide chain release factor 1 [Alkaliphilus oremlandii OhILAs] (357 aa)
Score = 841, Expect = 3.6e-88, Identities = 174/350 (49%), Positives = 266/350 (76%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGLSVKRMSEINKSIKETT---PIVEKFKEYKRTLNDIDSAEKLIKSEK-DNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           + + L  +EEK+ DL++++ +E   +    +  K +KE +    IV K++EYK+T   ++ A+++++ +  D E  E+A++E++E +  IE  E ELK+LLLPKDPNDDK+VIVE+R  AGGDE+ +F  DLF  Y RYA+++GWKV+M+   ++   GY  + FMI G   YS++K+ESGVHRVQR+P+TES GR+HTSTITVAVLPE ++V+  ++ +D+++D +R+SG GGQ +N T+SAVR+THIPTG  V+CQ+ KSQ++N+E A+K+LRA+L +   +E +  I+  RK QVGTG+R+E+IRTYN+PQ R+TDHRIN+TL +LD+ + G++ E+ID+LI+ D+A K++E
  S:     1 MLDKLAFLEEKYEDLSEKI-SEPEIINDQPQWKKLVKEHSDLEEIVMKYREYKKTEQGLNDAKEILRDKTADEEFREMAKMEIAELEEKIEVLEGELKILLLPKDPNDDKDVIVEIRAGAGGDEAGLFAADLFRMYTRYAENVGWKVEMMSANDTGIGGYKEVIFMIKGHGAYSRLKYESGVHRVQRIPSTESGGRIHTSTITVAVLPEADDVDFELDMNDIRVDVFRSSGNGGQSVNTTDSAVRVTHIPTGTVVSCQDEKSQLKNKEKALKILRARLLDVLIQEQQAEIAQDRKSQVGTGDRSERIRTYNFPQGRITDHRINVTLYRLDSFLNGDIQEMIDALITTDQAEKLKE 354
>gi|169351467|ref|ZP_02868405.1| hypothetical protein CLOSPI_02247 [Clostridium spiroforme DSM 1552] >gi|169291689|gb|EDS73822.1| hypothetical protein CLOSPI_02247 [Clostridium spiroforme DSM 1552] (358 aa)
Score = 841, Expect = 3.7e-88, Identities = 183/352 (51%), Positives = 260/352 (73%)
  Q:     4 NEKLYNSLLSMEEKFNDLNKELETE--GLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLE-VQESSHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQ 355
           NE +   L +ME ++ +L   L     G  +K+M+++ K         + ++EYK   N I+ A++L K E D EI E+A++EL+E +  +     +L++ L+PKDPND+K+VI+E+R AAGGDE +IF GDL+  Y +YA+S GWKV+++E +   + GY  ISFM+ GE VY K+KFESG HRVQRVP TE++GRVHTST TV V+PE+EEV++ IN +DL+IDTYRASGAGGQHINKT+SAVRITHIPTGI  A Q+G+SQ +N++ AMK L A++++  +++  + +   RK +VGTG+RAEKIRTYNYPQNRVTDHRI LT+ +LD ++ G L +II +LI+ D+ +K++
  S:     2 NESMLERLKTMENRYEELGHMLMDPDIGSDIKKMTDVTKEQASLQAAYDLYQEYKEIENGIEEAKELAK-EHDPEIKEMAKMELAELEEKLPDVIKKLEIELIPKDPNDNKDVIMEIRGAAGGDEGNIFAGDLYRMYVKYAESQGWKVEVMEAIDAEAGGYSLISFMVKGEGVYGKLKFESGSHRVQRVPKTETQGRVHTSTATVLVMPEVEEVDVEINKNDLRIDTYRASGAGGQHINKTDSAVRITHIPTGIVAASQDGRSQHDNKDKAMKALIARIYDYYQQQQDQQVESERKSKVGTGDRAEKIRTYNYPQNRVTDHRIGLTIQQLDRIIEGKLDDIITALINEDQRLKLE 355
>gi|157122799|gb|EDO66928.1| peptide chain release factor 1 [Francisella tularensis subsp. holarctica FSC022] (361 aa)
Score = 841, Expect = 3.9e-88, Identities = 179/341 (52%), Positives = 246/341 (72%)
  Q:    11 LLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           L S+ E+  +++  L   G+     +  +++K      PIV+ FKEY + L D  +A +++ +EKD E++E+A+ EL      IEK E EL++ LLP+DPNDD NV +E+R   GGDE+SIF GDLF  Y +YA+  GWK++++   E  HG Y  I   I G+ VYS++KFESG HRVQR+PATES+GR+HTS  TVAV+PE +EVE + IN +D+K+DT+RASGAGGQH+NKT+SA+RITHIPTG+ V CQ+ +SQ +NR  AM ML++KL + + ++ +K  SD RK  VG+G+R+E+IRTYNYPQ RVTDHRINLTL KLD VM G+L  II  L+   +A
  S:     9 LQSLIERHEEVSALLSEAGIISDQNKFRDLSKEYSHLEPIVKAFKEYTQALEDKQAAYEML-NEKDAELVEMAKEELKLANEAIEKLESELQIFLLPRDPNDDANVFLEIRAGTGGDEASIFSGDLFKMYSKYAEQRGWKIEVISASEGEHGGYKEIISRIYGDGVYSQLKFESGAHRVQRIPATESQGRIHTSACTVAVMPEADEVEGIDINPADIKVDTFRASGAGGQHVNKTDSAIRITHIPTGVVVECQDQRSQHKNRAAAMSMLKSKLLQAEIDKQQKEQSDTRKSLVGSGDRSERIRTYNYPQGRVTDHRINLTLYKLDEVMEGSLDSIIQPLVLEHQA 352
>gi|167766740|ref|ZP_02438793.1| hypothetical protein CLOSS21_01246 [Clostridium sp. SS2/1] >gi|167711494|gb|EDS22073.1| hypothetical protein CLOSS21_01246 [Clostridium sp. SS2/1] (366 aa)
Score = 841, Expect = 4.6e-88, Identities = 181/349 (51%), Positives = 260/349 (74%)
  Q:     6 KLYNSLLSMEEKFNDLNKELETEGLS--VKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           K+++ L  + ++ + + +EL    ++    R  ++ K   E TPIVEK+KEYK    +I+ +  L++ E D E+ ELA+ EL+E K  +E+ E ELK+LL+PKDP DDKN+IVEMR  AGGDE+ +FV D+   Y+ YA+S  WKV  L   ES   G+  + FM++G+  YS+ K+ESGVHRVQR+PATES GR+HTSTITVA++PE+E+VE+ I+ +D K D +RASG GGQ +N T+SAVR+THIPTGI V+CQ+ KSQ++N++ A+K+LR++L+E ++++     +  RK Q+GTG+R+EKIRTYNYPQ RVTDHRI LTL+KLD++M G+L E+IDSL + D+A K+
  S:     9 KMFDKLEGLVDRLDTVLQELNDPDVAGNQNRFRDLMKEQNELTPIVEKYKEYKAEKQNIEDSLMLLEEESDEEMKELAKEELNESKANVERLEEELKILLIPKDPMDDKNIIVEMRAGAGGDEAGLFVADVARMYRSYAESKRWKVNTLSFNESGIGGFKELVFMVSGQGAYSRFKYESGVHRVQRIPATESGGRIHTSTITVAIMPEVEDVEVEIDMNDCKFDVFRASGNGGQCVNTTDSAVRLTHIPTGIVVSCQDEKSQLKNKDKALKVLRSRLYELEQQKAHDEEAAKRKSQIGTGDRSEKIRTYNYPQGRVTDHRIKLTLHKLDSIMNGDLDELIDSLTAADQAAKL 360
>gi|153956299|ref|YP_001397064.1| peptide chain release factor 1 [Clostridium kluyveri DSM 555] >gi|189039965|sp|A5N3J7|RF1_CLOK5 Peptide chain release factor 1 (RF-1) >gi|146349157|gb|EDK35693.1| PrfA [Clostridium kluyveri DSM 555] (357 aa)
Score = 840, Expect = 5.2e-88, Identities = 173/342 (50%), Positives = 257/342 (75%)
  Q:    14 MEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQ 355
           +E K+ +L+ ++    +    K+  ++ K   E   IV K++EYK  L D++  +++++ E D ++ E+ Q E+     +IEK E ELK+LLLPKDPNDDKNV VE+R  AGG+E+++F  +L   Y RYA+  GWKV+ + +  +   G+  I FM+ G++ YS++K+ESG HRVQRVP TES GR+HTST TVAVLPE+++V++V+N +D++ID +RASG GGQ +N T+SAVRITH+PTG+ V+CQ+ KSQ++N+E AMK+L+++L+EK +EE   +I++ RK QVGTG+R+E+IRTYNYPQ RVTDHRI +TL KLD+ + G++ EIID+LI+ D+A KM+
  S:     8 IENKYEELSIKISDPTIIADQKKWQKLCKEHAELEEIVMKYREYKEALQDLEDNKEMLREETDKDMREMEQEEIKRLGDIIEKREDELKILLLPKDPNDDKNVFVEIRGGAGGEEAALFAANLTRMYTRYAEIKGWKVETISLSATDIGGFKEIVFMVKGKDAYSRLKYESGTHRVQRVPDTESSGRIHTSTATVAVLPEVDDVDIVVNQNDIRIDVFRASGHGGQCVNTTDSAVRITHLPTGLVVSCQDEKSQLKNKEKAMKVLKSRLYEKAQEERNASIAEDRKNQVGTGDRSERIRTYNYPQGRVTDHRIGMTLYKLDSFLNGDIDEIIDALITEDQAQKMK 352
>gi|56707338|ref|YP_169234.1| peptide chain release factor 1 [Francisella tularensis subsp. tularensis SCHU S4] >gi|110669808|ref|YP_666365.1| peptide chain release factor 1 [Francisella tularensis subsp. tularensis FSC198] >gi|61214577|sp|Q5NIA8|RF1_FRATT Peptide chain release factor 1 (RF-1) >gi|119361541|sp|Q14JR1|RF1_FRAT1 Peptide chain release factor 1 (RF-1) >gi|54112995|gb|AAV29131.1| NT02FT0305 [synthetic construct] >gi|56603830|emb|CAG44801.1| peptide chain release factor 1 [Francisella tularensis subsp. tularensis SCHU S4] >gi|110320141|emb|CAL08184.1| peptide chain release factor 1 [Francisella tularensis subsp. tularensis FSC 198] >gi|151568260|gb|EDN33914.1| peptide chain release factor 1 [Francisella tularensis subsp. tularensis FSC033] (361 aa)
Score = 839, Expect = 7.6e-88, Identities = 179/341 (52%), Positives = 246/341 (72%)
  Q:    11 LLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           L S+ E+  +++  L   G+     +  +++K      PIV+ FK+Y + L D  +A +++ +EKD E++E+A+ EL      IEK E EL++ LLP+DPNDD NV +E+R   GGDE+SIF GDLF  Y +YA+  GWK++++   E  HG Y  I   I G+ VYS++KFESG HRVQRVPATES+GR+HTS  TVAV+PE +EVE + IN +D+K+DT+RASGAGGQH+NKT+SA+RITHIPTG+ V CQ+ +SQ +NR  AM ML++KL + + ++ +K  SD RK  VG+G+R+E+IRTYNYPQ RVTDHRINLTL KLD VM G+L  II  L+   +A
  S:     9 LQSLIERHEEVSALLSEAGIISDQNKFRDLSKEYSHLEPIVKAFKKYTQALEDKQAAYEML-NEKDAELVEMAKEELKLANEAIEKLESELQIFLLPRDPNDDANVFLEIRAGTGGDEASIFSGDLFKMYSKYAEQRGWKIEVISASEGEHGGYKEIISRIYGDGVYSQLKFESGAHRVQRVPATESQGRIHTSACTVAVMPEADEVEGIDINPADIKVDTFRASGAGGQHVNKTDSAIRITHIPTGVVVECQDQRSQHKNRAAAMSMLKSKLLQAEIDKQQKEQSDTRKSLVGSGDRSERIRTYNYPQGRVTDHRINLTLYKLDEVMEGSLDSIIQPLVLEHQA 352
>gi|146296536|ref|YP_001180307.1| peptide chain release factor 1 [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|166223538|sp|A4XJN1|RF1_CALS8 Peptide chain release factor 1 (RF-1) >gi|145410112|gb|ABP67116.1| bacterial peptide chain release factor 1 (bRF-1) [Caldicellulosiruptor saccharolyticus DSM 8903] (355 aa)
Score = 838, Expect = 8.4e-88, Identities = 185/350 (52%), Positives = 258/350 (73%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGLSVKRMSEINKSIKETT---PIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           +   L  +EEK+ +L K++    + +    E  K +KE +   PIVEKF+EYKR +  I+ AE+L+ +  D +  +L + EL++ K   E  E ELK+LLLPKDPND+KNVI+E+R  AGG+E+++F  +LF  Y RYA+   WKV+++   ES   G+  + FMI+G+  YS++K+ESGVHRVQRVP TES GR+HTST TVAVLPE+E+VE+ I   DL+I+T+RA GAGGQH+NKTESAVRITH PTGI V+CQ+ +SQ  NR+ AMK+LRA+L++  +   +K I   R+ QVGTG+R+E+IRTYN+PQ RVTDHRI LTL KL+ V+ G+L EIID+LI+H +  +++E
  S:     1 MIEKLQVIEEKYLELEKKISDPEI-INNNQEWQKLMKEHSNLQPIVEKFREYKRIIKTIEEAEELLDTNLDEDFEKLVKEELNQAKEQKEIVERELKILLLPKDPNDEKNVIMEIRAGAGGEEAALFAAELFRMYSRYAERKNWKVEVMSTSESDLDGFKEVIFMISGKGAYSRLKYESGVHRVQRVPVTESGGRIHTSTATVAVLPEVEDVEVEIREEDLEIETFRAGGAGGQHVNKTESAVRITHKPTGIVVSCQDERSQHANRDRAMKILRARLYDYYQSLQQKEIESQRRSQVGTGDRSERIRTYNFPQGRVTDHRIGLTLYKLEQVLDGDLDEIIDALITHFQTERLKE 353
>gi|77920283|ref|YP_358098.1| peptide chain release factor 1 [Pelobacter carbinolicus DSM 2380] >gi|119361572|sp|Q3A129|RF1_PELCD Peptide chain release factor 1 (RF-1) >gi|77546366|gb|ABA89928.1| bacterial peptide chain release factor 1 (bRF-1) [Pelobacter carbinolicus DSM 2380] (356 aa)
Score = 838, Expect = 9.7e-88, Identities = 174/351 (49%), Positives = 255/351 (72%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQES-SHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISH--DEAVKMQEA 357
           ++N L  +E++F ++   L    +    KR  E+ +   E + +V  ++EYKR   DI+   +L++ + D E+ E+A+ EL E +   E+   +LKVLLLPKDPNDDKNVI+E+R   GGDE+++F GDLF  Y R+A+  GWKV+ + V +S + G+  I  MI+G  VYS++K+ESG HRVQRVP TE++GR+HTS  TVAVLPE E+V++ I+ +DL+ID YRASGAGGQH+NKTESAVRITH+PTG+ V+CQ+ KSQ +N+  AMK+L++++ ++   + +  ++  RK QVG+G+R+++IRTYN+PQ R TDHRI LTL +L+ +M GNLSE+++ L  H   EA+  QEA
  S:     2 IFNKLEEVEDRFREVEGLLSDPQVVSQQKRFLELTREHAELSSVVAVYREYKRVSEDIEGNRELLQ-DSDPEMREMAKAELPELEAHREELAQQLKVLLLPKDPNDDKNVILEIRAGTGGDEAALFAGDLFRMYSRFAEGQGWKVETMSVSDSEAGGFKEIIAMISGNRVYSQLKYESGTHRVQRVPETEAQGRIHTSACTVAVLPEAEDVDVDIDPTDLRIDVYRASGAGGQHVNKTESAVRITHVPTGVVVSCQDEKSQHKNKAKAMKVLKSRILDQVMADQQAQMAADRKSQVGSGDRSQRIRTYNFPQGRCTDHRIGLTLYRLEGIMQGNLSELVEPLTLHYQSEAMAAQEA 356
>gi|167627296|ref|YP_001677796.1| peptide chain release factor 1 [Francisella philomiragia subsp. philomiragia ATCC 25017] >gi|189039973|sp|B0TX37|RF1_FRAP2 Peptide chain release factor 1 (RF-1) >gi|167597297|gb|ABZ87295.1| peptide chain release factor 1 [Francisella philomiragia subsp. philomiragia ATCC 25017] (361 aa)
Score = 836, Expect = 1.4e-87, Identities = 175/318 (55%), Positives = 236/318 (74%)
  Q:    34 RMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           +  +++K      PIV  FKEY + L D ++A +++ +EKD E++E+A+ EL      IE+ E EL++LLLP+DPNDD N+ +E+R   GGDE+SIF GDLF  Y +YA+  GWK++++   E  HG Y  I   I G+ VYS++KFESG HRVQRVPATES+GR+HTS  TVAV+PE +EVE + IN +D+K+DT+RASGAGGQH+NKT+SA+RITHIPTG+ V CQ+ +SQ +NR  AM ML++KL + + ++ +K  SD RK  VG+G+R+E+IRTYNYPQ RVTDHRINLTL KLD VM G+L  II  LI   +A
  S:    34 KFRDLSKEYSHLEPIVMAFKEYTQALEDKEAAYEML-NEKDAELVEMAKEELKSANESIERLEDELQILLLPRDPNDDANIFLEIRAGTGGDEASIFSGDLFKMYSKYAEQRGWKIEVVSASEGEHGGYKEIISRIYGDGVYSQLKFESGAHRVQRVPATESQGRIHTSACTVAVMPEADEVEGIDINPADIKVDTFRASGAGGQHVNKTDSAIRITHIPTGVVVECQDQRSQHKNRAAAMSMLKSKLLQAEIDKQQKEQSDTRKNLVGSGDRSERIRTYNYPQGRVTDHRINLTLYKLDEVMEGSLDSIIQPLILEHQA 352
>gi|116629883|ref|YP_815055.1| peptide chain release factor 1 [Lactobacillus gasseri ATCC 33323] >gi|122273179|sp|Q042K5|RF1_LACGA Peptide chain release factor 1 (RF-1) >gi|116095465|gb|ABJ60617.1| bacterial peptide chain release factor 1 (bRF-1) [Lactobacillus gasseri ATCC 33323] (362 aa)
Score = 836, Expect = 1.4e-87, Identities = 170/324 (52%), Positives = 251/324 (77%)
  Q:    33 KRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           KR  EI+K   +   +V+K+++YK  + +ID  +++I SE D++++E+A+ E SE +  + K E E+K+L+LPKDPNDDK++I+E+R AAGGDE+S+F GDL   Y++YA++ GWKV +++ + +   GY  ++ MI G+ VYSK+K+E+G HRVQRVP TES+GRVHTST TVAV+PE E+V++ ++  D+++D YR+SGAGGQHINKT SAVR+TH+PTGI VA Q+ +SQ +NRE AM++L++++++  E +NR      RK  VGTG+R+E+IRTYNYPQNRVTDHRI LTLNKLD VM G L EII++L+ + +  ++++
  S:    32 KRYMEISKEEADMREVVQKYRKYKSDIKEIDDNKEIISSESDDDLVEMAKEENSELEKEVAKLEDEIKILMLPKDPNDDKDIIMEIRGAAGGDEASLFAGDLLRMYEKYAETQGWKVSLIDSEPTEVGGYKRVAVMITGDKVYSKLKYENGAHRVQRVPVTESQGRVHTSTATVAVMPEYEQVDIDLDPKDIRVDVYRSSGAGGQHINKTSSAVRMTHLPTGIVVAMQDQRSQQQNREKAMQILKSRVYDYYESQNRDKYDAKRKDAVGTGDRSERIRTYNYPQNRVTDHRIGLTLNKLDRVMNGELDEIINALVLYYQTQQLEK 356
>gi|164688895|ref|ZP_02212923.1| hypothetical protein CLOBAR_02543 [Clostridium bartlettii DSM 16795] >gi|164602099|gb|EDQ95564.1| hypothetical protein CLOBAR_02543 [Clostridium bartlettii DSM 16795] (354 aa)
Score = 834, Expect = 2.8e-87, Identities = 180/348 (51%), Positives = 262/348 (75%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           + N L  +E+K+ +L +++    +    K   +  K   +  PIV K++EYK  +++I  ++++++ E D E+ ELA++ELS+ +  +E  E ELK+LLLPKDPND+KNVIVE+R  AGGDE+++F GDLF  Y RYA+   WK ++L   ++   GY  +SFMI G+  YS++K+ESGVHRVQR+P+TES GR+HTST TVAVLPE+E+VE+ IN +DL+ID +RASG GGQ +N T+SAVRITH+PTG  V+CQ+ KSQ++N+E AMK+L+A+L++K   E   +I+  R+ QVGTG+R+E+IRTYN+PQ RV+DHRINLTL KL++ + G+L E+ID+LI+ D+  KM
  S:     1 MLNKLQVLEDKYKELTEKISDIEVINDQKTWQKYMKEHADLEPIVMKYREYKEVVDNIKESKEILEEESDEELRELAKMELSDLESRVEPIEDELKILLLPKDPNDEKNVIVEIRGGAGGDEAALFAGDLFRMYSRYAERRRWKTELLSASDTGVGGYKEVSFMIKGKGAYSRLKYESGVHRVQRIPSTESGGRIHTSTATVAVLPEVEDVEIEINPNDLRIDVFRASGNGGQCVNTTDSAVRITHLPTGEVVSCQDEKSQLKNKEKAMKVLKARLYDKALAEQHDDIAAERRSQVGTGDRSERIRTYNFPQGRVSDHRINLTLYKLESFLDGDLDEMIDALITEDQTKKM 351
>gi|116494651|ref|YP_806385.1| protein chain release factor A [Lactobacillus casei ATCC 334] >gi|191638150|ref|YP_001987316.1| Peptide chain release factor 1 (RF-1) [Lactobacillus casei] >gi|122263928|sp|Q03A29|RF1_LACC3 Peptide chain release factor 1 (RF-1) >gi|116104801|gb|ABJ69943.1| bacterial peptide chain release factor 1 (bRF-1) [Lactobacillus casei ATCC 334] >gi|190712452|emb|CAQ66458.1| Peptide chain release factor 1 (RF-1) [Lactobacillus casei BL23] (359 aa)
Score = 834, Expect = 2.9e-87, Identities = 175/355 (49%), Positives = 258/355 (72%)
  Q:     5 EKLYNSLLSMEEKFNDLNKEL-ETEGLS-VKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQEAKI 359
           +K++  L  + +++ +L + + + E +S  KR   ++K       +V  +K+YK+ L+DI  +E++++  KD+++  LA+ +L + +      E ++KVL+LPKDPNDDKN+I+E+R AAGGDE+S+F GDL + Y  YA+  GWK ++++   +   GY  +  MI G+NVYSK+K+E+G HRVQRVP TES GRVHTST TV V+PE +EV+L I+  D++ D YR+SGAGGQH+NKT SAVR+THIP+GI V+ Q+ +SQ ENR  AM++LR+++++  E +N++     RK  +GTG+R+E+IRTYNYPQNRVTDHRI LTLNKLD +M G L EIID+LI HD+A KM+   +
  S:     2 DKIFEQLDGLLDRYEELQELMSDPEVISDTKRYLALSKEEGGMRDVVAAYKKYKQVLSDIKESEEVLRESKDDDMEALAKEDLEDLQKQKADLEDQIKVLMLPKDPNDDKNIIMEIRGAAGGDEASLFAGDLLNMYMHYAERQGWKTEIIDATPTEVGGYKEVVVMITGDNVYSKLKYENGAHRVQRVPVTESAGRVHTSTATVGVMPEYDEVDLKIDPKDIRTDVYRSSGAGGQHVNKTSSAVRMTHIPSGIVVSMQDERSQQENRARAMQILRSRVYDYYETQNQEKYDQNRKNAIGTGDRSERIRTYNYPQNRVTDHRIGLTLNKLDRIMNGELDEIIDALIVHDQAQKMESLNV 359
>gi|73662075|ref|YP_300856.1| peptide chain release factor 1 [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|119361617|sp|Q49Z65|RF1_STAS1 Peptide chain release factor 1 (RF-1) >gi|72494590|dbj|BAE17911.1| peptide chain release factor 1 [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (358 aa)
Score = 833, Expect = 3.3e-87, Identities = 183/350 (52%), Positives = 256/350 (73%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           +++ L  +EE++  LN+ L    +  +   + + +K   E    V+ +++YK+T  DI   E++++  KDN+ IE+ + E    +  + K E ELK LL+PKDPNDDK+VIVE+R AAGGDE++IF GDLF  Y +YA++L +K  ++EV ES HG Y  ISF ++G   +SK+K+E+G HRVQRVP TES GR+HTST TVAVLPE+E+VE+ + N DLKIDTYR+SGAGGQH+N T+SAVRITHIPTG+     E KSQI+NRE A+K+L+A+L++ K +E ++  +  RK  VGTG+R+E+IRTYNYPQ+RVTDHRI LTL KLD +M G L EIID+L   ++  K++E
  S:     1 MFDQLDIVEERYEQLNEMLSDPDVVNNPDNLRKYSKEQAELQKTVDVYRDYKQTKEDISEVEEMLRDTKDNDEIEMLKEEHQTLQNKVPKLEEELKFLLIPKDPNDDKDVIVEIRAAAGGDEAAIFAGDLFRMYSKYAETLNYKTDIVEVTESDHGGYKEISFSVSGNGAFSKLKYENGAHRVQRVPETESGGRIHTSTATVAVLPEVEDVEIEVRNEDLKIDTYRSSGAGGQHVNTTDSAVRITHIPTGVIATSSE-KSQIQNREKALKVLKARLFDMKLQEEQQKYAAQRKSAVGTGDRSERIRTYNYPQSRVTDHRIGLTLQKLDQIMEGKLDEIIDALTLAEQTDKLKE 352
>gi|42518855|ref|NP_964785.1| peptide chain release factor 1 [Lactobacillus johnsonii NCC 533] >gi|61214647|sp|Q74K25|RF1_LACJO Peptide chain release factor 1 (RF-1) >gi|41583141|gb|AAS08751.1| peptide chain release factor 1 [Lactobacillus johnsonii NCC 533] (362 aa)
Score = 832, Expect = 5.0e-87, Identities = 168/324 (51%), Positives = 251/324 (77%)
  Q:    33 KRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           KR  EI+K   +   +V+K+++YK  + +ID  +++I +E DN+++E+A+ E SE +  + + E E+K+L+LPKDPNDDK++I+E+R AAGGDE+S+F GDL   Y++YA++ GWKV +++ + +   GY  ++ MI G+ VYSK+K+E+G HRVQRVP TES+GRVHTST TVAV+PE E+V++ ++  D+++D YR+SGAGGQHINKT SAVR+TH+PTGI VA Q+ +SQ +NRE AM++L++++++  E +NR      RK  VGTG+R+E+IRTYNYPQNRVTDHRI LTLNKLD +M G L EII++L+ + +  ++++
  S:    32 KRYMEISKEEADMREVVQKYRKYKSDIKEIDDNKEIISTESDNDLVEMAKEENSELEKEVAELEDEIKILMLPKDPNDDKDIIMEIRGAAGGDEASLFAGDLLRMYEKYAETQGWKVSLIDSEPTEVGGYKRVAVMITGDKVYSKLKYENGAHRVQRVPVTESQGRVHTSTATVAVMPEYEQVDIDLDPKDIRVDVYRSSGAGGQHINKTSSAVRMTHLPTGIVVAMQDQRSQQQNREKAMQILKSRVYDYYESQNRDQYDAKRKESVGTGDRSERIRTYNYPQNRVTDHRIGLTLNKLDRIMNGELDEIINALVLYYQTQQLEK 356
>gi|89095600|ref|ZP_01168494.1| peptide chain release factor 1 [Bacillus sp. NRRL B-14911] >gi|89089346|gb|EAR68453.1| peptide chain release factor 1 [Bacillus sp. NRRL B-14911] (357 aa)
Score = 828, Expect = 1.4e-86, Identities = 171/351 (48%), Positives = 251/351 (71%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQEA 357
           +Y+ L ++E+++  LN+ L    +    K++ E +K        VE ++EYK        A+ +++ + D E+ E+ + E+ E +  +E  E  LK+LL+PKDPNDDKNVI+E+R AAGGDE+++F GDL+  Y R+A+  GWK  ++E   +   GY  I F+ING   +SK+KFE+G HRVQRVP TES GR+HTST TVAVLPE EEVE+ I++ D+++DT+ +SG GGQ +N T SAVR+TH+PTG  V+CQ+ KSQI+N+E AMK+LRA++++K ++E +      RK  VGTG+R+E+IRTYN+PQNRVTDHRI LT+ KLD ++ G L E+ID+LI  +++ K++EA
  S:     1 MYDRLQAVEDRYERLNELLSDPEIVNDTKKLREYSKEQSGIQETVEAYREYKEVRGQYQDAKAMLEEKLDAEMREMVKEEIGELEDRVEALEARLKILLIPKDPNDDKNVIMEIRGAAGGDEAALFAGDLYRMYSRFAEVQGWKTDVIEASSTGVGGYKEIIFIINGNGAFSKLKFENGAHRVQRVPETESGGRIHTSTATVAVLPEAEEVEIEIHDKDIRVDTFASSGPGGQSVNTTMSAVRLTHLPTGTVVSCQDEKSQIKNKEKAMKVLRARVYDKFQQEAQAEYDQQRKSAVGTGDRSERIRTYNFPQNRVTDHRIGLTIQKLDQILQGKLDEVIDALIMEEQSAKLKEA 354
>gi|160935042|ref|ZP_02082428.1| hypothetical protein CLOLEP_03918 [Clostridium leptum DSM 753] >gi|156866495|gb|EDO59867.1| hypothetical protein CLOLEP_03918 [Clostridium leptum DSM 753] (358 aa)
Score = 825, Expect = 2.6e-86, Identities = 181/349 (51%), Positives = 262/349 (75%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLI-KSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQ 355
           +++ L   E+K+ + N++L    +    +  + + K +K   P+VEK+KEYK+  N+ + A++L+ +   + +  E+ +LEL E +  +EK   ELK+LLLPKDPNDD+NVIVE+R  AGG+E+++F   LF  Y  YA++  WK ++L   E+   GY  ISFMI GE  YS+MK+ESGVHRVQRVP TE++GR+HTST+TVAVLPE E+VE+ IN SDLKIDT+R+ GAGGQHINKT+SA+RITH+PTG+ V CQ+ +SQ +N++ AMK+L+++L E + E+ +  ++  RK QVGTG+R+E+IRTYN+PQ R+TDHRI LTL +L++VM GNL E+ID+LI+ D A K++
  S:     1 MFDRLEVFEKKYEECNQKLYDPAVVSDPEAYAALMKEVKGLEPVVEKYKEYKKQKNNEEEAKQLLAEGGLEKDFREMVELELEEARESLEKISEELKILLLPKDPNDDRNVIVEIRGGAGGEEAALFSASLFRMYSMYAETKRWKTEILNANETELGGYKEISFMITGEGAYSRMKYESGVHRVQRVPETETQGRIHTSTVTVAVLPEAEDVEVEINPSDLKIDTFRSGGAGGQHINKTDSAIRITHLPTGLVVECQDERSQYKNKDKAMKVLKSRLLEAEREKQQNEVAQERKSQVGTGDRSERIRTYNFPQGRLTDHRIGLTLYRLEDVMNGNLDEVIDALITADRAAKLE 353
>gi|153814377|ref|ZP_01967045.1| hypothetical protein RUMTOR_00587 [Ruminococcus torques ATCC 27756] >gi|145848773|gb|EDK25691.1| hypothetical protein RUMTOR_00587 [Ruminococcus torques ATCC 27756] (356 aa)
Score = 825, Expect = 2.8e-86, Identities = 172/348 (49%), Positives = 255/348 (73%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGLSVK--RMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           +++ L  +  ++ ++  EL+  G++    R  ++ K   +  PIVE + EYK+   +I+ +  +++ E D E+ ELA+ ELS+ +  +E+ E ELK+LLLPKDPNDDKNVIVE+R  AGGDE+++F  +++  Y  YADS  WK +M+ + E+   G+    FMI G+  YS++K+ESGVHRVQRVP TES GR+HTSTITVA++PE EEV++VI+  D++ID  RASG GGQ +N T+SAVR+TH PTGI +  Q  KSQ++N+E A ++LR+KL++ + E+ + + ++ R+ Q+GTG+R+EKIRTYN+PQ RVTDHRI LTL+KLD ++ G+L EIIDSLI+ D+  K+
  S:     1 MFDRLEDLLIRYEEVMGELQEPGVADDPVRFRKLMKEQSDLAPIVEAYNEYKQCRQNIEDSLAMLEEESDEEMRELAKEELSDSRKRVEELEQELKILLLPKDPNDDKNVIVEIRAGAGGDEAALFAAEIYRMYVHYADSRRWKTEMISLNENGIGGFKECVFMITGQGAYSRLKYESGVHRVQRVPETESGGRIHTSTITVAIMPEAEEVDVVIDEKDIRIDVMRASGNGGQCVNTTDSAVRLTHYPTGIVIYSQTEKSQLQNKEKAFRLLRSKLYDLELEKQQASEAEARRSQIGTGDRSEKIRTYNFPQGRVTDHRIKLTLHKLDTILNGDLDEIIDSLIAADQTAKL 351
>gi|184153097|ref|YP_001841438.1| peptide chain release factor 1 [Lactobacillus reuteri F275] >gi|183224441|dbj|BAG24958.1| peptide chain release factor 1 [Lactobacillus reuteri F275] (360 aa)
Score = 825, Expect = 3.1e-86, Identities = 171/354 (48%), Positives = 263/354 (74%)
  Q:     5 EKLYNSLLSMEEKFNDLNK-----ELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQEAK 358
           E++++ L ++ +++++LN+     E+  +     ++S+   S++ET   VEK+ +YK+    I   E+L++   D+++  L + EL+E +    + E EL+VLL+PKDPNDDKN+I+E+R AAGGDE+S+F  DL++ Y RYA+  GWKV++++  E+   G+  I+ MI G+ VYSK+KFE+G HRVQRVP TES GRVHTST TV V+PE E+V++ I+  D+++D YR+SGAGGQH+NKT SAVR+TH+PTGI VA Q+ +SQ +NR  AM++L++++++  +++ +      RK  +GTG+R+E+IRTYNYPQNRVTDHRI LTLNKLD +M G+L EII++LI  D+  K+++ +
  S:     2 EEIFDKLQAVADRYDELNELISDPEVIADSQRFMKLSKEEGSLRET---VEKYNQYKKVTQTISDDEELLRETNDDDLTALTKEELAEAREEQAQLEKELEVLLIPKDPNDDKNIIMEIRGAAGGDEASLFAADLYNMYLRYAEKQGWKVEVVDRNETEVGGFKEIALMITGDKVYSKLKFENGAHRVQRVPVTESAGRVHTSTATVGVMPEAEDVDVDIDPKDIRVDVYRSSGAGGQHVNKTSSAVRMTHLPTGIVVAMQDERSQQQNRAKAMRILKSRVYDYYQQQEQSAYDQKRKDAIGTGDRSERIRTYNYPQNRVTDHRIGLTLNKLDKIMAGDLDEIIEALIVADQTQKLEQLR 358
>gi|184154903|ref|YP_001843243.1| peptide chain release factor 1 [Lactobacillus fermentum IFO 3956] >gi|183226247|dbj|BAG26763.1| peptide chain release factor 1 [Lactobacillus fermentum IFO 3956] (360 aa)
Score = 824, Expect = 3.4e-86, Identities = 172/354 (48%), Positives = 264/354 (74%)
  Q:     5 EKLYNSLLSMEEKFNDLNK-----ELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQEAK 358
           E++++ L ++ +++++LN+     E+  +     ++S+   S++ET   VEK+ EYK     I    ++++ E D +++E+ + EL+E K    + + EL+VLL+PKDPNDDKN+I+E+R AAGGDE+S+F  DL++ Y RYA+  GW V++++  E+   G+  I+ +I G+ VYSK+KFE+G HRVQR+PATES GRVHTST TV V+PE E+V++ ++  D+++D YR+SGAGGQHINKT SAVR+TH+PTGI VA Q+ +SQ +NR  AM++L+A++++  +++ +      RK  +GTG+R+E+IRTYNYPQNRVTDHRI LTLNKLD +M G+L EII+SLI  D+A K+++ +
  S:     2 EEIFDKLQAVADRYDELNELISDPEVIADSQRFMKLSKEEGSLRET---VEKYNEYKEVTQTIKDDTEMLREESDPDLVEMTKEELNEAKERQAQLQDELEVLLIPKDPNDDKNIIMEIRGAAGGDEASLFAADLYNMYVRYAEKQGWNVEVVDRNETEVGGFKEIALIITGDQVYSKLKFENGAHRVQRIPATESAGRVHTSTATVGVMPEAEDVDVDLDPKDIRVDVYRSSGAGGQHINKTSSAVRMTHLPTGIVVAMQDERSQQQNRAKAMQILKARVYDYYQQQEQSEYDAQRKNAIGTGDRSERIRTYNYPQNRVTDHRIGLTLNKLDKIMAGDLEEIIESLIIADQAQKLEQLR 358
>gi|46581318|ref|YP_012126.1| peptide chain release factor 1 [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] >gi|120601501|ref|YP_965901.1| peptide chain release factor 1 [Desulfovibrio vulgaris subsp. vulgaris DP4] >gi|166223554|sp|A1VAK8|RF1_DESVV Peptide chain release factor 1 (RF-1) >gi|61214640|sp|Q727E1|RF1_DESVH Peptide chain release factor 1 (RF-1) >gi|46450740|gb|AAS97386.1| peptide chain release factor 1 [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] >gi|120561730|gb|ABM27474.1| bacterial peptide chain release factor 1 (bRF-1) [Desulfovibrio vulgaris subsp. vulgaris DP4] (357 aa)
Score = 824, Expect = 3.9e-86, Identities = 171/349 (48%), Positives = 251/349 (71%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQES-SHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISH--DEAVKMQ 355
           ++  L ++E KF DL ++L +  +     R  ++ K+  +   +V+ F+ YK    ++   ++L+  + D+EI  +A  E+   +  +   E ELK+LLLP+DP DDKN+++E+R   GG+E+S+F  DLF  Y RYA+ +GWKV++L   +S + GY  I  +I G+ VYS++K+ESG HRVQRVPATE++GR+HTS  TVAV+PE EEV++ I   DL+ID YRASGAGGQH+NKTESAVRITH+PTGI VACQ+ KSQ +N+  AMK+L +++ + ++E     I+D R+  VG+G+R+E+IRTYNYPQ+R+TDHRINLTL  LD VM G L+ ++D+L++H   EA+K Q
  S:     1 MFAKLENLELKFEDLEQQLSSAEVFNDQDRYRKLTKAHADLKQVVDAFRRYKEMKQNLADNKELL-GDSDHEIRAMAHEEIKAIEAALPDIEQELKILLLPRDPMDDKNILLEIRAGTGGEEASLFAADLFRMYTRYAEIMGWKVEVLSASDSDTGGYKEIIALIAGDKVYSRLKYESGTHRVQRVPATEAQGRIHTSAATVAVMPEAEEVDVDIRPDDLRIDVYRASGAGGQHVNKTESAVRITHLPTGIVVACQDEKSQHKNKAKAMKVLISRVLQAEQERAHSVIADARRALVGSGDRSERIRTYNYPQSRITDHRINLTLYSLDKVMEGELAPLVDALVTHAQTEALKAQ 353
>gi|148543687|ref|YP_001271057.1| peptide chain release factor 1 [Lactobacillus reuteri F275] >gi|148530721|gb|ABQ82720.1| bacterial peptide chain release factor 1 (bRF-1) [Lactobacillus reuteri F275] (362 aa)
Score = 823, Expect = 5.2e-86, Identities = 171/354 (48%), Positives = 263/354 (74%)
  Q:     5 EKLYNSLLSMEEKFNDLNK-----ELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQEAK 358
           E++++ L ++ +++++LN+     E+  +     ++S+   S++ET   VEK+ +YK+    I   E+L++   D+++  L + EL+E +    + E EL+VLL+PKDPNDDKN+I+E+R AAGGDE+S+F  DL++ Y RYA+  GWKV++++  E+   G+  I+ MI G+ VYSK+KFE+G HRVQRVP TES GRVHTST TV V+PE E+V++ I+  D+++D YR+SGAGGQH+NKT SAVR+TH+PTGI VA Q+ +SQ +NR  AM++L++++++  +++ +      RK  +GTG+R+E+IRTYNYPQNRVTDHRI LTLNKLD +M G+L EII++LI  D+  K+++ +
  S:     4 EEIFDKLQAVADRYDELNELISDPEVIADSQRFMKLSKEEGSLRET---VEKYNQYKKVTQTISDDEELLRETNDDDLTALTKEELAEAREEQAQLEKELEVLLIPKDPNDDKNIIMEIRGAAGGDEASLFAADLYNMYLRYAEKQGWKVEVVDRNETEVGGFKEIALMITGDKVYSKLKFENGAHRVQRVPVTESAGRVHTSTATVGVMPEAEDVDVDIDPKDIRVDVYRSSGAGGQHVNKTSSAVRMTHLPTGIVVAMQDERSQQQNRAKAMRILKSRVYDYYQQQEQSAYDQKRKDAIGTGDRSERIRTYNYPQNRVTDHRIGLTLNKLDKIMAGDLDEIIEALIVADQTQKLEQLR 360
>gi|16804581|ref|NP_466066.1| peptide chain release factor 1 [Listeria monocytogenes EGD-e] >gi|167213179|ref|ZP_02283486.1| peptide chain release factor 1 [Listeria monocytogenes LO28] >gi|20139329|sp|Q8Y4A8|RF1_LISMO Peptide chain release factor 1 (RF-1) >gi|16412031|emb|CAD00621.1| prf1 [Listeria monocytogenes] (358 aa)
Score = 822, Expect = 5.7e-86, Identities = 173/349 (49%), Positives = 256/349 (73%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQ 355
           +Y+ L ++E+++++LN+ L    +    KR+ +++K     T  VE ++EYK     I+  ++L+  + D+E+ E+A+ E +E +      E  LK+LL+PKDPNDDKNVI+E+R AAGGDE+++F GDLF  Y +YA+S GWKV++++   +   GY  I  M+NG + +S+MK+E+G HRVQRVP TES GR+HTST TVA+LPE EEVE+ +++ D++ DT+ ++GAGGQ +N T SAVR+THIPTGI V+ Q+ +SQ++N++ AMK+LRA++++K E E R+     RK  VGTG+R+E+IRTYNYPQNRVTDHRI LT+ KLD +M G L EIID+LI  D+  K++
  S:     1 MYDRLQAVEDRYDELNELLSDPDVVSDPKRLRDLSKEQSGITATVETYREYKNVNEQINETKELLGEKLDDEMREMAKEEFAELQKEKTDLEERLKLLLVPKDPNDDKNVILEIRGAAGGDEAALFAGDLFRMYSKYAESRGWKVEIMDANPTGIGGYKEIIAMMNGNDAFSRMKYENGAHRVQRVPETESGGRIHTSTATVAILPEAEEVEIELHDKDIRTDTFASTGAGGQSVNTTMSAVRLTHIPTGIVVSMQDERSQLKNKDKAMKVLRARVYDKFEREAREEYDANRKSAVGTGDRSERIRTYNYPQNRVTDHRIGLTIQKLDQIMEGKLDEIIDALILEDQTSKLE 352
>gi|46908715|ref|YP_015104.1| peptide chain release factor 1 [Listeria monocytogenes str. 4b F2365] >gi|47093870|ref|ZP_00231612.1| peptide chain release factor 1 [Listeria monocytogenes str. 4b H7858] >gi|153168646|ref|ZP_01928469.1| peptide chain release factor 1 [Listeria monocytogenes FSL N1-017] >gi|153175796|ref|ZP_01931100.1| peptide chain release factor 1 [Listeria monocytogenes FSL N3-165] >gi|153180631|ref|ZP_01933674.1| peptide chain release factor 1 [Listeria monocytogenes F6900] >gi|153184880|ref|ZP_01935528.1| peptide chain release factor 1 [Listeria monocytogenes J0161] >gi|153192199|ref|ZP_01939244.1| peptide chain release factor 1 [Listeria monocytogenes J2818] >gi|153197151|ref|ZP_01941421.1| peptide chain release factor 1 [Listeria monocytogenes 10403S] >gi|167015629|ref|ZP_02278162.1| peptide chain release factor 1 [Listeria monocytogenes FSL J1-194] >gi|167218331|ref|ZP_02287967.1| peptide chain release factor 1 [Listeria monocytogenes FSL J1-175] >gi|167405369|ref|ZP_02310126.1| peptide chain release factor 1 [Listeria monocytogenes FSL J2-003] >gi|167455009|ref|ZP_02321232.1| peptide chain release factor 1 [Listeria monocytogenes FSL J2-064] >gi|61214637|sp|Q71WN5|RF1_LISMF Peptide chain release factor 1 (RF-1) >gi|46881987|gb|AAT05281.1| peptide chain release factor 1 [Listeria monocytogenes str. 4b F2365] >gi|47017744|gb|EAL08535.1| peptide chain release factor 1 [Listeria monocytogenes str. 4b H7858] >gi|126942392|gb|EBA20131.1| peptide chain release factor 1 [Listeria monocytogenes J0161] >gi|127633202|gb|EBA22619.1| peptide chain release factor 1 [Listeria monocytogenes 10403S] >gi|127764527|gb|EBA25059.1| peptide chain release factor 1 [Listeria monocytogenes J2818] >gi|133726209|gb|EBA27907.1| peptide chain release factor 1 [Listeria monocytogenes FSL N1-017] >gi|133729221|gb|EBA30919.1| peptide chain release factor 1 [Listeria monocytogenes FSL N3-165] >gi|133732024|gb|EBA33722.1| peptide chain release factor 1 [Listeria monocytogenes F6900] (358 aa)
Score = 822, Expect = 5.8e-86, Identities = 173/349 (49%), Positives = 256/349 (73%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQ 355
           +Y+ L ++E+++++LN+ L    +    KR+ +++K     T  VE ++EYK     I+  ++L+  + D+E+ E+A+ E +E +      E  LK+LL+PKDPNDDKNVI+E+R AAGGDE+++F GDLF  Y +YA+S GWKV++++   +   GY  I  M+NG + +S+MK+E+G HRVQRVP TES GR+HTST TVA+LPE EEVE+ +++ D++ DT+ ++GAGGQ +N T SAVR+THIPTGI V+ Q+ +SQ++N++ AMK+LRA++++K E E R+     RK  VGTG+R+E+IRTYNYPQNRVTDHRI LT+ KLD +M G L EIID+LI  D+  K++
  S:     1 MYDRLQAVEDRYDELNELLSDPDVVSDPKRLRDLSKEQSGITATVETYREYKNVNEQINETKELLGEKLDDEMREMAKEEFAELQKEKADLEERLKLLLVPKDPNDDKNVILEIRGAAGGDEAALFAGDLFRMYSKYAESRGWKVEIMDANPTGIGGYKEIIAMMNGNDAFSRMKYENGAHRVQRVPETESGGRIHTSTATVAILPEAEEVEIELHDKDIRTDTFASTGAGGQSVNTTMSAVRLTHIPTGIVVSMQDERSQLKNKDKAMKVLRARVYDKFEREAREEYDANRKSAVGTGDRSERIRTYNYPQNRVTDHRIGLTIQKLDQIMEGKLDEIIDALILEDQTSKLE 352
>gi|166032746|ref|ZP_02235575.1| hypothetical protein DORFOR_02461 [Dorea formicigenerans ATCC 27755] >gi|166027103|gb|EDR45860.1| hypothetical protein DORFOR_02461 [Dorea formicigenerans ATCC 27755] (376 aa)
Score = 822, Expect = 6.7e-86, Identities = 177/350 (50%), Positives = 252/350 (72%)
  Q:     5 EKLYNSLLSMEEKFNDLNKELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           +KL + L+ +EE  ++L +          R  ++ K   E TPIVE +KEYK    +I+ + +L+  E D ++ ELA+ EL+E K  +E+ E+ELK+LLLPKDPNDDKNV+VE+R  AGGDE+++F  +++  Y  YA+S  WKV+++E +E    G   ++FMI+G+  YS MK+ESGVHRVQRVP TES GR+HTSTITVAV+PE E+V++ I+  D++ID  RASG GGQ +N T+SAVR+TH PTGI +  Q  KSQ++N+E A  +LRAKL++ + ++     ++ RK Q+GTG+R+EKIRTYN+PQ RVTDHRI LTL KLD +M G++ EIID+ I+ D+A K+
  S:    23 DKLEDLLIRLEEILSELQEP--DVASDPNRFRKLMKEQSELTPIVEAYKEYKACKQNIEESLELLNEESDEDMRELAKEELNESKARVEELEHELKILLLPKDPNDDKNVVVEIRAGAGGDEAALFAAEIYRMYLHYAESKRWKVELVECEEIGIGGMKNVTFMIDGQGAYSMMKYESGVHRVQRVPETESGGRIHTSTITVAVMPEAEDVDVHIDEKDIRIDVMRASGNGGQCVNTTDSAVRLTHYPTGIVIYSQTEKSQLQNKEKAFALLRAKLYDLECQKQHDAEAEARKSQIGTGDRSEKIRTYNFPQGRVTDHRIGLTLYKLDKIMNGDIQEIIDACIAADQAKKL 371
>gi|194468250|ref|ZP_03074236.1| peptide chain release factor 1 [Lactobacillus reuteri 100-23] >gi|194453103|gb|EDX42001.1| peptide chain release factor 1 [Lactobacillus reuteri 100-23] (362 aa)
Score = 822, Expect = 6.9e-86, Identities = 171/354 (48%), Positives = 262/354 (74%)
  Q:     5 EKLYNSLLSMEEKFNDLNK-----ELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQEAK 358
           E++++ L ++ +++++LN+     E+  +     + S+   S++ET   VEK+ +YK+    I   E+L++   D+++  L + EL+E +    + E EL+VLL+PKDPNDDKN+I+E+R AAGGDE+S+F  DL++ Y RYA+  GWKV++++  E+   G+  I+ MI G+ VYSK+KFE+G HRVQRVP TES GRVHTST TV V+PE E+V++ I+  D+++D YR+SGAGGQH+NKT SAVR+TH+PTGI VA Q+ +SQ +NR  AM++L++++++  +++ +      RK  +GTG+R+E+IRTYNYPQNRVTDHRI LTLNKLD +M G+L EII++LI  D+  K+++ +
  S:     4 EEIFDKLQAVADRYDELNELISDPEVIADSQRFMKFSKEEGSLRET---VEKYNQYKKVTQTISDDEELLRETNDDDLTALTKEELAEAREEQAQLEKELEVLLIPKDPNDDKNIIMEIRGAAGGDEASLFAADLYNMYLRYAEKQGWKVEVVDRNETEVGGFKEIALMITGDKVYSKLKFENGAHRVQRVPVTESAGRVHTSTATVGVMPEAEDVDVDIDPKDIRVDVYRSSGAGGQHVNKTSSAVRMTHLPTGIVVAMQDERSQQQNRAKAMRILKSRVYDYYQQQEQSAYDQKRKDAIGTGDRSERIRTYNYPQNRVTDHRIGLTLNKLDKIMAGDLDEIIEALIVADQTQKLEQLR 360
>gi|89897680|ref|YP_521167.1| peptide chain release factor 1 [Desulfitobacterium hafniense Y51] >gi|89337128|dbj|BAE86723.1| hypothetical protein [Desulfitobacterium hafniense Y51] (360 aa)
Score = 821, Expect = 8.7e-86, Identities = 171/351 (48%), Positives = 256/351 (72%)
  Q:     5 EKLYNSLLSMEEKFNDLNKELETEGLSVKRMSEINKSIKET---TPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQ 355
           E +   L+ +E ++++L  +L ++   +   SE  K  K     T IVE F+EY   +  ++  + L++ + D E  E+A+LEL E     ++ E ++++LLLPKDPNDDKNVI+E+R  AGG+E+++F GDL+  Y +YA+  GW+ ++L    +   G+  I F+I G+  YSK+KFESGVHRVQRVP TES GR+HTST TVAVLPE EEV++ IN +DL+ID + +SG GGQ +N T+SAVRITH+PTG  V+CQ+ KSQ++N+E A+++LRA+L E+ +EE    ++  R+ QVGTG+R+E+IRTYN+PQ RVTDHRI LTL++LD+++LG L E+I++LI+ D+A +++
  S:     4 ELMQRKLIEIERRYDELT-QLLSDPEVIGNQSEWQKYAKAQAGMTDIVEAFREYSEVVKHLEETQGLLEEKLDPEFKEMAELELEELTEKRDELEEKMRILLLPKDPNDDKNVIMEIRAGAGGEEAALFAGDLYRMYTKYAEQQGWRTELLSASYTDIGGFKEIIFLIEGQGAYSKLKFESGVHRVQRVPTTESGGRIHTSTTTVAVLPEAEEVDVAINPNDLRIDIFCSSGPGGQSVNTTQSAVRITHVPTGTVVSCQDEKSQLKNKEKALRVLRARLLERAQEEAMGELASERRSQVGTGDRSERIRTYNFPQGRVTDHRIGLTLHRLDSILLGELDEVINALITTDQAERLK 357
>gi|167759398|ref|ZP_02431525.1| hypothetical protein CLOSCI_01745 [Clostridium scindens ATCC 35704] >gi|167662955|gb|EDS07085.1| hypothetical protein CLOSCI_01745 [Clostridium scindens ATCC 35704] (356 aa)
Score = 821, Expect = 9.1e-86, Identities = 178/350 (50%), Positives = 252/350 (72%)
  Q:     5 EKLYNSLLSMEEKFNDLNKELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           +KL + L+ +EE  ++L +          R  ++ K   E TPIVE +KEYK     I+ + ++++ E D E+ ELA+ EL++ K  +E+ E+ELK+LLLPKDPNDDKNVIVE+R  AGGDE+++F  +++  Y  YA+S  WKV+++E +E    G   ++FMING+  YS MK+ESGVHRVQRVP TES GR+HTSTITVAV+PE E+V++ I+  D++ID  RASG GGQ +N T+SAVR+TH PTGI +  Q  KSQ++N+E A  +LRAKL++ + ++     ++ RK Q+GTG+R+EKIRTYN+PQ RVTDHRI LTL KLD +M G++ EIID+ I+ D+A K+
  S:     3 DKLEDLLIRLEEVLSELQEP--NVANDQNRFRKLMKEQNELTPIVEAYKEYKACKQAIEDSLQMLEEESDEEMRELAKEELNDSKARVEELEHELKILLLPKDPNDDKNVIVEIRAGAGGDEAALFAAEIYRMYLHYAESRRWKVELVECEEIGIGGMKNVTFMINGKGAYSVMKYESGVHRVQRVPETESGGRIHTSTITVAVMPEAEDVDIQIDEKDIRIDVMRASGNGGQCVNTTDSAVRLTHYPTGIVIYSQTEKSQLQNKEKAFALLRAKLYDMECQKRHDAEAEARKSQIGTGDRSEKIRTYNFPQGRVTDHRIGLTLYKLDKIMNGDIQEIIDACIAADQAAKL 351
>gi|160878572|ref|YP_001557540.1| peptide chain release factor 1 [Clostridium phytofermentans ISDg] >gi|189039966|sp|A9KHD4|RF1_CLOPH Peptide chain release factor 1 (RF-1) >gi|160427238|gb|ABX40801.1| peptide chain release factor 1 [Clostridium phytofermentans ISDg] (358 aa)
Score = 818, Expect = 2.0e-85, Identities = 174/350 (49%), Positives = 256/350 (73%)
  Q:     5 EKLYNSLLSMEEKFNDLNKELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           +KL + L+  +E  N+LN+   T   +  R  ++ K   +   IV+K+ EYK+T  +I+ + +L+  E D E+ ELA+ ELS  K  +   E +LK+LLLPKDPND KNVIVE+R  AGGDE+++F  +LF  Y +YA+++ WK+ M+ + E+   G+  + FMING+  YSK+K+ESGVHRVQR+P TES GR+HTST+TVA++PE EEV++ +N +D + D +R+SG GGQ +N T+SAVR+TH+PTGI ++CQ+ KSQ++NR+ A+K+LRA+L+E + E+     +  RK QVGTG+R+EKIRTYN+PQ R TDHRI LT ++LD++M G+L E+IDSL + D+A K+
  S:     3 DKLEDLLIRFQEIQNELNEPTVTNDQA--RFRKLMKEQNDLGEIVDKYLEYKQTKKNIEESLELLDEESDEEMRELAKEELSTSKANLVVIEEQLKILLLPKDPNDSKNVIVEIRGGAGGDEAALFAAELFRMYSKYAETMRWKIDMMNLNENGIGGFKEVIFMINGQGAYSKLKYESGVHRVQRIPVTESGGRIHTSTVTVAIMPEAEEVDVELNMNDCRFDVFRSSGNGGQCVNTTDSAVRLTHMPTGIVISCQDEKSQLKNRDKALKVLRARLYELELEKAHDAEAAARKSQVGTGDRSEKIRTYNFPQGRCTDHRIKLTSHRLDDIMNGDLQEVIDSLTAADQAAKL 351
>gi|126653461|ref|ZP_01725557.1| peptide chain release factor 1 [Bacillus sp. B14905] >gi|126589817|gb|EAZ83950.1| peptide chain release factor 1 [Bacillus sp. B14905] (358 aa)
Score = 817, Expect = 2.2e-85, Identities = 171/349 (48%), Positives = 252/349 (72%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQ 355
           +++ L ++E+++  L + L    +    K++ E +K   +    V+ ++EYK     +    +++ SEKD ++ E+ + E +  K   E+ E  L++LL+PKDPND+KNVI+E+R AAGGDE++IF GDLF  Y RYA++ GWK+ ++E   +  G Y  + FMING+  YSK KFE+G HRVQRVPATES+GR+HTST TVA LPE+EEV++ I+  D+++DT+ +SGAGGQ +N T SAVR+TH+PTG+ V+ Q+ +SQI+NRE AMK+LRA++ +   +E +K I   RK  VG+G+R+E+IRTYNYPQNRVTDHRI LT+ KLD ++ G L EIID+LI  ++A K++
  S:     1 MFDRLQAVEDRYERLTELLSDPDIVNDSKKLREYSKEQSDIQETVDSYREYKNVKEQLVDTREMLDSEKDPDMHEMVKEEFNLLKAQQEELEERLRILLIPKDPNDNKNVIMEIRGAAGGDEANIFAGDLFRMYSRYAETQGWKIDIMEATPNPMGGYKEVIFMINGQGAYSKFKFENGAHRVQRVPATESQGRIHTSTATVACLPEVEEVDVEIHEKDIRVDTFASSGAGGQSVNTTMSAVRMTHLPTGVVVSMQDERSQIKNREKAMKILRARVADMYMQEAQKEIDATRKSAVGSGDRSERIRTYNYPQNRVTDHRIGLTIQKLDQIVEGRLDEIIDTLILEEQASKLE 352
>gi|169826579|ref|YP_001696737.1| peptide chain release factor 1 [Lysinibacillus sphaericus C3-41] >gi|168991067|gb|ACA38607.1| Peptide chain release factor 1 (RF-1) [Lysinibacillus sphaericus C3-41] (358 aa)
Score = 817, Expect = 2.4e-85, Identities = 171/349 (48%), Positives = 252/349 (72%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQ 355
           +++ L ++E+++  L + L    +    K++ E +K   +    V+ ++EYK     +    +++ SEKD ++ E+ + E +  K   E+ E  L++LL+PKDPND+KNVI+E+R AAGGDE++IF GDLF  Y RYA++ GWK+ ++E   +  G Y  + FMING+  YSK KFE+G HRVQRVPATES+GR+HTST TVA LPE+EEV++ I+  D+++DT+ +SGAGGQ +N T SAVR+TH+PTG+ V+ Q+ +SQI+NRE AMK+LRA++ +   +E +K I   RK  VG+G+R+E+IRTYNYPQNRVTDHRI LT+ KLD ++ G L EIID+LI  ++A K++
  S:     1 MFDRLQAVEDRYERLTELLSDPDIVNDSKKLREYSKEQSDIQETVDTYREYKNVKEQLVDTREMLDSEKDPDMHEMVKEEFNLLKAQQEELEERLRILLIPKDPNDNKNVIMEIRGAAGGDEANIFAGDLFRMYSRYAETQGWKIDIMEATPNPMGGYKEVIFMINGQGAYSKFKFENGAHRVQRVPATESQGRIHTSTATVACLPEVEEVDVEIHEKDIRVDTFASSGAGGQSVNTTMSAVRMTHLPTGVVVSMQDERSQIKNREKAMKILRARVADMYMQEAQKEIDATRKSAVGSGDRSERIRTYNYPQNRVTDHRIGLTIQKLDQIVEGRLDEIIDTLILEEQASKLE 352
>gi|154502573|ref|ZP_02039633.1| hypothetical protein RUMGNA_00386 [Ruminococcus gnavus ATCC 29149] >gi|153796765|gb|EDN79185.1| hypothetical protein RUMGNA_00386 [Ruminococcus gnavus ATCC 29149] (356 aa)
Score = 817, Expect = 2.7e-85, Identities = 172/348 (49%), Positives = 256/348 (73%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGLS--VKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           +++ L  +  ++ ++  EL+  G++   +R  ++ K   +  PIVE + EYK+   +I+ +  +++ E D E+ ELA+ EL+E K  +E+ E ELK+LLLPKDPNDDKNVIVE+R  AGGDE+++F  +++  Y  YA+S  W+ +M+ + E+   G+    FMI G+  YS+MK+ESGVHRVQRVP TES GR+HTSTITVAV+PE E+V++VI+  D++ID  RASG GGQ +N T+SAVR+TH PTGI +  Q  KSQ++N+E A ++LR+KL+E + E+ +   ++ R+ Q+GTG+R+EKIRTYN+PQ RVTDHRI LTL+KLD ++ G+L E+IDSLI+ D++ K+
  S:     1 MFDKLEDLLIRYEEVMGELQEPGVANDPERFRKLMKEQSDLAPIVEAYNEYKQCKQNIEDSLMMLEEESDEEMRELAKEELNESKARVEELEQELKILLLPKDPNDDKNVIVEIRAGAGGDEAALFAAEVYRMYLHYAESRRWRTEMISLNENGIGGFKECVFMITGQGAYSRMKYESGVHRVQRVPETESGGRIHTSTITVAVMPEAEDVDVVIDEKDIRIDVMRASGNGGQCVNTTDSAVRLTHYPTGIVIYSQTEKSQLQNKEKAFRLLRSKLYELELEKQQSAEAEARRSQIGTGDRSEKIRTYNFPQGRVTDHRIKLTLHKLDTILNGDLDEVIDSLIAADQSAKL 351
>gi|109648005|ref|ZP_01371908.1| peptide chain release factor 1 [Desulfitobacterium hafniense DCB-2] >gi|109641095|gb|EAT50650.1| peptide chain release factor 1 [Desulfitobacterium hafniense DCB-2] (355 aa)
Score = 817, Expect = 2.8e-85, Identities = 170/345 (49%), Positives = 254/345 (73%)
  Q:    11 LLSMEEKFNDLNKELETEGLSVKRMSEINKSIKET---TPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQ 355
           L+ +E ++++L  +L ++   +   SE  K  K     T IVE F+EY   +  ++  + L++ + D E  E+A+LEL E     ++ E ++++LLLPKDPNDDKNVI+E+R  AGG+E+++F GDL+  Y +YA+  GW+ ++L    +   G+  I F+I G+  YSK+KFESGVHRVQRVP TES GR+HTST TVAVLPE EEV++ IN +DL+ID + +SG GGQ +N T+SAVRITH+PTG  V+CQ+ KSQ++N+E A+++LRA+L E+ +EE    ++  R+ QVGTG+R+E+IRTYN+PQ RVTDHRI LTL++LD+++LG L E+I++LI+ D+A +++
  S:     5 LIEIERRYDELT-QLLSDPEVIGNQSEWQKYAKAQAGMTDIVEAFREYSEVVKHLEETQGLLEEKLDPEFKEMAELELEELTEKRDELEEKMRILLLPKDPNDDKNVIMEIRAGAGGEEAALFAGDLYRMYTKYAEHQGWRTELLSASYTDIGGFKEIIFLIEGQGAYSKLKFESGVHRVQRVPTTESGGRIHTSTTTVAVLPEAEEVDVAINPNDLRIDIFCSSGPGGQSVNTTQSAVRITHVPTGTVVSCQDEKSQLKNKEKALRVLRARLLERAQEEAMGELASERRSQVGTGDRSERIRTYNFPQGRVTDHRIGLTLHRLDSILLGELDEVINALITTDQAERLK 352
>gi|119361535|sp|Q24ML9|RF1_DESHY Peptide chain release factor 1 (RF-1) (355 aa)
Score = 815, Expect = 3.8e-85, Identities = 170/345 (49%), Positives = 254/345 (73%)
  Q:    11 LLSMEEKFNDLNKELETEGLSVKRMSEINKSIKET---TPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQ 355
           L+ +E ++++L  +L ++   +   SE  K  K     T IVE F+EY   +  ++  + L++ + D E  E+A+LEL E     ++ E ++++LLLPKDPNDDKNVI+E+R  AGG+E+++F GDL+  Y +YA+  GW+ ++L    +   G+  I F+I G+  YSK+KFESGVHRVQRVP TES GR+HTST TVAVLPE EEV++ IN +DL+ID + +SG GGQ +N T+SAVRITH+PTG  V+CQ+ KSQ++N+E A+++LRA+L E+ +EE    ++  R+ QVGTG+R+E+IRTYN+PQ RVTDHRI LTL++LD+++LG L E+I++LI+ D+A +++
  S:     5 LIEIERRYDELT-QLLSDPEVIGNQSEWQKYAKAQAGMTDIVEAFREYSEVVKHLEETQGLLEEKLDPEFKEMAELELEELTEKRDELEEKMRILLLPKDPNDDKNVIMEIRAGAGGEEAALFAGDLYRMYTKYAEQQGWRTELLSASYTDIGGFKEIIFLIEGQGAYSKLKFESGVHRVQRVPTTESGGRIHTSTTTVAVLPEAEEVDVAINPNDLRIDIFCSSGPGGQSVNTTQSAVRITHVPTGTVVSCQDEKSQLKNKEKALRVLRARLLERAQEEAMGELASERRSQVGTGDRSERIRTYNFPQGRVTDHRIGLTLHRLDSILLGELDEVINALITTDQAERLK 352
>gi|194016506|ref|ZP_03055120.1| peptide chain release factor 1 [Bacillus pumilus ATCC 7061] >gi|194011979|gb|EDW21547.1| peptide chain release factor 1 [Bacillus pumilus ATCC 7061] (355 aa)
Score = 815, Expect = 4.6e-85, Identities = 173/352 (49%), Positives = 256/352 (72%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQES-SHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQEAK 358
           + + L S+EE++  LN+ L    +    K++ E +K   +    VE +++Y+   + +  A+ +++ + D E+ ++ + E+SE     E+ E ELK+LL+PKDPND+KNVIVE+R AAGG+E+++F G+L+  Y RYA+  GWK +++E   + + GY  I FMI+G+  YS++KFE+G HRVQRVP TES GR+HTST TVAVLPE EEVE+ I+  D+++DT+ +SG GGQ +N T SAVR+TH+PTG+ V+CQ+ KSQI+N+E AMK+LRA++++K + E +      RK  VGTG+R+E+IRTYN+PQNRVTDHRI LT+ KLD ++ G L E+ID+LI  D+A K+Q AK
  S:     1 MLDRLKSIEERYEKLNEYLSDPEVVNDPKKLREYSKEQSDIQETVEVYRQYRAAYDQLSEAKAMLEEKLDAEMRDMVKEEISELTEETERLEDELKILLIPKDPNDNKNVIVEVRGAAGGEEAALFAGNLYRMYSRYAEMQGWKTEVMEANVTGTGGYKEIIFMISGKGAYSRLKFENGAHRVQRVPETESGGRIHTSTATVAVLPEAEEVEIDIHEKDIRVDTFTSSGPGGQSVNTTMSAVRLTHLPTGVVVSCQDEKSQIKNKEKAMKVLRARIYDKFQREAQAEYDQTRKSAVGTGDRSERIRTYNFPQNRVTDHRIGLTIQKLDQILEGKLDEVIDALIMEDQARKLQNAK 355
>gi|157694096|ref|YP_001488558.1| peptide chain release factor 1 [Bacillus pumilus SAFR-032] >gi|166977360|sp|A8FID1|RF1_BACP2 Peptide chain release factor 1 (RF-1) >gi|157682854|gb|ABV63998.1| peptide chain release factor RF1 [Bacillus pumilus SAFR-032] (355 aa)
Score = 815, Expect = 4.6e-85, Identities = 173/352 (49%), Positives = 255/352 (72%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQES-SHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQEAK 358
           + + L S+EE++  LN+ L    +     ++ E +K   +    VE +++Y+   + +  A+ +++ + D E+ ++ + E+SE     E+ E ELK+LL+PKDPND+KNVIVE+R AAGG+E+++F G+L+  Y RYA+  GWK +++E   + + GY  I FMI+G+  YSK+KFE+G HRVQRVP TES GR+HTST TVAVLPE EEVE+ I+  D+++DT+ +SG GGQ +N T SAVR+TH+PTG+ V+CQ+ KSQI+N+E AMK+LRA++++K + E +      RK  VGTG+R+E+IRTYN+PQNRVTDHRI LT+ KLD ++ G L E+ID+LI  D+A K+Q AK
  S:     1 MLDRLKSIEERYEKLNEYLSDPEVVNDPTKLREYSKEQSDIQETVEVYRQYRAAYDQLSEAKAMLEDKLDAEMRDMVKEEISELTEETERLEDELKILLIPKDPNDNKNVIVEVRGAAGGEEAALFAGNLYRMYSRYAEMQGWKTEVMEASVTGTGGYKEIIFMISGKGAYSKLKFENGAHRVQRVPETESGGRIHTSTATVAVLPEAEEVEIDIHEKDIRVDTFTSSGPGGQSVNTTMSAVRLTHLPTGVVVSCQDEKSQIKNKEKAMKVLRARIYDKFQREAQAEYDQTRKSAVGTGDRSERIRTYNFPQNRVTDHRIGLTIQKLDQILEGKLDEVIDALIMEDQARKLQNAK 355
>gi|163727085|ref|ZP_02134584.1| peptide chain release factor 1 [Desulfatibacillum alkenivorans AK-01] >gi|161399632|gb|EDQ23901.1| peptide chain release factor 1 [Desulfatibacillum alkenivorans AK-01] (355 aa)
Score = 815, Expect = 4.8e-85, Identities = 166/314 (52%), Positives = 230/314 (73%)
  Q:    44 ETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKML-EVQESSHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQEA 357
           + + +VE ++EYK+ L  ++ +++L+K + D +I +LA+ E+        + E ELK+LLLPKDPNDDKNVI+E+R   GGDE+ +F  DLF  Y RYA++ GWKV+ L E      G   I+ MI G+ VYS  KFESG HRVQRVP TE++GR+HTS  TVAVLPE EEV++ I+ S++++D YR+ GAGGQH+N T+SAVR+TH+PTG+ V CQ+ KSQ +N+  AMK+LRA+L +   +E   +IS  RK QVG+G+R+E+IRTYNYPQ RVTDHRI LTL KL+++M G +SEI+D+L +H  A  +QE 
  S:    40 DLSKVVEAYREYKQVLEGLEESKELLK-DPDPDIKDLAKEEIDRLDKEQVRLEDELKILLLPKDPNDDKNVILEIRAGTGGDEAGLFAADLFRMYSRYAETRGWKVETLSEHLTGVGGIKEIAAMITGQGVYSAFKFESGTHRVQRVPVTEAQGRIHTSACTVAVLPEAEEVDIQIDPSEIRVDVYRSQGAGGQHVNTTDSAVRLTHLPTGVVVTCQDEKSQHKNKAKAMKVLRARLLDHAVQEQNASISAERKSQVGSGDRSERIRTYNYPQGRVTDHRIGLTLYKLESIMAGQISEIVDALTTHYNAEALQEG 353
>gi|160916055|ref|ZP_02078262.1| hypothetical protein EUBDOL_02082 [Eubacterium dolichum DSM 3991] >gi|158431779|gb|EDP10068.1| hypothetical protein EUBDOL_02082 [Eubacterium dolichum DSM 3991] (357 aa)
Score = 814, Expect = 6.2e-85, Identities = 164/344 (47%), Positives = 250/344 (72%)
  Q:    11 LLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQE-SSHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           L  M  +++++N+ + +  +    K ++++ +   +   +VE + EYK ++  ++ A+ L+  E D EI E+A++E+ E +P IE Y  +L++LL+PKDPND  N IVE+R AAGGDE +IF GDL+  Y +YA+S GW+++++E+ +  + G+  +SFM+ G+ VY ++KFESG HRVQRVP TES+GR+HTST TV V PE+E  +  I+ +DL+I+T RASGAGGQHINKT+SAVRI H PTGI V CQ+G+SQ ENR TA+  +R++++E+ + +  +     R+ ++GTG+RAEKIRTYNYPQNRVTDHRI   +N+LD +M G + +++D+L S D+  K+
  S:     8 LEGMVNRYHEINEMMMSPEIVSDSKMLAKLGREQADLVQVVETYTEYKNSVQALEDAKALLM-EDDKEIKEMAKMEIEELEPKIEGYLGKLEILLIPKDPNDSHNAIVEIRGAAGGDEGNIFAGDLYRMYSKYAESQGWRIEIIEMDDCEAGGFSLVSFMVKGDGVYGRLKFESGSHRVQRVPKTESQGRIHTSTATVLVTPEIEAEDFDIDMNDLEIETMRASGAGGQHINKTDSAVRIVHKPTGIVVKCQDGRSQHENRATALMTIRSRVYEEHQRKLEEEQGVERRSKIGTGDRAEKIRTYNYPQNRVTDHRIGYNVNQLDRIMEGRMQDLLDALCSADQQAKL 353
>gi|95929013|ref|ZP_01311758.1| peptide chain release factor 1 [Desulfuromonas acetoxidans DSM 684] >gi|95134914|gb|EAT16568.1| peptide chain release factor 1 [Desulfuromonas acetoxidans DSM 684] (358 aa)
Score = 813, Expect = 6.6e-85, Identities = 167/321 (52%), Positives = 233/321 (72%)
  Q:    34 RMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           +  E+ +   E +  VE ++ Y++   +I+   +L++ + D ++ E+A+ EL   +   E    +L +L+LPKDPND KN+I+E+R   GGDE+++F GDLF AY RYA+   WKV+++   ES   G+  +  MI+GENVYS++K+ESG HRVQRVP TE++GR+HTS  TVAVLPE EEV+L IN SDL+ID YRASGAGGQH+NKTESAVRITHIPTG+ VACQ+ KSQ +N+  AMK+LR+++ +  E E    ++  RK QVG+G+R+E+IRTYN+PQ R TDHRI LTL KLD +M G+L E+ D+L +H +A  M
  S:    32 KFRELTREHAELSEPVEVYRRYRQIQQEIEDNRELMRDD-DPDMREMAREELPALEDECEHLAEKLTLLMLPKDPNDGKNIILEIRAGTGGDEAALFAGDLFRAYSRYAEKHRWKVEIMSSSESGVGGFKEVIAMISGENVYSRLKYESGTHRVQRVPETETQGRIHTSACTVAVLPEAEEVDLEINPSDLRIDLYRASGAGGQHVNKTESAVRITHIPTGVVVACQDEKSQHKNKARAMKVLRSRILDAMEAEKHAEMAADRKSQVGSGDRSERIRTYNFPQGRCTDHRIGLTLYKLDAIMQGDLDEVFDALTTHYQAELM 352
>gi|167629003|ref|YP_001679502.1| peptide chain release factor 1 [Heliobacterium modesticaldum Ice1] >gi|167591743|gb|ABZ83491.1| peptide chain release factor 1 [Heliobacterium modesticaldum Ice1] (354 aa)
Score = 813, Expect = 6.9e-85, Identities = 178/349 (51%), Positives = 250/349 (71%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQ 355
           + + L  +E+K+++L + L    +     R     K     T IV+ F+ YK  L  ID A  ++ +E D E+ E+A LEL E     E+ E  LKVLLLPKDPNDDKNVI+E+R   GG+E+++F GDL+  Y R+AD  GW+ ++L    +   G+  +  +I G+  +SK+KFESGVHRVQRVPATES GR+HTS  TVAVLPE EEVE+ +N ++L+ID + +SGAGGQH+NKTESAVRITH+PTGI V+CQ+ KSQ++NRE AM++LRA+L EK  EE    ++  RK  VG+G+R+E+IRTYN+PQ RVTDHRI LTL++L+ ++ G+L E++D+LI+ D+A K++
  S:     1 MIDKLEIIEQKYDELTQLLSDPEIIQDQTRWQRHAKQQAGMTEIVDTFRAYKGVLQGIDDARAML-AESDPELQEMASLELDELLARKEELEQRLKVLLLPKDPNDDKNVIIEIRAGTGGEEAALFAGDLYRMYSRFADRQGWRTELLSANYTDIGGFKEVIVLIEGQGAFSKLKFESGVHRVQRVPATESSGRIHTSAATVAVLPEAEEVEIEVNPNELRIDVFCSSGAGGQHVNKTESAVRITHLPTGIVVSCQDEKSQLKNREKAMRVLRARLLEKAREEQHGEMASARKSMVGSGDRSERIRTYNFPQGRVTDHRIGLTLHRLETILDGDLDELLDALITTDQAEKLK 351
>gi|18311184|ref|NP_563118.1| peptide chain release factor 1 [Clostridium perfringens str. 13] >gi|110799590|ref|YP_696880.1| peptide chain release factor 1 [Clostridium perfringens ATCC 13124] >gi|110802815|ref|YP_699476.1| peptide chain release factor 1 [Clostridium perfringens SM101] >gi|168205561|ref|ZP_02631566.1| peptide chain release factor 1 [Clostridium perfringens E str. JGS1987] >gi|168210131|ref|ZP_02635756.1| peptide chain release factor 1 [Clostridium perfringens B str. ATCC 3626] >gi|168213694|ref|ZP_02639319.1| peptide chain release factor 1 [Clostridium perfringens CPE str. F4969] >gi|168215831|ref|ZP_02641456.1| peptide chain release factor 1 [Clostridium perfringens NCTC 8239] >gi|169344167|ref|ZP_02865149.1| peptide chain release factor 1 [Clostridium perfringens C str. JGS1495] >gi|182624062|ref|ZP_02951850.1| peptide chain release factor 1 [Clostridium perfringens D str. JGS1721] >gi|20139327|sp|Q8XIB9|RF1_CLOPE Peptide chain release factor 1 (RF-1) >gi|119361525|sp|Q0TNB0|RF1_CLOP1 Peptide chain release factor 1 (RF-1) >gi|119361526|sp|Q0SQY1|RF1_CLOPS Peptide chain release factor 1 (RF-1) >gi|18145867|dbj|BAB81908.1| peptide chain release factor 1 [Clostridium perfringens str. 13] >gi|110674237|gb|ABG83224.1| peptide chain release factor 1 [Clostridium perfringens ATCC 13124] >gi|110683316|gb|ABG86686.1| peptide chain release factor 1 [Clostridium perfringens SM101] >gi|169297625|gb|EDS79725.1| peptide chain release factor 1 [Clostridium perfringens C str. JGS1495] >gi|170662868|gb|EDT15551.1| peptide chain release factor 1 [Clostridium perfringens E str. JGS1987] >gi|170711762|gb|EDT23944.1| peptide chain release factor 1 [Clostridium perfringens B str. ATCC 3626] >gi|170714864|gb|EDT27046.1| peptide chain release factor 1 [Clostridium perfringens CPE str. F4969] >gi|177910955|gb|EDT73309.1| peptide chain release factor 1 [Clostridium perfringens D str. JGS1721] >gi|182382220|gb|EDT79699.1| peptide chain release factor 1 [Clostridium perfringens NCTC 8239] (360 aa)
Score = 813, Expect = 8.2e-85, Identities = 169/342 (49%), Positives = 252/342 (73%)
  Q:    14 MEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQ 355
           +E K+++L+ ++    +  + K   ++ K   +   IV K+KEYK    ++++ ++++  E D E+ E+   E+ +     ++ E E+++LLLPKDPNDDKNV VE+R  AGGDE+++F  +LF  Y +YA+   WKV+++   E+   G+  + FMI G   YSK+K+ESG HRVQRVP TES GR+HTST TVAVLPE+++VE+ IN+ D+KID +RASG GGQ +N T+SAVRITH+P+G+ V+CQ+ KSQ++N+E AMK+LRA+L+E+ E E    I++ RK QVGTG+R+E+IRTYNYPQ RVTDHRIN+TL KLD+ + G++ EI+++LI+ D+A KM+
  S:     9 IENKYDELSVKISDPSIMANQKEWRKLCKEHADLEVIVNKYKEYKEATEELEANKEMLSEESDQEMREMINSEIKDLTERKKELEDEIQILLLPKDPNDDKNVFVEIRGGAGGDEAALFAANLFRMYTKYAEKNRWKVELMSANETDIGGFKEVVFMIKGAGAYSKLKYESGAHRVQRVPDTESSGRIHTSTATVAVLPEVDDVEIEINDKDIKIDVFRASGNGGQCVNTTDSAVRITHLPSGLVVSCQDEKSQLKNKEKAMKVLRARLFEQAEAERLAGIAEDRKSQVGTGDRSERIRTYNYPQGRVTDHRINMTLYKLDSFLEGDIDEILNALITEDQAQKMK 353
>gi|52082235|ref|YP_081026.1| peptide chain release factor 1 [Bacillus licheniformis ATCC 14580] >gi|52787627|ref|YP_093456.1| peptide chain release factor 1 [Bacillus licheniformis ATCC 14580] >gi|81608865|sp|Q65DV1|RF1_BACLD Peptide chain release factor 1 (RF-1) >gi|52005446|gb|AAU25388.1| peptide chain release factor 1 [Bacillus licheniformis ATCC 14580] >gi|52350129|gb|AAU42763.1| PrfA [Bacillus licheniformis DSM 13] (356 aa)
Score = 812, Expect = 9.9e-85, Identities = 170/352 (48%), Positives = 255/352 (72%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQES-SHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQEAK 358
           + + L S+E+++  LN+ L    +    K++ E +K   +    VE ++ Y+     +  A+ +++ + D+++ E+ + E+SE +  IE    +LKVLL+PKDPNDDKNVI+E+R AAGG+E+++F G+L+  Y RYA+  GWK +++E   + + GY  I FMING   YS++K+E+G HRVQRVP TES GR+HTST TVA LPE EEVE+ I+  D+++DT+ +SG GGQ +N T SAVR+TH+PTG+ V+CQ+ KSQI+N+E AMK+LRA++++K ++E +      RK  VGTG+R+E+IRTYN+PQNRVTDHRI LT+ KLD ++ G L E+ID+LI  D+A K+Q+A+
  S:     1 MLDRLKSIEDRYEKLNELLSDPEVVNDPKKLREYSKEQSDLQETVEVYRRYRSASEQLSDAKAMLEEKLDSDMREMVKEEISELQEEIESLTDQLKVLLIPKDPNDDKNVIMEIRGAAGGEEAALFAGNLYRMYSRYAELQGWKTEVMEANMTGTGGYKEIIFMINGNGAYSRLKYENGAHRVQRVPETESGGRIHTSTATVACLPEAEEVEVDIHEKDIRVDTFASSGPGGQSVNTTMSAVRLTHLPTGVVVSCQDEKSQIKNKEKAMKVLRARIYDKFQQEAQAEYDQNRKSAVGTGDRSERIRTYNFPQNRVTDHRIGLTIQKLDQILEGKLDEVIDALIVEDQASKLQQAE 355
>gi|118443694|ref|YP_879014.1| peptide chain release factor 1 [Clostridium novyi NT] >gi|166223551|sp|A0Q312|RF1_CLONN Peptide chain release factor 1 (RF-1) >gi|118134150|gb|ABK61194.1| peptide chain release factor 1 [Clostridium novyi NT] (357 aa)
Score = 811, Expect = 1.3e-84, Identities = 167/316 (52%), Positives = 238/316 (75%)
  Q:    40 KSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQ 355
           K   E   IV K++EYK    ++++ ++++  E D ++ E+ Q E+   +  I K + ELK+LLLPKDPNDDKNV +E+R  AGGDE+++F  +LF  Y RYA+  GWK +++   E+   G+  + FM+ G+  YSKMKFESGVHRVQRVP TES GR+HTST TVAVLPE+++V++ I+ +D+++D +RASG GGQ +N T+SAVR+THIPTGI V+CQ+ KSQ++N+E AMK+L+A+L+EK E E   +IS  RK QVGTG+R+E+IRTYNYPQ RVT+HRI LTL KL+  + G++ E+ID+LI+ ++A KM+
  S:    36 KEHAELETIVTKYREYKTNKEELEANKEMLSEETDKDMKEMIQEEIKTLEESIVKDQEELKILLLPKDPNDDKNVFIEIRAGAGGDEAALFAANLFRMYTRYAERHGWKTELMSANETDIGGFKEVVFMLRGDCAYSKMKFESGVHRVQRVPDTESSGRIHTSTATVAVLPEVDDVDIQIDPNDIRVDVFRASGHGGQCVNTTDSAVRMTHIPTGIVVSCQDEKSQLKNKEKAMKVLKARLYEKAEAERSASISADRKSQVGTGDRSERIRTYNYPQGRVTEHRIGLTLYKLEAFLDGDMEEVIDALITAEQAEKMK 352
>gi|192360464|ref|YP_001981172.1| peptide chain release factor 1 [Cellvibrio japonicus Ueda107] >gi|190686629|gb|ACE84307.1| peptide chain release factor 1 [Cellvibrio japonicus Ueda107] (360 aa)
Score = 810, Expect = 1.5e-84, Identities = 176/321 (54%), Positives = 234/321 (72%)
  Q:    34 RMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGF--ISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           R  +++K   E  P+V  +K Y + L DI+ A+ LI +E D ++ E+A+ EL   +  +E  E EL+ LLLPKDPND+KN  +E+R   GGDE++IF GDLF  Y RYA++ GW+V++L   E  HG GF  I  +++G  VYSK+KFESG HRVQRVP TES+GR+HTS  TVAV+PE +E+E V IN +DL+IDTYRASGAGGQH+NKT+SA+RITHIPTGI V CQ+ +SQ +NR  AM +L  KL   +EE   K+IS+ R+  VG+G+R+E+IRTYNYPQ RVTDHRINLTL  LD VM G+L  +I  L +  +A ++
  S:    34 RFRDLSKEYAELEPVVVAYKGYLQLLADIEEAKHLI-AEGDADMREMAEEELEGCEARLEPTELELQKLLLPKDPNDEKNCYLEVRAGTGGDEAAIFSGDLFRMYSRYAETQGWRVEILSQSEGEHG-GFKEIISLVSGSGVYSKLKFESGAHRVQRVPETESQGRIHTSACTVAVMPEADELEEVNINKADLRIDTYRASGAGGQHVNKTDSAIRITHIPTGIVVECQDERSQHKNRARAMSLLATKLKTMQEEAAHKSISEERRNLVGSGDRSERIRTYNYPQGRVTDHRINLTLYSLDAVMQGDLEPVIGPLANEYQADQL 355
>gi|191162138|ref|ZP_03024019.1| peptide chain release factor 1 [Geobacter sp. M21] >gi|190996928|gb|EDV72375.1| peptide chain release factor 1 [Geobacter sp. M21] (359 aa)
Score = 810, Expect = 1.7e-84, Identities = 168/320 (52%), Positives = 239/320 (74%)
  Q:    36 SEINKSIKETTPIVE---KFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGF--ISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQ 355
           +E  K  KE + + E    ++EYK+ L+DID  ++L+K E D E+ E+AQ EL   +   E+ E E+K+LLLPKDPNDDKNV++E+R   GGDES++F GDLF  Y R+A++  W+V+++   ES  G GF  +  ++ G  V++K+K+ESG HRVQRVP TE++GR+HTS  TVAV+PE E+V++ IN +DLKID YR+SGAGGQH+N T+SAVRITH+PTG  VACQE +SQI+NR  AMK+L++++ +    E    ++  RK QVG+G+R+E+IRTYN+PQ R+TDHRI LTL +LD +M G+++EI DSL +H +   +Q
  S:    31 TEFRKLSKEHSGLAELVAAYREYKKILSDIDDNKELLK-EPDQEMREMAQAELLSLEARREELEGEIKLLLLPKDPNDDKNVVLEIRAGTGGDESALFAGDLFRMYSRFAETNRWRVEIISASESEKG-GFKEVIALVEGTGVFAKLKYESGTHRVQRVPETEAQGRIHTSACTVAVMPEAEDVDIDINPADLKIDVYRSSGAGGQHVNTTDSAVRITHLPTGTVVACQEERSQIKNRAKAMKVLKSRILDNILMEQNAKLAADRKSQVGSGDRSERIRTYNFPQGRMTDHRIGLTLYRLDAIMAGDIAEIADSLRAHYQMEALQ 353
>gi|150015294|ref|YP_001307548.1| peptide chain release factor 1 [Clostridium beijerinckii NCIMB 8052] >gi|189039964|sp|A6LQG2|RF1_CLOB8 Peptide chain release factor 1 (RF-1) >gi|149901759|gb|ABR32592.1| peptide chain release factor 1 [Clostridium beijerinckii NCIMB 8052] (360 aa)
Score = 810, Expect = 1.7e-84, Identities = 168/349 (48%), Positives = 257/349 (73%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGLSVKRMSEINKSIKETTP---IVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQ 355
           L + L  +E K+++L+ ++    + ++  +E  K  KE      IV  ++EYK+ + D+ + ++++  E D E+ E+   E+++     E+ E E+++LLLPKDPNDDKNV VE+R  AGG+E+++F  +LF  Y RYA++  W V+++ + E+   G+  + FMI G   YSK+K+ESGVHRVQRVP TES GR+HTST TVAVLPE+++VE+ + + D++ID +RASG GGQ +N T+SAVRITH+PTG+ V+CQ+ KSQ++N+E AMK+L+++L+E+ E E  + I++ RK QVGTG+R+E+IRTYNYPQ R+TDHRI LTL KLD  + G++ E+I++LI+ D+A KM+
  S:     2 LLDKLEFIENKYDELSVKISDPSI-MQNQNEWRKLCKEHADLEVIVNSYREYKKVVEDLKANKEMLSGESDKEMREMLNEEITDLTNREEQLETEIQILLLPKDPNDDKNVFVEIRGGAGGEEAALFAYNLFRMYTRYAETQRWGVEIMSLNETDLGGFKEVVFMIKGNGAYSKLKYESGVHRVQRVPDTESSGRIHTSTATVAVLPEVDDVEIEVADKDVRIDVFRASGNGGQCVNTTDSAVRITHLPTGLVVSCQDEKSQLKNKEKAMKVLKSRLYEQAERERAQGIAEDRKSQVGTGDRSERIRTYNYPQGRITDHRIGLTLYKLDTFLGGDIDEMINALITADQAEKMK 353
>gi|15616337|ref|NP_244642.1| peptide chain release factor 1 [Bacillus halodurans C-125] >gi|20139353|sp|Q9K6F4|RF1_BACHD Peptide chain release factor 1 (RF-1) >gi|10176399|dbj|BAB07494.1| peptide chain release factor 1 in translation [Bacillus halodurans C-125] (356 aa)
Score = 809, Expect = 2.0e-84, Identities = 171/350 (48%), Positives = 252/350 (72%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           ++  L S++E++  LN+ L    +     ++ E +K   +    V+ ++EYK  ++    A+++++ + D+E+  + + E+ E     E  E +LKVLLLPKDPNDDKNVIVE+R AAGGDE+ +F  DL+  Y RYA++ GWK++++E   +   GY  I F +NG+  YSK+K+E+G HRVQRVP TES GR+HTST TVAVLPE EEVE+ I+  D+++DT+ +SG GGQ +N T SAVR+TH+PTGI V+CQ+ KSQI+N+E AMK+LRA++++K ++E +      RK  VGTG+R+E+IRTYN+PQ+RVTDHRI LTL KL+ ++ G L EII+SLI H++A  M++
  S:     1 MFERLQSLDERYERLNELLSDPEVISDSNKLREYSKEQADMEETVQVYREYKTVMDQYQDAKEMLEDKLDDEMYAMVKEEIDELATRKEDLEAKLKVLLLPKDPNDDKNVIVEVRGAAGGDEAQLFAADLYKMYARYAEAQGWKIEVIEASSTELGGYKEIIFSVNGKGAYSKLKYENGAHRVQRVPQTESGGRIHTSTATVAVLPEAEEVEVDIHEKDIRVDTFASSGPGGQSVNTTMSAVRLTHLPTGIVVSCQDEKSQIKNKEKAMKVLRARIYDKFQQEAQAEYDQTRKSAVGTGDRSERIRTYNFPQSRVTDHRIGLTLQKLEQILQGKLDEIIESLIVHEQAELMKQ 353
>gi|168185914|ref|ZP_02620549.1| peptide chain release factor 1 [Clostridium botulinum C str. Eklund] >gi|169296113|gb|EDS78246.1| peptide chain release factor 1 [Clostridium botulinum C str. Eklund] (357 aa)
Score = 809, Expect = 2.0e-84, Identities = 167/316 (52%), Positives = 238/316 (75%)
  Q:    40 KSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQ 355
           K   E   IV K++EYK    ++++ ++++  E D ++ E+ Q E+   +  I   E ELK+LLLPKDPNDDKNV +E+R  AGGDE+++F  +LF  Y RYA+  GWK +++   E+   G+  + FM+ G++ YSKMKFESGVHRVQRVP TES GR+HTST TVAVLPE+++V++ I+ +D+++D +RASG GGQ +N T+SAVR+THIPTGI V+CQ+ KSQ++N+E AMK+L+A+L+EK E E   +IS  RK QVGTG+R+E+IRTYNYPQ RVT+HRI LTL KL+  + G++ E+ID+LI+ ++A KM+
  S:    36 KEHSELETIVTKYREYKGNKEELEANKEMLSEETDKDMKEMIQEEIKTLEENIVTDEEELKILLLPKDPNDDKNVFIEIRAGAGGDEAALFAANLFRMYTRYAERHGWKTELMSANETDIGGFKEVVFMLRGDSAYSKMKFESGVHRVQRVPDTESSGRIHTSTATVAVLPEVDDVDIQIDPNDIRVDVFRASGHGGQCVNTTDSAVRMTHIPTGIVVSCQDEKSQLKNKEKAMKVLKARLYEKAEAERSASISADRKSQVGTGDRSERIRTYNYPQGRVTEHRIGLTLYKLEAFLDGDMEEVIDALITAEQAEKMK 352
>gi|188590258|ref|YP_001919883.1| peptide chain release factor 1 [Clostridium botulinum E3 str. Alaska E43] >gi|188500539|gb|ACD53675.1| peptide chain release factor 1 [Clostridium botulinum E3 str. Alaska E43] (360 aa)
Score = 809, Expect = 2.1e-84, Identities = 172/350 (49%), Positives = 253/350 (72%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGLSVKRMSEINKSIKETTP---IVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           L + L  +E K+++L+ ++    + ++  +E  K  KE      IV  +KEYK+ + D+   ++++  E D E+ E+   E+S       + E E+++LLLPKDPNDDKNV VE+R  AGGDE+++F  +LF  Y RYA+   W  +++ + E+   G+  + FMI G   YSK+K+ESGVHRVQRVP TES GR+HTST+TVAVLPE+++VE+ I + D++ID +RASG GGQ +N T+SAVRITH+P+G+ V+CQ+ KSQ++N+E AMK+LR++L+EK E+E    I+  RK QVGTG+R+E+IRTYNYPQ R+TDHRI LTL KLD+ + G + E+I++LI+ D+A KMQ+
  S:     2 LLDKLAFIENKYDELSVKISDPSI-MQNQNEWRKLCKEQADLEIIVNAYKEYKQVIEDLQVNKEMLSDESDREMKEMLNEEISSLAEREIELEKEIQILLLPKDPNDDKNVFVEIRGGAGGDEAALFAYNLFRMYTRYAERQRWSTEIMSLNETDIGGFKEVVFMIKGNGAYSKLKYESGVHRVQRVPDTESSGRIHTSTVTVAVLPEVDDVEIEIADKDVRIDVFRASGHGGQCVNTTDSAVRITHLPSGLVVSCQDEKSQLKNKEKAMKVLRSRLFEKAEQERADGIAADRKSQVGTGDRSERIRTYNYPQGRITDHRIGLTLYKLDSFLDGEVQEMINALITADQAEKMQK 354
>gi|90961566|ref|YP_535482.1| peptide chain release factor 1 [Lactobacillus salivarius UCC118] >gi|119361553|sp|Q1WUD6|RF1_LACS1 Peptide chain release factor 1 (RF-1) >gi|90820760|gb|ABD99399.1| Bacterial Peptide Chain Release Factor 1 [Lactobacillus salivarius UCC118] (360 aa)
Score = 809, Expect = 2.1e-84, Identities = 170/352 (48%), Positives = 253/352 (71%)
  Q:     5 EKLYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           +KL++ L  +E+++ +L + L    +    KR ++++K + +    VEK+ +YK     I   E+++    D+E+  L + ELS  K    K E E+K+LLLPKDPNDDKN+I+E+R AAGGDE+S+F  DLFS Y +YA+  GW +++++   +   G+  I+ +ING +V+SK+K+ESG HRVQR+P TES GRVHTST TV V+PE E+VE+ ++  D+++D YR+SGAGGQHINKT SAVR+TH+PTGI VA Q+ +SQ +NRE AMK+L+A++++   ++ +      RK  VGTG+R+E+IRTYNYPQNRVTDHRI L+LNKLD +M G L ++ID+L+  ++   M++
  S:     2 DKLFDRLQMLEDRYEELGELLSDPDVISDTKRFTKLSKEMADLRETVEKYNKYKEVTQQISDDEEMLSDGLDDEMASLVKEELSNAKNEKVKLEEEIKILLLPKDPNDDKNIIMEIRGAAGGDEASLFAADLFSMYSKYAERQGWSIEVIDKNVTEVGGFKEIALIINGNSVWSKLKYESGAHRVQRIPVTESAGRVHTSTATVVVMPEEEDVEIELDPKDIRVDVYRSSGAGGQHINKTSSAVRMTHLPTGIVVAMQDQRSQQQNREKAMKILKARVYDYYAQQEQSEYDANRKSAVGTGDRSERIRTYNYPQNRVTDHRIGLSLNKLDRIMNGELEDVIDALVLFEQTKAMEK 356
>gi|187604004|ref|ZP_02990215.1| peptide chain release factor 1 [Exiguobacterium sp. AT1b] >gi|187484066|gb|EDU22059.1| peptide chain release factor 1 [Exiguobacterium sp. AT1b] (356 aa)
Score = 808, Expect = 2.9e-84, Identities = 169/352 (48%), Positives = 264/352 (75%)
  Q:     7 LYNSLLSMEEKFNDLNK-----ELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEK-DNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQEAK 358
           +++ L  +E+++  LN+     E+ ++   +++ S+    ++ET   V+ +++YK T      A+ +++    D E+ ELA+ E++  +P +++ E +L++LLLPKDPND+KNVIVE+R AAGGDE+++F GDL+  Y R+A+   WKV++++   +   G+  ++FMING   YSK+KFE+G HRVQRVP+TES GR+HTST TVAVLPE E+VE+ I+  D+++DT+ +SG GGQ +N T+SAVR+THIP+G+ V+CQ+ KSQ +N++ AMK+LRA+L++K + E+ + +S  RK  VGTG+R+E+IRTYN+PQ+RVTDHRI LTL KLD V+ G L +IID+LI  ++A  M++A+
  S:     1 MFDRLSVLEDRYMQLNEMLADPEVLSDSTKLRQYSKEQAQLEET---VQMYRQYKETSQAFKEAKSMLEDRTLDAEMRELAKEEMNLLEPEVKELEAKLRILLLPKDPNDEKNVIVEVRGAAGGDEAALFAGDLYKMYTRFAERQNWKVELIDANYTELGGFKEVTFMINGAGAYSKLKFENGAHRVQRVPSTESGGRIHTSTATVAVLPEAEDVEVHIDMKDVRVDTFTSSGPGGQSVNTTQSAVRLTHIPSGLVVSCQDEKSQHKNKDKAMKVLRARLYDKMQSEHMEELSAQRKSAVGTGDRSERIRTYNFPQSRVTDHRIGLTLQKLDRVLAGELEDIIDALIMDEQARLMEDAE 356
>gi|145617383|ref|ZP_01773448.1| peptide chain release factor 1 [Geobacter bemidjiensis Bem] >gi|144946172|gb|EDJ81232.1| peptide chain release factor 1 [Geobacter bemidjiensis Bem] >gi|197089430|gb|ACH40701.1| peptide chain release factor 1 [Geobacter bemidjiensis Bem] (359 aa)
Score = 807, Expect = 3.1e-84, Identities = 168/320 (52%), Positives = 237/320 (74%)
  Q:    36 SEINKSIKETTPIVE---KFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGF--ISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQ 355
           +E  K  KE + + E    ++EYK+ L+DID  ++L+K E D E+ E+AQ EL   +   E  E E+K+LLLPKDPNDDKNV++E+R   GGDES++F GDLF  Y R+A++  W+V+++   ES  G GF  +  ++ G  V++K+K+ESG HRVQRVP TE++GR+HTS  TVAV+PE E+V++ IN +DLKID YR+SGAGGQH+N T+SAVRITH+PTG  VACQE +SQI+NR  AMK+L++++ +    E    ++  RK QVG+G+R+E+IRTYN+PQ R+TDHRI LTL +LD +M G+++EI DSL  H +   +Q
  S:    31 TEFRKLSKEHSGLAELVAAYREYKKILSDIDDNKELLK-EPDQEMREMAQAELLSLEARREVLEGEIKLLLLPKDPNDDKNVVLEIRAGTGGDESALFAGDLFRMYSRFAETNRWRVEIISASESEKG-GFKEVIALVEGTGVFAKLKYESGTHRVQRVPETEAQGRIHTSACTVAVMPEAEDVDIDINPADLKIDVYRSSGAGGQHVNTTDSAVRITHLPTGTVVACQEERSQIKNRAKAMKVLKSRILDNIVMEQNAKLAADRKSQVGSGDRSERIRTYNFPQGRMTDHRIGLTLYRLDAIMAGDIAEIADSLRQHYQMEALQ 353
>gi|152989856|ref|YP_001355578.1| peptide chain release factor 1 [Nitratiruptor sp. SB155-2] >gi|166223578|sp|A6Q162|RF1_NITSB Peptide chain release factor 1 (RF-1) >gi|151421717|dbj|BAF69221.1| peptide chain release factor 1 [Nitratiruptor sp. SB155-2] (354 aa)
Score = 807, Expect = 3.2e-84, Identities = 178/342 (52%), Positives = 259/342 (75%)
  Q:    16 EKFNDLNKELETEGLS--VKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQES-SHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQEA 357
           +++N++N+ L +  ++  +K+M+ ++K   E  PIVEK KEY   L  I+    LI+   D E+ ELA+ EL E +P  E+ E E+KVLL+ KDPND+K++ +E+R   GG+E+++F  DLF AY RYA+  GW+V+++   ES S GY  I   I G+ VYS++K+E+G HRVQRVP TES+GR+HTS +TVA++PE+++V++ IN +DLKID YR+SG GGQ +N T+SAVRITHIPTGI VA Q+ KSQ +N+E A+K+L+A+++EK+  E ++ ++  RK QVG+G+R+E+IRTYN+PQNRVTDHRI LTL KL+ VM G+L +II+ LI+H +A K+QEA
  S:    11 QRYNEINELLSSPEITQDIKKMTALSKEQSEIEPIVEKAKEYMNILEAIEENRSLIE---DEELGELAKEELKELEPKKEQLEEEIKVLLISKDPNDEKDIYLEIRAGTGGEEAALFASDLFKAYARYAEKKGWRVEIVSSSESDSGGYKEIIAKIKGQGVYSRLKYEAGTHRVQRVPETESQGRIHTSAVTVAIMPEVDDVDVEINPNDLKIDVYRSSGHGGQSVNTTDSAVRITHIPTGIVVAMQDEKSQHKNKEKALKILKARIFEKRMREQQEALAKDRKEQVGSGDRSERIRTYNFPQNRVTDHRIGLTLYKLEEVMQGDLDQIIEPLIAHYQAQKIQEA 352
>gi|167745421|ref|ZP_02417548.1| hypothetical protein ANACAC_00112 [Anaerostipes caccae DSM 14662] >gi|167655142|gb|EDR99271.1| hypothetical protein ANACAC_00112 [Anaerostipes caccae DSM 14662] (357 aa)
Score = 807, Expect = 3.3e-84, Identities = 178/348 (51%), Positives = 262/348 (75%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGLS--VKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           +++ L S+ E+ + + ++L    ++    R  ++ K   +  PIVEK+KEY +   +I+ + +L++ E D E+ ELA+ ELSE K  +E+ E ELK+LL+PKDPNDDKN+IVE+R  AGGDE+++F  D+   Y+ YA+   WKV+ L   ES   G+  + FMI+G+  YS+ K+ESGVHRVQR+PATES GR+HTSTITVA++PE+E+VE+ ++ +D K D +RASG GGQ +N T+SAVR+TH+PTGI V+CQ+ KSQ++N++ A+K+LR++L+E ++++     ++ RK QVGTG+R+EKIRTYNYPQ RVTDHRI LTL+KLD+VM G+L E+IDSL + D+A K+
  S:     1 MFDKLESLVERMDTVLQQLNDPDVAGDQNRFRDLMKEQSDLAPIVEKYKEYVQEKQNIEESLELLEEESDEEMKELAKEELSESKANVERLEEELKILLIPKDPNDDKNIIVEIRAGAGGDEAALFAADVARMYRSYAEGRRWKVETLSFNESGIGGFKELVFMISGQGAYSRFKYESGVHRVQRIPATESGGRIHTSTITVAIMPEVEDVEVEVDLNDCKFDVFRASGNGGQCVNTTDSAVRLTHLPTGIVVSCQDEKSQLKNKDKALKVLRSRLYELEQQKAHDAEAEKRKSQVGTGDRSEKIRTYNYPQGRVTDHRIKLTLHKLDSVMNGDLDELIDSLTAADQAAKL 351
>gi|167750775|ref|ZP_02422902.1| hypothetical protein EUBSIR_01753 [Eubacterium siraeum DSM 15702] >gi|167656210|gb|EDS00340.1| hypothetical protein EUBSIR_01753 [Eubacterium siraeum DSM 15702] (358 aa)
Score = 807, Expect = 3.5e-84, Identities = 172/340 (50%), Positives = 244/340 (71%)
  Q:    15 EEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEK-DNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           E++F+++N++L    +    ++   + K +K  TPI+EK++ YK   +D + AE+++     D +  E+ Q +    K L+++Y  ELK+LLLPKDP+DD+NVI+E+R  AGG+E+++F   +F  Y  YA + GWK +++    +   GY  ISF + GE VY+K+K+ESGVHRVQRVP TE++GR+ TSTITVAVLPE+EEV++ IN +DL+  TYR+SGAGGQHINKTESA+RI H PTG+ V CQE +SQ +N++ AMKML +KL+E K  E    I+  RK QVGTG+R+E+IRTYNYPQ+RVTDHRI LTL KL+  M G+  E+ D+L   D   K+
  S:     9 EKRFDEINEKLTDINVINDQEQYKSLMKELKNLTPIIEKYRMYKTARSDFEEAEQMLSDGGLDKDFKEIVQEQYESNKKLMDEYTDELKILLLPKDPDDDRNVIIEIRGGAGGEEAALFANSMFRMYSMYAQTKGWKTEVISSNPTELGGYKEISFSVEGEGVYAKLKYESGVHRVQRVPETEAQGRIQTSTITVAVLPEVEEVDVEINPADLEFQTYRSSGAGGQHINKTESAIRIIHHPTGVVVECQEERSQYKNKDKAMKMLYSKLYEAKLNEQNSKIAAERKIQVGTGDRSERIRTYNYPQSRVTDHRIGLTLYKLEQFMNGDCDEVFDALAIADRTAKL 352
>gi|125975076|ref|YP_001038986.1| peptide chain release factor 1 [Clostridium thermocellum ATCC 27405] >gi|196251800|ref|ZP_03150466.1| peptide chain release factor 1 [Clostridium thermocellum DSM 4150] >gi|166223552|sp|A3DIL4|RF1_CLOTH Peptide chain release factor 1 (RF-1) >gi|125715301|gb|ABN53793.1| bacterial peptide chain release factor 1 (bRF-1) [Clostridium thermocellum ATCC 27405] >gi|196198740|gb|EDX93571.1| peptide chain release factor 1 [Clostridium thermocellum DSM 4150] (360 aa)
Score = 807, Expect = 3.9e-84, Identities = 178/348 (51%), Positives = 254/348 (72%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGLSVKRMSEINKSIKETTPI---VEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           ++    + E +++++N  L    + +    E  K +KE   +   V K+ EYK+   +I  A++++  + D E  E+ + EL E +  +E  + E+K+LLLPKDPND++NVIVE+R  AGGDE+++F GDLF  Y RYA+  GWK ++L+   +   G+  + F I G   YS++KFESGVHRVQRVP TE+ GRVHTST+TVAVLPE EE+++ IN +DL+IDTYRASGAGGQHINKT+SA+RITH+PTG+ V CQ+ +SQ +N+E AMK+LR+KL+E   E+    I+  RK QVGTG+R+E+IRTYN+PQ RVTDHRI LTL K+D+++ G++ EIID+LI+ D+A K+
  S:     1 MFEKFQAAENRYDEINHRLSDPAV-IANQDEYKKLMKEHAELEVLVTKYNEYKKLTKEIADAKEMLNEKLDKEFREMVETELKEAQEKLEVLKKEMKILLLPKDPNDERNVIVEIRGGAGGDEAALFAGDLFRMYTRYAERNGWKTEILDSNPTEIGGFKEVVFSIEGNGAYSRLKFESGVHRVQRVPVTEANGRVHTSTVTVAVLPEAEEIDVEINPNDLRIDTYRASGAGGQHINKTDSAIRITHLPTGLVVCCQDQRSQHKNKEKAMKVLRSKLYEMAREQQHNEIAQERKSQVGTGDRSERIRTYNFPQGRVTDHRIGLTLYKIDDILDGDIDEIIDALITTDQASKL 351
>gi|160940109|ref|ZP_02087454.1| hypothetical protein CLOBOL_04998 [Clostridium bolteae ATCC BAA-613] >gi|158436689|gb|EDP14456.1| hypothetical protein CLOBOL_04998 [Clostridium bolteae ATCC BAA-613] (358 aa)
Score = 806, Expect = 4.3e-84, Identities = 164/322 (50%), Positives = 243/322 (75%)
  Q:    33 KRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           KR + + K   +  PIVE +K+YK+   D++ +  L++ E D E+ E+A+ ELS+ +  IE  E+ELK+LLLPKDPNDDKN+I+E+R  AGGDE+++F  +L+  Y  YADS  WKV+++ + E+   G+  +  M+ G+  YSK+K+ESGVHRVQRVP TES GR+HTST TVAV+PE EEV++ I+ +D +ID  RASG GGQ +N T+SAVR+TH+PTGI +  Q  KSQ++N+E A ++LR+KL++ + E+ + + ++ R+ Q+GTG+R+EKIRTYN+PQ RVTDHRI LTL K+D++M G++ E++D+LI+ D+A K+
  S:    29 KRFTRLMKEQADLAPIVEAYKQYKQAKQDVEDSLALLEEESDEEMREMAKEELSDARKRIEDLEHELKILLLPKDPNDDKNIILEIRAGAGGDEAALFAAELYRMYSNYADSQRWKVEIVSLNENGIGGFKEVVAMVTGKGAYSKLKYESGVHRVQRVPETESGGRIHTSTATVAVMPEAEEVDVQIDMNDCRIDVMRASGNGGQCVNTTDSAVRLTHMPTGIVIYSQTEKSQLQNKEKAFRLLRSKLYDIELEKRQSSEAEERRSQIGTGDRSEKIRTYNFPQGRVTDHRIKLTLYKIDSIMNGDIQELLDNLIAADQAAKL 351
>gi|116513791|ref|YP_812697.1| peptide chain release factor 1 [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|122275439|sp|Q04BB3|RF1_LACDB Peptide chain release factor 1 (RF-1) >gi|116093106|gb|ABJ58259.1| bacterial peptide chain release factor 1 (bRF-1) [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (361 aa)
Score = 806, Expect = 4.6e-84, Identities = 164/324 (50%), Positives = 242/324 (74%)
  Q:    33 KRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           KR  EI K   +   +V+KF+++K    +I   +++I    D E++E+A++E SE +  I + E E+K+L+LPKDPNDDK++I+E+R AAGGDE+S+F GDL   Y++YA++ GW V +++ +++   GY  ++ MI G  VYSK+K+E+G HRVQR+P TES GRVHTST TVAV+PE E+V++ ++  ++++D YR+SGAGGQHINKT SAVR+TH+PTGI VA Q+ +SQ +NR  AM++L++++++  E +NR      RK  VGTG+R+E+IRTYNYPQNRVTDHRI LTLNKLD +M G L E+ID+L  + +  +++E
  S:    32 KRYMEITKEEADMREVVQKFRKFKADKEEIAGNKEIIADGSDPELVEMAKMENSELEDEISQLEDEIKILMLPKDPNDDKDIIMEIRGAAGGDEASLFAGDLLRMYEKYAENQGWNVSIVDSEQTEVGGYKRVAIMITGNKVYSKLKYENGAHRVQRIPVTESAGRVHTSTATVAVMPEYEQVDIDLDPKEIRVDVYRSSGAGGQHINKTSSAVRMTHLPTGIVVAMQDQRSQQQNRAKAMEILKSRVYDYYESQNRDKYDAKRKNAVGTGDRSERIRTYNYPQNRVTDHRIGLTLNKLDRIMNGELDEVIDALTVYYQTKQLEE 356
>gi|187935755|ref|YP_001884696.1| peptide chain release factor 1 [Clostridium botulinum B str. Eklund 17B] >gi|187723908|gb|ACD25129.1| peptide chain release factor 1 [Clostridium botulinum B str. Eklund 17B] (360 aa)
Score = 806, Expect = 4.6e-84, Identities = 170/350 (48%), Positives = 254/350 (72%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGLSVKRMSEINKSIKETTP---IVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           L + L  +E K+++L+ ++    + ++  +E  K  KE      IV  +KEYK+ + D+   ++++  E D E+ E+   E++       + E E+++LLLPKDPNDDKNV VE+R  AGG+E+++F  +LF  Y RYA+   W  +++ + E+   G+  + FMI G   YSK+K+ESGVHRVQRVP TES GR+HTST+TVAVLPE+++VE+ I + D++ID +RASG GGQ +N T+SAVRITH+P+G+ V+CQ+ KSQ++N+E AMK+LR++L+EK E+E    I+  RK QVGTG+R+E+IRTYNYPQ R+TDHRI LTL KLD+ + G++ E+I++LI+ D+A KMQ+
  S:     2 LLDKLAFIENKYDELSVKISDPSI-MQNQNEWRKLCKEQADLEIIVNAYKEYKQVIEDLQVNKEMLSDESDREMKEMLNEEIASLSQREVELEKEIQILLLPKDPNDDKNVFVEIRGGAGGEEAALFAYNLFRMYTRYAERQRWSTEIMSLNETDIGGFKEVVFMIKGNGAYSKLKYESGVHRVQRVPDTESSGRIHTSTVTVAVLPEVDDVEIEIADKDVRIDVFRASGHGGQCVNTTDSAVRITHLPSGLVVSCQDEKSQLKNKEKAMKVLRSRLFEKAEQERADGIAADRKSQVGTGDRSERIRTYNYPQGRITDHRIGLTLYKLDSFLDGDVQEMINALITADQAEKMQK 354
>gi|39998194|ref|NP_954145.1| peptide chain release factor 1 [Geobacter sulfurreducens PCA] >gi|61214645|sp|Q748B1|RF1_GEOSL Peptide chain release factor 1 (RF-1) >gi|39985140|gb|AAR36495.1| peptide chain release factor 1 [Geobacter sulfurreducens PCA] (355 aa)
Score = 806, Expect = 4.9e-84, Identities = 173/349 (49%), Positives = 254/349 (72%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGF--ISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISH--DEAVKMQ 355
           ++  +  +E ++++L   L    +  +      +++   + TP++E ++ YK+ L +++   +L+    D E+ E+AQ EL E +   E+ E E+K+LLLP+DPNDD+NVI+E+R   GGDES++F GDLF  Y R+A+   WKV+++   ES  G GF  I  +I G+ V++K+K+ESG HRVQRVP TE++GR+HTS  TVAVLPE E++E+ IN +DLKID YRASGAGGQH+NKTESAVRITHIPTGI V CQ+ +SQI+NR  AMK+L+ K+ +   +E    I+  RK QVG+G+R+E+IRTYN+PQ R+TDHRI LTL +LD++M G+++E++D+L +H   EA+K Q
  S:     1 MFEKIEELEVRYHELESLLADPAVLGNQPEFRRLSREHNDLTPLIESYRTYKKVLEEMEGNRELLA---DPEMKEMAQAELEELEQRQEELEGEIKLLLLPRDPNDDRNVILEIRAGTGGDESALFAGDLFRMYSRFAERNRWKVEVMSASESERG-GFKEIVALIEGQGVFAKLKYESGTHRVQRVPETEAQGRIHTSACTVAVLPEAEDIEVDINPADLKIDVYRASGAGGQHVNKTESAVRITHIPTGIVVECQDERSQIKNRAKAMKVLKTKILDGLHQEQNARIAADRKQQVGSGDRSERIRTYNFPQGRMTDHRIGLTLYRLDSLMEGDIAEVVDALRTHYQMEALKAQ 351
>gi|116749148|ref|YP_845835.1| peptide chain release factor 1 [Syntrophobacter fumaroxidans MPOB] >gi|166977370|sp|A0LIZ8|RF1_SYNFM Peptide chain release factor 1 (RF-1) >gi|116698212|gb|ABK17400.1| bacterial peptide chain release factor 1 (bRF-1) [Syntrophobacter fumaroxidans MPOB] (355 aa)
Score = 806, Expect = 5.0e-84, Identities = 169/345 (48%), Positives = 244/345 (70%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           +++ L S+ +KF  L ++L    L  + K   +I +   E  PIVE +  YK     +   ++L++ E D E+ EL + E++E K  IE  E  LK++L P+DPNDDKNVI+E+R   GG+E+++FV DLF  Y RYA+   WKV++L+  ++   G   +   +NG+  YS++KFE GVHRVQRVP TES+GR+HTS +TVAVLPE EEV++ I+ +DL++D +R+SG GGQ +N T+SAVR+THIP+G+ V CQ+ KSQ +N+  A+K+LRA+L ++ + E    I+  RK QVGTG+R+E+IRTYN+PQNRV+DHRINLTL KLD ++ G L EIID L +H +A
  S:     1 MFDRLESVAQKFRKLEEDLSNPELLANQKEYQKIAREHAEIAPIVEAYGLYKGLHRQLLDNQQLLEQETDPEMRELFRQEIAELKRQIEDTENGLKLMLAPRDPNDDKNVILEIRAGTGGEEAALFVSDLFRMYTRYAELRRWKVEILDSHQTGIGGLKEVIAAVNGQGAYSRLKFERGVHRVQRVPVTESQGRIHTSAVTVAVLPEAEEVDVYIDPNDLRVDVFRSSGPGGQSVNTTDSAVRVTHIPSGLVVICQDEKSQHKNKAKALKVLRARLLDQMQSEQEARIARDRKSQVGTGDRSERIRTYNFPQNRVSDHRINLTLYKLDIILGGALDEIIDPLSTHFQA 348
>gi|170017816|ref|YP_001728735.1| peptide chain release factor 1 [Leuconostoc citreum KM20] >gi|169804673|gb|ACA83291.1| Peptide chain release factor 1 [Leuconostoc citreum KM20] (357 aa)
Score = 806, Expect = 5.1e-84, Identities = 172/352 (48%), Positives = 248/352 (70%)
  Q:     5 EKLYNSLLSMEEKFNDLNKEL---ETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKML-EVQESSHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           + ++ SL ++ +++++LN++L   E  G   K M+ ++K   E    VE +  Y++ L DI  AE L+    D E+  LA+ +L+  KP  E  E +LK+L+LPKDPNDDKN+I+E+R AAGGDESS+F  DL   Y+RYA+   W + ++ E      GY  ++ MI G+NVYSK+KFESG HRVQRVPATE++GRVHTST TV V+PE +E++  +  SDL+ + +R+ GAGGQ++NK  +AVR+ H PTGI V  QE ++QI+NR+ A K+L +++++   ++N    ++ RK  VGTG+R+E+IRTYNYPQNRVTDHRI LTLNKLD VM G L E+ID+L+  D+  K+ E
  S:     2 DPIFQSLQTVVDRYDELNEQLADPEIAGDGQKYMA-LSKEAGEMRETVETYLHYQQVLQDIADAEDLLD---DAEMAPLAKEDLNTLKPEKEALESQLKILMLPKDPNDDKNIIMEIRGAAGGDESSLFAADLLDMYRRYAEKQRWTLSIIDETLTEVGGYKEVAVMITGDNVYSKLKFESGAHRVQRVPATETQGRVHTSTATVGVMPEFQEIDFELAESDLEEEFFRSGGAGGQNVNKVSTAVRLVHKPTGIMVKMQEERTQIKNRDKARKLLASRVYDFYAQQNEAEYAEKRKSAVGTGDRSERIRTYNYPQNRVTDHRIGLTLNKLDRVMNGELGEVIDALVIADQTAKLAE 353
>gi|194335257|ref|YP_002017051.1| peptide chain release factor 1 [Pelodictyon phaeoclathratiforme BU-1] >gi|194307734|gb|ACF42434.1| peptide chain release factor 1 [Pelodictyon phaeoclathratiforme BU-1] (357 aa)
Score = 806, Expect = 5.2e-84, Identities = 167/349 (47%), Positives = 244/349 (69%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGLSVK--RMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGF--ISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQ 355
           + + L S++EK  DL + L     +    R  ++NK   +   IV+ +  Y  T  ++D + +L+KSE D E+ EL Q E+SE +  + + E +LK+LLLPK+  D +NVI+E+R   GG+E+++F  DL   Y+RYA+  GW+ + L   ESS   GF  I+  +NG +VY  MK+ESGVHRVQRVP TE++GR+HTS ++VAVLPE EEV++ I   DL+ DTYR+ G GGQ++NK E+AVRITH+PTGI  ACQE +SQ++N+E AM+MLR KL++ +  E ++  +DLR+  V TG+R+ KIRTYNYPQ+RVTDHRI  T + L  ++ G+L +II++L  HD+A ++Q
  S:     1 MLDKLQSIKEKHLDLEQLLSDPNAAADQVRFRKLNKEYSDLREIVQAYDLYAATKTELDESRQLLKSESDAEMKELVQAEISELQKKLPELEQQLKILLLPKEEADSRNVIIEIRAGTGGEEAALFAADLTRMYQRYAEHQGWQCETLHFNESSVPGGFREITLSVNGHDVYGTMKYESGVHRVQRVPDTETQGRIHTSAVSVAVLPEAEEVDVEIRREDLRFDTYRSGGKGGQNVNKVETAVRITHMPTGIVSACQEQRSQLQNKERAMQMLRTKLYDIQLAEQQQQRADLRRSMVTTGDRSAKIRTYNYPQSRVTDHRIAFTSHALPQILQGDLQDIINALKMHDQAARLQ 353
>gi|91776824|ref|YP_546580.1| peptide chain release factor 1 [Methylobacillus flagellatus KT] >gi|119361559|sp|Q1GYE8|RF1_METFK Peptide chain release factor 1 (RF-1) >gi|91710811|gb|ABE50739.1| bacterial peptide chain release factor 1 (bRF-1) [Methylobacillus flagellatus KT] (360 aa)
Score = 805, Expect = 5.9e-84, Identities = 169/345 (48%), Positives = 245/345 (71%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGLS--VKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEV-ELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           +   L ++ E+ ++LN+ L +E ++  +    +I +   E TPIVE+F+ Y++   DI  A+ ++    D E+ E AQ E    K  ++  E +L+ LLLPKDPND++N+ +E+R   GGDES++F GDLF  Y RYA+  GWKV+++   ES   GY  I   I G   YSK+KFESG HRVQRVP TE++GR+HTS  TVAVLPE++EV ++ IN +D++IDT+RASGAGGQHINKT+SAVRITH PTGI V CQ+G+SQ  N+  AM++L A++  K+ +E +  I+  R+  +G+G+R+E+IRTYNYPQ R+TDHRINLTL K+D +  G++ E+I++L +  +A
  S:     5 MIKKLATLSERLDELNRLLSSEDVTNDIDNYRKITREHAEITPIVEQFRAYEQAEIDIKEAQAMLA---DPEMKEFAQEETEAGKQKLDDIEKQLQKLLLPKDPNDERNIFLEIRAGTGGDESALFAGDLFRMYSRYAERQGWKVEIVSANESEVGGYKEIIAKIEGFGAYSKLKFESGGHRVQRVPETETQGRIHTSACTVAVLPEVDEVSDVTINPADIRIDTFRASGAGGQHINKTDSAVRITHFPTGIVVECQDGRSQHSNKAQAMQVLAARIKAKQVDEQQSKIASERRSLIGSGDRSERIRTYNYPQGRITDHRINLTLYKIDAITEGDMDELINALAAEHQA 350
>gi|124004130|ref|ZP_01688976.1| peptide chain release factor 1 [Microscilla marina ATCC 23134] >gi|123990200|gb|EAY29699.1| peptide chain release factor 1 [Microscilla marina ATCC 23134] (356 aa)
Score = 804, Expect = 7.1e-84, Identities = 173/349 (49%), Positives = 259/349 (74%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGLSVKRM---SEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQE-SSHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQ 355
           + + L +++E+F+++  +L  +  +++ M   +++ K  K+   +VEK+ EYK  L +ID++++++ +EKD E+ E+A++EL E  P  EK E ELK LL+PKDPND KNVI+E+R  AGGDE++IF GDL   Y+R+A+   WK ++++  + SS G+  +   I+GE+VY  MK+ESGVHRVQRVPATE++GRVHTS  +VAVLPE+E+VE+ I+ SD++ D + +SG GGQ +N T SAVR+THIPTGI V+CQ+ KSQI+N+  AMK+LR+KL+E +  + ++ +   RK  VG+G+R++KIRTYNYPQ RVTDHRI  T++ L NVM G +++ I+SL   D A KM+
  S:     1 MIDKLEAIKERFDEVG-QLIVKPETIQDMDLYTKLTKEYKDLEKVVEKYNEYKIVLENIDTSKEILSTEKDPEMKEMAKMELEELNPQKEKIEEELKTLLIPKDPNDSKNVILEIRGGAGGDEAAIFAGDLLRMYQRFAEKRKWKFELMDFTDGSSGGFKEVVCSISGEDVYGMMKYESGVHRVQRVPATETQGRVHTSAASVAVLPEMEDVEVNIDPSDVRSDYFCSSGPGGQSVNTTYSAVRLTHIPTGIVVSCQDEKSQIKNKAKAMKVLRSKLYEIELSKQQEELGAQRKSMVGSGDRSDKIRTYNYPQGRVTDHRIKYTVHNLPNVMDGEIADFIESLRLADNAEKMK 352
>gi|192809077|ref|ZP_03037752.1| peptide chain release factor 1 [Geobacillus sp. Y412MC10] >gi|192801748|gb|EDV78253.1| peptide chain release factor 1 [Geobacillus sp. Y412MC10] (355 aa)
Score = 803, Expect = 9.7e-84, Identities = 158/325 (48%), Positives = 238/325 (73%)
  Q:    33 KRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQEA 357
           K++ + +K   +  P  E + EYK  + ++++A+ +   + D+E+ E+ ++E+ E     ++    +++LLLPKDPNDDKNVI+E+R AAGGDE+++F  DL+  Y RYAD+ GWKV++++V  +   G+  + FMING   YSKMKFESG HRVQR+P TES GR+HTST TVAV+PE EEV++ I++ D+++DT+ +SGAGGQ +N T+SAVR+THIPTGI   CQ+GKSQ  N+E A+++LRA++++   +E     +  RK +VGTG+R+E+IRTYN+PQ+RVTDHRI LT++KLD VM G + EI+ +L   ++A  M++ 
  S:    29 KKLRDYSKEQSDLQPAYEAYVEYKNVIEELEAAKTMQGEKMDDEMREMVKMEIEELTQREQELAERIRILLLPKDPNDDKNVIIEIRGAAGGDEAALFASDLYRMYTRYADTQGWKVELMDVNTNDLGGFKEVIFMINGRGAYSKMKFESGAHRVQRIPTTESGGRIHTSTSTVAVMPEAEEVDIEIHDKDIRVDTFCSSGAGGQSVNTTKSAVRVTHIPTGIVATCQDGKSQNSNKEKALQVLRARIFDMMRQEEEAKYAGERKSKVGTGDRSERIRTYNFPQSRVTDHRIGLTVHKLDQVMNGEIEEIVSALTLAEQAEAMEKG 354
>gi|16801748|ref|NP_472016.1| peptide chain release factor 1 [Listeria innocua Clip11262] >gi|116873908|ref|YP_850689.1| peptide chain release factor 1 [Listeria welshimeri serovar 6b str. SLCC5334] >gi|123466615|sp|A0ALM8|RF1_LISW6 Peptide chain release factor 1 (RF-1) >gi|20139333|sp|Q927V0|RF1_LISIN Peptide chain release factor 1 (RF-1) >gi|16415223|emb|CAC97913.1| prf1 [Listeria innocua] >gi|116742786|emb|CAK21910.1| prfA [Listeria welshimeri serovar 6b str. SLCC5334] (358 aa)
Score = 803, Expect = 1.1e-83, Identities = 174/349 (49%), Positives = 256/349 (73%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQ 355
           +Y+ L ++E+++++LN+ L    +    KR+ +++K     T  VE ++EYK     ID   +L+  + D+E+ E+A+ E +E +    + E  LK+LL+PKDPNDDKNVI+E+R AAGGDE+++F GDLF  Y +YA+S GWKV++++   +   GY  I  M+NG + +S+MK+E+G HRVQRVP TES GR+HTST TVA+LPE EEVE+ +++ D++ DT+ ++GAGGQ +N T SAVR+THIPTGI V+ Q+ +SQ++N++ AMK+LRA++++K E E R+     RK  VGTG+R+E+IRTYNYPQNRVTDHRI LT+ KLD +M G L EIID+LI  D+  K++
  S:     1 MYDRLQAVEDRYDELNELLSDPDVVSDPKRLRDLSKEQSGITATVETYREYKNVNEQIDETRELLGEKLDDEMREMAKEEFAELQKEKAELEERLKLLLVPKDPNDDKNVILEIRGAAGGDEAALFAGDLFRMYSKYAESRGWKVEIMDANPTGIGGYKEIIAMMNGNDAFSRMKYENGAHRVQRVPETESGGRIHTSTATVAILPEAEEVEIELHDKDIRTDTFASTGAGGQSVNTTMSAVRLTHIPTGIVVSMQDERSQLKNKDKAMKVLRARVYDKFEREAREEYDANRKSAVGTGDRSERIRTYNYPQNRVTDHRIGLTIQKLDQIMEGKLDEIIDALILEDQTSKLE 352
>gi|116618873|ref|YP_819244.1| peptide chain release factor 1 [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|122270927|sp|Q03VA1|RF1_LEUMM Peptide chain release factor 1 (RF-1) >gi|116097720|gb|ABJ62871.1| bacterial peptide chain release factor 1 (bRF-1) [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (356 aa)
Score = 803, Expect = 1.1e-83, Identities = 170/352 (48%), Positives = 248/352 (70%)
  Q:     5 EKLYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKML-EVQESSHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           + ++ SL ++ + +++LN++L    +  + +   +++K   E    VE +  YK+ + DI  AE+L+    D E+  LA+ +LS  KP  E+ E +LK+L+LPKDPNDDKN+I+E+R AAGGDESS+F  DL   Y+RYA+   W + ++ E      GY  ++ MI G+NVYSK+KFESG HRVQRVPATE++GRVHTST TV V+PE EE++  +N SDL+ + +R+ GAGGQ++NK  +AVR+ H PTGI V  QE ++QI+NR+ A K+L +++++   ++N    +  RK  VGTG+R+E+IRTYNYPQNRVTDHRI LTLNKLD +M G L E+ID+L+  D+  K+ E
  S:     2 DPIFQSLQTVIDHYDELNEQLADPEVMNNGQHYMKLSKEAGEIRQTVEVYTRYKQVIQDIQDAEELLG---DAEMAPLAKEDLSALKPEKEQLEEQLKILMLPKDPNDDKNIIMEIRGAAGGDESSLFAADLLDMYRRYAERQNWSMSIIDESTTEVGGYKEVAVMITGDNVYSKLKFESGAHRVQRVPATETQGRVHTSTATVGVMPEFEEIDFELNESDLEEEFFRSGGAGGQNVNKVSTAVRLIHKPTGIMVKMQEERTQIKNRDKARKLLASRVYDFYAQQNESEYAAQRKSAVGTGDRSERIRTYNYPQNRVTDHRIGLTLNKLDRIMNGELGEVIDALVIADQTAKLAE 353
>gi|147679165|ref|YP_001213380.1| protein chain release factor A [Pelotomaculum thermopropionicum SI] >gi|189039982|sp|A5CYC3|RF1_PELTS Peptide chain release factor 1 (RF-1) >gi|146275262|dbj|BAF61011.1| protein chain release factor A [Pelotomaculum thermopropionicum SI] (349 aa)
Score = 803, Expect = 1.2e-83, Identities = 169/340 (49%), Positives = 243/340 (71%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLI 346
           +   L S+E+K+ +L   +    +   + R  E  K+  E   IV  +++YK+ + +I     L+K E D ++ E+AQ EL E     +  E  LK+LLLPKDPND+KNVI+E+R   GG+E+++F  DLF  Y RYA+  GW+ ++L+   +   G+  +  +I G+ VYS+MKFESGVHRVQR+P TES GR+HTS  TVAVLPE EEV++ I+  DL+ID + +SG GGQ +N T+SAVRITHIPTGI V+ Q+ KSQ +N+E AMK+LRA+L ++ ++E+++ I+  RK  VGTG+R+E+IRTYN+PQNRVTDHR+ LTL++LD+V+ G+L EIID+LI
  S:     1 MIEKLDSIEKKYEELENLIGNPEIIADIARWQEYVKAHAELADIVAVYRDYKKVVKEIQDTIALMKEEPDEDLREMAQAELDELTEKKDNLENRLKMLLLPKDPNDEKNVILEIRAGTGGEEAALFAADLFRMYSRYAERQGWRTEILDANYTDIGGFKEVISLIEGKGVYSRMKFESGVHRVQRIPTTESGGRIHTSAATVAVLPEAEEVDVQIDPDDLRIDVFCSSGHGGQSVNTTQSAVRITHIPTGIVVSMQDEKSQHKNKEKAMKVLRARLLDRVQQEHQQKIASTRKSMVGTGDRSERIRTYNFPQNRVTDHRVGLTLHRLDSVLDGDLDEIIDTLI 343
>gi|104773785|ref|YP_618765.1| peptide chain release factor 1 [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|119361552|sp|Q1GAX5|RF1_LACDA Peptide chain release factor 1 (RF-1) >gi|103422866|emb|CAI97528.1| Peptide chain release factor 1 (RF-1) [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] (361 aa)
Score = 802, Expect = 1.2e-83, Identities = 164/324 (50%), Positives = 241/324 (74%)
  Q:    33 KRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           KR  EI K   +   +V+KF+++K    +I   +++I    D E++E+A++E SE +  I + E E+K+L+LPKDPNDDK++I+E+R AAGGDE+S+F GDL   Y++YA++ GW V +++ +++   GY   + MI G  VYSK+K+E+G HRVQR+P TES GRVHTST TVAV+PE E+V++ ++  ++++D YR+SGAGGQHINKT SAVR+TH+PTGI VA Q+ +SQ +NR  AM++L++++++  E +NR      RK  VGTG+R+E+IRTYNYPQNRVTDHRI LTLNKLD +M G L E+ID+L  + +  +++E
  S:    32 KRYMEITKEEADMREVVQKFRKFKADKEEIAGNKEIIADGSDPELVEMAKMENSELEDEISQLEDEIKILMLPKDPNDDKDIIMEIRGAAGGDEASLFAGDLLRMYEKYAENQGWNVSIVDSEQTEVGGYKRAAIMITGNKVYSKLKYENGAHRVQRIPVTESAGRVHTSTATVAVMPEYEQVDIDLDPKEIRVDVYRSSGAGGQHINKTSSAVRMTHLPTGIVVAMQDQRSQQQNRAKAMEILKSRVYDYYESQNRDKYDAKRKNAVGTGDRSERIRTYNYPQNRVTDHRIGLTLNKLDRIMNGELDEVIDALTVYYQTKQLEE 356
>gi|171779352|ref|ZP_02920316.1| hypothetical protein STRINF_01197 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gi|171281969|gb|EDT47400.1| hypothetical protein STRINF_01197 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] (359 aa)
Score = 802, Expect = 1.3e-83, Identities = 177/350 (50%), Positives = 254/350 (72%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIK-SEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGFIS---FMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           +Y+ L ++E+++ +L + L    +    KR   ++K    T   V  ++EYK+ L +I+ AE++IK +  D E+ E+A+ EL + K   E YE +LK+LLLPKDPNDDKN+I+E+R AAGGDE+++F GDL   Y++YA+S GWK  ++E   S +G G I     M++G++VYSK+K+ESG HRVQRVP TES+GRVHTST TV V+PE+EEVE  I+  DL++D Y ASGAGGQ++NK  +AVR+ HIPTGI V  QE ++Q +NR+ AMK++RA++ +   +  +      RK  VGTG+R+E+IRTYN+PQNRVTDHRI LTL KLD+++ G L E+ID+LI  D+  K++E
  S:     3 IYDQLQAVEDRYEELGELLSDPDVVSDTKRFMALSKEEASTRETVTVYREYKQILQNIEDAEEMIKDAGGDPELEEMAKEELKDSKAAKEDYEEKLKILLLPKDPNDDKNIILEIRGAAGGDEAALFAGDLLQMYQKYAESQGWKFDVMEA--SYNGVGGIKEVIVMVSGQSVYSKLKYESGAHRVQRVPVTESQGRVHTSTATVLVMPEVEEVEYEIDPKDLRVDIYHASGAGGQNVNKVATAVRMVHIPTGIKVEMQEERTQQKNRDKAMKIIRARVADHFAQIAQDEQDAERKSTVGTGDRSERIRTYNFPQNRVTDHRIGLTLQKLDSILSGKLDEVIDALILFDQTKKLEE 356
>gi|170723617|ref|YP_001751305.1| peptide chain release factor 1 [Pseudomonas putida W619] >gi|169761620|gb|ACA74936.1| peptide chain release factor 1 [Pseudomonas putida W619] (360 aa)
Score = 802, Expect = 1.4e-83, Identities = 168/348 (48%), Positives = 245/348 (70%)
  Q:     7 LYNSLLSMEEKFNDLNKEL-ETEGLSVK-RMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPEL-EEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           L N L +++++F +L   L + E +S + R    ++   E  P++  +KE+++  +D++ A+ L+K + D ++ E+A  E+ E K  +   E +L+ +LLPKDPND +NV +E+R   GGDE++IF GDLF  Y RYA+  GW++++L   E  HG Y  I   + G++VY K+KFESG HRVQRVP TES+GR+HTS  TVAVLPE  E+V + IN +DL++DTYRASGAGGQH+NKT+SA+RITH+PTGI V CQE +SQ +NR  AM  L AKL + +    +  I+  RK  VG+G+R+E+IRTYNYPQ RVTDHRINLTL  LD+++ G +  +I+ L++  +A ++
  S:     5 LLNKLDTLQDRFEELTALLGDAEVISDQARFRAYSREYSEVEPVIGAYKEWRKVQDDLEGAQALLK-DADPDMREMAVEEVREAKEQLVGLESQLQRMLLPKDPNDGRNVFLEIRAGTGGDEAAIFSGDLFRMYSRYAERRGWRLEILSENEGEHGGYKEIIARVEGDSVYGKLKFESGAHRVQRVPETESQGRIHTSACTVAVLPEPDEQVAIEINPADLRVDTYRASGAGGQHVNKTDSAIRITHLPTGIVVECQEERSQHKNRARAMSWLSAKLNDMQTSAAQNAIASERKLLVGSGDRSERIRTYNYPQGRVTDHRINLTLYSLDDILAGGVDAVIEPLLAEYQADQL 355
>gi|152977515|ref|YP_001377032.1| peptide chain release factor 1 [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|189039958|sp|A7GV79|RF1_BACCN Peptide chain release factor 1 (RF-1) >gi|152026267|gb|ABS24037.1| peptide chain release factor 1 [Bacillus cereus subsp. cytotoxis NVH 391-98] (355 aa)
Score = 802, Expect = 1.4e-83, Identities = 169/352 (48%), Positives = 250/352 (71%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQEAK 358
           + + L ++E+++  LN+ L    +     ++ E +K   +    VE ++EYK     +  A+ +++ + D E+ E+ + E+S+ +   ++    LK+LL+PKDPNDDKNVIVE+R AAGGDE+++F GDL+  Y RYA+  GWK  ++E   +   GY  I FMING+  Y+K+KFE+G HRVQRVP TES GR+HTST TVAVLPE EEVE+ I+  D+++DT+ +SG GGQ +N T SAVR+TH+PTG+ V+CQ+ KSQI+N+E AMK+LRA++++K  +E +      RK  VGTG+R+E+IRTYN+PQNRVTDHRI LT+ KLD ++ G L + I++L+  D+A KM+ A+
  S:     1 MLDRLQAVEDRYEKLNELLSDPAVINDSNKLREYSKEQSDIQETVEVYREYKDVREQLQDAKAMLEDKLDAEMREMVKEEVSDLEVQEKELSDRLKILLVPKDPNDDKNVIVEIRGAAGGDEAALFAGDLYRMYSRYAEMQGWKTDIIEASYTELGGYKEIIFMINGKGAYAKLKFENGAHRVQRVPETESGGRIHTSTATVAVLPEAEEVEIDIHEKDIRVDTFASSGPGGQSVNTTMSAVRLTHLPTGVVVSCQDEKSQIKNKEKAMKVLRARIYDKFRQEAQAEYDQNRKQAVGTGDRSERIRTYNFPQNRVTDHRIGLTIQKLDQILQGKLDDFINALVMEDQAKKMEAAE 355
>gi|78221601|ref|YP_383348.1| peptide chain release factor 1 [Geobacter metallireducens GS-15] >gi|119361544|sp|Q39YQ1|RF1_GEOMG Peptide chain release factor 1 (RF-1) >gi|78192856|gb|ABB30623.1| bacterial peptide chain release factor 1 (bRF-1) [Geobacter metallireducens GS-15] (355 aa)
Score = 802, Expect = 1.5e-83, Identities = 171/349 (48%), Positives = 254/349 (72%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGLSVKR--MSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGF--ISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISH--DEAVKMQ 355
           +++ +  +E ++ +L   L    +   +    ++++   + T +VE ++ YK+ L +I+   +L+    D E+ E+A+ EL + +   E+ E E+K+LLLPKDPNDD+NVI+E+R   GGDES++F GDLF  Y R+A+   WKV+++   ES  G GF  +  +I G+ V++K+K+ESG HRVQRVP TE++GR+HTS  TVAVLPE E++E+ IN  DLKID YRASGAGGQH+NKTESAVRITH+PTGI V CQ+ +SQI+NR  AMK+L++++ +  ++E    I+  RK QVG+G+R+E+IRTYN+PQ R+TDHRI LTL +LD +M G+++E++DSL +H   EA+K Q
  S:     1 MFDKIEELEIRYQELESLLAVPTVIANQPEFRKLSREHNDLTGLVEAYRRYKKVLAEIEGNRELLA---DPEMKEMAEAELEDLERQQEELEGEIKLLLLPKDPNDDRNVILEIRAGTGGDESALFAGDLFRMYSRFAERNRWKVEVMSASESERG-GFKEVVALIEGQAVFAKLKYESGTHRVQRVPETEAQGRIHTSACTVAVLPEAEDIEIDINPVDLKIDVYRASGAGGQHVNKTESAVRITHLPTGIVVECQDERSQIKNRSKAMKVLKSRILDGLQQEQNARIAADRKQQVGSGDRSERIRTYNFPQGRMTDHRIGLTLYRLDALMEGDIAEVVDSLRAHYQMEALKAQ 351
>gi|49484342|ref|YP_041566.1| peptide chain release factor 1 [Staphylococcus aureus subsp. aureus MRSA252] >gi|82751719|ref|YP_417460.1| peptide chain release factor 1 [Staphylococcus aureus RF122] >gi|56749405|sp|Q6GEV7|RF1_STAAR Peptide chain release factor 1 (RF-1) >gi|119361615|sp|Q2YUN5|RF1_STAAB Peptide chain release factor 1 (RF-1) >gi|49242471|emb|CAG41187.1| peptide chain release factor 1 [Staphylococcus aureus subsp. aureus MRSA252] >gi|82657250|emb|CAI81691.1| peptide chain release factor 1 [Staphylococcus aureus RF122] (358 aa)
Score = 802, Expect = 1.5e-83, Identities = 182/350 (52%), Positives = 252/350 (72%)
  Q:     7 LYNSLLSMEEKFNDLNKELE-----TEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           +++ L  +EE++  LN+ L       +   +++ S+    +++T  +   +K  K  L DI   E+++    D E +E+ + E S  K  +   E ELK+LL+PKDPNDDK+VIVE+R AAGGDE++IF GDL   Y +YA+S G+K +++E  ES HG Y  ISF ++G   YSK+KFE+G HRVQRVP TES GR+HTST TVAVLPE+E+VE+ I N DLKIDTYR+SGAGGQH+N T+SAVRITH+PTG+     E KSQI+NRE AMK+L+A+L++ K +E ++  +  RK  VGTG+R+E+IRTYNYPQ+RVTDHRI LTL KL  +M G+L EIID+L   ++  K++E
  S:     1 MFDQLDIVEERYEQLNELLSDPDVVNDSDKLRKYSKEQADLQKTVDVYRNYKAKKEELADI---EEMLSETDDKEEVEMLKEESSGIKAELPNLEEELKILLIPKDPNDDKDVIVEIRAAAGGDEAAIFAGDLMRMYSKYAESQGFKTEIVEASESDHGGYKEISFSVSGNGAYSKLKFENGAHRVQRVPETESGGRIHTSTATVAVLPEVEDVEIEIRNEDLKIDTYRSSGAGGQHVNTTDSAVRITHLPTGVIATSSE-KSQIQNREKAMKVLKARLYDMKVQEEQQKYASQRKSAVGTGDRSERIRTYNYPQSRVTDHRIGLTLQKLGQIMEGHLEEIIDALTLSEQTDKLKE 352
>gi|34763568|ref|ZP_00144503.1| Bacterial Peptide Chain Release Factor 1 (RF-1) [Fusobacterium nucleatum subsp. vincentii ATCC 49256] >gi|27886757|gb|EAA23895.1| Bacterial Peptide Chain Release Factor 1 (RF-1) [Fusobacterium nucleatum subsp. vincentii ATCC 49256] (357 aa)
Score = 802, Expect = 1.5e-83, Identities = 184/345 (53%), Positives = 259/345 (75%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEV-ELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           +++ L  +  ++++LNK L +  +    K+M E NK+I E T IVEK+KEYK+ ++DI+  ++  K+EKD+++ E+   EL E +  + K E ELK+LLLPKD NDDKNVIVE+R  AGGDE+++F  DLF  Y RYA+   WK++++E Q+    G   I+F I G   YS++KFESGVHRVQRVP TE+ GR+HTST TVAVLPE+E+V E++++  DLKIDTYRA GAGGQH+N T+SAVRITH+PTGI V CQ+ +SQ++NRE AMK L  KL+E ++E+ R  +   R+ QVGTG+RAEKIRTYN+P  R+TDHRI LT+++L+  + G++ E+ID+LI+  +A
  S:     1 MFDKLEEVVARYDELNKMLVSPEVLADSKKMIECNKAINEITEIVEKYKEYKKYVDDIEFIKESFKTEKDSDMKEMLNEELKEAEEKLPKLEEELKILLLPKDKNDDKNVIVEIRAGAGGDEAALFAADLFRMYSRYAERKKWKIEIIEKQDGELGGIKEIAFTIIGLGAYSRLKFESGVHRVQRVPKTEASGRIHTSTATVAVLPEVEDVQEVIVDPKDLKIDTYRAGGAGGQHVNMTDSAVRITHLPTGIVVQCQDERSQLKNREKAMKHLLTKLYEMEQEKQRSEVESERRLQVGTGDRAEKIRTYNFPDGRITDHRIKLTVHQLEAFLDGDIDEMIDALITFHQA 349
>gi|163789460|ref|ZP_02183899.1| peptide chain release factor 1 [Carnobacterium sp. AT7] >gi|159875314|gb|EDP69379.1| peptide chain release factor 1 [Carnobacterium sp. AT7] (358 aa)
Score = 801, Expect = 1.6e-83, Identities = 170/350 (48%), Positives = 253/350 (72%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           +++ L S+E ++ +LN+ L    +    KR+ ++ K        V  ++ YK    DI   E ++  + D+E+ E+A+ EL++ K    + E ++KVL+LPKD NDD+N+I+E+R AAGGDE+ +F G LF+ Y++YAD+ GWK ++L+   +   GY  I+ MI G+NVYSK+K+E+G HRVQRVP+TES+GR+HTST TV V+PE EEVEL + + D++ D Y ASGAGGQH+NKT SAVR+TH+PTGI VA Q+ +SQI+NRE AMK+LRA++++  ++  +      RK  +GTG+R+E+IRTYNYPQ+RVTDHRI LT+ KLD ++ G L EIID+L+ +++  KM++
  S:     1 MFDRLESVEGRYEELNELLSDPEVVSDTKRLMKLTKEEAAIRETVATYRRYKEVEQDISDTEDMLGEKLDSEMAEMAKEELNDLKKEKTEIEEKMKVLMLPKDENDDRNIIMEIRGAAGGDEAQLFAGTLFNMYQKYADAQGWKTEVLDANITGIGGYKEITLMITGDNVYSKLKYENGAHRVQRVPSTESQGRIHTSTATVVVMPEAEEVELDLPDKDIRTDIYHASGAGGQHVNKTASAVRLTHLPTGIAVAMQDERSQIKNREKAMKVLRARVYDHIQQAAQSEYDAERKSAIGTGDRSERIRTYNYPQSRVTDHRIGLTIQKLDQILSGKLDEIIDALVLNEQTAKMEQ 353
>gi|57238625|ref|YP_179756.1| peptide chain release factor 1 [Campylobacter jejuni RM1221] >gi|73621534|sp|Q5HSH9|RF1_CAMJR Peptide chain release factor 1 (RF-1) >gi|57167429|gb|AAW36208.1| peptide chain release factor 1 [Campylobacter jejuni RM1221] (355 aa)
Score = 801, Expect = 1.7e-83, Identities = 180/351 (51%), Positives = 253/351 (72%)
  Q:     9 NSLLSMEEKFNDLNKELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVML-GNLSEIIDSLISHDEAVKMQEAKI 359
           NSLLS  +  ND++K           M+ ++K  K   PIV K KEY +TL++I+  + L+    D E+ ELA+ EL   + L  K E E+K+LLLPKDPND++N+ +E+R  AGGDE+S+FVGDL  AY RYA++ G+K++++   E S  G+  I  ++ G   YS++K+E G HRVQRVP TES+GRVHTS ITVAV+PE++++E+ IN +DLK+D  R+SG GGQ +N T+SAVRITHIPTGI V  Q+GKSQ +N+E+AMK+L+A+L+E +E E     S+ RK QVG+G+R+E+IRTYN+PQNR++DHRINLTL +LD +M  G   EII+ LI+H +A  +QE  +
  S:    17 NSLLSSSDIINDISK-----------MTTLSKEQKNLEPIVLKAKEYLKTLDNIEENKALLN---DPELGELAKEELKTLEELKPKLEEEIKILLLPKDPNDERNIFLEIRAGAGGDEASLFVGDLVKAYARYAENRGYKLEIVSSSEGSVGGFKEIIMLVKGTGAYSRLKYEGGTHRVQRVPQTESQGRVHTSAITVAVMPEVDDIEIEINPNDLKVDVMRSSGHGGQSVNTTDSAVRITHIPTGIVVVNQDGKSQHKNKESAMKVLKARLYEMQESERLAKESEARKSQVGSGDRSERIRTYNFPQNRISDHRINLTLYRLDAIMQDGLFDEIIEPLITHHQAQALQEQNL 355
>gi|46576766|sp|Q812I4|RF1_BACCR Peptide chain release factor 1 (RF-1) (355 aa)
Score = 801, Expect = 1.9e-83, Identities = 169/352 (48%), Positives = 249/352 (70%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQEAK 358
           + + L ++E ++  LN+ L    +     ++ E +K   +    VE ++EYK     +  A+ +++ + D E+ E+ + E+SE +   +     LK+LL+PKDPNDDKNVIVE+R AAGGDE+++F GDL+  Y RYA+  GWK +++E   +   GY  I FMING+  ++K+KFE+G HRVQRVP TES GR+HTST TVAVLPE EEVE+ I+  D+++DT+ +SG GGQ +N T SAVR+TH+PTG+ V+CQ+ KSQI+N+E AMK+LRA++++K  +E +      RK  VGTG+R+E+IRTYN+PQNRVTDHRI LT+ KLD ++ G L + I++L+  D+A KM+ A+
  S:     1 MLDRLQAVENRYEKLNELLSDPAIISDSNKLREYSKEQSDIQETVEVYREYKDVREQLKDAKAMLEDKLDAEMREMVKEEVSELESQDKTLSERLKILLVPKDPNDDKNVIVEVRGAAGGDEAALFAGDLYRMYSRYAEVQGWKTEIIEASYTELGGYKEIIFMINGKGAFAKLKFENGAHRVQRVPETESGGRIHTSTATVAVLPEAEEVEIDIHEKDVRVDTFASSGPGGQSVNTTMSAVRLTHLPTGVVVSCQDEKSQIKNKEKAMKVLRARVYDKFRQEAQAEYDQNRKQAVGTGDRSERIRTYNFPQNRVTDHRIGLTIQKLDQILQGKLDDFINALVMEDQAQKMEAAE 355
>gi|152991659|ref|YP_001357380.1| peptide chain release factor 1 [Sulfurovum sp. NBC37-1] >gi|166223612|sp|A6Q6B4|RF1_SULNB Peptide chain release factor 1 (RF-1) >gi|151423520|dbj|BAF71023.1| peptide chain release factor 1 [Sulfurovum sp. NBC37-1] (355 aa)
Score = 801, Expect = 2.0e-83, Identities = 169/342 (49%), Positives = 254/342 (74%)
  Q:    16 EKFNDLNKELETEGLS--VKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQE-SSHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVM-LGNLSEIIDSLISHDEAVKMQEA 357
           +++N++++ L +  ++  + RM+E++K      P+VEK   Y  T + I   ++L+    D E+ +LA+ ELSE +P++ K E E+K+L++PKD NDDKN+ +E+R  AGGDES++FV D+F  Y RYA+ +GWKV+++   + ++ GY  +   I G+ VYS++K+E+G HRVQRVP TE++GRVHTS ITVAV+PE+++VE+ I  +++K+D YR+SG GGQ +N T+SAVR+THIPTGI VA Q+ KSQ +NR+ AMK+L+A+++E + ++     +  RK QVG+G+R+EKIRTYNYPQNR+TDHRI LTL  LD+VM  GNL  +ID LI+H +   +QEA
  S:    11 DRYNEISELLSSPDIASDINRMTELSKEQSGLAPLVEKANLYIETADAIAENKELLS---DEELGDLAKEELSELEPMLPKLEEEIKILMIPKDKNDDKNIFLELRAGAGGDESALFVADVFRMYSRYAEQMGWKVEIVSTNDGTAGGYKELIAEIKGQGVYSQLKYEAGTHRVQRVPDTETQGRVHTSAITVAVIPEVDDVEVDIKPNEVKMDVYRSSGCGGQSVNTTDSAVRLTHIPTGIVVAIQDEKSQHKNRDKAMKVLKARVYESELQKQLDETAGQRKLQVGSGDRSEKIRTYNYPQNRLTDHRIGLTLYALDDVMNNGNLKLVIDPLIAHAQTEAIQEA 353
>gi|163762328|ref|ZP_02169393.1| 3-hydroxybutyryl-CoA dehydrogenase [Bacillus selenitireducens MLS10] >gi|160357067|gb|EDP83715.1| 3-hydroxybutyryl-CoA dehydrogenase [Bacillus selenitireducens MLS10] (356 aa)
Score = 800, Expect = 2.0e-83, Identities = 172/352 (48%), Positives = 254/352 (72%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQEAK 358
           +++ L S+E ++  LN+ L    +     ++ + +K        VE +++YK   + ++  +++++   D+E+ E+A++EL E +  + + E +L+VLL+PKDPNDDKNVIVE+R AAGGDE+++F GDL+  Y RYA+S GWK  ++E  E+   GY  I F ING   YSKMKFE+G HRVQRVPATES GR+HTST TVAVLPE E+VE+ I+  D+++D + +SG GGQ +N T SAVR+TH PTGI V+CQ+ KSQI+N+E AMK+LRA++++K + E +    + RK  VGTG+R+E+IRTYN+PQ+RVTDHRI LT+ KLD ++ G L EII++LI  +++  M+ A+
  S:     1 MFDRLESVENRYEQLNELLMDPAVMNDTDKLRDYSKEQSGLQETVEAYRQYKDIKSQVEDTKEMLRDHLDDEMREMAKMELDELETELGELEEKLRVLLIPKDPNDDKNVIVEVRGAAGGDEAALFAGDLYRMYHRYAESQGWKTDVIEASETGIGGYKEIVFTINGTGAYSKMKFENGAHRVQRVPATESGGRIHTSTATVAVLPEAEDVEVDISEKDIRVDRFASSGPGGQSVNTTMSAVRLTHEPTGIVVSCQDEKSQIKNKEKAMKVLRARIYDKYQREAQAEYDENRKSAVGTGDRSERIRTYNFPQSRVTDHRIGLTIQKLDQILEGKLDEIIEALIVEEQSRMMENAQ 355
>gi|78187994|ref|YP_378332.1| peptide chain release factor 1 [Chlorobium chlorochromatii CaD3] >gi|119361520|sp|Q3AUE2|RF1_CHLCH Peptide chain release factor 1 (RF-1) >gi|78170193|gb|ABB27289.1| bacterial peptide chain release factor 1 (bRF-1) [Chlorobium chlorochromatii CaD3] (357 aa)
Score = 800, Expect = 2.3e-83, Identities = 165/349 (47%), Positives = 245/349 (70%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGLS--VKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGFISFM--INGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQ 355
           + + L +++EK  DL + L    L+   +R  ++N+       +V+ F  Y+R   ++++A+ L+ +E D E+  LA+ E+ E +  + + E  LK+LLLPK+  D +NVI+E+R   GGDE+S+F  DL   Y+RYA+  GW+ K+L+  ESS   GF   +  I+G NV+  MK+ESGVHRVQRVP TE++GR+HTS ++VAVLPE EEV++ I   DL+ DTYR+ G GGQ++NK E+AVRITH+PTGI  ACQE +SQ++N+E AM+MLR KL++ +  E ++  +DLR+  V TG+R+ KIRTYNYPQ+RVTDHRI  T + L  +M G L E+I++LI HD+A +++
  S:     1 MLDKLQAIKEKHLDLEQALSDPSLANDQERFRKLNREYSNLREVVQAFDAYQRKATELEAAQHLLATESDTEMKALAEAEVDELQETVAELEQGLKILLLPKEEADSRNVIIEIRAGTGGDEASLFAADLTRMYQRYAEQKGWQYKVLDYNESSVPGGFKEMILEISGNNVFGTMKYESGVHRVQRVPDTEAQGRIHTSAVSVAVLPEAEEVDVEIRRDDLRFDTYRSGGKGGQNVNKVETAVRITHMPTGIVAACQEERSQLQNKERAMQMLRTKLYDIQLAEQQQQRADLRRTMVATGDRSAKIRTYNYPQSRVTDHRIGFTSHALPQIMQGELHEVIEALIMHDQAERLK 353
>gi|154174699|ref|YP_001407404.1| peptide chain release factor 1 [Campylobacter curvus 525.92] >gi|166223540|sp|A7GW12|RF1_CAMC5 Peptide chain release factor 1 (RF-1) >gi|112802322|gb|EAT99666.1| peptide chain release factor 1 [Campylobacter curvus 525.92] (355 aa)
Score = 800, Expect = 2.4e-83, Identities = 168/326 (51%), Positives = 239/326 (73%)
  Q:    32 VKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQE-SSHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNL-SEIIDSLISHDEAVKMQEA 357
           +++M++++K      PI     +Y +TL+DI+  + L+    D E+ ELA+ EL   +   E+ E E+K+LLLPKDPNDDKN+ +E+R   GGDE+++FVGDLF+AY RYAD  G+K +++   E S+ G+  I  +I G+  YS++KFE G HRVQRVP TES+GRVHTS +TVA++PE+E+ E+ IN +DL+ID  R+SG GGQ +N T+SAVRITHIPTG+ V  Q+GKSQ +N+E AMK+L+A+L+E +E E     +  RK QVGTG+R+ +IRTYN+PQNR++DHRINLTL +LD +M G L  EII+ LI+H +A  + +A
  S:    29 IEKMTKLSKEQSSIEPIKNAASQYLQTLDDIEENKALLD---DAELGELAREELKSAQIRKEELENEIKILLLPKDPNDDKNIFLEIRAGTGGDEAALFVGDLFNAYIRYADLRGYKFEIVSQSEGSAGGFKEIILLIKGKGAYSRLKFEGGTHRVQRVPETESQGRVHTSAVTVAIMPEVEDSEIEINPNDLRIDVMRSSGHGGQSVNTTDSAVRITHIPTGLVVTNQDGKSQHKNKEAAMKVLKARLYEMQEAERIAKETSERKSQVGTGDRSGRIRTYNFPQNRISDHRINLTLYRLDAIMAGGLFDEIIEPLIAHHQAEAITDA 353
>gi|150388171|ref|YP_001318220.1| peptide chain release factor 1 [Alkaliphilus metalliredigens QYMF] >gi|166977357|sp|A6TK43|RF1_ALKMQ Peptide chain release factor 1 (RF-1) >gi|149948033|gb|ABR46561.1| peptide chain release factor 1 [Alkaliphilus metalliredigens QYMF] (357 aa)
Score = 800, Expect = 2.5e-83, Identities = 173/352 (49%), Positives = 257/352 (73%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGLSVKRMSEINKSIKETT---PIVEKFKEYKRTLNDIDSAEKLIKSE-KDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEV-ELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQEAK 358
           + + L  ++EK+ DL +++    + +    +  K IKE +   PIV K++EYK T   +   ++++  +  D E+ E+A++E+ E +  I + E +LKV+LLP DPNDDKNVIVE+R  AGGDE+ +F   LF  Y RYA+  GWKV+M+ + ES   GY  + FMI G+  YS++K+ESG HRVQR+P TES GR+HTST TV ++PE E+V E+ I+ ++L+ID +R+SG GGQ +N T+SAVRITH+PTG+ V+CQ+GKSQ++N+E AMK+L+++L ++  +E    IS  R+ +VGTG+R+E+IRTYN+PQ RVTDHRIN+T+ KLD  + G ++E+IDSLI+  +A KMQE +
  S:     1 MLDKLAFLQEKYEDLGEKISDPEI-INDQVQWQKLIKEHSEIEPIVMKYREYKTTQQALGETKEIMHDKATDAELKEMAKMEVEELEESIVEMEEQLKVMLLPTDPNDDKNVIVEIRGGAGGDEAGLFAAVLFRMYTRYAERSGWKVEMMSLNESGVGGYKEVIFMIKGKGAYSQLKYESGAHRVQRIPTTESGGRIHTSTATVVIMPEAEDVGEVNIDTNELRIDVFRSSGNGGQSVNTTDSAVRITHLPTGLVVSCQDGKSQLKNKEKAMKVLKSRLLDQMIQEQDAEISQDRRSKVGTGDRSERIRTYNFPQGRVTDHRINVTVYKLDAFLDGEINEMIDSLITSAQAEKMQEVQ 357
>gi|19704667|ref|NP_604229.1| peptide chain release factor 1 [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >gi|22096034|sp|Q8R5W0|RF1_FUSNN Peptide chain release factor 1 (RF-1) >gi|19714975|gb|AAL95528.1| Bacterial Peptide Chain Release Factor 1 (RF-1) [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] (365 aa)
Score = 800, Expect = 2.5e-83, Identities = 183/346 (52%), Positives = 260/346 (75%)
  Q:     6 KLYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEV-ELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           K+++ L  +  ++++LNK L +  +    K+M E NK+I E T IVEK+KEYK+ ++DI+  ++  K+EKD+++ E+   EL E +  + K E ELK+LLLPKD NDDKNVIVE+R  AGGDE+++F  DLF  Y RYA+   WK++++E Q+   +G   I+F I G   YS++KFESGVHRVQRVP TE+ GR+HTST TVAVLPE+E++ E+ ++  DLKIDTYR+ GAGGQH+N T+SAVRITH+PTGI V CQ+ +SQ++NRE AMK L  KL+E ++E+ R  +   R+ QVGTG+RAEKIRTYN+P  R+TDHRI LT+++L+  + G++ E+ID+LI+  +A
  S:     8 KMFDKLEEVVARYDELNKMLVSPEVLADSKKMIECNKAINEITEIVEKYKEYKKYVDDIEFIKESFKTEKDSDMKEMLNEELKEAEEKLPKLEEELKILLLPKDKNDDKNVIVEIRGGAGGDEAALFAADLFRMYSRYAERKKWKIEIIEKQDGELNGLKEIAFTIIGLGAYSRLKFESGVHRVQRVPKTEASGRIHTSTATVAVLPEVEDIQEVTVDPKDLKIDTYRSGGAGGQHVNMTDSAVRITHLPTGIVVQCQDERSQLKNREKAMKHLLTKLYEMEQEKQRSEVESERRLQVGTGDRAEKIRTYNFPDGRITDHRIKLTVHQLEAFLDGDIDEMIDALITFHQA 357
>gi|30023360|ref|NP_834991.1| peptide chain release factor 1 [Bacillus cereus ATCC 14579] >gi|29898921|gb|AAP12192.1| Bacterial Peptide Chain Release Factor 1 (RF-1) [Bacillus cereus ATCC 14579] (358 aa)
Score = 800, Expect = 2.6e-83, Identities = 169/350 (48%), Positives = 248/350 (70%)
  Q:     9 NSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQEAK 358
           + L ++E ++  LN+ L    +     ++ E +K   +    VE ++EYK     +  A+ +++ + D E+ E+ + E+SE +   +     LK+LL+PKDPNDDKNVIVE+R AAGGDE+++F GDL+  Y RYA+  GWK +++E   +   GY  I FMING+  ++K+KFE+G HRVQRVP TES GR+HTST TVAVLPE EEVE+ I+  D+++DT+ +SG GGQ +N T SAVR+TH+PTG+ V+CQ+ KSQI+N+E AMK+LRA++++K  +E +      RK  VGTG+R+E+IRTYN+PQNRVTDHRI LT+ KLD ++ G L + I++L+  D+A KM+ A+
  S:     6 DRLQAVENRYEKLNELLSDPAIISDSNKLREYSKEQSDIQETVEVYREYKDVREQLKDAKAMLEDKLDAEMREMVKEEVSELESQDKTLSERLKILLVPKDPNDDKNVIVEVRGAAGGDEAALFAGDLYRMYSRYAEVQGWKTEIIEASYTELGGYKEIIFMINGKGAFAKLKFENGAHRVQRVPETESGGRIHTSTATVAVLPEAEEVEIDIHEKDVRVDTFASSGPGGQSVNTTMSAVRLTHLPTGVVVSCQDEKSQIKNKEKAMKVLRARVYDKFRQEAQAEYDQNRKQAVGTGDRSERIRTYNFPQNRVTDHRIGLTIQKLDQILQGKLDDFINALVMEDQAQKMEAAE 358
>gi|160893851|ref|ZP_02074634.1| hypothetical protein CLOL250_01405 [Clostridium sp. L2-50] >gi|156864503|gb|EDO57934.1| hypothetical protein CLOL250_01405 [Clostridium sp. L2-50] (358 aa)
Score = 799, Expect = 2.8e-83, Identities = 174/350 (49%), Positives = 252/350 (72%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           +++ L  + ++ + LN +L    +     +  ++ K   E TPIVEK+KEYK     I+ +  +++ E D E+ E+A+ EL+E K  +EK E ELK+LLLPKDPND KNVIVE+R  AGGDE+++F  +++  Y++Y D   WKV+++ V E+   G+    FMI G+  YSKMK+ESGVHRVQR+P TES GR+HTST+TVAV+PE EEV++ IN +D++ID  RASG GGQ +N T+SAVR+THIPTGI +  Q  KSQ++N+  A  +LR+KL++ + ++     +  RK Q+GTG+R+EKIRTYN+P+ RVTDHRI LTL KL+ ++ G+L+EIIDSLI+ D+A K+ +
  S:     1 MFDKLEDLVDRLDTLNNQLTDPDIVSDQNKFRKLMKEQSELTPIVEKYKEYKDAKQTIEDSLLMLEEENDEELREMAKEELNEAKATVEKTENELKILLLPKDPNDSKNVIVEIRAGAGGDEAALFAYEIYRMYQKYVDQFKWKVELMSVNENGIGGFKEAVFMITGDGAYSKMKYESGVHRVQRIPKTESGGRIHTSTVTVAVMPEAEEVDVEINENDIRIDVMRASGNGGQCVNTTDSAVRLTHIPTGIVIYSQTEKSQLQNKAKAFALLRSKLYDMELQKQHDAEAADRKSQIGTGDRSEKIRTYNFPEGRVTDHRIKLTLYKLEQILNGDLNEIIDSLIAADQAAKLSQ 353
>gi|51246578|ref|YP_066462.1| peptide chain release factor 1 [Desulfotalea psychrophila LSv54] >gi|61214607|sp|Q6AJM5|RF1_DESPS Peptide chain release factor 1 (RF-1) >gi|50877615|emb|CAG37455.1| probable peptide chain release factor 1 (RF-1) [Desulfotalea psychrophila LSv54] (357 aa)
Score = 799, Expect = 2.9e-83, Identities = 168/341 (49%), Positives = 250/341 (73%)
  Q:    16 EKFNDLNKELE------TEGLSVKRMSEINKSIKE---TTPIVEKFKEYKRTLNDIDSAEKLIKSE-KDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQE-SSHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           +KF+DL+  +E      ++   V    E  K ++E    + +   +KEYK    D++  + ++  + +D ++ ELA+ EL E    I + +  +K++LLPKDPND+KN  +E+R  AGGDE+++FV DLF  Y R+A+++GWKV+++        G+  I  +I+GE V+SK+K+ESGVHRVQRVP TE++GR+HTS +TVA+LPE EEVEL I+ ++LK D +R+SG GGQ +N T+SAVRITH+PTG+ V CQ+ KSQ +N+  A+ +LRA+L +K E E+   IS+ R+ QVGTG+R+E+IRTYN+PQ RVTDHRINLTL KL+ +M G+L E+I  LI+HD+A K+++
  S:     4 DKFDDLDNRIEHLEGKLSDPEIVNDQKEFQKVVREHAHLSKLNTVYKEYKTACQDVEDNKAILHDDGEDPDLKELAKAELEELNVRIVELDKAIKIILLPKDPNDEKNTFLEIRAGAGGDEAALFVADLFRMYTRFAETMGWKVEVMSSNPLGIGGFKEIIALISGEQVFSKLKYESGVHRVQRVPETETQGRIHTSAVTVAILPEAEEVELHIDMNELKFDVFRSSGPGGQSVNTTDSAVRITHLPTGLVVICQDEKSQHKNKVKALTVLRARLLDKLESEHNAKISEARRSQVGTGDRSERIRTYNFPQGRVTDHRINLTLYKLETIMGGSLDEVIYPLITHDQAEKLKD 355
>gi|116493078|ref|YP_804813.1| peptide chain release factor 1 [Pediococcus pentosaceus ATCC 25745] >gi|116103228|gb|ABJ68371.1| bacterial peptide chain release factor 1 (bRF-1) [Pediococcus pentosaceus ATCC 25745] (359 aa)
Score = 799, Expect = 2.9e-83, Identities = 173/343 (50%), Positives = 249/343 (72%)
  Q:    16 EKFNDLNKELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQEAK 358
           E+ ++L  + E  G S +R  E++K   E    VEK++EY++T++ I   E+L + + D E+  L + EL+E +      E E+K+L+LP DPNDDKN+I+E+  AAGGDE+S+F  DL++ Y RYA++ GWKV++++   +   G+  I  MI+G  VYSK+K+E+G HRVQRVP TES GRVHTST TV V+PE E+V++ I+  D++ D YR+SGAGGQHINKT SAVR+TH+PTGI VA Q+ +SQ +NRE AM++L+A++++  + +     +  RK  VGTG+R+E+IRTYN+PQNRVTDHRI LTLNKLD VM G L +IID+LI  D+A K+++ +
  S:    15 EELSELLADPEVLGDS-QRYQELSKEEGEIRETVEKYREYRKTVDAIAENEELQREKLDPEMDSLVKAELAELRETKATLEEEIKILMLPTDPNDDKNIIMEIHGAAGGDEASLFAADLYNMYTRYAETQGWKVEVVDENATDVGGFKEIVLMISGNKVYSKLKYENGAHRVQRVPVTESAGRVHTSTSTVGVMPEAEDVDIEIDQKDIRTDVYRSSGAGGQHINKTSSAVRMTHLPTGIVVAMQDERSQQQNREKAMRILKARVYDYYQTQEEDAYNAERKSAVGTGDRSERIRTYNFPQNRVTDHRIGLTLNKLDRVMNGELDDIIDALILDDQAKKVEQLR 357
>gi|86152633|ref|ZP_01070838.1| peptide chain release factor 1 [Campylobacter jejuni subsp. jejuni HB93-13] >gi|85843518|gb|EAQ60728.1| peptide chain release factor 1 [Campylobacter jejuni subsp. jejuni HB93-13] (355 aa)
Score = 799, Expect = 3.0e-83, Identities = 179/351 (50%), Positives = 252/351 (71%)
  Q:     9 NSLLSMEEKFNDLNKELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVML-GNLSEIIDSLISHDEAVKMQEAKI 359
           NSLLS  +  ND++K           M+ ++K  K   PIV K KEY +TL++I+  + L+    D E+ ELA+ EL   + L  K E E+K+LLLPKDPND++N+ +E+R   GGDE+S+FVGDL  AY RYA++ G+K++++   E S  G+  I  ++ G   YS++K+E G HRVQRVP TES+GRVHTS ITVAV+PE++++E+ IN +DLK+D  R+SG GGQ +N T+SAVRITHIPTGI V  Q+GKSQ +N+E+AMK+L+A+L+E +E E     S+ RK QVG+G+R+E+IRTYN+PQNR++DHRINLTL +LD +M  G   EII+ LI+H +A  +QE  +
  S:    17 NSLLSSSDIINDISK-----------MTTLSKEQKNLEPIVLKVKEYLKTLDNIEENKALLN---DPELGELAKEELKTLEELKPKLEEEIKILLLPKDPNDERNIFLEIRAGTGGDEASLFVGDLVKAYARYAENRGYKLEIVSSSEGSVGGFKEIIMLVKGTGAYSRLKYEGGTHRVQRVPQTESQGRVHTSAITVAVMPEVDDIEIEINPNDLKVDVMRSSGHGGQSVNTTDSAVRITHIPTGIVVVNQDGKSQHKNKESAMKVLKARLYEMQESERLAKESEARKSQVGSGDRSERIRTYNFPQNRISDHRINLTLYRLDAIMQDGLFDEIIEPLITHHQAQALQEQNL 355
>gi|189345639|ref|YP_001942168.1| peptide chain release factor 1 [Chlorobium limicola DSM 245] >gi|189339786|gb|ACD89189.1| peptide chain release factor 1 [Chlorobium limicola DSM 245] (357 aa)
Score = 799, Expect = 3.0e-83, Identities = 162/353 (45%), Positives = 243/353 (68%)
  Q:     7 LYNSLLSMEEKFNDLNKELE--TEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGF--ISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQEAKI 359
           +++ L S++EK  DL ++L   +      R  ++NK   +   IV  F  Y      ++ + +L+ SEKD ++ EL Q+E+ + +  + + E +LKVLLLPKD  D +NVI+E+R   GGDE+++F  DL   Y+RYA+  GWK  +L+  ESS   GF  ++  ++G +V++ MK+ESGVHRVQRVP TE++GR+HTS  +VAVLPE EEV++ I   DL+ DTYR+ G GGQ++NK E+AVRITH+PTGI  ACQE +SQ++N+E AM MLR KL++ +  E ++  +DLR+  V TG+R+ KIRTYNYPQ+RVTDHRI  T + L  +M G + ++I++L  HD+  ++Q  ++
  S:     1 MFDKLQSIKEKHLDLEQQLADPSAASDQNRFRKLNKEYSDLKEIVHAFDRYSLARKQLEESRELLGSEKDPQMRELVQMEIEDLQEKLPELEQQLKVLLLPKDEADSRNVIMEIRAGTGGDEAALFAADLLRMYQRYAERQGWKCVLLDYTESSVPGGFREVTLEVSGHDVFATMKYESGVHRVQRVPDTETQGRIHTSAASVAVLPEAEEVDVEIRRDDLRFDTYRSGGKGGQNVNKVETAVRITHLPTGIVAACQEERSQLQNKERAMTMLRTKLYDIQLAEQQQQRADLRRSMVSTGDRSAKIRTYNYPQSRVTDHRIGFTSHALPQIMQGEIGDVIEALKLHDQTARLQAEQV 357
>gi|81428746|ref|YP_395746.1| peptide chain release factor 1 [Lactobacillus sakei subsp. sakei 23K] >gi|119361554|sp|Q38WJ4|RF1_LACSS Peptide chain release factor 1 (RF-1) >gi|78610388|emb|CAI55438.1| Peptide chain release factor 1 [Lactobacillus sakei subsp. sakei 23K] (365 aa)
Score = 799, Expect = 3.0e-83, Identities = 167/352 (47%), Positives = 250/352 (71%)
  Q:     5 EKLYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKML-EVQESSHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           +K++  L  + +++ +L + +    +     R  E++K       IV K+   K  L+++   E+L++   D+E+ EL + +L E +    + E E+K+L+LP DPND+KN+I+E+R AAGGDE+S+F GDL + Y+RYA+S  W+ +++ E      G+  ++ MI G+NVYSK+K+E+G HRVQR+P TES+GRVHTST TVAV+PE + V++ +   D+++D YRASGAGGQHINKT SAVR+THIPTGI VA Q+ +SQ +NR  AMK+L+A++++  E +N+      RK  VG+G+R+E+IRTYNYPQNRVTDHRI LTLNKLD +M G L ++ID+LI  D+  K+++
  S:     2 DKMFEQLDGLLDRYAELQELMSDPEVINETSRYMELSKEEAGLREIVGKYTRLKEVLSEVTENEELLRETTDSEMTELVKADLEELQTEKAQLEQEIKILMLPTDPNDEKNIIMEIRGAAGGDEASLFAGDLLNMYQRYAESQNWQTEIIDETATEVGGFKEVAMMITGKNVYSKLKYENGAHRVQRIPKTESQGRVHTSTATVAVMPEYDGVDVELEAKDIRVDVYRASGAGGQHINKTSSAVRMTHIPTGIVVAMQDQRSQQQNRVKAMKILQARVYDYYESQNQSEYDSSRKSAVGSGDRSERIRTYNYPQNRVTDHRIGLTLNKLDRIMNGELGDVIDALILFDQTEKLEQ 356
>gi|88596258|ref|ZP_01099495.1| peptide chain release factor 1 [Campylobacter jejuni subsp. jejuni 84-25] >gi|88191099|gb|EAQ95071.1| peptide chain release factor 1 [Campylobacter jejuni subsp. jejuni 84-25] (355 aa)
Score = 799, Expect = 3.1e-83, Identities = 179/351 (50%), Positives = 252/351 (71%)
  Q:     9 NSLLSMEEKFNDLNKELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVML-GNLSEIIDSLISHDEAVKMQEAKI 359
           NSLLS  +  ND++K           M+ ++K  K   PIV K KEY +TL++I+  + L+    D E+ ELA+ EL   + L  K E E+K+LLLPKDPND++N+ +E+R   GGDE+S+FVGDL  AY RYA++ G+K++++   E S  G+  I  ++ G   YS++K+E G HRVQRVP TES+GRVHTS ITVAV+PE++++E+ IN +DLK+D  R+SG GGQ +N T+SAVRITHIPTGI V  Q+GKSQ +N+E+AMK+L+A+L+E +E E     S+ RK QVG+G+R+E+IRTYN+PQNR++DHRINLTL +LD +M  G   EII+ LI+H +A  +QE  +
  S:    17 NSLLSSSDILNDISK-----------MTTLSKEQKNLEPIVLKAKEYLKTLDNIEENKALLN---DPELGELAKEELKTLEELKPKLEEEIKILLLPKDPNDERNIFLEIRAGTGGDEASLFVGDLIKAYARYAENRGYKLEIVSSSEGSVGGFKEIIMLVKGTGAYSRLKYEGGTHRVQRVPQTESQGRVHTSAITVAVMPEVDDIEIEINPNDLKVDVMRSSGHGGQSVNTTDSAVRITHIPTGIVVVNQDGKSQHKNKESAMKVLKARLYEMQESERLAKESEARKSQVGSGDRSERIRTYNFPQNRISDHRINLTLYRLDAIMQDGLFDEIIEPLITHHQAQALQEQNL 355
>gi|58337080|ref|YP_193665.1| peptide chain release factor 1 [Lactobacillus acidophilus NCFM] >gi|75432974|sp|Q5FKZ0|RF1_LACAC Peptide chain release factor 1 (RF-1) >gi|58254397|gb|AAV42634.1| peptide chain release factor I [Lactobacillus acidophilus NCFM] (361 aa)
Score = 799, Expect = 3.1e-83, Identities = 169/324 (52%), Positives = 248/324 (76%)
  Q:    33 KRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           KR  EI+K   +   +V+K+K+YK    +I+  +++I +E D+++IE+A+ E +E +  I + E ++K+L+LPKDPNDDK++I+E+R AAGGDE+S+F GDL   Y++YA+   W V M++ + +   GY  ++ MI G+ VYSK+K+E+G HRVQR+P TES+GRVHTST TVAV+PE E+V++ I+  D+++D YR+SGAGGQHINKT SAVR+TH+PTGI VA Q+ +SQ +NRE AM++L++++++  E +N+      RK  VGTG+R+E+IRTYNYPQNRVTDHRI LTLNKLD VM G L EIID+LI +++  +++E
  S:    32 KRYMEISKEEADLREVVQKYKKYKENKKEIEDNKEIISNETDSDLIEMAKEENAELEKEIPELEDQIKILMLPKDPNDDKDIIMEIRGAAGGDEASLFAGDLLRMYEKYAERQNWNVSMIDSEPTEVGGYKRVAIMITGDKVYSKLKYENGAHRVQRIPVTESQGRVHTSTATVAVMPEYEQVDIDIDPKDIRVDVYRSSGAGGQHINKTSSAVRMTHLPTGIVVAMQDQRSQQQNREKAMQILKSRVYDYYESQNQAQYDAKRKNAVGTGDRSERIRTYNYPQNRVTDHRIGLTLNKLDRVMNGELDEIIDALILYNQTKQLEE 356
>gi|161507266|ref|YP_001577220.1| peptide chain release factor 1 [Lactobacillus helveticus DPC 4571] >gi|172048215|sp|A8YUJ1|RF1_LACH4 Peptide chain release factor 1 (RF-1) >gi|160348255|gb|ABX26929.1| Peptide chain release factor 1 [Lactobacillus helveticus DPC 4571] (362 aa)
Score = 799, Expect = 3.2e-83, Identities = 168/324 (51%), Positives = 248/324 (76%)
  Q:    33 KRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           KR  EI+K   +   +V+K+K+YK    +I   +++I +E D+++IE+A+ E +E +  I + E ++K+L+LPKDPNDDK++I+E+R AAGGDE+S+F GDL   Y++YA+   WKV M++ + +   GY  ++ MI G+ VYSK+K+E+G HRVQR+P TES+GRVHTST TVAV+PE E+V++ I+  D+++D YR+SGAGGQHINKT SAVR+TH+PTGI VA Q+ +SQ +NRE AM++L++++++  E +N+      RK  +GTG+R+E+IRTYNYPQNRVTDHRI LT+NKLD VM G L EIID+LI +++  +++E
  S:    32 KRYMEISKEEADLREVVQKYKKYKEDKKEIADNKEIIANETDSDLIEMAKEENAEIEKEIPELEDQIKILMLPKDPNDDKDIIMEIRGAAGGDEASLFAGDLLRMYEKYAERQNWKVSMIDSEPTEVGGYKRVAIMITGDKVYSKLKYENGAHRVQRIPVTESQGRVHTSTATVAVMPEYEQVDIDIDPKDIRVDVYRSSGAGGQHINKTSSAVRMTHLPTGIVVAMQDQRSQQQNREKAMQILKSRVYDYYESQNQAKYDAKRKNAIGTGDRSERIRTYNYPQNRVTDHRIGLTINKLDRVMNGELDEIIDALILYNQTKQLEE 356
>gi|94264416|ref|ZP_01288206.1| Peptide chain release factor 1 [delta proteobacterium MLMS-1] >gi|93455173|gb|EAT05391.1| Peptide chain release factor 1 [delta proteobacterium MLMS-1] (354 aa)
Score = 799, Expect = 3.3e-83, Identities = 162/350 (46%), Positives = 251/350 (71%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGLSVK--RMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           ++  L  + E+  DL   L    +S    R   + K     + + E + +Y++T +D+++  +L++ E D EI+ELA+ E  E +  + + + EL++ L+P DPND+KN+++E+R   GGDE+S+FV +LF  Y RYA+ LGWKV++L    +   GY  I  +I+G++V+S++K+ESGVHRVQRVP TE++GRVHTS +TVAVLPE EEVEL IN ++LK D +R+SG GGQ +N T+SAVR+TH+PTG+ V CQ+ KSQ +N+  A+++LRA+L ++ +++    +S  RK QVG+G+R+E+IRTYN+PQNR+TDHRINLT  +L++VMLG L E+I+ L+ H +   +++
  S:     1 MFEQLADIAERKRDLEDRLADPAVSGDPGRYRSLAKEHSHVSRLEELYADYRKTSDDLEANGQLLQEEDDPEILELARQEGEELRQRLAQLDKELRLALVPPDPNDEKNILLEIRAGTGGDEASLFVANLFRMYSRYAEQLGWKVEVLSSSATEVGGYKEIIALISGDHVFSRLKYESGVHRVQRVPETETQGRVHTSAVTVAVLPEAEEVELTINPAELKYDVFRSSGPGGQSVNTTDSAVRVTHLPTGLVVICQDEKSQHKNKAKALQVLRARLLDQMQQQQHDQMSSDRKSQVGSGDRSERIRTYNFPQNRLTDHRINLTSYRLEDVMLGRLDEVIEPLMLHYQTAALKQ 353
>gi|15792917|ref|NP_282740.1| peptide chain release factor 1 [Campylobacter jejuni subsp. jejuni NCTC 11168] >gi|86149291|ref|ZP_01067522.1| peptide chain release factor 1 [Campylobacter jejuni subsp. jejuni CF93-6] >gi|20139359|sp|Q9PM63|RF1_CAMJE Peptide chain release factor 1 (RF-1) >gi|85840073|gb|EAQ57331.1| peptide chain release factor 1 [Campylobacter jejuni subsp. jejuni CF93-6] >gi|112360908|emb|CAL35709.1| peptide chain release factor 1 [Campylobacter jejuni subsp. jejuni NCTC 11168] (355 aa)
Score = 798, Expect = 3.6e-83, Identities = 179/351 (50%), Positives = 252/351 (71%)
  Q:     9 NSLLSMEEKFNDLNKELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVML-GNLSEIIDSLISHDEAVKMQEAKI 359
           NSLLS  +  ND++K           M+ ++K  K   PIV K KEY +TL++I+  + L+    D E+ ELA+ EL   + L  K E E+K+LLLPKDPND++N+ +E+R   GGDE+S+FVGDL  AY RYA++ G+K++++   E S  G+  I  ++ G   YS++K+E G HRVQRVP TES+GRVHTS ITVAV+PE++++E+ IN +DLK+D  R+SG GGQ +N T+SAVRITHIPTGI V  Q+GKSQ +N+E+AMK+L+A+L+E +E E     S+ RK QVG+G+R+E+IRTYN+PQNR++DHRINLTL +LD +M  G   EII+ LI+H +A  +QE  +
  S:    17 NSLLSSSDILNDISK-----------MTTLSKEQKNLEPIVLKAKEYLKTLDNIEENKALLN---DPELGELAKEELKTLEELKPKLEEEIKILLLPKDPNDERNIFLEIRAGTGGDEASLFVGDLVKAYARYAENRGYKLEIVSSSEGSVGGFKEIIMLVKGTGAYSRLKYEGGTHRVQRVPQTESQGRVHTSAITVAVMPEVDDIEIEINPNDLKVDVMRSSGHGGQSVNTTDSAVRITHIPTGIVVVNQDGKSQHKNKESAMKVLKARLYEMQESERLAKESEARKSQVGSGDRSERIRTYNFPQNRISDHRINLTLYRLDAIMQDGLFDEIIEPLITHHQAQALQEQNL 355
>gi|23100453|ref|NP_693920.1| peptide chain release factor RF-1 [Oceanobacillus iheyensis HTE831] >gi|32171555|sp|Q8EM60|RF1_OCEIH Peptide chain release factor 1 (RF-1) >gi|22778686|dbj|BAC14954.1| peptide chain release factor RF-1 [Oceanobacillus iheyensis HTE831] (356 aa)
Score = 798, Expect = 3.8e-83, Identities = 168/350 (48%), Positives = 256/350 (73%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           + + L S+E+++N LN+ L    +    K++ E +K       +V+ ++EYK     ++ A+++++ + D+E+ E+ + E++E     E+ E  +K+LLLPKDPNDDKNV +E+R AAGGDE+++F GDL+  Y RYA+  GWK+ ++E   +   GY  + FMING +VYSK+K+E+G HRVQRVP TES GR+HTST TVAVLPE EEVE+ +++ D+++DT+ +SG GGQ +N T SAVR+TH+PTGI V+ Q+ KSQI+N+E AMK+LRA++++K ++E +    + RK  VG+G+R+E+IRTYN+PQNRVTDHRI LT+ KLD +M G L E ID+L+  ++  K+++
  S:     1 MLDRLQSLEDRYNKLNEMLSDPEVINDSKKLREYSKEQSGLEDVVQAYREYKEVTEQLNDAKEMMEDKLDDEMYEMVKAEIAELNGRKEELESSMKILLLPKDPNDDKNVFMEIRGAAGGDEAALFAGDLYRMYSRYAEHQGWKIDVMEASSTGVGGYKEVIFMINGSDVYSKLKYENGAHRVQRVPETESGGRIHTSTATVAVLPEAEEVEVEVHDKDIRVDTFASSGPGGQSVNTTMSAVRLTHVPTGIVVSIQDEKSQIKNKEKAMKVLRARIYDKFQQEAQAEYDENRKSAVGSGDRSERIRTYNFPQNRVTDHRIGLTIQKLDQIMQGKLDEFIDALVMEEQTNKLEQ 353
>gi|22537235|ref|NP_688086.1| peptide chain release factor 1 [Streptococcus agalactiae 2603V/R] >gi|32171547|sp|Q8DZM4|RF1_STRA5 Peptide chain release factor 1 (RF-1) >gi|22534102|gb|AAM99958.1|AE014241_9 peptide chain release factor 1 [Streptococcus agalactiae 2603V/R] (359 aa)
Score = 798, Expect = 4.1e-83, Identities = 172/349 (49%), Positives = 255/349 (73%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIK-SEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGFIS---FMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQ 355
           +Y+ L ++E+++ +L + L    +    KR  E+++    T   V  ++EYK+ + +I  AE++IK +  D E+ E+A+ EL E K   E+YE  LK+LLLPKDPNDDKN+I+E+R AAGGDE+++F GDL + Y++YA++ GW+ +++E   S +G G I     M++G++VYSK+K+ESG HRVQRVP TES+GRVHTST TV V+PE+EEVE  I+  DL++D Y ASGAGGQ++NK  +AVR+ HIPTGI V  QE ++Q +NR+ AMK++RA++ +   +  +      RK  VGTG+R+E+IRTYN+PQNRVTDHRI LTL KLD ++ G + E+ID+L+ +D+  K++
  S:     3 IYDQLQAVEDRYEELGELLSDPDVVSDTKRFMELSREEASTRETVTAYREYKQVIQNISDAEEMIKDASGDAELEEMAKEELKESKAAKEEYEERLKILLLPKDPNDDKNIILEIRGAAGGDEAALFAGDLLTMYQKYAETQGWRFEVME--SSVNGVGGIKEVVAMVSGQSVYSKLKYESGAHRVQRVPVTESQGRVHTSTATVLVMPEVEEVEYEIDQKDLRVDIYHASGAGGQNVNKVATAVRMVHIPTGIKVEMQEERTQQKNRDKAMKIIRARVADHFAQIAQDEQDAERKSTVGTGDRSERIRTYNFPQNRVTDHRIGLTLQKLDTILSGKMDEVIDALVMYDQTQKLE 355
>gi|25011160|ref|NP_735555.1| peptide chain release factor 1 [Streptococcus agalactiae NEM316] >gi|76798425|ref|ZP_00780665.1| peptide chain release factor 1 [Streptococcus agalactiae 18RS21] >gi|77408667|ref|ZP_00785400.1| peptide chain release factor 1 [Streptococcus agalactiae COH1] >gi|77410552|ref|ZP_00786913.1| peptide chain release factor 1 [Streptococcus agalactiae CJB111] >gi|77413289|ref|ZP_00789485.1| peptide chain release factor 1 [Streptococcus agalactiae 515] >gi|32171550|sp|Q8E5C3|RF1_STRA3 Peptide chain release factor 1 (RF-1) >gi|23095559|emb|CAD46768.1| peptide chain release factor 1 [Streptococcus agalactiae NEM316] >gi|76586220|gb|EAO62738.1| peptide chain release factor 1 [Streptococcus agalactiae 18RS21] >gi|77160676|gb|EAO71791.1| peptide chain release factor 1 [Streptococcus agalactiae 515] >gi|77163500|gb|EAO74450.1| peptide chain release factor 1 [Streptococcus agalactiae CJB111] >gi|77172715|gb|EAO75851.1| peptide chain release factor 1 [Streptococcus agalactiae COH1] (359 aa)
Score = 798, Expect = 4.2e-83, Identities = 172/349 (49%), Positives = 255/349 (73%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIK-SEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGFIS---FMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQ 355
           +Y+ L ++E+++ +L + L    +    KR  E+++    T   V  ++EYK+ + +I  AE++IK +  D E+ E+A+ EL E K   E+YE  LK+LLLPKDPNDDKN+I+E+R AAGGDE+++F GDL + Y++YA++ GW+ +++E   S +G G I     M++G++VYSK+K+ESG HRVQRVP TES+GRVHTST TV V+PE+EEVE  I+  DL++D Y ASGAGGQ++NK  +AVR+ HIPTGI V  QE ++Q +NR+ AMK++RA++ +   +  +      RK  VGTG+R+E+IRTYN+PQNRVTDHRI LTL KLD ++ G + E+ID+L+ +D+  K++
  S:     3 IYDQLQAVEDRYEELGELLSDPDVVSDTKRFMELSREEANTRETVTAYREYKQVIQNISDAEEMIKDASGDAELEEMAKEELKESKAAKEEYEERLKILLLPKDPNDDKNIILEIRGAAGGDEAALFAGDLLTMYQKYAETQGWRFEVME--SSVNGVGGIKEVVAMVSGQSVYSKLKYESGAHRVQRVPVTESQGRVHTSTATVLVMPEVEEVEYEIDQKDLRVDIYHASGAGGQNVNKVATAVRMVHIPTGIKVEMQEERTQQKNRDKAMKIIRARVADHFAQIAQDEQDAERKSTVGTGDRSERIRTYNFPQNRVTDHRIGLTLQKLDTILSGKMDEVIDALVMYDQTQKLE 355
>gi|30265352|ref|NP_847729.1| peptide chain release factor 1 [Bacillus anthracis str. Ames] >gi|42784501|ref|NP_981748.1| peptide chain release factor 1 [Bacillus cereus ATCC 10987] >gi|47530891|ref|YP_022240.1| peptide chain release factor 1 [Bacillus anthracis str. 'Ames Ancestor'] >gi|46576768|sp|Q81JX1|RF1_BACAN Peptide chain release factor 1 (RF-1) >gi|61214595|sp|Q630R9|RF1_BACCZ Peptide chain release factor 1 (RF-1) >gi|61214623|sp|Q6HAV4|RF1_BACHK Peptide chain release factor 1 (RF-1) >gi|61214641|sp|Q72XC2|RF1_BACC1 Peptide chain release factor 1 (RF-1) >gi|30260030|gb|AAP29215.1| peptide chain release factor 1 [Bacillus anthracis str. Ames] >gi|42740433|gb|AAS44356.1| peptide chain release factor 1 [Bacillus cereus ATCC 10987] >gi|47506039|gb|AAT34715.1| peptide chain release factor 1 [Bacillus anthracis str. 'Ames Ancestor'] (355 aa)
Score = 798, Expect = 4.2e-83, Identities = 168/352 (47%), Positives = 249/352 (70%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQEAK 358
           + + L ++E ++  LN+ L    +     ++ E +K   +    VE ++EYK     +  A+ +++ + D E+ E+ + E+SE +   +     LK+LL+PKDPNDDKNVIVE+R AAGGDE+++F GDL+  Y RYA+  GWK +++E   +   GY  I FMING+  ++K+KFE+G HRVQRVP TES GR+HTST TVAVLPE EEVE+ I+  D+++DT+ +SG GGQ +N T SAVR+TH+PTG+ V+CQ+ KSQI+N+E AMK+LRA++++K  +E +      RK  VGTG+R+E+IRTYN+PQNRVTDHRI LT+ KLD ++ G L + I++L+  D+A +M+ A+
  S:     1 MLDRLQAVENRYEKLNELLSDPAIISDSNKLREYSKEQSDIQETVEVYREYKDVREQLKDAKAMLEDKLDAEMREMVKEEVSELESQEKTLSERLKILLVPKDPNDDKNVIVEVRGAAGGDEAALFAGDLYRMYSRYAEVQGWKTEIIEASYTELGGYKEIIFMINGKGAFAKLKFENGAHRVQRVPETESGGRIHTSTATVAVLPEAEEVEIDIHEKDVRVDTFASSGPGGQSVNTTMSAVRLTHLPTGVVVSCQDEKSQIKNKEKAMKVLRARVYDKFRQEAQAEYDQNRKQAVGTGDRSERIRTYNFPQNRVTDHRIGLTIQKLDQILQGKLDDFINALVMEDQAQRMEAAE 355
>gi|21910335|ref|NP_664603.1| peptide chain release factor 1 [Streptococcus pyogenes MGAS315] >gi|28895910|ref|NP_802260.1| peptide chain release factor 1 [Streptococcus pyogenes SSI-1] >gi|25091126|sp|Q8K7I2|RF1_STRP3 Peptide chain release factor 1 (RF-1) >gi|21904531|gb|AAM79406.1| putative peptide chain release factor 1 [Streptococcus pyogenes MGAS315] >gi|28811160|dbj|BAC64093.1| putative peptide chain release factor 1 [Streptococcus pyogenes SSI-1] (359 aa)
Score = 798, Expect = 4.3e-83, Identities = 173/349 (49%), Positives = 255/349 (73%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIK-SEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGFIS---FMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQ 355
           +Y+ L ++E+++ +L + L    +    KR  E+++    T   V  ++EYK+ +  I  AE++IK +  D E+ E+A+ EL E K   E+YE +LK+LLLPKDPNDDKN+I+E+R AAGGDE+++F GDL + Y++YA++ GW+ +++E   S +G G I     M++G++VYSK+K+ESG HRVQRVP TES+GRVHTST TV V+PE+EEVE  I+  DL+ID Y ASGAGGQ++NK  +AVR+ HIPTGI V  QE ++Q +NR+ AMK++RA++ +   +  +      RK  VGTG+R+E+IRTYN+PQNRVTDHRI LTL KLD ++ G + E+ID+L+ +D+  K++
  S:     3 IYDQLQAVEDRYEELGELLSDPDVVSDTKRFMELSREEANTRETVTAYREYKQVIQTISDAEEMIKDASGDPELEEMAKEELKESKAAKEEYEEKLKILLLPKDPNDDKNIILEIRGAAGGDEAALFAGDLLTMYQKYAETQGWRFEVME--SSVNGVGGIKEVVAMVSGQSVYSKLKYESGAHRVQRVPVTESQGRVHTSTATVLVMPEVEEVEYDIDPKDLRIDIYHASGAGGQNVNKVATAVRMVHIPTGIKVEMQEERTQQKNRDKAMKIIRARVADHFAQIAQDEQDAERKSTVGTGDRSERIRTYNFPQNRVTDHRIGLTLQKLDTILSGKMDEVIDALVMYDQTKKLE 355
>gi|148546007|ref|YP_001266109.1| peptide chain release factor 1 [Pseudomonas putida F1] >gi|166223590|sp|A5VYG5|RF1_PSEP1 Peptide chain release factor 1 (RF-1) >gi|148510065|gb|ABQ76925.1| bacterial peptide chain release factor 1 (bRF-1) [Pseudomonas putida F1] (360 aa)
Score = 798, Expect = 4.4e-83, Identities = 170/348 (48%), Positives = 242/348 (69%)
  Q:     7 LYNSLLSMEEKFNDLNKEL-ETEGLSVK-RMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPEL-EEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           L N L  ++++F +L   L + E +S + R    ++   E  P+   +KE+++  +D++ A+ L+K + D ++ E+A  E+ E K  +   E +L+ +LLPKDPND +NV +E+R   GGDE++IF GDLF  Y RYA+  GW++++L   E  HG Y  I   + GENVY K+KFESG HRVQRVP TES+GRVHTS  TVAVLPE  E+  + IN +DL++DTYRASGAGGQH+NKT+SA+RITH+PTGI V CQE +SQ +NR  AM  L AKL + +    +  I+  RK  VG+G+R+E+IRTYNYPQ RVTDHRINLTL  LD+++ G +  +I+ L++  +A ++
  S:     5 LLNKLEILQDRFEELTALLGDAEVISDQTRFRAYSREYAEVEPVYAAYKEWRKVQDDLEGAQALLK-DSDPDLREMALEEVREAKEQLLTLEAQLQRMLLPKDPNDGRNVFLEIRAGTGGDEAAIFSGDLFRMYSRYAEKRGWRLEILSENEGEHGGYKEIIARVEGENVYGKLKFESGAHRVQRVPETESQGRVHTSACTVAVLPEPDEQAAIEINPADLRVDTYRASGAGGQHVNKTDSAIRITHLPTGIVVECQEERSQHKNRARAMSWLSAKLNDMQTSAAQNAIASERKLLVGSGDRSERIRTYNYPQGRVTDHRINLTLYSLDDILSGGVDAVIEPLLAEYQADQL 355
>gi|76788237|ref|YP_329784.1| peptide chain release factor 1 [Streptococcus agalactiae A909] >gi|77405475|ref|ZP_00782567.1| peptide chain release factor 1 [Streptococcus agalactiae H36B] >gi|119361618|sp|Q3K119|RF1_STRA1 Peptide chain release factor 1 (RF-1) >gi|76563294|gb|ABA45878.1| peptide chain release factor 1 [Streptococcus agalactiae A909] >gi|77175872|gb|EAO78649.1| peptide chain release factor 1 [Streptococcus agalactiae H36B] (359 aa)
Score = 797, Expect = 4.7e-83, Identities = 172/349 (49%), Positives = 256/349 (73%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIK-SEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGFIS---FMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQ 355
           +Y+ L ++E+++ +L + L    +    KR  E+++    T   V  ++EYK+ + +I  AE++IK +  D E+ E+A+ EL E K   E+YE +LK+LLLPKDPNDDKN+I+E+R AAGGDE+++F GDL + Y++YA++ GW+ +++E   S +G G I     M++G++VYSK+K+ESG HRVQRVP TES+GRVHTST TV V+PE+EEVE  I+  DL++D Y ASGAGGQ++NK  +AVR+ HIPTGI V  QE ++Q +NR+ AMK++RA++ +   +  +      RK  VGTG+R+E+IRTYN+PQNRVTDHRI LTL KLD ++ G + E+ID+L+ +D+  K++
  S:     3 IYDQLQAVEDRYEELGELLSDPDVVSDTKRFMELSREEANTRETVTAYREYKQVIQNISDAEEMIKDASGDAELEEMAKEELKESKAAKEEYEEKLKILLLPKDPNDDKNIILEIRGAAGGDEAALFAGDLLTMYQKYAETQGWRFEVME--SSVNGVGGIKEVVAMVSGQSVYSKLKYESGAHRVQRVPVTESQGRVHTSTATVLVMPEVEEVEYEIDQKDLRVDIYHASGAGGQNVNKVATAVRMVHIPTGIKVEMQEERTQQKNRDKAMKIIRARVADHFAQIAQDEQDAERKSTVGTGDRSERIRTYNFPQNRVTDHRIGLTLQKLDTILSGKMDEVIDALVMYDQTQKLE 355
>gi|86152274|ref|ZP_01070485.1| peptide chain release factor 1 [Campylobacter jejuni subsp. jejuni 260.94] >gi|121613478|ref|YP_001001255.1| peptide chain release factor 1 [Campylobacter jejuni subsp. jejuni 81-176] >gi|148925756|ref|ZP_01809444.1| peptide chain release factor 1 [Campylobacter jejuni subsp. jejuni CG8486] >gi|157415831|ref|YP_001483087.1| peptide chain release factor 1 [Campylobacter jejuni subsp. jejuni 81116] >gi|166223544|sp|A1W1L4|RF1_CAMJJ Peptide chain release factor 1 (RF-1) >gi|172047202|sp|A8FNS3|RF1_CAMJ8 Peptide chain release factor 1 (RF-1) >gi|85840763|gb|EAQ58014.1| peptide chain release factor 1 [Campylobacter jejuni subsp. jejuni 260.94] >gi|87249710|gb|EAQ72669.1| peptide chain release factor 1 [Campylobacter jejuni subsp. jejuni 81-176] >gi|145845766|gb|EDK22857.1| peptide chain release factor 1 [Campylobacter jejuni subsp. jejuni CG8486] >gi|157386795|gb|ABV53110.1| peptide chain release factor RF-1 [Campylobacter jejuni subsp. jejuni 81116] (355 aa)
Score = 797, Expect = 5.0e-83, Identities = 179/351 (50%), Positives = 252/351 (71%)
  Q:     9 NSLLSMEEKFNDLNKELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVML-GNLSEIIDSLISHDEAVKMQEAKI 359
           NSLLS  +  ND++K           M+ ++K  K   PIV K KEY +TL++I+  + L+    D E+ ELA+ EL   + L  K E E+K+LLLPKDPND++N+ +E+R   GGDE+S+FVGDL  AY RYA++ G+K++++   E S  G+  I  ++ G   YS++K+E G HRVQRVP TES+GRVHTS ITVAV+PE++++E+ IN +DLK+D  R+SG GGQ +N T+SAVRITHIPTGI V  Q+GKSQ +N+E+AMK+L+A+L+E +E E     S+ RK QVG+G+R+E+IRTYN+PQNR++DHRINLTL +LD +M  G   EII+ LI+H +A  +QE  +
  S:    17 NSLLSSSDILNDISK-----------MTTLSKEQKNLEPIVLKAKEYLKTLDNIEENKALLN---DPELGELAKEELKTLEELKPKLEEEIKILLLPKDPNDERNIFLEIRAGTGGDEASLFVGDLVKAYARYAENRGYKLEIVSSSEGSVGGFKEIIMLVKGTGAYSRLKYEGGTHRVQRVPQTESQGRVHTSAITVAVMPEVDDIEIEINPNDLKVDVMRSSGHGGQSVNTTDSAVRITHIPTGIVVVNQDGKSQHKNKESAMKVLKARLYEMQESERLAKESEARKSQVGSGDRSERIRTYNFPQNRISDHRINLTLYRLDAIMQDGLFDEIIEPLITHHQAQALQEQNL 355
>gi|15925108|ref|NP_372642.1| peptide chain release factor 1 [Staphylococcus aureus subsp. aureus Mu50] >gi|15927692|ref|NP_375225.1| peptide chain release factor 1 [Staphylococcus aureus subsp. aureus N315] >gi|21283771|ref|NP_646859.1| peptide chain release factor 1 [Staphylococcus aureus subsp. aureus MW2] >gi|49486911|ref|YP_044132.1| peptide chain release factor 1 [Staphylococcus aureus subsp. aureus MSSA476] >gi|57652140|ref|YP_186925.1| peptide chain release factor 1 [Staphylococcus aureus subsp. aureus COL] >gi|87160795|ref|YP_494718.1| peptide chain release factor 1 [Staphylococcus aureus subsp. aureus USA300] >gi|88196022|ref|YP_500835.1| peptide chain release factor 1 [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|148268569|ref|YP_001247512.1| peptide chain release factor 1 [Staphylococcus aureus subsp. aureus JH9] >gi|150394633|ref|YP_001317308.1| peptide chain release factor 1 [Staphylococcus aureus subsp. aureus JH1] >gi|151222234|ref|YP_001333056.1| peptide chain release factor 1 [Staphylococcus aureus subsp. aureus str. Newman] >gi|156980433|ref|YP_001442692.1| peptide chain release factor 1 [Staphylococcus aureus subsp. aureus Mu3] >gi|161510323|ref|YP_001575982.1| peptide chain release factor 1 [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|168728878|ref|ZP_02761155.1| peptide chain release factor RF1 [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|166223609|sp|A7X4W4|RF1_STAA1 Peptide chain release factor 1 (RF-1) >gi|172048990|sp|A6QIW2|RF1_STAAE Peptide chain release factor 1 (RF-1) >gi|189039994|sp|A6U3K3|RF1_STAA2 Peptide chain release factor 1 (RF-1) >gi|189039995|sp|A5IUR3|RF1_STAA9 Peptide chain release factor 1 (RF-1) >gi|189039996|sp|A8YY83|RF1_STAAT Peptide chain release factor 1 (RF-1) >gi|54039049|sp|P66019|RF1_STAAN Peptide chain release factor 1 (RF-1) >gi|54039050|sp|P66020|RF1_STAAW Peptide chain release factor 1 (RF-1) >gi|54041594|sp|P66018|RF1_STAAM Peptide chain release factor 1 (RF-1) >gi|56749376|sp|Q6G7J2|RF1_STAAS Peptide chain release factor 1 (RF-1) >gi|71153097|sp|Q5HE82|RF1_STAAC Peptide chain release factor 1 (RF-1) >gi|119361613|sp|Q2FF10|RF1_STAA3 Peptide chain release factor 1 (RF-1) >gi|119361614|sp|Q2FWE0|RF1_STAA8 Peptide chain release factor 1 (RF-1) >gi|13701912|dbj|BAB43204.1| peptide chain release factor 1 [Staphylococcus aureus subsp. aureus N315] >gi|14247891|dbj|BAB58280.1| peptide chain release factor 1 [Staphylococcus aureus subsp. aureus Mu50] >gi|21205213|dbj|BAB95907.1| peptide chain release factor 1 [Staphylococcus aureus subsp. aureus MW2] >gi|49245354|emb|CAG43829.1| peptide chain release factor 1 [Staphylococcus aureus subsp. aureus MSSA476] >gi|57286326|gb|AAW38420.1| peptide chain release factor 1 [Staphylococcus aureus subsp. aureus COL] >gi|87126769|gb|ABD21283.1| peptide chain release factor 1 [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|87203580|gb|ABD31390.1| peptide chain release factor 1 [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|147741638|gb|ABQ49936.1| bacterial peptide chain release factor 1 (bRF-1) [Staphylococcus aureus subsp. aureus JH9] >gi|149947085|gb|ABR53021.1| peptide chain release factor 1 [Staphylococcus aureus subsp. aureus JH1] >gi|150375034|dbj|BAF68294.1| peptide chain release factor 1 [Staphylococcus aureus subsp. aureus str. Newman] >gi|156722568|dbj|BAF78985.1| peptide chain release factor 1 [Staphylococcus aureus subsp. aureus Mu3] >gi|160369132|gb|ABX30103.1| peptide chain release factor RF1 [Staphylococcus aureus subsp. aureus USA300_TCH1516] (358 aa)
Score = 797, Expect = 5.3e-83, Identities = 181/350 (51%), Positives = 252/350 (72%)
  Q:     7 LYNSLLSMEEKFNDLNKELE-----TEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           +++ L  +EE++  LN+ L       +   +++ S+    +++T  +   +K  K  L DI   E+++    D E +E+ + E +  K  +   E ELK+LL+PKDPNDDK+VIVE+R AAGGDE++IF GDL   Y +YA+S G+K +++E  ES HG Y  ISF ++G   YSK+KFE+G HRVQRVP TES GR+HTST TVAVLPE+E+VE+ I N DLKIDTYR+SGAGGQH+N T+SAVRITH+PTG+     E KSQI+NRE AMK+L+A+L++ K +E ++  +  RK  VGTG+R+E+IRTYNYPQ+RVTDHRI LTL KL  +M G+L EIID+L   ++  K++E
  S:     1 MFDQLDIVEERYEQLNELLSDPDVVNDSDKLRKYSKEQADLQKTVDVYRNYKAKKEELADI---EEMLSETDDKEEVEMLKEESNGIKAELPNLEEELKILLIPKDPNDDKDVIVEIRAAAGGDEAAIFAGDLMRMYSKYAESQGFKTEIVEASESDHGGYKEISFSVSGNGAYSKLKFENGAHRVQRVPETESGGRIHTSTATVAVLPEVEDVEIEIRNEDLKIDTYRSSGAGGQHVNTTDSAVRITHLPTGVIATSSE-KSQIQNREKAMKVLKARLYDMKVQEEQQKYASQRKSAVGTGDRSERIRTYNYPQSRVTDHRIGLTLQKLGQIMEGHLEEIIDALTLSEQTDKLKE 352
>gi|84686944|ref|ZP_01014828.1| peptide chain release factor 1 [Rhodobacterales bacterium HTCC2654] >gi|84665141|gb|EAQ11621.1| peptide chain release factor 1 [Rhodobacterales bacterium HTCC2654] (351 aa)
Score = 797, Expect = 5.5e-83, Identities = 165/348 (47%), Positives = 242/348 (69%)
  Q:     9 NSLLSMEEKFNDLNKELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           + L ++ ++F  L  ++ ++GLS   ++E+ +   E  P+VE+   +++ L+DI+ AE ++    D E+ ELA+ EL   +  +   E  ++V LLP+D  D +  +VE+RP  GGDE+S+F GDL   Y+RYA++ GWK   LE   +   G   +   ++G+ V++++KFESGVHRVQRVP TES GR+HTS  TVAVLPE E+V++ I+ +D++IDT RASGAGGQH+N T+SAVRITHIPTGI V   E KSQ  NRE AM++L+ +L++ + +      +  RK QVG+G+R+E+IRTYN+PQ R+TDHRINLTL KL +VM G+L E+ID+LI  D+A K+ E
  S:     5 DKLDAITQRFQFLEAKM-SQGLSGDEIAEVGREYAELKPVVEEIAAFRQLLSDIEDAEAMLS---DPEMRELAEDELPGLRERLPVMEQAMRVALLPRDAADARPAMVEIRPGTGGDEASLFAGDLLRMYQRYAEARGWKFDTLEQSLTEVGGVKEVVARVSGDGVFARLKFESGVHRVQRVPETESGGRIHTSAATVAVLPEAEDVDIHIDPADIRIDTMRASGAGGQHVNTTDSAVRITHIPTGIVVTSSE-KSQHRNREIAMQVLKTRLFDAERQRAHDERASARKAQVGSGDRSERIRTYNFPQGRMTDHRINLTLYKLGDVMQGDLDEVIDALIEADQAAKLAE 348
>gi|110598269|ref|ZP_01386544.1| peptide chain release factor 1 [Chlorobium ferrooxidans DSM 13031] >gi|110340077|gb|EAT58577.1| peptide chain release factor 1 [Chlorobium ferrooxidans DSM 13031] (357 aa)
Score = 797, Expect = 5.9e-83, Identities = 168/349 (48%), Positives = 241/349 (69%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGLSVK--RMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGF--ISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQ 355
           + + L S++EK  DL + L     +    R  ++NK   +   IV+ +  Y +   ++D ++KL+ SE D E+ EL Q E+SE +  + + E  LKVLLLPKD  D +NVIVE+R   GG+E+++F  D+   Y+RYA+  GWK ++L   ESS   GF  I+  ++G +VY  MK+ESGVHRVQRVP TE++GR+HTS ++VAVLPE EEV++ I   DL+ DTYR+ G GGQ++NK E+AVRITH+PTGI  ACQE +SQ++N+E AMKMLR KL++    E  +  +DLR+  V TG+R+ KIRTYNYPQ+RVTDHRI  T + L  ++ G + +IID+L  HD+A +++
  S:     1 MLDKLQSIKEKHLDLEQLLADPNAATDQARFRKLNKEYSDLREIVQAYDAYGQAKTELDQSKKLLDSESDPEMRELVQAEISELQKKLPELEQHLKVLLLPKDEADSRNVIVEIRAGTGGEEAALFAADILRMYQRYAEKQGWKCEVLHYNESSMPGGFREITLEVSGHDVYGTMKYESGVHRVQRVPDTETQGRIHTSAVSVAVLPEAEEVDVEIRREDLRFDTYRSGGKGGQNVNKVETAVRITHMPTGIVSACQEERSQLQNKERAMKMLRTKLYDILLAEQVQQRADLRRSMVTTGDRSAKIRTYNYPQSRVTDHRIGFTSHALPQILQGEIQDIIDALKMHDQAERLK 353
>gi|50914205|ref|YP_060177.1| peptide chain release factor 1 [Streptococcus pyogenes MGAS10394] >gi|61214586|sp|Q5XC69|RF1_STRP6 Peptide chain release factor 1 (RF-1) >gi|50903279|gb|AAT86994.1| Bacterial Peptide Chain Release Factor 1 [Streptococcus pyogenes MGAS10394] (359 aa)
Score = 796, Expect = 6.0e-83, Identities = 172/349 (49%), Positives = 256/349 (73%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIK-SEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGFIS---FMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQ 355
           +Y+ L ++E+++ +L + L    +    KR  E+++    T   V  ++EYK+ +  I  AE++IK +  D E+ E+A+ EL E K   E+YE +LK+LLLPKDPNDDKN+I+E+R AAGGDE+++F GDL + Y++YA++ GW+ +++E   S +G G I     M++G++VYSK+K+ESG HRVQRVP TES+GRVHTST TV V+PE+EEVE  I+  DL++D Y ASGAGGQ++NK  +AVR+ HIPTGI V  QE ++Q +NR+ AMK++RA++ +   +  +      RK  VGTG+R+E+IRTYN+PQNRVTDHRI LTL KLD ++ G ++E+ID+L+ +D+  K++
  S:     3 IYDQLQAVEDRYEELGELLSDPDVVSDTKRFMELSREEANTRETVTAYREYKQVIQTISDAEEMIKDASGDPELEEMAKEELKESKAAKEEYEEKLKILLLPKDPNDDKNIILEIRGAAGGDEAALFAGDLLTMYQKYAETQGWRFEVME--SSVNGVGGIKEVVAMVSGQSVYSKLKYESGAHRVQRVPVTESQGRVHTSTATVLVMPEVEEVEYDIDPKDLRVDIYHASGAGGQNVNKVATAVRMVHIPTGIKVEMQEERTQQKNRDKAMKIIRARVADHFAQIAQDEQDAERKSTVGTGDRSERIRTYNFPQNRVTDHRIGLTLQKLDTILSGKMNEVIDALVMYDQTKKLE 355
>gi|56808656|ref|ZP_00366381.1| COG0216: Protein chain release factor A [Streptococcus pyogenes M49 591] >gi|71903502|ref|YP_280305.1| peptide chain release factor 1 [Streptococcus pyogenes MGAS6180] >gi|71910676|ref|YP_282226.1| peptide chain release factor 1 [Streptococcus pyogenes MGAS5005] >gi|119361623|sp|Q48TL0|RF1_STRPM Peptide chain release factor 1 (RF-1) >gi|71802597|gb|AAX71950.1| bacterial peptide chain release factor 1 [Streptococcus pyogenes MGAS6180] >gi|71853458|gb|AAZ51481.1| bacterial peptide chain release factor 1 [Streptococcus pyogenes MGAS5005] (359 aa)
Score = 796, Expect = 6.2e-83, Identities = 172/349 (49%), Positives = 255/349 (73%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIK-SEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGFIS---FMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQ 355
           +Y+ L ++E+++ +L + L    +    KR  E+++    T   V  ++EYK+ +  I  AE++IK +  D E+ E+A+ EL E K   E+YE +LK+LLLPKDPNDDKN+I+E+R AAGGDE+++F GDL + Y++YA++ GW+ +++E   S +G G I     M++G++VYSK+K+ESG HRVQRVP TES+GRVHTST TV V+PE+EEVE  I+  DL++D Y ASGAGGQ++NK  +AVR+ HIPTGI V  QE ++Q +NR+ AMK++RA++ +   +  +      RK  VGTG+R+E+IRTYN+PQNRVTDHRI LTL KLD ++ G + E+ID+L+ +D+  K++
  S:     3 IYDQLQAVEDRYEELGELLSDPDVVSDTKRFMELSREEANTRETVTAYREYKQVIQTISDAEEMIKDASGDPELEEMAKEELKESKAAKEEYEEKLKILLLPKDPNDDKNIILEIRGAAGGDEAALFAGDLLTMYQKYAETQGWRFEVME--SSVNGVGGIKEVVAMVSGQSVYSKLKYESGAHRVQRVPVTESQGRVHTSTATVLVMPEVEEVEYDIDPKDLRVDIYHASGAGGQNVNKVATAVRMVHIPTGIKVEMQEERTQQKNRDKAMKIIRARVADHFAQIAQDEQDAERKSTVGTGDRSERIRTYNFPQNRVTDHRIGLTLQKLDTILSGKMDEVIDALVMYDQTKKLE 355
>gi|126725348|ref|ZP_01741190.1| peptide chain release factor 1 [Rhodobacterales bacterium HTCC2150] >gi|126704552|gb|EBA03643.1| peptide chain release factor 1 [Rhodobacterales bacterium HTCC2150] (421 aa)
Score = 796, Expect = 6.3e-83, Identities = 168/320 (52%), Positives = 226/320 (70%)
  Q:    37 EINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           E+++   E  P+ ++   ++  + DID+AE ++    D E+ ELA  EL E +  +   E  +K++LLPKD  D +  I+E+RP  GGDE+++F GDL   Y+RYA+S GWK +++E Q S   G   I   I G NV+ K+KFESGVHRVQRVP TES GR+HTS  TVAVLPE EEV+L I  SDL+IDT RASGAGGQH+N T+SAVRITH+PTG+ V   E KSQ  NRE AM+++R++L+E + ++     +  RK QVG+G+R+E+IRTYN+PQ R+TDHRINLTL KLD VM G L EIID+L + D+A K+ E
  S:   102 ELSREYSELKPVADQIMAFQTLVQDIDAAEAMLD---DPEMRELAAEELKELRDSLPDAENAIKLVLLPKDTADARPAIIEIRPGTGGDEAALFAGDLLRMYQRYAESNGWKFEIIEEQVSELGGIKEIIANIKGTNVFGKLKFESGVHRVQRVPTTESGGRIHTSAATVAVLPEAEEVDLDIPASDLRIDTMRASGAGGQHVNTTDSAVRITHLPTGMIVVSME-KSQHRNREIAMQVMRSRLYEMERQKVADERAADRKSQVGSGDRSERIRTYNFPQGRMTDHRINLTLYKLDQVMSGELDEIIDALHADDQAQKLAE 418
>gi|49188164|ref|YP_031417.1| peptide chain release factor 1 [Bacillus anthracis str. Sterne] >gi|49480414|ref|YP_039322.1| peptide chain release factor 1 [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|52140231|ref|YP_086598.1| peptide chain release factor 1 [Bacillus cereus E33L] >gi|118480364|ref|YP_897515.1| peptide chain release factor 1 [Bacillus thuringiensis str. Al Hakam] >gi|165871326|ref|ZP_02215975.1| peptide chain release factor 1 [Bacillus anthracis str. A0488] >gi|167636684|ref|ZP_02394972.1| peptide chain release factor 1 [Bacillus anthracis str. A0442] >gi|168164301|ref|ZP_02599534.1| peptide chain release factor 1 [Bacillus cereus H3081.97] >gi|170688145|ref|ZP_02879356.1| peptide chain release factor 1 [Bacillus anthracis str. A0465] >gi|170709368|ref|ZP_02899781.1| peptide chain release factor 1 [Bacillus anthracis str. A0389] >gi|177651841|ref|ZP_02934424.1| peptide chain release factor 1 [Bacillus anthracis str. A0174] >gi|49182091|gb|AAT57467.1| peptide chain release factor 1 [Bacillus anthracis str. Sterne] >gi|49331970|gb|AAT62616.1| peptide chain release factor 1 [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|51973700|gb|AAU15250.1| peptide chain release factor 1 [Bacillus cereus E33L] >gi|118419589|gb|ABK88008.1| bacterial peptide chain release factor 1 (bRF-1) [Bacillus thuringiensis str. Al Hakam] >gi|164712993|gb|EDR18521.1| peptide chain release factor 1 [Bacillus anthracis str. A0488] >gi|167527884|gb|EDR90706.1| peptide chain release factor 1 [Bacillus anthracis str. A0442] >gi|170125716|gb|EDS94630.1| peptide chain release factor 1 [Bacillus anthracis str. A0389] >gi|170667838|gb|EDT18590.1| peptide chain release factor 1 [Bacillus anthracis str. A0465] >gi|172082545|gb|EDT67609.1| peptide chain release factor 1 [Bacillus anthracis str. A0174] (358 aa)
Score = 796, Expect = 6.3e-83, Identities = 168/350 (48%), Positives = 248/350 (70%)
  Q:     9 NSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQEAK 358
           + L ++E ++  LN+ L    +     ++ E +K   +    VE ++EYK     +  A+ +++ + D E+ E+ + E+SE +   +     LK+LL+PKDPNDDKNVIVE+R AAGGDE+++F GDL+  Y RYA+  GWK +++E   +   GY  I FMING+  ++K+KFE+G HRVQRVP TES GR+HTST TVAVLPE EEVE+ I+  D+++DT+ +SG GGQ +N T SAVR+TH+PTG+ V+CQ+ KSQI+N+E AMK+LRA++++K  +E +      RK  VGTG+R+E+IRTYN+PQNRVTDHRI LT+ KLD ++ G L + I++L+  D+A +M+ A+
  S:     6 DRLQAVENRYEKLNELLSDPAIISDSNKLREYSKEQSDIQETVEVYREYKDVREQLKDAKAMLEDKLDAEMREMVKEEVSELESQEKTLSERLKILLVPKDPNDDKNVIVEVRGAAGGDEAALFAGDLYRMYSRYAEVQGWKTEIIEASYTELGGYKEIIFMINGKGAFAKLKFENGAHRVQRVPETESGGRIHTSTATVAVLPEAEEVEIDIHEKDVRVDTFASSGPGGQSVNTTMSAVRLTHLPTGVVVSCQDEKSQIKNKEKAMKVLRARVYDKFRQEAQAEYDQNRKQAVGTGDRSERIRTYNFPQNRVTDHRIGLTIQKLDQILQGKLDDFINALVMEDQAQRMEAAE 358
>gi|94988610|ref|YP_596711.1| peptide chain release factor 1 [Streptococcus pyogenes MGAS9429] >gi|94990486|ref|YP_598586.1| peptide chain release factor 1 [Streptococcus pyogenes MGAS10270] >gi|94992434|ref|YP_600533.1| peptide chain release factor 1 [Streptococcus pyogenes MGAS2096] >gi|94994408|ref|YP_602506.1| peptide chain release factor 1 [Streptococcus pyogenes MGAS10750] >gi|139473768|ref|YP_001128484.1| peptide chain release factor 1 [Streptococcus pyogenes str. Manfredo] >gi|166223610|sp|A2REH9|RF1_STRPG Peptide chain release factor 1 (RF-1) >gi|119361619|sp|Q1JBR9|RF1_STRPB Peptide chain release factor 1 (RF-1) >gi|119361620|sp|Q1JLQ2|RF1_STRPC Peptide chain release factor 1 (RF-1) >gi|119361621|sp|Q1JGV2|RF1_STRPD Peptide chain release factor 1 (RF-1) >gi|119361622|sp|Q1J6M1|RF1_STRPF Peptide chain release factor 1 (RF-1) >gi|94542118|gb|ABF32167.1| bacterial peptide chain release factor 1 (RF-1) [Streptococcus pyogenes MGAS9429] >gi|94543994|gb|ABF34042.1| Bacterial Peptide Chain Release Factor 1 (RF-1) [Streptococcus pyogenes MGAS10270] >gi|94545942|gb|ABF35989.1| Bacterial Peptide Chain Release Factor 1 (RF-1) [Streptococcus pyogenes MGAS2096] >gi|94547916|gb|ABF37962.1| Bacterial Peptide Chain Release Factor 1 (RF-1) [Streptococcus pyogenes MGAS10750] >gi|134272015|emb|CAM30254.1| peptide chain release factor 1 [Streptococcus pyogenes str. Manfredo] (359 aa)
Score = 796, Expect = 6.3e-83, Identities = 172/349 (49%), Positives = 255/349 (73%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIK-SEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGFIS---FMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQ 355
           +Y+ L ++E+++ +L + L    +    KR  E+++    T   V  ++EYK+ +  I  AE++IK +  D E+ E+A+ EL E K   E+YE +LK+LLLPKDPNDDKN+I+E+R AAGGDE+++F GDL + Y++YA++ GW+ +++E   S +G G I     M++G++VYSK+K+ESG HRVQRVP TES+GRVHTST TV V+PE+EEVE  I+  DL++D Y ASGAGGQ++NK  +AVR+ HIPTGI V  QE ++Q +NR+ AMK++RA++ +   +  +      RK  VGTG+R+E+IRTYN+PQNRVTDHRI LTL KLD ++ G + E+ID+L+ +D+  K++
  S:     3 IYDQLQAVEDRYEELGELLSDPDVVSDTKRFMELSREEANTRETVTAYREYKQVIQTISDAEEMIKDASGDPELEEMAKEELKESKAAKEEYEEKLKILLLPKDPNDDKNIILEIRGAAGGDEAALFAGDLLTMYQKYAETQGWRFEVME--SSVNGVGGIKEVVAMVSGQSVYSKLKYESGAHRVQRVPVTESQGRVHTSTATVLVMPEVEEVEYDIDQKDLRVDIYHASGAGGQNVNKVATAVRMVHIPTGIKVEMQEERTQQKNRDKAMKIIRARVADHFAQIAQDEQDAERKSTVGTGDRSERIRTYNFPQNRVTDHRIGLTLQKLDTILSGKMDEVIDALVMYDQTKKLE 355
>gi|94271210|ref|ZP_01291905.1| Peptide chain release factor 1 [delta proteobacterium MLMS-1] >gi|93450530|gb|EAT01680.1| Peptide chain release factor 1 [delta proteobacterium MLMS-1] (354 aa)
Score = 796, Expect = 6.4e-83, Identities = 162/350 (46%), Positives = 251/350 (71%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGLSVK--RMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           ++  L  + E+  DL   L    +S    R   + K     + + E + +Y++T +D+++  +L++ E D EI+ELA+ E  E +  + + + EL++ L+P DPND+KN+++E+R   GGDE+S+FV +LF  Y RYA+ LGWKV++L    +   GY  I  +I+G++V+S++K+ESGVHRVQRVP TE++GRVHTS +TVAVLPE EEVEL IN ++LK D +R+SG GGQ +N T+SAVR+TH+PTG+ V CQ+ KSQ +N+  A+++LRA+L ++ +++    +S  RK QVG+G+R+E+IRTYN+PQNR+TDHRINLT  +L++VMLG L E+I+ L+ H +   +++
  S:     1 MFEQLADIAERKRDLEDRLADPAVSGDPGRYRSLAKEHSHVSRLEELYADYRKTSDDLEANGQLLQEEDDPEILELARQEGEELRQRLAQLDKELRLALVPPDPNDEKNILLEIRAGTGGDEASLFVANLFRMYSRYAEQLGWKVEVLSSSTTEVGGYKEIIALISGDHVFSRLKYESGVHRVQRVPETETQGRVHTSAVTVAVLPEAEEVELSINPAELKYDVFRSSGPGGQSVNTTDSAVRVTHLPTGLVVICQDEKSQHKNKAKALQVLRARLLDQMQQQQHDQMSSDRKSQVGSGDRSERIRTYNFPQNRLTDHRINLTSYRLEDVMLGRLDEVIEPLMLHYQTAALKQ 353
>gi|146306094|ref|YP_001186559.1| peptide chain release factor 1 [Pseudomonas mendocina ymp] >gi|166223589|sp|A4XR61|RF1_PSEMY Peptide chain release factor 1 (RF-1) >gi|145574295|gb|ABP83827.1| bacterial peptide chain release factor 1 (bRF-1) [Pseudomonas mendocina ymp] (360 aa)
Score = 796, Expect = 6.4e-83, Identities = 170/348 (48%), Positives = 245/348 (70%)
  Q:     7 LYNSLLSMEEKFNDLNKEL-ETEGLSVK-RMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGFISFM--INGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPEL-EEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           L N L ++ ++F +L   L + E +S + +    +K   E  P++  F+E ++  +D++ A+ L+K E D ++ E+A+ E+++ K  +   E +L+ +LLPKDPND +NV +E+R   GGDE++IF GDLF  Y RYA+  GW+V++L   E  HG GF   +  + G+NVY+K+KFESG HRVQRVP TES+GR+HTS  TVAVLPE  E+  + IN +DL++DTYR+SGAGGQH+N T+SA+RITHIPTG  V CQE +SQ +NR  AM  L AKL +++E    K IS+ RK  VG+G+R+E+IRTYN+PQ RVTDHRINLTL  L  VM G +  +I+ L++  +A ++
  S:     5 LLNKLDNLSDRFEELTALLGDAEVISKQTQFRAYSKEYAEIEPVIATFRELRKVQSDLEGAQALLK-ESDPDLREMAEEEVAQAKEALTTLEDKLQRMLLPKDPNDGRNVYLEVRAGTGGDEAAIFSGDLFRMYSRYAEKQGWRVEVLSANEGEHG-GFKEVIARVEGDNVYAKLKFESGAHRVQRVPETESQGRIHTSACTVAVLPEPDEQAAIEINPADLRVDTYRSSGAGGQHVNTTDSAIRITHIPTGTVVECQEERSQHKNRAKAMAWLAAKLQDQQEAAAHKEISETRKLLVGSGDRSERIRTYNFPQGRVTDHRINLTLYSLSEVMAGGVEAVIEPLLAEYQADQL 355
>gi|117926919|ref|YP_867536.1| peptide chain release factor 1 [Magnetococcus sp. MC-1] >gi|117610675|gb|ABK46130.1| bacterial peptide chain release factor 1 (bRF-1) [Magnetococcus sp. MC-1] (361 aa)
Score = 796, Expect = 6.5e-83, Identities = 155/322 (48%), Positives = 233/322 (72%)
  Q:    33 KRMSEINKSIKETTPIVEKFKEYKRTLNDI-DSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           KR +  +K   +  P+V  ++ +   L  + ++ E L ++  D E+ ++A+ E    K  +E+ +  L ++LLPKDPNDDKNVI+E+R   GG+E+++FV DLF  Y R+A+  GW+++ML    +   GY  +  M+ G+  Y  +K+ESGVHRVQR+P TE+ GR+HTS +TVA+LPE +EVEL I + DL+ID YR+SG GGQ +N T+SAVRITH+PTG+ V CQ+ KSQ +N+  AMK+L+A+L + +++      ++ RKGQVG+G+R+E+IRTYN+PQ+RVTDHRINLTL+KLD V+ G L+E++D+L +HD+A K+
  S:    31 KRFAAYSKEFSDLEPVVAAWQAHLAILQQLAETDEMLAEAGDDAEMRQMAREERETLKNKLEQSQKHLHLMLLPKDPNDDKNVILEIRAGTGGEEAALFVSDLFRMYGRFAEIKGWRIEMLSSSATDLGGYKELIAMVQGKGAYMGLKYESGVHRVQRIPVTETGGRIHTSAVTVAILPEADEVELHIEDKDLRIDVYRSSGPGGQSVNTTDSAVRITHLPTGLVVICQDEKSQHKNKAKAMKVLQARLLDAQQQAADSQRAEARKGQVGSGDRSERIRTYNFPQSRVTDHRINLTLHKLDQVLQGGLAEVVDALTAHDQASKL 354
>gi|114327270|ref|YP_744427.1| peptide chain release factor 1 [Granulibacter bethesdensis CGDNIH1] >gi|119361545|sp|Q0BUJ8|RF1_GRABC Peptide chain release factor 1 (RF-1) >gi|114315444|gb|ABI61504.1| bacterial peptide chain release factor 1 (RF-1) [Granulibacter bethesdensis CGDNIH1] (352 aa)
Score = 796, Expect = 6.9e-83, Identities = 162/333 (48%), Positives = 237/333 (71%)
  Q:    27 TEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGFISFM--INGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQEAKI 359
           +EGL+    +  ++ + E  P+V + +E       +  AE ++      E+ E     L EK P + +   E+++ LLPKD  D+++ I+E+RPAAGGDE+S+F   LFS Y+RYA+  GW+ ++LE  ++  G G    M  I G +V++++K+ESGVHRVQRVPATES+GR+HTST+TVAVLPE E+V++ ++  DL+ID YRASGAGGQH+NKTESAVRITH+P+GI VA QE KSQ +NR  AMK+L+A+L+E++      + +  R+ QVGTG+R+E+IRTYN+PQ RV+DHRINLTL K+D VMLG L + +D+L + D+A ++   ++
  S:    22 SEGLNGDSFAAASRELAELEPVVARIEELWAAERGLAEAEAMLADPDMRELAESEAEILREKLPSLTR---EIRIALLPKDEADERSAILEIRPAAGGDEASLFAAQLFSMYQRYAEIRGWRFEILEYDDTGLG-GLKGGMAEITGRSVFARLKYESGVHRVQRVPATESQGRIHTSTVTVAVLPEAEDVDVQVDEGDLRIDVYRASGAGGQHVNKTESAVRITHLPSGIVVAMQEEKSQHKNRAKAMKILKARLYEQQRAALHASRAADRRAQVGTGDRSERIRTYNFPQGRVSDHRINLTLYKIDRVMLGELDDFVDALTAEDQAARLSAQEL 352
>gi|15675118|ref|NP_269292.1| peptide chain release factor 1 [Streptococcus pyogenes M1 GAS] >gi|20139346|sp|Q99ZP5|RF1_STRP1 Peptide chain release factor 1 (RF-1) >gi|13622277|gb|AAK34013.1| putative peptide chain release factor 1 [Streptococcus pyogenes M1 GAS] (359 aa)
Score = 796, Expect = 7.4e-83, Identities = 172/349 (49%), Positives = 255/349 (73%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIK-SEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGFIS---FMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQ 355
           +Y+ L ++E+++ +L + L    +    KR  E+++    T   V  ++EYK+ +  I  AE++IK +  D E+ E+A+ EL E K   E+YE +LK+LLLPKDPNDDKN+I+E+R AAGGDE+++F GDL + Y++YA++ GW+ +++E   S +G G I     M++G++VYSK+K+ESG HRVQRVP TES+GRVHTST TV V+PE+EEVE  I+  DL++D Y ASGAGGQ++NK  +AVR+ HIPTGI V  QE ++Q +NR+ AMK++RA++ +   +  +      RK  VGTG+R+E+IRTYN+PQNRVTDHRI LTL KLD ++ G + E+ID+L+ +D+  K++
  S:     3 IYDQLQAVEDRYEELGELLSDPDVVSDTKRFMELSREETNTRETVTAYREYKQVIQTISDAEEMIKDASGDPELEEMAKEELKESKAAKEEYEEKLKILLLPKDPNDDKNIILEIRGAAGGDEAALFAGDLLTMYQKYAETQGWRFEVME--SSVNGVGGIKEVVAMVSGQSVYSKLKYESGAHRVQRVPVTESQGRVHTSTATVLVMPEVEEVEYDIDPKDLRVDIYHASGAGGQNVNKVATAVRMVHIPTGIKVEMQEERTQQKNRDKAMKIIRARVADHFAQIAQDEQDAERKSTVGTGDRSERIRTYNFPQNRVTDHRIGLTLQKLDTILSGKMDEVIDALVMYDQTKKLE 355
>gi|15896138|ref|NP_349487.1| peptide chain release factor 1 [Clostridium acetobutylicum ATCC 824] >gi|20139340|sp|Q97F68|RF1_CLOAB Peptide chain release factor 1 (RF-1) >gi|15025931|gb|AAK80827.1|AE007785_12 Protein chain release factor A [Clostridium acetobutylicum ATCC 824] (359 aa)
Score = 795, Expect = 7.9e-83, Identities = 165/343 (48%), Positives = 250/343 (72%)
  Q:    14 MEEKFNDLNKELETEGLSVKRMSEINKSIKETTP---IVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           +E K+++L+ ++    +   + SE  K  KE +    IV K++EYK+   D+++ +++++ + D E+ E+ + E+ E +  +  YE EL+V+LLPKDPND KNV VE+R   GG+E+++F  DLF  Y RYA+  GW  +++   E+   G+  I FM+ G   YS+MK+ESG HRVQRVP TES GR+HTS  TVAVLPE+++V++ IN +D++ID +RASG GGQ +N T+SAVRITH+PTGI V+CQ+ K Q++N+E AMK+LRA+L+EK E E    I++ R+ QVG+G+R+E+IRTYN+PQ R+TDHRI LT+ KL+  + G++ E+I+ LI+ ++A KM+E
  S:     8 IESKYDELSVKISDPSVMANQ-SEWQKLCKEHSEVENIVLKYREYKKAKEDLEADKEMLRDKIDAELKEMVEEEIKELEKSVVDYEEELRVMLLPKDPNDSKNVFVEIRGGTGGEEAALFAADLFRMYTRYAERQGWHTEVMSANETDIGGFKEIVFMVKGNGAYSRMKYESGTHRVQRVPNTESSGRIHTSAATVAVLPEVDDVDIEINPNDIRIDVFRASGHGGQCVNTTDSAVRITHLPTGIVVSCQDEKRQLKNKEKAMKVLRARLYEKAEAERNAGIAENRRNQVGSGDRSERIRTYNFPQGRITDHRIGLTIYKLEQFLDGDIDEVINGLITAEQAEKMKE 353
>gi|157736354|ref|YP_001489037.1| peptide chain release factor 1 [Arcobacter butzleri RM4018] >gi|166977359|sp|A8EQZ4|RF1_ARCB4 Peptide chain release factor 1 (RF-1) >gi|157698208|gb|ABV66368.1| peptide chain release factor 1 [Arcobacter butzleri RM4018] (355 aa)
Score = 795, Expect = 8.2e-83, Identities = 181/351 (51%), Positives = 255/351 (72%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGLS--VKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQES-SHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVML-GNLSEIIDSLISHDEAVKMQEA 357
           L + L     +F ++N+ L +  ++  +KRM++++K      PIV K KEY + L DI+  + ++    D E+ +LA+ EL E +    + E E+KVL++PKDPNDD+N+ +E+R   GGDE++IFVGDLF AY RYA++ GWKV+++   +S S GY  I  ++ G++VYSK+KFE G HRVQRVPATES+GRVHTS ITVAV+PE+++VE+ IN +DLKID  RASG GGQ +N T+SAVRITHIP+GI V  Q+ KSQ +N++ A+K+L+AKL+E + E+  +     RK QVGTG+R+ +IRTYNYPQNR++DHRINLTL +LD +M  G   E+ID LI+ D   K+ EA
  S:     2 LKDKLQPFINRFEEINQLLMSSEITSDIKRMTDLSKEQSSIQPIVSKAKEYIKVLEDIEENKLMLD---DPELGDLAKEELKELETRKPELEEEIKVLMIPKDPNDDRNIYLELRAGTGGDEAAIFVGDLFRAYLRYAENNGWKVEIMSSSDSESGGYKEIVILVKGDHVYSKLKFEGGTHRVQRVPATESQGRVHTSAITVAVMPEVDDVEIEINENDLKIDVMRASGNGGQSVNTTDSAVRITHIPSGIVVTNQDQKSQHKNKDRALKVLKAKLYEIEMEKKMEAEGATRKEQVGTGDRSGRIRTYNYPQNRISDHRINLTLYRLDYIMNDGLFGEVIDPLIA-DHQSKLIEA 352
>gi|26987469|ref|NP_742894.1| peptide chain release factor 1 [Pseudomonas putida KT2440] >gi|32171521|sp|Q88PW5|RF1_PSEPK Peptide chain release factor 1 (RF-1) >gi|24982133|gb|AAN66358.1|AE016264_2 peptide chain release factor 1 [Pseudomonas putida KT2440] (360 aa)
Score = 795, Expect = 8.7e-83, Identities = 169/348 (48%), Positives = 242/348 (69%)
  Q:     7 LYNSLLSMEEKFNDLNKEL-ETEGLSVK-RMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPEL-EEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           L N L  ++++F +L   L + E +S + R    ++   E  P+   +KE+++  +D++ A+ L+K + D ++ E+A  E+ E K  +   E +L+ +LLPKDPND +NV +E+R   GGDE++IF GDLF  Y RYA+  GW++++L   E  HG Y  I   + GENVY K+KFESG HRVQRVP TES+GRVHTS  TVAVLPE  E+  + IN +DL++DTYRASGAGGQH+NKT+SA+RITH+PTGI V CQE +SQ +NR  AM  L AKL + +    +  ++  RK  VG+G+R+E+IRTYNYPQ RVTDHRINLTL  LD+++ G +  +I+ L++  +A ++
  S:     5 LLNKLEILQDRFEELTALLGDAEVISDQTRFRAYSREYAEVEPVYAAYKEWRKVQDDLEGAQALLK-DSDPDLREMAVEEVREAKEQLLTLEAQLQRMLLPKDPNDGRNVFLEIRAGTGGDEAAIFSGDLFRMYSRYAEKRGWRLEILSENEGEHGGYKEIIARVEGENVYGKLKFESGAHRVQRVPETESQGRVHTSACTVAVLPEPDEQAAIEINPADLRVDTYRASGAGGQHVNKTDSAIRITHLPTGIVVECQEERSQHKNRARAMSWLSAKLNDMQTSAAQNALASERKLLVGSGDRSERIRTYNYPQGRVTDHRINLTLYSLDDILSGGVDAVIEPLLAEYQADQL 355
>gi|20806672|ref|NP_621843.1| peptide chain release factor 1 [Thermoanaerobacter tengcongensis MB4] >gi|22096035|sp|Q8RD98|RF1_THETN Peptide chain release factor 1 (RF-1) >gi|20515122|gb|AAM23447.1| Protein chain release factor A [Thermoanaerobacter tengcongensis MB4] (356 aa)
Score = 795, Expect = 9.1e-83, Identities = 179/349 (51%), Positives = 261/349 (74%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGLSVKRMSEINKSIKETTPI---VEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQ 355
           +   L ++E+++ +L++++    + +  + E  K +KE   I   V K++EYK+ L +I + E+L+ S+ D E+ E+A+ ELS+ +   EK   E+K+LLLPKDPND+KNVI+E+R  AGG+E+++F  DLF  Y  YA+  GWKV+++   ++   G+  + F I+G+  YS++K+ESGVHRVQR+P TE+ GR+HTST TVAVLPE EEV++ IN +D+KID +R+SG GGQ +N T+SAVR+THIPTGI V CQ+ +SQI+NRE A+K+LRAKL+E   +E ++ I++ RK QVGTGER+E+IRTYN+PQ RVTDHRI LTL KL  V+ G L EIID+LI +D+A K++
  S:     1 MIEKLQAIEDRYVELSQKISDPNV-ISNVEEWRKYVKEHAAIEDIVLKYREYKKVLEEIKATEELLSSQ-DEELKEMAEEELSQLEEKKEKLMEEIKILLLPKDPNDEKNVIMEIRAGAGGEEAALFAYDLFRMYTMYAEKKGWKVEIMSANKTDIGGFKEVIFSISGKGAYSRLKYESGVHRVQRIPTTEAGGRIHTSTATVAVLPEAEEVDVEINPNDIKIDVFRSSGHGGQSVNTTDSAVRVTHIPTGIVVTCQDERSQIQNRERALKILRAKLYEMALKEQQREIAEARKSQVGTGERSERIRTYNFPQGRVTDHRIGLTLYKLQEVLDGELDEIIDALILNDQAEKLK 351
>gi|148323010|gb|EDK88260.1| peptide chain release factor RF1 [Fusobacterium nucleatum subsp. polymorphum ATCC 10953] (357 aa)
Score = 794, Expect = 1.0e-82, Identities = 184/345 (53%), Positives = 258/345 (74%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEV-ELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           +++ L  +  ++++LNK L +  +    K+M E NK+I E T IVEK+KEYK+ ++DI+  ++  K+EKD+E+ E+   EL E +  + K E ELK+LLLPKD NDDKNVIVE+R  AGGDE+++F  DLF  Y RYA+   WK++++E Q+    G   I+F I G   YS++KFESGVHRVQRVP TE+ GR+HTST TVAVLPE+E+V E+ ++  DLKIDTYR+ GAGGQH+N T+SAVRITH+PTGI V CQ+ +SQ++NRE AMK L  KL+E ++E+ R  +   R+ QVGTG+RAEKIRTYN+P  R+TDHRI LT+++L+  + G++ E+ID+LI+  +A
  S:     1 MFDKLEEVVTRYDELNKMLVSPEVLADSKKMIECNKAINEITEIVEKYKEYKKYVDDIEFIKESFKTEKDSEMKEMLNEELKEAEEKLPKLEEELKILLLPKDKNDDKNVIVEIRGGAGGDEAALFAADLFRMYSRYAERKKWKIEIIEKQDGELGGIKEIAFTIIGLGAYSRLKFESGVHRVQRVPKTEASGRIHTSTATVAVLPEVEDVQEVTVDPKDLKIDTYRSGGAGGQHVNMTDSAVRITHLPTGIVVQCQDERSQLKNREKAMKHLLTKLYEMEQEKQRSEVESERRLQVGTGDRAEKIRTYNFPDGRITDHRIKLTVHQLEAFLDGDIDEMIDALITFHQA 349
>gi|167464538|ref|ZP_02329627.1| peptide chain release factor 1 [Paenibacillus larvae subsp. larvae BRL-230010] (357 aa)
Score = 794, Expect = 1.1e-82, Identities = 157/326 (48%), Positives = 241/326 (73%)
  Q:    33 KRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQEAK 358
           K++ E +K         + + EYK+ L  +++A+ + K + D+E+ EL ++E+ E     E+ E  LK+L+LPKDPND+KNVIVE+R AAGGDE+++F  DL+  Y RYA+S GWK ++L+   +   G+  I+FMI G   YSK+K+ESG HRVQR+P TES GR+HTST TVAV+PE+E++++ I +SD+++DT+ +SGAGGQ +N T+SAVR+TH+PTGI   CQ+GKSQ +N+  A+++LRA+++++  +E     +  RK +VGTG+R+E+IRTYN+PQ+RVTDHRI LTL+KLD+++ G+L EII +L    +A ++++ +
  S:    30 KKLREYSKEQSGLQEAYDTYMEYKQVLGQLEAAKAMQKEKLDDEMSELVKMEIEELSGRKEELEERLKILMLPKDPNDNKNVIVEVRGAAGGDEAALFAADLYRMYSRYAESQGWKTEVLDANLNDLGGFKEITFMIKGNGAYSKLKYESGAHRVQRIPVTESGGRIHTSTSTVAVMPEMEDIDIEIKDSDIRVDTFCSSGAGGQSVNTTKSAVRVTHVPTGIVATCQDGKSQNDNKAKALQVLRARIYDQVRQEEEAKYAGERKSKVGTGDRSERIRTYNFPQSRVTDHRIGLTLHKLDSILGGDLEEIITALTMAAQAEQLEKGE 356
>gi|27468634|ref|NP_765271.1| peptide chain release factor 1 [Staphylococcus epidermidis ATCC 12228] >gi|57867593|ref|YP_189289.1| peptide chain release factor 1 [Staphylococcus epidermidis RP62A] >gi|32171533|sp|Q8CNI7|RF1_STAES Peptide chain release factor 1 (RF-1) >gi|71153098|sp|Q5HMA4|RF1_STAEQ Peptide chain release factor 1 (RF-1) >gi|27316181|gb|AAO05315.1|AE016749_261 peptide chain release factor RF-1 [Staphylococcus epidermidis ATCC 12228] >gi|57638251|gb|AAW55039.1| peptide chain release factor 1 [Staphylococcus epidermidis RP62A] (358 aa)
Score = 794, Expect = 1.1e-82, Identities = 176/350 (50%), Positives = 249/350 (71%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           +++ L  +EE++  LN+ L    +     ++ + +K   +    V+ ++ YK    ++   E ++    D E +E+ + E S  K  +   E ELK+LL+PKDPNDDK+VIVE+R AAGGDE++IF GDL   Y +YA++ G+K +++E  ES HG Y  +SF ++G   YSK+KFE+G HRVQRVP TES GR+HTST TVAVLPE E+VE+ I N DLKIDTYR+SGAGGQH+N T+SAVRITH+PTG+     E KSQI+NRE AMK+L+A+L++ K +E ++  +  RK  VGTG+R+E+IRTYNYPQ+RVTDHRI LTL KL+ +M GNL EI+++L   ++  K++E
  S:     1 MFDQLDIVEERYEQLNELLSDPDVVNDADKLRKYSKEQADLQKTVDVYRSYKTKKEELQDIEDMLNETSDKEEVEMLKEESSALKTELPDMEEELKILLIPKDPNDDKDVIVEIRAAAGGDEAAIFAGDLMRMYSKYAEANGFKTEIVEASESDHGGYKEVSFSVSGTGAYSKLKFENGAHRVQRVPETESGGRIHTSTATVAVLPEAEDVEIEIRNEDLKIDTYRSSGAGGQHVNTTDSAVRITHLPTGVIATSSE-KSQIQNREKAMKVLKARLYDMKLQEEQQKYASQRKSAVGTGDRSERIRTYNYPQSRVTDHRIGLTLQKLNQIMEGNLDEIVEALTLSEQTEKLKE 352
>gi|154252199|ref|YP_001413023.1| peptide chain release factor 1 [Parvibaculum lavamentivorans DS-1] >gi|171769599|sp|A7HTY3|RF1_PARL1 Peptide chain release factor 1 (RF-1) >gi|154156149|gb|ABS63366.1| peptide chain release factor 1 [Parvibaculum lavamentivorans DS-1] (355 aa)
Score = 794, Expect = 1.2e-82, Identities = 170/354 (48%), Positives = 245/354 (69%)
  Q:     1 MIYNEKLYNSLLSMEEKFNDLNKELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGN-LSEIIDSLISHDEAVKM 354
           MI  E+L + +   E   +++N ++  +     R   ++K   E  P+            +   AE+L++     ++ E+A+ E++     + + E+E++++LLPKD  DD+NVI+E+R   GGDE+++F GDLF  Y+RYA + GWKV+++   E   G Y  I   I+G  VY+K+KFESGVHRVQRVP TE  GR+HTS  TVAVLPE EEV++ I + DL+ID YRASGAGGQH+NKTESAVRITH+PTGI VA Q+ KSQ +N+  AM++LRA++++ + E   +  S  RKGQVG+G+R+E+IRTYN+PQ+RVTDHRINLTL+KLD V+ G  L E+ID+LI+ D+A ++
  S:     1 MIPEERLQSVIARFEAVQSEMNSDVPRD-----RFVALSKEFSELEPVAAAIGHLLARRREYADAEQLLRVR---DMAEMAKEEIARLNEELPRLEHEVQLMLLPKDAADDRNVILEVRAGTGGDEAALFAGDLFRMYERYASNQGWKVELIAASEGEMGGYKEIIAGISGPGVYAKLKFESGVHRVQRVPVTEGGGRIHTSAATVAVLPEAEEVDVEIEDKDLRIDVYRASGAGGQHVNKTESAVRITHLPTGIVVAQQDEKSQHKNKARAMQILRARIFDAERERLDRERSAARKGQVGSGDRSERIRTYNFPQSRVTDHRINLTLHKLDQVLEGEALGELIDALIAEDQAARL 348
>gi|189424095|ref|YP_001951272.1| peptide chain release factor 1 [Geobacter lovleyi SZ] >gi|189420354|gb|ACD94752.1| peptide chain release factor 1 [Geobacter lovleyi SZ] (355 aa)
Score = 794, Expect = 1.2e-82, Identities = 168/349 (48%), Positives = 251/349 (71%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGLSVKRMSEINKSIKE---TTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISH--DEAVKMQ 355
           +++ +  +E +F +L + L ++   +    E  K  +E     P++E F+ YK+ L++++  ++L+    D E+ E+A+ E+S      E+ + E+K+LLLPKDPND ++VI+E+R   GGDES++F GDLF  Y R+A+   WKV+ML   ES  G Y  +   I G++VY+K+K+ESG HRVQRVP TE++GR+HTS  TVA++ E E+V++ IN +DLKID YR+SGAGGQH+N T+SAVRITHIPTG  VACQE +SQI+NR  AMK+L+ ++ +  ++E    ++  RK QVG+G+R+E+IRTYN+PQ R+TDHRI LTL +LD++M G++ EI D+L +H   EA+K Q
  S:     1 MFDKIQDLEIRFQEL-ESLLSDPTVIANQPEFRKLSREHADLAPLIEAFRRYKKVLDELEENQELLA---DPEMKEMAEEEISRLSQEKERLDAEIKILLLPKDPNDSRDVILEIRAGTGGDESALFSGDLFRMYSRFAEKNRWKVEMLSCSESERGGYKEVIASIEGQDVYAKLKYESGTHRVQRVPETEAQGRIHTSACTVAIMAEAEDVDIDINPADLKIDVYRSSGAGGQHVNTTDSAVRITHIPTGTVVACQEERSQIKNRAKAMKVLKTRILDTIQQEQNAKLAADRKQQVGSGDRSERIRTYNFPQGRMTDHRIGLTLYRLDSIMAGDIEEITDALRAHYQMEALKAQ 351
>gi|167031789|ref|YP_001667020.1| peptide chain release factor 1 [Pseudomonas putida GB-1] >gi|189039985|sp|B0KNE4|RF1_PSEPG Peptide chain release factor 1 (RF-1) >gi|166858277|gb|ABY96684.1| peptide chain release factor 1 [Pseudomonas putida GB-1] (360 aa)
Score = 794, Expect = 1.3e-82, Identities = 170/348 (48%), Positives = 240/348 (68%)
  Q:     7 LYNSLLSMEEKFNDLNKEL-ETEGLSVK-RMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPEL-EEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           L N L  ++++F +L   L + E +S + R    ++   E  P+   +KE+ +   D++ A+ L+K + D ++ E+A  E+ E K  +   E +L+ +LLPKDPND +NV +E+R   GGDE++IF GDLF  Y RYA+  GW++++L   E  HG Y  I   + GENVY K+KFESG HRVQRVP TES+GRVHTS  TVAVLPE  E+  + IN +DL++DTYRASGAGGQH+NKT+SA+RITH+PTGI V CQE +SQ +NR  AM  L AKL + +    +  I+  RK  VG+G+R+E+IRTYNYPQ RVTDHRINLTL  LD+++ G +  +I+ L++  +A ++
  S:     5 LLNKLDILQDRFEELTALLGDAEVISDQTRFRAYSREYAEVEPVYAAYKEWCKVQGDLEGAQALLK-DSDPDLREMAVEEVREAKEQLLTLESQLQRMLLPKDPNDGRNVFLEIRAGTGGDEAAIFSGDLFRMYSRYAEKRGWRLEILSENEGEHGGYKEIIARVEGENVYGKLKFESGAHRVQRVPETESQGRVHTSACTVAVLPEPDEQAAIEINPADLRVDTYRASGAGGQHVNKTDSAIRITHLPTGIVVECQEERSQHKNRARAMSWLSAKLNDMQTSAAQNAIASERKLLVGSGDRSERIRTYNYPQGRVTDHRINLTLYSLDDILSGGVEAVIEPLLAEYQADQL 355
>gi|78778239|ref|YP_394554.1| peptide chain release factor 1 [Sulfurimonas denitrificans DSM 1251] >gi|119361635|sp|Q30NW2|RF1_THIDN Peptide chain release factor 1 (RF-1) >gi|78498779|gb|ABB45319.1| bacterial peptide chain release factor 1 (bRF-1) [Sulfurimonas denitrificans DSM 1251] (355 aa)
Score = 794, Expect = 1.3e-82, Identities = 179/351 (50%), Positives = 251/351 (71%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGLS--VKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQES-SHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNL-SEIIDSLISHDEAVKMQEA 357
           L + L     ++N+L + L +  ++  +KRM+ ++K       IVEK +EYK  ++ I+  ++++    D E+ E+A+ EL E +  I   E ++K+LLLPKDPNDD+N+IVE+R  AGGDE++IFVG+LF AY RYAD   WKV++L    S + GY  I  +I GE VYS++K+E G HRVQRVPATES+GRVHTS ITVAV+PE+++VE+ IN +DLKID  R+SG GGQ +N T+SAVRITH+PTG+ V  Q+ KSQ +N+E AMK+L+A+L++ + +E     S  R  QVGTG+R+ +IRTYNYPQNR++DHRI LTL +L  +M G L  EII+ LI+ D   K+ EA
  S:     2 LADKLTPFINRYNELGEMLSSPDITSDIKRMTTLSKERSSLEKIVEKAQEYKSVISQINDTKEMLY---DAEMAEMAKEELKELEIQIPILENDIKLLLLPKDPNDDRNIIVELRAGAGGDEAAIFVGNLFEAYTRYADLKDWKVEILSSSPSDAGGYKEIIALIRGEQVYSRLKYEGGTHRVQRVPATESQGRVHTSAITVAVMPEVDDVEIQINENDLKIDVMRSSGCGGQSVNTTDSAVRITHLPTGLVVTNQDQKSQHKNKEKAMKVLKARLYDLEMQEAIAKDSANRSAQVGTGDRSGRIRTYNYPQNRMSDHRITLTLYRLAEIMQGGLMDEIIEPLIA-DHQSKIVEA 352
>gi|104780100|ref|YP_606598.1| peptide chain release factor 1 [Pseudomonas entomophila L48] >gi|166223588|sp|Q1IEX1|RF1_PSEE4 Peptide chain release factor 1 (RF-1) >gi|95109087|emb|CAK13784.1| peptide chain release factor 1 [Pseudomonas entomophila L48] (360 aa)
Score = 794, Expect = 1.3e-82, Identities = 166/348 (47%), Positives = 243/348 (69%)
  Q:     7 LYNSLLSMEEKFNDLNKEL-ETEGLSVK-RMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPEL-EEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           L N L +++++F +L   L + E +S + R    ++   E  P++  +  +++  +D++ A+ L+K + D ++ E+A  E+ E K  +   E +L+ +LLPKDPND +NV +E+R   GGDE++IF GDLF  Y RYA+  GW++++L   E  HG Y  I   + G++VY K+KFESG HRVQRVP TES+GR+HTS  TVAVLPE  E+V + IN +DL++DTYRASGAGGQH+NKT+SA+RITH+PTGI V CQE +SQ +NR  AM  L AKL + +    +  I+  RK  VG+G+R+E+IRTYNYPQ RVTDHRINLTL  LD+++ G +  +I+ L++  +A ++
  S:     5 LLNKLDTLQDRFEELTALLGDAEVISDQTRFRAYSREYAEVEPVIACYVGWRKVQDDLEGAQALLK-DADPDLREMAVEEVREAKEQLVGLESQLQRMLLPKDPNDGRNVFLEIRAGTGGDEAAIFSGDLFRMYSRYAEKRGWRLEILSENEGEHGGYKEIIARVEGDSVYGKLKFESGAHRVQRVPETESQGRIHTSACTVAVLPEPDEQVAIEINPADLRVDTYRASGAGGQHVNKTDSAIRITHLPTGIVVECQEERSQHKNRARAMSWLSAKLNDMQTSAAQNAIASERKLLVGSGDRSERIRTYNYPQGRVTDHRINLTLYSLDDILAGGVDAVIEPLLAEYQADQL 355
>gi|163943017|ref|YP_001647901.1| peptide chain release factor 1 [Bacillus weihenstephanensis KBAB4] >gi|163865214|gb|ABY46273.1| peptide chain release factor 1 [Bacillus weihenstephanensis KBAB4] (355 aa)
Score = 793, Expect = 1.3e-82, Identities = 169/352 (48%), Positives = 252/352 (71%)
  Q:     7 LYNSLLSMEEKFNDLNKEL-ETEGLS-VKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQEAK 358
           + + L ++E ++  LN+ L + E +S   ++ E +K   +    VE ++EYK     +  A+ +++ + D ++ ++ + E+SE +   +     LK+LL+PKDPNDDKNVIVE+R AAGGDE+++F GDL+  Y RYA+  GWK +++E   +   GY  I FMING+  ++K+KFE+G HRVQRVP TES GR+HTST TVAVLPE EEVE+ I+  D+++DT+ +SG GGQ +N T SAVR+TH+PTG+ V+CQ+ KSQI+N+E AMK+LRA++++K  +E +      RK  VGTG+R+E+IRTYN+PQNRVTDHRI LT+ KLD ++ G L + I++L+  D+A KM+ A+
  S:     1 MLDRLQAVENRYEKLNELLSDPEVISDTNKLREYSKEQSDIQDTVEVYREYKDVREQLRDAKAMLEDKLDADMRDMVKEEVSELEGQEKTLSERLKILLVPKDPNDDKNVIVEVRGAAGGDEAALFAGDLYRMYSRYAEVQGWKTEIIEASYTELGGYKEIIFMINGKGAFAKLKFENGAHRVQRVPETESGGRIHTSTATVAVLPEAEEVEINIHEKDVRVDTFASSGPGGQSVNTTMSAVRLTHLPTGVVVSCQDEKSQIKNKEKAMKVLRARVYDKFRQEAQAEYDQNRKQAVGTGDRSERIRTYNFPQNRVTDHRIGLTIQKLDQILQGKLDDFINALVMEDQAQKMEAAE 355
>gi|65317305|ref|ZP_00390264.1| COG0216: Protein chain release factor A [Bacillus anthracis str. A2012] (323 aa)
Score = 793, Expect = 1.3e-82, Identities = 165/320 (51%), Positives = 235/320 (73%)
  Q:    39 NKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQEAK 358
           N  I+ET   VE ++EYK     +  A+ +++ + D E+ E+ + E+SE +   +     LK+LL+PKDPNDDKNVIVE+R AAGGDE+++F GDL+  Y RYA+  GWK +++E   +   GY  I FMING+  ++K+KFE+G HRVQRVP TES GR+HTST TVAVLPE EEVE+ I+  D+++DT+ +SG GGQ +N T SAVR+TH+PTG+ V+CQ+ KSQI+N+E AMK+LRA++++K  +E +      RK  VGTG+R+E+IRTYN+PQNRVTDHRI LT+ KLD ++ G L + I++L+  D+A +M+ A+
  S:     6 NXDIQET---VEVYREYKDVREXLKDAKAMLEDKLDAEMREMVKEEVSELESQEKTLSERLKILLVPKDPNDDKNVIVEVRGAAGGDEAALFAGDLYRMYSRYAEVQGWKTEIIEASYTELGGYKEIIFMINGKGAFAKLKFENGAHRVQRVPETESGGRIHTSTATVAVLPEAEEVEIDIHEKDVRVDTFASSGPGGQSVNTTMSAVRLTHLPTGVVVSCQDEKSQIKNKEKAMKVLRARVYDKFRQEAQAEYDQNRKQAVGTGDRSERIRTYNFPQNRVTDHRIGLTIQKLDQILQGKLDDFINALVMEDQAQRMEAAE 323
>gi|19746088|ref|NP_607224.1| peptide chain release factor 1 [Streptococcus pyogenes MGAS8232] >gi|24418636|sp|Q8P125|RF1_STRP8 Peptide chain release factor 1 (RF-1) >gi|19748260|gb|AAL97723.1| putative peptide chain release factor 1 [Streptococcus pyogenes MGAS8232] (359 aa)
Score = 793, Expect = 1.3e-82, Identities = 172/349 (49%), Positives = 255/349 (73%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIK-SEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGFIS---FMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQ 355
           +Y+ L ++E+++ +L + L    +    KR  E+++    T   V  ++EYK+ +  I  AE++IK +  D E+ E+A+ EL E K   E+YE +LK+LLLPKDPNDDKN+I+E+R AAGGDE+++F GDL + Y++YA++ GW+ +++E   S +G G I     M++G++VYSK+K+ESG HRVQRVP TES+GRVHTST TV V+PE+EEVE  I+  DL++D Y ASGAGGQ++NK  +AVR+ HIPTGI V  QE ++Q +NR+ AMK++RA++ +   +  +      RK  VGTG+R+E+IRTYN+PQNRVTDHRI LTL KLD ++ G + E+ID+L+ +D+  K++
  S:     3 IYDQLQAVEDRYEELGELLSDPDVVSDTKRFMELSREEANTRETVTAYREYKQVIQTISDAEEMIKDASGDPELEEMAKEELKESKAAKEEYEEKLKILLLPKDPNDDKNIILEIRGAAGGDEAALFAGDLLTMYQKYAETQGWRFEVME--SSVNGVGGIKEVVAMVSGQSVYSKLKYESGAHRVQRVPVTESQGRVHTSTATVLVMPEVEEVEYDIDQKDLRVDIYHASGAGGQNVNKVATAVRMVHIPTGIKVEMQEERTQQKNRDKAMKIIRARVADHFAQIAQDEQDAERKSTVGTGDRSERIRTYNFPQNRVTDHRIGLTLQKLDIILSGKMDEVIDALVMYDQTKKLE 355
>gi|47570471|ref|ZP_00241104.1| peptide chain release factor 1 [Bacillus cereus G9241] >gi|47552867|gb|EAL11285.1| peptide chain release factor 1 [Bacillus cereus G9241] (358 aa)
Score = 793, Expect = 1.4e-82, Identities = 176/354 (49%), Positives = 250/354 (70%)
  Q:     5 EKLYNSLLSMEEKFNDLNKELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQEAK 358
           EKL N LLS  E  +D NK        ++  S+    I+ET   VE ++EYK     +  A+ +++ + D E+ E+ + E+SE +   +     LK+LL+PKDPNDDKNVIVE+R AAGGDE+++F GDL+  Y RYA+  GWK +++E   +   GY  I FMING+  ++K+KFE+G HRVQRVP TES GR+HTST TVAVLPE EEVE+ I+  D+++DT+ +SG GGQ +N T SAVR+TH+PTG+ V+CQ+ KSQI+N+E AMK+LRA++++K  +E +      RK  VGTG+R+E+IRTYN+PQNRVTDHRI LT+ KLD ++ G L + I++L+  D+A +M+ A+
  S:    16 EKL-NELLSDPEVISDTNK--------LREYSKEQSDIQET---VEVYREYKDVREQLKDAKAMLEDKLDAEMREMVKEEVSELESQEKTLSERLKILLVPKDPNDDKNVIVEVRGAAGGDEAALFAGDLYRMYSRYAEVQGWKTEIIEASYTELGGYKEIIFMINGKGAFAKLKFENGAHRVQRVPETESGGRIHTSTATVAVLPEAEEVEIDIHEKDVRVDTFASSGPGGQSVNTTMSAVRLTHLPTGVVVSCQDEKSQIKNKEKAMKVLRARVYDKFRQEAQAEYDQNRKQAVGTGDRSERIRTYNFPQNRVTDHRIGLTIQKLDQILQGKLDDFINALVMEDQAQRMEAAE 358
>gi|169824785|ref|YP_001692396.1| peptide chain release factor 1 [Finegoldia magna ATCC 29328] >gi|167831590|dbj|BAG08506.1| bacterial peptide chain release factor 1 [Finegoldia magna ATCC 29328] (355 aa)
Score = 793, Expect = 1.4e-82, Identities = 166/349 (47%), Positives = 252/349 (72%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQ 355
           ++ +L S+ +KF DL  ++    +   ++  +++ K   +  P+V K+  YK  L +++  ++L+ +  D+E+ EL + E+S  +  IEK + ELK+LLLPKDPND+KNV +E+R  AGGDE+ +F G+L   Y+ Y+D   W  +++++Q+    G   +  M+ G+  YS++K+ESGVHRVQRVP TES GR+HTST TVAVLPE E+V++ I   DL+ID +RASG GGQ +N T+SAVRITHIPTG+ V CQ+ KSQI+N++ AMK+L+++L++  EEE  K+ +D RK QVGTG+R+E+IRTYN+PQ R+TDHRIN T+ +L N + G++ E+ID L S+D+A K++
  S:     1 MFENLDSVVDKFKDLEVKVADPEVIADMENWTKLMKEHADLEPVVNKYLSYKDNLKNLEEDKELLGTTGDSEMEELLKDEISTLEEQIEKDQEELKILLLPKDPNDEKNVFIEIRAGAGGDEAGLFAGELLRMYQMYSDKKHWTTEIMDIQQQGVGGIKEVVMMVKGKGAYSRLKYESGVHRVQRVPQTESSGRIHTSTATVAVLPEAEDVDVKIEQKDLRIDVFRASGNGGQCVNTTDSAVRITHIPTGLVVTCQDEKSQIKNKDKAMKVLKSRLYDLMEEEKNKDRADARKSQVGTGDRSERIRTYNFPQGRITDHRINKTIFQLQNFLDGDIEEMIDDLTSYDQAEKLK 352
>gi|20139347|sp|Q9AG29|RF1_STRAG Peptide chain release factor 1 (RF-1) >gi|13487345|gb|AAK27505.1|AF343879_1 peptide chain release factor 1 [Streptococcus agalactiae] (359 aa)
Score = 792, Expect = 1.7e-82, Identities = 172/349 (49%), Positives = 253/349 (72%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIK-SEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGFIS---FMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQ 355
           +Y+ L  +E+++ +L + L    +    KR  E+++    T   V  ++EYK+ + +I  AE++IK +  D E+ E+A+ EL E K   E+YE  LK+LLLPKDPNDDKN+I+E+R AAGGDE+++F GDL + Y++YA++ GW+ +++E   S +G G I     M++G++VYSK+K+ESG HRVQRVP TES+GRVHTST TV V+PE+EEVE  I+  DL+ D Y ASGAGGQ++NK  +AVR+ HIPTGI V  QE ++Q +NR+ AMK++RA++ +   +  +      RK  VGTG+R+E+IRTYN+PQNRVTDHRI LTL KLD ++ G + E+ID+L+ +D+  K++
  S:     3 IYDQLQPVEDRYEELGELLSDPYVVSDTKRFMELSREEANTRETVTAYREYKQVIQNISDAEEMIKDASGDAELEEMAKEELKESKAAKEEYEERLKILLLPKDPNDDKNIILEIRGAAGGDEAALFAGDLLTMYQKYAETQGWRFEVME--SSVNGVGGIKEVVAMVSGQSVYSKLKYESGAHRVQRVPVTESQGRVHTSTATVLVMPEVEEVEYEIDQKDLRADIYHASGAGGQNVNKVATAVRMVHIPTGIKVEMQEERTQQKNRDKAMKIIRARVADHFAQIAQDEQDAERKSTVGTGDRSERIRTYNFPQNRVTDHRIGLTLQKLDTILSGKMDEVIDALVMYDQTQKLE 355
>gi|16080754|ref|NP_391582.1| peptide chain release factor 1 [Bacillus subtilis subsp. subtilis str. 168] >gi|1172909|sp|P45872|RF1_BACSU Peptide chain release factor 1 (RF-1) >gi|853776|emb|CAA89884.1| peptide chain release factor 1 [Bacillus subtilis] >gi|2636226|emb|CAB15718.1| peptide chain release factor 1 [Bacillus subtilis subsp. subtilis str. 168] (356 aa)
Score = 792, Expect = 1.9e-82, Identities = 165/352 (46%), Positives = 252/352 (71%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQES-SHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQEAK 358
           + + L S+EE++  LN+ L    +    K++ E +K   +    V+ +++Y+     +  A+ +++ + D E+ ++ + E+SE +   E     LKVLL+PKDPNDDKNVI+E+R AAGG+E+++F G+L+  Y RYA+  GWK +++E   + + GY  I FMI G   YSK+K+E+G HRVQRVP TES GR+HTST TVA LPE EEVE+ I+  D+++DT+ +SG GGQ +N T SAVR+TH+PTG+ V+CQ+ KSQI+N+E AMK+LRA++++K ++E +      RK  VG+G+R+E+IRTYN+PQNRVTDHRI LT+ KLD ++ G L E++++LI  D+A K+Q+++
  S:     1 MLDRLKSIEERYEKLNELLSDPEVVNDPKKLREYSKEQSDIQETVDVYRQYRDASEQLADAKAMLEEKLDAEMRDMVKEEISELQKETETLSERLKVLLIPKDPNDDKNVIMEIRGAAGGEEAALFAGNLYRMYSRYAELQGWKTEVMEANVTGTGGYKEIIFMITGSGAYSKLKYENGAHRVQRVPETESGGRIHTSTATVACLPEAEEVEVDIHEKDIRVDTFASSGPGGQSVNTTMSAVRLTHLPTGVVVSCQDEKSQIKNKEKAMKVLRARIYDKFQQEAQAEYDQTRKSAVGSGDRSERIRTYNFPQNRVTDHRIGLTIQKLDQILEGKLDEVVEALIVEDQASKLQQSE 355
>gi|193214860|ref|YP_001996059.1| peptide chain release factor 1 [Chloroherpeton thalassium ATCC 35110] >gi|193088337|gb|ACF13612.1| peptide chain release factor 1 [Chloroherpeton thalassium ATCC 35110] (358 aa)
Score = 792, Expect = 2.0e-82, Identities = 161/349 (46%), Positives = 250/349 (71%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGF--ISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQ 355
           +++ L S+++++ ++ K+L   G+  +  +  ++NK     + IV+ + EY++  + +  +++L+ +E D E+ ELAQ +  E    + + E +LK+LLLPK+  D +N +VE+R  AGGDE+++F  DL   Y+R+A+  GWK ++L+  ESS   GF   +  ++G++VY  MKFESGVHRVQRVP TE++GRVHTS  +VAVLPE E+ ++ I   DL++DTYR+ G GGQ++NK E+AVRITH+P+GI VACQE +SQ++NRE AMKMLR+KL++ K  E +K  +DLR+  V TG+R+ KIRTYN+PQ+RVTDHRI  T + L  ++ G+L EII++L  HD+  +++
  S:     1 MFDQLQSIKDRYKEIEKQLSDPGVISNQDKFRQLNKEYSGLSEIVKAYDEYRKAKDALQQSKELLYTESDPEMKELAQADYDEYSEKVPELEQQLKILLLPKEEADSRNAMVEIRAGAGGDEAALFAADLLRMYQRFAERNGWKCEVLDYNESSGLGGFKEATISLSGDDVYGTMKFESGVHRVQRVPETETQGRVHTSAASVAVLPEAEDFDIEIRKEDLQMDTYRSGGKGGQNVNKVETAVRITHVPSGIVVACQEERSQLQNRERAMKMLRSKLYDIKLAEQQKERADLRRSMVSTGDRSAKIRTYNFPQSRVTDHRIGFTTHALPQLLDGDLFEIIEALRVHDQTERLK 353
>gi|145218953|ref|YP_001129662.1| peptide chain release factor 1 [Prosthecochloris vibrioformis DSM 265] >gi|189039984|sp|A4SCF1|RF1_PROVI Peptide chain release factor 1 (RF-1) >gi|145205117|gb|ABP36160.1| bacterial peptide chain release factor 1 (bRF-1) [Prosthecochloris vibrioformis DSM 265] (357 aa)
Score = 792, Expect = 2.0e-82, Identities = 166/352 (47%), Positives = 242/352 (68%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGLS--VKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGF--ISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQEAK 358
           ++++L S++E+  DL + L     +    R  ++NK   +   IVE +  Y      ++ + +L+K+E+D E+  L + E+ E +  I   E E+KVLLLPKD  D +NVI+E+R   GG+E+++F  DLF  Y+RYA+  GW  +ML+  ESS   GF   +  I G +V+  MK+ESGVHRVQRVP TE++GR+HTS  +VAVLPE EEV++ I   DL++DTYR+ G GGQ++NK E+AVRITH+PTG+  ACQE +SQ++N+E AMKMLRAKL++ +  E ++  +DLR+  V TG+R+ KIRTYNYPQ+RVTDHRI  T + L   M G + E+ID+L  HD+  ++Q A+
  S:     1 MFDNLQSIKERHLDLERLLADPDAAGDQTRFRKLNKEYSDLREIVETYDRYSHIKKQLEDSRQLLKNEQDQEMKALVEEEIEELQRQIPALEQEIKVLLLPKDEADSRNVILEIRAGTGGEEAALFTTDLFRMYQRYAEKQGWNFQMLDYNESSVPGGFREATISITGHDVFGTMKYESGVHRVQRVPDTETQGRIHTSAASVAVLPEAEEVDVEIRKEDLRLDTYRSGGKGGQNVNKVETAVRITHMPTGMVAACQEERSQLQNKERAMKMLRAKLFDIQLAEQQQARADLRRTMVATGDRSAKIRTYNYPQSRVTDHRIGFTTHALPQFMQGEIGELIDALKMHDQTERLQAAQ 356
>gi|153854177|ref|ZP_01995485.1| hypothetical protein DORLON_01476 [Dorea longicatena DSM 13814] >gi|149753226|gb|EDM63157.1| hypothetical protein DORLON_01476 [Dorea longicatena DSM 13814] (358 aa)
Score = 791, Expect = 2.5e-82, Identities = 171/348 (49%), Positives = 252/348 (72%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGLS--VKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           +++ L  +  + +++  EL+   ++    R  ++ K   + TPIVE + EYK     I+ + ++++ E D E+ ELA+ EL++ K  +E+ E ELK+LLLPKDPND+KNVIVE+R  AGGDE+++F  +++  Y  YA+S  WKV+++E +E    G   ++FMI+G+  YSKMK+ESGVHRVQRVP TES GR+HTSTITVAV+PE E+V++ I+  D++ID  RASG GGQ +N T+SAVR+TH PTGI +  Q  KSQ++N++ A  +LRAKL++ + ++     ++ RK Q+GTG+R+EKIRTYN+PQ RVTDHRI LTL KLD +M G++ EIID+ I+ D+A K+
  S:     1 MFDKLEDLRIRLDEILNELQEPDVANDQNRFRKLMKEQNDLTPIVEAYNEYKECKQAIEDSLEMLEEESDEEMRELAKEELNDNKKRVEELEQELKILLLPKDPNDEKNVIVEIRAGAGGDEAALFAAEIYRMYMHYAESQRWKVELVECEEIGIGGMKNVTFMIDGKGAYSKMKYESGVHRVQRVPETESGGRIHTSTITVAVMPEAEDVDIQIDEKDIRIDVMRASGNGGQCVNTTDSAVRLTHYPTGIVIYSQTEKSQLQNKDKAFALLRAKLYDLECQKRHDAEAEARKSQIGTGDRSEKIRTYNFPQGRVTDHRIGLTLYKLDKIMNGDIQEIIDACIAADQAAKL 351
>gi|116333899|ref|YP_795426.1| peptide chain release factor 1 [Lactobacillus brevis ATCC 367] >gi|122269414|sp|Q03QX7|RF1_LACBA Peptide chain release factor 1 (RF-1) >gi|116099246|gb|ABJ64395.1| bacterial peptide chain release factor 1 (bRF-1) [Lactobacillus brevis ATCC 367] (361 aa)
Score = 791, Expect = 2.5e-82, Identities = 165/354 (46%), Positives = 249/354 (70%)
  Q:     5 EKLYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQEAK 358
           +++++ L ++ +++++LN+ +    +    +R   ++K   E    V+K+ +Y+     I   ++++  + D ++  + + EL E        E ++KVLLLPKDPNDDKN+I+E+  AAGGDE+S+F  DLFS Y +YA+  GW++++++   +   G+  I  MI G  VYSK+K+E+G HRVQRVP TES GRVHTST TV V+PE E+V++ I+  D++ D YR+SGAGGQHINKT SAVR+TH+PTGI VA Q+ +SQ +NR  AM++LRA++++  +++     +  RK  VGTG+R+E+IRTYNYPQNRVTDHRI LTLNKLD +M G L +IID+LI  D+A K+++ K
  S:     2 DEMFDKLQAVADRYDELNELISDPEVIADTQRFMALSKEEGELRETVDKYHQYQDVTQQIADDDEMLHDKLDADMESMIKDELKELTAQKAALEEDIKVLLLPKDPNDDKNIIMEIHGAAGGDEASLFAADLFSMYSKYAERQGWQIEVVDENATEVGGFKEIVMMITGNKVYSKLKYENGAHRVQRVPVTESAGRVHTSTATVGVMPEEEDVDIDIDPKDIRTDVYRSSGAGGQHINKTSSAVRMTHLPTGIVVAMQDERSQQQNRAKAMQILRARVYDYYKQQEESAYNAERKSAVGTGDRSERIRTYNYPQNRVTDHRIGLTLNKLDRIMNGELDDIIDALIVSDQAAKLEDLK 358
>gi|92113653|ref|YP_573581.1| peptide chain release factor 1 [Chromohalobacter salexigens DSM 3043] >gi|119361523|sp|Q1QXC6|RF1_CHRSD Peptide chain release factor 1 (RF-1) >gi|91796743|gb|ABE58882.1| bacterial peptide chain release factor 1 (bRF-1) [Chromohalobacter salexigens DSM 3043] (361 aa)
Score = 791, Expect = 2.6e-82, Identities = 157/348 (45%), Positives = 242/348 (69%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEV-ELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           L   L   +E+F +L   L    +     R  + ++   E  P++E ++ Y+RT +D+++AE++ + + D E+ ELA+ E  E +  +E  + ++K LL+P+DP+D  NV +E+R   GGDE+++F GDLF  Y RYA+ +GW+++++       G Y  +   + G+NVY+++KFESG HRVQRVPATES+GR+HTS  TVAV+ E   V E+ +N++DL++DT+R+SGAGGQH+N T+SA+RITH+P+G+ V CQE +SQ +NR  AM +L A+L +   +  R+  +D R+  VG+G+R+E+IRTYN+PQ R+TDHRINLTL KL +VM G L E+ID LI   +A ++
  S:     5 LRTRLDGFQERFEELAALLAEPDVIADQARFRDYSREYAELEPLIEAWRSYRRTEDDLEAAEQM-REDSDPEMRELAEEEWREAQARLEALDADVKRLLVPRDPDDASNVFLEIRAGTGGDEAALFAGDLFRMYSRYAEKVGWRIEVINASHGEQGGYKELIARVRGDNVYARLKFESGAHRVQRVPATESQGRIHTSACTVAVMAEASAVGEVELNSNDLRVDTFRSSGAGGQHVNTTDSAIRITHLPSGLVVECQEERSQHKNRAKAMALLAARLKQSAVDAQRQQQADTRRSLVGSGDRSERIRTYNFPQGRITDHRINLTLYKLGDVMAGELGEVIDPLIHEYQAEQL 355
>gi|146318502|ref|YP_001198214.1| peptide chain release factor 1 [Streptococcus suis 05ZYH33] >gi|146320693|ref|YP_001200404.1| peptide chain release factor 1 [Streptococcus suis 98HAH33] >gi|145689308|gb|ABP89814.1| Protein chain release factor A [Streptococcus suis 05ZYH33] >gi|145691499|gb|ABP92004.1| Protein chain release factor A [Streptococcus suis 98HAH33] (364 aa)
Score = 791, Expect = 2.6e-82, Identities = 171/350 (48%), Positives = 253/350 (72%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIK-SEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGFIS---FMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           +Y+ L ++E+++ +L + L    +    KR  E++K    T   V  ++EYK  L +I  AE++IK S  D ++ E+A+ EL + K   E YE +LK+LLLPKDPNDDKN+I+E+R AAGGDE+++F GDL + Y++YA+  GW+ +++E   S +G G I     M++G++VYSK+K+ESG HRVQRVP TES+GRVHTST TV ++PE+EEVE  I+  DL++D Y ASGAGGQ++NK  +AVRI H+PT I V  QE ++Q +NRE AMK++RA++ +   +  +      RK  +GTG+R+E+IRTYN+PQNRVTDHRI LTL KLD ++ G + E++D+L+ +D+  K++E
  S:     8 IYDQLQAVEDRYEELGELLSDPDVVSDTKRFMELSKEEATTRDTVTAYREYKTVLQNIVDAEEMIKESSGDADLEEMAKEELKQAKADKEAYEEKLKILLLPKDPNDDKNIILEIRGAAGGDEAALFAGDLLTMYQKYAEGQGWRFEVMEA--SYNGVGGIKEVVAMVSGQSVYSKLKYESGAHRVQRVPVTESQGRVHTSTATVLIMPEVEEVEYDIDPKDLRVDIYHASGAGGQNVNKVATAVRIVHLPTNIKVEMQEERTQQKNREKAMKIIRARVADHFAQIAQDEQDAERKSTIGTGDRSERIRTYNFPQNRVTDHRIGLTLQKLDTILSGKMDEVVDALVLYDQTQKLEE 361
>gi|86156794|ref|YP_463579.1| peptide chain release factor 1 [Anaeromyxobacter dehalogenans 2CP-C] >gi|119361506|sp|Q2IMW2|RF1_ANADE Peptide chain release factor 1 (RF-1) >gi|85773305|gb|ABC80142.1| bacterial peptide chain release factor 1 (bRF-1) [Anaeromyxobacter dehalogenans 2CP-C] (370 aa)
Score = 791, Expect = 2.6e-82, Identities = 159/347 (45%), Positives = 246/347 (70%)
  Q:    11 LLSMEEKFNDLNKELETEGLSVK--RMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQEA 357
           L ++E++F +L + L    ++    R  ++ K        V   + Y++ L+D+   E L+  +KD E+ ELA+ EL++ +P +E  E +LK+ L+PKDPND+K+VIVE+R  AGGDE+ +F  ++   Y RYA+  GW+V++++    +  G    +  ++G+ VYS +K+ESGVHRVQRVPATE++GR+HTST+TVAV+PE EE+++ +N +D+++D +R++G+GGQ +N T+SAVR+TH PTGI V CQ+ KSQ++NR  AMKMLRAKL+E ++E  R      RK QVGTG+R+EKIRTYN+PQ+R+TDHR+N T + L  VM G++ ++ID+  +   A  ++EA
  S:    10 LEAIEQRFEELTQLLSDPAVAGNGDRFRKVAKERASIEQTVTALRAYRKLLDDVAGNEALL-GDKDPELRELAKEELAQLRPQVEPAEEQLKLYLVPKDPNDEKDVIVEIRAGAGGDEAGLFAAEVMRMYVRYAERRGWRVELMDTSGGALGGVKEATLTVSGDAVYSSLKYESGVHRVQRVPATEAQGRIHTSTVTVAVMPEAEEIDVQVNPADVEMDVFRSTGSGGQSVNTTDSAVRLTHKPTGIVVKCQQEKSQLKNRTMAMKMLRAKLFEIEQERQRSARDATRKSQVGTGDRSEKIRTYNFPQDRLTDHRVNYTRHNLPAVMDGDVQDVIDACRTFYAAQALREA 358
>gi|154687816|ref|YP_001422977.1| peptide chain release factor 1 [Bacillus amyloliquefaciens FZB42] >gi|154353667|gb|ABS75746.1| PrfA [Bacillus amyloliquefaciens FZB42] (359 aa)
Score = 791, Expect = 2.7e-82, Identities = 165/350 (47%), Positives = 252/350 (72%)
  Q:     9 NSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQES-SHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQEAK 358
           + L S+E+++  LN+ L    +    K++ E +K   +    VE +++Y+     +  A+ +++ + D ++ E+ + E+SE +   E     LKVLL+PKDPNDDKNVI+E+R AAGG+E+++F G+L+  Y RYA+  GWK +++E   + + GY  I FMI G+  YSK+K+E+G HRVQRVP TES GR+HTST TVA LPE EEVE+ I+  D+++DT+ +SG GGQ +N T SAVR+TH+PTG+ V+CQ+ KSQI+N+E AMK+LRA++++K ++E +      RK  VG+G+R+E+IRTYN+PQNRVTDHRI LT+ KLD ++ G L E++++LI  D++ K+Q+A+
  S:     6 DRLQSIEQRYEKLNELLSDPEVVNDPKKLREYSKEQSDIQETVEVYRQYRDASEQLADAKAMLEEKLDADMREMVKEEISELQGETETLSERLKVLLIPKDPNDDKNVIMEIRGAAGGEEAALFAGNLYRMYSRYAEIQGWKTEVMEANVTGTGGYKEIIFMITGKGAYSKLKYENGAHRVQRVPETESGGRIHTSTATVACLPEAEEVEVDIHEKDIRVDTFASSGPGGQSVNTTMSAVRLTHLPTGVVVSCQDEKSQIKNKEKAMKVLRARIYDKFQQEAQAEYDQTRKSAVGSGDRSERIRTYNFPQNRVTDHRIGLTIQKLDQILEGKLDEVVEALIVEDQSSKLQQAE 358
>gi|28210063|ref|NP_781007.1| peptide chain release factor 1 [Clostridium tetani E88] >gi|32171526|sp|Q898Y5|RF1_CLOTE Peptide chain release factor 1 (RF-1) >gi|28202498|gb|AAO34944.1| bacterial peptide chain release factor 1 [Clostridium tetani E88] (355 aa)
Score = 791, Expect = 2.9e-82, Identities = 160/324 (49%), Positives = 241/324 (74%)
  Q:    33 KRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           K   ++ K   +   IV  +KEYK  L  I+  ++++K + + E+ ++ Q ++ E +  +++ E ELK+LL+PKDPND+KNV +E+R  AGGDE+++F  +LF  Y RYA+   WK + + V E+   G+  I FM+ G+  YS++K+ESGVHRVQRVP TES GR+HTST TVAVLPE+E+V++ IN +DL++D YRASG GGQ +N T+SAVRITH+P+G+ V CQ+ KSQ++N+E AMK+L+++L++  E E   +I++ RK QVGTG+R+E+IRTYNYPQ RVTDHRI LTL KL++ + G++ E+ID LI+ +++ +M++
  S:    29 KEWQKLCKEHSDMETIVTTYKEYKEVLQSIEDNKEMLKEDIEQELRDMVQEDIKELEQRVQELEQELKMLLVPKDPNDEKNVFIEIRAGAGGDEAALFAANLFRMYTRYAERHNWKTEAVSVNETDIGGFKEIVFMVRGKGAYSRLKYESGVHRVQRVPDTESSGRIHTSTATVAVLPEVEDVDVEINQNDLRVDVYRASGHGGQCVNTTDSAVRITHLPSGLVVTCQDEKSQLKNKEKAMKVLKSRLYDMLESERSASIAEDRKSQVGTGDRSERIRTYNYPQGRVTDHRIGLTLYKLESFLDGDIEEMIDGLITVEQSERMKD 353
>gi|163815255|ref|ZP_02206632.1| hypothetical protein COPEUT_01415 [Coprococcus eutactus ATCC 27759] >gi|158449450|gb|EDP26445.1| hypothetical protein COPEUT_01415 [Coprococcus eutactus ATCC 27759] (358 aa)
Score = 790, Expect = 3.0e-82, Identities = 172/350 (49%), Positives = 255/350 (72%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGLSVKRMSEINKSIKETT---PIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           +++ L  + +K + +N +L T+   V   ++  K +KE +   PIV+K+KEYK     I+ + ++++ E D E+ E+A+ E+++ K  +E  E ELK+LLLPKDPND KNVIVE+R  AGGDE+++F  +++  Y++Y D   WKV+++ V E+   G+    FMI G+  YSKMK+ESGVHRVQR+P TES GR+HTST+TVAV+PE EEV++ IN++D++ID  RASG GGQ +N T+SAVR+THIPTGI +  Q  KSQ++N+  A  +LR+KL++ + ++     +  RK Q+GTG+R+EKIRTYN+P+ RVTDHRI LTL KLD +M G+L+E+IDSLI+ D+  K+ +
  S:     1 MFDRLEELVDKLDTINNQL-TDPDVVTDQNKFRKLMKEQSDLVPIVDKYKEYKDAKTTIEDSLEILEEENDEELREMAKEEMNDAKSRLETIEQELKILLLPKDPNDSKNVIVEIRAGAGGDEAALFAYEIYRMYQKYVDQFKWKVELMSVNENGIGGFKEAVFMITGDGAYSKMKYESGVHRVQRIPKTESGGRIHTSTVTVAVMPEAEEVDVEINDNDIRIDVMRASGNGGQCVNTTDSAVRLTHIPTGIVIYSQTEKSQLQNKAKAFALLRSKLYDMELQKQHDAEAADRKSQIGTGDRSEKIRTYNFPEGRVTDHRIKLTLYKLDQIMNGDLNELIDSLIAADQTAKLAQ 353
>gi|116491555|ref|YP_811099.1| peptide chain release factor 1 [Oenococcus oeni PSU-1] >gi|116092280|gb|ABJ57434.1| bacterial peptide chain release factor 1 (bRF-1) [Oenococcus oeni PSU-1] (357 aa)
Score = 790, Expect = 3.0e-82, Identities = 169/352 (48%), Positives = 254/352 (72%)
  Q:     5 EKLYNSLLSMEEKFNDLNKELETEGLSVK--RMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGFISFMIN--GENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEV--ELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           +K++  + ++ +++++LN+ L    ++    + +   K + E TPIVE ++ Y++  N+I+  ++L+    D E+  LA+ ELSE +P   +   +L+VL++PKDPNDDKN+I+E+R A GGDE+++F GDL + Y  YA S  W  ++++ Q      GF   +IN  GENVYSK+KFESG HRVQRVP TE++GRVHTST TV V+PE E++  E +I+  D++ D YR+SGAGGQHINKT SAVR+ H+PTGI V  QE +SQ +NR  A ++LR+++++   +ENR+     R+ ++G+G+R+E+IRTYN+PQNRVTDHRIN TLNKLD V+ G+L EIID+LI  D+  +++E
  S:     2 DKIFAQIQNVVDRYDELNELLADPDVASDSGKYTRYAKELGEITPIVENYRRYQQLTNEINDDKELLN---DKEMASLAKKELSELEPEQSELSEKLRVLMIPKDPNDDKNIIMEIRGAVGGDEANLFAGDLLNMYAHYAQSQNWSFEIVD-QTVGEAGGFKEAVINISGENVYSKLKFESGAHRVQRVPVTETQGRVHTSTATVGVMPEFEDIDTEGLIDPKDVREDVYRSSGAGGQHINKTSSAVRLVHLPTGIKVEMQEQRSQQQNRSKAWQILRSRVYDHFAQENREQYDQQRRTKIGSGDRSERIRTYNFPQNRVTDHRINFTLNKLDKVINGDLEEIIDALIIADQTKRLEE 355
>gi|157273346|gb|ABV27245.1| peptide chain release factor 1 [Candidatus Chloracidobacterium thermophilum] (357 aa)
Score = 790, Expect = 3.2e-82, Identities = 170/349 (48%), Positives = 249/349 (71%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG---YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQ 355
           +++ L ++EEK+  L  +L    +     R +++ K   E T +VEKF+EY+    ++ SA +L+   +D E++ LA+ E++  +    + + EL+ LL PKDPND KNV++E+R   GG+E+S+F G+L   Y RYA+  GW+V++L+   S  G    G +  +I G  VYS++K ESGVHRVQRVP TES GR+HTST+TVAVLPE EEV++ I+  D++IDT+ +SG GGQ +N T SAVR+TH+PTG+ V+ Q+ KSQI+NRE A ++LRA+L E + ++  + I+  R+ QVGTGER+EKIRTYN+ +NRVTDHRI LTL++LD +M G L  +ID LI+H +A+KMQ
  S:     1 MFDKLKALEEKYEALTAQLSDPEVVADAARYAKLAKQHSELTEVVEKFREYQTIEANLASARELLNEAEDAEMVALAREEIALLEKQRAQCQLELEQLLTPKDPNDRKNVLLEIRAGTGGNEASLFAGELLRMYLRYAERRGWRVQILDESLSEVGGLKEGIV--LIEGTGVYSRLKHESGVHRVQRVPVTESAGRIHTSTVTVAVLPEAEEVDIEIDPKDVRIDTFCSSGPGGQSVNTTYSAVRLTHLPTGLVVSIQDEKSQIKNREKAFRILRARLLELERQKQHEAIAGERRAQVGTGERSEKIRTYNFKENRVTDHRIGLTLHQLDTIMDGELDGLIDPLITHFQALKMQ 352
>gi|56965632|ref|YP_177366.1| peptide chain release factor 1 [Bacillus clausii KSM-K16] >gi|61214582|sp|Q5WB55|RF1_BACSK Peptide chain release factor 1 (RF-1) >gi|56911878|dbj|BAD66405.1| peptide chain release factor 1 [Bacillus clausii KSM-K16] (356 aa)
Score = 790, Expect = 3.6e-82, Identities = 166/348 (47%), Positives = 250/348 (71%)
  Q:    11 LLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQEAK 358
           L ++E+++  LN++L    +  +  ++ E +K   +    V+ +++YK+    +  A+ +++ + D+++ ++ + EL E      + E  LK+LLLPKDPNDDKNVIVE+R AAGGDE+ +F  DL+  Y RYA+  GWK +++E   +   GY  I FM+NG   YSK+K+E+G HRVQRVP TES GR+HTST TVAVLPE EEVE+ I+  D+++DT+ +SG GGQ +N T SAVR+TH+PT   V+CQ+ KSQI+N+E AMK+LRA++++K ++E +   ++ RK  VGTG+R+E+IRTYN+PQ+RVTDHRI LTL KL+ V+ G L EIID+L+  D++  M++A+
  S:     5 LQAVEDRYEYLNEQLSDPNVISNATKLREYSKEQAQIEETVQTYRQYKQVTEQLADAKAMLEEKLDDDMYQMVKEELDELSERKAELEERLKILLLPKDPNDDKNVIVEIRGAAGGDEAQLFAADLYKMYHRYAEMQGWKTEVIEAHATELGGYKEIIFMVNGSGAYSKLKYENGAHRVQRVPQTESGGRIHTSTATVAVLPEAEEVEIDIHEKDIRVDTFASSGPGGQSVNTTMSAVRLTHLPTNTVVSCQDEKSQIKNKEKAMKVLRARIFDKVQQEAQAEYAESRKLAVGTGDRSERIRTYNFPQSRVTDHRIGLTLQKLEQVLQGKLDEIIDALVVADQSEAMKKAE 355
>gi|182420270|ref|ZP_02951499.1| peptide chain release factor 1 [Clostridium butyricum 5521] >gi|182375865|gb|EDT73457.1| peptide chain release factor 1 [Clostridium butyricum 5521] (360 aa)
Score = 790, Expect = 3.8e-82, Identities = 169/349 (48%), Positives = 255/349 (73%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGLSVKRMSEINKSIKETTP---IVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQ 355
           L + L  +E K+++L+ ++    + ++  +E  K  KE      IV  +KEYK+   D+++ ++++  E D E+ E+   E+S+      + E  +++LLLPKDPNDDKNV VE+R  AGG+E+++F  +LF  Y RYA++  W V+++ + E+   G+  + FMI G   YSK+K+ESGVHRVQRVP TES GR+HTST TVAVLPE+++VE+ I+  DL+ID +RASG GGQ +N T+SAVRITH+P+G+ V+CQ+ KSQ++N+E AMK+L+++L+E+ E E  + I++ RK QVGTG+R+E+IRTYNYPQ RVTDHRI LTL KL+  + G++ E+I++LI+ D+A KM+
  S:     2 LLDKLEFIENKYDELSVKISDPSI-MQNQNEWRKLCKEHADLEIIVNAYKEYKKVTEDLEANKEMLSEENDKEMREMLSEEISDLTKREVELENHIQILLLPKDPNDDKNVFVEIRGGAGGEEAALFAYNLFRMYTRYAETQRWAVEIMSLNETDLGGFKEVVFMIKGNGAYSKLKYESGVHRVQRVPDTESSGRIHTSTSTVAVLPEVDDVEIEISEKDLRIDVFRASGNGGQCVNTTDSAVRITHLPSGLVVSCQDEKSQLKNKEKAMKVLKSRLYEQAERERAEGIAEDRKSQVGTGDRSERIRTYNYPQGRVTDHRIGLTLYKLETFLNGDIDEMINALITADQAEKMK 353
>gi|89054297|ref|YP_509748.1| peptide chain release factor 1 [Jannaschia sp. CCS1] >gi|119361551|sp|Q28RD9|RF1_JANSC Peptide chain release factor 1 (RF-1) >gi|88863846|gb|ABD54723.1| bacterial peptide chain release factor 1 (bRF-1) [Jannaschia sp. CCS1] (354 aa)
Score = 789, Expect = 4.2e-82, Identities = 162/348 (46%), Positives = 241/348 (69%)
  Q:     9 NSLLSMEEKFNDLNKELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           + L  + ++F  L  +L   G     +++I++   E  P+V +   Y++ L D+  A+ ++    D ++  LA+ EL   +  I   E  L++ LLPKD  D K  ++E+RP  GGDE+++F GDL   Y RYA++ GW+++++++QES   G    +  + GENV++++KFESGVHRVQRVP TES GR+HTS  TVAVLPE E+V++ I  +D++IDT RASGAGGQH+N T+SAVRITH+P+GI V   E KSQ  NRE AM+ LR +L++ + ++    ++  RK Q+G+G+R+E+IRTYN+PQ R+TDHRINLTL KLD VMLG+L EI+D+L + D+A+K+ E
  S:     8 DRLRQITDRFEYLEAQLNG-GPDPSDIAKISREYAELKPVVAEIAGYEQLLADMAEAQNMLA---DPDMRPLAEEELPRLEAAIPAAEQSLQLALLPKDAADAKPAMIEIRPGTGGDEAALFAGDLLRMYTRYAEARGWRLEIVDLQESDLGGIKECTARVEGENVFARLKFESGVHRVQRVPETESGGRIHTSAATVAVLPEAEDVDIDIPATDIRIDTMRASGAGGQHVNTTDSAVRITHVPSGIVVVSSE-KSQHRNREIAMQTLRTRLYDLERQKADDAMAADRKAQIGSGDRSERIRTYNFPQGRMTDHRINLTLYKLDAVMLGDLDEIVDALTAEDQAMKLAE 351
>gi|78484734|ref|YP_390659.1| peptide chain release factor 1 [Thiomicrospira crunogena XCL-2] >gi|119361633|sp|Q31IN8|RF1_THICR Peptide chain release factor 1 (RF-1) >gi|78363020|gb|ABB40985.1| bacterial peptide chain release factor 1 (bRF-1) [Thiomicrospira crunogena XCL-2] (363 aa)
Score = 789, Expect = 4.9e-82, Identities = 164/350 (46%), Positives = 246/350 (70%)
  Q:     5 EKLYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           E + + L ++ E+ +++N  +    +  +  +   + K   + TP+VE F ++ +   D+  A+ +IKS  D ++ E+ Q EL E +      E EL+ +LLPKDPNDD N+ +E+R   GGDE++IF GDLF  Y RYA+++ W+V+++  QE  HG Y  I   I G+  YS++KFESG HRVQRVPATE++GRVHTS  TV ++PE ++VE + +N +DLK+DT+RASGAGGQH+NKT+SA+RITHIPTG  V CQ+ +SQ +NR  AM +L +++ ++++  + + I+  RK  VG+G+R+E+IRTYNYPQ RVTDHRINLTL KLD +M G L +++D LI+  +A ++
  S:     3 ESIRSKLENLVERLDEVNHLISDPEIINNQNKFRNLTKEHSQLTPVVETFNQFIQNQGDLQEAKDMIKS-GDPDLKEMGQEELPELEKQQATLEAELQKMLLPKDPNDDANIFLEIRAGTGGDEAAIFAGDLFRMYSRYAETMRWQVEVINSQEGEHGGYKEIIARIIGDGAYSRLKFESGAHRVQRVPATETQGRVHTSAATVVIMPEAQDVEQIDLNPADLKVDTFRASGAGGQHVNKTDSAIRITHIPTGTVVECQDERSQHKNRARAMSLLASRIMDERQRIHDQEIAQERKSLVGSGDRSERIRTYNYPQGRVTDHRINLTLYKLDEIMQGGLQQVVDPLINEYQAEQL 355
>gi|70725918|ref|YP_252832.1| peptide chain release factor 1 [Staphylococcus haemolyticus JCSC1435] >gi|119361616|sp|Q4L7Z9|RF1_STAHJ Peptide chain release factor 1 (RF-1) >gi|68446642|dbj|BAE04226.1| peptide chain release factor 1 [Staphylococcus haemolyticus JCSC1435] (358 aa)
Score = 788, Expect = 6.3e-82, Identities = 176/350 (50%), Positives = 251/350 (71%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           +++ L  +EE++  LN+ L    +     ++ + +K   +    V+ +++YK    +I   ++++   +D E IE+ + E +  K  I + E +LK LL+PKDPND+K+VIVE+R AAGGDE++IF GDL   Y +YA+S  +K +++E  ES HG Y  ISF ++G   YSK+KFE+G HRVQRVP TES GR+HTST TVAVLPE+E+VE+ I N DLKIDTYR+SGAGGQH+N T+SAVRITH+PTG+     E KSQI+NRE A+K+L+A+L++ K +E ++  +  RK  VGTG+R+E++RTYNYPQ+RVTDHRI LTL KLD +M G L EIID+L   ++  K++E
  S:     1 MFDQLDIVEERYEQLNEMLSDPEIVNDSDKLRKYSKEQADLQKTVDVYRDYKSKKEEIAEIDEMLNETEDKEEIEMLKEESASLKSAIPELEEQLKFLLIPKDPNDEKDVIVEIRAAAGGDEAAIFAGDLLRMYSKYAESQNFKTEIVEAAESDHGGYKEISFSVSGSGAYSKLKFENGAHRVQRVPETESGGRIHTSTATVAVLPEVEDVEIEIRNEDLKIDTYRSSGAGGQHVNTTDSAVRITHLPTGVIATSSE-KSQIQNREKALKVLKARLYDMKLQEEQQKYAAQRKSAVGTGDRSERVRTYNYPQSRVTDHRIGLTLQKLDQIMEGKLDEIIDALTLSEQTEKLKE 352
>gi|114777343|ref|ZP_01452340.1| peptide chain release factor 1 [Mariprofundus ferrooxydans PV-1] >gi|114552125|gb|EAU54627.1| peptide chain release factor 1 [Mariprofundus ferrooxydans PV-1] (357 aa)
Score = 787, Expect = 6.9e-82, Identities = 158/319 (49%), Positives = 226/319 (70%)
  Q:    33 KRMSEINKSIKETTPIVEKFKEYKRTLNDI-DSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           KR + +++   E  P+ E+ + Y      + D+ E +   + D E+ E+A+ E  E K  I   +  L +LLLPKDPND+++VI+E+R   GGDE+++F  DLF  Y RYA++ G+KV++L   ++   GY  I   I+G  V+S+ KFESG HRVQRVP TES GR+HTS  TVA+LP  EEV++ I   DL+ID YRASGAGGQH+NKTESAVRITHIP+G+ V CQ+  SQ +N+  AMK+L+A+L++K++ E     S  RKG VG+G+R+E+IRTYNYPQ R+TDHRI LTL KL+ ++ G++ E++D+LI++ +A
  S:    29 KRYTALSREFSEIEPVAEEAQHYLDLQQQLADNLELIADPDCDAELKEMAEAEAREIKQAISASDAALSMLLLPKDPNDNRDVILEIRAGTGGDEAALFAADLFRMYSRYAETQGYKVEILSASDTGIGGYKEIIAQISGNGVFSRFKFESGAHRVQRVPETESGGRIHTSACTVAILPVAEEVDINIRPEDLRIDVYRASGAGGQHVNKTESAVRITHIPSGLVVTCQDQASQHKNKAQAMKVLQARLFDKEQSELDAERSQARKGMVGSGDRSERIRTYNYPQGRITDHRIGLTLYKLEQILGGDMGELLDALITYHQA 349
>gi|172058704|ref|YP_001815164.1| peptide chain release factor 1 [Exiguobacterium sibiricum 255-15] >gi|171991225|gb|ACB62147.1| peptide chain release factor 1 [Exiguobacterium sibiricum 255-15] (352 aa)
Score = 787, Expect = 7.0e-82, Identities = 162/351 (46%), Positives = 247/351 (70%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQEA 357
           + + L ++E+++  LN  L    +     ++ E++K   +  P VE ++ Y+  +     A  ++    D E+ +LA+ E++  +P I+  E +LK LLLPKDPNDDKNVIVE+R AAGGDE+++F GDLF  Y ++A+   WK+++++   +   GY  I F++ G   YSK+K+E+G HRVQRVP+TES GR+HTST TVAVLPE E+VE+ I++ D+++DT+ +SG GGQ +N T+SAVR+TH+PTGI  +CQ+ KSQI+N+E AMK+LRA++++K + E +    + RK  VGTG+R+E+IRTYN+ QNRVTDHRI LT+ KLD ++ G + E+ID+L+   +A   + A
  S:     1 MLDRLSALEDRYEKLNDLLADPAIIKDTNQLREVSKEQSQLAPTVEVYRVYRDKMEAYQEARHMLT---DPEMRDLAKEEVAVLEPEIKDLETKLKALLLPKDPNDDKNVIVEIRGAAGGDEAALFAGDLFKMYSKFAEKQNWKIEIIDASYTELGGYKEIIFIVKGSGAYSKLKYENGAHRVQRVPSTESGGRIHTSTATVAVLPEAEDVEVEIHDKDVRVDTFTSSGPGGQSVNTTQSAVRVTHVPTGIVASCQDEKSQIKNKEKAMKVLRARVYDKIQREQQAEYDEKRKSAVGTGDRSERIRTYNFAQNRVTDHRIGLTIQKLDRILQGEMDEVIDTLVMEYQARASEAA 351
>gi|49531479|emb|CAG69191.1| peptide chain release factor 1 [Acinetobacter sp. ADP1] (376 aa)
Score = 787, Expect = 7.1e-82, Identities = 158/313 (50%), Positives = 228/313 (72%)
  Q:    33 KRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELE-EVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSL 345
           KR  ++++   +   IV+ + +Y++   DI++AE ++    D +  ++AQ E+ E + LIE+ E +L +L++PKDPND     +E+R   GGDE++IF GDLF  Y +YA+S GW++++L   E  HG Y  +   ++G+ VY ++KFESG HRVQRVPATES+GRVHTS  TVA+LPE++ +  + IN +DL+IDTYRASGAGGQHINKT+SAVRITH+PTG+ V CQE +SQ +N+  AM +L ++L   K        S++R+  VG+G+R+E+IRTYNYPQ R+TDHRINLTL KLD +M G+L+E++DSL
  S:    47 KRFRKLSREHSDLNEIVDVWSKYRQAEEDIETAESMLS---DPDFKDMAQEEIKENRALIEQLEGDLNILMIPKDPNDANAAYLEVRAGTGGDEAAIFSGDLFRMYSKYAESRGWRIEVLSENEGEHGGYKEVICRVDGDGVYGRLKFESGAHRVQRVPATESQGRVHTSACTVAILPEVDVDTTVEINPADLRIDTYRASGAGGQHINKTDSAVRITHVPTGVVVECQEERSQHKNKAKAMALLVSRLENAKRAAQETATSEMRRDLVGSGDRSERIRTYNYPQGRMTDHRINLTLYKLDAIMEGDLTELLDSL 358
>gi|58038522|ref|YP_190486.1| peptide chain release factor 1 [Gluconobacter oxydans 621H] >gi|81557234|sp|Q5FUR9|RF1_GLUOX Peptide chain release factor 1 (RF-1) >gi|58000936|gb|AAW59830.1| Bacterial Peptide Chain Release Factor 1 (RF-1) [Gluconobacter oxydans 621H] (353 aa)
Score = 787, Expect = 7.2e-82, Identities = 166/350 (47%), Positives = 244/350 (69%)
  Q:     1 MIYNEKLYNSLLSMEEKFNDLNKELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDE 350
           M ++++L   +++  E+   L    E  G    R+S+      E  P+V   + +K        A+ L+    D E+ ELAQ+EL+E +  +   ++ L++ LLPKD  D+++ I+E+RPAAGGDE+ +F  +LF AY+R+++  GW+ +++E  E+   G       I+G +V++++K+ESGVHRVQRVPATES+GR+HTST+TVAVLPE EEV++ +N+ DL+ID YRASGAGGQH+NKTESAVR+TH+P+GI VA QE KSQ +N+  AMK+LRA+L+E++  +     +  RK QVGTG+R+E+IRTYN+PQ RVTDHRINLTL K+D +M G   EIID+L   ++
  S:     1 MAFDDRL-ERIVARSEEVQALMSSGELTGEDFTRLSQ---EYAELEPVVASIQAWKSAEEQKAGAQALLD---DPEMRELAQMELAEIEATLPDLQHALRLALLPKDAADERSAILEIRPAAGGDEAGLFAAELFDAYRRFSEQNGWRFEVMEYAENEVAGLKEGMATISGRSVFARLKYESGVHRVQRVPATESQGRIHTSTVTVAVLPEAEEVDVTVNDDDLRIDVYRASGAGGQHVNKTESAVRVTHMPSGIVVAMQEEKSQHKNKAKAMKILRARLYERERAQLHATRAADRKSQVGTGDRSERIRTYNFPQGRVTDHRINLTLYKIDRIMGGEFDEIIDALTREEQ 344
>gi|163768088|ref|ZP_02175089.1| peptide chain release factor 1 [Anaeromyxobacter sp. K] >gi|196170663|gb|ACG71636.1| peptide chain release factor 1 [Anaeromyxobacter sp. K] (370 aa)
Score = 787, Expect = 7.3e-82, Identities = 159/347 (45%), Positives = 247/347 (71%)
  Q:    11 LLSMEEKFNDLNKELETEGLSVK--RMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQEA 357
           L ++E++F +L + L    ++    R  ++ K        V   + Y++ L D++  E L+ ++KD E+ ELA+ EL++ +P +E  E +LK+ L+PKDPND+K+VIVE+R  AGGDE+ +F  ++   Y RYA+  GW+V++++    +  G    +  ++G+ VYS +K+ESGVHRVQRVPATE++GR+HTST+TVAV+PE EE+++ +N +D+++D +R++G+GGQ +N T+SAVR+TH PTGI V CQ+ KSQ++NR  AMKMLRAKL+E ++E  R      RK QVGTG+R+EKIRTYN+PQ+R+TDHR+N T + L  VM G++ ++ID+  +   A  ++EA
  S:    10 LEAIEQRFEELTQLLSDPAVAGNGDRFRKVAKERASIEQTVTALRAYRKLLEDVEGNEALL-ADKDPELRELAKEELAQLRPQVEPAEEQLKLYLVPKDPNDEKDVIVEIRAGAGGDEAGLFAAEVMRMYVRYAERRGWRVELMDTSGGALGGVKEATLTVSGDAVYSSLKYESGVHRVQRVPATEAQGRIHTSTVTVAVMPEAEEIDVQVNPADVEMDVFRSTGSGGQSVNTTDSAVRLTHKPTGIVVKCQQEKSQLKNRTMAMKMLRAKLFEIEQERQRSARDATRKSQVGTGDRSEKIRTYNFPQDRLTDHRVNYTRHNLPAVMDGDVQDVIDACRTFYAAQALREA 358
>gi|55820816|ref|YP_139258.1| peptide chain release factor 1 [Streptococcus thermophilus LMG 18311] >gi|55822719|ref|YP_141160.1| peptide chain release factor 1 [Streptococcus thermophilus CNRZ1066] >gi|116627620|ref|YP_820239.1| peptide chain release factor 1 [Streptococcus thermophilus LMD-9] >gi|122267782|sp|Q03L79|RF1_STRTD Peptide chain release factor 1 (RF-1) >gi|81559540|sp|Q5M0B7|RF1_STRT1 Peptide chain release factor 1 (RF-1) >gi|81560720|sp|Q5M4W4|RF1_STRT2 Peptide chain release factor 1 (RF-1) >gi|55736801|gb|AAV60443.1| peptide chain release factor 1 [Streptococcus thermophilus LMG 18311] >gi|55738704|gb|AAV62345.1| peptide chain release factor 1 [Streptococcus thermophilus CNRZ1066] >gi|116100897|gb|ABJ66043.1| bacterial peptide chain release factor 1 (bRF-1) [Streptococcus thermophilus LMD-9] (359 aa)
Score = 787, Expect = 7.6e-82, Identities = 170/350 (48%), Positives = 256/350 (73%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIK-SEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGFIS---FMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           +Y+ L ++E+++ +L + L    +    KR  E+++    T   V  ++EYK+ + +I  AE++IK +  D ++ E+A+ EL + K   E+YE  LK+LLLPKDPNDDKN+I+E+R AAGGDE+++F GDL + Y++YA++ GW+ +++E   S +G G I     M++GE+VYSK+K+ESG HRVQRVP TES+GRVHTST TV V+PE+EE+E  I+  DL++D Y ASGAGGQ++NK  +AVR+ HIPTGI V  QE ++Q +NR+ A+K++RA++ +   +  +      RK  VGTG+R+E+IRTYN+PQNRVTDHRI LTL KLD ++ G + E+ID+L+ +D+  K++E
  S:     3 IYDQLQAVEDRYEELGELLSDPEVVSDTKRFMELSREEANTRETVIAYREYKQVIQNISDAEEMIKEASGDADLEEMAKEELKKSKAAKEEYEERLKILLLPKDPNDDKNIILEIRGAAGGDEAALFAGDLLAMYQKYAETQGWRFEVMEA--SYNGVGGIKEVVAMVSGESVYSKLKYESGAHRVQRVPVTESQGRVHTSTATVLVMPEVEEMEYEIDPKDLRVDIYHASGAGGQNVNKVATAVRMVHIPTGIKVEMQEERTQQKNRDKALKIIRARVADHFAQIAQDEQDAERKSTVGTGDRSERIRTYNFPQNRVTDHRIGLTLQKLDTILAGKMDEVIDALVLYDQTQKLEE 356
>gi|94971498|ref|YP_593546.1| peptide chain release factor 1 [Acidobacteria bacterium Ellin345] >gi|119361503|sp|Q1II28|RF1_ACIBL Peptide chain release factor 1 (RF-1) >gi|94553548|gb|ABF43472.1| bacterial peptide chain release factor 1 (bRF-1) [Acidobacteria bacterium Ellin345] (359 aa)
Score = 787, Expect = 7.9e-82, Identities = 167/350 (47%), Positives = 245/350 (70%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           ++  L  ME K+++L + L +  +     +  +  K+  E T +V+K++EYK     I  + +++  E D E+   AQ EL+E +  +   E +LKVLLLP+DPNDDKN+IVE+R   GGDE+S+F  +LF  Y RYA++  WKV++L   ES   G   +  +I G   YSK+K+ESGVHRVQRVP TE++GRVHTS +TVAVLPE EEV++ I   D++IDT+ +SG GGQ +N T SAVRITH+PT   V+CQ+ KSQI+NRE  M++LRA+L+E ++++    ++  RK QVG+G+R+EKIRTYN+PQNRVTDHRI  T+++L   M G ++ +I++L +H +A K++E
  S:     1 MFERLDLMEAKYDELTQALASPEIVNDSAKYQKTAKAHAELTQLVQKYREYKDLTRGIKDSRQMVAEETDAEMKAYAQQELTELEQRLHAVEEDLKVLLLPRDPNDDKNIIVEIRAGTGGDEASLFAAELFRMYNRYAETQRWKVEVLSSSESGVGGLKEVIAIIEGRGAYSKLKYESGVHRVQRVPQTETQGRVHTSAVTVAVLPEAEEVDIKIEAKDIRIDTFCSSGPGGQSVNTTYSAVRITHLPTNTVVSCQDEKSQIKNREKGMRVLRARLYEVEQQKQADALAKERKQQVGSGDRSEKIRTYNFPQNRVTDHRIGYTVHQLSEFMDGKINALIEALTTHYQAEKLKE 353
>gi|161349962|ref|YP_047013.2| peptide chain release factor 1 [Acinetobacter sp. ADP1] >gi|61214614|sp|Q6F9S2|RF1_ACIAD Peptide chain release factor 1 (RF-1) (362 aa)
Score = 787, Expect = 8.2e-82, Identities = 158/313 (50%), Positives = 228/313 (72%)
  Q:    33 KRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELE-EVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSL 345
           KR  ++++   +   IV+ + +Y++   DI++AE ++    D +  ++AQ E+ E + LIE+ E +L +L++PKDPND     +E+R   GGDE++IF GDLF  Y +YA+S GW++++L   E  HG Y  +   ++G+ VY ++KFESG HRVQRVPATES+GRVHTS  TVA+LPE++ +  + IN +DL+IDTYRASGAGGQHINKT+SAVRITH+PTG+ V CQE +SQ +N+  AM +L ++L   K        S++R+  VG+G+R+E+IRTYNYPQ R+TDHRINLTL KLD +M G+L+E++DSL
  S:    33 KRFRKLSREHSDLNEIVDVWSKYRQAEEDIETAESMLS---DPDFKDMAQEEIKENRALIEQLEGDLNILMIPKDPNDANAAYLEVRAGTGGDEAAIFSGDLFRMYSKYAESRGWRIEVLSENEGEHGGYKEVICRVDGDGVYGRLKFESGAHRVQRVPATESQGRVHTSACTVAILPEVDVDTTVEINPADLRIDTYRASGAGGQHINKTDSAVRITHVPTGVVVECQEERSQHKNKAKAMALLVSRLENAKRAAQETATSEMRRDLVGSGDRSERIRTYNYPQGRMTDHRINLTLYKLDAIMEGDLTELLDSL 344
>gi|81096267|ref|ZP_00874614.1| Peptide chain release factor 1 [Streptococcus suis 89/1591] >gi|80977611|gb|EAP41147.1| Peptide chain release factor 1 [Streptococcus suis 89/1591] (359 aa)
Score = 787, Expect = 8.2e-82, Identities = 170/350 (48%), Positives = 253/350 (72%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIK-SEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGFIS---FMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           +Y+ L ++E+++ +L + L    +    KR  E++K    T   V  ++EYK  L ++  AE++IK S  D ++ E+A+ EL + K   E YE +LK+LLLPKDPNDDKN+I+E+R AAGGDE+++F GDL + Y++YA+  GW+ +++E   S +G G I     M++G++VYSK+K+ESG HRVQRVP TES+GRVHTST TV ++PE+EEVE  I+  DL++D Y ASGAGGQ++NK  +AVRI H+PT I V  QE ++Q +NRE AMK++RA++ +   +  +      RK  +GTG+R+E+IRTYN+PQNRVTDHRI LTL KLD ++ G + E++D+L+ +D+  K++E
  S:     3 IYDQLQAVEDRYEELGELLSDPDVVSDTKRFMELSKEEAATRDTVTAYREYKTVLQNMVDAEEMIKESSGDADLEEMAKEELKQAKADKEAYEEKLKILLLPKDPNDDKNIILEIRGAAGGDEAALFAGDLLTMYQKYAEGQGWRFEVMEA--SYNGVGGIKEVVAMVSGQSVYSKLKYESGAHRVQRVPVTESQGRVHTSTATVLIMPEVEEVEYDIDPKDLRVDIYHASGAGGQNVNKVATAVRIVHLPTNIKVEMQEERTQQKNREKAMKIIRARVADHFAQIAQDEQDAERKSTIGTGDRSERIRTYNFPQNRVTDHRIGLTLQKLDTILSGKMDEVVDALVLYDQTQKLEE 356
>gi|88800296|ref|ZP_01115863.1| peptide chain release factor 1 [Reinekea sp. MED297] >gi|88777011|gb|EAR08219.1| peptide chain release factor 1 [Reinekea sp. MED297] (361 aa)
Score = 786, Expect = 8.8e-82, Identities = 167/339 (49%), Positives = 238/339 (70%)
  Q:    13 SMEEKFNDLNKELETEGLSVKR---------MSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           S+ +K  +L +  E  GL + +           + ++   E   +V+ F  Y     DI++A  L+  E D ++ E+ + EL+  + L E+ + +L++LLLPKDPND KNV +E+R   GGDE++IF GDLF  Y RYA+ +GW+V++L   E  HG Y  I   ++GE VYS++KFESG HRVQRVP TES+GR+HTS  TVAV+PE +E+E + I+ +DL++DT+RASGAGGQH+NKT+SA+R+TH+PTGI V CQ+ +SQ +N+  AM +L AKL + +E    +  +D RK  VG+G+R+E+IRTYN+PQ RVTDHRINLTL KLD V+ G L  II  L+   +A
  S:     4 SIHQKLTELTERYEELGLLLSQPDVISDQTAFRQYSQEYAELENVVQCFSRYTACEADIEAARGLLDDE-DPDMREMGKDELASAEALREELDEQLQILLLPKDPNDHKNVYLEVRAGTGGDEAAIFSGDLFRMYSRYAEKMGWRVEVLSASEGEHGGYKEIISRLSGERVYSQLKFESGAHRVQRVPETESQGRIHTSACTVAVMPEADELESIEIDKNDLRVDTFRASGAGGQHVNKTDSAIRLTHLPTGIVVECQDERSQHKNKARAMSLLAAKLKDAQESAAAREQADQRKSLVGSGDRSERIRTYNFPQGRVTDHRINLTLYKLDEVIGGQLDHIIQPLLQEHQA 352
>gi|169333846|ref|ZP_02861039.1| hypothetical protein ANASTE_00232 [Anaerofustis stercorihominis DSM 17244] >gi|169259411|gb|EDS73377.1| hypothetical protein ANASTE_00232 [Anaerofustis stercorihominis DSM 17244] (355 aa)
Score = 786, Expect = 9.0e-82, Identities = 163/348 (46%), Positives = 250/348 (71%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           + + L S+E++FN++++++    +  + +  +E+ K      PIV  +K+Y   +  ++S ++++    D++  E+   ++S      E  E E+K+LL+PKDPNDDKNVIVE+R   GGDE+++F GDL   Y RYA+   WKV+ML   E    GY    F I G+  YS++K+ESG HRVQR+P TES GR+HTS ITVAVLPE E+VE+ I+ +DL+ID YR+SG GGQ +N T+SAVRITHIP+G+ VACQ+ KSQ++N++ A+K+L+A+L+E ++ + ++ I+  RK Q+G+G+R+E+IRTYN+PQ RVTDHR+ LTL KL++V+ G++ E ID+LI  D++ +M
  S:     1 MLDKLKSIEKRFNEVSEDISNPDIINNHELYTELIKEHSHLEPIVIAYKKYADVMEQLESNKEMLNDSDDDDFKEMILEDISSLNEQKEGLEQEIKILLIPKDPNDDKNVIVEIRAGVGGDEAALFAGDLLRMYTRYAERNRWKVEMLSTNEIGIGGYKEAVFSIQGKGAYSRLKYESGTHRVQRIPDTESSGRIHTSAITVAVLPEAEDVEVNIDPNDLRIDVYRSSGNGGQSVNTTDSAVRITHIPSGLVVACQDEKSQLKNKDKALKILKARLFEIEQRKQQEAIASNRKSQIGSGDRSERIRTYNFPQGRVTDHRVGLTLYKLNDVLDGDIDEFIDTLIVQDQSEQM 351
>gi|153952433|ref|YP_001398893.1| peptide chain release factor 1 [Campylobacter jejuni subsp. doylei 269.97] >gi|166223543|sp|A7H5W3|RF1_CAMJD Peptide chain release factor 1 (RF-1) >gi|152939879|gb|ABS44620.1| peptide chain release factor 1 [Campylobacter jejuni subsp. doylei 269.97] (355 aa)
Score = 786, Expect = 9.0e-82, Identities = 178/351 (50%), Positives = 251/351 (71%)
  Q:     9 NSLLSMEEKFNDLNKELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVML-GNLSEIIDSLISHDEAVKMQEAKI 359
           NSLLS  +  ND++K           M+ ++K  K   PIV K KEY +TL++I+  + L+    D E+ ELA+ EL   + L  K E E+K+LLLPKD ND++N+ +E+R   GGDE+S+FVGDL  AY RYA++ G+K++++   E S  G+  I  ++ G   YS++K+E G HRVQRVP TES+GRVHTS ITVAV+PE++++E+ IN +DLK+D  R+SG GGQ +N T+SAVRITHIPTGI V  Q+GKSQ +N+E+AMK+L+A+L+E +E E     S+ RK QVG+G+R+E+IRTYN+PQNR++DHRINLTL +LD +M  G   EII+ LI+H +A  +QE  +
  S:    17 NSLLSSSDILNDISK-----------MTTLSKEQKNLEPIVLKTKEYLKTLDNIEENKALLN---DPELGELAKEELKTLEELKPKLEEEIKILLLPKDLNDERNIFLEIRAGTGGDEASLFVGDLVKAYARYAENRGYKLEIVSSSEGSVGGFKEIIMLVKGTGAYSRLKYEGGTHRVQRVPQTESQGRVHTSAITVAVMPEVDDIEIEINPNDLKVDVMRSSGHGGQSVNTTDSAVRITHIPTGIVVVNQDGKSQHKNKESAMKVLKARLYEMQENERLAKESEARKSQVGSGDRSERIRTYNFPQNRISDHRINLTLYRLDAIMQDGLFDEIIEPLITHHQAQALQEQNL 355
>gi|167038490|ref|YP_001666068.1| peptide chain release factor 1 [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|166857324|gb|ABY95732.1| peptide chain release factor 1 [Thermoanaerobacter pseudethanolicus ATCC 33223] (356 aa)
Score = 786, Expect = 1.1e-81, Identities = 180/353 (50%), Positives = 265/353 (75%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGLSVKRMSEINKSIKETTPI---VEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGFISFMIN--GENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQEAKI 359
           + + L ++E+++ DL++++    + +  ++E  K +KE   I   V K++EYK+ L DI++ ++L+ S  D E+ E+A+ ELS+ +   EK   E+K+LL+PKDPND+KNVI+E+R  AGG+E+++F  DLF  Y  YA+  GWKV+++   E+  G GF   ++N  G+  YS++K+ESGVHRVQRVP TE+ GR+HTST TVAVLPE+EEV++ IN +D+KID +R+ G GGQ +N T+SAVR+THIPTGI V CQ+ +SQI+NRE A+K+LRAKL+E   +E ++ I++ RK QVGTGER+E+IRTYN+PQ RVTDHRI LTL +L  V+ G+L EIID+LI +D+A K++   +
  S:     1 MIDKLQAIEDRYVDLSQKISDPNI-ISNVAEWRKYVKEHAAIEDIVLKYREYKKVLEDIEATKELL-SSNDEELKEMAEEELSQLEEKKEKLLEEIKILLIPKDPNDEKNVIMEIRAGAGGEEAALFAHDLFRMYSMYAEKKGWKVEIMSSNETDIG-GFKEVILNISGKGSYSRLKYESGVHRVQRVPTTEAGGRIHTSTATVAVLPEVEEVDVEINPNDIKIDVFRSGGHGGQSVNTTDSAVRVTHIPTGIVVTCQDERSQIQNRERALKILRAKLYEMALQEQQREIAETRKSQVGTGERSERIRTYNFPQGRVTDHRIGLTLYRLQEVLDGDLDEIIDALILNDQAEKLKNMNL 355
>gi|53804790|ref|YP_113526.1| peptide chain release factor 1 [Methylococcus capsulatus str. Bath] >gi|61214591|sp|Q60A21|RF1_METCA Peptide chain release factor 1 (RF-1) >gi|53758551|gb|AAU92842.1| peptide chain release factor 1 [Methylococcus capsulatus str. Bath] (360 aa)
Score = 785, Expect = 1.1e-81, Identities = 160/348 (45%), Positives = 239/348 (68%)
  Q:     4 NEKLYNSLLSMEEKFNDLNKELETEGLS--VKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           N  +   L ++  +F ++   L T  +     R   +++   +  P V  F+ Y+ TL  +D A+ L++ + D E+  LA+ EL   +   +  E EL++LLLP+DPND++NV +E+R   GG E++IF GDL   Y RYA+  GW+ +++   E  HG Y  +   I+G+NVYS++KFE+G HRVQRVP TE++GR+HTS  TVA+LPE ++VE+ IN +DL+IDT+RASGAGGQH+N+T+SA+RITHIPTG  V CQ+ +SQ +NR  AM +L+A++    +E+    I+  RK QVG+G+R+E+IRTYN+PQ R+TDHRINLT+ +LD +M G+L  +ID L+   +A
  S:     2 NPSVQQKLENLSHRFEEITGLLATPEVQNDQNRFKALSREYAQLEPCVACFRRYRETLEGLDHAQALLQ-DPDPEVRSLAREELETGRKRCDALEQELQILLLPRDPNDERNVFLEVRAGTGGAEAAIFAGDLQRMYSRYAERQGWRAEIVSESEGEHGGYKEVVMRISGQNVYSRLKFEAGTHRVQRVPTTEAQGRIHTSACTVAILPEFDDVEIDINPADLRIDTFRASGAGGQHVNRTDSAIRITHIPTGTVVECQDERSQHKNRARAMSLLQARILAAAQEKQNSEIAASRKLQVGSGDRSERIRTYNFPQGRLTDHRINLTIYRLDAIMEGDLDPVIDPLLQEHQA 351
>gi|167456475|ref|ZP_02322693.1| peptide chain release factor 1 [Anaeromyxobacter dehalogenans 2CP-1] >gi|167417204|gb|EDR83911.1| peptide chain release factor 1 [Anaeromyxobacter dehalogenans 2CP-1] (370 aa)
Score = 785, Expect = 1.1e-81, Identities = 158/347 (45%), Positives = 247/347 (71%)
  Q:    11 LLSMEEKFNDLNKELETEGLSVK--RMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQEA 357
           L ++E++F +L + L    ++    R  ++ K        V   + Y++ L D++  E L+ ++KD E+ ELA+ EL++ +P ++  E +LK+ L+PKDPND+K+VIVE+R  AGGDE+ +F  ++   Y RYA+  GW+V++++    +  G    +  ++G+ VYS +K+ESGVHRVQRVPATE++GR+HTST+TVAV+PE EE+++ +N +D+++D +R++G+GGQ +N T+SAVR+TH PTGI V CQ+ KSQ++NR  AMKMLRAKL+E ++E  R      RK QVGTG+R+EKIRTYN+PQ+R+TDHR+N T + L  VM G++ ++ID+  +   A  ++EA
  S:    10 LEAIEQRFEELTQLLSDPAVAGNGDRFRKVAKERASIEQTVTALRAYRKLLEDVEGNEALL-ADKDPELRELAKEELAQLRPQVDPAEEQLKLYLVPKDPNDEKDVIVEIRAGAGGDEAGLFAAEVMRMYVRYAERRGWRVELMDTSGGALGGVKEATLTVSGDAVYSSLKYESGVHRVQRVPATEAQGRIHTSTVTVAVMPEAEEIDVQVNPADVEMDVFRSTGSGGQSVNTTDSAVRLTHKPTGIVVKCQQEKSQLKNRTMAMKMLRAKLFEIEQERQRSARDATRKSQVGTGDRSEKIRTYNFPQDRLTDHRVNYTRHNLPAVMDGDVQDVIDACRTFYAAQALREA 358
>gi|196157374|ref|YP_002126863.1| peptide chain release factor 1 [Alteromonas macleodii 'Deep ecotype'] >gi|88772578|gb|EAR03859.1| peptide chain release factor 1 [Alteromonas macleodii 'Deep ecotype'] >gi|196113153|gb|ACG66869.1| peptide chain release factor 1 [Alteromonas macleodii 'Deep ecotype'] (361 aa)
Score = 785, Expect = 1.2e-81, Identities = 162/318 (50%), Positives = 233/318 (73%)
  Q:    34 RMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           +   ++K   +   +V  F  Y++   ++ SA++++ +E D E+ E+AQ E+ E K  IE+ E EL+VLLLPKDPNDD N  +E+R  AGGDE++IF GDLF  Y RYA+S GW+V+++   ES HG Y  +   ++G+ VY  +KFESG HRVQRVP TES+GR+HTS  TVAVLPE+ E E + IN ++L+IDT+RASGAGGQH+NKT+SA+RITH+PTG+ V CQ+ +SQ +NR  AM +L+A+L + +EE+     +  RK  VG+G+R+E+IRTYN+PQ RVTDHRINLT+ +LD V+ G+L +++D ++   +A
  S:    34 KFRNLSKEFSQLEDVVAGFNAYQQAQENLASAQEML-NEDDAEMREMAQEEMKEAKGEIERLETELQVLLLPKDPNDDNNCFLEIRAGAGGDEAAIFAGDLFRMYSRYAESRGWRVELVNANESEHGGYKEVVANVSGDGVYGVLKFESGGHRVQRVPETESQGRIHTSACTVAVLPEIPESEAIEINPAELRIDTFRASGAGGQHVNKTDSAIRITHLPTGLVVECQDERSQHKNRAKAMSVLQARLNQIEEEKRAAEEASTRKSLVGSGDRSERIRTYNFPQGRVTDHRINLTIYRLDEVVEGDLKQLVDPILQEHQA 352
>gi|187777270|ref|ZP_02993743.1| hypothetical protein CLOSPO_00822 [Clostridium sporogenes ATCC 15579] >gi|187774198|gb|EDU38000.1| hypothetical protein CLOSPO_00822 [Clostridium sporogenes ATCC 15579] (358 aa)
Score = 785, Expect = 1.2e-81, Identities = 165/343 (48%), Positives = 250/343 (72%)
  Q:    14 MEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           +E K+ +L+ ++    +  + K   ++ K   +   IV  ++EYK+   D++S +++++ E D E+ E+AQ E+ E    +E  E EL +LLLPKDPNDDK+V +E+R  AGGDE+++F  +L   Y RYA+   WKV+ + +  +   G+  ++  + G+  YS++K+ESGVHRVQRVP TES GR+HTST TVAVLPE+++V++ IN +DL+ID YRASG GGQ +N T+SAVRITH+PTG+ V CQ+ KSQ++N+E AMK+L+A+L+E  E E   +I++ RK QVGTG+R+E+IRTYNYPQ R+TDHRI LTL KL+  + G++ E+I++L++ D+A KM++
  S:     8 IENKYEELSNKISDPSVMANQKEWQKLCKEHADLEIIVNTYREYKKAQEDLESDKEMLREESDKELREMAQEEIKELTLKLEDLERELTILLLPKDPNDDKDVFIEIRAGAGGDEAALFASNLLRMYTRYAERKNWKVETMSLNATDIGGFKEVTVAVKGKGAYSRLKYESGVHRVQRVPDTESSGRIHTSTATVAVLPEVDDVDININANDLRIDVYRASGHGGQCVNTTDSAVRITHLPTGLVVTCQDEKSQLKNKEKAMKVLKARLFEAAEAERAASIAEDRKSQVGTGDRSERIRTYNYPQGRITDHRIGLTLYKLETFLDGDIDEVIEALVTEDQAEKMKD 353
>gi|189485187|ref|YP_001956128.1| peptide chain release factor 1 [uncultured Termite group 1 bacterium phylotype Rs-D17] >gi|170287146|dbj|BAG13667.1| peptide chain release factor 1 [uncultured Termite group 1 bacterium phylotype Rs-D17] (356 aa)
Score = 785, Expect = 1.3e-81, Identities = 183/354 (51%), Positives = 245/354 (69%)
  Q:     6 KLYNSLLS-MEEKFNDLNKELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEK---YEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQEAKI 359
           KL NS+   +E K +DL+     E        E+ K      P+ EK+  Y + LN+I  AE+L KS KD E+ E+A    +E   LIEK    E E+KVLL+P DPN+DKN+IVE+R   GG+E+++FVGDL+  Y R+A+  GWK ++L    +   GY  + F ING  V+   KFE G HRVQRVP TE+ GRVHTS  TVAVLPE EEV++ I   DL+IDTYRASGAGGQHINKT+SA+RITH+PTG+ VACQ+ +SQI+NR  A K+LRAK++E++  E+   +S  RK Q+G+G+R+EKIRTYN+PQNR+TDHRI  ++  +  VM GNLSE+++ LI  D   K++E  I
  S:     7 KLLNSIFEEVESKLSDLSVISNQE-----EYRELTKQHFYLRPLAEKYIRYSKLLNEIKDAEELQKS-KDAEMKEIA---FAEYNNLIEKRNQMENEIKVLLIPTDPNEDKNIIVEIRAGTGGNEAALFVGDLYGMYTRFAERNGWKYEVLGSNPTGLGGYKEVVFEINGGKVWRCFKFERGAHRVQRVPETEASGRVHTSAATVAVLPEAEEVDVEIKMEDLRIDTYRASGAGGQHINKTDSAIRITHLPTGLVVACQDERSQIKNRAKAFKVLRAKIYEQRILEHEMRLSSERKQQIGSGDRSEKIRTYNFPQNRITDHRIGYSVYNITEVMDGNLSELVNKLIKADIESKLKENNI 356
>gi|75762680|ref|ZP_00742519.1| Bacterial Peptide Chain Release Factor 1 (RF-1) [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|74489826|gb|EAO53203.1| Bacterial Peptide Chain Release Factor 1 (RF-1) [Bacillus thuringiensis serovar israelensis ATCC 35646] (358 aa)
Score = 785, Expect = 1.3e-81, Identities = 175/354 (49%), Positives = 249/354 (70%)
  Q:     5 EKLYNSLLSMEEKFNDLNKELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQEAK 358
           EKL N LLS  E  +D NK        ++  S+    I+ET   VE ++EYK     +  A+ +++ + D E+ ++ + E+SE +   +     LK+LL+PKDPNDDKNVIVE+R AAGGDE+++F GDL+  Y RYA+  GWK +++E   +   GY  I FMING+  ++K+KFE+G HRVQRVP TES GR HTST TVAVLPE EEVE+ I+  D+++DT+ +SG GGQ +N T SAVR+TH+PTG+ V+CQ+ KSQI+N+E AMK+LRA++++K  +E +      RK  VGTG+R+E+IRTYN+PQNRVTDHRI LT+ KLD ++ G L + I++L+  D+A +M+ A+
  S:    16 EKL-NELLSDPEVISDTNK--------LREYSKEQSDIQET---VEVYREYKDVREQLKDAKAMLEEKLDAEMRDMVKEEVSELESQEKTLSERLKILLVPKDPNDDKNVIVEVRGAAGGDEAALFAGDLYRMYSRYAEVQGWKTEIIEASYTELGGYKEIIFMINGKRAFAKLKFENGAHRVQRVPETESGGRXHTSTATVAVLPEAEEVEIDIHEKDVRVDTFASSGPGGQSVNTTMSAVRLTHLPTGVVVSCQDEKSQIKNKEKAMKVLRARVYDKFRQEAQAEYDQNRKQAVGTGDRSERIRTYNFPQNRVTDHRIGLTIQKLDQILQGKLDDFINALVMEDQAQRMEAAE 358
>gi|169182756|ref|ZP_02843270.1| peptide chain release factor 1 [Thauera sp. MZ1T] >gi|169010164|gb|EDS56932.1| peptide chain release factor 1 [Thauera sp. MZ1T] (360 aa)
Score = 785, Expect = 1.4e-81, Identities = 168/347 (48%), Positives = 235/347 (67%)
  Q:     5 EKLYNSLLSMEEKFNDLNKELETE--GLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           + + + L  +  +  +L++ L +E     +    E+++   E  P+V  ++E++    D  +A +L+    D E+ EL +LEL+E +  IE  E EL+  LLP+DPND +N+ +E+R   GGDE+++F GDL   Y RYA+   WKV+++   ES   GY  +   + G   YSK+KFESG HRVQRVP TE++GR+HTS  TVAVLPE +EVE V IN +DL+IDT+RASGAGGQHINKT+SAVRITHIPTGI V CQ+ +SQ  N+  AM +L A+L++ +    +   +  RK  VG+G+R+E+IRTYN+PQ RVTDHRINLTL KLD VM G L EI+D+L    +A
  S:     3 QSIRDKLEHLANRLEELDRTLASEEGARDMNAFRELSRERAEIEPVVALYREHRLAEADCATARELLA---DPEMRELGELELAEGEARIEALEAELQRALLPRDPNDARNLFLEIRAGTGGDEAALFAGDLLRMYTRYAERQRWKVEIVSASESDLGGYKEVIARVVGNGAYSKLKFESGGHRVQRVPVTETQGRIHTSACTVAVLPEADEVEAVDINPADLRIDTFRASGAGGQHINKTDSAVRITHIPTGIVVECQDDRSQHRNKAQAMAVLAARLYDARVRAQQSAEAAQRKSLVGSGDRSERIRTYNFPQGRVTDHRINLTLYKLDAVMQGELDEIVDALTLEHQA 350
>gi|34495535|ref|NP_899750.1| peptide chain release factor 1 [Chromobacterium violaceum ATCC 12472] >gi|46576724|sp|Q7P1Y2|RF1_CHRVO Peptide chain release factor 1 (RF-1) >gi|34101390|gb|AAQ57759.1| peptide chain release factor I [Chromobacterium violaceum ATCC 12472] (358 aa)
Score = 785, Expect = 1.4e-81, Identities = 164/326 (50%), Positives = 234/326 (71%)
  Q:    26 ETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEV-ELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           ET    ++   ++ +   E TP+VE F  Y++   DI +AE ++    D E+ E AQ E++E K  +E  + EL+ LLLPKDPNDDKN+ +E+R   GGDE+++F  DL   Y RYA+   W+V+++   ES   GY  +   + G+  YS++KFESG HRVQRVPATE++GR+HTS  TVAV+ E +E+ E+V+N +DL+IDT+RASGAGGQHINKT+SAVRITHIPTGI   CQ+G+SQ  N+ +AM++L A++++ +  E  +  +  RK  +G+G+R+E+IRTYNYPQ R+TDHRINLTL KLD VM G+L+E+ D+LI+  +A
  S:    26 ETATQDMEAFKKLTREHAELTPVVETFSAYRQCEGDIAAAEDMLA---DPEMKEFAQAEIAEGKDKLEALDLELQKLLLPKDPNDDKNIFLEIRAGTGGDEAALFAADLLRMYTRYAERNRWQVEIVSASESDLGGYKEVIVRLVGQGAYSRLKFESGGHRVQRVPATETQGRIHTSACTVAVMAEADEIAEVVLNPADLRIDTFRASGAGGQHINKTDSAVRITHIPTGIVAECQDGRSQHANKASAMQVLAARIYDIQLREKNQKEAAERKSLIGSGDRSERIRTYNYPQGRITDHRINLTLYKLDYVMDGDLAELTDALIAEQQA 350
>gi|126665163|ref|ZP_01736146.1| peptide chain release factor 1 [Marinobacter sp. ELB17] >gi|126630533|gb|EBA01148.1| peptide chain release factor 1 [Marinobacter sp. ELB17] (364 aa)
Score = 784, Expect = 1.6e-81, Identities = 162/341 (47%), Positives = 239/341 (70%)
  Q:    11 LLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKS-EKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           L  + E+F +++  L   G+  +  +  E+++   E  P+V+ F+ ++ +L DI+ A +L K  + D ++ E+A+ EL   +   E+ + EL+ L+LPKDPND KNV +E+R   GGDE++IF GDLF  Y R+A+   W+V++L   E  HG Y  +   + G  VY  +KFESGVHRVQRVP TES+GR+HTS  TVAV+PE +E E V IN  DL++DT+RASGAGGQH+NKT+SA+RITH+P+G+ V CQE +SQ +NR  AM +L ++L   + E   +++++ RK  VG+G+R+E+IRTYN+PQ+RVTDHRINLTL KLD V+ G+L  ++  L+   +A
  S:     9 LEQLVERFEEVSALLSDAGVIANQNKFRELSREYAEIEPVVQCFQAWQHSLVDINEARELSKDGDADADMREMAEEELHTAQQASEELDAELQGLMLPKDPNDGKNVFLEVRAGTGGDEAAIFAGDLFRMYSRFAERRRWQVEILSASEGEHGGYKEVIARVAGSGVYGTLKFESGVHRVQRVPETESQGRIHTSACTVAVMPEADEAEAVEINKGDLRVDTFRASGAGGQHVNKTDSAIRITHLPSGLVVECQEERSQHKNRAKAMSLLASRLQNIETERAHQSMAETRKSLVGSGDRSERIRTYNFPQSRVTDHRINLTLYKLDEVIAGDLDSVVKPLLQEHQA 354
>gi|157165147|ref|YP_001465968.1| peptide chain release factor 1 [Campylobacter concisus 13826] >gi|166223539|sp|A7ZB10|RF1_CAMC1 Peptide chain release factor 1 (RF-1) >gi|112801757|gb|EAT99101.1| peptide chain release factor 1 [Campylobacter concisus 13826] (355 aa)
Score = 784, Expect = 1.7e-81, Identities = 166/328 (50%), Positives = 239/328 (72%)
  Q:    32 VKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQE-SSHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNL-SEIIDSLISHDEAVKMQEAKI 359
           +++M++++K      P+     +Y + LNDI+  + L++   D E+ ELA+ EL   +   EK E E+K+LLLPKDPNDDKN+ +E+R   GGDE+++F GDLF+AY RYA+  G+K +++   E ++ G+  I  +I G+  YS++KFE G HRVQRVP TES+GRVHTS +TVA++PE+E+ E+ IN +D+++D  R+SG GGQ +N T+SAVRITHIPTG+ V  Q+GKSQ +N+E AMK+L+A+L+E +E+E     +  RK QVGTG+R+ +IRTYNYPQNR++DHRINLTL +LD +M   L  EII+ LI+H +A  M EA I
  S:    29 IEKMTKLSKEQSSIEPVATAATKYLQILNDIEENKALLE---DAELGELAKEELKSLEISREKLEEEIKILLLPKDPNDDKNIFLEIRAGTGGDEAALFAGDLFNAYIRYAELRGYKFEIVSQSEGNTGGFKEIIVLIKGKGAYSRLKFEGGTHRVQRVPETESQGRVHTSAVTVAIMPEVEDSEIEINPNDIRVDVMRSSGHGGQSVNTTDSAVRITHIPTGLVVTNQDGKSQHKNKEAAMKVLKARLYEMQEQERLAKETSERKSQVGTGDRSGRIRTYNYPQNRISDHRINLTLYRLDAIMAAGLFDEIIEPLITHYQAEAMLEAGI 355
>gi|54020410|ref|YP_115756.1| peptide chain release factor 1 [Mycoplasma hyopneumoniae 232] >gi|61214589|sp|Q601F9|RF1_MYCH2 Peptide chain release factor 1 (RF-1) >gi|53987583|gb|AAV27784.1| peptide chain release factor 1 (RF-1), peptide termination factor [Mycoplasma hyopneumoniae 232] (361 aa)
Score = 783, Expect = 2.0e-81, Identities = 174/346 (50%), Positives = 258/346 (74%)
  Q:     5 EKLYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQES-SHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEE-VELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDE 350
           +K++NSL+ + +K+ DL + LET+ +    K+  +I K I   T I+E F+++      ++ A+ ++  E D E+I+LA++E++     IE+YE +L +L+LPKD ND+K+VIVE+R AAGGDE++IFVGDLF  Y ++ADS   KVK+L    + + G+  I F I+G+ +YSK+KFESGVHRVQRVPATE+ GR+HTST TV V+P+++E +E+ IN SDLKIDTYR+SGAGGQ +N T+SAVRITHIPTGI V  Q+ +SQI N+E AM +L++K++  + ++ ++  SD RK   G+G R+EKIRTYNYPQ+R+TDHRIN +   L  ++ GNL+ II++L++ ++
  S:     3 KKMFNSLMKIHQKYQDLKQLLETDQILNDQKQYLQIAKEIASITEIIEVFQKFLDDQKVLEDAKTILIQEDDPELIQLAKVEIATMSKNIEEYEKKLLILMLPKDKNDEKDVIVEIRGAAGGDEANIFVGDLFKMYHKWADSQKAKVKVLSSSLALAGGFSQIIFQISGQKIYSKLKFESGVHRVQRVPATETMGRIHTSTATVTVMPKIDEKIEIEINPSDLKIDTYRSSGAGGQSVNTTDSAVRITHIPTGIVVTSQDERSQIGNKEIAMGILKSKIYNLELQKQQQKQSDFRK-LAGSGARSEKIRTYNYPQDRLTDHRINFS-TSLKPIIQGNLNPIIEALLAQEK 350
>gi|168177471|ref|ZP_02612135.1| peptide chain release factor 1 [Clostridium botulinum NCTC 2916] >gi|182670538|gb|EDT82512.1| peptide chain release factor 1 [Clostridium botulinum NCTC 2916] (358 aa)
Score = 783, Expect = 2.3e-81, Identities = 166/343 (48%), Positives = 250/343 (72%)
  Q:    14 MEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           +E K+ +L+ ++    +  + K   ++ K   +   IV  ++EYK+   D++S ++++K E D E+ E+AQ E+ E    +E  E EL +LLLPKDPNDDK+V +E+R  AGG+E+++F  +L   Y RYA+   WKV+ + +  +   G+  ++  I G+  YS++K+ESGVHRVQRVP TES GR+HTST TVAVLPE+++V++ IN +DL+ID YRASG GGQ +N T+SAVRITH+PTG+ V CQ+ KSQ++N+E AMK+L+A+L+E  E E   +I++ RK QVGTG+R+E+IRTYNYPQ R+TDHRI LTL KL+  + G++ E+I++L++ D+A KM++
  S:     8 IENKYEELSNKISDPSVMANQKEWQKLCKEHADLEIIVNTYREYKKAQEDLESDKEMLKEESDKELREMAQEEIKELTLRLEDLERELTILLLPKDPNDDKDVFIEIRAGAGGEEAALFASNLLRMYTRYAERKNWKVETMSLNATDIGGFKEVTVAIKGKGAYSRLKYESGVHRVQRVPDTESSGRIHTSTATVAVLPEVDDVDININANDLRIDVYRASGHGGQCVNTTDSAVRITHLPTGLVVTCQDEKSQLKNKEKAMKVLKARLFEAAEAERAASIAEDRKSQVGTGDRSERIRTYNYPQGRITDHRIGLTLYKLETFLDGDIDEVIEALVTEDQAEKMKD 353
>gi|69933101|ref|ZP_00628303.1| Peptide chain release factor 1 [Paracoccus denitrificans PD1222] >gi|119383645|ref|YP_914701.1| peptide chain release factor 1 [Paracoccus denitrificans PD1222] >gi|166223583|sp|A1B0G1|RF1_PARDP Peptide chain release factor 1 (RF-1) >gi|119373412|gb|ABL69005.1| bacterial peptide chain release factor 1 (bRF-1) [Paracoccus denitrificans PD1222] (351 aa)
Score = 783, Expect = 2.3e-81, Identities = 162/346 (46%), Positives = 236/346 (68%)
  Q:     9 NSLLSMEEKFNDLNKELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGFISFM--INGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           + L+ + E+F  L   L   G + + ++ I++   E  P+V +  +++    DI  A+ ++    D+E+ ELAQ ELS  +  +   E+ L+V LLP+D  D +  I+E+RP  GG+E+++F GDL   Y+R+A+S GW+ +MLE+  S  G G    M  I GE V++++K+ESGVHRVQRVP TES GR+HTS  TVAVLPE EEV++ I  +D++IDT RASGAGGQH+N T+SAVRITH+PTGI V   E KSQ +NR  AM +LRA+L++ +        +  RK QVG+G+R+E+IRTYN+PQ R+TDHRI LTL  LD +M G + EI+++L +HD+A ++
  S:     5 DRLIQIVERFEYLEARLNA-GPAAEEIAAISREYAELKPVVAQIAQWRSVQEDIRQAQAMLA---DHEMRELAQDELSRLRAGLPALEHALRVALLPRDAADARPAILEIRPGTGGEEAALFAGDLLDMYRRFAESQGWQFQMLELVRSDLG-GVREAMARIEGEGVFARLKYESGVHRVQRVPETESGGRIHTSAATVAVLPEAEEVDVDIPAADIRIDTMRASGAGGQHVNTTDSAVRITHLPTGIVVTSSE-KSQHQNRANAMAVLRARLYDMERSRADAERAADRKSQVGSGDRSERIRTYNFPQGRMTDHRIGLTLYALDRIMQGEIGEIVEALAAHDQAARL 346
>gi|119472532|ref|ZP_01614580.1| Peptide chain release factor 1 (RF-1) [Alteromonadales bacterium TW-7] >gi|119444856|gb|EAW26156.1| Peptide chain release factor 1 (RF-1) [Alteromonadales bacterium TW-7] (361 aa)
Score = 782, Expect = 2.7e-81, Identities = 167/347 (48%), Positives = 242/347 (69%)
  Q:     5 EKLYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           E +YN L ++ E++ ++   L    +     R   ++K   E   IV+ F  Y++T  D+ SAE+++K + D ++ E+AQ E  E K  I   E E++VL+LPKDP D+ NV +E+R   GGDE++IF GDLF  Y R+A++  WK++++   E  HG Y  +   I+GE VY K+KFESGVHRVQRVP TES+GRVHTS  TVAV+ E+ E E + IN +D+K+DT+RASGAGGQH+NKT+SA+RITH+PTG+ V CQ+ +SQ +NR  AM +L A+L + ++E+     +  R+  VG+G+R+E+IRTYNYPQ R+TDHRINLTL +L+ V+ G+L  I+D L+   +A
  S:     3 ESVYNKLETLVERYEEVQALLSDPSVISDQNRFRGLSKEYSELEEIVKTFLAYQQTKEDLASAEEMLK-DSDPDMREMAQEEYKEAKAQILSLEDEIQVLMLPKDPKDNNNVFLEVRAGTGGDEAAIFAGDLFRMYSRFAETQKWKLEVVTTNEGEHGGYKEVIANISGEGVYGKLKFESGVHRVQRVPETESQGRVHTSACTVAVMAEIPEAEAIEINTADIKVDTFRASGAGGQHVNKTDSAIRITHLPTGVVVECQDERSQHKNRAKAMSVLAARLQQAEDEKRHAAEASERRNLVGSGDRSERIRTYNYPQGRITDHRINLTLYRLNEVVAGDLGAIVDPLMQEHQA 352
>gi|56476056|ref|YP_157645.1| peptide chain release factor 1 [Azoarcus sp. EbN1] >gi|81598974|sp|Q5P7G7|RF1_AZOSE Peptide chain release factor 1 (RF-1) >gi|56312099|emb|CAI06744.1| peptide chain release factor 1 (RF-1) [Azoarcus sp. EbN1] (359 aa)
Score = 782, Expect = 2.8e-81, Identities = 165/350 (47%), Positives = 236/350 (67%)
  Q:     5 EKLYNSLLSMEEKFNDLNKELETEGLSVKRMS---EINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           + + + L  +  +  +L++EL + G +V+ M     + +   E  P+V  +  Y++   D +SA  ++    D E+ ELA+ EL      ++  E EL+  LLP DP+D++N+ +E+R   GGDE+S+F GDL   Y RYA+   WKV+++    S   GY  +   I G   YSK+KFESG HRVQR+P TE++GR+HTS  TVAV+PE +EVE V IN +DL+IDT+RASGAGGQHINKT+SAVRITH+PTGI V CQ+ +SQ  NR  AM +L A++ +++  E +   +  RK  VG+G+R+E+IRTYNYPQ RVTDHRINLTL KLD VM G+L E++D+L    +A ++
  S:     3 QSIRDKLELLTHRLAELDRELSS-GDAVRDMDGFRSLGRERAEIEPVVALYGAYRQAEADCESARAMLA---DAEMRELAESELETGAVRLQALEAELQCALLPCDPSDERNLFLEVRAGTGGDEASLFAGDLLRMYTRYAERQRWKVEIVSSSPSDLGGYKEVILRIAGAGAYSKLKFESGGHRVQRIPVTETQGRIHTSACTVAVMPEADEVEAVNINPADLRIDTFRASGAGGQHINKTDSAVRITHLPTGIVVECQDDRSQHRNRAQAMSVLAARIQDRQLREQQAREAATRKSLVGSGDRSERIRTYNYPQGRVTDHRINLTLYKLDAVMQGDLDELVDALTREHQADQL 353
>gi|21672964|ref|NP_661029.1| peptide chain release factor 1 [Chlorobium tepidum TLS] >gi|28201874|sp|Q8KG45|RF1_CHLTE Peptide chain release factor 1 (RF-1) >gi|21646023|gb|AAM71371.1| peptide chain release factor 1 [Chlorobium tepidum TLS] (357 aa)
Score = 782, Expect = 2.8e-81, Identities = 165/349 (47%), Positives = 236/349 (67%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGLSV--KRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS--HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQ 355
           +++ L S+++KF  + ++L    +     R  ++NK       IV  + E+ RT   +D A  + K+E D E+  L + E  E +  + K E +LK+LLLPKD  D +N I+E+R   GGDE+ +F  DL   Y+RYA+  GW  + LEV E S       +S  ++G NVY  +KFESGVHRVQRVP TE++GR+HTS  +VAVLPE EEV++ I   DL IDT+R+ G GGQ++NK E+AVRITH+P+GI VACQE +SQ++NRE AMKMLR+KL++ +  E +K+ +DLR+  V TG+R+ KIRTYN+PQ+RVTDHRI  T + L  +M G L  +I++L  HD+A ++Q
  S:     1 MFDKLQSIKDKFQTIEQQLSDPEVVADQNRFRKLNKEYSSLKEIVRAYDEWSRTKKQLDEAHSMQKNENDPEMRALVEEEAGELQERLPKLEQQLKILLLPKDEADSRNAIIEIRAGTGGDEAGLFAADLMRMYQRYAERQGWSCQTLEVSEGSVPGSLKEVSLEVSGHNVYGILKFESGVHRVQRVPETETQGRIHTSAASVAVLPEAEEVDVEIRKEDLLIDTFRSGGKGGQNVNKVETAVRITHVPSGIVVACQEERSQLQNRERAMKMLRSKLYDLQIAEQQKSRADLRRSMVTTGDRSAKIRTYNFPQSRVTDHRIGFTSHALPQIMQGELDPLIEALRMHDQAERLQ 353
>gi|51891211|ref|YP_073902.1| peptide chain release factor 1 [Symbiobacterium thermophilum IAM 14863] >gi|81610729|sp|Q67TD5|RF1_SYMTH Peptide chain release factor 1 (RF-1) >gi|51854900|dbj|BAD39058.1| peptide chain release factor 1 [Symbiobacterium thermophilum IAM 14863] (356 aa)
Score = 782, Expect = 3.0e-81, Identities = 158/305 (51%), Positives = 223/305 (73%)
  Q:    47 PIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQES-SHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           PIVEKF+ Y++T  ++D   ++++   D E   L   EL + K  ++    EL++LLLP+DPNDDKNVI+E+R  AGGDE+S+F  +LF  Y R A+   WK ++L + E+ + G   + F IN E  YS++K+E GVHRVQRVP TES+GR+HTST+TVAV+PE+EEV++ I   DLKI+  RA GAGGQH+NKTESAVR+TH+PTGI V C + +SQ++NRE A+++LRA++ +   ++ +     LR+ QVGTGER+EKIRTYN+PQ+RVTDHRI LT++ +  VM G +  IID+L  H++A
  S:    43 PIVEKFRAYQKTERELDDVLEMLEGPLDPEERALFNQELRDLKEKLQTLSDELRILLLPRDPNDDKNVIMEIRAGAGGDEASLFAAELFRMYTRLAERHKWKTEVLSISENEAGGIKEVLFQINAEGAYSRLKYEGGVHRVQRVPVTESQGRIHTSTVTVAVMPEMEEVDIEIKPEDLKIEVQRAGGAGGQHVNKTESAVRMTHLPTGIVVYCADERSQMQNREKALRVLRARVADYYAQQAKSEEEQLRRAQVGTGERSEKIRTYNFPQDRVTDHRIGLTVHNIAAVMDGEIDHIIDALAQHEQA 348
>gi|154500225|ref|ZP_02038263.1| hypothetical protein BACCAP_03889 [Bacteroides capillosus ATCC 29799] >gi|150270957|gb|EDM98231.1| hypothetical protein BACCAP_03889 [Bacteroides capillosus ATCC 29799] (355 aa)
Score = 782, Expect = 3.0e-81, Identities = 171/351 (48%), Positives = 247/351 (70%)
  Q:     7 LYNSLLSMEEKFNDLNKEL---ETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQEA 357
           + + L S+E  + DL   L   ET G     ++++NK   E  P+VE ++ Y R   D++ A  L+    D ++ ELAQ E ++ K   E+ E ++K+LLLP DPND KNVIVE+R   GG+E+++F   L+  Y  YA++  WKV++  + E+   G   ISF + G   YS++KFESGVHRVQRVP TES  R+HTST+TVAVLPE EEV++ IN +D+++  +R+SGAGGQHINKT SAVR+ H PTG+ V CQ+ +SQ +NR+ AM++LR++L+E +++      S+ R+ QVGTG R E+IRTYN+PQ R+TDHRI LTL KL++VM G+L EIIDSLI+ D+A +++++
  S:     1 MLDKLRSLELHYEDLVARLNAPETYG-DPALVAKLNKEQSELEPLVETYRRYIRRQQDMEEARSLMS---DPDMKELAQEEFAQAKEEAEELEQKMKILLLPTDPNDGKNVIVEIRAGVGGEEAALFANSLYRMYSMYAETRHWKVEVASLNETELGGIKEISFTVEGGGAYSRLKFESGVHRVQRVPETESGDRIHTSTVTVAVLPEAEEVDVDINPADIEMQVFRSSGAGGQHINKTSSAVRLIHKPTGMVVECQQERSQFQNRDKAMQILRSRLYEAEQQRVSAEWSEERRSQVGTGMRNERIRTYNFPQGRLTDHRIGLTLYKLEDVMNGDLDEIIDSLITADQAERLKQS 351
>gi|163743155|ref|ZP_02150537.1| peptide chain release factor 1 [Phaeobacter gallaeciensis 2.10] >gi|161383572|gb|EDQ07959.1| peptide chain release factor 1 [Phaeobacter gallaeciensis 2.10] (351 aa)
Score = 781, Expect = 3.3e-81, Identities = 157/329 (47%), Positives = 233/329 (70%)
  Q:    28 EGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           EG++   ++ + K   +  P+ E+   Y+R L+D++ AE+++    D ++ ELA+ EL + +  + + E+ L++ LLP+D  D +  ++E+RP  GGDE+++F GDL   Y+RYA++ GW ++++E Q +   G   +   + GENV++++K+ESGVHRVQRVP TES GR+HTS  TVAVLPE E+V+L I+  DL+IDT RASGAGGQH+N T+SAVRITHIPTGI V   E KSQ  NRE AM+++R +L++ + +      S  R  QVG+G+R+E+IRTYN+PQ R++DHRINLTL KLD +M G+L EIID+L + D+A  + E
  S:    23 EGVAGADIAALAKEYSDLRPVAEQISAYRRLLSDLEEAEQMLA---DPDMAELAEEELPQLRAALPEAEHALQLALLPRDEADARPAMLEIRPGTGGDEAALFAGDLLRMYQRYAEARGWGIEIIEEQTTELGGLKEVVAHVKGENVFARLKYESGVHRVQRVPVTESGGRIHTSAATVAVLPEAEDVDLRIDPGDLRIDTMRASGAGGQHVNTTDSAVRITHIPTGIIVVSSE-KSQHRNREIAMQVMRTRLYDLERQRIDSERSADRASQVGSGDRSERIRTYNFPQGRMSDHRINLTLYKLDQIMQGDLDEIIDALTADDQARLLAE 348
>gi|153939567|ref|YP_001389502.1| peptide chain release factor 1 [Clostridium botulinum F str. Langeland] >gi|168182252|ref|ZP_02616916.1| peptide chain release factor 1 [Clostridium botulinum Bf] >gi|170755459|ref|YP_001779766.1| peptide chain release factor 1 [Clostridium botulinum B1 str. Okra] >gi|166223550|sp|A7G9P2|RF1_CLOBL Peptide chain release factor 1 (RF-1) >gi|152935463|gb|ABS40961.1| peptide chain release factor 1 [Clostridium botulinum F str. Langeland] >gi|169120671|gb|ACA44507.1| peptide chain release factor 1 [Clostridium botulinum B1 str. Okra] >gi|182674565|gb|EDT86526.1| peptide chain release factor 1 [Clostridium botulinum Bf] (358 aa)
Score = 781, Expect = 3.5e-81, Identities = 166/343 (48%), Positives = 250/343 (72%)
  Q:    14 MEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           +E K+ +L+ ++    +  + K   ++ K   +   IV  ++EYK+   D++S ++++K E D E+ E+AQ E+ E    +E  E EL +LLLPKDPNDDK+V +E+R  AGG+E+++F  +L   Y RYA+   WKV+ + +  +   G+  ++  I G+  YS++K+ESGVHRVQRVP TES GR+HTST TVAVLPE+++V++ IN +DL+ID YRASG GGQ +N T+SAVRITH+PTG+ V CQ+ KSQ++N+E AMK+L+A+L+E  E E   +I++ RK QVGTG+R+E+IRTYNYPQ R+TDHRI LTL KL+  + G++ E+I++L++ D+A KM++
  S:     8 IENKYEELSNKISDPSVMANQKEWQKLCKEHADLEIIVNTYREYKKAQEDLESDKEMLKEESDKELREMAQEEIKELTLKLEDLERELTILLLPKDPNDDKDVFIEIRAGAGGEEAALFASNLLRMYTRYAERKNWKVETMSLNATDIGGFKEVTVAIKGKGAYSRLKYESGVHRVQRVPDTESSGRIHTSTATVAVLPEVDDVDININANDLRIDVYRASGHGGQCVNTTDSAVRITHLPTGLVVTCQDEKSQLKNKEKAMKVLKARLFEAAEAERAASIAEDRKSQVGTGDRSERIRTYNYPQGRITDHRIGLTLYKLETFLDGDIDEVIEALVTEDQAEKMKD 353
>gi|24379522|ref|NP_721477.1| peptide chain release factor 1 [Streptococcus mutans UA159] >gi|32171546|sp|Q8DU64|RF1_STRMU Peptide chain release factor 1 (RF-1) >gi|24377463|gb|AAN58783.1|AE014946_8 putative peptide chain release factor 1 [Streptococcus mutans UA159] (359 aa)
Score = 780, Expect = 4.4e-81, Identities = 168/350 (48%), Positives = 253/350 (72%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIK-SEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           +Y+ L ++E+++ +L + L    +    KR  E+++    +   V  ++EYK+ + +I  A+++IK +  D E+ E+A+ EL   K   E+YE +L+ LLLPKDPNDDKN+I+E+R AAGGDE+++F GDL + Y++YA++ GWK +++E   +   G   +  M++G++VYSK+K+ESG HRVQRVP TES+GRVHTST TV V+PE+EEVE  I+  DL++D Y ASGAGGQ++NK  +AVRI H+PT I V  QE ++Q +NR+ AMK++RA++ +   +  +      RK  VGTG+R+E+IRTYN+PQNRVTDHRI LTL KLD+++ G L E+ID+LI +D+  K++E
  S:     3 IYDQLQAVEDRYEELGELLSDPDVVSDTKRFMELSREEANSRETVAVYREYKQVVQNIADAQEMIKDASGDPELEEMAKEELKNSKVAKEEYEEKLRFLLLPKDPNDDKNIILEIRGAAGGDEAALFAGDLLNMYQKYAENQGWKFEVMEASANGVGGLKEVVAMVSGQSVYSKLKYESGAHRVQRVPVTESQGRVHTSTATVLVMPEVEEVEYEIDPKDLRVDIYHASGAGGQNVNKVATAVRIIHLPTNIKVEMQEERTQQKNRDKAMKIIRARVADHFAQIAQDEQDAERKSTVGTGDRSERIRTYNFPQNRVTDHRIGLTLQKLDSILSGKLDEVIDALILYDQTQKLEE 356
>gi|91785343|ref|YP_560549.1| peptide chain release factor 1 [Burkholderia xenovorans LB400] >gi|119361518|sp|Q13TU2|RF1_BURXL Peptide chain release factor 1 (RF-1) >gi|91689297|gb|ABE32497.1| bacterial peptide chain release factor 1 (bRF-1) [Burkholderia xenovorans LB400] (360 aa)
Score = 780, Expect = 4.5e-81, Identities = 160/341 (46%), Positives = 241/341 (70%)
  Q:    11 LLSMEEKFNDLNKELETEGLS--VKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEV-ELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           L  +  +  +LN  L  E ++  + +  ++ +   E  P+VE +  +++ +ND  +A++L+    D  + + A+ E+   +  ++K   EL+ +LLPKDPNDD+N+ +E+R   GGDES++F GDL   Y RYA+   W+V+M+   ES   GY  +   I GE  YSK+KFESG HRVQRVPATE++GR+HTS  TVAV+PE +E+ E+ IN +DL+IDT+RASGAGGQHINKT+SAVR+TH+PTGI V CQ+ +SQ +N++ A+K+L A++ +K+  E +   +  RK  +G+G+R+E+IRTYN+PQ R+TDHRINLTL +LD +M G+L E+I +L+S  +A
  S:     9 LDQLTTRLAELNDLLSREDITSNLDQYRKLTREHAELGPVVEHYALWRQAMNDAATAQELLA---DASMRDFAEEEIRAARERMDKLGAELQKMLLPKDPNDDRNIFLEIRAGTGGDESALFAGDLLRMYLRYAERNRWQVEMMSASESDLGGYKEVIVRIAGEAAYSKLKFESGGHRVQRVPATETQGRIHTSACTVAVMPEADEIGEVEINPADLRIDTFRASGAGGQHINKTDSAVRVTHLPTGIVVECQDDRSQHKNKDRALKVLAARIKDKQSHEQQAKEAATRKSLIGSGDRSERIRTYNFPQGRLTDHRINLTLYRLDAIMDGDLDELIAALVSEHQA 350
>gi|28378950|ref|NP_785842.1| peptide chain release factor 1 [Lactobacillus plantarum WCFS1] >gi|32171522|sp|Q88UT2|RF1_LACPL Peptide chain release factor 1 (RF-1) >gi|28271787|emb|CAD64693.1| peptide chain release factor 1 [Lactobacillus plantarum WCFS1] (360 aa)
Score = 780, Expect = 5.4e-81, Identities = 164/351 (46%), Positives = 251/351 (71%)
  Q:     5 EKLYNSLLSMEEKFNDLNKEL-ETEGLS-VKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQ 355
           +K ++ L ++ +++ +L + L + E +S  +R  +++K +      VEK+  YK   + I+  ++L+  + D+E+  + + +L       ++ E+E+ +L+LPKDPNDDKN+I+E+  AAGGDE+S+F  DLF+ Y +YA+  GW+V++ +  E+   G+  I  +I+G+ VYSK+K+ESG HRVQRVP TES GRVHTST TV V+PE ++V++ I+  D++ D +R+SGAGGQHINKT SAVR+TH+PTGI V+ Q+ +SQ +NR  AM++LRA++++  +   +      RK  VGTG+R+E+IRTYN+PQNRVTDHRI LTLNKLD VM G L E+ID+L+  D+A KM+
  S:     2 DKFFDKLQAVADRYEELGELLSDPEVISDSQRFMKLSKEMGNIRETVEKYNHYKEVTSQIEENDELLHEKLDDEMNAMVKDDLKNLNAEKDQLEHEITLLMLPKDPNDDKNIIMEIHGAAGGDEASLFAADLFNMYSKYAERQGWQVEVADRNETEVGGFKEIVLIISGDKVYSKLKYESGAHRVQRVPVTESAGRVHTSTATVGVMPEAQDVDIDIDQKDIRTDVFRSSGAGGQHINKTSSAVRMTHLPTGIVVSMQDQRSQQQNRAKAMEILRARVYDYYQSREQNEYDAERKSAVGTGDRSERIRTYNFPQNRVTDHRIGLTLNKLDRVMNGELDEVIDALVLADQAEKME 355
>gi|186477469|ref|YP_001858939.1| peptide chain release factor 1 [Burkholderia phymatum STM815] >gi|184193928|gb|ACC71893.1| peptide chain release factor 1 [Burkholderia phymatum STM815] (360 aa)
Score = 780, Expect = 5.5e-81, Identities = 161/341 (47%), Positives = 243/341 (71%)
  Q:    11 LLSMEEKFNDLNKELETEGLS--VKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEV-ELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           L  +  +  +LN  L  E ++  + +  ++ +   E  P+VE++  +++T+ND  +A++L+    D  + + A+ E+   +  +E  E EL+ +LLPKDPNDD+N+ +E+R   GGDES++F GDL   Y RYA+   W+V+M+   ES   GY  +   I GE  YSK+KFESG HRVQRVPATE++GR+HTS  TVAV+PE +E+ E+ IN +DL+IDT+RASGAGGQHINKT+SAVR+TH+PTGI V CQ+ +SQ +N++ A+K+L A++ +K+  E     +  RK  +G+G+R+E+IRTYN+PQ R+TDHRINLTL +L+++M G+L E+I +L+S  +A
  S:     9 LDQLTTRLAELNDLLSREDITSNIDQYRKLTREHAELQPVVEQYGLWRQTMNDAATAQELLS---DASMKDFAEEEIRASRERMETLESELQKMLLPKDPNDDRNIFLEIRAGTGGDESALFAGDLLRMYLRYAERNRWQVEMMSASESDLGGYKEVIVRIAGEAAYSKLKFESGGHRVQRVPATETQGRIHTSACTVAVMPEADEIGEVEINPADLRIDTFRASGAGGQHINKTDSAVRVTHLPTGIVVECQDDRSQHKNKDRALKVLAARIKDKQYHEQHAKEAATRKSLIGSGDRSERIRTYNFPQGRLTDHRINLTLYRLESIMEGDLDELIAALVSEHQA 350
>gi|83591213|ref|YP_431222.1| peptide chain release factor 1 [Moorella thermoacetica ATCC 39073] >gi|119361560|sp|Q2RFW0|RF1_MOOTA Peptide chain release factor 1 (RF-1) >gi|83574127|gb|ABC20679.1| bacterial peptide chain release factor 1 (bRF-1) [Moorella thermoacetica ATCC 39073] (356 aa)
Score = 780, Expect = 5.5e-81, Identities = 155/308 (50%), Positives = 227/308 (73%)
  Q:    48 IVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQ 355
           IV  F+ Y++  N++   + +++ EKD E  EL + E+       E+ E ELK+LLLPKDPND+K++I+E+R  AGG+E+++F GDLF  Y+RYA+   W+ +++    +   G+  I F + G+ VYS++KFESGVHRVQR+P TES GR+HTST TVAVLPE EEV++ I   DL++D + +SG GGQ +N T SAVRITH+PTG+ V+CQ+ KSQ++N+E AM++LRA+L +    E    +++ R+ QVG+G+R+E+IRTYN+PQNRVTDHRI LTL+ LD V+ G L EIID+L++ D+A +++
  S:    44 IVTTFRRYRQVSNELAEDKAMLEEEKDREFQELLKAEIERLTGEQERLEQELKILLLPKDPNDEKDIIMEIRAGAGGEEAALFAGDLFRMYQRYAEKKRWRTEIISSHPTELGGFKEIIFQVEGQGVYSRLKFESGVHRVQRIPTTESGGRIHTSTATVAVLPEAEEVDVEIKPEDLRVDIFCSSGPGGQSVNTTYSAVRITHLPTGLVVSCQDEKSQLKNKEKAMRVLRARLLDMARAEREGELAEERRSQVGSGDRSERIRTYNFPQNRVTDHRIGLTLHHLDQVLAGELDEIIDALVTTDQAERLK 352
>gi|110601334|ref|ZP_01389526.1| peptide chain release factor 1 [Geobacter sp. FRC-32] >gi|110547967|gb|EAT61201.1| peptide chain release factor 1 [Geobacter sp. FRC-32] (356 aa)
Score = 779, Expect = 6.3e-81, Identities = 162/349 (46%), Positives = 250/349 (71%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGLSVKRMSEINKSIKE---TTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGF--ISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQ 355
           L++ +  +E ++ +L + L ++ + +    E  K  +E    + +V+ ++ YKR +++I+   +L+    D E+ E+A+ EL   +   +  E E+K+LLLPKDPNDDK+VI+E+R   GGDE+++F GDLF  Y R+A++  W+V+++   ES  G GF  +   + GE V++K+K+ESG HRVQRVP TE++GR+HTS  TVA++PE E+V++ IN +DLKID YR+SGAGGQH+N T+SAVRITH+PTG  VACQE +SQI+NR  AMK+L+ ++ +   +E    ++  RK QVG+G+R+E+IRTYN+PQ R+TDHRI LTL +LD +M G+++EI D+L +H +   +Q
  S:     2 LFDKIEELERRYQEL-EALLSDPVVLGNQPEFRKLSREHFDLSALVQAYRNYKRIISEIEGNRELLA---DPEMKEMAEAELESLEKQRDALESEIKLLLLPKDPNDDKSVILEIRAGTGGDEAALFAGDLFRMYSRFAETNRWRVEVISSSESEKG-GFKEVVASVEGEGVFAKLKYESGTHRVQRVPETEAQGRIHTSACTVAIMPEAEDVDIDINPTDLKIDVYRSSGAGGQHVNTTDSAVRITHLPTGTVVACQEERSQIKNRAKAMKVLKTRILDNILQEQNAKLAADRKQQVGSGDRSERIRTYNFPQGRMTDHRIGLTLYRLDAIMAGDIAEIADALRAHYQMEALQ 350
>gi|163739713|ref|ZP_02147121.1| peptide chain release factor 1 [Phaeobacter gallaeciensis BS107] >gi|161386943|gb|EDQ11304.1| peptide chain release factor 1 [Phaeobacter gallaeciensis BS107] (351 aa)
Score = 779, Expect = 6.3e-81, Identities = 157/329 (47%), Positives = 231/329 (70%)
  Q:    28 EGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           EG++   ++ + K   +  P+ E+   Y+R L D++ AE+++    D ++ ELA+ EL + +  + + E+ L++ LLP+D  D +  ++E+RP  GGDE+++F GDL   Y+RYA++ GW  +++E Q +   G   +   + GENV++++K+ESGVHRVQRVP TES GR+HTS  TVAVLPE E+V+L I+  DL+IDT RASGAGGQH+N T+SAVRITHIPTGI V   E KSQ  NRE AM+++R +L++ + +      S  R  QVG+G+R+E+IRTYN+PQ R++DHRINLTL KLD +M G+L EIID+L + D+A  + E
  S:    23 EGVAGADIAALAKEYSDLRPVAEQITAYRRLLCDLEEAEQMLA---DPDMAELAEEELPQLRAALPEAEHALQLALLPRDEADARPAMLEIRPGTGGDEAALFAGDLLRMYQRYAEARGWGFEIIEEQTTELGGLKEVVAHVKGENVFARLKYESGVHRVQRVPVTESGGRIHTSAATVAVLPEAEDVDLRIDPGDLRIDTMRASGAGGQHVNTTDSAVRITHIPTGIIVVSSE-KSQHRNREIAMQVMRTRLYDLERQRIDSERSADRASQVGSGDRSERIRTYNFPQGRMSDHRINLTLYKLDQIMQGDLDEIIDALTADDQARLLAE 348
>gi|167038767|ref|YP_001661752.1| peptide chain release factor 1 [Thermoanaerobacter sp. X514] >gi|166853007|gb|ABY91416.1| peptide chain release factor 1 [Thermoanaerobacter sp. X514] (356 aa)
Score = 779, Expect = 6.4e-81, Identities = 179/353 (50%), Positives = 265/353 (75%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGLSVKRMSEINKSIKETTPI---VEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGFISFMIN--GENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQEAKI 359
           + + L ++E+++ +L++++    + +  ++E  K +KE   I   V K++EYK+ L DI++ ++L+ S  D E+ E+A+ ELS+ +   EK   E+K+LL+PKDPND+KNVI+E+R  AGG+E+++F  DLF  Y  YA+  GWKV+++   E+  G GF   ++N  G+  YS++K+ESGVHRVQRVP TE+ GR+HTST TVAVLPE+EEV++ IN +D+K+D +R+ G GGQ +N T+SAVR+THIPTGI V CQ+ +SQI+NRE A+K+LRAKL+E   +E ++ I++ RK QVGTGER+E+IRTYNYPQ RVTDHRI LTL +L  V+ G+L EIID+LI +D+A K++   +
  S:     1 MIDKLQAIEDRYVELSQKISDPNI-ISNVNEWRKYVKEHAAIEDIVLKYREYKKVLEDIEATKELL-SSNDEELKEMAEEELSQLEEKKEKLLEEIKILLIPKDPNDEKNVIMEIRAGAGGEEAALFAHDLFRMYSMYAEKKGWKVEIMSSNETDIG-GFKEVILNISGKGSYSRLKYESGVHRVQRVPTTEAGGRIHTSTATVAVLPEVEEVDVEINPNDIKVDVFRSGGHGGQSVNTTDSAVRVTHIPTGIVVTCQDERSQIQNRERALKILRAKLYEMALQEQQREIAETRKSQVGTGERSERIRTYNYPQGRVTDHRIGLTLYRLQEVLDGDLDEIIDALILNDQAEKLKNMNL 355
>gi|120555272|ref|YP_959623.1| peptide chain release factor 1 [Marinobacter aquaeolei VT8] >gi|166223568|sp|A1U367|RF1_MARAV Peptide chain release factor 1 (RF-1) >gi|120325121|gb|ABM19436.1| bacterial peptide chain release factor 1 (bRF-1) [Marinobacter aquaeolei VT8] (363 aa)
Score = 779, Expect = 6.7e-81, Identities = 164/341 (48%), Positives = 244/341 (71%)
  Q:    11 LLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGFISFM--INGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           L  + E+F ++N  L    +  +  +  ++++   E  P+V+ F+ ++++L DID+A +L K + D ++ E+A+ EL+  +   E+ + EL+ L+LPKDPND KNV +E+R   GGDE++IF GDLF  Y RYA+   W+V++L   E  HG GF   +  ++G+ VY  +KFESG HRVQRVP TES+GR+HTS  TVAV+PE +E E V IN +DL++DT+R+SGAGGQH+NKT+SA+RITH+PTGI V CQE +SQ +NR  A+ +L ++L   + E+ +K++++ RK  VG+G+R+E+IRTYN+PQ RVTDHRINLTL KLD V+ G+L  ++  L    +A
  S:     9 LEQLVERFEEVNALLSDASVIANQDKFRDLSREFAEIEPVVKCFQAWRQSLEDIDAATELAK-DGDADMREMAEEELASARARSEELDEELQRLMLPKDPNDTKNVFLEIRAGTGGDEAAIFAGDLFRMYSRYAEKRRWQVEVLSENEGEHG-GFKEIIARLSGDGVYGTLKFESGAHRVQRVPETESQGRIHTSACTVAVMPEADEAEAVEINKADLRVDTFRSSGAGGQHVNKTDSAIRITHLPTGIVVECQEERSQHKNRAKALSLLASRLQNAELEKQQKSMAETRKSLVGSGDRSERIRTYNFPQGRVTDHRINLTLYKLDEVIAGDLDAVVVPLQQEHQA 352
>gi|72080478|ref|YP_287536.1| peptide chain release factor 1 [Mycoplasma hyopneumoniae 7448] >gi|119361561|sp|Q4A8M6|RF1_MYCH7 Peptide chain release factor 1 (RF-1) >gi|71913602|gb|AAZ53513.1| peptide chain release factor RF-1 [Mycoplasma hyopneumoniae 7448] (361 aa)
Score = 779, Expect = 6.8e-81, Identities = 173/346 (50%), Positives = 258/346 (74%)
  Q:     5 EKLYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQES-SHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEE-VELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDE 350
           +K++NSL+ + +K+ DL + LET+ +    K+  +I K I   T I+E F+++      ++ A+ ++  E D E+I+LA++E++     IE+YE +L +L+LPKD ND+K+VIVE+R AAGGDE++IFVGDLF  Y ++ADS   KVK+L    + + G+  I F I+G+ +YSK+KFESGVHRVQRVPATE+ GR+HTST TV V+P+++E +E+ IN SDLKIDTYR+SGAGGQ +N T+SAVRITHIPTGI V  Q+ +SQI N+E AM +L++K++  + ++ ++  SD RK   G+G R+EKIRTYNYPQ+R+TDHRIN +   L  ++ G+L+ II++L++ ++
  S:     3 KKMFNSLMKIHQKYQDLKQLLETDQILNDQKQYLQIAKEIASITEIIEVFQKFLDDQKVLEDAKTILIQEDDPELIQLAKVEIATMSKNIEEYEKKLLILMLPKDKNDEKDVIVEIRGAAGGDEANIFVGDLFKMYHKWADSQKAKVKVLSSSLALAGGFSQIIFQISGQKIYSKLKFESGVHRVQRVPATETMGRIHTSTATVTVMPKIDEKIEIEINPSDLKIDTYRSSGAGGQSVNTTDSAVRITHIPTGIVVTSQDERSQIGNKEIAMGILKSKIYNLELQKQQQKQSDFRK-LAGSGARSEKIRTYNYPQDRLTDHRINFS-TSLKPIIQGSLNPIIEALLAQEK 350
>gi|187925494|ref|YP_001897136.1| peptide chain release factor 1 [Burkholderia phytofirmans PsJN] >gi|187716688|gb|ACD17912.1| peptide chain release factor 1 [Burkholderia phytofirmans PsJN] (360 aa)
Score = 778, Expect = 8.1e-81, Identities = 159/341 (46%), Positives = 241/341 (70%)
  Q:    11 LLSMEEKFNDLNKELETEGLS--VKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEV-ELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           L  +  +  +LN  L  E ++  + +  ++ +   E  P+V+ +  +++ +ND  +A++L+    D  + + A+ E+   +  +EK   EL+ +LLPKDPNDD+N+ +E+R   GGDES++F GDL   Y R+A+   W+V+M+   ES   GY  +   I GE  YSK+KFESG HRVQRVPATE++GR+HTS  TVAV+PE +E+ E+ IN +DL+IDT+RASGAGGQHINKT+SAVR+TH+PTGI V CQ+ +SQ +N++ A+K+L A++ +K+  E +   +  RK  +G+G+R+E+IRTYN+PQ R+TDHRINLTL +LD +M G+L E+I +L+S  +A
  S:     9 LDQLTTRLAELNDLLSREDITSNLDQYRKLTREHAELGPVVDHYALWRQAMNDATTAQELLA---DASMRDFAEDEIRAARERMEKLGAELQKMLLPKDPNDDRNIFLEIRAGTGGDESALFAGDLLRMYLRFAERNRWQVEMMSASESDLGGYKEVIVRIAGEAAYSKLKFESGGHRVQRVPATETQGRIHTSACTVAVMPEADEIGEVEINPADLRIDTFRASGAGGQHINKTDSAVRVTHLPTGIVVECQDDRSQHKNKDRALKVLAARIKDKQSHEQQAKEAATRKSLIGSGDRSERIRTYNFPQGRLTDHRINLTLYRLDAIMDGDLDELIAALVSEHQA 350
>gi|153007050|ref|YP_001381375.1| peptide chain release factor 1 [Anaeromyxobacter sp. Fw109-5] >gi|166223527|sp|A7HI45|RF1_ANADF Peptide chain release factor 1 (RF-1) >gi|152030623|gb|ABS28391.1| peptide chain release factor 1 [Anaeromyxobacter sp. Fw109-5] (372 aa)
Score = 778, Expect = 8.7e-81, Identities = 157/356 (44%), Positives = 250/356 (70%)
  Q:     2 IYNEKLYNSLLSMEEKFNDLNKELETEGLSVK--RMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQEA 357
           + ++++   L ++E++F +L   L    ++    R  +++K      P VE  + Y++ + DI   E L++ EKD ++ E+A+ EL++ +P ++  E +LK+ L+PKDP D+K+VI+E+R  AGGDE+ +F  +L   Y RYA+  GW+ ++ +    +  G   ++  I G++VYS +KFESGVHRVQRVPATE++GR+HTST+TVAV+PE E++++ ++ +D+++D +R++G+GGQ +N T+SAVR+TH PTGI V CQ+ KSQ++NR  AM+MLRAKL+E + E  R      RK QVGTG+R+EKIRTYN+PQ+R+TDHRIN T + L  VM G++ ++ID+  +   A  ++EA
  S:     1 MLSQEVLKKLEAIEQRFEELTALLSDPSVASNGDRFRKVSKERASLEPTVEALRAYRKLVTDIGDNEALLE-EKDPDLREMAKEELAQLRPQVDPAEEQLKLYLVPKDPADEKDVILEIRAGAGGDEAGLFAAELLRMYLRYAERRGWRTEVADTSAGNLGGVKDVTVNIAGDSVYSWLKFESGVHRVQRVPATEAQGRIHTSTVTVAVMPEAEDIDIQVSPADIEMDVFRSTGSGGQSVNTTDSAVRLTHKPTGIIVKCQQEKSQLKNRNMAMRMLRAKLYEIELERQRSARDAARKSQVGTGDRSEKIRTYNFPQDRLTDHRINYTRHNLPAVMDGDVQDVIDACRTFYAAQALREA 358
>gi|163750755|ref|ZP_02157990.1| peptide chain release factor 1 [Shewanella benthica KT99] >gi|161329450|gb|EDQ00444.1| peptide chain release factor 1 [Shewanella benthica KT99] (361 aa)
Score = 778, Expect = 9.0e-81, Identities = 164/318 (51%), Positives = 229/318 (72%)
  Q:    34 RMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGF--ISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           R   ++K   +   +V  FK +++   D+D+A++++ SE D EI ++AQ E+ E K LI+K E EL++LLLPKDPNDD N  VE+R  AGGDE++IF GDL+  Y RY +S  W+ +++   E  HG GF  I   ++GE VY ++KFESG HRVQRVP TES+GRVHTS  TVAVL E+ E E + IN +DLK+DT+RASGAGGQH+NKT+SA+R+THIP+GI V CQ+ +SQ +NR  AM +L A++   ++E+ R      R+  VG+G+R+E+IRTYNYPQ RV+DHRINLTL +L+ +M G L  +I  L+  ++A
  S:    34 RFRALSKEYSQLEDVVAAFKGFQQATEDLDAAKEML-SENDPEIKQMAQEEMKEAKSLIKKLEDELQILLLPKDPNDDNNAFVEIRAGAGGDEAAIFAGDLYRMYSRYFESNRWQTEIMNANEGEHG-GFKEIIIKVSGEGVYGRLKFESGGHRVQRVPETESQGRVHTSACTVAVLVEVPEAEAIKINPADLKVDTFRASGAGGQHVNKTDSAIRLTHIPSGIVVECQDQRSQHKNRAQAMSVLTARIQAVEDEKRRSVEETTRRNLVGSGDRSERIRTYNYPQGRVSDHRINLTLYRLNEIMEGELDVLIVPLMQENQA 352
>gi|153809900|ref|ZP_01962568.1| hypothetical protein RUMOBE_00281 [Ruminococcus obeum ATCC 29174] >gi|149834078|gb|EDM89158.1| hypothetical protein RUMOBE_00281 [Ruminococcus obeum ATCC 29174] (359 aa)
Score = 777, Expect = 9.5e-81, Identities = 172/350 (49%), Positives = 256/350 (73%)
  Q:     5 EKLYNSLLSMEEKFNDLNKELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           +KL + L+  EE  N+L +   T+  + +R  ++ K   E  PIV+ +KEYK     I  +  +++ EKD E+ E+ + ELS+ K  +E+ E ELK+LLLPKDPND KNVIVE+R  AGGDE+++F  +++  Y +YA+S  WK +M+ + E+   G+  ++FMI G+  YS++K+ESGVHRVQRVP TES GR+HTST TVA++PE EE++  ++ +D K D +RASG GGQ +N T+SAVR+THIPTGI ++CQ+ KSQ++N++ A+K+LR++L+E +  +     ++ R+ Q+GTG+R+EKIRTYN+PQ RVTDHRI LTL++LD V+ G+L EI+DSLI+ D+A K+
  S:     3 DKLEDLLVRFEEVLNELGEPGVTD--NQERFQKLMKEQSELQPIVDAYKEYKDNKETIQDSLSMLEEEKDEEMREMLKEELSDAKKRVEELEKELKILLLPKDPNDSKNVIVEIRAGAGGDEAALFAAEIYRMYVKYAESRRWKTEMMSLNENGIGGFKEVTFMIQGQGAYSRLKYESGVHRVQRVPETESGGRIHTSTCTVAIMPEAEEIDFHLDMNDCKFDVFRASGNGGQCVNTTDSAVRLTHIPTGIVISCQDEKSQLKNKDKALKVLRSRLYEMELAKQHDAEAEARRSQIGTGDRSEKIRTYNFPQGRVTDHRIKLTLHRLDAVLGGDLDEILDSLIAADQAAKL 351
>gi|169832291|ref|YP_001718273.1| peptide chain release factor 1 [Candidatus Desulforudis audaxviator MP104C] >gi|169639135|gb|ACA60641.1| peptide chain release factor 1 [Candidatus Desulforudis audaxviator MP104C] (355 aa)
Score = 777, Expect = 9.7e-81, Identities = 168/349 (48%), Positives = 248/349 (71%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQ 355
           ++  L  +E K+ +LN+ +    +    +R     KS  E   +V  ++EYKR   ++D A ++++ E+D E+ ELA+ E+   +   ++    L+VLLLPKDPND+KNVI+E+R   GG+E+++F GDL   Y RYA+  GW+ +ML V E+   G      ++ G   YS++KFESGVHRVQRVPATES GR+HTS  TVAVLPE EEV++ I   DL+ID + ++G GGQ +N T+SAVR+TH+P+GI V+CQ+ KSQ +NR+ AMK+LRA+L +K ++E ++ I+  RK QVGTG+R+E+IRTYN+PQNRVTDHR+NLTL +L+ V+ G+L E + +LI+ D+A K++
  S:     1 MFAKLDHLEAKYEELNRLISDPVVIQDQERWRGYVKSHAEIGEVVAVYREYKRVAAEMDDARQMLREEQDAELRELAESEVEVLRERSDELRRRLRVLLLPKDPNDEKNVIIEIRAGTGGEEAALFAGDLLRMYLRYAERRGWRAEMLNVNETDLGGIKEAIVLLEGRGAYSELKFESGVHRVQRVPATESGGRIHTSAATVAVLPEAEEVDVEIRPEDLRIDVFCSTGPGGQSVNTTQSAVRVTHLPSGIVVSCQDEKSQHKNRDKAMKVLRARLLDKAQQEQQERIASSRKTQVGTGDRSERIRTYNFPQNRVTDHRLNLTLYRLEEVLQGDLHEFVSALITSDQAEKLK 352
>gi|70732476|ref|YP_262238.1| peptide chain release factor 1 [Pseudomonas fluorescens Pf-5] >gi|119361580|sp|Q4K695|RF1_PSEF5 Peptide chain release factor 1 (RF-1) >gi|68346775|gb|AAY94381.1| peptide chain release factor 1 [Pseudomonas fluorescens Pf-5] (360 aa)
Score = 777, Expect = 9.8e-81, Identities = 168/348 (48%), Positives = 241/348 (69%)
  Q:     7 LYNSLLSMEEKFNDLNKEL-ETEGLSVK-RMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           L + L  ++++F +L   L + E +S + +    +K   E  PIV  +K+  +   D++ A+ L+K + D ++ E+A  E+ E K  + + E  L+ +LLPKDPND +NV +E+R   GGDE++IF GDLF  Y RYA+  GW++++L   E  HG Y  +   + GE+VY K+KFESG HRVQRVPATES+GR+HTS  TVAVLPE +E E + IN +DL+IDTYR+SGAGGQH+NKT+SA+RITHIP+GI V CQE +SQ +NR  AM  L AKL +++       I+  RK  VG+G+R+E+IRTYN+PQ RVTDHRINLTL  LD ++ G +  +I+ L++  +A ++
  S:     5 LLSKLDILQDRFEELTALLGDAEVISDQAKFRAYSKEYAEVEPIVATYKQVLKVQADLEGAQALLK-DNDPDLREMAAEEVREAKEQLAELESSLQRMLLPKDPNDGRNVFLEIRAGTGGDEAAIFSGDLFRMYSRYAERRGWRLEILSENEGEHGGYKEVIARVEGESVYGKLKFESGAHRVQRVPATESQGRIHTSACTVAVLPEPDEQEAIEINPADLRIDTYRSSGAGGQHVNKTDSAIRITHIPSGIVVECQEERSQHKNRARAMSWLSAKLNDQQTSAAANAIASERKLLVGSGDRSERIRTYNFPQGRVTDHRINLTLYSLDEILAGGVEAVIEPLLAEYQADQL 355
>gi|148378145|ref|YP_001252686.1| peptide chain release factor 1 [Clostridium botulinum A str. ATCC 3502] >gi|153932228|ref|YP_001382546.1| peptide chain release factor 1 [Clostridium botulinum A str. ATCC 19397] >gi|153936703|ref|YP_001386098.1| peptide chain release factor 1 [Clostridium botulinum A str. Hall] >gi|166223548|sp|A7FQG2|RF1_CLOB1 Peptide chain release factor 1 (RF-1) >gi|166223549|sp|A5HY35|RF1_CLOBH Peptide chain release factor 1 (RF-1) >gi|148287629|emb|CAL81694.1| peptide chain release factor 1 [Clostridium botulinum A str. ATCC 3502] >gi|152928272|gb|ABS33772.1| peptide chain release factor 1 [Clostridium botulinum A str. ATCC 19397] >gi|152932617|gb|ABS38116.1| peptide chain release factor 1 [Clostridium botulinum A str. Hall] (358 aa)
Score = 777, Expect = 1.2e-80, Identities = 165/343 (48%), Positives = 249/343 (72%)
  Q:    14 MEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           +E K+ +L+ ++    +  + K   ++ K   +   IV  ++EYK+   D++S ++++K E D E+ E+AQ E+ E    +E  E EL +LLLPKDPNDDK+V +E+R  AGG+E+++F  +L   Y RYA+   WKV+ + +  +   G+  ++  + G+  YS++K+ESGVHRVQRVP TES GR+HTST TVAVLPE+++V++ IN +DL+ID YRASG GGQ +N T+SAVRITH+PTG+ V CQ+ KSQ++N+E AMK+L+A+L+E  E E   +I++ RK QVGTG+R+E+IRTYNYPQ R+TDHRI LTL KL+  + G++ E I++L++ D+A KM++
  S:     8 IENKYEELSNKISDPSVMANQKEWQKLCKEHADLEIIVNTYREYKKAQEDLESDKEMLKEESDKELREMAQEEIKELTLKLEDLERELTILLLPKDPNDDKDVFIEIRAGAGGEEAALFASNLLRMYTRYAERKNWKVETISLNATDIGGFKEVTVAVKGKGAYSRLKYESGVHRVQRVPDTESSGRIHTSTATVAVLPEVDDVDININANDLRIDVYRASGHGGQCVNTTDSAVRITHLPTGLVVTCQDEKSQLKNKEKAMKVLKARLFEAAEAERAASIAEDRKSQVGTGDRSERIRTYNYPQGRITDHRIGLTLYKLETFLDGDIDEAIEALVTEDQAEKMKD 353
>gi|83859678|ref|ZP_00953198.1| peptide chain release factor 1 [Oceanicaulis alexandrii HTCC2633] >gi|83852037|gb|EAP89891.1| peptide chain release factor 1 [Oceanicaulis alexandrii HTCC2633] (357 aa)
Score = 775, Expect = 1.6e-80, Identities = 168/318 (52%), Positives = 232/318 (72%)
  Q:    37 EINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGN-LSEIIDSLISHDEAVKM 354
           +++K   E   + EK +E K      + AE +I+   D +++ELA+ E  E K  +   E EL++LL+PKD +DD ++++E+R   GGDE+++F GDLF  Y+RYA + GWKV ++E  E+   GY  I   ++G+ V+ KMKFESGVHRVQRVP TES GR+HTS  TVAVLPE E VE+ I + D++IDT RASGAGGQH+NKTESAVR+THIPTGI V   E KSQ +NR  AM++L+A+L+EK+  E  +  +  RKGQVG+G+R+E+IRTYN+PQ RV+DHRINLTL KLD ++ G+ L E+ID+L+S D+A K+
  S:    33 KLSKEHAELKLVAEKARELKTARESFEEAEAIIEDGSDRDMVELAEEERQELKKRLPGLERELQLLLIPKDRDDDASIMLEIRAGTGGDEAALFAGDLFRMYERYASNHGWKVDVVEASEAEVGGYKEIVASVSGKGVFGKMKFESGVHRVQRVPVTESGGRIHTSAATVAVLPEPENVEIDIKDEDIRIDTMRASGAGGQHVNKTESAVRMTHIPTGIVVVSSE-KSQHQNRAIAMQVLKARLYEKERREKDEARAAERKGQVGSGDRSERIRTYNFPQGRVSDHRINLTLYKLDEILSGDALDEVIDALLSEDQAAKL 351
>gi|170696251|ref|ZP_02887383.1| peptide chain release factor 1 [Burkholderia graminis C4D1M] >gi|170138811|gb|EDT07007.1| peptide chain release factor 1 [Burkholderia graminis C4D1M] (360 aa)
Score = 775, Expect = 1.6e-80, Identities = 160/341 (46%), Positives = 242/341 (70%)
  Q:    11 LLSMEEKFNDLNKELETEGLS--VKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEV-ELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           L  +  +  +LN  L  E ++  + +  ++ +   E  P+VE++  +++ ++D  +A++L+    D  + E A+ E+   +  +E+   EL+ +LLPKDPNDD+N+ +E+R   GGDES++F GDL   Y RYA+   W+V+M+   ES   GY  +   I GE  YSK+KFESG HRVQRVPATE++GR+HTS  TVAV+PE +E+ E+ IN +DL+IDT+RASGAGGQHINKT+SAVR+TH+PTGI V CQ+ +SQ +N++ A+K+L A++ +K+  E +   +  RK  +G+G+R+E+IRTYN+PQ R+TDHRINLTL +LD +M G+L E+I +L+S  +A
  S:     9 LDQLTTRLAELNDLLSREDITSNLDQYRKLTREHAELGPVVEQYALWRQAMHDAATAQELLT---DISMREFAEEEIRAARERMEQLGGELQKMLLPKDPNDDRNIFLEIRAGTGGDESALFAGDLLRMYLRYAERNRWQVEMMSASESDLGGYKEVIVRIAGEAAYSKLKFESGGHRVQRVPATETQGRIHTSACTVAVMPEADEIGEVEINPADLRIDTFRASGAGGQHINKTDSAVRVTHLPTGIVVECQDDRSQHKNKDRALKVLAARIKDKQSHEQQAKEAATRKSLIGSGDRSERIRTYNFPQGRLTDHRINLTLYRLDAIMDGDLDELISALVSEHQA 350
>gi|71893491|ref|YP_278937.1| peptide chain release factor 1 [Mycoplasma hyopneumoniae J] >gi|119361562|sp|Q4AAJ5|RF1_MYCHJ Peptide chain release factor 1 (RF-1) >gi|71851618|gb|AAZ44226.1| peptide chain release factor RF-1 [Mycoplasma hyopneumoniae J] (361 aa)
Score = 775, Expect = 1.7e-80, Identities = 172/346 (49%), Positives = 258/346 (74%)
  Q:     5 EKLYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQES-SHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEE-VELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDE 350
           +K++NSL+ + +K+ DL + LET+ +    K+  +I K I   + I+E F+++      ++ A+ ++  E D E+I+LA++E++     IE+YE +L +L+LPKD ND+K+VIVE+R AAGGDE++IFVGDLF  Y ++ADS   KVK+L    + + G+  I F I+G+ +YSK+KFESGVHRVQRVPATE+ GR+HTST TV V+P+++E +E+ IN SDLKIDTYR+SGAGGQ +N T+SAVRITHIPTGI V  Q+ +SQI N+E AM +L++K++  + ++ ++  SD RK   G+G R+EKIRTYNYPQ+R+TDHRIN +   L  ++ G+L+ II++L++ ++
  S:     3 KKMFNSLMKIHQKYQDLKQLLETDQILNDQKQYLQIAKEIASISEIIEVFQKFLDDQKVLEDAKTILIQEDDPELIQLAKVEIATMSKNIEEYEKKLLILMLPKDKNDEKDVIVEIRGAAGGDEANIFVGDLFKMYHKWADSQKAKVKVLSSSLALAGGFSQIIFQISGQKIYSKLKFESGVHRVQRVPATETMGRIHTSTATVTVMPKIDEKIEIEINPSDLKIDTYRSSGAGGQSVNTTDSAVRITHIPTGIVVTSQDERSQIGNKEIAMGILKSKIYNLELQKQQQKQSDFRK-LAGSGARSEKIRTYNYPQDRLTDHRINFS-TSLKPIIQGSLNPIIEALLAQEK 350
>gi|119477466|ref|ZP_01617657.1| peptide chain release factor 1 [marine gamma proteobacterium HTCC2143] >gi|119449392|gb|EAW30631.1| peptide chain release factor 1 [marine gamma proteobacterium HTCC2143] (361 aa)
Score = 775, Expect = 1.7e-80, Identities = 160/317 (50%), Positives = 234/317 (73%)
  Q:    38 INKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEV-ELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           ++K   E  P+V+ ++ Y +TL+DI+ A+ L+K + D ++ E+AQ ELS  +   +    EL+ LLLP+DPND  NV +E+R   GGDE++IF GDLF  Y RYA++ GWK++++  +   HG Y  +   ++G++VY+ +KFESG HRVQRVP TES+GRVHTS  TVA++PE++ V E+ IN SDL+IDT+RASGAGGQH+NKT+SA+RITHIP+G+ V CQ+ +SQ +N+  AM +L+++L    +++ ++  SD R+  VG+G+R+E+IRTYNYPQ RVTDHRINLTL KL  VM G L ++ID L +  +A ++
  S:    38 LSKEYAEVEPVVKCYENYCQTLDDIEEAKSLLK-DGDADMREMAQEELSGAQSQRDVMMEELQRLLLPRDPNDSHNVFLEIRAGTGGDEAAIFSGDLFRMYTRYAENKGWKIEIISERSGDHGGYKELISRVSGQDVYAHLKFESGAHRVQRVPETESQGRVHTSACTVAIMPEVDSVDEVEINKSDLRIDTFRASGAGGQHVNKTDSAIRITHIPSGLVVECQDERSQHKNKARAMSLLQSRLLTGIQDKQQQEQSDERRSLVGSGDRSERIRTYNYPQGRVTDHRINLTLYKLAEVMEGALGDVIDPLRNEYQADQL 355
>gi|15642178|ref|NP_231810.1| peptide chain release factor 1 [Vibrio cholerae O1 biovar eltor str. N16961] >gi|147674456|ref|YP_001217695.1| peptide chain release factor 1 [Vibrio cholerae O395] >gi|153213234|ref|ZP_01948646.1| peptide chain release factor 1 [Vibrio cholerae 1587] >gi|153223504|ref|ZP_01953906.1| peptide chain release factor 1 [Vibrio cholerae MAK 757] >gi|153801649|ref|ZP_01956235.1| peptide chain release factor 1 [Vibrio cholerae MZO-3] >gi|153818801|ref|ZP_01971468.1| peptide chain release factor 1 [Vibrio cholerae NCTC 8457] >gi|153823572|ref|ZP_01976239.1| peptide chain release factor 1 [Vibrio cholerae B33] >gi|153825583|ref|ZP_01978250.1| peptide chain release factor 1 [Vibrio cholerae MZO-2] >gi|153828626|ref|ZP_01981293.1| peptide chain release factor 1 [Vibrio cholerae 623-39] >gi|172047628|sp|A5F696|RF1_VIBC3 Peptide chain release factor 1 (RF-1) >gi|20139356|sp|Q9KQ25|RF1_VIBCH Peptide chain release factor 1 (RF-1) >gi|9656733|gb|AAF95324.1| peptide chain release factor 1 [Vibrio cholerae O1 biovar El Tor str. N16961] >gi|124116034|gb|EAY34854.1| peptide chain release factor 1 [Vibrio cholerae 1587] >gi|124118142|gb|EAY36885.1| peptide chain release factor 1 [Vibrio cholerae MAK 757] >gi|124122826|gb|EAY41569.1| peptide chain release factor 1 [Vibrio cholerae MZO-3] >gi|126510644|gb|EAZ73238.1| peptide chain release factor 1 [Vibrio cholerae NCTC 8457] >gi|126518907|gb|EAZ76130.1| peptide chain release factor 1 [Vibrio cholerae B33] >gi|146316339|gb|ABQ20878.1| peptide chain release factor 1 [Vibrio cholerae O395] >gi|148875897|gb|EDL74032.1| peptide chain release factor 1 [Vibrio cholerae 623-39] >gi|149740734|gb|EDM54833.1| peptide chain release factor 1 [Vibrio cholerae MZO-2] >gi|150422740|gb|EDN14694.1| peptide chain release factor 1 [Vibrio cholerae AM-19226] (362 aa)
Score = 775, Expect = 1.8e-80, Identities = 154/321 (47%), Positives = 228/321 (71%)
  Q:    34 RMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           +   ++K   +   I + F+ Y++   D+ +AE++ + E D E+ E+AQ E+   K  IE+   EL++LLLPKDPNDD+N  +E+R  AGGDE+ IF GDLF  Y R+A+  GW+++++   E+ HG Y  +   +NG+  Y  +KFESG HRVQRVPATE++GR+HTS  TVAV+PE+ E E+  I  SDLKIDT+R+SGAGGQH+N T+SA+RITH+PTGI V CQ+ +SQ +N+  AM +L A++ + +E +    ISD R+  +G+G+R+++IRTYNYPQ RV+DHRINLT+ +L  VM G++  +ID +I   +A ++
  S:    34 KFRALSKEYSQLEEITQCFQAYQQAKEDLVAAEEMAQ-EDDAEMREMAQDEIKAAKAAIERLTDELQILLLPKDPNDDRNCFLEIRAGAGGDEAGIFAGDLFRMYSRFAEKKGWRIEVMSSSEAEHGGYKEMIAKVNGDGAYGTLKFESGGHRVQRVPATEAQGRIHTSACTVAVMPEIPEAEIPEIKASDLKIDTFRSSGAGGQHVNTTDSAIRITHLPTGIVVECQDERSQHKNKAKAMSVLAARIAQAEESKRAAEISDTRRNLLGSGDRSDRIRTYNYPQGRVSDHRINLTVYRLTEVMEGDMQSLIDPVIHEHQADQL 355
>gi|169633250|ref|YP_001706986.1| peptide chain release factor 1 [Acinetobacter baumannii SDF] >gi|184158674|ref|YP_001847013.1| protein chain release factor A [Acinetobacter baumannii ACICU] >gi|169152042|emb|CAP00926.1| peptide chain release factor 1 [Acinetobacter baumannii] >gi|183210268|gb|ACC57666.1| Protein chain release factor A [Acinetobacter baumannii ACICU] >gi|193077723|gb|ABO12581.2| peptide chain release factor 1 [Acinetobacter baumannii ATCC 17978] (362 aa)
Score = 775, Expect = 2.0e-80, Identities = 161/313 (51%), Positives = 230/313 (73%)
  Q:    33 KRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGFISFM--INGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELE-EVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSL 345
           KR  ++++   + T I E + +Y++   DI++AE ++KS+ D +  ++A+ E+   K L+E+ E +L +L++PKDPND     +E+R   GGDE++IF GDLF  Y +YA+S GW++++L   E  HG GF   +  ++G+ VY ++KFESG HRVQRVPATES+GRVHTS  TVA+LPE++ +  + IN +DL+IDTYRASGAGGQHINKT+SAVRITHIPTG  V CQE +SQ +N+  AM +L ++L   K        S++R+  VG+G+R+E+IRTYNYPQ R+TDHRINLTL KLD +M G+L+E++DSL
  S:    33 KRFRKLSREHSDLTEITEVWGKYRQAEEDIETAE-MMKSDPDFK--DMAEEEIQANKALLEELESQLNILMIPKDPNDSNAAYLEIRAGTGGDEAAIFSGDLFRMYSKYAESQGWRIEVLSENEGEHG-GFKEVICRVDGDGVYGRLKFESGAHRVQRVPATESQGRVHTSACTVAILPEIDVDTNVEINPADLRIDTYRASGAGGQHINKTDSAVRITHIPTGTVVECQEERSQHKNKAKAMALLVSRLENAKRAAADAATSEMRRDLVGSGDRSERIRTYNYPQGRMTDHRINLTLYKLDAIMEGDLTELLDSL 344
>gi|162147699|ref|YP_001602160.1| putative peptide chain release factor 1 [Gluconacetobacter diazotrophicus PAl 5] >gi|187596092|ref|ZP_02982355.1| peptide chain release factor 1 [Gluconacetobacter diazotrophicus PAl 5] >gi|189039975|sp|A9HJ50|RF1_GLUDA Peptide chain release factor 1 (RF-1) >gi|161786276|emb|CAP55858.1| putative peptide chain release factor 1 [Gluconacetobacter diazotrophicus PAl 5] >gi|187491926|gb|EDU29864.1| peptide chain release factor 1 [Gluconacetobacter diazotrophicus PAl 5] (352 aa)
Score = 774, Expect = 2.2e-80, Identities = 160/324 (49%), Positives = 230/324 (70%)
  Q:    28 EGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGFISFMIN--GENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           EGL  +  ++ ++   E  PIV++  E +    +   ++ L+    D E+ ELA+ EL + +  I     ++++ +LP+D  D+++ I+E+RPAAGGDE+++F  +LF AY+RYA   GW+ +++E  ES  G G    + N  G  V++++K+ESGVHRVQRVPATES+GR+HTST+TVAVLPE  +V++ IN+ DL+ID YRASGAGGQH+NKTESAVRITH+PTG+ VA QE KSQ +NR  AMK+L A+L+E++        +  RK QVGTG+R+E+IRTYN+PQ RVTDHRINLT  K+D VM+G   E +D+L   ++A
  S:    23 EGLVGEAFAKASREYAELEPIVDRIGELRLAEQEERQSQALLA---DPEMRELAEAELEDLRARIPVLRQDIRIAMLPRDEADERSAILEIRPAAGGDEAALFAAELFDAYRRYAALRGWRFEIMEFDESELG-GLREGIANITGRGVFARLKYESGVHRVQRVPATESQGRIHTSTVTVAVLPEAGDVDVQINDGDLRIDVYRASGAGGQHVNKTESAVRITHLPTGLVVAMQEEKSQHKNRAKAMKILMARLYERERAAAHATRAADRKSQVGTGDRSERIRTYNFPQGRVTDHRINLTAYKIDRVMMGEFDEFVDALTQDEQA 344
>gi|170761198|ref|YP_001785468.1| peptide chain release factor 1 [Clostridium botulinum A3 str. Loch Maree] >gi|169408187|gb|ACA56598.1| peptide chain release factor 1 [Clostridium botulinum A3 str. Loch Maree] (358 aa)
Score = 774, Expect = 2.3e-80, Identities = 165/342 (48%), Positives = 248/342 (72%)
  Q:    14 MEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQ 355
           +E K+ +L+ ++    +  + K   ++ K   +   IV  ++EYK+   D++S ++++K E D E+ E+AQ E+ E    +E  E EL +LLLPKDPNDDK+V +E+R  AGG+E+++F  +L   Y RYA+   WKV+ + +  +   G+  ++  + G+  YS++K+ESGVHRVQRVP TES GR+HTST TVAVLPE+++V++ IN +DL+ID YRASG GGQ +N T+SAVRITH+PTG+ V CQ+ KSQ++N+E AMK+L+A+L+E  E E   +I++ RK QVGTG+R+E+IRTYNYPQ R+TDHRI LTL KL+  + G++ E I++L++ D+A KM+
  S:     8 IENKYEELSNKISDPSVMANQKEWQKLCKEHADLEIIVNTYREYKKAQEDLESDKEMLKEESDKELREMAQEEIKELTLKLEDLERELTILLLPKDPNDDKDVFIEIRAGAGGEEAALFASNLLRMYTRYAERKNWKVETISLNATDIGGFKEVTVAVKGKGAYSRLKYESGVHRVQRVPDTESSGRIHTSTATVAVLPEVDDVDININANDLRIDVYRASGHGGQCVNTTDSAVRITHLPTGLVVTCQDEKSQLKNKEKAMKVLKARLFEAAEAERAASIAEDRKSQVGTGDRSERIRTYNYPQGRITDHRIGLTLYKLETFLDGDIDEAIEALVTEDQAEKMK 352
>gi|89094907|ref|ZP_01167839.1| peptide chain release factor 1 [Oceanospirillum sp. MED92] >gi|89080864|gb|EAR60104.1| peptide chain release factor 1 [Oceanospirillum sp. MED92] (362 aa)
Score = 774, Expect = 2.6e-80, Identities = 173/345 (50%), Positives = 244/345 (70%)
  Q:    10 SLLSMEEKFNDLNKEL-----ETEGLS-VKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEE-VELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           S+LS  EK +D  +EL     + E +S  ++  E +    E  P+V+ F+ Y +   D++ AE ++ ++ D ++ E+A+ E  E K  IE  E EL++LLLPKDPND +NV +E+R   GGDE++IF GDLF  Y RYA+  GW+V+++   E  HG Y  I   I G NVYS++KFESG HRVQRVP TES+GR+HTS  TVA++ E++E  E+ IN +DL+IDT+RASGAGGQH+NKT+SA+RITHIPTG+ V CQE +SQ +NR  AM +L ++L   +EE     ++  RK  VG+G+R+E+IRTYNYPQ RVTDHRINLTL KL  V+ G L  +++ L++  +A ++
  S:     4 SILSKLEKLSDRYEELAALLSDPEVISDQEKFREYSMEYSELEPVVKAFEAYTQAQEDLEEAEMMM-ADSDPDMREMAKEEYPEVKARIESLEGELQILLLPKDPNDSRNVFLEVRAGTGGDEAAIFAGDLFRMYSRYAEVQGWRVEVVSANEGEHGGYKEIISRIVGTNVYSQLKFESGAHRVQRVPETESQGRIHTSACTVAIMAEMDESAEIEINKADLRIDTFRASGAGGQHVNKTDSAIRITHIPTGVVVECQEERSQHKNRAKAMSLLASRLQAAEEERQAAELASTRKSLVGSGDRSERIRTYNYPQGRVTDHRINLTLYKLQEVISGELQHVVEPLMNEYQAEQL 355
>gi|71736680|ref|YP_273268.1| peptide chain release factor 1 [Pseudomonas syringae pv. phaseolicola 1448A] >gi|119361578|sp|Q48MV4|RF1_PSE14 Peptide chain release factor 1 (RF-1) >gi|71557233|gb|AAZ36444.1| peptide chain release factor 1 [Pseudomonas syringae pv. phaseolicola 1448A] (360 aa)
Score = 774, Expect = 2.6e-80, Identities = 164/348 (47%), Positives = 240/348 (68%)
  Q:     7 LYNSLLSMEEKFNDLNKEL-ETEGLSVK-RMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           L N L  + ++F +L   L + E +S + R    ++   E  P+V  +++  R   D++ A+ L+K + D ++ E+A  E+ E K  + + E +L+ +LLPKDPND +NV +E+R   GGDE++IF GDLF  Y RYA+  GW+V++L   E  HG Y  +   + G++VY K+KFESG HRVQRVP TES+GR+HTS  TVAVLPE +E + + IN +DL++DTYR+SGAGGQH+NKT+SA+RITH+P+GI V CQE +SQ +NR  AM  L AKL +++       I+  RK  VG+G+R+E+IRTYN+PQ RVTDHR+NLTL  LD V+ G +  +I+ L++  +A ++
  S:     5 LLNKLDVLSDRFEELTALLGDAEVISDQTRFRAYSREYAEVEPVVALYQQLIRVQGDLEGAQALLK-DSDPDMREMAVEEVRETKQQLVELEAQLQRMLLPKDPNDGRNVFLEIRAGTGGDEAAIFSGDLFRMYSRYAERRGWRVEILSENEGEHGGYKEVIARVEGDSVYGKLKFESGAHRVQRVPETESQGRIHTSACTVAVLPEPDEQQAIEINPADLRVDTYRSSGAGGQHVNKTDSAIRITHLPSGIVVECQEERSQHKNRARAMSWLSAKLNDQQTSAAANAIASERKLLVGSGDRSERIRTYNFPQGRVTDHRVNLTLYSLDEVLAGGVDAVIEPLLAEYQADQL 355
>gi|149019616|ref|ZP_01834935.1| peptide chain release factor 1 [Streptococcus pneumoniae SP23-BS72] >gi|168483091|ref|ZP_02708043.1| peptide chain release factor 1 [Streptococcus pneumoniae CDC1873-00] >gi|147930991|gb|EDK81971.1| peptide chain release factor 1 [Streptococcus pneumoniae SP23-BS72] >gi|172043551|gb|EDT51597.1| peptide chain release factor 1 [Streptococcus pneumoniae CDC1873-00] (359 aa)
Score = 774, Expect = 2.7e-80, Identities = 170/350 (48%), Positives = 254/350 (72%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIK-SEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           +Y+ L ++E+++ +L + L    +    KR  E++K        V  ++EYK+ L +I  AE++IK S  D ++ ELA+ EL + K   E+YE +LK+LLLPKDPNDDKN+I+E+R AAGGDE+++F GDL + Y++YA++ GW+ +++E   +   G+  +  M++G++VYSK+K+ESG HRVQRVP TES+GRVHTST TV V+PE+EEVE  I+  DL++D Y ASGAGGQ++NK  +AVRI H+PT I V  QE ++Q +NRE AMK++RA++ +   +  +      RK  +GTG+R+E+IRTYN+PQNRVTDHRI LTL KLD ++ G L E++D+L+ +D+  K++E
  S:     3 IYDQLQAVEDRYEELGELLSDPDVVSDTKRFMELSKEEASNRDTVIAYREYKQVLQNIVDAEEMIKESGGDADLEELAKQELKDAKAEKEEYEEKLKILLLPKDPNDDKNIILEIRGAAGGDEAALFAGDLLTMYQKYAEAQGWRFEVMEASMNGVGGFKEVVAMVSGQSVYSKLKYESGAHRVQRVPVTESQGRVHTSTATVLVMPEVEEVEYDIDPKDLRVDIYHASGAGGQNVNKVATAVRIVHLPTNIKVEMQEERTQQKNREKAMKIIRARVADHFAQIAQDEQDAERKSTIGTGDRSERIRTYNFPQNRVTDHRIGLTLQKLDTILSGKLDEVVDALVLYDQTQKLEE 356
>gi|171323817|ref|ZP_02912335.1| peptide chain release factor 1 [Geobacillus sp. WCH70] >gi|171090128|gb|EDT36440.1| peptide chain release factor 1 [Geobacillus sp. WCH70] (358 aa)
Score = 774, Expect = 2.7e-80, Identities = 173/351 (49%), Positives = 255/351 (72%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQEA 357
           ++  L ++EE++  LN+ L    +    K++ + +K   + +  V+ ++EYK     +D A+ +++ + D E+ E+ + E+ E +   E+   +LK+LLLPKDPND+KNVI+E+R AAGG+E+++F GDL+  Y RYA+S GWK +++E   +   GY  I F I G+  YSK+K+E+G HRVQRVP TES GR+HTST TVA LPE+EE+E+ IN  D+++DT+ +SG GGQ +N T SAVR+THIPTGI V CQ+ KSQI+N+E AMK+LRA++++K ++E R      RK  VGTG+R+E+IRTYN+PQNRVTDHRI LT+ KLD V+ GNL EII++LI  D++ K+++A
  S:     1 MFERLEAVEERYEKLNQLLMDPEVINDPKKLRDYSKEQSDLSETVQTYREYKSVRKQLDEAKAMLEEKLDPEMREMVKEEIDELEQKEEELVNKLKILLLPKDPNDEKNVIMEIRAAAGGEEAALFAGDLYRMYTRYAESQGWKTEVIEASPTGLGGYKEIIFTIIGKGAYSKLKYENGAHRVQRVPETESGGRIHTSTATVACLPEMEEIEVEINEKDIRVDTFASSGPGGQSVNTTMSAVRLTHIPTGIVVTCQDEKSQIKNKEKAMKVLRARIYDKYQQEARAEYDQTRKQAVGTGDRSERIRTYNFPQNRVTDHRIGLTIQKLDQVLDGNLDEIIEALILDDQSKKLEQA 354
>gi|85860527|ref|YP_462729.1| peptide chain release factor 1 [Syntrophus aciditrophicus SB] >gi|119361624|sp|Q2LWU9|RF1_SYNAS Peptide chain release factor 1 (RF-1) >gi|85723618|gb|ABC78561.1| bacterial peptide chain release factor 1 (rf-1) [Syntrophus aciditrophicus SB] (357 aa)
Score = 773, Expect = 2.7e-80, Identities = 162/350 (46%), Positives = 249/350 (71%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGLSVKRMSEINKSIKETTPI---VEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGFISFM--INGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           +++ L  +E ++ +L K L ++   V R S   K  KE   +   VE F++Y++    I+ A++L++ + D E+ E+A+ EL E +  +   E  LKVLLLP+D NDD+NV +E+R   GGDE+ +FVGDLF  Y RYA+   WKV+++    SS   GF   +  I G+  YS++K+ESGVHRVQRVP TE++GR+HTS +TVA++PE +EVE+ I+ +DL+ID + +SG GGQ +N T+SAVRITH+PTG+ V+CQ+ KSQ++N+  A+K+LRA+L +   ++    IS+ RK QVG+G+R+E+IRTYN+PQ RVTDHR+ LTL  L+N++ G++ E ID+L ++ +A  +++
  S:     1 MFSKLKEVESRYLELEKLL-SDPTVVTRQSLYQKYAKEHADLRDLVEVFRKYEKVGAAIEEAQQLLRGD-DEELKEIAREELPELRQHLAGLEERLKVLLLPRDLNDDRNVFLEIRAGTGGDEAGLFVGDLFRMYARYAEMRRWKVEVISSTPSSGVGGFKEIIASIAGQGAYSQLKYESGVHRVQRVPVTEAQGRIHTSAVTVAIMPEADEVEVTIDPNDLRIDVFHSSGHGGQSVNTTDSAVRITHLPTGLVVSCQDEKSQLKNKAKALKVLRARLLDIMVKKQSDEISEARKSQVGSGDRSERIRTYNFPQGRVTDHRVGLTLYSLENILGGDIQEFIDALTAYFQAESLKQ 353
>gi|78185965|ref|YP_374008.1| peptide chain release factor 1 [Pelodictyon luteolum DSM 273] >gi|119361573|sp|Q3B6R6|RF1_PELLD Peptide chain release factor 1 (RF-1) >gi|78165867|gb|ABB22965.1| bacterial peptide chain release factor 1 (bRF-1) [Pelodictyon luteolum DSM 273] (358 aa)
Score = 773, Expect = 2.8e-80, Identities = 160/351 (45%), Positives = 240/351 (68%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGLS--VKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGF--ISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQEA 357
           +++ L S++E+  DL + L     +    R   +NK   +   IV+ +  Y      ++ +  + K+E+D E+  +A+ E+ E +  I   E EL++LLLPKD  D +NVI+E+R   GG+E+++F  DL   Y+RYA+  GW+ ++L+  ESS   GF  ++  I+G +VY  +K+ESGVHRVQRVP TE++GR+HTS  +VAVLPE EEV++ I   DL+ DTYR+ G GGQ++NK E+AVRITH PTG+  ACQE +SQ++N+E AMKML AKL++ K +E ++  +D+R+  V +G+R+ KIRTYNYPQ+RVTDHRI  T + L + M G + E+ID+L  HD+  ++QEA
  S:     1 MFDKLQSIKERHLDLERMLADPAAAGDQTRFRRLNKEYSDLKEIVQAYDRYASARQQLEESRHMQKAEEDPEMKAMAREEMLELEERIPGLEQELRILLLPKDEADSRNVIMEIRAGTGGEEAALFAADLMRMYQRYAERQGWRCEVLDYNESSGPGGFREVTLTISGHDVYGTLKYESGVHRVQRVPETETQGRIHTSAASVAVLPEAEEVDVEIRRDDLRFDTYRSGGKGGQNVNKVETAVRITHEPTGLVAACQEERSQLQNKERAMKMLMAKLYDIKLQEQQQERADMRRTMVASGDRSAKIRTYNYPQSRVTDHRIGFTSHGLPHFMQGEIGELIDALKMHDQTERLQEA 355
>gi|94496666|ref|ZP_01303242.1| peptide chain release factor 1 [Sphingomonas sp. SKA58] >gi|94424026|gb|EAT09051.1| peptide chain release factor 1 [Sphingomonas sp. SKA58] (361 aa)
Score = 773, Expect = 3.0e-80, Identities = 160/343 (46%), Positives = 234/343 (68%)
  Q:    14 MEEKFNDLNKELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEK-DNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGF--ISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLG-NLSEIIDSLISHDEAVKMQE 356
           +E + +++   +    L+  +   ++K   E  P+    +E +R   ++ + E +   E+ D  + ++AQ E+   K  +   E  L + LLP+D  D +  ++E+R   GGDE+++F GDLF  Y+RYAD+ GWK++ML    S  G GF  +   ING  V++K+KFESGVHRVQRVP TES GR+HTS  TVAVLPE EEV++ I ++DLKID YRASGAGGQH+N T+SAVRITH+PTGI V  Q+ +SQ +N+  AM++LRA+L+E + E  +   +  RK  VG+G+R+E+IRTYN+PQ RVTDHRINLTL++L  ++ G  LSE+ID+L + DEA ++ +
  S:    11 IEARRDEVQASMTRADLAPDQFVRLSKEYAEIEPVAAAARELRRLRQELAALEMMTGGEEADPAMRDMAQEEMQLLKSQLPAAERALALQLLPRDAADARPAMLEIRAGTGGDEAALFAGDLFRMYQRYADTQGWKMEMLSANASEQG-GFKEVVASINGAGVFAKLKFESGVHRVQRVPVTESGGRIHTSAATVAVLPEPEEVDVQIADADLKIDIYRASGAGGQHVNTTDSAVRITHVPTGIVVTQQDERSQHKNKAKAMQVLRARLYEAERERTQNEQAGARKAMVGSGDRSERIRTYNFPQGRVTDHRINLTLHRLPEILEGPGLSEVIDALTAEDEAARLAQ 356
>gi|66044202|ref|YP_234043.1| peptide chain release factor 1 [Pseudomonas syringae pv. syringae B728a] >gi|75503325|sp|Q4ZXW7|RF1_PSEU2 Peptide chain release factor 1 (RF-1) >gi|63254909|gb|AAY36005.1| Peptide chain release factor 1 [Pseudomonas syringae pv. syringae B728a] (360 aa)
Score = 773, Expect = 3.1e-80, Identities = 164/348 (47%), Positives = 239/348 (68%)
  Q:     7 LYNSLLSMEEKFNDLNKEL-ETEGLSVK-RMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           L N L  + ++F +L   L + E +S + R    ++   E  P+V  + +  R   D++ A+ L+K + D ++ E+A  E+ E K  + + E +L+ +LLPKDPND +NV +E+R   GGDE++IF GDLF  Y RYA+  GW+V++L   E  HG Y  +   + G++VY K+KFESG HRVQRVP TES+GR+HTS  TVAVLPE +E + + IN +DL++DTYR+SGAGGQH+NKT+SA+RITH+P+GI V CQE +SQ +NR  AM  L AKL +++       I+  RK  VG+G+R+E+IRTYN+PQ RVTDHR+NLTL  LD V+ G +  +I+ L++  +A ++
  S:     5 LLNKLDVLSDRFEELTALLGDAEVISDQTRFRAYSREYAEVEPVVALYAQLLRVQGDLEGAQALLK-DSDPDMREMAVEEVRETKQQLVELEAQLQRMLLPKDPNDGRNVFLEIRAGTGGDEAAIFSGDLFRMYSRYAERRGWRVEILSENEGEHGGYKEVIARVEGDSVYGKLKFESGAHRVQRVPETESQGRIHTSACTVAVLPEPDEQQAIEINPADLRVDTYRSSGAGGQHVNKTDSAIRITHLPSGIVVECQEERSQHKNRARAMSWLSAKLNDQQTSAAANAIASERKLLVGSGDRSERIRTYNFPQGRVTDHRVNLTLYSLDEVLAGGVDAVIEPLLAEYQADQL 355
>gi|169795523|ref|YP_001713316.1| peptide chain release factor 1 [Acinetobacter baumannii AYE] >gi|169148450|emb|CAM86316.1| peptide chain release factor 1 [Acinetobacter baumannii] (362 aa)
Score = 773, Expect = 3.1e-80, Identities = 161/313 (51%), Positives = 230/313 (73%)
  Q:    33 KRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGFISFM--INGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELE-EVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSL 345
           KR  ++++   + T I E + +Y++   DI++AE ++KS+ D +  ++A+ E+   K L+E+ E +L +L++PKDPND     +E+R   GGDE++IF GDLF  Y +YA+S GW++++L   E  HG GF   +  ++G+ VY ++KFESG HRVQRVPATES+GRVHTS  TVA+LPE++ +  + IN +DL+IDTYRASGAGGQHINKT+SAVRITHIPTG  V CQE +SQ +N+  AM +L ++L   K        S++R+  VG+G+R+E+IRTYNYPQ R+TDHRINLTL KLD +M G+L+E++DSL
  S:    33 KRFRKLSREHSDLTEITEVWGKYRQAEEDIETAE-MMKSDPDFK--DMAEEEIQANKVLLEELESQLNILMIPKDPNDSNAAYLEIRAGTGGDEAAIFSGDLFRMYSKYAESQGWRIEVLSENEGEHG-GFKEVICRVDGDGVYGRLKFESGAHRVQRVPATESQGRVHTSACTVAILPEIDVDTNVEINPADLRIDTYRASGAGGQHINKTDSAVRITHIPTGTVVECQEERSQHKNKAKAMALLVSRLENAKRAAADAATSEMRRDLVGSGDRSERIRTYNYPQGRMTDHRINLTLYKLDAIMEGDLTELLDSL 344
>gi|86138685|ref|ZP_01057258.1| peptide chain release factor 1 [Roseobacter sp. MED193] >gi|85824745|gb|EAQ44947.1| peptide chain release factor 1 [Roseobacter sp. MED193] (361 aa)
Score = 773, Expect = 3.2e-80, Identities = 168/356 (47%), Positives = 240/356 (67%)
  Q:     1 MIYNEKLYNSLLSMEEKFNDLNKELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           MI  E+L   L    ++F  L   +  EG S   ++ + +   E  P+ E+   Y++ L D++ AE ++    D ++ ELA  E+ E K  +   E  L++ LLPKD  D +  ++E+RP  GGDE+++F GDL   Y+RYA++ GWK +++E Q +   G   +   I GENV+++MK+ESGVHRVQRVP TES GR+HTS  TVAVLPE +EV++ I+ SD++IDT RASGAGGQH+N T+SAVRITHIPTG+ V   E KSQ  NRE AM++LRA+L++ + +      S  R  QVG+G+R+E+IRTYN+PQ R++DHRINLTL KLD +M G+L EIID+L + ++A  + E
  S:    11 MIPEERLEQIL----QRFQYLEAAM-AEGASGAEIANLAREYSEIKPVAEQITAYRQLLTDLEDAEAMLS---DPDMKELAAEEIPELKAALPGAEEALQLALLPKDAADARPAMLEIRPGTGGDEAALFAGDLLRMYQRYAEARGWKFEVIEEQATELGGIKEVVAHIKGENVFARMKYESGVHRVQRVPVTESGGRIHTSAATVAVLPEAQEVDVQIDPSDIRIDTMRASGAGGQHVNTTDSAVRITHIPTGVMVVSAE-KSQHRNREIAMQVLRARLYDLERQRVDSERSADRASQVGSGDRSERIRTYNFPQGRMSDHRINLTLYKLDQIMQGDLDEIIDALTADNQARLLAE 358
>gi|160945367|ref|ZP_02092593.1| hypothetical protein FAEPRAM212_02889 [Faecalibacterium prausnitzii M21/2] >gi|158443098|gb|EDP20103.1| hypothetical protein FAEPRAM212_02889 [Faecalibacterium prausnitzii M21/2] (361 aa)
Score = 773, Expect = 3.2e-80, Identities = 152/319 (47%), Positives = 233/319 (73%)
  Q:    37 EINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKS--EKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG---YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQ 355
           ++ +   +T P+VE +++++  L+ +  A+ L++     D +  ++ Q E+SEK   + K E  LK+LLLPKD ND KNVI+E+R  AGG+E+++F   L   Y  YA + GW +++L + E+  G      IS  ++G   Y+++K+ESGVHRVQRVP TE++GR+HTST TVAV+P+ EEV+  ++  DL+IDT+R+SGAGGQHINKT SA+R+THIPTG  V CQ  +SQ +N++ A+++LR++L  +K++E +  I+  R+GQVGTG+R+EKIRTYN+PQ+R TDHRI LT++ L+ +M GNL E+ID+L + ++  K+Q
  S:    36 KLMREYHDTEPVVEAYRDWQTALDHLAQAKALLEEPGSLDPDFKQMIQQEISEKSQDVAKLENNLKILLLPKDVNDGKNVIMEIRSGAGGEEAALFAHSLLRMYTMYAQNRGWTLELLNLNETELGGVKEAIIS--VDGAGAYNRLKYESGVHRVQRVPETETQGRIHTSTATVAVMPQAEEVDFALDMKDLRIDTFRSSGAGGQHINKTSSAIRVTHIPTGTVVECQNERSQFQNKDKALEILRSRLLAQKQKEQQDAINAQRQGQVGTGDRSEKIRTYNFPQDRCTDHRIGLTVHNLEKIMDGNLDEVIDALATREQTEKLQ 357
>gi|77360001|ref|YP_339576.1| peptide chain release factor 1 [Pseudoalteromonas haloplanktis TAC125] >gi|119361581|sp|Q3IK95|RF1_PSEHT Peptide chain release factor 1 (RF-1) >gi|76874912|emb|CAI86133.1| Peptide chain release factor 1 (RF-1) [Pseudoalteromonas haloplanktis TAC125] (361 aa)
Score = 772, Expect = 4.0e-80, Identities = 167/347 (48%), Positives = 241/347 (69%)
  Q:     5 EKLYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           E +Y+ L  + E++ ++   L    +     R   ++K   +   +V+ F  Y++   D+ SAE+++K + D +I E+AQ E  E K  I   E E++VL+LPKDP D+ NV +E+R   GGDE++IF GDLF  Y RYA++  WKV ++   E  HG Y  I   I+GE V+ ++KFESGVHRVQRVP TES+GRVHTS  TVAV+ E+ E E + IN++DLK+DT+RASGAGGQH+NKT+SA+RITHIPTG+ V CQ+ +SQ +NR  AM +L A+L + ++E+     +  R+  VG+G+R+E+IRTYNYPQ R+TDHRINLTL +L+ V+ G+LS I++ L+   +A
  S:     3 ESVYHKLEILVERYEEVQALLSDPSVIRDQNRFRALSKEYSDLEEVVKTFLSYQQAQQDVISAEEMLK-DSDPDIREMAQEEYKEAKAQILTIEDEIQVLMLPKDPKDNNNVYLEVRAGTGGDEAAIFAGDLFRMYSRYAETKKWKVDVVTTNEGEHGGYKEIIANISGEGVFGQLKFESGVHRVQRVPETESQGRVHTSACTVAVMAEVPEAEAIEINSADLKVDTFRASGAGGQHVNKTDSAIRITHIPTGVVVECQDQRSQHKNRAKAMSVLAARLQQAEDEKRDAAEASERRNLVGSGDRSERIRTYNYPQGRITDHRINLTLYRLNEVVAGDLSCIVEPLMQEHQA 352
>gi|163858862|ref|YP_001633160.1| peptide chain release factor 1 [Bordetella petrii DSM 12804] >gi|163262590|emb|CAP44893.1| peptide chain release factor 1 [Bordetella petrii] (360 aa)
Score = 772, Expect = 4.1e-80, Identities = 153/323 (47%), Positives = 235/323 (72%)
  Q:    32 VKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEV-ELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           ++R  ++++   E  P+V+ F ++ RT +D+ +A++++    D ++  +A+ E+   +  +EK E EL+VLLLP+DPND +++ +E+R   GGDES++F GDL   Y RYA+  GW+V+++    S   GY  +   I+G+  Y ++KFESG HRVQRVPATE++GR+HTS  TVAV+PE + + ++VIN +DL+IDT+RASGAGGQHINKT+SAVRITH+PTG+ V CQ+ +SQ  N++ AM++L A+L +++  E +   +  RK  VG+G+R+E+IRTYN+PQ RVTDHRINLTL KL  +M G+L E+  +LI+  +A ++
  S:    32 MERFRKLSRERAELEPVVQAFAQFARTEDDLATAQEMLA---DPDMKAMAEDEIKTGRERLEKLESELQVLLLPRDPNDGRSLFLEIRAGTGGDESALFSGDLLRMYSRYAEQRGWRVELMSESPSELGGYKEVIARIDGDGAYGRLKFESGAHRVQRVPATEAQGRIHTSACTVAVMPEADAMSDIVINPADLRIDTFRASGAGGQHINKTDSAVRITHLPTGLVVECQDDRSQHRNKDKAMQVLAARLKDRELRERQSKEAAERKSLVGSGDRSERIRTYNFPQGRVTDHRINLTLYKLQQIMEGDLEELTGALIAEHQAEQL 353
>gi|163803585|ref|ZP_02197452.1| peptide chain release factor 1 [Vibrio campbellii AND4] >gi|159172627|gb|EDP57484.1| peptide chain release factor 1 [Vibrio campbellii AND4] (362 aa)
Score = 772, Expect = 4.1e-80, Identities = 154/321 (47%), Positives = 227/321 (70%)
  Q:    34 RMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           +   ++K   +   + + F+ Y++  +D+ +AE +  +E D E+ E+AQ E+ E K  IE+   EL++LLLPKDPNDD+N  +E+R  AGGDE+ IF GDLF  Y +YA+  GW+++++   ES HG Y  +   ++G+  Y  +KFESG HRVQRVPATES+GRVHTS  T+AV+ E+ E +L  I  +DLKIDT+RASGAGGQH+N T+SA+RITH+PTG  V CQ+ +SQ +N+  AM +L A++ + +EE     +SD R+  +G+G+R+++IRTYNYPQ RV+DHRINLTL +L+ VM G+L  +ID ++    A ++
  S:    34 KFRALSKEYSQLEEVTQCFQAYQQAQDDLAAAEDM-ANEDDEEMREMAQEEIKEAKAAIERLTDELQILLLPKDPNDDRNCFLEIRAGAGGDEAGIFAGDLFRMYSKYAEKRGWRIEVMSSNESEHGGYKEMIAKVSGDGAYGVLKFESGGHRVQRVPATESQGRVHTSACTLAVMAEIPEADLPEIKAADLKIDTFRASGAGGQHVNTTDSAIRITHLPTGTVVECQDERSQHKNKAKAMAVLAARIVQAEEERRAAEVSDTRRNLLGSGDRSDRIRTYNYPQGRVSDHRINLTLYRLNEVMEGDLQSLIDPVVQEHHADQL 355
>gi|57505831|ref|ZP_00371756.1| peptide chain release factor 1 [Campylobacter upsaliensis RM3195] >gi|57015861|gb|EAL52650.1| peptide chain release factor 1 [Campylobacter upsaliensis RM3195] (355 aa)
Score = 772, Expect = 4.3e-80, Identities = 174/348 (50%), Positives = 248/348 (71%)
  Q:     9 NSLLSMEEKFNDLNKELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQE-SSHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNL-SEIIDSLISH--DEAVKMQE 356
           N+LLS  +  ND+ K           M+ ++K  K   PIV K K+Y  TL  I+  + L+    D E  ELA+ EL   +     +E E+K+LLLPKDPND+KN+ +E+R   GGDE+S+FVGDL  AY +YAD  G+K++++   E S+ G+  +  ++ G   YS++KFESG HRVQR+P TES+GR+HTS ITVA++PE++++E+ IN +DLKID  R+SG GGQ +N T+SAVRITHIP+G+ V  Q+GKSQ +N+E+AMK+L+A+L+E +E E     S+ RK QVG+G+R+E+IRTYN+PQNR++DHRINLTL +LD +M G L  E+I+ LI+H   EA+K +E
  S:    17 NTLLSDTKIINDIEK-----------MTSLSKEQKNLEPIVLKTKDYFNTLTQIEDNKALLN---DPEFSELAKEELKNLEEEKINFEEEIKILLLPKDPNDEKNIFLEIRAGTGGDEASLFVGDLVKAYAKYADLRGYKIEIVSSSEGSAGGFKELIMLVKGTGAYSRLKFESGTHRVQRIPQTESQGRIHTSAITVAIMPEVDDIEIQINPNDLKIDVMRSSGHGGQSVNTTDSAVRITHIPSGLVVVNQDGKSQHKNKESAMKILKARLYEMQESERLAKESEARKSQVGSGDRSERIRTYNFPQNRISDHRINLTLYRLDAIMEGGLFDELIEPLIAHHQSEALKAEE 354
>gi|67154364|ref|ZP_00416109.1| Peptide chain release factor 1 [Azotobacter vinelandii AvOP] >gi|67088497|gb|EAM07963.1| Peptide chain release factor 1 [Azotobacter vinelandii AvOP] (360 aa)
Score = 772, Expect = 4.5e-80, Identities = 163/348 (46%), Positives = 242/348 (69%)
  Q:     7 LYNSLLSMEEKFNDLNKEL-ETEGLSVK-RMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPEL-EEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           L N L  + +++ +L   L + E ++ + R    +K   E  P+V  ++E+++  +D+  A+ L+K + D ++ E+A  E++E +  +   E  L+ +LLP+DPND +NV +E+R   GGDE++IF GDLF  Y RYA+  GW++++L      HG Y  I   + G+NVY K+KFESG HRVQRVP TES+GR+HTS  TVAVLPE  E+  + IN ++L++DTYR+SGAGGQH+NKT+SA+RITH+PTGI V CQE +SQ +NR  AM  L AKL ++++    + IS+ R+  VG+G+R+E+IRTYN+PQ RVT+HRINLTL  LD VM G +  +I+ L+S  +A ++
  S:     5 LLNKLDLLHDRYEELTALLGDAEVIAEQGRFRAYSKEYAEVEPVVAAYREFRKVRDDLAGAQALLK-DSDPDLREMAAEEVAEARERLAGLEDRLQRMLLPRDPNDARNVFLEIRAGTGGDEAAIFAGDLFRMYSRYAEKQGWRIEILSENPGEHGGYKEIITRVEGDNVYGKLKFESGAHRVQRVPETESQGRIHTSACTVAVLPEPDEQAAIEINPAELRVDTYRSSGAGGQHVNKTDSAIRITHLPTGIVVECQEERSQHKNRAKAMAWLAAKLQDRQDAAAHREISETRRLLVGSGDRSERIRTYNFPQGRVTEHRINLTLYALDEVMAGGVEAVIEPLLSEYQADQL 355
>gi|154482489|ref|ZP_02024937.1| hypothetical protein EUBVEN_00156 [Eubacterium ventriosum ATCC 27560] >gi|149736690|gb|EDM52576.1| hypothetical protein EUBVEN_00156 [Eubacterium ventriosum ATCC 27560] (356 aa)
Score = 771, Expect = 4.8e-80, Identities = 166/348 (47%), Positives = 254/348 (72%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGLSVKRMSEINKSIKETT---PIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           +++ L  + E+++++ ++L    + V   +   K +KE +   PIVE +K YK     ++ +  ++  E D E+ ELA+ E++E K  I + E +LK+LLLPKD NDDKNV+VE+R  AGGDE+++F  +L+  Y  YA++  WK +M+ V E+   G+  + FMING+  YSK+K+ESGVHRVQR+P TES GR+HTST TVA++PE EEV++ I+ +D + D +RASG GGQ +N T+SAVR+THIPTGI ++CQ+ KSQ++N++ A+K+LRA+L+E + ++ +   S+ R+ Q+GTG+R+EKIRTYN+PQ RVTDHRI  T ++LD ++ G+L EIID+ I+ D+A K+
  S:     1 MFDKLDGILERYDEIMEQLNDPNV-VSDQNNFRKLMKEQSDLAPIVEAYKAYKEAKQTVEDSLMILDEESDEEMRELAKEEMNEAKEQITELEEKLKILLLPKDENDDKNVVVEIRGGAGGDEAALFAAELYRMYCMYAETQHWKTEMISVNENGLGGFKEVVFMINGQGAYSKLKYESGVHRVQRIPVTESGGRIHTSTATVAIMPEAEEVDVEIDMNDCRFDVFRASGNGGQCVNTTDSAVRLTHIPTGIVISCQDEKSQLKNKDKALKVLRARLYELECQKKQDAESEARRSQIGTGDRSEKIRTYNFPQGRVTDHRIKFTSHRLDEILNGHLEEIIDNCIAADQAAKL 351
>gi|42521715|ref|NP_967095.1| peptide chain release factor RF-1 [Bdellovibrio bacteriovorus HD100] >gi|61214632|sp|Q6MRK9|RF1_BDEBA Peptide chain release factor 1 (RF-1) >gi|39574245|emb|CAE77749.1| peptide chain release factor RF-1 [Bdellovibrio bacteriovorus HD100] (357 aa)
Score = 771, Expect = 5.0e-80, Identities = 160/350 (45%), Positives = 251/350 (71%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGLSVKRMS--EINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQE-SSHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           +++ L ++E ++ ++N  L+   ++  +     + K +     IV  +++Y++   ++ ++++L+ +E+D E+ EL + E+ E +  +   E +LK+ L+PKDPNDDKN I+E+R  AGGDE+++F  +LF  Y  YA + GWKV+M+   E ++ G   I   I G++V+SKMK+ESGVHRVQRVP TE+ GR+HTST+TVAV+PE+E  E+ I  SD++I+T R+ G+GGQ +N+TESAVR+ H+PTGI V CQEGKSQ  NRE A ++L AKL + ++E+ RK  SD+R  Q+GTG+R+E+IRTYN+PQ R+TDHRI LT+++LD VM G+   +ID LI++ +A  +++
  S:     1 MFSKLDAVESRYEEVNMALQRPDIASNQTQYRALMKELGNLEKIVLVYRDYRKKTENLKASKELLTAEQDAEMRELIREEVKELEAELPDLEQQLKIALIPKDPNDDKNTILEIRAGAGGDEAALFADELFRGYVHYASTQGWKVEMISFSEGNAGGAKEIIASITGDSVFSKMKYESGVHRVQRVPKTEAAGRIHTSTVTVAVIPEVEVSEIKIPMSDVRIETMRSQGSGGQSVNRTESAVRVVHLPTGIDVKCQEGKSQSTNRERAFQILYAKLQQIEDEKARKEASDVRLEQIGTGDRSERIRTYNFPQTRITDHRIGLTIHQLDQVMSGSFELLIDPLIANFQAEALKK 353
>gi|28868324|ref|NP_790943.1| peptide chain release factor 1 [Pseudomonas syringae pv. tomato str. DC3000] >gi|32171519|sp|Q888C1|RF1_PSESM Peptide chain release factor 1 (RF-1) >gi|28851561|gb|AAO54638.1| peptide chain release factor 1 [Pseudomonas syringae pv. tomato str. DC3000] (360 aa)
Score = 771, Expect = 5.0e-80, Identities = 165/348 (47%), Positives = 240/348 (68%)
  Q:     7 LYNSLLSMEEKFNDLNKEL-ETEGLSVK-RMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           L N L  + ++F +L   L + E +S + R    ++   E  P+V  +K+  R   D++ A+ L+K + D ++ E+A  E+ E K  + + E +L+ +LLPKDPND +NV +E+R   GGDE++IF GDLF  Y RYA+  GW+V++L   E  HG Y  +   + G++VY K+KFESG HRVQRVP TES+GR+HTS  TVAVLPE +E + + IN +DL++DTYR+SGAGGQH+NKT+SA+RITH+P+GI V CQE +SQ +NR  AM  L AKL +++       I+  RK  VG+G+R+E+IRTYN+PQ RVTDHR+NLTL  LD V+ G +  +I+ L++  +A ++
  S:     5 LLNKLDVLSDRFEELTALLGDAEVISDQTRFRAYSREYAEVEPVVALYKQLARVQGDLEGAQALLK-DSDPDMREMAVEEVRETKQQLVELEAQLQRMLLPKDPNDGRNVFLEIRAGTGGDEAAIFSGDLFRMYSRYAERRGWRVEILSENEGEHGGYKEVIARVEGDSVYGKLKFESGAHRVQRVPKTESQGRIHTSACTVAVLPEPDEQQAIEINPADLRVDTYRSSGAGGQHVNKTDSAIRITHLPSGIVVECQEERSQHKNRARAMSWLSAKLNDQQTSAAASAIASERKLLVGSGDRSERIRTYNFPQGRVTDHRVNLTLYSLDEVLAGGVDAVIEPLLAEYQADQL 355
>gi|15902968|ref|NP_358518.1| peptide chain release factor 1 [Streptococcus pneumoniae R6] >gi|116517153|ref|YP_816384.1| peptide chain release factor 1 [Streptococcus pneumoniae D39] >gi|148994243|ref|ZP_01823536.1| peptide chain release factor 1 [Streptococcus pneumoniae SP9-BS68] >gi|148998842|ref|ZP_01826278.1| peptide chain release factor 1 [Streptococcus pneumoniae SP11-BS70] >gi|149003880|ref|ZP_01828703.1| peptide chain release factor 1 [Streptococcus pneumoniae SP14-BS69] >gi|149006296|ref|ZP_01830008.1| peptide chain release factor 1 [Streptococcus pneumoniae SP18-BS74] >gi|149012959|ref|ZP_01833848.1| peptide chain release factor 1 [Streptococcus pneumoniae SP19-BS75] >gi|168488841|ref|ZP_02713040.1| peptide chain release factor 1 [Streptococcus pneumoniae SP195] >gi|168491915|ref|ZP_02716058.1| peptide chain release factor 1 [Streptococcus pneumoniae CDC0288-04] >gi|168494449|ref|ZP_02718592.1| peptide chain release factor 1 [Streptococcus pneumoniae CDC3059-06] >gi|168576251|ref|ZP_02722145.1| peptide chain release factor 1 [Streptococcus pneumoniae MLV-016] >gi|182683968|ref|YP_001835715.1| peptide chain release factor 1 [Streptococcus pneumoniae CGSP14] >gi|122278730|sp|Q04KR4|RF1_STRP2 Peptide chain release factor 1 (RF-1) >gi|32171541|sp|Q8DPZ4|RF1_STRR6 Peptide chain release factor 1 (RF-1) >gi|15458532|gb|AAK99728.1| Peptide chain release factor I [Streptococcus pneumoniae R6] >gi|116077729|gb|ABJ55449.1| peptide chain release factor 1 [Streptococcus pneumoniae D39] >gi|147755269|gb|EDK62320.1| peptide chain release factor 1 [Streptococcus pneumoniae SP11-BS70] >gi|147758110|gb|EDK65114.1| peptide chain release factor 1 [Streptococcus pneumoniae SP14-BS69] >gi|147762073|gb|EDK69035.1| peptide chain release factor 1 [Streptococcus pneumoniae SP18-BS74] >gi|147763112|gb|EDK70053.1| peptide chain release factor 1 [Streptococcus pneumoniae SP19-BS75] >gi|147927384|gb|EDK78415.1| peptide chain release factor 1 [Streptococcus pneumoniae SP9-BS68] >gi|182629302|gb|ACB90250.1| peptide chain release factor 1 [Streptococcus pneumoniae CGSP14] >gi|183572574|gb|EDT93102.1| peptide chain release factor 1 [Streptococcus pneumoniae SP195] >gi|183573754|gb|EDT94282.1| peptide chain release factor 1 [Streptococcus pneumoniae CDC0288-04] >gi|183575581|gb|EDT96109.1| peptide chain release factor 1 [Streptococcus pneumoniae CDC3059-06] >gi|183577929|gb|EDT98457.1| peptide chain release factor 1 [Streptococcus pneumoniae MLV-016] (359 aa)
Score = 771, Expect = 5.1e-80, Identities = 169/350 (48%), Positives = 254/350 (72%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIK-SEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           +Y+ L ++E+++ +L + L    +    KR  E++K        V  ++EYK+ L +I  AE++IK S  D ++ E+A+ EL + K   E+YE +LK+LLLPKDPNDDKN+I+E+R AAGGDE+++F GDL + Y++YA++ GW+ +++E   +   G+  +  M++G++VYSK+K+ESG HRVQRVP TES+GRVHTST TV V+PE+EEVE  I+  DL++D Y ASGAGGQ++NK  +AVRI H+PT I V  QE ++Q +NRE AMK++RA++ +   +  +      RK  +GTG+R+E+IRTYN+PQNRVTDHRI LTL KLD ++ G L E++D+L+ +D+  K++E
  S:     3 IYDQLQAVEDRYEELGELLSDPDVVSDTKRFMELSKEEASNRDTVIAYREYKQVLQNIVDAEEMIKESGGDADLEEMAKQELKDAKAEKEEYEEKLKILLLPKDPNDDKNIILEIRGAAGGDEAALFAGDLLTMYQKYAEAQGWRFEVMEASMNGVGGFKEVVAMVSGQSVYSKLKYESGAHRVQRVPVTESQGRVHTSTATVLVMPEVEEVEYDIDPKDLRVDIYHASGAGGQNVNKVATAVRIVHLPTNIKVEMQEERTQQKNREKAMKIIRARVADHFAQIAQDEQDAERKSTIGTGDRSERIRTYNFPQNRVTDHRIGLTLQKLDTILSGKLDEVVDALVLYDQTQKLEE 356
>gi|157150598|ref|YP_001450441.1| peptide chain release factor 1 [Streptococcus gordonii str. Challis substr. CH1] >gi|172046863|sp|P47850|RF1_STRGC Peptide chain release factor 1 (RF-1) >gi|157075392|gb|ABV10075.1| peptide chain release factor 1 [Streptococcus gordonii str. Challis substr. CH1] (359 aa)
Score = 771, Expect = 5.4e-80, Identities = 173/350 (49%), Positives = 253/350 (72%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIK-SEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGFIS---FMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           +Y  L ++E+++ +L + L    +    KR  E++K    T   V  ++EYK+ L +I  AE++IK S  D ++ E+A+ EL + K   E+YE +LK+LLLPKDPNDDKN+I+E+R AAGGDE+ +F GDL   Y++YA+S GW+ +++E   S +G G I     M++G++VYSK+K+ESG HRVQRVP TES+GRVHTST TV V+PE+EEVE  I+  DL++D Y ASGAGGQ++NK  +AVRI H+PT I V  QE ++Q +NR+ AMK++RA++ +   +  +      RK  +GTG+R+E+IRTYN+PQNRVTDHRI LTL KLD ++ G L E++D+L+ +D+  K++E
  S:     3 IYEQLQAVEDRYEELGELLSDPDVVSDTKRFMELSKEEASTRDTVTAYREYKQVLQNIVDAEEMIKESGGDADLEEMAKQELKDAKAEKEEYEEKLKILLLPKDPNDDKNIILEIRGAAGGDEAQLFAGDLLQMYQKYAESQGWRFEVMEA--SYNGVGGIKEVVAMVSGQSVYSKLKYESGAHRVQRVPVTESQGRVHTSTATVLVMPEIEEVEYDIDPKDLRVDIYHASGAGGQNVNKVATAVRIVHLPTNIKVEMQEERTQQKNRDKAMKIIRARVADHFAQIAQDEQDAERKSTIGTGDRSERIRTYNFPQNRVTDHRIGLTLQKLDTILAGKLDEVVDALVLYDQTQKLEE 356
>gi|15900891|ref|NP_345495.1| peptide chain release factor 1 [Streptococcus pneumoniae TIGR4] >gi|111658249|ref|ZP_01408941.1| hypothetical protein SpneT_02000563 [Streptococcus pneumoniae TIGR4] >gi|20139341|sp|Q97R20|RF1_STRPN Peptide chain release factor 1 (RF-1) >gi|14972493|gb|AAK75135.1| peptide chain release factor 1 [Streptococcus pneumoniae TIGR4] (359 aa)
Score = 771, Expect = 5.4e-80, Identities = 170/350 (48%), Positives = 253/350 (72%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIK-SEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           +Y+ L  +E+++ +L + L    +    KR  E++K        V  ++EYK+ L +I  AE++IK S  D ++ ELA+ EL + K   E+YE +LK+LLLPKDPNDDKN+I+E+R AAGGDE+++F GDL + Y++YA++ GW+ +++E   +   G+  +  M++G++VYSK+K+ESG HRVQRVP TES+GRVHTST TV V+PE+EEVE  I+  DL++D Y ASGAGGQ++NK  +AVRI H+PT I V  QE ++Q +NRE AMK++RA++ +   +  +      RK  +GTG+R+E+IRTYN+PQNRVTDHRI LTL KLD ++ G L E++D+L+ +D+  K++E
  S:     3 IYDQLQVVEDRYEELGELLSDPDVVSDTKRFMELSKEEASNRDTVIAYREYKQVLQNIVDAEEMIKESGGDADLEELAKQELKDAKAEKEEYEEKLKILLLPKDPNDDKNIILEIRGAAGGDEAALFAGDLLTMYQKYAEAQGWRFEVMEASMNGVGGFKEVVAMVSGQSVYSKLKYESGAHRVQRVPVTESQGRVHTSTATVLVMPEVEEVEYDIDPKDLRVDIYHASGAGGQNVNKVATAVRIVHLPTNIKVEMQEERTQQKNREKAMKIIRARVADHFAQIAQDEQDAERKSTIGTGDRSERIRTYNFPQNRVTDHRIGLTLQKLDTILSGKLDEVVDALVLYDQTQKLEE 356
>gi|125717977|ref|YP_001035110.1| peptide chain release factor 1 [Streptococcus sanguinis SK36] >gi|166223611|sp|A3CN05|RF1_STRSV Peptide chain release factor 1 (RF-1) >gi|125497894|gb|ABN44560.1| Protein chain release factor A, putative [Streptococcus sanguinis SK36] (359 aa)
Score = 771, Expect = 5.5e-80, Identities = 171/350 (48%), Positives = 253/350 (72%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIK-SEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGFIS---FMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           +Y  L ++E+++ +L + L    +    KR  +++K    T   V  ++EYK+ L +I  AE++IK +  D ++ E+A+ EL + K   E+YE +LK+LLLPKDPNDDKN+I+E+R AAGGDE+ +F GDL   Y++YA+S GW+ +++E   S +G G I     M++G++VYSK+K+ESG HRVQRVP TES+GRVHTST TV V+PE+EEVE  I+  DL++D Y ASGAGGQ++NK  +AVRI H+PT I V  QE ++Q +NR+ AMK++RA++ +   +  +      RK  +GTG+R+E+IRTYN+PQNRVTDHRI LTL KLD ++ G L E++D+L+ +D+  K++E
  S:     3 IYEQLQAVEDRYEELGELLSDPDVVSDTKRFMDLSKEEASTRDTVTAYREYKKVLQNITDAEEMIKDASGDADLEEMAKQELKDAKAEKEEYEEKLKILLLPKDPNDDKNIILEIRGAAGGDEAQLFAGDLLQMYQKYAESQGWRFEVMEA--SYNGVGGIKEVVAMVSGQSVYSKLKYESGAHRVQRVPVTESQGRVHTSTATVLVMPEIEEVEYDIDPKDLRVDIYHASGAGGQNVNKVATAVRIVHLPTNIKVEMQEERTQQKNRDKAMKIIRARVADHFAQIAQDEQDAERKSTIGTGDRSERIRTYNFPQNRVTDHRIGLTLQKLDTILAGKLDEVVDALVLYDQTQKLEE 356
>gi|168334105|ref|ZP_02692318.1| peptide chain release factor 1 [Epulopiscium sp. 'N.t. morphotype B'] (356 aa)
Score = 771, Expect = 5.6e-80, Identities = 163/349 (46%), Positives = 258/349 (73%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGLSVKRMS--EINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQ 355
           +++ +  +  KF +++ ++    +   +++   + K I   +PIVEK+KEYK  L  ID +  +++ + D++++ L + ELS+ K  +E  E ELK+LLLP DPND+KNVIVE+R  AGGDE+++F  DL+  Y R+A+   WK +++++ E+   G+    FM+ G+  YS++K+ESGVHRVQRVP TES GR+HTST+TVA++PE E+V++ +N +D+K+D +R+SG GGQ +N T+SAVR+TH+PTGI V+CQ+ KSQ++N++ AMK+LRAKL+E +  + +  I+  +K QVGTG+R+E+IRTYN+PQ RVTDHR+ LT++KL+ V+ G+L EII +L + D+  K++
  S:     1 MFDQIKELVVKFENISAKVNEPAVIADQVTWRALMKEISTLSPIVEKYKEYKTVLTAIDDSLLMLEEKLDDDMLALVKEELSDNKKRVEPLEEELKILLLPTDPNDEKNVIVEIRGGAGGDEAALFAADLYRMYHRFAERSKWKTELMDINENGIGGFKEAIFMLKGDGAYSRLKYESGVHRVQRVPDTESSGRIHTSTVTVAIMPEAEDVDVEVNPNDVKVDVFRSSGNGGQSVNTTDSAVRLTHLPTGIVVSCQDEKSQLKNKDKAMKVLRAKLYELELNKQKALIAAEKKSQVGTGDRSERIRTYNFPQGRVTDHRVGLTVHKLEQVLDGDLEEIISTLTTFDQTEKLK 352
>gi|189182919|ref|YP_001936704.1| peptide chain release factor RF-1 [Orientia tsutsugamushi str. Ikeda] >gi|189179690|dbj|BAG39470.1| peptide chain release factor RF-1 [Orientia tsutsugamushi str. Ikeda] (359 aa)
Score = 771, Expect = 5.7e-80, Identities = 167/344 (48%), Positives = 244/344 (70%)
  Q:    16 EKFNDLNKELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVML-GNLSEIIDSLISHDEAVKMQEAKI 359
           +K+ DL  +L    L  K ++ I+K      PI+EK   Y +   +I   +++I +E+D E+  +A++EL +    + K E E+K+ LLPK+ +D KN I+E+R   GGDE+++F   LF  Y RYA+   WK ++L + ++   GY   S +I+G  V++ +KFESGVHRVQR+P TES GR+HTS  TV VLPE EEV++ I+  DLKIDTYRASGAGGQH+N T+SAVRITHIPTG+ V+ Q+ KSQ +N+  AMK+L A+L++ +++++++  +  RK QVGTG+R+E+IRTYNYPQ RVTDHRINLTL K++ ++  G L EII++LIS +EA K+ ++ I
  S:    12 QKYQDLEADLNGGKLDNKELALISKEYSNLKPIIEKLNRYLKAHENIKYLQQVIDTEQDLELKSIAEVELYDTLNYLPKLEEEVKISLLPKESDDHKNAIIEVRAGTGGDEAALFAASLFQMYNRYAERKKWKFELLSISDTEIGGYKEASALISGNGVFANLKFESGVHRVQRIPKTESNGRIHTSAATVVVLPEAEEVDVKIDAKDLKIDTYRASGAGGQHVNTTDSAVRITHIPTGVVVSQQDEKSQHKNKAKAMKILYARLYDLEKQKSQQEQAMSRKVQVGTGDRSERIRTYNYPQGRVTDHRINLTLYKIEEIIQEGKLDEIINNLISENEAKKIADSNI 357
>gi|125620572|gb|EAZ48938.1| peptide chain release factor 1 [Vibrio cholerae V51] (362 aa)
Score = 771, Expect = 5.9e-80, Identities = 153/321 (47%), Positives = 228/321 (71%)
  Q:    34 RMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           +   ++K   +   I + F+ Y++   D+ +AE++ + E D E+ E+AQ E+   K  IE+   EL++LLLPKDP+DD+N  +E+R  AGGDE+ IF GDLF  Y R+A+  GW+++++   E+ HG Y  +   +NG+  Y  +KFESG HRVQRVPATE++GR+HTS  TVAV+PE+ E E+  I  SDLKIDT+R+SGAGGQH+N T+SA+RITH+PTGI V CQ+ +SQ +N+  AM +L A++ + +E +    ISD R+  +G+G+R+++IRTYNYPQ RV+DHRINLT+ +L  VM G++  +ID +I   +A ++
  S:    34 KFRALSKEYSQLEEITQCFQAYQQAKEDLVAAEEMAQ-EDDAEMREMAQDEIKAAKAAIERLTDELQILLLPKDPDDDRNCFLEIRAGAGGDEAGIFAGDLFRMYSRFAEKKGWRIEVMSSSEAEHGGYKEMIAKVNGDGAYGTLKFESGGHRVQRVPATEAQGRIHTSACTVAVMPEIPEAEIPEIKASDLKIDTFRSSGAGGQHVNTTDSAIRITHLPTGIVVECQDERSQHKNKAKAMSVLAARIAQAEESKRAAEISDTRRNLLGSGDRSDRIRTYNYPQGRVSDHRINLTVYRLTEVMEGDMQSLIDPVIHEHQADQL 355
>gi|110640072|ref|YP_680282.1| peptide chain release factor 1 [Cytophaga hutchinsonii ATCC 33406] >gi|119361529|sp|Q11NS4|RF1_CYTH3 Peptide chain release factor 1 (RF-1) >gi|110282753|gb|ABG60939.1| bacterial peptide chain release factor 1 (bRF-1) [Cytophaga hutchinsonii ATCC 33406] (359 aa)
Score = 771, Expect = 5.9e-80, Identities = 157/326 (48%), Positives = 237/326 (72%)
  Q:    32 VKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQE-SSHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQEA 357
           +KR + +NK  KE   IVE + +YK  L++I+S++K++  EKD +  E+A+ EL       +  E  +K LL+PKDPND KN+I+E+R   GGDE+SIF GD+F  Y+RY D +GWK+++++  E +S GY  I   I+GE+VY K+KFESGVHRVQRVPATE++GR+HTS  +VAVLPE+EE+++ +N +D++ DT+ +SG GGQ +N T SA+R+THIP+G  V CQ+ KSQI+N E A+K+LR++++E + ++ +  +   R   +G+G+R++KIRTYNYPQ+RVTDHRI  T++ L  VM GN+ + I+ L   + A +++E 
  S:    28 MKRYASLNKEYKELNKIVEVYAQYKNILDNIESSKKVLSVEKDPDFREMAKEELETLAVQKDDIELVIKELLIPKDPNDSKNIILEIRGGTGGDEASIFAGDIFRMYQRYCDRMGWKMELIDATEGTSGGYKEIICGISGEDVYGKLKFESGVHRVQRVPATETQGRIHTSAASVAVLPEVEELDVQLNMNDIRKDTFCSSGPGGQSVNTTYSAIRLTHIPSGTVVQCQDEKSQIKNFEKALKVLRSRIYEIEYKKQQDELGKERNSMIGSGDRSDKIRTYNYPQSRVTDHRIGHTVHNLPAVMDGNIDDFIEELRLAENAERLKEG 354
>gi|114567903|ref|YP_755057.1| peptide chain release factor 1 [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|119361631|sp|Q0AUB8|RF1_SYNWW Peptide chain release factor 1 (RF-1) >gi|114338838|gb|ABI69686.1| bacterial peptide chain release factor 1 (bRF-1) [Syntrophomonas wolfei subsp. wolfei str. Goettingen] (355 aa)
Score = 771, Expect = 6.1e-80, Identities = 165/350 (47%), Positives = 251/350 (71%)
  Q:     7 LYNSLLSMEEKFNDLNKEL-ETEGLSVK-RMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           +   L S+EEK+++L   L + E LS + R  ++ K+    + IV  ++EYK     ++ +++++  E+D E  ++   E+ + +      E EL++LLLP+DPND+K+VI+E+R   GG+E+++F GDLF  Y RYA+  GWK+++++   +   G   I F+++G   YSK+KFESGVHRVQR+P TES GR+HTS  TVAVLPE EEVE+ I+ +DL+ID Y +SG GGQ +N T+SAVRITH+PTG  V CQ+ KSQ +N+  A+++LRA+L E  EEE    ++  RK QVG+G+R+E+IRTYN+PQ RV+DHRINLTL++L++V+ G L EII++LI+H +A ++++
  S:     1 MLEKLDSLEEKYDELTHLLSQPEVLSDQARFQKLAKAHSALSDIVTMYREYKSLSRQLEDSKEMLVEEEDEEFRQMLADEIPQLQEKKASLEQELRILLLPQDPNDEKSVIMEIRAGTGGEEAALFAGDLFRMYSRYAEEQGWKIEIMDTHYTDIGGIKEIVFVVDGRGAYSKLKFESGVHRVQRIPVTESGGRIHTSAATVAVLPEAEEVEVAIDPNDLRIDVYCSSGPGGQSVNTTQSAVRITHVPTGEVVTCQDEKSQHKNKAKALRVLRARLKELLEEEKNAEMAGTRKNQVGSGDRSERIRTYNFPQGRVSDHRINLTLHRLESVLEGRLEEIINALIAHYQAERLKQ 353
>gi|32171537|sp|Q8DFF9|RF1_VIBVU Peptide chain release factor 1 (RF-1) >gi|46576703|sp|Q7MMY6|RF1_VIBVY Peptide chain release factor 1 (RF-1) (362 aa)
Score = 770, Expect = 6.3e-80, Identities = 154/321 (47%), Positives = 225/321 (70%)
  Q:    34 RMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           +   ++K   +   + + F  YK+   D+ +AE++ K E D E+ E+AQ E+   K  IE    EL++LLLPKDPNDD+N  +E+R  AGGDE+ IF GDLF  Y ++A+  GW+++++   E+ HG Y  +   +NG+  Y  +KFESG HRVQRVPATES+GRVHTS  TVA++PE+ E E+  I  SDLKIDT+R+SGAGGQH+N T+SA+RITH+PTG  V CQ+ +SQ +N+  AM +L A++ + +E +    +SD R+  +G+G+R+++IRTYNYPQ RV+DHRINLT+ +L  VM G+L  +ID +I   +A ++
  S:    34 KFRALSKEYSQLEEVTKCFTAYKQAQEDLVAAEEMAK-EDDAEMREMAQEEIKAAKVAIEDLAAELQILLLPKDPNDDRNCFLEIRAGAGGDEAGIFAGDLFRMYSKFAEKRGWRIEVMSANEAEHGGYKEMIAKVNGDGAYGFLKFESGGHRVQRVPATESQGRVHTSACTVAIMPEIPEAEIPEIKASDLKIDTFRSSGAGGQHVNTTDSAIRITHLPTGTVVECQDERSQHKNKAKAMAVLAARIVQAEEAKRAAEVSDTRRNLLGSGDRSDRIRTYNYPQGRVSDHRINLTIYRLSEVMEGDLQSLIDPVIQEHQADQL 355
>gi|187476811|ref|YP_784835.1| peptide chain release factor 1 [Bordetella avium 197N] >gi|115421397|emb|CAJ47902.1| peptide chain release factor 1 [Bordetella avium 197N] (356 aa)
Score = 770, Expect = 6.4e-80, Identities = 155/321 (48%), Positives = 231/321 (71%)
  Q:    34 RMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEV-ELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           R   +++   E  P+V  F  ++ T  D+ +A++++    D E+  +A+ E+   +  IE  E EL+VLLLP+DPND +++ +E+R   GGDES++F GDL   Y RYA+S GW+V+++    S   GY  +   I+G+  Y ++KFESG HRVQRVPATE++GR+HTS  TVAV+PE +E+ ++VIN +DL+IDT+RASGAGGQHINKT+SAVRITH+PTG+ V CQ+ +SQ  N++ AM++L A+L +K+  E +   +  RK  VG+G+R+E+IRTYNYPQ RVTDHRINLTL KL  ++ G+L+E+  +L++  +A ++
  S:    30 RFRRLSRERAELEPVVLAFNAFQSTQADLATAQEMLA---DPEMKAMAEEEIKAARERIEVLEGELQVLLLPRDPNDGRSLFLEIRAGTGGDESALFSGDLLRMYSRYAESQGWRVEIMSESPSELGGYKEVIARIDGDGAYGRLKFESGAHRVQRVPATEAQGRIHTSACTVAVMPEADEMNDIVINPADLRIDTFRASGAGGQHINKTDSAVRITHLPTGLVVECQDDRSQHRNKDRAMQVLAARLKDKELRERQSKEAAERKSLVGSGDRSERIRTYNYPQGRVTDHRINLTLYKLQQILEGDLNELTGALLAEHQAEQL 349
>gi|27363734|ref|NP_759262.1| peptide chain release factor 1 [Vibrio vulnificus CMCP6] >gi|37679115|ref|NP_933724.1| peptide chain release factor 1 [Vibrio vulnificus YJ016] >gi|27359850|gb|AAO08789.1|AE016797_244 Protein chain release factor A [Vibrio vulnificus CMCP6] >gi|37197857|dbj|BAC93695.1| protein chain release factor A [Vibrio vulnificus YJ016] (363 aa)
Score = 770, Expect = 6.4e-80, Identities = 154/321 (47%), Positives = 225/321 (70%)
  Q:    34 RMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           +   ++K   +   + + F  YK+   D+ +AE++ K E D E+ E+AQ E+   K  IE    EL++LLLPKDPNDD+N  +E+R  AGGDE+ IF GDLF  Y ++A+  GW+++++   E+ HG Y  +   +NG+  Y  +KFESG HRVQRVPATES+GRVHTS  TVA++PE+ E E+  I  SDLKIDT+R+SGAGGQH+N T+SA+RITH+PTG  V CQ+ +SQ +N+  AM +L A++ + +E +    +SD R+  +G+G+R+++IRTYNYPQ RV+DHRINLT+ +L  VM G+L  +ID +I   +A ++
  S:    35 KFRALSKEYSQLEEVTKCFTAYKQAQEDLVAAEEMAK-EDDAEMREMAQEEIKAAKVAIEDLAAELQILLLPKDPNDDRNCFLEIRAGAGGDEAGIFAGDLFRMYSKFAEKRGWRIEVMSANEAEHGGYKEMIAKVNGDGAYGFLKFESGGHRVQRVPATESQGRVHTSACTVAIMPEIPEAEIPEIKASDLKIDTFRSSGAGGQHVNTTDSAIRITHLPTGTVVECQDERSQHKNKAKAMAVLAARIVQAEEAKRAAEVSDTRRNLLGSGDRSDRIRTYNYPQGRVSDHRINLTIYRLSEVMEGDLQSLIDPVIQEHQADQL 356
>gi|94500021|ref|ZP_01306556.1| peptide chain release factor 1 [Oceanobacter sp. RED65] >gi|94427879|gb|EAT12854.1| peptide chain release factor 1 [Oceanobacter sp. RED65] (363 aa)
Score = 770, Expect = 6.6e-80, Identities = 168/347 (48%), Positives = 240/347 (69%)
  Q:     5 EKLYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELE-EVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           E +   L +++E++ ++   L   G+     +  E++K   E  P+V+ F +Y +   ++  AE L K + D ++ E+ Q E S  K  IE+ + EL++LLLPKDPND KNVI+E+R   GGDE++IF GDLF  Y RYA+  GWK +++   E  HG Y  +   I G+ VY ++KFESG HRVQRVPATES+GR+HTS  TVAV+PE+E E ++ IN +DL+IDT+RASGAGGQH+NKT+SA+RITH+PTG+ V CQE +SQ +NR  AM +L  +L +   ++ +   +  RK  VG+G+R+E+IRTYNYPQ RV+DHRINLT+ KLD +M G++  II  L+   +A
  S:     3 ESVKVKLQTLDERYEEIGHLLSDAGVISDQNKFRELSKEYAEIEPVVKAFAQYTQAEENLAEAEALAKDD-DPDMREMGQEEYSAAKEEIERLDGELQILLLPKDPNDGKNVILEIRAGTGGDEAAIFSGDLFRMYTRYAEKRGWKCEVMSANEGEHGGYKEVITRIAGDGVYGQLKFESGAHRVQRVPATESQGRIHTSACTVAVMPEIENEDDVDINKADLRIDTFRASGAGGQHVNKTDSAIRITHLPTGLVVECQEERSQHKNRAKAMSILATRLNDAVVQKAQAEQAAERKSLVGSGDRSERIRTYNYPQGRVSDHRINLTVYKLDELMQGDVDMIIQPLLQEHQA 352
>gi|158426116|ref|YP_001527408.1| peptide chain release factor 1 [Azorhizobium caulinodans ORS 571] >gi|158333005|dbj|BAF90490.1| peptide chain release factor 1 [Azorhizobium caulinodans ORS 571] (357 aa)
Score = 769, Expect = 8.5e-80, Identities = 159/320 (49%), Positives = 224/320 (70%)
  Q:    38 INKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGN-LSEIIDSLISHDEAVKMQEA 357
           + +   + +P+VE+ +  +    D+  A +L+    D E+ +LAQ E++  +  +E    E+++ LLPKD  D++ VI+E+R   GGDE+++F GDLF  Y RYA   GW V++L   E +  GY  +   ++G   Y+++KFESGVHRVQRVP TE+ GR+HTS  TVAVLPE E+V++ IN SDL+ID YRA GAGGQH+NKTESAVRITHIPTG+ VA Q+ +SQ  N+  AM +LR+++ +++ ++   N +  RKGQVG+G+R+E+IRTYN+PQ RVTDHRINLTL KLD VM G  L EIID L++  +A  M  A
  S:    36 LGREFSDLSPVVEQVRALRAAERDLADARELLA---DPEMRDLAQSEVTRLEAELETLAKEVRLALLPKDAMDERGVILEVRAGTGGDEAALFAGDLFRMYARYAAEKGWSVELLSESEGTVGGYKEVVAAVHGRGAYARLKFESGVHRVQRVPDTETSGRIHTSAATVAVLPEAEDVDVDINESDLRIDVYRAQGAGGQHVNKTESAVRITHIPTGMVVAVQDERSQHRNKARAMALLRSRMLDEERQKADANRAADRKGQVGSGDRSERIRTYNFPQGRVTDHRINLTLYKLDEVMTGQALDEIIDPLLTEHQASLMAAA 354
>gi|148656981|ref|YP_001277186.1| peptide chain release factor 1 [Roseiflexus sp. RS-1] >gi|148569091|gb|ABQ91236.1| bacterial peptide chain release factor 1 (bRF-1) [Roseiflexus sp. RS-1] (364 aa)
Score = 769, Expect = 8.5e-80, Identities = 160/349 (45%), Positives = 238/349 (68%)
  Q:     7 LYNSLLSMEEKFNDL-----NKELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITH---IPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQ 355
           L + L ++  ++N+L       E+ T+ +   R+ +  +  ++  P+VE ++ Y+     I+    L+ +E D E+ +LAQ EL        + E ++KVLLLP+DPND KNVI+E+R   GGDE+++F  DLF  Y RYA+  GW V ++   E+   GY  I F I GE  YS++K+E GVHRVQRVPATE++GR+HTST TVAVLPE+EE E+ +N SD ++D +R+SG GGQ +N T+SAVRI +    P  I V CQ+ +SQ++N+ +A+ +LRA+L+ ++EE+ RK + + R  QVG GERAEKIRTYN+PQ+RVTDHRI    + L  ++ G+L  +ID+LI  D A +++
  S:     5 LIDKLANVAARYNELLDLMAQPEIATDPV---RLQQYVREQRDLEPLVEAYQAYRDVERQIEDTRFLLANETDPEVRQLAQEELDHLIERRARLETDIKVLLLPRDPNDSKNVIMELRQGEGGDEAALFAADLFRMYTRYAEQRGWDVDVISATENGPGGYKEIVFEIKGEGAYSRLKYEGGVHRVQRVPATEARGRIHTSTATVAVLPEIEETEIELNPSDYRVDVFRSSGHGGQGVNTTDSAVRIVYKPGTPEEIVVTCQDSRSQLKNKASALAVLRARLYAREEEKRRKELGESRLAQVGAGERAEKIRTYNFPQDRVTDHRIGQNFSNLPGILDGDLDRLIDALIIADNAERLE 359
>gi|116052810|ref|YP_793127.1| peptide chain release factor 1 [Pseudomonas aeruginosa UCBPP-PA14] >gi|194555428|ref|YP_002090455.1| peptide chain release factor 1 [Pseudomonas aeruginosa 2192] >gi|122257179|sp|Q02G09|RF1_PSEAB Peptide chain release factor 1 (RF-1) >gi|115588031|gb|ABJ14046.1| peptide chain release factor 1 [Pseudomonas aeruginosa UCBPP-PA14] >gi|126197821|gb|EAZ61884.1| peptide chain release factor 1 [Pseudomonas aeruginosa 2192] (360 aa)
Score = 769, Expect = 8.7e-80, Identities = 159/321 (49%), Positives = 227/321 (70%)
  Q:    34 RMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPEL-EEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           R    ++   E  P++  F++Y++   D++ A+ L+K + D E+ +LA+ E++E +  +      L+ +LLPKDPND +NV +E+R   GGDE++IF GDLF  Y RYA+  GW+V+ L   E  HG Y  +   + G+NVY+K+KFESG HRVQRVP TES+GR+HTS  TVAVLPE  E+  + IN +DL++DTYR+SGAGGQH+NKT+SAVRITHIP+GI V CQE +SQ +NR  AM  L AKL ++++   ++ I+  RK  VG+G+R+E+IRTYN+PQ RVTDHRINLTL  L  VM G + ++I+ L+   +A ++
  S:    34 RFRAYSREYAEVEPVILAFRDYRKVQADLEGAQALLK-DSDPELRDLAEEEVAEARGRLAALGDSLQRMLLPKDPNDSRNVFLEIRAGTGGDEAAIFSGDLFRMYSRYAERQGWRVETLSENEGEHGGYKEVIARVEGDNVYAKLKFESGAHRVQRVPETESQGRIHTSACTVAVLPEPDEQAAIEINPADLRVDTYRSSGAGGQHVNKTDSAVRITHIPSGIVVECQEERSQHKNRAKAMAWLAAKLNDQQQAAAQQAIASTRKLLVGSGDRSERIRTYNFPQGRVTDHRINLTLYSLGEVMEGAVEQVIEPLLQEYQADQL 355
>gi|148984974|ref|ZP_01818217.1| peptide chain release factor 1 [Streptococcus pneumoniae SP3-BS71] >gi|147922672|gb|EDK73789.1| peptide chain release factor 1 [Streptococcus pneumoniae SP3-BS71] (354 aa)
Score = 769, Expect = 9.2e-80, Identities = 169/347 (48%), Positives = 251/347 (72%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIK-SEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVK 353
           +Y+ L ++E+++ +L + L    +    KR  E++K        V  ++EYK+ L +I  AE++IK S  D ++ ELA+ EL + K   E+YE +LK+LLLPKDPNDDKN+I+E+R AAGGDE+++F GDL + Y++YA++ GW+ +++E   +   G+  +  M++G++VYSK+K+ESG HRVQRVP TES+GRVHTST TV V+PE+EEVE  I+  DL++D Y ASGAGGQ++NK  +AVRI H+PT I V  QE ++Q +NRE AMK++RA++ +   +  +      RK  +GTG+R+E+IRTYN+PQNRVTDHRI LTL KLD ++ G L E++D+L+ +D+  K
  S:     3 IYDQLQAVEDRYEELGELLSDPDVVSDTKRFMELSKEEASNRDTVIAYREYKQVLQNIVDAEEMIKESGGDADLEELAKQELKDAKAEKEEYEEKLKILLLPKDPNDDKNIILEIRGAAGGDEAALFAGDLLTMYQKYAEAQGWRFEVMEASMNGVGGFKEVVAMVSGQSVYSKLKYESGAHRVQRVPVTESQGRVHTSTATVLVMPEVEEVEYDIDPKDLRVDIYHASGAGGQNVNKVATAVRIVHLPTNIKVEMQEERTQQKNREKAMKIIRARVADHFAQIAQDEQDAERKSTIGTGDRSERIRTYNFPQNRVTDHRIGLTLQKLDTILSGKLDEVVDALVLYDQNTK 353
>gi|119361511|sp|Q2KZZ3|RF1_BORA1 Peptide chain release factor 1 (RF-1) (360 aa)
Score = 769, Expect = 9.7e-80, Identities = 155/321 (48%), Positives = 231/321 (71%)
  Q:    34 RMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEV-ELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           R   +++   E  P+V  F  ++ T  D+ +A++++    D E+  +A+ E+   +  IE  E EL+VLLLP+DPND +++ +E+R   GGDES++F GDL   Y RYA+S GW+V+++    S   GY  +   I+G+  Y ++KFESG HRVQRVPATE++GR+HTS  TVAV+PE +E+ ++VIN +DL+IDT+RASGAGGQHINKT+SAVRITH+PTG+ V CQ+ +SQ  N++ AM++L A+L +K+  E +   +  RK  VG+G+R+E+IRTYNYPQ RVTDHRINLTL KL  ++ G+L+E+  +L++  +A ++
  S:    34 RFRRLSRERAELEPVVLAFNAFQSTQADLATAQEMLA---DPEMKAMAEEEIKAARERIEVLEGELQVLLLPRDPNDGRSLFLEIRAGTGGDESALFSGDLLRMYSRYAESQGWRVEIMSESPSELGGYKEVIARIDGDGAYGRLKFESGAHRVQRVPATEAQGRIHTSACTVAVMPEADEMNDIVINPADLRIDTFRASGAGGQHINKTDSAVRITHLPTGLVVECQDDRSQHRNKDRAMQVLAARLKDKELRERQSKEAAERKSLVGSGDRSERIRTYNYPQGRVTDHRINLTLYKLQQILEGDLNELTGALLAEHQAEQL 353
>gi|119775698|ref|YP_928438.1| peptide chain release factor 1 [Shewanella amazonensis SB2B] >gi|166223600|sp|A1S8R2|RF1_SHEAM Peptide chain release factor 1 (RF-1) >gi|119768198|gb|ABM00769.1| peptide chain release factor 1 [Shewanella amazonensis SB2B] (363 aa)
Score = 769, Expect = 1.0e-79, Identities = 160/318 (50%), Positives = 231/318 (72%)
  Q:    34 RMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           R   ++K   +   +V+ FK Y++ + D+++A+++++ E D E+ E+AQ E+   K  +E+ E EL++LLLPKDPND+ N  VE+R  AGGDE++IF GDLF  Y RYA++  W+V+++   E  HG Y  +    +GE VY K+KFESG HRVQRVP TES+GRVHTS  TVAVL E+ E E V IN S+L+IDT+RASGAGGQH+NKT+SA+RITH+PTG  V CQ+ +SQ +N+  AM +L A+L   ++E+ R   +  R+  VG+G+R+E+IRTYN+PQ RV+DHRINLTL +L+ VM G+L+ +I+ ++   +A
  S:    34 RFRALSKEYAQLEDVVKGFKAYQQAVADLETAKEMLE-EDDPELKEMAQEEIKSAKASLERLEAELQILLLPKDPNDEANAFVEIRAGAGGDEAAIFAGDLFRMYSRYAETQRWQVEIMSANEGEHGGYKEVIARFSGERVYGKLKFESGGHRVQRVPETESQGRVHTSACTVAVLHEVPEAEAVEINPSELRIDTFRASGAGGQHVNKTDSAIRITHLPTGTVVECQDERSQHKNKARAMSVLVARLQAAEDEKRRSAEATTRRNLVGSGDRSERIRTYNFPQGRVSDHRINLTLYRLNEVMEGDLNALIEPIVQEHQA 352
>gi|189502103|ref|YP_001957820.1| hypothetical protein Aasi_0702 [Candidatus Amoebophilus asiaticus 5a2] >gi|189497544|gb|ACE06091.1| hypothetical protein Aasi_0702 [Candidatus Amoebophilus asiaticus 5a2] (355 aa)
Score = 769, Expect = 1.0e-79, Identities = 160/351 (45%), Positives = 249/351 (70%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLE-VQESSHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQEA 357
           + + L ++E+K+ +++K++    +   +K+ + +NK+ KE + IV+ +  YK  L +++SA+ L+  EKD    +LA+ E+   +    + E +LK LLLPKDPND KNVI+E+R   GGDE+ IF GDLF  Y R+A+ + WK+ ++E V+ +S GY  I   I GE  Y  +K+ESGVHRVQRVPATE++GR+HTS  +V VLPE++EVE+ ++ +D++ DT+ +SG GGQ +N T SA+R+THIPTGI V+CQ+ KSQI+N E A+K+LRA+L+E++ ++ +  I   R+  V +G+R++KIRTYN+PQ RVTDHRI  T++ L  VM G + ++I++L   D A ++Q+ 
  S:     1 MIDKLEAIEKKYEEVSKQIVDPSIMADMKQYASLNKTYKELSKIVDVYTVYKSNLANLESAKTLLSIEKDAAFRDLAKEEIDSLELQKTQLEEDLKFLLLPKDPNDSKNVILEIRAGTGGDEAGIFAGDLFRMYSRFAEKMQWKLSIIEEVESTSGGYKEIICSIAGEGAYGMLKYESGVHRVQRVPATETQGRIHTSAASVVVLPEMDEVEVDLDMNDIRKDTFCSSGPGGQSVNTTYSAIRLTHIPTGIVVSCQDEKSQIKNLEKALKVLRARLYEQELKKQQDAIGAERRSMVKSGDRSDKIRTYNFPQGRVTDHRIGYTIHNLPAVMDGAVGDLIEALQLADNAERLQQG 354
>gi|15828576|ref|NP_325936.1| peptide chain release factor 1 [Mycoplasma pulmonis UAB CTIP] >gi|20139344|sp|Q98RA5|RF1_MYCPU Peptide chain release factor 1 (RF-1) >gi|14089518|emb|CAC13278.1| PEPTIDE CHAIN RELEASE FACTOR 1 (RF-1) [Mycoplasma pulmonis] (359 aa)
Score = 769, Expect = 1.0e-79, Identities = 180/355 (50%), Positives = 257/355 (72%)
  Q:     5 EKLYNSLLSMEEKFNDLNKEL-ETEGLS-VKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQ-ESSHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEE-VELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQEAKI 359
           + +YNSL S+ +K+ +LN+EL + E LS +K   + ++ +     I E+F +Y      I+S++ ++  EKD E+I LA+ E+ E +  +     ELK+LLLPKD ND+ +VI+E+R AAGGDE++IF GDLF  Y ++A++   KV +L+    +S G+  I F I+GE  YSK+KFESGVHRVQR+P TESKGRVHTST TV  +PE+++ +E+ IN SDLKIDT+R+SGAGGQ +N T+SAVRITHIPTGI  + QEG+SQI NRE A+K+L+AKL++ + ++  + +   RK   G+G R+EKIRTYNYPQ+RVTDHRIN + + L  +M G L  IIDSL++ ++A K++E  I
  S:     3 KSMYNSLKSILDKYQELNQELLKPEVLSDIKLYKKFSRELNSIKSISEEFSKYLNYEKTIESSKIILAQEKDEELISLAKKEILECEEKMSSLVEELKILLLPKDKNDELDVIMEIRGAAGGDEANIFAGDLFEMYSKWANNNNMKVSVLDRNYATSGGFTLIVFTISGEKAYSKLKFESGVHRVQRIPVTESKGRVHTSTATVTAMPEIDDDIEVEINPSDLKIDTFRSSGAGGQSVNTTDSAVRITHIPTGIISSSQEGRSQISNRELALKILKAKLYDHENQKKLEKVGQYRK-LAGSGARSEKIRTYNYPQDRVTDHRINFS-SSLKQIMEGKLQIIIDSLLAEEQAEKIKEVGI 359
>gi|29655248|ref|NP_820940.1| peptide chain release factor 1 [Coxiella burnetii RSA 493] >gi|154706179|ref|YP_001425370.1| peptide chain release factor 1 [Coxiella burnetii Dugway 5J108-111] >gi|161830069|ref|YP_001596008.1| peptide chain release factor 1 [Coxiella burnetii RSA 331] >gi|165924041|ref|ZP_02219873.1| peptide chain release factor 1 [Coxiella burnetii RSA 334] >gi|189039967|sp|A9KGY3|RF1_COXBN Peptide chain release factor 1 (RF-1) >gi|189039968|sp|A9N9K2|RF1_COXBR Peptide chain release factor 1 (RF-1) >gi|30581025|sp|P47849|RF1_COXBU Peptide chain release factor 1 (RF-1) >gi|29542520|gb|AAO91454.1| peptide chain release factor 1 [Coxiella burnetii RSA 493] >gi|154355465|gb|ABS76927.1| peptide chain release factor 1 [Coxiella burnetii Dugway 5J108-111] >gi|161761936|gb|ABX77578.1| peptide chain release factor 1 [Coxiella burnetii RSA 331] >gi|165916526|gb|EDR35130.1| peptide chain release factor 1 [Coxiella burnetii RSA 334] (361 aa)
Score = 769, Expect = 1.0e-79, Identities = 159/323 (49%), Positives = 237/323 (73%)
  Q:    34 RMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGFISFM--INGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           R  E+ K   +  PIV+ F+++++    I+SAE++ + EKD E+ +LA+ EL +     E+ E +LK+LL+PKDPND++NV +E+R   GG+E++IF GDLF  Y RYA++ GW+V ++   E  HG GF   +  + GE VYS++KFESG HRVQRVP TES+GR+HTS  TVA++PE++E++ + IN ++L+IDT+RASGAGGQH+N+T+SA+RITH+PTG+ V CQ+ +SQ +N+  AM +L++KL   +  +  +  +  RK  VG+G+R+E+IRTYN+PQ RVTDHRINLTL +LD V+ G+L  +I  LI   +A ++ E
  S:    34 RYRELGKEYAQLEPIVKCFQQFQQNEKAIESAEEM-QQEKDPELRKLAEEELEQLTLKKEELEDQLKLLLVPKDPNDERNVFLEIRAGTGGNEAAIFAGDLFRMYARYAETKGWRVNIVSAHEGEHG-GFKEVIARVIGEGVYSQLKFESGAHRVQRVPVTESQGRIHTSACTVAIMPEVDEIDQIKINPAELRIDTFRASGAGGQHVNRTDSAIRITHLPTGVVVECQDERSQHKNKARAMSLLQSKLLAAERAKQDQEQAAKRKSLVGSGDRSERIRTYNFPQGRVTDHRINLTLYQLDEVIEGDLDPVIGPLIRELQAEQLAE 357
>gi|169833220|ref|YP_001694464.1| peptide chain release factor 1 [Streptococcus pneumoniae Hungary19A-6] >gi|168995722|gb|ACA36334.1| peptide chain release factor 1 [Streptococcus pneumoniae Hungary19A-6] (359 aa)
Score = 768, Expect = 1.1e-79, Identities = 168/350 (48%), Positives = 254/350 (72%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIK-SEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           +Y+ L ++E+++ +L + L    +    +R  E++K        V  ++EYK+ L +I  AE++IK S  D ++ E+A+ EL + K   E+YE +LK+LLLPKDPNDDKN+I+E+R AAGGDE+++F GDL + Y++YA++ GW+ +++E   +   G+  +  M++G++VYSK+K+ESG HRVQRVP TES+GRVHTST TV V+PE+EEVE  I+  DL++D Y ASGAGGQ++NK  +AVRI H+PT I V  QE ++Q +NRE AMK++RA++ +   +  +      RK  +GTG+R+E+IRTYN+PQNRVTDHRI LTL KLD ++ G L E++D+L+ +D+  K++E
  S:     3 IYDQLQAVEDRYEELGELLSDPDVVSDTRRFMELSKEEASNRDTVIAYREYKQVLQNIVDAEEMIKESGGDADLEEMAKQELKDAKAEKEEYEEKLKILLLPKDPNDDKNIILEIRGAAGGDEAALFAGDLLTMYQKYAEAQGWRFEVMEASMNGVGGFKEVVAMVSGQSVYSKLKYESGAHRVQRVPVTESQGRVHTSTATVLVMPEVEEVEYDIDPKDLRVDIYHASGAGGQNVNKVATAVRIVHLPTNIKVEMQEERTQQKNREKAMKIIRARVADHFAQIAQDEQDAERKSTIGTGDRSERIRTYNFPQNRVTDHRIGLTLQKLDTILSGKLDEVMDALVLYDQTQKLEE 356
>gi|149925825|ref|ZP_01914089.1| peptide chain release factor 1 [Limnobacter sp. MED105] >gi|149825942|gb|EDM85150.1| peptide chain release factor 1 [Limnobacter sp. MED105] (360 aa)
Score = 768, Expect = 1.1e-79, Identities = 160/352 (45%), Positives = 245/352 (69%)
  Q:     5 EKLYNSLLSMEEKFNDLNKELETEGLS--VKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           + + N L  + E+  DL + L ++  +  + +   I +   E  P  E+F EY     D+++A++ +    D ++ ++A+ E+++ +  + + E +L+ LLLPKDPND +N ++E+R   GGDES++F GDLF  Y RYA+  GW+++++   ES   GY  +   + G++VY  +KFESG HRVQRVPATES+GR+HTS  TVAV+ E +E E++ IN +DL+IDTYRASGAGGQHINKT+SAVRITH+PTG+ V CQ+ +SQ +N+  AMK+L  +L +K + E +   +  R+  VG+G+R+E+IRTYN+PQ R+TDHRINLTL KLD +M G+L+++++ L +  EA  + E
  S:     3 DSMRNRLTRLAERLADLEEFLSSQNAANDMAQFKAITRERSELLPATERFAEYLSIEADLNTAQEWLS---DPDMRDMAREEIAQNEAKLAQLEADLQRLLLPKDPNDHRNAMLEIRAGTGGDESALFAGDLFRMYTRYAERQGWQIEVMSASESELGGYKEVIIRLAGDHVYKHLKFESGGHRVQRVPATESQGRIHTSACTVAVMAEPDEAEVIEINPADLRIDTYRASGAGGQHINKTDSAVRITHLPTGLVVECQDERSQHKNKAKAMKVLNVRLQDKIDRERQAAEASERRSLVGSGDRSERIRTYNFPQGRMTDHRINLTLYKLDYIMDGDLTDLMNGLTAFHEAELLAE 355
>gi|15599860|ref|NP_253354.1| peptide chain release factor 1 [Pseudomonas aeruginosa PAO1] >gi|107099668|ref|ZP_01363586.1| hypothetical protein PaerPA_01000686 [Pseudomonas aeruginosa PACS2] >gi|12231016|sp|P42806|RF1_PSEAE Peptide chain release factor 1 (RF-1) >gi|9950920|gb|AAG08052.1|AE004880_8 peptide chain release factor 1 [Pseudomonas aeruginosa PAO1] (360 aa)
Score = 768, Expect = 1.2e-79, Identities = 158/321 (49%), Positives = 227/321 (70%)
  Q:    34 RMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPEL-EEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           R    ++   E  P++  F++Y++   D++ A+ L+K + D E+ +LA+ E++E +  +      L+ +LLPKDPND +NV +E+R   GGDE++IF GDLF  Y RYA+  GW+++ L   E  HG Y  +   + G+NVY+K+KFESG HRVQRVP TES+GR+HTS  TVAVLPE  E+  + IN +DL++DTYR+SGAGGQH+NKT+SAVRITHIP+GI V CQE +SQ +NR  AM  L AKL ++++   ++ I+  RK  VG+G+R+E+IRTYN+PQ RVTDHRINLTL  L  VM G + ++I+ L+   +A ++
  S:    34 RFRAYSREYAEVEPVILAFRDYRKVQADLEGAQALLK-DSDPELRDLAEEEVAEARGRLAALGDSLQRMLLPKDPNDSRNVFLEIRAGTGGDEAAIFSGDLFRMYSRYAERQGWRIETLSENEGEHGGYKEVIARVEGDNVYAKLKFESGAHRVQRVPETESQGRIHTSACTVAVLPEPDEQAAIEINPADLRVDTYRSSGAGGQHVNKTDSAVRITHIPSGIVVECQEERSQHKNRAKAMAWLAAKLNDQQQAAAQQAIASTRKLLVGSGDRSERIRTYNFPQGRVTDHRINLTLYSLGEVMEGAVEQVIEPLLQEYQADQL 355
>gi|82703754|ref|YP_413320.1| peptide chain release factor 1 [Nitrosospira multiformis ATCC 25196] >gi|119361568|sp|Q2Y5P3|RF1_NITMU Peptide chain release factor 1 (RF-1) >gi|82411819|gb|ABB75928.1| bacterial peptide chain release factor 1 (bRF-1) [Nitrosospira multiformis ATCC 25196] (358 aa)
Score = 767, Expect = 1.5e-79, Identities = 158/351 (45%), Positives = 244/351 (69%)
  Q:     4 NEKLYNSLLSMEEKFNDLNKELETEGLSVK--RMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVE-LVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           N+ +   L  +  +  +LN+ L +E ++V   +  ++ +   E  P+V+ +  Y ++  DI +A+++     + E+ E A  E+ + K  + +Y  EL+  LLPKDPND++N+ +E+R   GGDES++F  DLF  Y R+A+   W+V+++    S   GY  I   I+GE  YSK+KFESG HRVQRVPATE++GR+HTS  TVAV+PE +E+E + +N ++L+IDT+RASGAGGQHINKT+SAVRITH+PTGI V CQ+G+SQ +N+  AM +L A++ +K+ +E +   +  RK  VGTG R+ +IRTYN+PQ R+TDHRINLTL K++ +M G+L+E+  +L++  +A ++
  S:     2 NKSMTAKLTQLSVRLEELNRLLSSESITVNLDQYRKLTRERAEIAPVVDLYNAYLQSEQDIHTAQEM---AAEAEMREFADAEIRDAKERLVRYGAELQKQLLPKDPNDERNIFLEIRAGTGGDESALFAADLFRMYARFAERQRWQVEIISQSPSDVGGYKEIIAKISGEGAYSKLKFESGGHRVQRVPATETQGRIHTSACTVAVMPEADEIEDVALNPAELRIDTFRASGAGGQHINKTDSAVRITHLPTGIVVECQDGRSQHKNKAQAMSVLAARIRDKQMQEQQSKQAATRKSLVGTGNRSGRIRTYNFPQGRITDHRINLTLYKIEQIMDGDLNELCSALLAEHQAEQL 353
>gi|121997785|ref|YP_001002572.1| peptide chain release factor 1 [Halorhodospira halophila SL1] >gi|166223563|sp|A1WVQ8|RF1_HALHL Peptide chain release factor 1 (RF-1) >gi|121589190|gb|ABM61770.1| bacterial peptide chain release factor 1 (bRF-1) [Halorhodospira halophila SL1] (363 aa)
Score = 767, Expect = 1.5e-79, Identities = 155/348 (44%), Positives = 240/348 (68%)
  Q:     9 NSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           N L  M E+  ++  +L    +     + +E+++      P+V+    Y+   + + SAE ++ ++ D EI  LA+ EL+E +  +E+ E  L+  L+P DPND +N+ +E+R  AGGDE+++F GDL   Y RYA+  GWK ++L  +E  HG Y  +   ++G +VY+++KFESG HRVQRVPATES+GR+HTS  TVA+LPEL+EV  + +N +DL++DT+R+SGAGGQH+N T+SA+RITH+P+G+ V CQ+ +SQ +NR  A+ +L+A+L E++  + +   S+ R+  VG+G+R+E+IRTYN+PQ RVTDHRI LTL KL+ VM G + E++D L    +A  + E
  S:     7 NKLERMAERHEEIGAQLADPDVVGDPSKFAELSREYARLEPVVQDLNAYRAEADTVASAEAML-NDGDAEIRALAEQELAEAQRRLEELEGALQRHLVPTDPNDQRNIFLEVRAGAGGDEAALFAGDLLRMYMRYAERQGWKTEILSAREGEHGGYREVIARVSGRSVYARLKFESGAHRVQRVPATESQGRIHTSACTVAILPELDEVSAIEVNTADLRVDTFRSSGAGGQHVNTTDSAIRITHLPSGLVVECQDERSQNKNRAKAIALLQARLTEQERAKQQSERSEQRRLAVGSGDRSERIRTYNFPQGRVTDHRIGLTLYKLEQVMEGGMDELLDGLTQEHQAEALAE 357
>gi|156973549|ref|YP_001444456.1| peptide chain release factor 1 [Vibrio harveyi ATCC BAA-1116] >gi|166223617|sp|A7MY68|RF1_VIBHB Peptide chain release factor 1 (RF-1) >gi|156525143|gb|ABU70229.1| hypothetical protein VIBHAR_01250 [Vibrio harveyi ATCC BAA-1116] (362 aa)
Score = 766, Expect = 1.8e-79, Identities = 153/321 (47%), Positives = 228/321 (71%)
  Q:    34 RMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           +   ++K   +   + + F+ Y++  +D+ +AE +  +E D E+ E+AQ E+ E K  IE+   EL++LLLPKDPNDD+N  +E+R  AGGDE+ IF GDLF  Y +YA+  GW+++++   E+ HG Y  +   ++G+  Y  +KFESG HRVQRVPATES+GRVHTS  TVAV+ E+ E +L  I  +DLKIDT+RASGAGGQH+N T+SA+RITH+PTG  V CQ+ +SQ +N+  AM +L A++ + +EE     +SD R+  +G+G+R+++IRTYNYPQ RV+DHRINLT+ +L+ VM G+L  +ID ++   +A ++
  S:    34 KFRALSKEYSQLEEVTKCFQAYQQAQDDLAAAEDM-ANEDDEEMREMAQEEIKEAKEAIERLTDELQILLLPKDPNDDRNCFLEIRAGAGGDEAGIFAGDLFRMYSKYAEKRGWRIEVMSSNEAEHGGYKEMIAKVSGDGAYGVLKFESGGHRVQRVPATESQGRVHTSACTVAVMAEIPEADLPEIKAADLKIDTFRASGAGGQHVNTTDSAIRITHLPTGTVVECQDERSQHKNKAKAMAVLAARIVQAEEERRAAEVSDTRRNLLGSGDRSDRIRTYNYPQGRVSDHRINLTIYRLNEVMEGDLQSLIDPVVQEHQADQL 355
>gi|71281852|ref|YP_270226.1| peptide chain release factor 1 [Colwellia psychrerythraea 34H] >gi|119361527|sp|Q47Y94|RF1_COLP3 Peptide chain release factor 1 (RF-1) >gi|71147592|gb|AAZ28065.1| peptide chain release factor 1 [Colwellia psychrerythraea 34H] (362 aa)
Score = 766, Expect = 1.9e-79, Identities = 161/350 (46%), Positives = 237/350 (67%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           +Y  L  + E+F ++   L         ++   ++K  K+   +   F  YK   +D  +AE ++K + D ++ E+AQ E  + K  +     EL++LLLP+DPNDD N  VE+R  AGGDE++IF GDLF  Y RYA+  GWK++++   ES  G Y  +   +NGE V+  MKFESG HRVQRVPATES+GRVHTS  TV V+PE+ E + + IN +DLK+DT+RASGAGGQH+NKT+SA+RITHIPTG+ V CQE +SQ +NR  AM +L+A+L + ++E+ R      R+  V +G+R+E+IRTYN+PQ R++DHRINLTL +L+ +M G+L  +++ ++  ++A  + E
  S:     5 VYQKLEVLVERFEEVQALLSDPATISDQEKFRALSKEFKQLDAVTSVFNNYKSAEDDFSTAELMLKDD-DPDMREMAQEEFKDAKKAVADIADELQILLLPRDPNDDNNCFVEIRAGAGGDEAAIFAGDLFRMYSRYAEKKGWKIEVMNSNESEQGGYKELIMKVNGEGVFGHMKFESGGHRVQRVPATESQGRVHTSACTVVVMPEIPEADAIEINKADLKVDTFRASGAGGQHVNKTDSAIRITHIPTGVVVECQEQRSQHKNRAQAMSVLQARLQQAEDEKRRSEEESSRRNLVASGDRSERIRTYNFPQGRMSDHRINLTLYRLNEIMEGSLQLVMEPIMQENQADLLAE 357
>gi|34557214|ref|NP_907029.1| peptide chain release factor 1 [Wolinella succinogenes DSM 1740] >gi|46576699|sp|Q7M9M4|RF1_WOLSU Peptide chain release factor 1 (RF-1) >gi|34482930|emb|CAE09929.1| PEPTIDE CHAIN RELEASE FACTOR 1 [Wolinella succinogenes] (355 aa)
Score = 766, Expect = 2.0e-79, Identities = 171/352 (48%), Positives = 248/352 (70%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVML-GNLSEIIDSLISHDEAVKMQEAK 358
           L + L    E+F ++ + L T  +   +KRM+E++K       +V K KEY +T   I     L +   D E+ +LA+ E    +  +E  E E+K+LL+PKDPNDDKN+ +E+R   GGDE+ IFVGDLF +Y RYAD  GWKV+++   E+S  GY  +  +I G  VYS++K+E G HRVQRVP TES+GR+HTS ITVA++PE+++VE+ IN +DLKID +R+ G GGQ +N T+SAVRITH+PTGI V+ Q+ KSQ +N++ A+K+L+A+L+E + E      S  RK QVG+G+R+E+IRTYNYPQNR+TDHRI LTL  L+ +ML GN  +++D +++H +A  M+E++
  S:     2 LISKLTPFIERFEEITRLLGTMEVISDIKRMTELSKEQSALEALVLKAKEYLQTHRSIQENRALFE---DKELGDLAKEENKLLEESLESLESEIKLLLIPKDPNDDKNIYLEIRAGTGGDEAGIFVGDLFKSYCRYADLKGWKVEIISSSENSVGGYKEVIALIKGNGVYSRLKYEGGTHRVQRVPETESQGRIHTSAITVAIMPEVDDVEVNINPNDLKIDVFRSGGHGGQSVNTTDSAVRITHLPTGISVSMQDEKSQHKNKDKALKILKARLYEAELEAKLSENSAARKLQVGSGDRSERIRTYNYPQNRLTDHRIGLTLYSLEEIMLSGNFDQVVDPIVAHYQAEMMKESE 354
>gi|146283509|ref|YP_001173662.1| peptide chain release factor 1 [Pseudomonas stutzeri A1501] >gi|166223591|sp|A4VPB9|RF1_PSEU5 Peptide chain release factor 1 (RF-1) >gi|145571714|gb|ABP80820.1| peptide chain release factor 1 [Pseudomonas stutzeri A1501] (360 aa)
Score = 766, Expect = 2.1e-79, Identities = 167/348 (47%), Positives = 245/348 (70%)
  Q:     7 LYNSLLSMEEKFNDLNKEL-ETEGLSVK-RMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           L N L  ++++F +L   L + E +S + R    ++   E  P++  +++  +   D++ A+ L+K + D ++ E+A+ E++E K  +E  E  L+ +LLPKDPND +NV +E+R   GGDE++IF GDLF  Y RYA+  GW+V++L   E  HG Y  +   + G+NVY+K+KFESG HRVQRVP TES+GR+HTS  TVAVLPE +E   V IN ++L+IDTYR+SGAGGQH+NKT+SA+RITH+PTGI V CQE +SQ +NR  AM  L AKL ++++    K IS+ RK  VG+G+R+E+IRTYN+PQ RVTDHR+NLTL  L+ V+ G + ++I+ L+   +A ++
  S:     5 LLNKLDILQDRFEELTALLGDAEVISDQSRFRAYSREYAEVEPVIVAYRQLCKVQQDLEGAQALLK-DSDPDMREMAEEEVAEAKAQLETLEANLQRMLLPKDPNDGRNVFLEIRAGTGGDEAAIFAGDLFRMYSRYAEKQGWRVEILSESEGEHGGYKEVISRVEGDNVYAKLKFESGAHRVQRVPETESQGRIHTSACTVAVLPEPDEQAAVEINPAELRIDTYRSSGAGGQHVNKTDSAIRITHLPTGIVVECQEERSQHKNRAKAMAWLAAKLQDRQDAAAHKEISETRKLLVGSGDRSERIRTYNFPQGRVTDHRVNLTLYSLNEVIGGAVEQVIEPLLQEYQADQL 355
>gi|149195429|ref|ZP_01872512.1| peptide chain release factor 1 [Caminibacter mediatlanticus TB-2] >gi|149134434|gb|EDM22927.1| peptide chain release factor 1 [Caminibacter mediatlanticus TB-2] (355 aa)
Score = 766, Expect = 2.1e-79, Identities = 175/351 (49%), Positives = 261/351 (74%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGLS--VKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKML-EVQESSHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVM-LGNLSEIIDSLISHDEAVKMQEA 357
           L   L    EK+N++N++L +  ++  +K+M+++++  +    IV K KEY+  LN+++ A+ ++    D E+ ELA+ E+ E +  + K E E+K+LLLPKDPNDDKN+ +E+R   GGDE+++FVGDL  AY RYAD+ GWKV+++ E +    GY  I  +I GE  YS++K+E G HRVQR+PATES+GR+HTS +TVAV+PE+++V++ ++  D+KI+  RA GAGGQH+NKTESAVR+THIPTGI V+ Q+ +SQ  N+E A+++L+A+++EK E+E  + I   RK QVG+G+R+E+IRTYNYPQNR+TDHRI LTL +L+ +M  G   EIID LI+H +A  ++EA
  S:     2 LLEKLKPFVEKYNEINQKLSSPEITKDIKQMTKLSREARSLEEIVNKAKEYEELLNNLEEAKMMLD---DAEMSELAKEEIKEIEEKLPKLEEEIKLLLLPKDPNDDKNIFLEIRAGTGGDEAALFVGDLMKAYLRYADNKGWKVEIVSESKNDIGGYKEIILLIKGEGAYSRLKYEGGTHRVQRIPATESQGRIHTSAVTVAVMPEVDDVDIELDPKDIKIEVMRAGGAGGQHVNKTESAVRMTHIPTGITVSMQDERSQQRNKEKALQILKARVYEKLEKERLEKIGKERKSQVGSGDRSERIRTYNYPQNRITDHRIGLTLYRLEQIMNEGLFDEIIDPLIAHYQAEALKEA 353
>gi|28897517|ref|NP_797122.1| peptide chain release factor 1 [Vibrio parahaemolyticus RIMD 2210633] >gi|153840439|ref|ZP_01993106.1| peptide chain release factor 1 [Vibrio parahaemolyticus AQ3810] >gi|31076863|sp|Q87RN4|RF1_VIBPA Peptide chain release factor 1 (RF-1) >gi|28805729|dbj|BAC59006.1| peptide chain release factor 1 [Vibrio parahaemolyticus RIMD 2210633] >gi|149745897|gb|EDM57027.1| peptide chain release factor 1 [Vibrio parahaemolyticus AQ3810] (362 aa)
Score = 766, Expect = 2.2e-79, Identities = 152/321 (47%), Positives = 229/321 (71%)
  Q:    34 RMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           +   ++K   +   + + F+ Y++  +D+ +AE++ K E D E+ E+AQ E+ + K  IE+   EL++LLLPKDPNDD+N  +E+R  AGGDE+ IF GDLF  Y +YA+  GW+++++   E+ HG Y  +   ++G+  Y  +KFESG HRVQRVPATES+GRVHTS  TVAV+ E+ E +L  I  +DLKIDT+RASGAGGQH+N T+SA+RITH+PTG  V CQ+ +SQ +N+  AM +L A++ + ++E     +SD R+  +G+G+R+++IRTYNYPQ RV+DHRINLT+ +L+ VM G+L  +ID ++   +A ++
  S:    34 KFRALSKEYSQLEEVTKCFQAYQQAQDDLAAAEEMAK-EDDEEMREMAQEEIKDAKEAIERLADELQILLLPKDPNDDRNCFLEIRAGAGGDEAGIFAGDLFRMYSKYAEKRGWRIEVMSSNEAEHGGYKEMIAKVSGDGAYGVLKFESGGHRVQRVPATESQGRVHTSACTVAVMAEIPEADLPEIKAADLKIDTFRASGAGGQHVNTTDSAIRITHLPTGTVVECQDERSQHKNKAKAMAVLAARIVQAEQERRAAEVSDTRRNLLGSGDRSDRIRTYNYPQGRVSDHRINLTIYRLNEVMEGDLQSLIDPVVQEHQADQL 355
>gi|118052150|ref|ZP_01520697.1| peptide chain release factor 1 [Comamonas testosteroni KF-1] >gi|118000278|gb|EAV14435.1| peptide chain release factor 1 [Comamonas testosteroni KF-1] (359 aa)
Score = 766, Expect = 2.3e-79, Identities = 158/339 (46%), Positives = 234/339 (69%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVE-LVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSL 345
           L N L    ++  +L+  L  E +   +K+   I++   + T I  ++  Y +T  DI +A +++    D ++ E+AQ E+   +  + K E EL+ LLLPKDP+D +   VE+R   GGDES++F GDL   Y RYA ++GWKV+++   E+   GY  +   I G+NVY  ++FESG HRVQRVPATE++GR+HTS  TVAV+PE +E E + +N +DL+IDT+RASGAGGQHINKT+SAVR+ H+PTGI   CQ+G+SQ  N+  A+++L+A++ EK+  E     + +RKG +G+G+R+++IRTYN+PQ R+TDHRINLTL KL  VM G+L ++I +L
  S:     5 LRNQLERYAQRLQELDFLLSREDIMGDMKQYRTISREHADVTAIASRYTRYLQTEADIAAAREMLD---DPDMAEMAQEEIGSGEAELIKLEDELQRLLLPKDPDDARPAFVEIRAGTGGDESALFAGDLTRMYTRYAANVGWKVEVMSASENEIGGYKEVVLRIEGDNVYGALRFESGGHRVQRVPATETQGRIHTSACTVAVMPEPDEAEAITLNPADLRIDTFRASGAGGQHINKTDSAVRVVHLPTGIVAECQDGRSQHSNKAKALQVLQARIQEKERSERAAKEAAMRKGLIGSGDRSDRIRTYNFPQGRLTDHRINLTLYKLLAVMEGDLGDVIQAL 344
>gi|27375329|ref|NP_766858.1| peptide chain release factor 1 [Bradyrhizobium japonicum USDA 110] >gi|32171530|sp|Q89XT9|RF1_BRAJA Peptide chain release factor 1 (RF-1) >gi|27348465|dbj|BAC45483.1| peptide chain release factor 1 [Bradyrhizobium japonicum USDA 110] (361 aa)
Score = 765, Expect = 2.4e-79, Identities = 162/324 (50%), Positives = 228/324 (70%)
  Q:    24 ELETEG-LSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKS-EKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGN-LSEIIDSLIS 347
           E E+ G L+ +R  +I + + E TP++E  K Y+  + ++   E LI     D E+  +A+ E  E  P IE    +++V LLPKD  DD+NV++E+R   GGDE+S+F GDLF  Y+R+A   GWKV+++   E +  GY  I   + G   +SK+KFESGVHRVQRVP TE++GR+HTS  TVAVLPE+E+V++ I N DL+I+T RA GAGGQH+NKTESA+RITHIPTGI V  Q+ +SQ +NR +AM +LR+++++ + +      S  RK +VG+G+R+E+IRTYN+PQ RVTDHRINLTL KL  V+ G  L E+ID+L +
  S:    20 EAESLGQLASERYVQITRELAEITPLIEAVKTYRSAVKELADTEALIADPATDAEMRGMAEAERDELAPRIEDLVQKIRVALLPKDAMDDRNVVLEIRAGTGGDEASLFAGDLFRMYERFASLQGWKVEVISASEGTVGGYKEIIAEVQGRGAFSKLKFESGVHRVQRVPDTETQGRIHTSAATVAVLPEVEDVDVDIKNDDLRIETMRAQGAGGQHVNKTESAIRITHIPTGIVVMMQDSRSQHKNRASAMNILRSRIYDAERQRVDAARSAERKEKVGSGDRSERIRTYNFPQGRVTDHRINLTLYKLPQVIAGEALGELIDALTT 347
>gi|77460969|ref|YP_350476.1| peptide chain release factor 1 [Pseudomonas fluorescens PfO-1] >gi|119361582|sp|Q3K6W9|RF1_PSEPF Peptide chain release factor 1 (RF-1) >gi|77384972|gb|ABA76485.1| bacterial peptide chain release factor 1 (bRF-1) [Pseudomonas fluorescens PfO-1] (360 aa)
Score = 765, Expect = 2.5e-79, Identities = 167/348 (47%), Positives = 239/348 (68%)
  Q:     7 LYNSLLSMEEKFNDLNKEL-ETEGLSVK-RMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           L N L  ++++F +L   L + E +S + +    +K   E  P+V+ +K+      D++ A+ L+K + D ++ E+A  E+ E K L+   E +L+ +LLPKDPND +NV +E+R   GGDE++IF GDLF  Y RYA+  GW+V++L   E  HG Y  +   I G+NVY K+KFESG HRVQRVPATES+GR+HTS  TVAVLPE +E E + IN +DL++DTYR+SGAGGQH+N T+SA+RITHIPTG  V CQE +SQ +NR  AM  L AKL +++       I+  RK  VG+G+R+E+IRTYN+ Q RVTDHR+NLTL  LD ++ G +  +I+ L++  +A ++
  S:     5 LLNKLDILQDRFEELTALLGDGEVISDQTKFRAYSKEYAELEPVVQGYKKLLGVQGDLEGAQALLK-DSDPDMREMAVEEVREAKELLITLESDLQRMLLPKDPNDGRNVFLEIRAGTGGDEAAIFSGDLFRMYSRYAERRGWRVEILSENEGEHGGYKEVIARIEGDNVYGKLKFESGAHRVQRVPATESQGRIHTSACTVAVLPEPDEREAIEINPADLRVDTYRSSGAGGQHVNTTDSAIRITHIPTGTVVECQEERSQHKNRARAMAWLSAKLNDQQTAAAANAIASERKLLVGSGDRSERIRTYNFAQGRVTDHRVNLTLYSLDEILAGGVEAVIEPLLAEYQADQL 355
>gi|57241669|ref|ZP_00369614.1| peptide chain release factor 1 [Campylobacter lari RM2100] >gi|57017562|gb|EAL54339.1| peptide chain release factor 1 [Campylobacter lari RM2100] (355 aa)
Score = 765, Expect = 2.5e-79, Identities = 179/353 (50%), Positives = 255/353 (72%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGLS--VKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNL-SEIIDSLISHDEAVKMQEAKI 359
           L + L     +F++LN  L    +S  + +M+ ++K  K   PIVEK KEY +TL+DI+  + L+    D E+ ELA+ EL   + L    E ELK+LLLPKDPNDDKN+ +E+R   GGDE+S+FVGDL  AY RYA++  +K +++   E S  G+  I  +I G   YS++K+E G HRVQRVP TES+GRVHTS ITVA++PE+++VE+ IN +DLKID  R+SG GGQ +N T+SAVRITHIPTGI V  Q+GKSQ +N+E+AMK+L+A+L+E +E+E     S+ RK QVG+G+R+E+IRTYN+PQNR++DHRINLTL +LD ++ G L  EI++ LI++ +A  +++  +
  S:     2 LADKLKPFLTRFDELNTLLSDVNISNDISKMTALSKEQKNLEPIVEKAKEYLKTLDDIEENKLLLS---DPELGELAKEELKNLELLKPNLEEELKILLLPKDPNDDKNIFLEIRAGTGGDEASLFVGDLVKAYIRYAENRDYKYEIVSSSEGSVGGFKEIIILIKGNGAYSRLKYEGGTHRVQRVPETESQGRVHTSAITVAIMPEVDDVEIQINPNDLKIDVMRSSGHGGQSVNTTDSAVRITHIPTGIVVVNQDGKSQHKNKESAMKVLKARLFEMQEQERLAKESEARKSQVGSGDRSERIRTYNFPQNRISDHRINLTLYRLDAILEGGLFDEIVEPLIAYYQAEALKQENL 355
>gi|153002121|ref|YP_001367802.1| peptide chain release factor 1 [Shewanella baltica OS185] >gi|166223602|sp|A6WSF0|RF1_SHEB8 Peptide chain release factor 1 (RF-1) >gi|151366739|gb|ABS09739.1| peptide chain release factor 1 [Shewanella baltica OS185] (363 aa)
Score = 765, Expect = 2.9e-79, Identities = 160/321 (49%), Positives = 230/321 (71%)
  Q:    34 RMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGF--ISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           R   ++K   +   +V  FK Y++   D+DSA+++++ E D E+ E+AQ E+   K  +E  E EL++LLLPKDP+DDKN  VE+R  AGGDE++IF GDLF  Y RYA++  W+++++   E  HG GF  +   ++GE VY K+KFESG HRVQRVP TES+GRVHTS +TV VL E+ E E + IN +DLK+DT+R+SGAGGQH+NKT+SA+RITHIPTGI V CQ+ +SQ +NR  AM +L A++   ++E+ R      R+  V +G+R+E++RTYN+PQ RV++HRINLTL +L+ VM G+L  I+  L+   +A ++
  S:    34 RFRALSKEYAQLEDVVAGFKAYQQAQADLDSAKEMLE-EDDAEMREMAQEEMKAAKAKLEHLEDELQILLLPKDPDDDKNAFVEIRAGAGGDEAAIFAGDLFRMYSRYAEANRWQIEIMSCNEGEHG-GFKEVIMKVSGEGVYGKLKFESGGHRVQRVPETESQGRVHTSAVTVVVLHEVPEAEAISINPADLKVDTFRSSGAGGQHVNKTDSAIRITHIPTGIVVECQDQRSQHKNRAQAMSVLAARIQAVEDEKRRSAEESTRRSLVASGDRSERVRTYNFPQGRVSEHRINLTLYRLNEVMEGDLDAILLPLMQEHQADQL 355
>gi|167625123|ref|YP_001675417.1| peptide chain release factor 1 [Shewanella halifaxensis HAW-EB4] >gi|189039991|sp|B0TR27|RF1_SHEHH Peptide chain release factor 1 (RF-1) >gi|167355145|gb|ABZ77758.1| peptide chain release factor 1 [Shewanella halifaxensis HAW-EB4] (361 aa)
Score = 765, Expect = 2.9e-79, Identities = 162/319 (50%), Positives = 226/319 (70%)
  Q:    33 KRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGFISFM--INGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           +R   ++K   +   +V  FK Y++   D +SA+++++ E D E+ E+AQ E    K  I   E EL++LLLPKDPNDD N  +E+R  AGGDE++IF GDLF  Y RYA+S  W+++++   E  HG GF   +  I+GE VY K+KFESG HRVQRVP TES+GRVHTS  TV VLPE+ E E + IN +DLK+DT+RASGAGGQH+NKT+SA+RITHIPTGI V CQ+ +SQ +NR  AM +L A++   ++E+ R      R+  V +G+R+E+IRTYNYPQ RV++HRINLTL +L+  M G++  +++ LI  ++A
  S:    33 ERFRALSKEYSQLEDVVRTFKSYQQAEEDFESAKEMME-EDDPELKEMAQEEYKATKEAIATLEAELQILLLPKDPNDDNNCFIEIRAGAGGDEAAIFAGDLFRMYSRYAESKRWQIEVMNTNEGEHG-GFKEVIAKISGEGVYGKLKFESGGHRVQRVPETESQGRVHTSACTVIVLPEVPEAEAIEINKADLKVDTFRASGAGGQHVNKTDSAIRITHIPTGIVVECQDQRSQHKNRAQAMSVLAARIQAVEDEKRRSAEESTRRNLVSSGDRSERIRTYNYPQGRVSEHRINLTLYRLNEFMEGDIDCVVEPLIQENQA 352
>gi|194538367|ref|YP_002073464.1| peptide chain release factor 1 [Vibrio sp. Ex25] >gi|151936922|gb|EDN55812.1| peptide chain release factor 1 [Vibrio sp. Ex25] (362 aa)
Score = 764, Expect = 3.1e-79, Identities = 153/321 (47%), Positives = 228/321 (71%)
  Q:    34 RMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           +   +++   +   + + F+ Y++   D+ +AE++  +E D E+ E+AQ E+ E K  IE+   EL++LLLPKDPNDD+N  +E+R  AGGDE+ IF GDLF  Y +YA+  GW+++++   E+ HG Y  +   ++G+  Y  +KFESG HRVQRVPATES+GRVHTS  TVAV+ E+ E +L  I  +DLKIDT+RASGAGGQH+N T+SA+RITH+PTG  V CQ+ +SQ +N+  AM +L A++ + +EE     +SD R+  +G+G+R+++IRTYNYPQ RV+DHRINLT+ +L+ VM G+L  +ID +I   +A ++
  S:    34 KFRALSREYSQLEEVTKCFQAYQQAQEDLVAAEEM-ANEDDEEMREMAQEEIKEAKATIERLTDELQILLLPKDPNDDRNCFLEIRAGAGGDEAGIFAGDLFRMYSKYAEKRGWRIEVMSSNEAEHGGYKEMIAKVSGDGAYGVLKFESGGHRVQRVPATESQGRVHTSACTVAVMAEIPEADLPEIKAADLKIDTFRASGAGGQHVNTTDSAIRITHLPTGTVVECQDERSQHKNKAKAMAVLAARIVQAEEERRAAEVSDTRRNLLGSGDRSDRIRTYNYPQGRVSDHRINLTIYRLNEVMEGDLQSLIDPVIQEHQADQL 355
>gi|91228927|ref|ZP_01262825.1| peptide chain release factor 1 [Vibrio alginolyticus 12G01] >gi|91187510|gb|EAS73844.1| peptide chain release factor 1 [Vibrio alginolyticus 12G01] (362 aa)
Score = 764, Expect = 3.1e-79, Identities = 153/321 (47%), Positives = 228/321 (71%)
  Q:    34 RMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           +   +++   +   + + F+ Y++   D+ +AE++  +E D E+ E+AQ E+ E K  IE+   EL++LLLPKDPNDD+N  +E+R  AGGDE+ IF GDLF  Y +YA+  GW+++++   E+ HG Y  +   ++G+  Y  +KFESG HRVQRVPATES+GRVHTS  TVAV+ E+ E +L  I  +DLKIDT+RASGAGGQH+N T+SA+RITH+PTG  V CQ+ +SQ +N+  AM +L A++ + +EE     +SD R+  +G+G+R+++IRTYNYPQ RV+DHRINLT+ +L+ VM G+L  +ID +I   +A ++
  S:    34 KFRALSREYSQLEEVTKCFQAYQQAQEDLVAAEEM-ANEDDEEMREMAQEEIKEAKATIERLTDELQILLLPKDPNDDRNCFLEIRAGAGGDEAGIFAGDLFRMYSKYAEKRGWRIEVMSSNEAEHGGYKEMIAKVSGDGAYGVLKFESGGHRVQRVPATESQGRVHTSACTVAVMAEIPEADLPEIKAADLKIDTFRASGAGGQHVNTTDSAIRITHLPTGTVVECQDERSQHKNKAKAMAVLAARIVQAEEERRAAEVSDTRRNLLGSGDRSDRIRTYNYPQGRVSDHRINLTIYRLNEVMEGDLQSLIDPVIQEHQADQL 355
>gi|145298193|ref|YP_001141034.1| protein chain release factor A [Aeromonas salmonicida subsp. salmonicida A449] >gi|166223526|sp|A4SK64|RF1_AERS4 Peptide chain release factor 1 (RF-1) >gi|142850965|gb|ABO89286.1| Protein chain release factor A [Aeromonas salmonicida subsp. salmonicida A449] (362 aa)
Score = 764, Expect = 3.2e-79, Identities = 162/351 (46%), Positives = 236/351 (67%)
  Q:     4 NEKLYNSLLSMEEKFNDLNKELETEGLSVK--RMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           N  L   L  + E+  ++   L   G++    R   + +   +   IV  F+ +++   +++ A KL+  E D ++ E+AQ EL   K  +E+ E  L+V+LLP+DP DD N  +E+R  AGGDE++IF GDLF  Y RYA+  GW++ ++   +  HG Y  +   ++GE+VY ++KFESG HRVQRVP TES+GRVHTS  TVAVLPE+ E E + IN +DLKIDT+RASGAGGQH+NKT+SA+RITH+PTG+ V CQ+ +SQ +NR  AM +L A+L   ++E +R      R+  VG+G+R+E+IRTYNYPQ R+++HRINLTL +L  +M G+L  II  +I   +A ++
  S:     2 NPSLIRKLEGLIERHEEVQAMLGEPGVASDQDRYRALTREYAQLEDIVHAFQRFRQAEENLE-ATKLMLEEDDADLREMAQEELPLAKSTLEEQEQALQVMLLPRDPKDDNNCYLEIRAGAGGDEAAIFAGDLFRMYSRYAERQGWRISIVSCNDGEHGGYKEVIAKVDGEHVYGRLKFESGGHRVQRVPETESQGRVHTSACTVAVLPEVPEAEQIEINANDLKIDTFRASGAGGQHVNKTDSAIRITHLPTGLVVECQDERSQHKNRAKAMSVLSARLQAAEDERHRAAEQSTRRNLVGSGDRSERIRTYNYPQGRLSEHRINLTLYRLGEIMEGDLDCIISPMIQEYQADQL 355
>gi|623028|emb|CAA55563.1| unnamed protein product [Coxiella burnetii] (361 aa)
Score = 764, Expect = 3.3e-79, Identities = 158/323 (48%), Positives = 236/323 (73%)
  Q:    34 RMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGFISFM--INGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           R  E+ K   +  PIV+ F+++++    I+SAE++ + EKD E+ +LA+ EL +     E+ E +L +LL+PKDPND++NV +E+R   GG+E++IF GDLF  Y RYA++ GW+V ++   E  HG GF   +  + GE VYS++KFESG HRVQRVP TES+GR+HTS  TVA++PE++E++ + IN ++L+IDT+RASGAGGQH+N+T+SA+RITH+PTG+ V CQ+ +SQ +N+  AM +L++KL   +  +  +  +  RK  VG+G+R+E+IRTYN+PQ RVTDHRINLTL +LD V+ G+L  +I  LI   +A ++ E
  S:    34 RYRELGKEYAQLEPIVKCFQQFQQNEKAIESAEEM-QQEKDPELRKLAEEELEQLTLKKEELEDQLNLLLVPKDPNDERNVFLEIRAGTGGNEAAIFAGDLFRMYARYAETKGWRVNIVSAHEGEHG-GFKEVIARVIGEGVYSQLKFESGAHRVQRVPVTESQGRIHTSACTVAIMPEVDEIDQIKINPAELRIDTFRASGAGGQHVNRTDSAIRITHLPTGVVVECQDERSQHKNKARAMSLLQSKLLAAERAKQDQEQAAKRKSLVGSGDRSERIRTYNFPQGRVTDHRINLTLYQLDEVIEGDLDPVIGPLIRELQAEQLAE 357
>gi|167058616|ref|ZP_02280873.1| peptide chain release factor 1 [Listeria monocytogenes FSL F2-515] (292 aa)
Score = 764, Expect = 3.4e-79, Identities = 156/282 (55%), Positives = 217/282 (76%)
  Q:    74 DNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQ 355
           D+E+ E+A+ E +E +      E  LK+LL+PKDPNDDKNVI+E+R AAGGDE+++F GDLF  Y +YA+S GWKV++++   +   GY  I  M+NG + +S+MK+E+G HRVQRVP TES GR+HTST TVA+LPE EEVE+ +++ D++ DT+ ++GAGGQ +N T SAVR+THIPTGI V+ Q+ +SQ++N++ AMK+LRA++++K E E R+     RK  VGTG+R+E+IRTYNYPQNRVTDHRI LT+ KLD +M G L EIID+LI  D+  K++
  S:     4 DDEMREMAKEEFAELQKEKTDLEERLKLLLVPKDPNDDKNVILEIRGAAGGDEAALFAGDLFRMYSKYAESRGWKVEIMDANPTGIGGYKEIIAMMNGNDAFSRMKYENGAHRVQRVPETESGGRIHTSTATVAILPEAEEVEIELHDKDIRTDTFASTGAGGQSVNTTMSAVRLTHIPTGIVVSMQDERSQLKNKDKAMKVLRARVYDKFEREAREEYDANRKSAVGTGDRSERIRTYNYPQNRVTDHRIGLTIQKLDQIMEGKLDEIIDALILEDQTSKLE 286
>gi|158520489|ref|YP_001528359.1| peptide chain release factor 1 [Desulfococcus oleovorans Hxd3] >gi|158509315|gb|ABW66282.1| peptide chain release factor 1 [Desulfococcus oleovorans Hxd3] (356 aa)
Score = 764, Expect = 3.5e-79, Identities = 158/351 (45%), Positives = 251/351 (71%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGLSVKRMS--EINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQES-SHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQEA 357
           +++ L  +E +F +L   +    +   R +  + ++   E   IV+ ++ YK   ++I+ +  L++ ++D EI ELA+ E+S  K   E+ + EL+ LL PKDPND+KNV+VE+R   GG+E+S+F  DLF  Y RYA+++GWK +++    + S G+  + FM+ G+  YS +KFESG+HRVQRVP TE++GR+HTS +TVAVL E EEVEL I+ S++K D +R+SG GGQ +N T+SAVR+TH+PTG+ V CQ+ KSQ++N+  AMK+LRA+L ++  ++  + I+  RK QVG+G+R+ +IRTYN+PQ RVTDHR  +TL KL++V+ G+LSE+++ L ++ +A ++++A
  S:     1 MFDRLQDVERRFGELEGLMADPSIVNDREAYQKHSREHAELADIVDAYRRYKAVSDEIEKSRDLLE-DRDPEIRELAKEEISRLKDERERLDGELQNLLTPKDPNDNKNVLVEIRAGTGGEEASLFAHDLFRMYWRYAETMGWKTEIMSSSVTGSGGFKEVIFMVYGKGAYSHLKFESGIHRVQRVPETEAQGRIHTSAVTVAVLAEAEEVELHIDPSEIKTDVFRSSGPGGQSVNTTDSAVRLTHLPTGVVVICQDEKSQLKNKNKAMKVLRARLLDRMIQDQNEKIAQNRKDQVGSGDRSGRIRTYNFPQGRVTDHRAGITLYKLESVLQGDLSELVNGLATYFQAERLKQA 353
>gi|170746587|ref|YP_001752847.1| peptide chain release factor 1 [Methylobacterium radiotolerans JCM 2831] >gi|170653109|gb|ACB22164.1| peptide chain release factor 1 [Methylobacterium radiotolerans JCM 2831] (361 aa)
Score = 763, Expect = 4.3e-79, Identities = 157/315 (49%), Positives = 221/315 (70%)
  Q:    37 EINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSE-KDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGF--ISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGN-LSEIIDSLISHDEA 351
           ++++ + +  P+V   + Y+  L ++   E LI     D E+  LA  E  E    +E     L++LLLPKD  D+K+ I+E+R   GGDE+++F GDLF  Y +YA+S GW+V+++   E + G GF  +   + G  V++++KFESG HRVQRVP TE++GR+HTS  TVAVLPE EEV++ +N++DLKIDT RA GAGGQH+NKTESA+RITH+PTGI V  QE +SQ +NR  AM +LRA+L+E +        +  RK QVG+G+R+E+IRTYN+PQ RVTDHRINLTL KL+ VM G  L E++D+LI+  +A
  S:    35 QLSRELSDLDPVVAAIRAYRAALENLAGVEALIDEPGTDPEMRALAAEEKPEALAALETAHRALQLLLLPKDAADEKSAILEVRAGTGGDEAALFAGDLFRMYAKYAESKGWRVEVISESEGTVG-GFREVVAEVKGRGVFARLKFESGAHRVQRVPDTETQGRIHTSAATVAVLPEAEEVDIHVNDADLKIDTMRAQGAGGQHVNKTESAIRITHLPTGIVVFVQEERSQHKNRARAMALLRARLYEAERNAKDSARAADRKAQVGSGDRSERIRTYNFPQGRVTDHRINLTLYKLEEVMAGTALDEVVDALITEHQA 352
>gi|196194898|gb|EDX89857.1| peptide chain release factor 1 [Alcanivorax sp. DG881] (361 aa)
Score = 763, Expect = 4.6e-79, Identities = 148/321 (46%), Positives = 227/321 (70%)
  Q:    34 RMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEV-ELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           +  ++++   E  P+V+ ++ Y +  +++D+A + ++ + D ++ E+   E  + +  +E+   EL+ L+LPKDP D  NV +E+R   GGDE++IF GDLF  Y +YAD  GWKV+M+   E  HG Y  +   + G+ VYS+MKFESG HRVQRVPATES+GR+HTS  TVA++ E E++ ++ I N DL+IDTYR+SGAGGQH+N T+SAVRITH+PTG+ V CQ+ +SQ +N+  AM +L AKL++ ++       +  RK  VG+G+R+E+IRTYNYPQ RV+DHRINLTL +L  +M G++ E++ +L++  +A ++
  S:    34 QFRDLSREYAEIDPVVKCYQAYLQAADNLDAA-RAMQDDSDPDMREMGAEEARDAQARMEELAEELQKLMLPKDPRDGANVFLEVRAGTGGDEAAIFAGDLFRMYSKYADQRGWKVEMVSASEGEHGGYKEVIARVIGDGVYSRMKFESGAHRVQRVPATESQGRIHTSACTVAIMAEAEQLGDITIRNEDLRIDTYRSSGAGGQHVNTTDSAVRITHLPTGVVVECQDERSQHKNKARAMSLLSAKLYDAQQNAAHAEQAAERKSLVGSGDRSERIRTYNYPQGRVSDHRINLTLYRLGELMEGDMDELLGALLAEYQADQL 355
>gi|110833384|ref|YP_692243.1| peptide chain release factor 1 [Alcanivorax borkumensis SK2] >gi|119361504|sp|Q0VS77|RF1_ALCBS Peptide chain release factor 1 (RF-1) >gi|110646495|emb|CAL15971.1| peptide chain release factor 1 [Alcanivorax borkumensis SK2] (361 aa)
Score = 763, Expect = 4.6e-79, Identities = 150/321 (46%), Positives = 225/321 (70%)
  Q:    34 RMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEV-ELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           +  ++++   E  P+V+ +++Y++ + D   A K ++ + D ++ E+   E  + +  +E    EL+ L+LPKDP D  NV +E+R   GGDE++IF GDLF  Y +YAD  GWKV+M+   E  HG Y  +   + G+ VYS+MKFESG HRVQRVPATES+GR+HTS  TVA++ E E++ ++ I   DL+IDTYR+SGAGGQH+N T+SAVRITH+PTG+ V CQ+ +SQ +N+  AM +L AKL++ ++       +  RK  VG+G+R+E+IRTYNYPQ RVTDHRINLTL +L+ ++ G+L EI+ +L++  +A ++
  S:    34 QFRDLSREYAEIDPVVKCYRQYQQAVED-HGAAKAMQDDSDADMREMGAEEARDAQERMEALAAELQKLMLPKDPRDGANVFLEVRAGTGGDEAAIFAGDLFRMYSKYADQRGWKVEMVSASEGEHGGYKEVIARVIGDGVYSRMKFESGAHRVQRVPATESQGRIHTSACTVAIMAEAEDLGDIKIRTEDLRIDTYRSSGAGGQHVNTTDSAVRITHLPTGVVVECQDERSQHKNKARAMSLLSAKLYDAQQNAAHAEQAAERKSLVGSGDRSERIRTYNYPQGRVTDHRINLTLYRLNEIVEGDLDEILGALLAEYQADQL 355
>gi|194549580|ref|YP_002084608.1| peptide chain release factor 1 [Pseudomonas aeruginosa C3719] >gi|126170526|gb|EAZ56037.1| peptide chain release factor 1 [Pseudomonas aeruginosa C3719] (360 aa)
Score = 763, Expect = 4.7e-79, Identities = 158/321 (49%), Positives = 226/321 (70%)
  Q:    34 RMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPEL-EEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           R    ++   E  P++  F++Y++   D++ A+ L+K + D E+ +LA+ E++E +  +      L+ +LLPKDPND +NV +E+R    GDE++IF GDLF  Y RYA+  GW+V+ L   E  HG Y  +   + G+NVY+K+KFESG HRVQRVP TES+GR+HTS  TVAVLPE  E+  + IN +DL++DTYR+SGAGGQH+NKT+SAVRITHIP+GI V CQE +SQ +NR  AM  L AKL ++++   ++ I+  RK  VG+G+R+E+IRTYN+PQ RVTDHRINLTL  L  VM G + ++I+ L+   +A ++
  S:    34 RFRAYSREYAEVEPVILAFRDYRKVQADLEGAQALLK-DSDPELRDLAEEEVAEARGRLAALGDSLQRMLLPKDPNDSRNVFLEIRAGTCGDEAAIFSGDLFRMYSRYAERQGWRVETLSENEGEHGGYKEVIARVEGDNVYAKLKFESGAHRVQRVPETESQGRIHTSACTVAVLPEPDEQAAIEINPADLRVDTYRSSGAGGQHVNKTDSAVRITHIPSGIVVECQEERSQHKNRAKAMAWLAAKLNDQQQAAAQQAIASTRKLLVGSGDRSERIRTYNFPQGRVTDHRINLTLYSLGEVMEGAVEQVIEPLLQEYQADQL 355
>gi|88861344|ref|ZP_01135974.1| Peptide chain release factor 1 (RF-1) [Pseudoalteromonas tunicata D2] >gi|88816610|gb|EAR26435.1| Peptide chain release factor 1 (RF-1) [Pseudoalteromonas tunicata D2] (361 aa)
Score = 763, Expect = 5.0e-79, Identities = 162/347 (46%), Positives = 237/347 (68%)
  Q:     5 EKLYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           E +Y  L ++ E++ ++   L    +     R   ++K   E   + + F  Y++   D+ +AE++ K E D ++ ++AQ E    K  +E    EL+VL+LPKDP D+ NV +E+R   GGDE++IF GDLF  Y R+A++  WKV+++   E  HG Y  +   I+G  VY K+KFESGVHRVQRVP TES+GRVHTS  TVAV+PE+ E E + IN +D+K+DT+RASGAGGQH+NKT+SA+RITHIPTG+ V CQ+ +SQ +NR  AM +L ++L + ++E+     +  R+  VG+G+R+E+IRTYNYPQ R+TDHRINLTL KL+ ++ G+L  II+ L+   +A
  S:     3 ESVYRKLETLVERYEEVEALLSEASVISDQDRFRALSKEYAELEDVSKVFNAYRQAEQDLVAAEEMFKDE-DPDMRDMAQDEFKAAKAQLETLTDELQVLMLPKDPKDNNNVYLEVRAGTGGDEAAIFAGDLFRMYARFAETQKWKVEIVSANEGEHGGYKEVIANISGTGVYGKLKFESGVHRVQRVPETESQGRVHTSACTVAVMPEIPEAEAIEINAADIKVDTFRASGAGGQHVNKTDSAIRITHIPTGVVVECQDERSQHKNRAKAMSVLASRLQQAEDEKRHAEEATQRRNLVGSGDRSERIRTYNYPQGRITDHRINLTLYKLNEIVSGDLLPIINPLVQEHQA 352
>gi|134093473|ref|YP_001098548.1| peptide chain release factor 1 [Herminiimonas arsenicoxydans] (356 aa)
Score = 762, Expect = 5.3e-79, Identities = 162/341 (47%), Positives = 236/341 (69%)
  Q:    11 LLSMEEKFNDLNKELETEGLS--VKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKML-EVQESSHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           L  + E+  +LN  L  E  +  +    ++ +   E  P+V  +  Y +  NDI  A+ ++    D ++ E AQ E++  K  +E+ E +L+ +LLPKDPND++N+ +E+R   GGDES++F GDL   Y R+A+   W+++M+ E      GY  +   I G   YSK+KFESG HRVQRVPATE++GR+HTS  TVAV+PE +EVE V IN +DL+IDTYRASGAGGQHINKT+SAVRITHIPTGI V CQ+ +SQ +N+ +A+K+L A++ + +  E +   +  RK  +G+G+R+E+IRTYN+PQ R+TDHRINLTL KLD +M G+L+E+ ++L +  +A
  S:     5 LDQLTERLAELNVLLMQEDATSNMDNYRKMTREHAELGPLVALYGNYTQADNDIKDAQGMLS---DPDMKEFAQEEMAAAKTRMEQLELDLQKMLLPKDPNDERNIFLEIRAGTGGDESALFAGDLLRMYTRFAERNRWQIEMVSESASEVGGYKEVIVRIVGNGAYSKLKFESGGHRVQRVPATETQGRIHTSACTVAVMPEADEVEDVNINPADLRIDTYRASGAGGQHINKTDSAVRITHIPTGIVVECQDDRSQHKNKASALKVLAARIKDVQLREQQSQEAATRKSLIGSGDRSERIRTYNFPQGRMTDHRINLTLYKLDFIMDGDLTELTNALAAEHQA 346
>gi|126172944|ref|YP_001049093.1| peptide chain release factor 1 [Shewanella baltica OS155] >gi|149114992|ref|ZP_01841740.1| peptide chain release factor 1 [Shewanella baltica OS223] >gi|166223601|sp|A3D0G1|RF1_SHEB5 Peptide chain release factor 1 (RF-1) >gi|125996149|gb|ABN60224.1| peptide chain release factor 1 [Shewanella baltica OS155] >gi|146865222|gb|EDK50560.1| peptide chain release factor 1 [Shewanella baltica OS223] (363 aa)
Score = 762, Expect = 5.4e-79, Identities = 159/321 (49%), Positives = 230/321 (71%)
  Q:    34 RMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGF--ISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           R   ++K   +   +V  FK Y++   D+DSA+++++ E D E+ E+AQ E+   K  +E  E EL++LLLPKDP+DDKN  VE+R  AGGDE++IF GDLF  Y RYA++  W+++++   E  HG GF  +   ++G+ VY K+KFESG HRVQRVP TES+GRVHTS +TV VL E+ E E + IN +DLK+DT+R+SGAGGQH+NKT+SA+RITHIPTGI V CQ+ +SQ +NR  AM +L A++   ++E+ R      R+  V +G+R+E++RTYN+PQ RV++HRINLTL +L+ VM G+L  I+  L+   +A ++
  S:    34 RFRALSKEYAQLEDVVAGFKAYQQAQVDLDSAKEMLE-EDDAEMREMAQEEMKAAKAKLEHLEDELQILLLPKDPDDDKNAFVEIRAGAGGDEAAIFAGDLFRMYSRYAEANRWQIEIMSCNEGEHG-GFKEVIMKVSGDGVYGKLKFESGGHRVQRVPETESQGRVHTSAVTVVVLHEVPEAEAISINPADLKVDTFRSSGAGGQHVNKTDSAIRITHIPTGIVVECQDQRSQHKNRAQAMSVLAARIQALEDEKRRSAEESTRRSLVASGDRSERVRTYNFPQGRVSEHRINLTLYRLNEVMEGDLDAILLPLMQEHQADQL 355
>gi|193222210|emb|CAL60419.2| Peptide chain release factor 1 (RF-1) [Herminiimonas arsenicoxydans] (361 aa)
Score = 762, Expect = 5.7e-79, Identities = 162/341 (47%), Positives = 236/341 (69%)
  Q:    11 LLSMEEKFNDLNKELETEGLS--VKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKML-EVQESSHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           L  + E+  +LN  L  E  +  +    ++ +   E  P+V  +  Y +  NDI  A+ ++    D ++ E AQ E++  K  +E+ E +L+ +LLPKDPND++N+ +E+R   GGDES++F GDL   Y R+A+   W+++M+ E      GY  +   I G   YSK+KFESG HRVQRVPATE++GR+HTS  TVAV+PE +EVE V IN +DL+IDTYRASGAGGQHINKT+SAVRITHIPTGI V CQ+ +SQ +N+ +A+K+L A++ + +  E +   +  RK  +G+G+R+E+IRTYN+PQ R+TDHRINLTL KLD +M G+L+E+ ++L +  +A
  S:    10 LDQLTERLAELNVLLMQEDATSNMDNYRKMTREHAELGPLVALYGNYTQADNDIKDAQGMLS---DPDMKEFAQEEMAAAKTRMEQLELDLQKMLLPKDPNDERNIFLEIRAGTGGDESALFAGDLLRMYTRFAERNRWQIEMVSESASEVGGYKEVIVRIVGNGAYSKLKFESGGHRVQRVPATETQGRIHTSACTVAVMPEADEVEDVNINPADLRIDTYRASGAGGQHINKTDSAVRITHIPTGIVVECQDDRSQHKNKASALKVLAARIKDVQLREQQSQEAATRKSLIGSGDRSERIRTYNFPQGRMTDHRINLTLYKLDFIMDGDLTELTNALAAEHQA 351
>gi|170728014|ref|YP_001762040.1| peptide chain release factor 1 [Shewanella woodyi ATCC 51908] >gi|169813361|gb|ACA87945.1| peptide chain release factor 1 [Shewanella woodyi ATCC 51908] (361 aa)
Score = 762, Expect = 5.7e-79, Identities = 161/319 (50%), Positives = 231/319 (72%)
  Q:    33 KRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGFISFM--INGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           +R   ++K   +   +V+ F  +++   D+++A++++ +E D E+ E+AQ E+ E K ++E  E EL++LLLPKDPNDD N  +E+R  AGGDE++IF GDLF  Y +Y++S  W+++++   E  HG GF   +  I+GE VY K+KFESG HRVQRVP TES+GRVHTS  TV VLPE+ E E + IN +DLK+DT+RASGAGGQH+NKT+SA+RITHIPTGI V CQ+ +SQ +NR  AM +L A++   ++E+ R      R+  V +G+R+E+IRTYN+PQ R++DHRINLTL +L+ VM G L  II+ LI  ++A
  S:    33 ERFRALSKEYSQLEDVVKSFTAFQQATEDLEAAKEML-NEDDPELKEMAQEEMKEAKSVLETLEDELQILLLPKDPNDDNNAFIEIRAGAGGDEAAIFAGDLFRMYSKYSESNRWQIEVMNTNEGEHG-GFKEVIAKISGEGVYGKLKFESGGHRVQRVPETESQGRVHTSACTVIVLPEIPEAEAIEINKADLKVDTFRASGAGGQHVNKTDSAIRITHIPTGIVVECQDQRSQHKNRAQAMSVLSARIQAVEDEKRRSEEESTRRNLVSSGDRSERIRTYNFPQGRMSDHRINLTLYRLNEVMEGVLDVIIEPLILENQA 352
>gi|160876841|ref|YP_001556157.1| peptide chain release factor 1 [Shewanella baltica OS195] >gi|189039990|sp|A9L2D4|RF1_SHEB9 Peptide chain release factor 1 (RF-1) >gi|160862363|gb|ABX50897.1| peptide chain release factor 1 [Shewanella baltica OS195] (363 aa)
Score = 762, Expect = 5.8e-79, Identities = 159/321 (49%), Positives = 230/321 (71%)
  Q:    34 RMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGF--ISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           R   ++K   +   +V  FK Y++   D+DSA+++++ E D E+ E+AQ E+   K  +E  E EL++LLLPKDP+DDKN  VE+R  AGGDE++IF GDLF  Y RYA++  W+++++   E  HG GF  +   ++G+ VY K+KFESG HRVQRVP TES+GRVHTS +TV VL E+ E E + IN +DLK+DT+R+SGAGGQH+NKT+SA+RITHIPTGI V CQ+ +SQ +NR  AM +L A++   ++E+ R      R+  V +G+R+E++RTYN+PQ RV++HRINLTL +L+ VM G+L  I+  L+   +A ++
  S:    34 RFRALSKEYAQLEDVVAGFKAYQQAQVDLDSAKEMLE-EDDAEMREMAQEEMKAAKAKLEHLEDELQILLLPKDPDDDKNAFVEIRAGAGGDEAAIFAGDLFRMYSRYAEANRWQIEIMSCNEGEHG-GFKEVIMKVSGDGVYGKLKFESGGHRVQRVPETESQGRVHTSAVTVVVLHEVPEAEAISINPADLKVDTFRSSGAGGQHVNKTDSAIRITHIPTGIVVECQDQRSQHKNRAQAMSVLAARIQAVEDEKRRSAEESTRRSLVASGDRSERVRTYNFPQGRVSEHRINLTLYRLNEVMEGDLDAILLPLMQEHQADQL 355
>gi|157376591|ref|YP_001475191.1| peptide chain release factor 1 [Shewanella sediminis HAW-EB3] >gi|189039993|sp|A8FYZ0|RF1_SHESH Peptide chain release factor 1 (RF-1) >gi|157318965|gb|ABV38063.1| peptide chain release factor 1 [Shewanella sediminis HAW-EB3] (361 aa)
Score = 762, Expect = 6.1e-79, Identities = 159/319 (49%), Positives = 230/319 (72%)
  Q:    33 KRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGFISFM--INGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           +R   ++K   +   +V  FK +++   D+++A+++  S+ D E+ E+AQ E+ E K L+EK E EL++LLLPKDPNDD N  +E+R  AGGDE++IF GDLF  Y +Y +S  W+++++   E  HG GF   +  ++GE VY ++KFESG HRVQRVP TES+GRVHTS  TV VLPE+ E E + IN  DLK+DT+RASGAGGQH+NKT+SA+R+THIP+GI V CQ+ +SQ +NR  AM +L A++   ++E+ R      R+  VG+G+R+E+IRTYN+PQ RV++HRINLTL +L+ VM G L  I++ L+  ++A
  S:    33 ERFRALSKEYSQLEDVVTSFKSFQQATEDLEAAKEM-ASDDDPELKEMAQEEMKEAKSLLEKLEDELQILLLPKDPNDDNNCFIEIRAGAGGDEAAIFAGDLFRMYSKYVESKRWQLEVMNTNEGEHG-GFKEVIAKVSGEGVYGQLKFESGGHRVQRVPETESQGRVHTSACTVVVLPEIPESEAIEINKGDLKVDTFRASGAGGQHVNKTDSAIRLTHIPSGIVVECQDQRSQHKNRAQAMSVLTARIQAVEDEKRRSAEESTRRNLVGSGDRSERIRTYNFPQGRVSEHRINLTLYRLNEVMEGELDAILEPLMLENQA 352
>gi|23015680|ref|ZP_00055449.1| COG0216: Protein chain release factor A [Magnetospirillum magnetotacticum MS-1] (354 aa)
Score = 762, Expect = 6.5e-79, Identities = 152/329 (46%), Positives = 235/329 (71%)
  Q:    28 EGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGN-LSEIIDSLISHDEAVKMQE 356
           +GL  + +  ++K + E  P+V     +++   D+  A +++    D ++ +LA+ E    K  +   E E++++LLPKD  D+KN I+E+R   GG+E+++F  +LF  Y+RYA   GW+ ++++V ++   G    S  I G NV++++KFESGVHRVQRVPATES+GR+HTS  TVA++PE EEV++ +N+SDL+ D YR+ G+GGQ +N T+SAVR+THIPTG+ VACQ+ KSQ +N+ TA+K+LRA+L+E++        +  RK QVG+G+R+E+IRTYN+PQ RVTDHRINLTL K+D VM G+ L E+I++L++ D+A ++ E
  S:    25 DGLDSQTIQRLSKELSELDPVVTAVVAFRKAREDMVQAAEMMN---DPDMKDLAEEEFYALKERLPALEREVQIMLLPKDEADEKNAIIEVRAGTGGEEAALFAAELFRMYERYASVHGWRFEVMDVNDTGIGGVKEASATITGRNVFARLKFESGVHRVQRVPATESQGRIHTSAATVAIMPEAEEVDIQLNDSDLRFDVYRSQGSGGQSVNTTDSAVRVTHIPTGLAVACQQEKSQHKNKATALKLLRARLYERERSAKDAERAAARKSQVGSGDRSERIRTYNFPQGRVTDHRINLTLYKIDAVMSGDALDELIEALVAADQAERLAE 352
>gi|149377994|ref|ZP_01895719.1| peptide chain release factor 1 [Marinobacter algicola DG893] >gi|149357703|gb|EDM46200.1| peptide chain release factor 1 [Marinobacter algicola DG893] (361 aa)
Score = 761, Expect = 7.3e-79, Identities = 163/341 (47%), Positives = 234/341 (68%)
  Q:    11 LLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           L  + ++F +++  L  +G   +  +  ++++   E  PIV  F+ ++++ +D+  A +L + + D ++  +A+ EL   +   E+ + EL+ L+LPKDPND KNV +E+R   GGDE++IF GDLF  Y RYA+   W+V+++   E  HG Y  +   I G  VY  +KFESG HRVQRVP TES+GR+HTS  TVAV+PE +E E V IN SDL++DT+RASGAGGQH+NKT+SA+RITHIPTGI V CQE +SQ +NR  AM  L ++L  ++ E  +K ++  RK  VG+G+R+E+IRTYN+PQ RVTDHRINLTL KLD V+ G+L  +I  L    +A
  S:     9 LEQLVDRFEEVSALLSDQGTIANQDKFRDLSREFAEIEPIVHCFQAWQKSRDDVKEATELAR-DGDADMRAMAEEELGLAEQKGEELDEELQRLMLPKDPNDGKNVFLEVRAGTGGDEAAIFAGDLFKMYMRYAERQRWQVEVISASEGEHGGYKEVIARIAGSAVYGALKFESGAHRVQRVPETESQGRIHTSACTVAVMPEADETEAVEINKSDLRVDTFRASGAGGQHVNKTDSAIRITHIPTGIVVECQEERSQHKNRAKAMSFLASRLQNEEIERQQKTMAATRKSLVGSGDRSERIRTYNFPQGRVTDHRINLTLYKLDEVISGDLDAVIMPLQQEHQA 352
>gi|120600166|ref|YP_964740.1| peptide chain release factor 1 [Shewanella sp. W3-18-1] >gi|124545635|ref|ZP_01704810.1| peptide chain release factor 1 [Shewanella putrefaciens 200] >gi|146291906|ref|YP_001182330.1| peptide chain release factor 1 [Shewanella putrefaciens CN-32] >gi|166223604|sp|A4Y3J8|RF1_SHEPC Peptide chain release factor 1 (RF-1) >gi|166223606|sp|A1RNE1|RF1_SHESW Peptide chain release factor 1 (RF-1) >gi|120560259|gb|ABM26186.1| peptide chain release factor 1 [Shewanella sp. W3-18-1] >gi|124510611|gb|EAY54679.1| peptide chain release factor 1 [Shewanella putrefaciens 200] >gi|145563596|gb|ABP74531.1| peptide chain release factor 1 [Shewanella putrefaciens CN-32] (363 aa)
Score = 761, Expect = 8.1e-79, Identities = 158/318 (49%), Positives = 227/318 (71%)
  Q:    34 RMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGF--ISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           R   ++K   +   +V  FK Y++   D+DSA+++++ E D E+ E+AQ E+   K  +E+ E EL++LLLPKDPNDD N  +E+R  AGGDE++IF GDLF  Y RYA++  W+++++   E  HG GF  I   ++GE  Y K+KFESG HRVQRVP TES+GRVHTS +TV V+ E+ E E + IN +DLK+DT+R+SGAGGQH+NKT+SA+RITHIPTGI V CQ+ +SQ +NR  AM +L A++   ++E+ R      R+  V +G+R+E++RTYN+PQ RV++HRINLTL +L+ VM G+L  I+  L+   +A
  S:    34 RFRALSKEYSQLEEVVAGFKAYQQAQADLDSAKEMLE-EDDAEMREMAQEEMKAAKAELERLESELQILLLPKDPNDDTNAFIEIRAGAGGDEAAIFAGDLFRMYSRYAEANRWQMEVMSCNEGEHG-GFKEIIVKVSGEGAYGKLKFESGGHRVQRVPETESQGRVHTSAVTVVVMHEVPEAEAISINPADLKVDTFRSSGAGGQHVNKTDSAIRITHIPTGIVVECQDQRSQHKNRAQAMSVLAARIQAVEDEKRRSAEESTRRSLVASGDRSERVRTYNFPQGRVSEHRINLTLYRLNEVMEGDLDAILTPLMQEHQA 352
>gi|121635327|ref|YP_975572.1| peptide chain release factor 1 [Neisseria meningitidis FAM18] >gi|166223577|sp|A1KV95|RF1_NEIMF Peptide chain release factor 1 (RF-1) >gi|120867033|emb|CAM10796.1| peptide chain release factor I [Neisseria meningitidis FAM18] (358 aa)
Score = 761, Expect = 8.4e-79, Identities = 162/315 (51%), Positives = 228/315 (72%)
  Q:    37 EINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVE-LVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           ++ +   E TP+VE F+ Y+   +D+  AE+++    D E+ + A  E+   K  I + + EL+ LLLPKD +DDKN+ +E+R   GGDE+++F GDL   Y RYA+   W+V+++   ES   GY  +   I G   YS++KFESG HRVQRVPATES+GR+HTS  TVAV+PE +E+E + +N +DL+IDT+RASGAGGQHINKT+SAVRITH+PTG+ V CQ+G+SQ  N+  AMK+L A+L + ++ E +   +  RK  +G+G+R+E+IRTYNYPQ RVTDHRINLTL+KLD VM G+L+EI D+LI+  +A
  S:    37 KLTREHAELTPVVEVFQNYRLAQSDLADAEEMLS---DPEMKDFAAEEIEAAKAKIGELDTELQKLLLPKDADDDKNIFIEIRAGTGGDEAALFAGDLLRMYSRYAERNRWQVEIVSANESELGGYKEVIARIVGLGAYSRLKFESGGHRVQRVPATESQGRIHTSACTVAVMPEADELEDIELNPADLRIDTFRASGAGGQHINKTDSAVRITHLPTGMVVECQDGRSQHANKAQAMKVLAARLNDAQKREAQAKEAAERKSLIGSGDRSERIRTYNYPQGRVTDHRINLTLHKLDFVMDGDLAEITDALIAEHQA 350
>gi|145632952|ref|ZP_01788685.1| peptide chain release factor 1 [Haemophilus influenzae 3655] >gi|144986608|gb|EDJ93174.1| peptide chain release factor 1 [Haemophilus influenzae 3655] (361 aa)
Score = 761, Expect = 8.7e-79, Identities = 165/344 (47%), Positives = 238/344 (69%)
  Q:    11 LLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           L S++E++ +L   L    +     +    +K   +   +V+ F  + +   +I+ AE L+    D E+ E+AQ+E+ E K  IE+ E +L++LLLPKDPND+ N  +E+R   GGDE+ IF GDLF  Y RYA+S  W+V+ML   ES  G Y  +   ++GE VY ++KFESG HRVQRVP TES+GR+HTS  TVAV+PEL E E+  IN +DL+IDTYR+SGAGGQH+N T+SAVRITHIPTGI V CQ+ +SQ +N+  AM +L +++ + ++E      +D+R+  +G+G+R++KIRTYNYPQ RVTDHRINLT+ +LD VM G + E+I  +I+  +A ++
  S:    10 LESLKERYEELEALLGDASVISDQDKFRAYSKEYSQLEDVVKCFNRWTQLNQNIEEAEILLD---DPEMKEMAQMEIEESKAEIEEVEQQLQILLLPKDPNDEYNCYLEIRAGTGGDEAGIFAGDLFRMYSRYAESKRWRVEMLSANESEQGGYKEVIVKVSGEGVYGQLKFESGGHRVQRVPKTESQGRIHTSACTVAVMPELPESEMPEINPADLRIDTYRSSGAGGQHVNTTDSAVRITHIPTGIVVECQDERSQHKNKAKAMSVLASRIVQAEQERQAAEQTDMRRNLLGSGDRSDKIRTYNYPQGRVTDHRINLTIYRLDEVMNGKIDELIQPIITEYQADQL 354
>gi|116625721|ref|YP_827877.1| peptide chain release factor 1 [Solibacter usitatus Ellin6076] >gi|116228883|gb|ABJ87592.1| bacterial peptide chain release factor 1 (bRF-1) [Solibacter usitatus Ellin6076] (362 aa)
Score = 760, Expect = 9.0e-79, Identities = 159/346 (45%), Positives = 250/346 (72%)
  Q:    11 LLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           L  +E++F++L +++    +     +  ++ K+  E + I  K++E+K+  + +  A  +++ E+D E+ E+A+LE+++ +P   + E EL+VLLLPKDPNDDKNV++E+R   GGDE+++F  ++F  Y RYA++  WK+++    ESS  G   +  +++G  VY+K+K+ESGVHRVQRVP TE +GRVHTS ITVAVLPE +EVE+ +   D++IDT+ +SG GGQ +N T SAVRITH+PTG+ V+CQ+ KSQI+NR  A ++LR++L+E + E+ +  +   R+  VG+G+R+EKIRTYN+PQNRV+DHRI LTL++LD VM G +  I+D+L    +A K+++
  S:     7 LDQLEKRFDELTQQMADPAVISDADQYRKVAKAQSELSDIAAKYREWKKVEDGLAQARPMLQ-EQDAELKEMAELEIAQLEPEKLRIEEELRVLLLPKDPNDDKNVVLEIRAGTGGDEATLFAAEIFRMYSRYAETQNWKMEVTSSSESSVGGLKEVIALVSGNKVYAKLKYESGVHRVQRVPVTEQQGRVHTSAITVAVLPEADEVEVKLEAKDIRIDTFCSSGPGGQSVNTTYSAVRITHLPTGLVVSCQDEKSQIKNRAKAERVLRSRLYELELEKQQAALGAERRTMVGSGDRSEKIRTYNFPQNRVSDHRIGLTLHQLDFVMEGKMDAIVDALTEFYQAQKLKQ 354
>gi|152980137|ref|YP_001351903.1| RF-1 peptide chain release factor [Janthinobacterium sp. Marseille] >gi|166223564|sp|A6SUF6|RF1_JANMA Peptide chain release factor 1 (RF-1) >gi|151280214|gb|ABR88624.1| RF-1 peptide chain release factor [Janthinobacterium sp. Marseille] (360 aa)
Score = 760, Expect = 9.0e-79, Identities = 160/341 (46%), Positives = 238/341 (69%)
  Q:    11 LLSMEEKFNDLNKELETEGLS--VKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKML-EVQESSHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           L  + E+ ++LN  L  E  +  +    ++ +   E  P+V  +  Y++  +DI  A+ ++    D ++ E AQ E++  K  +E+ E +L+ +LLPKDPNDD+N+ +E+R   GGDE+++F GDL   Y R+A+   W+++M+ E      GY  +   I G   YSK+KFESG HRVQRVPATE++GR+HTS  TVA++PE +EVE V IN +DL+IDTYRASGAGGQHINKT+SAVRITHIPTGI V CQ+ +SQ +N+ +A+K+L A++ + +  E +   +  RK  +G+G+R+E+IRTYN+PQ R+TDHRINLTL KLD +M G+L+E+ ++L +  +A
  S:     9 LDQLTERLDELNVLLMQEDATSNMDNYRKMTREHAELGPLVALYGNYRQADSDIQDAQGMLS---DPDMKEFAQEEIAAAKTRMEQLEIDLQKMLLPKDPNDDRNIFLEIRAGTGGDEAALFAGDLLRMYSRFAERNRWQIEMVSESASEVGGYKEVIVRIIGFGAYSKLKFESGGHRVQRVPATETQGRIHTSACTVAIMPEADEVEDVNINPADLRIDTYRASGAGGQHINKTDSAVRITHIPTGIVVECQDDRSQHKNKASALKVLAARIKDVQLREQQSKEAATRKSLIGSGDRSERIRTYNFPQGRMTDHRINLTLYKLDFIMDGDLTELTNALAAEHQA 350
>gi|56697312|ref|YP_167678.1| peptide chain release factor 1 [Silicibacter pomeroyi DSS-3] >gi|81558450|sp|Q5LQM7|RF1_SILPO Peptide chain release factor 1 (RF-1) >gi|56679049|gb|AAV95715.1| peptide chain release factor 1 [Silicibacter pomeroyi DSS-3] (351 aa)
Score = 760, Expect = 9.2e-79, Identities = 156/342 (45%), Positives = 237/342 (69%)
  Q:    15 EEKFNDLNKELE------TEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           EE+ + + +  +       +G S   ++ + K   +  P+VE+   +++   D+D A  ++    D ++  LA+ EL   K  + + E  L++ LLPKD  D +  ++E+RP  GGDE+++F GDL   Y+RYA++ GWK++++E+QE+   G   +   I+GENV++++K+ESGVHRVQRVP TES GR+HTS  TVAVLPE ++V++ I+  D++IDT R+SGAGGQH+N T+SAVRITH+P+GI V   E KSQ  NRE AM++L+ +L++ + +   +  S  R  QVGTG+R+E+IRTYN+PQ R+TDHRINLTL KLD VM G+L E+ID+L +  +A  + E
  S:     4 EERLDQITQRFQYLEAAMADGASGSDIAALAKEYSDLRPVVEQIAAWRQLCADMDEARAMLS---DPDMKALAEEELPLLKARLPEAEQALQLALLPKDAADARPAMLEIRPGTGGDEAALFAGDLLRMYQRYAEARGWKLELIELQETELGGIKEVVARISGENVFARLKYESGVHRVQRVPETESGGRIHTSAATVAVLPEAQDVDIQIDPGDIRIDTMRSSGAGGQHVNTTDSAVRITHLPSGIVVTSSE-KSQHRNREIAMQVLKTRLYDLERQRLDRERSASRSAQVGTGDRSERIRTYNFPQGRMTDHRINLTLYKLDAVMQGDLDEVIDALAADGQARMLAE 348
>gi|148284270|ref|YP_001248360.1| peptide chain release factor [Orientia tsutsugamushi str. Boryong] >gi|166223581|sp|A5CCS8|RF1_ORITB Peptide chain release factor 1 (RF-1) >gi|146739709|emb|CAM79522.1| peptide chain release factor [Orientia tsutsugamushi Boryong] (359 aa)
Score = 760, Expect = 9.4e-79, Identities = 165/344 (47%), Positives = 243/344 (70%)
  Q:    16 EKFNDLNKELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVML-GNLSEIIDSLISHDEAVKMQEAKI 359
           +K+ DL  +L    L  K ++ I+K      PI+EK   Y +   +I   +++I +E+D E+  +A++EL +    + K E E+K+ LLPK+ +D KN I+E+R   GGDE+++F   LF  Y +YA+   WK ++L + ++   G    S +I+G  V++ +KFESGVHRVQR+P TES GR+HTS  TV VLPE EEV++ I+  DLKIDTYRASGAGGQH+N T+SAVRITHIPTG+ V+ Q+ KSQ +N+  AMK+L A+L++ +++++++  +  RK QVGTG+R+E+IRTYNYPQ RVTDHRINLTL K++ ++  G L EII++LIS +EA K+ ++ I
  S:    12 QKYQDLEADLNGGKLDNKELALISKEYSNLKPIIEKLNRYLKAHENIKYLQQVIDTEQDLELKSIAEVELYDTLNYLPKLEEEVKISLLPKESDDHKNAIIEVRAGTGGDEAALFAASLFQMYNKYAERKKWKFELLSISDTEIGGCKEASALISGNGVFANLKFESGVHRVQRIPKTESNGRIHTSAATVVVLPEAEEVDVKIDAKDLKIDTYRASGAGGQHVNTTDSAVRITHIPTGVVVSQQDEKSQHKNKAKAMKILYARLYDLEKQKSKQEQAISRKVQVGTGDRSERIRTYNYPQGRVTDHRINLTLYKIEEIIQEGKLDEIINNLISENEAKKIADSNI 357
>gi|157962943|ref|YP_001502977.1| peptide chain release factor 1 [Shewanella pealeana ATCC 700345] >gi|189039992|sp|A8H7A5|RF1_SHEPA Peptide chain release factor 1 (RF-1) >gi|157847943|gb|ABV88442.1| peptide chain release factor 1 [Shewanella pealeana ATCC 700345] (361 aa)
Score = 760, Expect = 9.4e-79, Identities = 160/319 (50%), Positives = 226/319 (70%)
  Q:    33 KRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGFISFM--INGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           +R   ++K   +   +V  FK +++   D++SA+++++ E D E+ E+AQ E    K  I   E EL++LLLPKDPNDD N  +E+R  AGGDE++IF GDLF  Y RYA+S  W+++++   E  HG GF   +  I+GE VY K+KFESG HRVQRVP TES+GRVHTS  TV VLPE+ E E + IN +DLK+DT+RASGAGGQH+NKT+SA+RITHIPTGI V CQ+ +SQ +NR  AM +L A++   ++E+ R      R+  V +G+R+E+IRTYN+PQ RV++HRINLTL +L   M G++  +++ LI  ++A
  S:    33 ERFRALSKEYSQLEDVVSTFKSFQQAEEDLESAKEMME-EDDPELKEMAQEEYKVAKSAIAALEDELQILLLPKDPNDDNNCFIEIRAGAGGDEAAIFAGDLFRMYSRYAESKRWQIEVMNTNEGEHG-GFKEVIAKISGEGVYGKLKFESGGHRVQRVPETESQGRVHTSACTVIVLPEVPEAEAIEINKADLKVDTFRASGAGGQHVNKTDSAIRITHIPTGIVVECQDQRSQHKNRAQAMSVLAARIQAVEDEKRRSAEESTRRNLVSSGDRSERIRTYNFPQGRVSEHRINLTLYRLGEFMEGDIDCVVEPLIQENQA 352
>gi|117621299|ref|YP_857649.1| peptide chain release factor 1 [Aeromonas hydrophila subsp. hydrophila ATCC 7966] >gi|166223525|sp|A0KMZ8|RF1_AERHH Peptide chain release factor 1 (RF-1) >gi|117562706|gb|ABK39654.1| peptide chain release factor 1 [Aeromonas hydrophila subsp. hydrophila ATCC 7966] (362 aa)
Score = 760, Expect = 9.7e-79, Identities = 154/321 (47%), Positives = 224/321 (69%)
  Q:    34 RMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           R   + +   +   IV  F+++++   ++D+  ++++ E D ++ E+AQ EL   K   E+ E  L+V+LLP+DP DD N  +E+R  AGGDE++IF GDLF  Y RYA+  GW+V ++   +  HG Y  +   + GE+VY ++KFESG HRVQRVP TES+GRVHTS  TVAVLPE+ E E + IN S+LKIDT+RASGAGGQH+NKT+SA+RITH+PTG+ V CQ+ +SQ +NR  AM +L A+L   ++E +R      R+  VG+G+R+E+IRTYNYPQ R+++HRINLTL +L  +M G+L  +I  +I   +A ++
  S:    34 RYRALTREYAQLEDIVHAFQQFRQAEENLDATRQMLE-EDDADLREMAQEELPLAKATFEEQEQALQVMLLPRDPKDDNNCYLEIRAGAGGDEAAIFAGDLFRMYSRYAERQGWRVSIVSCNDGEHGGYKEVIAKVEGEHVYGRLKFESGGHRVQRVPETESQGRVHTSACTVAVLPEVPEAEQIEINPSELKIDTFRASGAGGQHVNKTDSAIRITHLPTGLVVECQDERSQHKNRAKAMSVLSARLQAAEDERHRAAEQSTRRNLVGSGDRSERIRTYNYPQGRLSEHRINLTLYRLGEIMEGDLDCVISPMIQEYQADQL 355
>gi|160900908|ref|YP_001566490.1| peptide chain release factor 1 [Delftia acidovorans SPH-1] >gi|160366492|gb|ABX38105.1| peptide chain release factor 1 [Delftia acidovorans SPH-1] (360 aa)
Score = 760, Expect = 9.8e-79, Identities = 154/353 (43%), Positives = 243/353 (68%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVE-LVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQEAKI 359
           L   L    ++  +LN  L  E +   +K+   I++   + T I  ++  +++   D+ +A+ ++    D ++ ++AQ E++  +  + + E EL+ LLLPKDP+D +N  +E+R   GGDES++F GDL   Y R+ D++GWKV+++   ES   GY  +   + G +VY +++FESG HRVQRVPATE++GR+HTS  TVAV+PE +E + + +N +DL+IDT+RASGAGGQHINKT+SAVR+ H+PTGI   CQ+G+SQ  N+  A+++L+A+L EK+  E     + LRKG +G+G+R+++IRTYN+PQ R+TDHRINLT+ KL  VM G+L +++D+L +  EA  + E ++
  S:     5 LRQQLERYAQRLEELNFLLSREDIMGDMKQYRAISREHADVTAIAGRYARHRQREADLAAAQDMLS---DPDMADMAQEEIASAEAELVQLEDELQRLLLPKDPDDARNAYLEIRAGTGGDESALFAGDLARMYTRHCDAVGWKVEIMSANESELGGYKEVVLRVEGTDVYGRLRFESGGHRVQRVPATETQGRIHTSACTVAVMPEPDETQAITLNPADLRIDTFRASGAGGQHINKTDSAVRVVHLPTGIVAECQDGRSQHSNKAKALQVLQARLQEKERSEREAKEAALRKGLIGSGDRSDRIRTYNFPQGRLTDHRINLTIYKLLAVMEGDLGDVLDALQAAREAELLAELQV 358
>gi|118581059|ref|YP_902309.1| peptide chain release factor 1 [Pelobacter propionicus DSM 2379] >gi|166223584|sp|A1ASD1|RF1_PELPD Peptide chain release factor 1 (RF-1) >gi|118503769|gb|ABL00252.1| bacterial peptide chain release factor 1 (bRF-1) [Pelobacter propionicus DSM 2379] (354 aa)
Score = 760, Expect = 1.1e-78, Identities = 161/349 (46%), Positives = 248/349 (71%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGFISFM--INGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISH--DEAVKMQ 355
           +++ +  +E ++ +L   L    +  +     ++++   + T +V  ++ Y+R L +++   +L+    D ++ E+A+ EL   +   E+ E E+++LLLP+DPNDDK+VI+E+R   GGDES++F GDLF  Y R+AD   WKV+ +   ES  G GF   +  + GE V++K+K+ESG HRVQRVP TE++GR+HTS  TVA++ E E+V++ IN +DLKID YR+SGAGGQH+N T+SAVRITH+PTG  VACQE +SQI+NR  AMK+L+ ++ +  ++E    ++  RK QVG+G+R+E+IRTYN+PQ R+TDHRI LTL +LD +M G+++EI+D+L +H   EA+K Q
  S:     1 MFDKIEELERRYQELEALLSDPAVISNQPEFRKLSREHADLTGLVAAYRRYRRVLEEMEGNRELLA---DVDMKEMAEEELKVLEEEKERLEGEIQMLLLPRDPNDDKSVILEIRAGTGGDESALFAGDLFRMYSRFADVNRWKVETISASESERG-GFKEIIASVEGEGVFAKLKYESGTHRVQRVPETEAQGRIHTSACTVAIMAEAEDVDIDINPTDLKIDVYRSSGAGGQHVNTTDSAVRITHLPTGTVVACQEERSQIKNRAKAMKVLKTRIMDSIQQEQNARMAADRKQQVGSGDRSERIRTYNFPQGRMTDHRIGLTLYRLDAIMAGDIAEIVDALRAHYQMEALKAQ 351
>gi|74318511|ref|YP_316251.1| peptide chain release factor 1 [Thiobacillus denitrificans ATCC 25259] >gi|119361634|sp|Q3SG10|RF1_THIDA Peptide chain release factor 1 (RF-1) >gi|74058006|gb|AAZ98446.1| peptide chain release factor 1 [Thiobacillus denitrificans ATCC 25259] (360 aa)
Score = 759, Expect = 1.2e-78, Identities = 159/348 (45%), Positives = 241/348 (69%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGLSVKRMS--EINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKML-EVQESSHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEV-ELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           L + L   +E+  +L+  L    ++    S  ++ +   E +P+V  +++YK+   D  +A++++    D ++ ELA+ EL++    I + E EL+  LLP+DPND++N+ +E+R   GGDES++F G+L   Y RYA+   WKV+++ E      GY  +   I GE  YS++KFESG HRVQRVP TES+GR+HTS  TVAV+PE  EV E+ IN +DL+IDT+RASGAGGQHINKT+SAVRITH+PTG+ V CQ+ +SQ  NR  AM +L A+L +++ +  + + +  RK  +G+G+R+++IRTYN+PQ R+TDHRINLTL K+D VM G+L E++D+L +  +A ++
  S:     5 LADKLARADERLEELDALLAQPEVAADMDSYRKLTREHAELSPVVGLYRQYKQVEADQKTAQEMLA---DADMRELAEAELADGAARITELENELQTALLPRDPNDERNIFLEIRAGTGGDESALFAGNLLRMYTRYAERQRWKVEIVSESPGEVGGYKEVIVRIVGEGAYSRLKFESGGHRVQRVPETESQGRIHTSACTVAVMPEAAEVGEVDINPADLRIDTFRASGAGGQHINKTDSAVRITHLPTGLVVECQDDRSQHRNRAQAMSVLAARLKDREIQAQQASEASTRKSLIGSGDRSDRIRTYNFPQGRITDHRINLTLYKIDAVMDGDLGELLDALAAEHQAAQL 353
>gi|163783081|ref|ZP_02178076.1| peptide chain release factor RF-1 [Hydrogenivirga sp. 128-5-R1-1] >gi|159881761|gb|EDP75270.1| peptide chain release factor RF-1 [Hydrogenivirga sp. 128-5-R1-1] (361 aa)
Score = 759, Expect = 1.2e-78, Identities = 175/341 (51%), Positives = 250/341 (73%)
  Q:     5 EKLYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSL 345
           ++L + L  + EK+  + +EL    +   VKR  E+++  KE   + E ++EYKR   +++ A++L+KS  + E+ ELAQ E+ + +  I + E +LK+LL+PKDPND KNVI+E+R   GG+E+++FV DL   Y++YA+  GWK  +L   ++   GY  +  +I GE  YS++K+ESGVHRVQR+P TES GR+HTST TVAVLPE +E ++ IN  DLKI+T+RASGAGGQ++N TE+AVRITH PTGI V+CQ+ +SQ +N++ A+K+L AKL +  E + R+ I+  RK QVGTGER+EKIRTYN+PQNRVTDHR+NLTL KL++V+ G L E ID+L
  S:     4 KELIDKLEKLTEKYKRIEEELSKPEVIQDVKRYRELSREHKELAELYETYQEYKRLQRELNEAKELLKS-PEKELKELAQEEIEDIQSRIPELEEKLKLLLVPKDPNDSKNVILEIRAGTGGEEAALFVADLLRMYQKYAEDKGWKFSILNANKTGLGGYKEVIALIEGEGAYSRLKYESGVHRVQRIPVTESGGRIHTSTATVAVLPEADEADVEINPQDLKIETFRASGAGGQYVNTTETAVRITHTPTGIVVSCQDERSQFQNKQKALKILYAKLKDFYERKKREEIARERKEQVGTGERSEKIRTYNFPQNRVTDHRVNLTLYKLNDVLEGKLDEFIDAL 346
>gi|83310717|ref|YP_420981.1| protein chain release factor A [Magnetospirillum magneticum AMB-1] >gi|119361556|sp|Q2W6V3|RF1_MAGMM Peptide chain release factor 1 (RF-1) >gi|82945558|dbj|BAE50422.1| Protein chain release factor A [Magnetospirillum magneticum AMB-1] (354 aa)
Score = 759, Expect = 1.2e-78, Identities = 150/329 (45%), Positives = 236/329 (71%)
  Q:    28 EGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGN-LSEIIDSLISHDEAVKMQE 356
           EG+  + +  ++K + E  P+V   + +++   D+  A +++    D ++ +LA+ E    K  +   E E++++LLPKD  D+KN I+E+R   GG+E+++F  +LF  Y+RYA   GW+ ++++V ++   G    S  I G NV++++KFESGVHRVQRVPATES+GR+HTS  TVA++PE EEV++ +N+SDL+ D YR+ G+GGQ +N T+SAVR+THIPTG+ VACQ+ KSQ +N+ TA+K+LRA+L+E++        +  RK QVG+G+R+E+IRTYN+PQ RVTDHRIN+TL K+D VM G+ L E++++L++ D+A ++ E
  S:    25 EGMDSQTIQRLSKELSELDPVVTAVQAFRKAREDMVQAAEMMN---DPDMKDLAEEEFYALKERLPALEREVQIMLLPKDEADEKNAIIEVRAGTGGEEAALFAAELFRMYERYAGLHGWRFEVMDVNDTGIGGVKEASATITGRNVFARLKFESGVHRVQRVPATESQGRIHTSAATVAIMPEAEEVDIQLNDSDLRFDVYRSQGSGGQSVNTTDSAVRVTHIPTGLAVACQQEKSQHKNKATALKLLRARLYERERSAKDAERAAARKSQVGSGDRSERIRTYNFPQGRVTDHRINMTLYKIDAVMSGDALDELVEALVAADQAERLAE 352
>gi|115350468|ref|YP_772307.1| peptide chain release factor 1 [Burkholderia ambifaria AMMD] >gi|170703671|ref|ZP_02894403.1| peptide chain release factor 1 [Burkholderia ambifaria IOP40-10] >gi|172059501|ref|YP_001807153.1| peptide chain release factor 1 [Burkholderia ambifaria MC40-6] >gi|122324144|sp|Q0BIQ0|RF1_BURCM Peptide chain release factor 1 (RF-1) >gi|115280456|gb|ABI85973.1| bacterial peptide chain release factor 1 (bRF-1) [Burkholderia ambifaria AMMD] >gi|170131417|gb|EDT00013.1| peptide chain release factor 1 [Burkholderia ambifaria IOP40-10] >gi|171992018|gb|ACB62937.1| peptide chain release factor 1 [Burkholderia ambifaria MC40-6] (360 aa)
Score = 759, Expect = 1.2e-78, Identities = 156/341 (45%), Positives = 240/341 (70%)
  Q:    11 LLSMEEKFNDLNKELETEGLS--VKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEV-ELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           L  +  +  +LN  L  E ++  + +   + +   E  P+VE++  ++++ ND  +A++L+    D  + + A+ E+   +  + + E EL+ +LLPKDPNDD+N+ +E+R  AGGDES++F GDL   Y R+A+   W+V+M+    S   GY  +   I G+  YS++KFESG HRVQRVPATE++GR+HTS  TVAV+PE +E+ E+ IN +DL+IDT+RASGAGGQHINKT+SAVR+THIPTGI V CQ+ +SQ +N++ A+K+L A++ +K+  E     +  RK  +G+G+R+E+IRTYN+PQ R+TDHRINLTL +L+ +M G+L E+I +L++  +A
  S:     9 LDQLSTRLAELNDLLSRENVTADLDQYRRLTREHAELGPVVEQYALWRQSRNDETAAQELLA---DASMRDFAEDEIRSARERMVRLEAELQKMLLPKDPNDDRNIFLEIRAGAGGDESALFAGDLLRMYLRFAERQRWQVEMMSESASDLGGYKEVIVRIAGQGAYSRLKFESGGHRVQRVPATETQGRIHTSACTVAVMPEADEIGEVEINPADLRIDTFRASGAGGQHINKTDSAVRVTHIPTGIVVECQDDRSQHKNKDRALKVLAARIKDKQYHEQHAKEAATRKSLIGSGDRSERIRTYNFPQGRMTDHRINLTLYRLEALMDGDLDELIGALVTEHQA 350
>gi|33595093|ref|NP_882736.1| peptide chain release factor 1 [Bordetella parapertussis 12822] >gi|46576758|sp|Q7WCE3|RF1_BORPA Peptide chain release factor 1 (RF-1) >gi|33565170|emb|CAE35966.1| peptide chain release factor 1 [Bordetella parapertussis] (360 aa)
Score = 759, Expect = 1.3e-78, Identities = 151/321 (47%), Positives = 230/321 (71%)
  Q:    34 RMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEV-ELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           R  ++++   E  P+VE F  +     D+ +A++++    D ++  +A+ E+   +  IE+ E  L++LLLP+DP+D +++ +E+R   GGDES++F GDL   Y RYA++ GW+V+++   ES   GY  +   I+G+  Y ++KFESG HRVQRVPATE++GR+HTS  TVAV+PE + + ++VIN SDL+IDT+RASGAGGQHINKT+SAVRITH+PTG+ V CQ+ +SQ  N++ AM++L A+L +K+  E +   +  RK  +G+G+R+E+IRTYNYPQ RVTDHRINLTL KL  +M G+L E+  +L++  +A ++
  S:    34 RFRKLSRERAELEPVVEAFNAFLGVEADVATAQEMLS---DPDMKAMAEDEIKTGRARIEEMEAALQLLLLPRDPDDGRSLFLEIRAGTGGDESALFSGDLLRMYTRYAETRGWRVEIMSESESELGGYKEVIVRIDGDGAYGRLKFESGAHRVQRVPATEAQGRIHTSACTVAVMPEADAMSDIVINPSDLRIDTFRASGAGGQHINKTDSAVRITHVPTGLVVECQDDRSQHRNKDKAMQVLAARLKDKEMRERQSKEAAERKSLIGSGDRSERIRTYNYPQGRVTDHRINLTLYKLQQIMEGDLDELTGALLAEHQAEQL 353
>gi|99080782|ref|YP_612936.1| peptide chain release factor 1 [Silicibacter sp. TM1040] >gi|119361610|sp|Q1GI42|RF1_SILST Peptide chain release factor 1 (RF-1) >gi|99037062|gb|ABF63674.1| bacterial peptide chain release factor 1 (bRF-1) [Silicibacter sp. TM1040] (350 aa)
Score = 759, Expect = 1.3e-78, Identities = 157/322 (48%), Positives = 229/322 (71%)
  Q:    35 MSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGFISFM--INGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           ++++ K   +  P+VE+   Y++ L+D+  AE+++    D ++  LA+ E+   K  + + E+ L++ LLPKD  D +  I+E+RP  GGDE+++F  DL+  Y RYA++ GWKV ++E Q S  G G    +  ING+ V++++K+ESGVHRVQRVP TES GR+HTS  TVAVLPE E+V++ I+ +DL+IDT RASGAGGQH+N T+SAVRITH+PTG+ V   E KSQ  NRE AM++L+ +L++ + +      S  R  QVG+G+R+E+IRTYN+PQ R++DHRINLTL KLD +M G+L EIID+LIS  +A  + E
  S:    29 IAKLAKEYSDLRPVVEQISAYQQLLSDLAEAEEMLA---DPDMKALAEEEIPTLKAALPQAEHALQLALLPKDEADSRAAILEIRPGTGGDEAALFAADLYRMYSRYAETQGWKVDVIEEQASELG-GLKELVARINGDGVFARLKYESGVHRVQRVPVTESGGRIHTSAATVAVLPEAEDVDIKIDANDLRIDTMRASGAGGQHVNTTDSAVRITHLPTGLVVTSSE-KSQHRNREIAMQVLKTRLYDLERQRIDTERSADRASQVGSGDRSERIRTYNFPQGRMSDHRINLTLYKLDQIMGGDLDEIIDALISEHQAKLLAE 347
>gi|88657945|ref|YP_507408.1| peptide chain release factor 1 [Ehrlichia chaffeensis str. Arkansas] >gi|119361539|sp|Q2GGM5|RF1_EHRCR Peptide chain release factor 1 (RF-1) >gi|88599402|gb|ABD44871.1| peptide chain release factor 1 [Ehrlichia chaffeensis str. Arkansas] (359 aa)
Score = 759, Expect = 1.3e-78, Identities = 171/351 (48%), Positives = 246/351 (70%)
  Q:     9 NSLLSMEEKFNDLNKELETEG-LSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKS-EKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGF---ISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVML-GNLSEIIDSLISHDEAVKMQEAKI 359
           NSL  + +KF  L   LE    LSV      +K   E  P++    +Y     DI   E+LI + E D+E+  LA+ E  E++  + K +++LK+ LLPKD +D +N I+E+R   GG+E+++FV DL+  Y +YA+   WK +  ++  SS G G    IS  I+G NV++++KFESGVHRVQRVP TE+ GR+HTS  TVAVLPE+EEV+L I+  DL+ID YR+SG GGQ +N T+SAVRITHIP+GI V  Q+ KSQ +N+  A+K+LRA+L+  ++++    IS +RK Q+G+G+R+E+IRTYN+PQ+R+TDHRINLTL +LD++M  GNL E I++LI+ DEA K++   I
  S:     5 NSLEELSQKFYKLKSMLEDPSQLSVDSFVAASKEYSELLPVISVIDQYNILQKDIAGLEELINNPETDHELKSLAKEEFYERQKQLPKVKHKLKLSLLPKDKDDARNAILEIRAGTGGEEAALFVTDLYRMYTKYAEQKNWKFE--QINSSSTGIGGHKEISLCISGSNVFARLKFESGVHRVQRVPETEASGRLHTSAATVAVLPEIEEVDLKIDEKDLRIDVYRSSGPGGQSVNTTDSAVRITHIPSGIVVIQQDEKSQHKNKSKALKVLRARLYNLEKQKRDAEISQMRKSQIGSGDRSERIRTYNFPQSRITDHRINLTLYRLDDIMKEGNLDEFIEALIAEDEANKLKNLHI 359
>gi|56751903|ref|YP_172604.1| peptide chain release factor 1 [Synechococcus elongatus PCC 6301] >gi|81301012|ref|YP_401220.1| peptide chain release factor 1 [Synechococcus elongatus PCC 7942] >gi|81561678|sp|Q5N0T6|RF1_SYNP6 Peptide chain release factor 1 (RF-1) >gi|119361627|sp|Q31L36|RF1_SYNP7 Peptide chain release factor 1 (RF-1) >gi|56686862|dbj|BAD80084.1| peptide chain release factor RF-1 [Synechococcus elongatus PCC 6301] >gi|81169893|gb|ABB58233.1| bacterial peptide chain release factor 1 (bRF-1) [Synechococcus elongatus PCC 7942] (368 aa)
Score = 759, Expect = 1.4e-78, Identities = 166/350 (47%), Positives = 249/350 (71%)
  Q:     7 LYNSLLSMEEKFNDLNK-----ELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIK-SEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKML-EVQESSHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           L   L S+E+ F DL +     E+ T+    +R++ +  S++E   +V  ++E+K+   ++  A ++++ S  D E+ E+A LE++E + L+   E  LK+LLLP+DPNDDKN+++E+R   GGDE+S++ GDL   Y RYA+S GW+VK+L E      GY      I GE+VYSK+KFE+GVHRVQRVPATE+ GRVHTST TVA++PE++EVE+ I+  D+++ T R+ GAGGQ++NK E+AV + H PTGI + C E +SQ++NRE AM++LRAKL+E K +E ++ +S +R+ QVGTG R+EKIRTYNY  NR TDHR+ L  + L+ V+ G + E+I + IS D+  ++ +
  S:     6 LIEKLQSVEQTFQDLTRRLADPEIATDPREFQRVARMRSSMEE---LVTTYEEWKQRDAELKGAREILRESSGDPELREMAALEVNELEALLVSLEERLKILLLPRDPNDDKNIMLEIRAGTGGDEASLWAGDLLRMYSRYAESQGWRVKLLSESTGELGGYKEAILEIQGESVYSKLKFEAGVHRVQRVPATEAGGRVHTSTATVAIMPEVDEVEVSIDPKDIELTTARSGGAGGQNVNKVETAVDLFHKPTGIRIFCTEERSQLQNRERAMQILRAKLYEMKLQEQQEAVSSMRRSQVGTGSRSEKIRTYNYKDNRATDHRLGLNFS-LNPVLEGEIEEVIQACISKDQTEQLAQ 358
>gi|113971503|ref|YP_735296.1| peptide chain release factor 1 [Shewanella sp. MR-4] >gi|114046304|ref|YP_736854.1| peptide chain release factor 1 [Shewanella sp. MR-7] >gi|119361605|sp|Q0HFC8|RF1_SHESM Peptide chain release factor 1 (RF-1) >gi|119361606|sp|Q0HYK8|RF1_SHESR Peptide chain release factor 1 (RF-1) >gi|113886187|gb|ABI40239.1| peptide chain release factor 1 [Shewanella sp. MR-4] >gi|113887746|gb|ABI41797.1| peptide chain release factor 1 [Shewanella sp. MR-7] (363 aa)
Score = 759, Expect = 1.4e-78, Identities = 158/319 (49%), Positives = 229/319 (71%)
  Q:    33 KRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGF--ISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           +R   ++K   +   +V  FK Y++ L D++SA+++++ E D E+ E+AQ E+   K  +E+ E EL++LLLPKDPNDD N  +E+R  AGGDE++IF GDLF  Y RYA++  W+++++   E  HG GF  I   ++GE  Y K+KFESG HRVQRVP TES+GRVHTS +TV V+ E+ E E + IN +DLK+DT+R+SGAGGQH+NKT+SA+RITHIPTGI V CQ+ +SQ +NR  AM +L A++   ++E+ R      R+  V +G+R+E++RTYN+PQ RV++HRINLTL +L+ VM G+L  I+  L+   +A
  S:    33 ERFRALSKEYSQLEEVVAGFKAYQQALADLESAKEMLE-EDDAEMREMAQEEIKAAKAELERLEAELQILLLPKDPNDDTNAFIEIRAGAGGDEAAIFAGDLFRMYSRYAEANRWQLEIMSSNEGEHG-GFKEIIVKVSGEGAYGKLKFESGGHRVQRVPETESQGRVHTSAVTVVVMHEVPEAEAISINPADLKVDTFRSSGAGGQHVNKTDSAIRITHIPTGIVVECQDQRSQHKNRAQAMSVLAARIQAVEDEKRRSAEESTRRSLVASGDRSERVRTYNFPQGRVSEHRINLTLYRLNEVMEGDLDAILGPLMQEHQA 352
>gi|161870534|ref|YP_001599706.1| peptide chain release factor 1 [Neisseria meningitidis 053442] >gi|189039981|sp|A9M1Q8|RF1_NEIM0 Peptide chain release factor 1 (RF-1) >gi|161596087|gb|ABX73747.1| peptide chain release factor I [Neisseria meningitidis 053442] (358 aa)
Score = 758, Expect = 1.5e-78, Identities = 162/315 (51%), Positives = 226/315 (71%)
  Q:    37 EINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVE-LVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           ++ +   E TP+VE F+ Y+   +D+  AE+++    D E+ + A  E+   K  I   + EL+ LLLPKD +DDKN+ +E+R   GGDE+++F GDL   Y RYA+   W+V+++   ES   GY  +   I G   YS++KFESG HRVQRVPATES+GR+HTS  TVAV+PE +E+E + +N  DL+IDT+RASGAGGQHINKT+SAVRITH+PTG+ V CQ+G+SQ  N+  AMK+L A+L + ++ E +   +  RK  +G+G+R+E+IRTYNYPQ RVTDHRINLTL+KLD VM G+L+EI D+LI+  +A
  S:    37 KLTREHAELTPVVEVFQNYRLAQSDLADAEEMLS---DPEMKDFAAEEIEAAKAKIGALDTELQKLLLPKDADDDKNIFIEVRAGTGGDEAALFAGDLLRMYSRYAERNRWQVEIVSANESELGGYKEVIARIIGLGAYSRLKFESGGHRVQRVPATESQGRIHTSACTVAVMPEADELEDIELNPVDLRIDTFRASGAGGQHINKTDSAVRITHLPTGMVVECQDGRSQHANKAQAMKVLAARLNDAQKREAQAKEAAERKSLIGSGDRSERIRTYNYPQGRVTDHRINLTLHKLDFVMDGDLAEITDALIAEHQA 350
>gi|146277160|ref|YP_001167319.1| peptide chain release factor 1 [Rhodobacter sphaeroides ATCC 17025] >gi|166223594|sp|A4WRK0|RF1_RHOS5 Peptide chain release factor 1 (RF-1) >gi|145555401|gb|ABP70014.1| bacterial peptide chain release factor 1 (bRF-1) [Rhodobacter sphaeroides ATCC 17025] (351 aa)
Score = 758, Expect = 1.5e-78, Identities = 157/348 (45%), Positives = 236/348 (67%)
  Q:     9 NSLLSMEEKFNDLNKELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           + LL +  +F  L   L + G +   ++ +++   E  P+V +   Y+  L D+  AE ++    D E+  LA+ EL   +  I + E  L++ LLP+D  D +  I+E+RP  GG+E+++F GDL   Y+RYA++ GW+ ++L++  S   G    +  I GE  ++++K+ESGVHRVQRVP TE++GR+HTS  TVAVLPE EEV++ I  +D++IDT R+SGAGGQH+N T+SAVRITH+PTGI V   E KSQ  NRE AM++LRA+L++ + +   +  S  RK QVG+G+R+E+IRTYN+PQ R+TDHRINLTL  L  +M G+L+E+I +L +HD+A ++ E
  S:     5 DRLLQIVRRFEFLEARL-SAGAAPAEIAALSREYAELKPVVAEIAAYRTALEDLAEAEAMLA---DPEMRALAEDELPRLRARIPEMEQALRLALLPRDAADARPAILEIRPGTGGEEAALFAGDLLRMYQRYAEAQGWRFELLDLAPSELGGIREATARIEGEGAFARLKYESGVHRVQRVPETEAQGRIHTSAATVAVLPEAEEVDIAIPAADIRIDTMRSSGAGGQHVNTTDSAVRITHLPTGIVVTSSE-KSQHRNREIAMQVLRARLYDLERQRLAEARSADRKAQVGSGDRSERIRTYNFPQGRMTDHRINLTLYALPQIMAGDLAEVIAALTAHDQAARLAE 348
>gi|126739408|ref|ZP_01755101.1| peptide chain release factor 1 [Roseobacter sp. SK209-2-6] >gi|126719508|gb|EBA16217.1| peptide chain release factor 1 [Roseobacter sp. SK209-2-6] (351 aa)
Score = 758, Expect = 1.5e-78, Identities = 164/356 (46%), Positives = 240/356 (67%)
  Q:     1 MIYNEKLYNSLLSMEEKFNDLNKELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           MI  E+L   L    ++F  L   +  EG S   ++++ +   E  P+ E+   Y++ L D++ AE ++    D ++ ELA+ E+   K  +   E+ L++ LLPKD  D +  ++E+RP  GGDE+S+F GDL   Y+RYA++ GWK +++E Q +   G   +   I GENV+++MK+ESGVHRVQRVP TES GR+HTS  TVAVLPE E+V++ I+ +DL+IDT R+SGAGGQH+N T+SAVRITH+PTG+ V   E KSQ  NRE AM++L+ +L++ + +      S  R  QVG+G+R+E+IRTYN+PQ R++DHRINLTL KLD +M G+L EIID+L +  +A  + E
  S:     1 MIPEERLEQIL----QRFQYLEAAM-AEGASGAEIADLAREYSEIKPVAEQICAYRQLLADLEEAEVMLA---DPDMKELAEEEIPTLKAALPDAEHALQLALLPKDAADTRPAMLEIRPGTGGDEASLFAGDLLRMYQRYAEARGWKFEVIEEQATELGGIKEVVVHIKGENVFARMKYESGVHRVQRVPVTESGGRIHTSAATVAVLPEAEDVDIHIDANDLRIDTMRSSGAGGQHVNTTDSAVRITHLPTGLVVTSSE-KSQHRNREIAMQVLKTRLYDLERQRIDSERSADRASQVGSGDRSERIRTYNFPQGRMSDHRINLTLYKLDQIMQGDLDEIIDALTADHQARLLSE 348
>gi|90581727|ref|ZP_01237514.1| peptide chain release factor 1 [Vibrio angustum S14] >gi|90437081|gb|EAS62285.1| peptide chain release factor 1 [Vibrio angustum S14] (362 aa)
Score = 758, Expect = 1.6e-78, Identities = 158/321 (49%), Positives = 227/321 (70%)
  Q:    34 RMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           R   ++K   +   + + F+ Y++   D+ +AE++ + E D E+ E+AQ E+ E K  IE+   EL+VLL+PKDPNDD+N  VE+R  AGGDE+ IF GDLF  Y +YA+S GW+++++    S  G Y  +   +NG+ VY  +KFESG HRVQRVPATES+GRVHTS  TVAVLPE+ E E+  IN  DLKIDT+RASGAGGQH+N T+SA+RITH+PTGI V CQ+ +SQ +N+  AM +L A++ + +EE+     +  R+  +G+G+R+++IRTYNYPQ RV+DHRI LTL +L+ VM G+L  +I  + +  +A ++
  S:    34 RFRALSKEYSQLEEVTKCFQAYQQAKEDLVAAEEMAQ-EDDAEMREMAQEEIKEAKAEIERLADELQVLLIPKDPNDDRNCFVEIRAGAGGDEAGIFAGDLFRMYSKYAESRGWRIEIINENRSEQGGYKEMIAKVNGDGVYGILKFESGGHRVQRVPATESQGRVHTSACTVAVLPEIPEAEIPEINAGDLKIDTFRASGAGGQHVNTTDSAIRITHLPTGIVVECQDERSQHKNKAKAMSVLAARIIKAEEEKRHAEEASTRRNLLGSGDRSDRIRTYNYPQGRVSDHRITLTLYRLNEVMEGDLDALIQPVFTEYQADQL 355
>gi|194564361|ref|YP_002099384.1| Peptide chain release factor 1 [Burkholderia dolosa AUO158] >gi|124895985|gb|EAY69865.1| Peptide chain release factor 1 [Burkholderia dolosa AUO158] (360 aa)
Score = 758, Expect = 1.6e-78, Identities = 155/341 (45%), Positives = 241/341 (70%)
  Q:    11 LLSMEEKFNDLNKELETEGLS--VKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEV-ELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           L  +  +  +LN+ L  E ++  + +  ++ +   E  P+VE++  ++++ +D  +A++L+    D  + + A+ E+   +  + + E EL+ +LLPKDPNDD+N+ +E+R   GGDES++F GDL   Y R+A+   W+V+M+    S   GY  +   I G+  YS++KFESG HRVQRVPATE++GR+HTS  TVAV+PE +E+ E+ IN +DL+IDT+RASGAGGQHINKT+SAVR+THIPTGI V CQ+ +SQ +N++ A+K+L A++ +K+  E     +  RK  +G+G+R+E+IRTYN+PQ R+TDHRINLTL +L+ +M G+L E+I +L+S  +A
  S:     9 LDQLSTRLAELNELLSRENVTADLDQYRKLTREHAELGPVVEQYALWRQSRSDETAAQELLA---DPSMRDFAEDEIRSARDRMARLELELQKMLLPKDPNDDRNIFLEIRAGTGGDESALFAGDLLRMYLRFAERQRWQVEMMSESPSDLGGYKEVIVRIAGQGAYSRLKFESGGHRVQRVPATETQGRIHTSACTVAVMPEADEIGEVEINPADLRIDTFRASGAGGQHINKTDSAVRVTHIPTGIVVECQDDRSQHKNKDRALKVLAARIKDKQYHEQHAKEAATRKSLIGSGDRSERIRTYNFPQGRMTDHRINLTLYRLEAIMDGDLDELIGALVSEHQA 350
>gi|56416889|ref|YP_153963.1| peptide chain release factor 1 [Anaplasma marginale str. St. Maries] >gi|81599140|sp|Q5PAH2|RF1_ANAMM Peptide chain release factor 1 (RF-1) >gi|56388121|gb|AAV86708.1| peptide chain release factor 1 [Anaplasma marginale str. St. Maries] (359 aa)
Score = 758, Expect = 1.7e-78, Identities = 164/348 (47%), Positives = 250/348 (71%)
  Q:     9 NSLLSMEEKFNDLNKEL-ETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKS-EKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVML-GNLSEIIDSLISHDEAVKMQE 356
           +SL  + EKF  L ++L + E L V+     ++   +  PI+   +EY+    +I+  E LI S + D E++ LA+ EL  K+ LI K +++L++ LLPKD +D ++ I+E+R   GG+E+++FV DL+  Y +YA+   WKV+ + +  +   GY   S  I G++V++++KFESGVHRVQRVP TES GR+HTS  TVAVLPE+EEV+L I+  DL+ID YR+SG GGQ +N T+SAVRITHIPTGI V  Q+ KSQ +N+  A+K+LRA+L+  ++++    IS +RK Q+G+G+R+E+IRTYN+ Q+R+TDHRIN+TL +L+++M  G+L E +D+LI+ D+A K+Q+
  S:     5 DSLEGLCEKFRILKQQLSDPESLGVQAFVVASREYSDLLPIMSLIEEYQTAQKEIEELEGLINSTDTDAELVHLAREELYTKQKLIPKLKHQLQLSLLPKDKDDSRSAILEIRAGTGGEEAALFVCDLYRMYIKYAERKSWKVEPIGISTTGIGGYKEASLCIGGKDVFARLKFESGVHRVQRVPETESSGRLHTSAATVAVLPEVEEVDLKIDEKDLRIDVYRSSGPGGQSVNTTDSAVRITHIPTGIVVIQQDEKSQHKNKSKALKVLRARLYNLEKQKIEDEISKMRKSQIGSGDRSERIRTYNFLQSRITDHRINMTLYRLEHIMKEGDLDEFVDALIADDQANKLQQ 356
>gi|33591871|ref|NP_879515.1| peptide chain release factor 1 [Bordetella pertussis Tohama I] >gi|33599373|ref|NP_886933.1| peptide chain release factor 1 [Bordetella bronchiseptica RB50] >gi|46576754|sp|Q7W023|RF1_BORPE Peptide chain release factor 1 (RF-1) >gi|46576762|sp|Q7WQE9|RF1_BORBR Peptide chain release factor 1 (RF-1) >gi|33566969|emb|CAE30882.1| peptide chain release factor 1 [Bordetella bronchiseptica RB50] >gi|33571515|emb|CAE40989.1| peptide chain release factor 1 [Bordetella pertussis Tohama I] (360 aa)
Score = 758, Expect = 1.7e-78, Identities = 151/321 (47%), Positives = 230/321 (71%)
  Q:    34 RMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEV-ELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           R  ++++   E  P+VE F  +     D+ +A++++    D ++  +A+ E+   +  IE+ E  L++LLLP+DP+D +++ +E+R   GGDES++F GDL   Y RYA++ GW+V+++   ES   GY  +   I+G+  Y ++KFESG HRVQRVPATE++GR+HTS  TVAV+PE + + ++VIN SDL+IDT+RASGAGGQHINKT+SAVRITH+PTG+ V CQ+ +SQ  N++ AM++L A+L +K+  E +   +  RK  +G+G+R+E+IRTYNYPQ RVTDHRINLTL KL  +M G+L E+  +L++  +A ++
  S:    34 RFRKLSRERAELEPVVEAFNAFLGVEADVATAQEMLS---DPDMKAMAEDEIKTGRARIEEMEAALQLLLLPRDPDDGRSLFLEIRAGTGGDESALFSGDLLRMYTRYAETRGWRVEIMSESESELGGYKEVIARIDGDGAYGRLKFESGAHRVQRVPATEAQGRIHTSACTVAVMPEADAMSDIVINPSDLRIDTFRASGAGGQHINKTDSAVRITHVPTGLVVECQDDRSQHRNKDKAMQVLAARLKDKEMRERQSKEAAERKSLIGSGDRSERIRTYNYPQGRVTDHRINLTLYKLQQIMEGDLDELTGALLAEHQAEQL 353
>gi|154149107|ref|YP_001407141.1| peptide chain release factor 1 [Campylobacter hominis ATCC BAA-381] >gi|166223542|sp|A7I3Q0|RF1_CAMHC Peptide chain release factor 1 (RF-1) >gi|153805116|gb|ABS52123.1| peptide chain release factor 1 [Campylobacter hominis ATCC BAA-381] (355 aa)
Score = 758, Expect = 1.8e-78, Identities = 161/328 (49%), Positives = 234/328 (71%)
  Q:    32 VKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQE-SSHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNL-SEIIDSLISHDEAVKMQEAKI 359
           +  +++++K  +   P+     +Y   L +I+  + LI    D E+ +LA+ EL   +    K E E+K+LL+PKDPND+KN+ +E+R   GGDE+++F GDL  AY RYA+  G+K +++   E S+ G+  +  ++ G+  YS++KFE G HRVQRVP TES+GRVHTS ITVA++PE+E+ E+ IN +DL+ID  RASG GGQ +N T+SAVRITHIPTG+ V  Q+GKSQ +N+E AMK+L+A+L++ +E+E +      RK QVGTG+R+ +IRTYNYPQNR+TDHRINLTL +LD +M G L  EIID LI+H +A  + +++I
  S:    29 ISLVTKLSKEQRSIEPVRNATLQYLEVLKNIEDNKSLIN---DTELGDLAKEELKNLEISQNKLEEEIKILLIPKDPNDEKNIFLEIRAGTGGDEAALFAGDLLDAYLRYAELRGYKTEIVSQSEGSAGGFKEVILLVKGDGAYSRLKFEGGTHRVQRVPETESQGRVHTSAITVAIMPEIEDSEIQINENDLRIDVMRASGHGGQCVNTTDSAVRITHIPTGLVVTNQDGKSQHKNKEAAMKVLKARLYDLQEKERKAKEQSERKDQVGTGDRSGRIRTYNYPQNRITDHRINLTLYRLDAIMAGGLFDEIIDPLIAHAQAEAINKSEI 355
>gi|109898878|ref|YP_662133.1| peptide chain release factor 1 [Pseudoalteromonas atlantica T6c] >gi|119361579|sp|Q15SQ9|RF1_PSEA6 Peptide chain release factor 1 (RF-1) >gi|109701159|gb|ABG41079.1| bacterial peptide chain release factor 1 (bRF-1) [Pseudoalteromonas atlantica T6c] (362 aa)
Score = 758, Expect = 1.9e-78, Identities = 160/347 (46%), Positives = 239/347 (68%)
  Q:     5 EKLYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           E +   L S+ E+F ++   +    +     +   + K   +   +V+ F +Y+    D +SA+++++ E D E+ E+AQ E    K  IE+YE EL++LLLPKDPND+ N  +E+R  AGGDE++IF GDLF  Y RYA++  WKV+++ + E  HG Y  +   I G+  Y  +KFESG HRVQRVP TES+GR+HTS  TV V+PE+ E E + +N +DLKIDT+RASGAGGQH+NKT+SA+RITH+P+GI V CQ+ +SQ +NR  AM +L+++L + +EE+ +   +  R+  V +G+R+E+IRTYN+PQ RVTDHRINLTL +LD+V+ G+L  +++ +    +A
  S:     3 ESVQRKLESLTERFEEVQALVSQPEIIADQDKYRALTKEYSQLEGVVKCFADYQGAQGDFESAQEMMQ-ESDPEMREMAQEEYKSSKQAIEQYEDELQILLLPKDPNDESNCFIEIRAGAGGDEAAIFAGDLFRMYSRYAEARRWKVEVVTMNEGDHGGYKEVIANIIGDGAYGVLKFESGGHRVQRVPETESQGRIHTSACTVVVMPEVPESEAIEVNKADLKIDTFRASGAGGQHVNKTDSAIRITHVPSGIVVECQDERSQHKNRAKAMAVLQSRLNKLEEEKRQAEETSTRRNLVASGDRSERIRTYNFPQGRVTDHRINLTLYRLDDVVAGDLDAVLEPIRQEHQA 352
>gi|148826783|ref|YP_001291536.1| peptide chain release factor 1 [Haemophilus influenzae PittGG] >gi|148718025|gb|ABQ99152.1| peptide chain release factor 1 [Haemophilus influenzae PittGG] (361 aa)
Score = 758, Expect = 1.9e-78, Identities = 165/344 (47%), Positives = 238/344 (69%)
  Q:    11 LLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           L S++E++ +L   L    +     +    +K   +   +V+ F  + +   +I+ AE L+    D E+ E+AQ+E+ E K  IE+ E +L++LLLPKDPND+ N  +E+R   GGDE+ IF GDLF  Y RYA+S  W+V+ML   ES  G Y  +   ++GE VY ++KFESG HRVQRVP TES+GR+HTS  TVAV+PEL E E+  IN +DL+IDTYR+SGAGGQH+N T+SAVRITHIPTGI V CQ+ +SQ +N+  AM +L +++ + ++E      +D+R+  +G+G+R++KIRTYNYPQ RVTDHRINLT+ +LD VM G + E+I  +I+  +A ++
  S:    10 LESLKERYEELEALLGDVSVISDQDKFRAYSKEYSQLEEVVKCFNRWTQLNQNIEEAEILLD---DPEMKEMAQMEIEESKAEIEEVEQQLQILLLPKDPNDEYNCYLEIRAGTGGDEAGIFAGDLFRMYSRYAESKRWRVEMLSANESEQGGYKEVIVKVSGEGVYGQLKFESGGHRVQRVPKTESQGRIHTSACTVAVMPELPESEMPEINPADLRIDTYRSSGAGGQHVNTTDSAVRITHIPTGIVVECQDERSQHKNKAKAMSVLASRIVQAEQERQAAEQTDMRRNLLGSGDRSDKIRTYNYPQGRVTDHRINLTIYRLDEVMNGKIDELIQPIITEYQADQL 354
>gi|113869288|ref|YP_727777.1| peptide chain release factor 1 [Ralstonia eutropha H16] >gi|113528064|emb|CAJ94409.1| protein chain release factor A (RF-1) [Ralstonia eutropha H16] (356 aa)
Score = 757, Expect = 2.0e-78, Identities = 152/344 (44%), Positives = 242/344 (70%)
  Q:    11 LLSMEEKFNDLNKELETEGLSVK--RMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEV-ELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           L  + E+ +++N  L  E  + K  +  ++++   E +P+ E++ +Y++  +D+ +A+ L+    D E+ + A  E++  +  +E  E  L+ LLLPKDPNDD+N+++E+R   GG+ES++F GDL   Y RYA+   W+V+++    S   GY  +   I G+  +S++KFESG HRVQRVPATE++GR+HTS  TVAV+PE +EV E+ IN +DL+IDT+RASGAGGQH+NKT+SAVR+TH+PTGI V CQ+ +SQ  N++ AMK+L A++ + +    +   +  R+  +G+G+R+++IRTYN+PQ RVTDHRINLTL K+D +M G++ E++ +L S  +A ++
  S:     5 LDQLAERLDEVNALLAREDATAKIDQYRKLSREHAELSPVAEQYGQYRQAQDDLATAQALLD---DPEMKDFAADEIASARARLEGLEASLQRLLLPKDPNDDRNLLLEIRAGTGGEESALFAGDLLRMYTRYAERQRWQVEVMSESASDLGGYKEVIVRIAGDAAFSRLKFESGGHRVQRVPATEAQGRIHTSACTVAVMPEADEVGEVEINPADLRIDTFRASGAGGQHVNKTDSAVRLTHLPTGIVVECQDDRSQHRNKDKAMKVLAARIKDMQTRAAQAKEASTRRNLIGSGDRSDRIRTYNFPQGRVTDHRINLTLYKIDMIMDGDMDELLSALASEHQADQL 349
>gi|16273461|ref|NP_439710.1| peptide chain release factor 1 [Haemophilus influenzae Rd KW20] >gi|145631803|ref|ZP_01787563.1| peptide chain release factor 1 [Haemophilus influenzae 22.4-21] >gi|145637543|ref|ZP_01793200.1| peptide chain release factor 1 [Haemophilus influenzae PittHH] >gi|145642039|ref|ZP_01797610.1| peptide chain release factor 1 [Haemophilus influenzae R3021] >gi|148826083|ref|YP_001290836.1| peptide chain release factor 1 [Haemophilus influenzae PittEE] >gi|1574404|gb|AAC23209.1| peptide chain release factor 1 (prfA) [Haemophilus influenzae Rd KW20] >gi|144982593|gb|EDJ90143.1| peptide chain release factor 1 [Haemophilus influenzae R3021] >gi|145269229|gb|EDK09175.1| peptide chain release factor 1 [Haemophilus influenzae PittHH] >gi|145273219|gb|EDK13094.1| peptide chain release factor 1 [Haemophilus influenzae 22.4-21] >gi|148716243|gb|ABQ98453.1| peptide chain release factor 1 [Haemophilus influenzae PittEE] (361 aa)
Score = 757, Expect = 2.1e-78, Identities = 165/344 (47%), Positives = 237/344 (68%)
  Q:    11 LLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           L S++E++ +L   L    +     +    +K   +   +V+ F  + +   +I+ AE L+    D E+ E+AQ+E+ E K  IE+ E +L++LLLPKDPND+ N  +E+R   GGDE+ IF GDLF  Y RYA+S  W+V+ML   ES  G Y  +   + GE VY ++KFESG HRVQRVP TES+GR+HTS  TVAV+PEL E E+  IN +DL+IDTYR+SGAGGQH+N T+SAVRITHIPTGI V CQ+ +SQ +N+  AM +L +++ + ++E      +D+R+  +G+G+R++KIRTYNYPQ RVTDHRINLT+ +LD VM G + E+I  +I+  +A ++
  S:    10 LESLKERYEELEALLGDVSVISDQDKFRAYSKEYSQLEEVVKCFNRWTQLNQNIEEAEILLD---DPEMKEMAQMEIEESKAEIEEVEQQLQILLLPKDPNDEYNCYLEIRAGTGGDEAGIFAGDLFRMYSRYAESKRWRVEMLSANESEQGGYKEVIVKVTGEGVYGQLKFESGGHRVQRVPKTESQGRIHTSACTVAVMPELPESEMPEINPADLRIDTYRSSGAGGQHVNTTDSAVRITHIPTGIVVECQDERSQHKNKAKAMSVLASRIVQAEQERQAAEQTDMRRNLLGSGDRSDKIRTYNYPQGRVTDHRINLTIYRLDEVMNGKIDELIQPIITEYQADQL 354
>gi|61252075|sp|P43917|RF1_HAEIN Peptide chain release factor 1 (RF-1) (360 aa)
Score = 757, Expect = 2.1e-78, Identities = 165/344 (47%), Positives = 237/344 (68%)
  Q:    11 LLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           L S++E++ +L   L    +     +    +K   +   +V+ F  + +   +I+ AE L+    D E+ E+AQ+E+ E K  IE+ E +L++LLLPKDPND+ N  +E+R   GGDE+ IF GDLF  Y RYA+S  W+V+ML   ES  G Y  +   + GE VY ++KFESG HRVQRVP TES+GR+HTS  TVAV+PEL E E+  IN +DL+IDTYR+SGAGGQH+N T+SAVRITHIPTGI V CQ+ +SQ +N+  AM +L +++ + ++E      +D+R+  +G+G+R++KIRTYNYPQ RVTDHRINLT+ +LD VM G + E+I  +I+  +A ++
  S:     9 LESLKERYEELEALLGDVSVISDQDKFRAYSKEYSQLEEVVKCFNRWTQLNQNIEEAEILLD---DPEMKEMAQMEIEESKAEIEEVEQQLQILLLPKDPNDEYNCYLEIRAGTGGDEAGIFAGDLFRMYSRYAESKRWRVEMLSANESEQGGYKEVIVKVTGEGVYGQLKFESGGHRVQRVPKTESQGRIHTSACTVAVMPELPESEMPEINPADLRIDTYRSSGAGGQHVNTTDSAVRITHIPTGIVVECQDERSQHKNKAKAMSVLASRIVQAEQERQAAEQTDMRRNLLGSGDRSDKIRTYNYPQGRVTDHRINLTIYRLDEVMNGKIDELIQPIITEYQADQL 353
>gi|30249865|ref|NP_841935.1| peptide chain release factor 1 [Nitrosomonas europaea ATCC 19718] >gi|46576779|sp|Q82TH4|RF1_NITEU Peptide chain release factor 1 (RF-1) >gi|30180902|emb|CAD85824.1| prfA: peptide chain release factor 1 [Nitrosomonas europaea ATCC 19718] (359 aa)
Score = 757, Expect = 2.1e-78, Identities = 157/351 (44%), Positives = 238/351 (67%)
  Q:     4 NEKLYNSLLSMEEKFNDLNKELETEGLS--VKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEV-ELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           N+ + + L  +  +  +L+K L TE ++  +    ++++   E  P+ E ++ Y++   D+ +A ++     D +  + A+ E+   +  +   E E+   LLPKDPND++N+ +E+R   GGDES++F GDLF  Y RYA+  GW+V+++    S   GY  I   I G   YS++KFESG HRVQRVPATE++GRVHTST TVAVLPE +E+ ++ +N +DL+IDT+RASGAGGQHINKT+SAVRITH+PTGI   CQEG+SQ +N+  AM +L A++ +K+    +   +  RK  VG+GER+E+IRTYN+PQ R+TDHRINLTL K++ ++ G L E+  +L +  +A ++
  S:     2 NKGIIDQLTRLSMRLGELDKLLSTEKITADLDNYRKLSRERAEIEPVTELYRTYQQVEQDLATAREM---SSDPQFRDFAEAEIEADRRKLTNIETEILRQLLPKDPNDERNIFLEIRAGTGGDESALFAGDLFRMYSRYAEREGWQVEVVSQNPSEVGGYKEIIVRIIGHGAYSRLKFESGGHRVQRVPATETQGRVHTSTCTVAVLPEADEIADITLNPADLRIDTFRASGAGGQHINKTDSAVRITHLPTGIVAECQEGRSQHKNKAQAMSVLIARILDKQVRAQQAEQAATRKSLVGSGERSERIRTYNFPQGRITDHRINLTLYKIEQIIDGELDELCSALAAEHQAAQL 353
>gi|159899315|ref|YP_001545562.1| peptide chain release factor 1 [Herpetosiphon aurantiacus ATCC 23779] >gi|159892354|gb|ABX05434.1| peptide chain release factor 1 [Herpetosiphon aurantiacus ATCC 23779] (365 aa)
Score = 757, Expect = 2.4e-78, Identities = 154/345 (44%), Positives = 245/345 (71%)
  Q:    11 LLSMEEKFNDLNKEL-ETEGLSVK-RMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITH---IPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQ 355
           L  +E ++ +LN E+ + + LS   R++ + +   E   +V +++E+ +    ++ A+ L++ E D E+ E+AQLE+ E    +E    E++VLLLP+DPND+KNVI+E+R   GGDE+++F  D++  Y+RYA+  GWK +++ + E+   G+  + F + G+  +S++K+E GVHRVQRVPATE++GR+HTSTITVAVLPE+EE  + I   D +ID YR+ G GGQ +N T+SAVRI +    P  I V CQ+ +SQI+NRE+A+ +LRA+L+ +++E+ +K + + R  QVG+GERAEK+RTYNYPQ+R+TDHRI   ++ L  V+ G L  +ID+L++ D A +++
  S:     9 LARVEARYIELNDEMTQPDALSDHVRLTTLAREQTELGELVGRYREFMQAEKSVEEAKALLREENDPELREMAQLEIDELSARMEAIGAEVRVLLLPRDPNDEKNVIIEIRQGEGGDEAALFGADVYRMYQRYAEIRGWKTEVMSLSENGIGGFKEVIFEVQGQGAWSRLKYEGGVHRVQRVPATEARGRIHTSTITVAVLPEVEETAVEIKQEDYRIDVYRSGGHGGQGVNTTDSAVRIVYKAGTPEEIVVVCQDTRSQIKNRESALNVLRARLYAREQEKRQKELGESRLAQVGSGERAEKMRTYNYPQDRITDHRIGQNISNLPVVLDGALDRLIDALVTFDNAERLK 359
>gi|190893591|ref|YP_001980133.1| peptide chain release factor 1 protein [Rhizobium etli CIAT 652] >gi|190698870|gb|ACE92955.1| peptide chain release factor 1 protein [Rhizobium etli CIAT 652] (351 aa)
Score = 757, Expect = 2.5e-78, Identities = 160/346 (46%), Positives = 240/346 (69%)
  Q:    11 LLSMEEKFNDLNKELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEK-DNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQE-SSHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           +L +E +F+++   + + G +     ++     E  P+V K + Y++ + ++   + L++ +  D E+ +LA+LEL E K  IE  E E+++LLLPKD  D+K+ I+E+R   GG E+++F GDLF  Y+R+A   GWKV++L   E  + GY  I   I G  V++K+KFESGVHRVQRVP TE+ GR+HTS  TVAVLPE EE+++ I   D++IDT R+SGAGGQH+N T+SAVRITH+P+GI V   E KSQ +NR  AM++LR++L++ + +      S  RK QVG+G+R+E+IRTYN+PQ RVTDHRINLTL KLD +M G + E++D+L++  +A ++ +
  S:     1 MLELERRFDEIEARM-SAGPAADVYVKLASEYSELQPVVTKIRAYEKAVAELADLDTLLEDKAVDREMRDLAELELPEVKERIEALEQEMQILLLPKDAADEKSAILEIRAGTGGSEAALFAGDLFRMYERFAAEKGWKVEVLSASEGEAGGYKEIIATITGRGVFAKLKFESGVHRVQRVPETEAGGRIHTSAATVAVLPEAEEIDIEIRPEDIRIDTMRSSGAGGQHVNTTDSAVRITHLPSGIVVTSSE-KSQHQNRAKAMQVLRSRLYDAERQRADSERSADRKSQVGSGDRSERIRTYNFPQGRVTDHRINLTLYKLDRMMEGEIEEVVDALMADYQASQLAQ 346
>gi|163784022|ref|ZP_02178981.1| peptide chain release factor RF-1 [Hydrogenivirga sp. 128-5-R1-1] >gi|159880707|gb|EDP74252.1| peptide chain release factor RF-1 [Hydrogenivirga sp. 128-5-R1-1] (359 aa)
Score = 757, Expect = 2.5e-78, Identities = 178/356 (50%), Positives = 248/356 (69%)
  Q:     4 NEKLYNSLLSMEEKFNDLNKELETEGLS--VKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQEAKI 359
           ++KL      +E K  ++ ++L +  ++   K++ E+ K  K    +VE F  Y+     I   ++L+ S+ D E+  LA+ EL   K   EK E E+++ L+PKDPNDDKNVI+E+R  AGGDE+++F  +LF  Y+RYA+  GWKV++L + E+  G    +  +I GE  YSK+K+ESGVHRVQRVP TES GR+HTST TVAVLPE EEV++ IN  DLKI+T RASGAGGQH+N T+SAVRITHIPTGI V+CQ+ +SQ++NR  AM++LRA+L +  +   ++ I   RK QVGTG+R+EKIRTYN+PQNRVTDHRI  T ++++ ++ G L EIID LI  D+  K+    I
  S:     2 SKKLLGKKSELEAKLKEVEEKLASPEVANNPKQLQELAKEHKHLAYVVELFNRYENIEKSIKETKELLHSQ-DEEMRLLAEEELENLKSQKEKLESEIQIALIPKDPNDDKNVILEIRQGAGGDEAALFAAELFRMYQRYAEKNGWKVEILSLHENERGGIKEVIALIKGEGAYSKLKYESGVHRVQRVPETESSGRIHTSTATVAVLPEAEEVDVEINPDDLKIETMRASGAGGQHVNTTDSAVRITHIPTGIVVSCQDERSQLQNRAKAMQILRARLKDYYDRIQQEKIKSERKSQVGTGDRSEKIRTYNFPQNRVTDHRIGYTSHRINEILDGELDEIIDQLILKDQEEKLSSLSI 359
>gi|114773558|ref|ZP_01450656.1| Protein chain release factor A [alpha proteobacterium HTCC2255] (361 aa)
Score = 756, Expect = 2.6e-78, Identities = 155/318 (48%), Positives = 223/318 (70%)
  Q:    34 RMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           R   ++K   +   +V+ F++Y+    D+ SA ++++ E D E+ E+AQ E+   K  IE  E  L++LLLP+DP DD N  +E+R  AGGDE++IF GDL+  Y RYA++ GW+V ++   E  HG Y  +   I G+  Y  MKFESG HRVQRVP TES+GR+HTS  TVAVL E+ E E + IN +DL++DT+RASGAGGQH+NKT+SA+RITHIP+G+ V CQ+ +SQ +NR  AM +L+++L   ++E+     +  RK  VG+G+R+E+IRTYNYPQ RVTDHRINLTL KLD+V+ G++  +++ +    +A
  S:    34 RFRSLSKEYAQLEDVVKSFRDYQGAQEDLASANEMMQ-EDDAEMREMAQEEIKAAKASIETLEQALQILLLPRDPQDDSNCFLEIRAGAGGDEAAIFAGDLYRMYSRYAETKGWRVDLVSANEGEHGGYKEVIANIIGDGAYGVMKFESGGHRVQRVPETESQGRIHTSACTVAVLAEVAESEAIDINPADLRVDTFRASGAGGQHVNKTDSAIRITHIPSGVVVECQDERSQHKNRAKAMSVLQSRLNNIEKEKRDAEEASTRKSLVGSGDRSERIRTYNYPQGRVTDHRINLTLYKLDDVVAGDVDALLEPIRQEHQA 352
>gi|59801687|ref|YP_208399.1| peptide chain release factor 1 [Neisseria gonorrhoeae FA 1090] >gi|75432438|sp|Q5F750|RF1_NEIG1 Peptide chain release factor 1 (RF-1) >gi|59718582|gb|AAW89987.1| putative peptide chain release factor I [Neisseria gonorrhoeae FA 1090] (358 aa)
Score = 756, Expect = 2.6e-78, Identities = 161/315 (51%), Positives = 228/315 (72%)
  Q:    37 EINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVE-LVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           ++ +   E TP+VE F+ Y+   +D+  AE+++    D E+ + A  E+   K  I++ + EL+ LLLPKD +DDKN+ +E+R   GGDE+++F GDL   Y RYA+   W+V+++   ES   GY  +   I G   YS++KFESG HRVQRVPATES+GR+HTS  TVAV+PE +E+E + +N +DL+ DT+RASGAGGQHINKT+SAVRITH+PTG+ V CQ+G+SQ  N+  AMK+L A+L + ++ E +   +  RK  +G+G+R+E+IRTYNYPQ RVTDHRINLTL+KLD VM G+L+EI D+LI+  +A
  S:    37 KLTREHAELTPVVEVFQNYRLAQSDLADAEEMLS---DPEMKDFAAEEIEAAKAKIDELDTELQKLLLPKDADDDKNIFIEIRAGTGGDEAALFAGDLLRMYSRYAERNRWQVEIVSANESELGGYKEVIARIVGLGAYSRLKFESGGHRVQRVPATESQGRIHTSACTVAVMPEADELEDIELNPADLRTDTFRASGAGGQHINKTDSAVRITHLPTGMVVECQDGRSQHANKAQAMKVLAARLNDAQKREVQAKEAAERKSLIGSGDRSERIRTYNYPQGRVTDHRINLTLHKLDFVMDGDLAEITDALIAEHQA 350
>gi|52842546|ref|YP_096345.1| peptide chain release factor 1 [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] >gi|54295177|ref|YP_127592.1| peptide chain release factor 1 [Legionella pneumophila str. Lens] >gi|54298226|ref|YP_124595.1| peptide chain release factor 1 [Legionella pneumophila str. Paris] >gi|61214584|sp|Q5WUB1|RF1_LEGPL Peptide chain release factor 1 (RF-1) >gi|61214585|sp|Q5X2V3|RF1_LEGPA Peptide chain release factor 1 (RF-1) >gi|61214588|sp|Q5ZT29|RF1_LEGPH Peptide chain release factor 1 (RF-1) >gi|52629657|gb|AAU28398.1| peptide chain release factor 1 (RF-1) [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] >gi|53752011|emb|CAH13437.1| peptide chain release factor 1 [Legionella pneumophila str. Paris] >gi|53755009|emb|CAH16497.1| peptide chain release factor 1 [Legionella pneumophila str. Lens] (362 aa)
Score = 756, Expect = 2.6e-78, Identities = 154/335 (45%), Positives = 238/335 (71%)
  Q:    11 LLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEV-ELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSL 345
           L  M E++ ++ + L    +     +   ++K   +  P+ + ++ Y    N++DS  +L++S+ D ++  +A+ E+   K  IE+ + +L+  L+PKDP+D++N+ +E+R   GGDE++IF GDLF  Y RYA+S GW+++++      HG Y  I   I+G+ VYS++KFESG HRVQRVP TES+GRVHTS  TVA++PE++E+ ++ IN  DL+IDTYR+SGAGGQH+NKT+SA+RITHIPTG+ V CQ+ +SQ +NR  AM +L+ +L + +  + ++  +  RK  VGTG+R+E+IRTYN+PQ R+TDHRINLT+ +L ++M GNLS +ID L
  S:     9 LQQMLERYEEVGRLLSEASIIADQNQFKSLSKEYAQLEPVSQCYESYLEAKNNLDSLNELLESD-DKDLATMAEEEIDTVKKQIEELDEQLQWHLIPKDPDDERNIYLEVRAGTGGDEAAIFAGDLFRMYSRYAESQGWQIELISASHGEHGGYKEIIAKISGQAVYSQLKFESGAHRVQRVPETESQGRVHTSACTVAIMPEVDEINDIQINPDDLRIDTYRSSGAGGQHVNKTDSAIRITHIPTGVVVECQDERSQHKNRAKAMSLLKTRLLDAEVSKQKQEQAQTRKSLVGTGDRSERIRTYNFPQGRLTDHRINLTIYQLSDIMEGNLSLVIDPL 346
>gi|119361546|sp|Q4QKS1|RF1_HAEI8 Peptide chain release factor 1 (RF-1) (360 aa)
Score = 756, Expect = 2.7e-78, Identities = 167/348 (47%), Positives = 241/348 (69%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGLSVKRMSE------INKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           + +S+++  E   +  +ELE     V  +S+       +K   +   +V+ F  + +   +I+ AE L+    D E+ E+AQ+E+ E K  IE+ E +L++LLLPKDPND+ N  +E+R   GGDE+ IF GDLF  Y RYA+S  W V+ML   ES  G Y  +   ++GE VY ++KFESG HRVQRVP TES+GR+HTS  TVAV+PEL E E+  IN +DL+IDTYR+SGAGGQH+N T+SAVRITHIPTGI V CQ+ +SQ +N+  AM +L +++ + ++E      +D+R+  +G+G+R++KIRTYNYPQ RVTDHRINLT+ +LD VM G + E+I  +I+  +A ++
  S:     1 MKDSIIAKLESLKERYEELEALLGDVSVISDQDKFRAYSKEYSQLEEVVKCFNRWTQLNQNIEEAEILLD---DPEMKEMAQMEIEESKAEIEEVEQQLQILLLPKDPNDEYNCYLEIRAGTGGDEAGIFAGDLFRMYSRYAESKRWCVEMLSANESEQGGYKEVIVKVSGEGVYGQLKFESGGHRVQRVPKTESQGRIHTSACTVAVMPELPESEMPEINPADLRIDTYRSSGAGGQHVNTTDSAVRITHIPTGIVVECQDERSQHKNKAKAMSVLASRIVQAEQERQAAEQTDMRRNLLGSGDRSDKIRTYNYPQGRVTDHRINLTIYRLDEVMNGKIDELIQPIITEYQADQL 353
>gi|68249924|ref|YP_249036.1| peptide chain release factor 1 [Haemophilus influenzae 86-028NP] >gi|68058123|gb|AAX88376.1| peptide chain release factor 1 [Haemophilus influenzae 86-028NP] (361 aa)
Score = 756, Expect = 2.7e-78, Identities = 167/348 (47%), Positives = 241/348 (69%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGLSVKRMSE------INKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           + +S+++  E   +  +ELE     V  +S+       +K   +   +V+ F  + +   +I+ AE L+    D E+ E+AQ+E+ E K  IE+ E +L++LLLPKDPND+ N  +E+R   GGDE+ IF GDLF  Y RYA+S  W V+ML   ES  G Y  +   ++GE VY ++KFESG HRVQRVP TES+GR+HTS  TVAV+PEL E E+  IN +DL+IDTYR+SGAGGQH+N T+SAVRITHIPTGI V CQ+ +SQ +N+  AM +L +++ + ++E      +D+R+  +G+G+R++KIRTYNYPQ RVTDHRINLT+ +LD VM G + E+I  +I+  +A ++
  S:     2 MKDSIIAKLESLKERYEELEALLGDVSVISDQDKFRAYSKEYSQLEEVVKCFNRWTQLNQNIEEAEILLD---DPEMKEMAQMEIEESKAEIEEVEQQLQILLLPKDPNDEYNCYLEIRAGTGGDEAGIFAGDLFRMYSRYAESKRWCVEMLSANESEQGGYKEVIVKVSGEGVYGQLKFESGGHRVQRVPKTESQGRIHTSACTVAVMPELPESEMPEINPADLRIDTYRSSGAGGQHVNTTDSAVRITHIPTGIVVECQDERSQHKNKAKAMSVLASRIVQAEQERQAAEQTDMRRNLLGSGDRSDKIRTYNYPQGRVTDHRINLTIYRLDEVMNGKIDELIQPIITEYQADQL 354
>gi|161526057|ref|YP_001581069.1| peptide chain release factor 1 [Burkholderia multivorans ATCC 17616] >gi|189349228|ref|YP_001944856.1| peptide chain release factor RF-1 [Burkholderia multivorans ATCC 17616] >gi|160343486|gb|ABX16572.1| peptide chain release factor 1 [Burkholderia multivorans ATCC 17616] >gi|189333250|dbj|BAG42320.1| peptide chain release factor RF-1 [Burkholderia multivorans ATCC 17616] (360 aa)
Score = 756, Expect = 2.8e-78, Identities = 155/341 (45%), Positives = 240/341 (70%)
  Q:    11 LLSMEEKFNDLNKELETEGLS--VKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEV-ELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           L  +  +  +LN  L  E ++  + +  ++ +   E  P+VE++  ++++ +D  +A++L+    D  + + A+ E+   +  + + E EL+ +LLPKDPNDD+N+ VE+R   GGDES++F GDL   Y R+A+   W+V+M+    S   GY  +   I G+  YS++KFESG HRVQRVPATE++GR+HTS  TVAV+PE +E+ E+ IN +DL+IDT+RASGAGGQHINKT+SAVR+TH+PTGI V CQ+ +SQ +N++ A+K+L A++ +K+  E     +  RK  +G+G+R+E+IRTYN+PQ R+TDHRINLTL +L+ +M G+L E+I +L+S  +A
  S:     9 LDQLSTRLAELNDLLSRENVTADLDQYRKLTREHAELGPVVEQYALWRQSRSDETAAQELLA---DPSMRDFAEEEIRSARERMARLEVELQKMLLPKDPNDDRNIFVEIRAGTGGDESALFAGDLLRMYLRFAERQRWQVEMMSESPSDLGGYKEVIVRIAGQGAYSRLKFESGGHRVQRVPATETQGRIHTSACTVAVMPEADEIGEVEINLADLRIDTFRASGAGGQHINKTDSAVRVTHLPTGIVVECQDDRSQHKNKDRALKVLAARIKDKQYHEQHAKEAATRKSLIGSGDRSERIRTYNFPQGRMTDHRINLTLYRLEAIMDGDLDELIGALVSEHQA 350
>gi|156742398|ref|YP_001432527.1| peptide chain release factor 1 [Roseiflexus castenholzii DSM 13941] >gi|156233726|gb|ABU58509.1| peptide chain release factor 1 [Roseiflexus castenholzii DSM 13941] (364 aa)
Score = 756, Expect = 2.8e-78, Identities = 153/349 (43%), Positives = 233/349 (66%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGLSVK--RMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITH---IPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQ 355
           L + L S+  ++++L   +    ++    R+    +  +E  P+VE ++ Y+     I+    L++ E D ++ +LAQ EL        + E ++KVLLLP+DPND KN I+E+R   GGDE+++F  DLF  Y RYA+  GW ++++   E+   GY  I F + GE  YS++K+E GVHRVQRVPATE++GR+HTST TVAVLPE+EE ++ +N SD ++D +R+ G GGQ +N T+SAVRI +    P  I V CQ+ +SQ++N+ +A+ +LRA+L+ ++EE+ RK + + R  QVG GERAEKIRTYN+PQ+RVTDHRI    + L  ++ G+L  +ID LI  D A +++
  S:     5 LIDKLASITARYDELLDLMAQPDVATDPVRLQRYAREQRELEPLVEAYRAYRDVERQIEDTSFLLEHETDQDVRQLAQDELDHLLERRAQLEQQIKVLLLPRDPNDSKNAIMELRQGEGGDEAALFAADLFRMYTRYAEQRGWDIEVISATENGPGGYKEIIFEVRGEGAYSRLKYEGGVHRVQRVPATEARGRIHTSTATVAVLPEVEETDIELNPSDYRVDVFRSGGHGGQGVNTTDSAVRIVYKPGTPEEIVVTCQDSRSQLKNKASALAVLRARLYAREEEKRRKELGETRLAQVGAGERAEKIRTYNFPQDRVTDHRIGQNFSNLPGILDGDLDRLIDMLIIADNAERLE 359
>gi|118045663|ref|ZP_01514321.1| peptide chain release factor 1 [Chloroflexus aggregans DSM 9485] >gi|117997898|gb|EAV12081.1| peptide chain release factor 1 [Chloroflexus aggregans DSM 9485] (361 aa)
Score = 756, Expect = 2.8e-78, Identities = 161/353 (45%), Positives = 245/353 (69%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGLS--VKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITH---IPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQEAKI 359
           +++ L ++ +++++L + +    ++  V  + +  +  +E   IV  ++EY+     I  AE ++  E D E+  LAQ EL  ++  +   E +LKVLLLP+DPND K+VI+E+R   GGDE+++F  DLF  Y R+A+S GWKV++  + E+   G   + F I+GE  YS++K+E GVHRVQRVPATE++GR+HTST TVAVLPE+EE E+ I   DL+ID +R++G GGQ +N T+SAVRI +    P  I V CQ+G+SQI+NRE AM +LRA+L+ +++E+ ++ I   R  QVG+GERAEKIRTYN+PQ+R+TDHRI    + L  V+ G L +II++LI +D A +++ + I
  S:     1 MFDKLEAVAQRYDELTQLMAQPEVATNVTLLQQYAREQRELEDIVTTYREYQAAQRAIAEAEAML-DENDPELRALAQEELDTQRKRLATLEEQLKVLLLPRDPNDSKDVIMEIRQGEGGDEAALFAADLFRMYTRFAESRGWKVEVDSLTENGIGGIKEVIFQIHGEGAYSQLKYEGGVHRVQRVPATEARGRIHTSTATVAVLPEVEETEIEIKPEDLRIDVFRSAGHGGQGVNTTDSAVRIVYKPGTPEEIVVTCQDGRSQIQNRERAMTVLRARLYAREQEKRQREIGASRLAQVGSGERAEKIRTYNFPQDRITDHRIGQNFSNLPAVLDGELDKIIEALIVYDTAERLRASGI 358
>gi|167838055|ref|ZP_02464914.1| peptide chain release factor 1 [Burkholderia thailandensis MSMB43] (360 aa)
Score = 756, Expect = 2.8e-78, Identities = 157/345 (45%), Positives = 238/345 (68%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGLS--VKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEV-ELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           + + L  +  +  +LN  L  E ++  + +  ++ +   E  P+VE + ++++   D  +A++L+    D  + + A+ EL   +  + +   EL+ +LLPKDPND++N+ VE+R   GGDES++F GDL   Y RYA+   W+V+M+    S   GY  +   I G   YS++KFESG HRVQRVPATE++GR+HTS  TVAV+PE +E+ E+ IN +DL+IDT+RASGAGGQHINKT+SAVR+THIPTGI V CQ+ +SQ +N++ A+K+L A++ +K+  E     +  RK  +G+G+R+E+IRTYN+PQ R+TDHRINLTL KL+ +M G+L E+I +L+S  +A
  S:     5 MQSKLDQLTTRLAELNDLLSRENVTADLDQYRKLTREHAEIGPVVEHYAQWRQARADELAAQELLA---DASMRDFAEDELRGARDRMSRLAAELQTMLLPKDPNDERNIFVEIRAGTGGDESALFAGDLLRMYLRYAERQRWQVEMMSESPSDLGGYKEVIVRIAGYGAYSRLKFESGGHRVQRVPATETQGRIHTSACTVAVMPEADEIGEVEINPADLRIDTFRASGAGGQHINKTDSAVRVTHIPTGIVVECQDDRSQHKNKDRALKVLAARIKDKQYHEQHAKEAATRKSLIGSGDRSERIRTYNFPQGRMTDHRINLTLYKLEQIMDGDLDELIAALVSEHQA 350
>gi|114561906|ref|YP_749419.1| peptide chain release factor 1 [Shewanella frigidimarina NCIMB 400] >gi|119361604|sp|Q087I4|RF1_SHEFN Peptide chain release factor 1 (RF-1) >gi|114333199|gb|ABI70581.1| peptide chain release factor 1 [Shewanella frigidimarina NCIMB 400] (361 aa)
Score = 756, Expect = 2.9e-78, Identities = 159/318 (50%), Positives = 226/318 (71%)
  Q:    34 RMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGF--ISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           R   ++K   +   +V  FK +++   D D A+++++ E D E+ E+AQ E  + K ++EK E EL+VLLLP DPNDD N  +E+R  AGGDE++IF GDL+  Y RY ++  W+++++ V E  HG GF  I   I+G+  Y K+KFESG HRVQRVP TES+GRVHTS  TV VL E+ E E + IN +DLK+DT+RASGAGGQH+NKT+SA+RITHIP+GI V CQ+ +SQ +NR  AM +L A++   ++E+ R      R+  V +G+R+E+IRTYNYPQ RV+DHRINLTL +L+ VM G+L+ ++D ++   +A
  S:    34 RFRGLSKEYSQLEDVVSSFKAFQQAQKDFDYAKEMLE-EDDLEMREMAQDEYKQSKQVLEKLEDELQVLLLPTDPNDDTNAFLEIRAGAGGDEAAIFAGDLYRMYSRYCEANRWQMEVMNVNEGEHG-GFKEIIVKISGDGAYGKLKFESGGHRVQRVPETESQGRVHTSACTVVVLHEVPEAEAISINAADLKVDTFRASGAGGQHVNKTDSAIRITHIPSGIIVECQDQRSQHKNRAQAMSVLAARIQAVEDEKRRSAEETTRRSLVASGDRSERIRTYNYPQGRVSDHRINLTLYRLNEVMEGDLNVLLDPIMLEHQA 352
>gi|134294603|ref|YP_001118338.1| peptide chain release factor 1 [Burkholderia vietnamiensis G4] >gi|166223537|sp|A4JB50|RF1_BURVG Peptide chain release factor 1 (RF-1) >gi|134137760|gb|ABO53503.1| bacterial peptide chain release factor 1 (bRF-1) [Burkholderia vietnamiensis G4] (360 aa)
Score = 756, Expect = 3.1e-78, Identities = 155/335 (46%), Positives = 237/335 (70%)
  Q:    17 KFNDLNKELETEGLS--VKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEV-ELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           +  +LN  L  E ++  + +  ++ +   E  P+VE++  ++++ ND  +A++L+    D  + + A+  +   +  + + E EL+ +LLPKDPNDD+N+ +E+R   GGDES++F GDL   Y RYA+   W+V+M+    S   GY  +   I G+  YS++KFESG HRVQRVPATE++GR+HTS  TVAV+PE +E+ E+ IN +DL+IDT+RASGAGGQHINKT+SAVR+THIPTGI V CQ+ +SQ +N++ A+K+L A++ +K+  E     +  RK  +G+G+R+E+IRTYN+PQ R+TDHRINLTL +L+ +M G+L E+I +L+S  +A
  S:    15 RLAELNDLLSRENVTADLDQYRKLTREHAELGPVVEQYALWRQSRNDEAAAQELLA---DASMRDFAEEAIRSARERMTRLEGELQKMLLPKDPNDDRNIFLEIRAGTGGDESALFAGDLLRMYLRYAERQRWQVEMMSESPSDLGGYKEVIVRIAGQGAYSRLKFESGGHRVQRVPATETQGRIHTSACTVAVMPEADEIGEVEINPADLRIDTFRASGAGGQHINKTDSAVRVTHIPTGIVVECQDDRSQHKNKDRALKVLAARIKDKQYHEQHAKEAATRKSLIGSGDRSERIRTYNFPQGRMTDHRINLTLYRLEALMDGDLDELIGALVSEHQA 350
>gi|86359340|ref|YP_471232.1| peptide chain release factor 1 [Rhizobium etli CFN 42] >gi|86283442|gb|ABC92505.1| peptide chain release factor 1 protein [Rhizobium etli CFN 42] (351 aa)
Score = 756, Expect = 3.3e-78, Identities = 160/343 (46%), Positives = 237/343 (69%)
  Q:    14 MEEKFNDLNKELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEK-DNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQE-SSHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           +E +F ++   + + G +     ++     E  P+V K + Y++ + ++   E L++ +  D E+ +LA+LEL E +  IE  E E+++LLLPKD  D+K+ I+E+R   GG E+++F GDLF  Y+R+A   GWKV++L   E  + GY  I   I G  V++K+KFESGVHRVQRVP TE+ GR+HTS  TVAVLPE EE+++ I   D++IDT R+SGAGGQH+N T+SAVRITH+PTGI V   E KSQ +NR  AM++LR++L++ + +      S  RK QVG+G+R+E+IRTYN+PQ RVTDHRINLTL KLD +M G + E++D+L++  +A ++ +
  S:     4 LERRFGEIEARM-SAGPAADVYVKLASEYSELQPVVTKIRAYEKAVAELADLETLLEDKSVDREMRDLAELELPEVRARIEALEQEMQILLLPKDAADEKSAILEIRAGTGGSEAALFAGDLFRMYERFASEKGWKVEVLSASEGEAGGYKEIIATITGRGVFAKLKFESGVHRVQRVPETEAGGRIHTSAATVAVLPEAEEIDIEIRPEDIRIDTMRSSGAGGQHVNTTDSAVRITHLPTGIVVTSSE-KSQHQNRAKAMQVLRSRLYDAERQRADSERSADRKSQVGSGDRSERIRTYNFPQGRVTDHRINLTLYKLDRMMEGEIEEVVDALMADYQASQLAQ 346
>gi|126462320|ref|YP_001043434.1| peptide chain release factor 1 [Rhodobacter sphaeroides ATCC 17029] >gi|166223593|sp|A3PJZ6|RF1_RHOS1 Peptide chain release factor 1 (RF-1) >gi|126103984|gb|ABN76662.1| bacterial peptide chain release factor 1 (bRF-1) [Rhodobacter sphaeroides ATCC 17029] (351 aa)
Score = 756, Expect = 3.3e-78, Identities = 158/348 (45%), Positives = 233/348 (66%)
  Q:     9 NSLLSMEEKFNDLNKELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           + LL +  +F  L   L + G +   ++ +++   E  P+V +   Y+  L D+  AE ++    D E+  LA+ E+   +  I   E  L++ LLPKD  D +  I+E+RP  GG+E+++F GDL   Y+RYA+  GW+ ++L++  S   G    +  + GE  ++++K+ESGVHRVQRVP TE++GR+HTS  TVAVLPE EEV+L I  +D++IDT R+SGAGGQH+N T+SAVRITH+PTGI V   E KSQ  NRE AM++LRA+L++ + +      S  RK QVG+G+R+E+IRTYN+PQ R+TDHRINLTL  L  +M G+LSE+I +L +HD+A ++ E
  S:     5 DRLLQIVRRFEFLEARL-SAGAAPAEIAALSREYAELKPVVAEISAYRTALEDLAEAEAMLS---DPEMRALAEDEIPALRARIPGMEQALRLALLPKDAADARPAILEIRPGTGGEEAALFAGDLLRMYQRYAEGQGWRFELLDLAPSELGGIREATARVEGEGAFARLKYESGVHRVQRVPETEAQGRIHTSAATVAVLPEAEEVDLEIPAADIRIDTMRSSGAGGQHVNTTDSAVRITHLPTGIIVTSSE-KSQHRNREIAMQVLRARLYDLERQRLADARSADRKAQVGSGDRSERIRTYNFPQGRMTDHRINLTLYALPQIMAGDLSEVISALTAHDQAARLAE 348
>gi|53720682|ref|YP_109668.1| peptide chain release factor 1 [Burkholderia pseudomallei K96243] >gi|76809766|ref|YP_334968.1| peptide chain release factor 1 [Burkholderia pseudomallei 1710b] >gi|126440521|ref|YP_001060595.1| peptide chain release factor 1 [Burkholderia pseudomallei 668] >gi|126454756|ref|YP_001067845.1| peptide chain release factor 1 [Burkholderia pseudomallei 1106a] >gi|134283294|ref|ZP_01769995.1| peptide chain release factor 1 [Burkholderia pseudomallei 305] >gi|161358386|ref|ZP_02104259.1| peptide chain release factor 1 [Burkholderia pseudomallei 1106b] >gi|161372112|ref|ZP_02111674.1| peptide chain release factor 1 [Burkholderia pseudomallei 1710a] >gi|167721407|ref|ZP_02404643.1| peptide chain release factor 1 [Burkholderia pseudomallei DM98] >gi|167740375|ref|ZP_02413149.1| peptide chain release factor 1 [Burkholderia pseudomallei 14] >gi|167817592|ref|ZP_02449272.1| peptide chain release factor 1 [Burkholderia pseudomallei 91] >gi|167825994|ref|ZP_02457465.1| peptide chain release factor 1 [Burkholderia pseudomallei 9] >gi|167847481|ref|ZP_02472989.1| peptide chain release factor 1 [Burkholderia pseudomallei B7210] >gi|167896069|ref|ZP_02483471.1| peptide chain release factor 1 [Burkholderia pseudomallei 7894] >gi|167904455|ref|ZP_02491660.1| peptide chain release factor 1 [Burkholderia pseudomallei NCTC 13177] >gi|167912716|ref|ZP_02499807.1| peptide chain release factor 1 [Burkholderia pseudomallei 112] >gi|167920676|ref|ZP_02507767.1| peptide chain release factor 1 [Burkholderia pseudomallei BCC215] >gi|194508773|ref|YP_002021306.1| peptide chain release factor 1 [Burkholderia pseudomallei Pasteur 52237] >gi|194514207|ref|YP_002049888.1| peptide chain release factor 1 [Burkholderia pseudomallei S13] >gi|194567914|ref|YP_002102922.1| peptide chain release factor 1 [Burkholderia pseudomallei 406e] >gi|166223535|sp|A3NZS4|RF1_BURP0 Peptide chain release factor 1 (RF-1) >gi|166223536|sp|A3NE24|RF1_BURP6 Peptide chain release factor 1 (RF-1) >gi|61214599|sp|Q63QF0|RF1_BURPS Peptide chain release factor 1 (RF-1) >gi|119361515|sp|Q3JN85|RF1_BURP1 Peptide chain release factor 1 (RF-1) >gi|52211096|emb|CAH37084.1| peptide chain release factor 1 [Burkholderia pseudomallei K96243] >gi|76579219|gb|ABA48694.1| peptide chain release factor 1 [Burkholderia pseudomallei 1710b] >gi|126220014|gb|ABN83520.1| peptide chain release factor 1 [Burkholderia pseudomallei 668] >gi|126228398|gb|ABN91938.1| peptide chain release factor 1 [Burkholderia pseudomallei 1106a] >gi|134245489|gb|EBA45582.1| peptide chain release factor 1 [Burkholderia pseudomallei 305] >gi|157810508|gb|EDO87678.1| peptide chain release factor 1 [Burkholderia pseudomallei 406e] >gi|157938149|gb|EDO93819.1| peptide chain release factor 1 [Burkholderia pseudomallei Pasteur 52237] >gi|169655254|gb|EDS87947.1| peptide chain release factor 1 [Burkholderia pseudomallei S13] (360 aa)
Score = 755, Expect = 3.7e-78, Identities = 157/345 (45%), Positives = 238/345 (68%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGLS--VKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEV-ELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           + + L  +  +  +LN  L  E ++  + +  ++ +   E  P+VE + ++++   D  +A++L+    D  + + A+ EL   +  + +   EL+ +LLPKDPND++N+ VE+R   GGDES++F GDL   Y RYA+   W+V+M+    S   GY  +   I G   YS++KFESG HRVQRVPATE++GR+HTS  TVAV+PE +E+ E+ IN +DL+IDT+RASGAGGQHINKT+SAVR+THIPTGI V CQ+ +SQ +N++ A+K+L A++ +K+  E     +  RK  +G+G+R+E+IRTYN+PQ R+TDHRINLTL KL+ +M G+L E+I +L+S  +A
  S:     5 MQSKLDQLTTRLAELNDLLSRENVTADLDQYRKLTREHAEIGPVVEHYAQWRQARADELAAQELLA---DASMRDFAEDELRGARDRMGRLAAELQTMLLPKDPNDERNIFVEIRAGTGGDESALFAGDLLRMYLRYAERQRWQVEMMSESPSDLGGYKEVIVRIAGYGAYSRLKFESGGHRVQRVPATETQGRIHTSACTVAVMPEADEIGEVEINPADLRIDTFRASGAGGQHINKTDSAVRVTHIPTGIVVECQDDRSQHKNKDRALKVLAARIKDKQYHEQHAKEAATRKSLIGSGDRSERIRTYNFPQGRMTDHRINLTLYKLEQIMDGDLDELIAALVSEHQA 350
>gi|15604386|ref|NP_220902.1| peptide chain release factor 1 [Rickettsia prowazekii str. Madrid E] >gi|6225942|sp|Q9ZD21|RF1_RICPR Peptide chain release factor 1 (RF-1) >gi|3861078|emb|CAA14978.1| PEPTIDE CHAIN RELEASE FACTOR 1 (prfA) [Rickettsia prowazekii] (355 aa)
Score = 755, Expect = 3.8e-78, Identities = 164/348 (47%), Positives = 249/348 (71%)
  Q:     9 NSLLSMEEKFNDLNKELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKL-IKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVML-GNLSEIIDSLISHDEAVKMQE 356
           ++L+ + +K+ +L K+L + G+      + +K   E   +V K K+Y +  ++++ A    ++   DN  +E+   E+   + L+ K E  +++ LLPKD  D K+ I+E+R  +GG+E+++F   LF+ Y+RY++  GW+ ++L + ++   GY   S  I G++V+SK+KFESGVHRVQR+P TES+GR+HTS  TVAVLPE E +++ I + DL+IDTYRASGAGGQH+N T+SAVRITHIPTGI VA Q+ KSQ +N+  A+K+LRA+L+E+K  +  +  SD R+GQVG+G+R+E+IRTYN+PQ RV+DHRINLTL K+D V+  G L E I++LI++DEA K+ E
  S:     5 DNLVKILDKYENLGKKLSS-GIIGDEFVKASKEYAELEDVVVKIKQYNKAKSELEEANNFRLEMALDNATLEMIDNEIHTLENLLPKLERAVRISLLPKDEADSKSAIIEVRAGSGGEEAALFAAVLFNMYQRYSEFKGWRFEILAISDTGIGGYKEASASIKGKDVFSKLKFESGVHRVQRIPETESQGRIHTSAATVAVLPEAEGIDIKIEDKDLRIDTYRASGAGGQHVNTTDSAVRITHIPTGITVALQDEKSQHKNKAKALKILRARLYEEKRRQKEQERSDSRRGQVGSGDRSERIRTYNFPQGRVSDHRINLTLYKIDEVVKHGQLDEFIEALIANDEAKKLSE 354
>gi|15794828|ref|NP_284650.1| peptide chain release factor 1 [Neisseria meningitidis Z2491] >gi|20139350|sp|Q9JT75|RF1_NEIMA Peptide chain release factor 1 (RF-1) >gi|121052714|emb|CAM09057.1| peptide chain release factor I [Neisseria meningitidis Z2491] (358 aa)
Score = 755, Expect = 3.9e-78, Identities = 161/315 (51%), Positives = 228/315 (72%)
  Q:    37 EINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVE-LVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           ++ +   E TP+VE F+ Y+   +D+  AE+++    D E+ + A  E+   K  I + + EL+ LLLPKD +DDKN+ +E+R   GGDE+++F GDL   Y RYA+   W+V+++   ES   GY  +   I G   YS++KFESG HRVQRVPATES+GR+HTS  TVAV+PE +E+E + +N +DL+IDT+RASGAGGQHINKT+SAVRITH+PTG+ V CQ+G+SQ  N+  AMK+L A+L + ++ E +   +  RK  +G+G+R+E+IRTYNYPQ RVTDHRINLTL+KLD VM G+L+EI ++LI+  +A
  S:    37 KLTREHAELTPVVEVFQNYRLAQSDLADAEEMLS---DPEMKDFAAEEIEAAKAKIGELDTELQKLLLPKDADDDKNIFIEIRAGTGGDEAALFAGDLLRMYSRYAERNRWQVEIVSANESELGGYKEVIARIIGLGAYSRLKFESGGHRVQRVPATESQGRIHTSACTVAVMPEADELEDIELNPADLRIDTFRASGAGGQHINKTDSAVRITHLPTGMVVECQDGRSQHANKAQAMKVLAARLNDAQKREAQAKEAAERKSLIGSGDRSERIRTYNYPQGRVTDHRINLTLHKLDFVMDGDLAEITNALIAEHQA 350
>gi|83720975|ref|YP_443437.1| peptide chain release factor 1 [Burkholderia thailandensis E264] >gi|167582488|ref|ZP_02375362.1| peptide chain release factor 1 [Burkholderia thailandensis TXDOH] >gi|119361517|sp|Q2SUG2|RF1_BURTA Peptide chain release factor 1 (RF-1) >gi|83654800|gb|ABC38863.1| peptide chain release factor 1 [Burkholderia thailandensis E264] (360 aa)
Score = 755, Expect = 4.1e-78, Identities = 157/345 (45%), Positives = 238/345 (68%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGLS--VKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEV-ELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           + + L  +  +  +LN  L  E ++  + +  ++ +   E  P+VE + ++++   D  +A++L+    D  + + A+ EL   +  + +   EL+ +LLPKDPND++N+ VE+R   GGDES++F GDL   Y RYA+   W+V+M+    S   GY  +   I G   YS++KFESG HRVQRVPATE++GR+HTS  TVAV+PE +E+ E+ IN +DL+IDT+RASGAGGQHINKT+SAVR+THIPTGI V CQ+ +SQ +N++ A+K+L A++ +K+  E     +  RK  +G+G+R+E+IRTYN+PQ R+TDHRINLTL KL+ +M G+L E+I +L+S  +A
  S:     5 MQSKLDQLTTRLAELNDLLSRENVTADLDQYRKLTREHAEIGPVVEHYAQWRQARADELAAQELLA---DASMRDFAEDELRGARERMSRLAAELQTMLLPKDPNDERNIFVEIRAGTGGDESALFAGDLLRMYLRYAERQRWQVEMMSESPSDLGGYKEVIVRIAGYGAYSRLKFESGGHRVQRVPATETQGRIHTSACTVAVMPEADEIGEVEINPADLRIDTFRASGAGGQHINKTDSAVRVTHIPTGIVVECQDDRSQHKNKDRALKVLAARIKDKQYHEQHAKEAATRKSLIGSGDRSERIRTYNFPQGRMTDHRINLTLYKLEQIMDGDLDELIAALVSEHQA 350
>gi|138896954|ref|YP_001127407.1| peptide chain release factor 1 [Geobacillus thermodenitrificans NG80-2] >gi|196249772|ref|ZP_03148468.1| peptide chain release factor 1 [Geobacillus sp. G11MC16] >gi|166223561|sp|A4ITK8|RF1_GEOTN Peptide chain release factor 1 (RF-1) >gi|134268467|gb|ABO68662.1| Peptide chain release factor 1 [Geobacillus thermodenitrificans NG80-2] >gi|196210648|gb|EDY05411.1| peptide chain release factor 1 [Geobacillus sp. G11MC16] (358 aa)
Score = 755, Expect = 4.2e-78, Identities = 174/351 (49%), Positives = 256/351 (72%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQEA 357
           +++ L ++E+++  LN+ L    +    K++ + +K   + T  V+ ++EYK   + +  A+ +++ + + E+ E+ + E+ E +   E    +LKVLLLPKDPND+KNVI+E+R AAGG+E+++F GDL+  Y RYA+S GWK +++E   +   GY  I FM+NG+  YSK+KFE+G HRVQRVP TES GR+HTST TVA LPE+EEVE+ I+  D+++DTY +SG GGQ +N T SAVR+THIPTGI V CQ+ KSQI+N+E AMK+LRA++++K ++E R      RK  VGTG+R+E+IRTYN+PQNRVTDHRI LT+ KLD V+ G L EII++LI  D++ K+++A
  S:     1 MFDRLEAVEQRYEKLNELLMDPAVINDPKKLRDYSKEQADLTETVQTYREYKSVRSQLAEAKAMLEEKLEPELREMVKEEIDELEEREEALVEKLKVLLLPKDPNDEKNVIMEIRAAAGGEEAALFAGDLYRMYTRYAESQGWKTEVIEASPTGLGGYKEIIFMVNGKGAYSKLKFENGAHRVQRVPETESGGRIHTSTATVACLPEMEEVEVEIHEKDIRVDTYASSGPGGQSVNTTMSAVRLTHIPTGIVVTCQDEKSQIKNKEKAMKVLRARIYDKYQQEARAEYDQTRKQAVGTGDRSERIRTYNFPQNRVTDHRIGLTIQKLDLVLDGQLDEIIEALILDDQSKKLEQA 354
>gi|148359876|ref|YP_001251083.1| peptide chain release factor 1 [Legionella pneumophila str. Corby] >gi|166223567|sp|A5IED7|RF1_LEGPC Peptide chain release factor 1 (RF-1) >gi|148281649|gb|ABQ55737.1| peptide chain release factor 1 (RF-1) [Legionella pneumophila str. Corby] (362 aa)
Score = 755, Expect = 4.3e-78, Identities = 154/335 (45%), Positives = 238/335 (71%)
  Q:    11 LLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEV-ELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSL 345
           L  M E++ ++ + L    +     +   ++K   +  P+ + ++ Y    N++DS  +L++S+ D ++  +A+ E+   K  IE+ + +L+  L+PKDP+D++N+ +E+R   GGDE++IF GDLF  Y RYA+S GW+++++      HG Y  I   I+G+ VYS++KFESG HRVQRVP TES+GRVHTS  TVA++PE++E+ ++ IN  DL+IDTYR+SGAGGQH+NKT+SA+RITHIPTG+ V CQ+ +SQ +NR  AM +L+ +L + +  + ++  +  RK  VGTG+R+E+IRTYN+PQ R+TDHRINLT+ +L ++M GNLS +ID L
  S:     9 LQQMLERYEEVGRLLSEASIIADQNQFKSLSKEYAQLEPVSQCYESYLEAKNNLDSLNELLESD-DKDLATMAEEEIDIVKKQIEELDEQLQWHLIPKDPDDERNIYLEVRAGTGGDEAAIFAGDLFRMYSRYAESQGWQIELISASHGEHGGYKEIIAKISGQAVYSQLKFESGAHRVQRVPETESQGRVHTSACTVAIMPEVDEINDIQINPDDLRIDTYRSSGAGGQHVNKTDSAIRITHIPTGVVVECQDERSQHKNRAKAMSLLKTRLLDAEVSKQKQEQAQTRKSLVGTGDRSERIRTYNFPQGRLTDHRINLTIYQLSDIMEGNLSLVIDPL 346
>gi|119361587|sp|Q2K3T1|RF1_RHIEC Peptide chain release factor 1 (RF-1) (359 aa)
Score = 754, Expect = 4.8e-78, Identities = 160/343 (46%), Positives = 237/343 (69%)
  Q:    14 MEEKFNDLNKELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEK-DNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQE-SSHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           +E +F ++   + + G +     ++     E  P+V K + Y++ + ++   E L++ +  D E+ +LA+LEL E +  IE  E E+++LLLPKD  D+K+ I+E+R   GG E+++F GDLF  Y+R+A   GWKV++L   E  + GY  I   I G  V++K+KFESGVHRVQRVP TE+ GR+HTS  TVAVLPE EE+++ I   D++IDT R+SGAGGQH+N T+SAVRITH+PTGI V   E KSQ +NR  AM++LR++L++ + +      S  RK QVG+G+R+E+IRTYN+PQ RVTDHRINLTL KLD +M G + E++D+L++  +A ++ +
  S:    12 LERRFGEIEARM-SAGPAADVYVKLASEYSELQPVVTKIRAYEKAVAELADLETLLEDKSVDREMRDLAELELPEVRARIEALEQEMQILLLPKDAADEKSAILEIRAGTGGSEAALFAGDLFRMYERFASEKGWKVEVLSASEGEAGGYKEIIATITGRGVFAKLKFESGVHRVQRVPETEAGGRIHTSAATVAVLPEAEEIDIEIRPEDIRIDTMRSSGAGGQHVNTTDSAVRITHLPTGIVVTSSE-KSQHQNRAKAMQVLRSRLYDAERQRADSERSADRKSQVGSGDRSERIRTYNFPQGRVTDHRINLTLYKLDRMMEGEIEEVVDALMADYQASQLAQ 354
>gi|34539945|ref|NP_904424.1| peptide chain release factor 1 [Porphyromonas gingivalis W83] >gi|46576709|sp|Q7MXT5|RF1_PORGI Peptide chain release factor 1 (RF-1) >gi|34396256|gb|AAQ65323.1| peptide chain release factor 1 [Porphyromonas gingivalis W83] (361 aa)
Score = 754, Expect = 4.8e-78, Identities = 158/353 (44%), Positives = 243/353 (68%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQE-SSHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQEAKI 359
           L + L  +E +F +++  +    +   +KR ++++K  ++   I    ++Y+  L +I+ A+  +  E D E+ E+A+  L+E    +   E E+K+LL+P +P DDKN IVE+R   GGDE+++F GDL+  Y +Y +S GW+V++ ++ E ++ GY  I F + GE VY  +K+ESGVHRVQRVPATE++GR+HTS  TVAVLPE EEV++ IN +D+++ T R+ GAGGQ++NK E+ V++TH PTG+ V CQ+ +SQI NRE AM+MLR+KL++ +  ++ + I+  RK  V TG+R+ KIRTYNYPQ RVTDHRIN+T+  L  VM G +   ID+LI  +   +M+EA +
  S:     6 LLDRLDGLESRFEEISTLITDPAVIADMKRFTKLSKEYRDLEKIHTAGRDYRNLLANIEEAKHTMAKESDEELREMAREMLAEANERLPILEEEIKMLLIPANPEDDKNAIVEIRGGTGGDEAALFAGDLYRMYVKYCESKGWQVEVTDLSEGATGGYKEIVFSVKGEGVYGILKYESGVHRVQRVPATETQGRIHTSAATVAVLPEAEEVDVEINPADIEMQTSRSGGAGGQNVNKVETKVQLTHKPTGMVVVCQQARSQIANRELAMQMLRSKLYDIELSKHNEAIAARRKTMVSTGDRSAKIRTYNYPQGRVTDHRINMTVYNLSAVMDGEVQPFIDALIIAENVERMKEAAL 361
>gi|167620578|ref|ZP_02389209.1| peptide chain release factor 1 [Burkholderia thailandensis Bt4] (360 aa)
Score = 754, Expect = 4.9e-78, Identities = 157/345 (45%), Positives = 238/345 (68%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGLS--VKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEV-ELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           + + L  +  +  +LN  L  E ++  + +  ++ +   E  P+VE + ++++   D  +A++L+    D  + + A+ EL   +  + +   EL+ +LLPKDPND++N+ VE+R   GGDES++F GDL   Y RYA+   W+V+M+    S   GY  +   I G   YS++KFESG HRVQRVPATE++GR+HTS  TVAV+PE +E+ E+ IN +DL+IDT+RASGAGGQHINKT+SAVR+THIPTGI V CQ+ +SQ +N++ A+K+L A++ +K+  E     +  RK  +G+G+R+E+IRTYN+PQ R+TDHRINLTL KL+ +M G+L E+I +L+S  +A
  S:     5 MQSKLDQLTTRLAELNDLLSRENVTADLDQYRKLTREHAEIGPVVEHYAQWRQARADELAAQELLA---DASMRDFAEDELRGARERMSRLAAELQTMLLPKDPNDERNIFVEIRAGTGGDESALFAGDLLRMYLRYAERQRWQVEMMSESASDLGGYKEVIVRIAGYGAYSRLKFESGGHRVQRVPATETQGRIHTSACTVAVMPEADEIGEVEINPADLRIDTFRASGAGGQHINKTDSAVRVTHIPTGIVVECQDDRSQHKNKDRALKVLAARIKDKQYHEQHAKEAATRKSLIGSGDRSERIRTYNFPQGRMTDHRINLTLYKLEQIMDGDLDELIAALVSEHQA 350
>gi|171319081|ref|ZP_02908205.1| peptide chain release factor 1 [Burkholderia ambifaria MEX-5] >gi|171095720|gb|EDT40676.1| peptide chain release factor 1 [Burkholderia ambifaria MEX-5] (360 aa)
Score = 754, Expect = 5.0e-78, Identities = 155/341 (45%), Positives = 239/341 (70%)
  Q:    11 LLSMEEKFNDLNKELETEGLS--VKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEV-ELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           L  +  +  +LN  L  E ++  + +   + +   E  P+VE++  ++++ ND  +A++L+    D  + + A+ E+   +  + + E EL+ +LLPKDPNDD+N+ +E+R   GGDES++F GDL   Y R+A+   W+V+M+    S   GY  +   I G+  YS++KFESG HRVQRVPATE++GR+HTS  TVAV+PE +E+ E+ IN +DL+IDT+RASGAGGQHINKT+SAVR+THIPTGI V CQ+ +SQ +N++ A+K+L A++ +K+  E     +  RK  +G+G+R+E+IRTYN+PQ R+TDHRINLTL +L+ +M G+L E+I +L++  +A
  S:     9 LDQLSTRLAELNDLLSRENVTADLDQYRRLTREHAELGPVVEQYALWRQSRNDETAAQELLA---DASMRDFAEDEIRSARERMVRLEGELQKMLLPKDPNDDRNIFLEIRAGTGGDESALFAGDLLRMYLRFAERQRWQVEMMSESASDLGGYKEVIVRIAGQGAYSRLKFESGGHRVQRVPATETQGRIHTSACTVAVMPEADEIGEVEINPADLRIDTFRASGAGGQHINKTDSAVRVTHIPTGIVVECQDDRSQHKNKDRALKVLAARIKDKQYHEQHAKEAATRKSLIGSGDRSERIRTYNFPQGRMTDHRINLTLYRLEALMDGDLDELIGALVTEHQA 350
>gi|145634872|ref|ZP_01790579.1| peptide chain release factor 1 [Haemophilus influenzae PittAA] >gi|145267738|gb|EDK07735.1| peptide chain release factor 1 [Haemophilus influenzae PittAA] (361 aa)
Score = 754, Expect = 5.2e-78, Identities = 164/344 (47%), Positives = 238/344 (69%)
  Q:    11 LLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           L S++E++ +L   L    +     +    +K   +   +V+ F  + +   +I+ AE L+    D E+ E+AQ+E+ E K  IE+ E +L++LLLPKDPND+ N  +E+R   GGDE+ IF GDLF  Y RYA+S  W+V+ML   ES  G Y  +   ++GE VY ++KFESG HRVQRVP TES+GR+HTS  TVAV+PEL E E+  IN +DL+IDTYR+SGAGGQH+N T+SAVRITHIPTGI V CQ+ +SQ +N+  AM +L +++ + ++E      +D+R+  +G+G+R++KIRTYNYPQ RVTDHRINLT+ +LD V+ G + E+I  +I+  +A ++
  S:    10 LESLKERYEELEALLGDVSVISDQDKFRAYSKEYSQLEEVVKCFNRWTQLNQNIEEAEILLD---DPEMKEMAQMEIEESKAEIEEVEQQLQILLLPKDPNDEYNCYLEIRAGTGGDEAGIFAGDLFRMYSRYAESKRWRVEMLSANESEQGGYKEVIVKVSGEGVYGQLKFESGGHRVQRVPKTESQGRIHTSACTVAVMPELPESEMPEINPADLRIDTYRSSGAGGQHVNTTDSAVRITHIPTGIVVECQDERSQHKNKAKAMSVLASRIVQAEQERQAAEQTDMRRNLLGSGDRSDKIRTYNYPQGRVTDHRINLTIYRLDEVINGKIDELIQPIITEYQADQL 354
>gi|77463465|ref|YP_352969.1| peptide chain release factor 1 [Rhodobacter sphaeroides 2.4.1] >gi|119361594|sp|Q3J2B6|RF1_RHOS4 Peptide chain release factor 1 (RF-1) >gi|77387883|gb|ABA79068.1| bacterial peptide chain release factor 1 (bRF-1) [Rhodobacter sphaeroides 2.4.1] (351 aa)
Score = 754, Expect = 5.2e-78, Identities = 158/348 (45%), Positives = 233/348 (66%)
  Q:     9 NSLLSMEEKFNDLNKELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           + LL +  +F  L   L + G +   ++ +++   E  P+V +   Y+  L D+  AE ++    D E+  LA+ E+   +  I   E  L++ LLPKD  D +  I+E+RP  GG+E+++F GDL   Y+RYA+  GW+ ++L++  S   G    +  + GE  ++++K+ESGVHRVQRVP TE++GR+HTS  TVAVLPE EEV+L I  +D++IDT R+SGAGGQH+N T+SAVRITH+PTGI V   E KSQ  NRE AM++LRA+L++ + +      S  RK QVG+G+R+E+IRTYN+PQ R+TDHRINLTL  L  +M G+LSE+I +L +HD+A ++ E
  S:     5 DRLLQIVRRFEFLEARL-SAGAAPAEIAALSREYAELKPVVVEISAYRTALEDLAEAEAMLS---DPEMRALAEDEIPALRARIPGMEQALRLALLPKDAADARPAILEIRPGTGGEEAALFAGDLLRMYQRYAEGQGWRFELLDLAPSELGGIREATARVEGEGAFARLKYESGVHRVQRVPETEAQGRIHTSAATVAVLPEAEEVDLEIPAADIRIDTMRSSGAGGQHVNTTDSAVRITHLPTGIIVTSSE-KSQHRNREIAMQVLRARLYDLERQRLADARSADRKAQVGSGDRSERIRTYNFPQGRMTDHRINLTLYALPQIMAGDLSEVISALTAHDQAARLAE 348
>gi|167564255|ref|ZP_02357171.1| peptide chain release factor 1 [Burkholderia oklahomensis EO147] >gi|167571406|ref|ZP_02364280.1| peptide chain release factor 1 [Burkholderia oklahomensis C6786] (360 aa)
Score = 754, Expect = 5.3e-78, Identities = 157/345 (45%), Positives = 238/345 (68%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGLS--VKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEV-ELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           + + L  +  +  +LN  L  E ++  + +  ++ +   E  P+VE + ++++   D  +A++L+    D  + + A+ EL   +  + +   EL+ +LLPKDPND++N+ VE+R   GGDES++F GDL   Y RYA+   W+V+M+    S   GY  +   I G   YS++KFESG HRVQRVPATE++GR+HTS  TVAV+PE +E+ E+ IN +DL+IDT+RASGAGGQHINKT+SAVR+THIPTGI V CQ+ +SQ +N++ A+K+L A++ +K+  E     +  RK  +G+G+R+E+IRTYN+PQ R+TDHRINLTL KL+ +M G+L E+I +L+S  +A
  S:     5 MQSKLDQLTTRLAELNDLLSRENVTADLDQYRKLTREHAEIGPVVEHYAQWRQARADELAAQELLG---DASMRDFAEDELRGARERMGRLAAELQTMLLPKDPNDERNIFVEIRAGTGGDESALFAGDLLRMYLRYAERQRWQVEMMSESPSDLGGYKEVIVRIAGYGAYSRLKFESGGHRVQRVPATETQGRIHTSACTVAVMPEADEIGEVEINPADLRIDTFRASGAGGQHINKTDSAVRVTHIPTGIVVECQDDRSQHKNKDRALKVLAARIKDKQYHEQHAKEAATRKSLIGSGDRSERIRTYNFPQGRMTDHRINLTLYKLEQIMDGDLDELIAALVSEHQA 350
>gi|152986475|ref|YP_001350646.1| peptide chain release factor 1 [Pseudomonas aeruginosa PA7] >gi|166223587|sp|A6VC61|RF1_PSEA7 Peptide chain release factor 1 (RF-1) >gi|150961633|gb|ABR83658.1| peptide chain release factor 1 [Pseudomonas aeruginosa PA7] (360 aa)
Score = 754, Expect = 5.4e-78, Identities = 159/321 (49%), Positives = 227/321 (70%)
  Q:    34 RMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPEL-EEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           R    ++   E  P++  F++Y++   D++ A+ L+K + D E+ +LA+ E++E +  +      L+ +LLPKDPND +NV +E+R   GGDE++IF GDLF  Y RYA+  GW+V+ L   E  HG Y  +   + GENVY+K+KFESG HRVQRVP TES+GR+HTS  TVAVLPE  E+  + IN +DL++DTYR+SGAGGQH+NKT+SAVRITH+P+GI V CQE +SQ +NR  AM  L AKL ++++   ++ I+  RK  VG+G+R+E+IRTYN+PQ RVTDHRINLTL  L  VM G + ++I+ L+   +A ++
  S:    34 RFRAYSREYAEVEPVILAFRDYRKVQADLEGAQALLK-DSDPELRDLAEEEVAEARERLAALGDSLQRMLLPKDPNDGRNVFLEIRAGTGGDEAAIFSGDLFRMYSRYAERQGWRVETLSENEGEHGGYKEVIARVEGENVYAKLKFESGAHRVQRVPETESQGRIHTSACTVAVLPEPDEQAAIEINPADLRVDTYRSSGAGGQHVNKTDSAVRITHLPSGIVVECQEERSQHKNRAKAMAWLAAKLNDQQQAAAQQAIASTRKLLVGSGDRSERIRTYNFPQGRVTDHRINLTLYSLGEVMEGAVEQVIEPLLQEYQADQL 355
>gi|167587636|ref|ZP_02380024.1| peptide chain release factor 1 [Burkholderia ubonensis Bu] (360 aa)
Score = 754, Expect = 5.6e-78, Identities = 154/344 (44%), Positives = 242/344 (70%)
  Q:    11 LLSMEEKFNDLNKELETEGLS--VKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEV-ELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           L  +  +  +LN  L  E ++  + +  ++ +   E  P+V ++  ++++L+D  +A++L+    D  + + A+ E+   +  + + E EL+ +LLPKDPNDD+N+ +E+R   GGDES++F GDL   Y R+A+   W+V+M+    S   GY  +   I G+  YS++KFESG HRVQRVPATE++GR+HTS  TVAV+PE +E+ E+ IN +DL+IDT+RASGAGGQHINKT+SAVR+TH+PTGI V CQ+ +SQ +N++ A+K+L A++ +K+  E     +  RK  +G+G+R+E+IRTYN+PQ R+TDHRINLTL +L+ +M G+L E+I +L+S  +A ++
  S:     9 LDQLSTRLAELNDLLSRENVTADLDQYRKLTREHAELDPVVGQYALWRQSLSDEAAAQELLG---DASMRDFAEDEIRSARDRMVQLEVELQKMLLPKDPNDDRNIFLEIRAGTGGDESALFAGDLLRMYLRFAERQRWQVEMMSESASDLGGYKEVIVRIAGQGAYSRLKFESGGHRVQRVPATETQGRIHTSACTVAVMPEADEIGEVEINPADLRIDTFRASGAGGQHINKTDSAVRVTHLPTGIVVECQDDRSQHKNKDRALKVLAARIKDKQYHEQHAKEAATRKSLIGSGDRSERIRTYNFPQGRMTDHRINLTLYRLEAIMDGDLDELIAALVSEHQAEQL 353
>gi|163746457|ref|ZP_02153815.1| peptide chain release factor 1 [Oceanibulbus indolifex HEL-45] >gi|161380342|gb|EDQ04753.1| peptide chain release factor 1 [Oceanibulbus indolifex HEL-45] (351 aa)
Score = 754, Expect = 5.7e-78, Identities = 158/346 (45%), Positives = 235/346 (67%)
  Q:    11 LLSMEEKFNDLNKELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           L  + ++F  L   + + G      + + K   +  P+V++   Y++   D++ A++++K   D E+ ELA+ EL   +  + + E  L++ LLP+D  D K  ++E+RP  GGDE+++F GDL   Y+RYA++ GW   ++E Q +   G   +   I G+NV++++KFESGVHRVQRVP+TES GR+HTS  TVAVLPE E+V++ IN +DL+IDT R+SGAGGQH+N T+SAVRITHIPTGI V   E KSQ  NR+ AM++L+A+L++ +        S  R  QVG+G+R+E+IRTYN+PQ R+TDHRINLTL +L+ VM G+L EIID+L +  +A ++ E
  S:     7 LAQISQRFQFLEASM-SAGSDGADFAALAKEYSDLKPVVDQIDLYQQLQRDLEEAQEMLK---DPEMAELAREELPRLRARLPEVEGALQLALLPRDAADAKPAMLEIRPGTGGDEAALFAGDLLRMYQRYAEARGWGFDLIESQMTELGGVKEVVAHITGQNVFARLKFESGVHRVQRVPSTESGGRIHTSAATVAVLPEAEDVDIEINANDLRIDTMRSSGAGGQHVNTTDSAVRITHIPTGIVVTSSE-KSQHRNRDKAMQVLKARLYDMERGRIDSERSADRAAQVGSGDRSERIRTYNFPQGRMTDHRINLTLYRLEAVMQGDLDEIIDALTADAQARQLSE 348
>gi|15672577|ref|NP_266751.1| peptide chain release factor 1 [Lactococcus lactis subsp. lactis Il1403] >gi|13878663|sp|Q9CHX3|RF1_LACLA Peptide chain release factor 1 (RF-1) >gi|12723487|gb|AAK04693.1|AE006292_13 peptide chain release factor 1 [Lactococcus lactis subsp. lactis Il1403] (357 aa)
Score = 753, Expect = 6.3e-78, Identities = 164/350 (46%), Positives = 247/350 (70%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDI-DSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           +++ L S+  ++ +L + L    +    KR  E+++   +    V  + EYK+ L  I DS E L +   D+++ E+ + ELS  K   E  E E+K+LLLPKDPND KN+I+E+R AAGGDE+++F GDL + Y+ +++S GWK +++E   +   GY  +S +I+G +VYSK+K+ESG HRVQRVP TE++GRVHTST TV V+PE+EE E+ I+  DL++D Y ASGAGGQ++NK  +AVR+ H+PTGI V  QE ++Q +NR+ A+K+L  K+++  ++      +  RK  VGTG+R+E+IRTYN+PQNRVTDHRI LTL KLD+++ G + E+ID+LI +D+  K++E
  S:     1 MFDQLESIVGRYEELGELLSDPEVVSDTKRFMELSREEADLRDKVATYNEYKKVLETISDSEEMLGEGGLDDDMKEMLKEELSSAKSQKELLEEEIKILLLPKDPNDGKNIILEIRGAAGGDEAALFAGDLLNMYQHFSESQGWKFEIMEANITGIGGYKEVSALISGPSVYSKLKYESGAHRVQRVPVTETQGRVHTSTATVLVMPEVEEFEMTIDQKDLRVDIYHASGAGGQNVNKVATAVRMVHLPTGIKVEMQEERTQQKNRDKAIKLLNTKVFDYYQQIELDKQNAERKSTVGTGDRSERIRTYNFPQNRVTDHRIGLTLQKLDSILSGKMDEVIDALIVYDQTKKLEE 354
>gi|85709577|ref|ZP_01040642.1| protein chain release factor A [Erythrobacter sp. NAP1] >gi|85688287|gb|EAQ28291.1| protein chain release factor A [Erythrobacter sp. NAP1] (355 aa)
Score = 753, Expect = 6.3e-78, Identities = 160/344 (46%), Positives = 234/344 (68%)
  Q:    11 LLSMEEKFNDLNKELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGFISFMIN--GENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLG-NLSEIIDSLISHDEAVKM 354
           L  +  +F +L   + +  L  +     ++   E  P+ +   E K    +I+  E+++    D E+  +A+ ELS  +  + + E  L + LLP+D  D K  ++E+R   GGDE+++F GDLF  Y++YA   GW+V+ + +  S  G GF   + N  G+ V++K+KFESGVHRVQRVP TES GR+HTS  TVAVLPE +EV++ I+  DLKIDTYRASGAGGQH+N T+SA+RITH PTG+ V CQ+G+SQ +NRE AM++LRA+L+EK  +E +   ++ RK  VG+G+R+E+IRTYN+PQ RVTDHRI LTL+KL+ V+ G  L E++D+LI+ DE  ++
  S:     8 LDQIANRFAELEARMASGTLEGEEFVAASRDYAELEPVAKIAGEVKAMREEIEGLEEMLA---DPEMKAMAEEELSAIREALPEKERSLAIALLPRDRADAKPAMLEIRAGTGGDEAALFAGDLFRMYEKYAAEQGWRVEPVSMSASEVG-GFKEIVANVSGQGVFAKLKFESGVHRVQRVPVTESGGRIHTSAATVAVLPEPDEVDVQIDPGDLKIDTYRASGAGGQHVNTTDSAIRITHEPTGLVVTCQDGRSQHKNREKAMQVLRARLYEKTRDEAQGAEAEARKAMVGSGDRSERIRTYNFPQGRVTDHRIGLTLHKLEEVLAGPGLDELVDALIAEDEGKRL 350
>gi|188995885|ref|YP_001930137.1| peptide chain release factor 1 [Porphyromonas gingivalis ATCC 33277] >gi|188595565|dbj|BAG34540.1| peptide chain release factor 1 [Porphyromonas gingivalis ATCC 33277] (352 aa)
Score = 753, Expect = 6.6e-78, Identities = 156/346 (45%), Positives = 240/346 (69%)
  Q:    14 MEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQE-SSHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQEAKI 359
           +E +F +++  +    +   +KR ++++K  ++   I    ++Y+  L +I+ A+  +  E D E+ E+A+  L+E    +   E E+K+LL+P +P DDKN IVE+R   GGDE+++F GDL+  Y +Y +S GW+V++ ++ E ++ GY  I F + GE VY  +K+ESGVHRVQRVPATE++GR+HTS  TVAVLPE EEV++ IN +D+++ T R+ GAGGQ++NK E+ V++TH PTG+ V CQ+ +SQI NRE AM+MLR+KL++ +  ++ + I+  RK  V TG+R+ KIRTYNYPQ RVTDHRIN+T+  L  VM G +   ID+LI  +   +M+EA +
  S:     4 LESRFEEISTLITDPAVIADMKRFTKLSKEYRDLEKIHTAGRDYRNLLANIEEAKHTMAKESDEELREMAREMLAEANERLPILEEEIKMLLIPANPEDDKNAIVEIRGGTGGDEAALFAGDLYRMYVKYCESKGWQVEVTDLSEGATGGYKEIVFSVKGEGVYGILKYESGVHRVQRVPATETQGRIHTSAATVAVLPEAEEVDVEINPADIEMQTSRSGGAGGQNVNKVETKVQLTHKPTGMVVVCQQARSQIANRELAMQMLRSKLYDIELSKHNEAIAARRKTMVSTGDRSAKIRTYNYPQGRVTDHRINMTVYNLSAVMDGEVQPFIDALIIAENVERMKEAAL 352
>gi|53732835|ref|ZP_00155134.2| COG0216: Protein chain release factor A [Haemophilus influenzae R2846] (361 aa)
Score = 753, Expect = 7.0e-78, Identities = 165/348 (47%), Positives = 241/348 (69%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGLSVKRMSE------INKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           + +S+++  E   +  +ELE     V  +S+       +K   +   +V+ F  + +   +I+ AE L+    D E+ E+AQ+E+ E K  IE+ E +L++LLLPKDPND+ N  +E+R   GGDE+ IF GDLF  Y RYA+S  W+V+ML   ES  G Y  +   + GE VY ++KFESG HRVQRVP TES+GR+HTS  TVAV+P+L E E+  IN +DL+IDTYR+SGAGGQH+N T+SAVRITHIPTGI V CQ+ +SQ +N+  AM +L +++ + ++E      +D+R+  +G+G+R++KIRTYNYPQ RVTDHRINLT+ +LD +M G + E+I  +I+  +A ++
  S:     2 MKDSIIAKLESLKERYEELEALLGDVSVISDQDKFRAYSKEYSQLEEVVKCFNRWTQLNQNIEEAEILLD---DPEMKEMAQMEIEESKAEIEEVEQQLQILLLPKDPNDEYNCYLEIRAGTGGDEAGIFAGDLFRMYSRYAESKRWRVEMLSANESEQGGYKEVIVKVTGEGVYGQLKFESGGHRVQRVPKTESQGRIHTSACTVAVMPKLPESEMPEINPADLRIDTYRSSGAGGQHVNTTDSAVRITHIPTGIVVECQDERSQHKNKAKAMSVLASRIVQAEQERQAAEQTDMRRNLLGSGDRSDKIRTYNYPQGRVTDHRINLTIYRLDEIMNGKIDELIQPIITEYQADQL 354
>gi|163735803|ref|ZP_02143232.1| peptide chain release factor 1 [Roseobacter litoralis Och 149] >gi|161390889|gb|EDQ15229.1| peptide chain release factor 1 [Roseobacter litoralis Och 149] (351 aa)
Score = 753, Expect = 7.4e-78, Identities = 161/348 (46%), Positives = 239/348 (68%)
  Q:     9 NSLLSMEEKFNDLNKELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           + L  + E+F  L   + T G     ++ + K   +  P+VE+   Y++ LND++ A +++    D ++  LA+ E+   K  + + E  L++ LLPKD  D K  ++E+RP  GGDE+++F GDLF  Y+RYA++ GWKV ++E+QE+   G   +   I G +V++++K+ESGVHRVQRVP+TES GR+HTS  TVAVLPE E+V++ I  +DL+IDT R+SGAGGQH+N T+SAVRITH+PTG+ V   E KSQ  NRE AM++L+A+L++ +        S  R  QVG+G+R+E+IRTYN+PQ R+TDHRINLTL +LD ++ G+L EIID+L +H +A  M +
  S:     5 DRLRQITERFQYLEAAMST-GDGGGDIATLAKEYSDLRPVVEQISAYQQLLNDLEDAAEMLG---DPDMAPLAEEEIPRLKSALPQAEAALQLALLPKDKADAKPAMLEIRPGTGGDEAALFAGDLFRMYQRYAETQGWKVDVIELQETELGGIKEVVAHIKGADVFARLKYESGVHRVQRVPSTESGGRIHTSAATVAVLPEAEDVDIHIEANDLRIDTMRSSGAGGQHVNTTDSAVRITHLPTGLVVTSSE-KSQHRNREIAMQVLKARLYDLERSRVDDERSADRAAQVGSGDRSERIRTYNFPQGRMTDHRINLTLYRLDAILQGDLDEIIDALTAHAQAQLMAD 348
>gi|127513840|ref|YP_001095037.1| peptide chain release factor 1 [Shewanella loihica PV-4] >gi|166223603|sp|A3QH30|RF1_SHELP Peptide chain release factor 1 (RF-1) >gi|126639135|gb|ABO24778.1| peptide chain release factor 1 [Shewanella loihica PV-4] (361 aa)
Score = 752, Expect = 7.6e-78, Identities = 155/319 (48%), Positives = 227/319 (71%)
  Q:    33 KRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGF--ISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           +R   ++K   +   +V+ FK Y++   D+ SA++++ +E D ++ E+AQ E+ E K  ++  E EL++LLLPKDP DD N  +E+R  AGGDE++IF GDLF  Y RY ++  W+++++   E  HG GF  I   ++G+ VY K+KFESG HRVQRVP TES+GRVHTS  TV V+PE+ E E + IN +DLK+DT+RASGAGGQH+NKT+SA+RITHIP+GI V CQ+ +SQ +NR  AM +L A++   ++E+ R      R+  V +G+R+E++RTYN+PQ RV++HRINLTL +L  VM G+L  I+  L+  ++A
  S:    33 ERFRALSKEYSQLEDVVKSFKAYRQAEEDLASAQEML-AEDDADLKEMAQEEIKEAKATLDVLEGELQILLLPKDPKDDNNAFLEIRAGAGGDEAAIFAGDLFRMYSRYCEANRWQMEIMNANEGEHG-GFKEIIVKVSGDGVYGKLKFESGGHRVQRVPETESQGRVHTSACTVVVMPEIPEAEAIEINPADLKVDTFRASGAGGQHVNKTDSAIRITHIPSGIVVECQDQRSQHKNRAQAMSVLAARIQAVEDEKRRSEEESTRRNLVASGDRSERVRTYNFPQGRVSEHRINLTLYRLSEVMEGDLDAILGPLMQENQA 352
>gi|116511384|ref|YP_808600.1| peptide chain release factor 1 [Lactococcus lactis subsp. cremoris SK11] >gi|123125765|sp|Q031E4|RF1_LACLS Peptide chain release factor 1 (RF-1) >gi|116107038|gb|ABJ72178.1| bacterial peptide chain release factor 1 (bRF-1) [Lactococcus lactis subsp. cremoris SK11] (357 aa)
Score = 752, Expect = 7.6e-78, Identities = 165/350 (47%), Positives = 246/350 (70%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDI-DSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           +++ L S+  ++ +L + L    +    KR  E+++   +    V  + EYK+ L  I DS E L +   D+E+ E+ + ELS  K   E  E E+K+LLLPKDPND KN+I+E+R AAGGDE+++F GDL + Y+ +++S GWK +++E   +   GY  +S +I+G +VYSK+K+ESG HRVQRVP TE++GRVHTST TV V+PE+EE E+ I   DL++D Y ASGAGGQ++NK  +AVR+ H+PTGI V  QE ++Q +NR+ A+K+L  K+++  ++      +  RK  VGTG+R+E+IRTYN+PQNRVTDHRI LTL KLD+++ G + E+ID+LI +D+  K++E
  S:     1 MFDQLESIVGRYEELGELLSDPEVVSDTKRFMELSREEADLRDKVATYNEYKKVLETISDSEEMLGEGGLDDEMKEMLKEELSSAKSQKEVLEEEIKILLLPKDPNDGKNIILEIRGAAGGDEAALFAGDLLNMYQHFSESQGWKFEIMEANITGIGGYKEVSALISGPSVYSKLKYESGAHRVQRVPVTETQGRVHTSTATVLVMPEVEEFEMTIEQKDLRVDIYHASGAGGQNVNKVATAVRMVHLPTGIKVEMQEERTQQKNRDKAIKLLNTKVFDYYQQIELDKQNAERKSTVGTGDRSERIRTYNFPQNRVTDHRIGLTLQKLDSILSGKMDEVIDALIVYDQTKKLEE 354
>gi|187930213|ref|YP_001900700.1| peptide chain release factor 1 [Ralstonia pickettii 12J] >gi|187727103|gb|ACD28268.1| peptide chain release factor 1 [Ralstonia pickettii 12J] (360 aa)
Score = 752, Expect = 7.7e-78, Identities = 156/348 (44%), Positives = 239/348 (68%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGLS--VKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEV-ELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           + + L  + E+  ++N  L  E  +  + +  ++ +   E  P+V +F  +K+   DI +A++L     D ++   A+ EL   +  +E  E EL+ LLLPKDPND +N+ VE+R   GGDES++F GDL   Y RYA+   W+V+++    S   GY  +   + GE  YS++KFESG HRVQRVPATE++GR+HTS  TVAV+PE + + ++ IN +DL+IDT+RASGAGGQHINKT+SAVRITH+PTG+ V CQ+ +SQ  N++ AM++L A+L +++E E +   +  RK  +G+G+R+++IRTYN+PQ RVTDHRINLTL K+D +M G++ E++ +L +  +A ++
  S:     5 MLSKLDQLAERIVEINALLAREDATANLDQYRKLTREHAELEPVVAQFAAWKQAEEDIATAQEL---AADPDMKAFAEDELRAARERMESLEGELQRLLLPKDPNDHRNIFVEIRAGTGGDESALFAGDLLRMYTRYAERQRWQVEIVSESPSDLGGYKEVIARLVGEGAYSRLKFESGGHRVQRVPATEAQGRIHTSACTVAVMPEADALADIQINPADLRIDTFRASGAGGQHINKTDSAVRITHLPTGLVVECQDDRSQHRNKDRAMQVLAARLKDRQEREAQAKEASARKSLIGSGDRSDRIRTYNFPQGRVTDHRINLTLYKIDAIMDGDIDELVGALAAEHQAEQL 353
>gi|107024140|ref|YP_622467.1| peptide chain release factor 1 [Burkholderia cenocepacia AU 1054] >gi|116688534|ref|YP_834157.1| peptide chain release factor 1 [Burkholderia cenocepacia HI2424] >gi|170731835|ref|YP_001763782.1| peptide chain release factor 1 [Burkholderia cenocepacia MC0-3] >gi|194557450|ref|YP_002092476.1| Peptide chain release factor 1 [Burkholderia cenocepacia PC184] >gi|166223531|sp|A0K437|RF1_BURCH Peptide chain release factor 1 (RF-1) >gi|119361514|sp|Q1BSB1|RF1_BURCA Peptide chain release factor 1 (RF-1) >gi|105894329|gb|ABF77494.1| bacterial peptide chain release factor 1 (bRF-1) [Burkholderia cenocepacia AU 1054] >gi|116646623|gb|ABK07264.1| bacterial peptide chain release factor 1 (bRF-1) [Burkholderia cenocepacia HI2424] >gi|124871241|gb|EAY62957.1| Peptide chain release factor 1 [Burkholderia cenocepacia PC184] >gi|169815077|gb|ACA89660.1| peptide chain release factor 1 [Burkholderia cenocepacia MC0-3] (360 aa)
Score = 752, Expect = 7.8e-78, Identities = 154/341 (45%), Positives = 240/341 (70%)
  Q:    11 LLSMEEKFNDLNKELETEGLS--VKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEV-ELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           L  +  +  +LN  L  E ++  + +  ++ +   E  P+VE++  ++++ +D  +A++L+    D  + + A+ E+   +  + + E EL+ +LLPKDPNDD+N+ +E+R   GGDES++F GDL   Y R+A+   W+V+M+    S   GY  +   I G+  YS++KFESG HRVQRVPATE++GR+HTS  TVAV+PE +E+ E+ IN +DL+IDT+RASGAGGQHINKT+SAVR+THIPTGI V CQ+ +SQ +N++ A+K+L A++ +K+  E     +  RK  +G+G+R+E+IRTYN+PQ R+TDHRINLTL +L+ +M G+L E+I +L++  +A
  S:     9 LDQLSTRLAELNDLLSRENVTADLDQYRKLTREHAELGPVVEQYALWRQSRSDETAAQELLA---DPSMRDFAEDEIRSAREGMARLETELQKMLLPKDPNDDRNIFLEIRAGTGGDESALFAGDLLRMYLRFAERQRWQVEMMSESASDLGGYKEVIVRIAGQGAYSRLKFESGGHRVQRVPATETQGRIHTSACTVAVMPEADEIGEVEINPADLRIDTFRASGAGGQHINKTDSAVRVTHIPTGIVVECQDDRSQHKNKDRALKVLAARIKDKQYHEQHAKEAATRKSLIGSGDRSERIRTYNFPQGRMTDHRINLTLYRLEAIMDGDLDELIGALVTEHQA 350
>gi|117919221|ref|YP_868413.1| peptide chain release factor 1 [Shewanella sp. ANA-3] >gi|166223605|sp|A0KT88|RF1_SHESA Peptide chain release factor 1 (RF-1) >gi|117611553|gb|ABK47007.1| peptide chain release factor 1 [Shewanella sp. ANA-3] (363 aa)
Score = 752, Expect = 7.8e-78, Identities = 157/319 (49%), Positives = 228/319 (71%)
  Q:    33 KRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGF--ISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           +R   ++K   +   +V  FK Y++   D++SA+++++ E D E+ E+AQ E+   K  +E+ E EL++LLLPKDPNDD N  +E+R  AGGDE++IF GDLF  Y RYA++  W+++++   E  HG GF  I   ++GE  Y K+KFESG HRVQRVP TES+GRVHTS +TV V+ E+ E E + IN +DLK+DT+R+SGAGGQH+NKT+SA+RITHIPTGI V CQ+ +SQ +NR  AM +L A++   ++E+ R      R+  V +G+R+E++RTYN+PQ RV++HRINLTL +L+ VM G+L  I+  L+   +A
  S:    33 ERFRALSKEYSQLEEVVAGFKAYQQAQADLESAKEMLE-EDDAEMREMAQEEIKAAKAELERLEAELQILLLPKDPNDDTNAFIEIRAGAGGDEAAIFAGDLFRMYSRYAEANRWQLEIMSSNEGEHG-GFKEIIVKVSGEGAYGKLKFESGGHRVQRVPETESQGRVHTSAVTVVVMHEVPEAEAISINPADLKVDTFRSSGAGGQHVNKTDSAIRITHIPTGIVVECQDQRSQHKNRAQAMSVLAARIQAVEDEKRRSAEESTRRSLVASGDRSERVRTYNFPQGRVSEHRINLTLYRLNEVMEGDLDAILGPLMQEHQA 352
>gi|91792280|ref|YP_561931.1| peptide chain release factor 1 [Shewanella denitrificans OS217] >gi|119361603|sp|Q12QR8|RF1_SHEDO Peptide chain release factor 1 (RF-1) >gi|91714282|gb|ABE54208.1| peptide chain release factor 1 [Shewanella denitrificans OS217] (361 aa)
Score = 752, Expect = 7.9e-78, Identities = 155/319 (48%), Positives = 230/319 (72%)
  Q:    33 KRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           +R   ++K   +   +V+ FK +++   D+ SA+++++ E D E+ E+AQ E+   K +IE+ E EL++LLLPKDPNDD N  +E+R  AGGDE++IF GDLF  Y R+ ++  W+V+++ V E+   G+  I   ++GE VY K+K+ESG HRVQRVP TES+GRVHTS  TV VL E+ E E + IN +DLK+DT+RASGAGGQH+NKT+SA+RITHIP+GI V CQ+ +SQ +NR  AM +L A++   ++E+ R      R+  V +G+R+E+IRTYNYPQ RV+DHRINLTL +L+ +M G+L+ +++ ++   +A
  S:    33 ERFRALSKEYSQLEDVVKSFKAFQQAQLDLASAKEMLQ-EDDAEMREMAQEEMKAAKKVIEQLEDELQILLLPKDPNDDTNAFLEIRAGAGGDEAAIFAGDLFRMYSRFCEANKWQVEVMNVNEADLGGFKEIIVKVSGEGVYGKLKYESGGHRVQRVPETESQGRVHTSACTVVVLHEVPEAEAISINPADLKVDTFRASGAGGQHVNKTDSAIRITHIPSGIIVECQDQRSQHKNRAQAMSVLAARIQAIEDEKRRSAEETTRRSLVASGDRSERIRTYNYPQGRVSDHRINLTLYRLNEIMEGDLNALLEPIMLEHQA 352
>gi|125623422|ref|YP_001031905.1| peptide chain release factor 1 [Lactococcus lactis subsp. cremoris MG1363] >gi|166223566|sp|A2RIR4|RF1_LACLM Peptide chain release factor 1 (RF-1) >gi|124492230|emb|CAL97159.1| peptide chain release factor 1 (RF-1) [Lactococcus lactis subsp. cremoris MG1363] (357 aa)
Score = 752, Expect = 8.0e-78, Identities = 165/350 (47%), Positives = 246/350 (70%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDI-DSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           +++ L S+  ++ +L + L    +    KR  E+++   +    V  + EYK+ L  I DS E L +   D+E+ E+ + ELS  K   E  E E+K+LLLPKDPND KN+I+E+R AAGGDE+++F GDL + Y+ +++S GWK +++E   +   GY  +S +I+G +VYSK+K+ESG HRVQRVP TE++GRVHTST TV V+PE+EE E+ I   DL++D Y ASGAGGQ++NK  +AVR+ H+PTGI V  QE ++Q +NR+ A+K+L  K+++  ++      +  RK  VGTG+R+E+IRTYN+PQNRVTDHRI LTL KLD+++ G + E+ID+LI +D+  K++E
  S:     1 MFDQLESIVGRYEELGELLSDPEVVSDTKRFMELSREEADLRDKVATYNEYKKVLETISDSEEMLGEGGLDDEMKEMLKEELSSAKSQKEVLEEEIKILLLPKDPNDGKNIILEIRGAAGGDEAALFAGDLLNMYQHFSESQGWKFEIMEANITGIGGYKEVSALISGPSVYSKLKYESGAHRVQRVPVTETQGRVHTSTATVLVMPEVEEFEMTIEQKDLRVDIYHASGAGGQNVNKVATAVRMVHLPTGIKVEMQEERTQQKNRDKAIKLLNTKVFDYYQQIELDKQNTERKSTVGTGDRSERIRTYNFPQNRVTDHRIGLTLQKLDSILSGKMDEVIDALIVYDQTKKLEE 354
>gi|148981991|ref|ZP_01816579.1| peptide chain release factor 1 [Vibrionales bacterium SWAT-3] >gi|145960679|gb|EDK26023.1| peptide chain release factor 1 [Vibrionales bacterium SWAT-3] (362 aa)
Score = 752, Expect = 8.1e-78, Identities = 152/321 (47%), Positives = 229/321 (71%)
  Q:    34 RMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           +   ++K   +   + + F+ Y++  +D+++AE + + E D E+ E+AQ E+ E K  IE+   EL++LLLPKDPND++N  +E+R  AGGDE+ IF G+LF  Y ++A+  GW+V+++   +S  G Y  +   ++GE VY  MKFESG HRVQRVP TES+GRVHTS  TVAV+PE+ E +L  I  +DLKIDT+RASGAGGQH+N T+SA+RITH+PTG  V CQ+ +SQ +N+  AM +L A++ + +EE     +SD R+  +G+G+R+++IRTYNYPQ RV+DHRINLTL +L+ V+ G++  +ID ++   +A ++
  S:    34 KFRALSKEYSQLEEVTKCFQAYQQAQDDLEAAEDMAQ-EDDEEMREMAQEEIKEAKEAIERLTDELQILLLPKDPNDERNCFLEIRAGAGGDEAGIFAGNLFRMYSKFAEKKGWRVEVMSSNDSEQGGYKEMIAKVSGEGVYGVMKFESGGHRVQRVPETESQGRVHTSACTVAVMPEIPEADLPEIKAADLKIDTFRASGAGGQHVNTTDSAIRITHLPTGTVVECQDERSQHKNKAKAMAVLAARIVQAEEERRAAEVSDTRRNLLGSGDRSDRIRTYNYPQGRVSDHRINLTLYRLNEVLEGDMQSLIDPVLQEHQADQL 355
>gi|159044282|ref|YP_001533076.1| peptide chain release factor 1 [Dinoroseobacter shibae DFL 12] >gi|189039970|sp|A8LLU7|RF1_DINSH Peptide chain release factor 1 (RF-1) >gi|157912042|gb|ABV93475.1| peptide chain release factor 1 [Dinoroseobacter shibae DFL 12] (351 aa)
Score = 752, Expect = 8.2e-78, Identities = 162/348 (46%), Positives = 232/348 (66%)
  Q:    11 LLSMEEKFNDLNKELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGFISFMI---NGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQEAK 358
           L  + E+F  +   +   G + + ++ + +   E  P+V +   Y R   D+  AE ++    D E+  LA+ E+   K  I + E  L++ LLPKD  D +  ++E+RP  GG+E+++F GDL   Y+RYA++ GW+ ++  V ES    G I  +I   +G  V++K+K+ESGVHRVQRVP TES GR+HTS  TVAVLPE E V++ I  SD++IDT RASGAGGQH+N T+SAVRITHIPTG+ V   E KSQ  NR+ AM++LRA+L++ + +      S  RKGQVG+G+R+E+IRTYN+PQ R+TDHRINLTL KLD VM G+L E+I +L + D+A  + E +
  S:     7 LAQITERFEYIEARMAA-GAAGEDIAALGREYAELKPVVAEIAAYSRARADLAEAEAMLD---DPEMRALAEEEIPALKARIPEMEQALRLALLPKDAADARPAMIEIRPGTGGEEAALFAGDLLRMYQRYAEAQGWRFQI--VSESLTELGGIKEVIAHVSGSGVFAKLKYESGVHRVQRVPVTESGGRIHTSAATVAVLPEAEAVDIDIPASDIRIDTMRASGAGGQHVNTTDSAVRITHIPTGLVVTSSE-KSQHRNRDIAMQVLRARLYDLERQRADAERSAARKGQVGSGDRSERIRTYNFPQGRMTDHRINLTLYKLDQVMQGDLDEVIAALAADDQARLLAEVE 350
>gi|56421913|ref|YP_149231.1| peptide chain release factor 1 [Geobacillus kaustophilus HTA426] >gi|61214572|sp|Q5KUH3|RF1_GEOKA Peptide chain release factor 1 (RF-1) >gi|56381755|dbj|BAD77663.1| peptide chain release factor 1 (RF-1) in translation [Geobacillus kaustophilus HTA426] (358 aa)
Score = 752, Expect = 8.5e-78, Identities = 174/351 (49%), Positives = 255/351 (72%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQEA 357
           +++ L ++E+++  LN+ L    +    K++ + +K   +    V+ ++EYK     +  A+ +++ + + E+ E+ + E+ E +   E    +LKVLLLPKDPND+KNVI+E+R AAGG+E+++F GDL+  Y RYA+S GWK +++E   +   GY  I FMING+  YSK+KFE+G HRVQRVP TES GR+HTST TVA LPE+EE+E+ IN  D+++DT+ +SG GGQ +N T SAVR+THIPTGI V CQ+ KSQI+N+E AMK+LRA++++K ++E R      RK  VGTG+R+E+IRTYN+PQNRVTDHRI LT+ KLD V+ G+L EII++LI  D+A K+++A
  S:     1 MFDRLEAVEQRYEKLNELLMDPDVINDPKKLRDYSKEQADLEETVQTYREYKSVREQLAEAKAMLEEKLEPELREMVKEEIGELEEREEALVEKLKVLLLPKDPNDEKNVIMEIRAAAGGEEAALFAGDLYRMYTRYAESQGWKTEVIEASPTGLGGYKEIIFMINGKGAYSKLKFENGAHRVQRVPETESGGRIHTSTATVACLPEMEEIEVEINEKDIRVDTFASSGPGGQSVNTTMSAVRLTHIPTGIVVTCQDEKSQIKNKEKAMKVLRARIYDKYQQEARAEYDQTRKQAVGTGDRSERIRTYNFPQNRVTDHRIGLTIQKLDQVLDGHLDEIIEALILDDQAKKLEQA 354
>gi|24375323|ref|NP_719366.1| peptide chain release factor 1 [Shewanella oneidensis MR-1] >gi|32171552|sp|Q8EAR3|RF1_SHEON Peptide chain release factor 1 (RF-1) >gi|24350136|gb|AAN56810.1|AE015816_7 peptide chain release factor 1 [Shewanella oneidensis MR-1] (363 aa)
Score = 752, Expect = 9.0e-78, Identities = 157/318 (49%), Positives = 227/318 (71%)
  Q:    34 RMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGF--ISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           R   ++K   +   +V  FK Y++   D++SA+++++ E D E+ E+AQ E+   K  +E+ E EL++LLLPKDPNDD N  +E+R  AGGDE++IF GDLF  Y RYA++  W+++++   E  HG GF  I   ++GE  Y K+KFESG HRVQRVP TES+GRVHTS +TV V+ E+ E E + IN +DLK+DT+R+SGAGGQH+NKT+SA+RITHIPTGI V CQ+ +SQ +NR  AM +L A++   ++E+ R      R+  V +G+R+E++RTYN+PQ RV++HRINLTL +L+ VM G+L  I+  L+   +A
  S:    34 RFRALSKEYSQLEEVVAGFKAYQQAQADLESAKEMLE-EDDAEMREMAQEEIKAAKVELERLEAELQILLLPKDPNDDTNAFIEIRAGAGGDEAAIFAGDLFRMYSRYAEANRWQLEIMSSNEGEHG-GFKEIIVKVSGEGAYGKLKFESGGHRVQRVPETESQGRVHTSAVTVVVMHEVPEAEAISINPADLKVDTFRSSGAGGQHVNKTDSAIRITHIPTGIVVECQDQRSQHKNRAQAMSVLAARIQAVEDEKRRSAEESTRRSLVASGDRSERVRTYNFPQGRVSEHRINLTLYRLNEVMEGDLDAILGPLMQEHQA 352
>gi|15677534|ref|NP_274690.1| peptide chain release factor 1 [Neisseria meningitidis MC58] >gi|20139351|sp|Q9JY93|RF1_NEIMB Peptide chain release factor 1 (RF-1) >gi|7226940|gb|AAF42034.1| peptide chain release factor 1 [Neisseria meningitidis MC58] (358 aa)
Score = 752, Expect = 9.5e-78, Identities = 161/315 (51%), Positives = 227/315 (72%)
  Q:    37 EINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVE-LVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           ++ +   E TP+VE F+ Y+   +D+  AE+++    D E+ + A  E+   K  I + + EL+ LLLPKD +DDKN+ +E+R   GGDE+++F GDL   Y RYA+   W+V+++   ES   GY  +   I G   YS++KFESG HRVQRVPATES+GR+HTS  TVAV+PE +E+E + +N +DL+IDT+RASGAGGQHINKT+SAVRITH+PTG+ V CQ+G+SQ  N+  AMK+L A+L + ++ E +   +  RK  +G+G+R+E+IRTYNYPQ RVTDHRINLTL+KLD VM G+L EI ++LI+  +A
  S:    37 KLTREHAELTPVVEVFQNYRLAQSDLADAEEMLS---DPEMKDFAAEEIEAAKAKIGELDTELQKLLLPKDADDDKNIFIEIRAGTGGDEAALFAGDLLRMYSRYAERNRWQVEIVSANESELGGYKEVIARIVGLGAYSRLKFESGGHRVQRVPATESQGRIHTSACTVAVMPEADELEDIELNPADLRIDTFRASGAGGQHINKTDSAVRITHLPTGMVVECQDGRSQHANKAQAMKVLAARLNDAQKREAQAKEAAERKSLIGSGDRSERIRTYNYPQGRVTDHRINLTLHKLDFVMDGDLEEITNALIAEHQA 350
>gi|103488191|ref|YP_617752.1| peptide chain release factor 1 [Sphingopyxis alaskensis RB2256] >gi|119361612|sp|Q1GPK3|RF1_SPHAL Peptide chain release factor 1 (RF-1) >gi|98978268|gb|ABF54419.1| bacterial peptide chain release factor 1 (bRF-1) [Sphingopyxis alaskensis RB2256] (355 aa)
Score = 752, Expect = 9.5e-78, Identities = 153/339 (45%), Positives = 229/339 (67%)
  Q:    16 EKFNDLNKELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           E+   L   + T  ++       +K   E  P+    +E  R   ++ +  +++    D E+  +A  E++  +  +   E++L + LLPKD  D +  ++E+R   GGDE+++F GDL   Y RYAD+ GWKV+++   E+   GY  +   ++G+ V++K+KFESGVHRVQRVP TES GR+HTS  TVAVLPE EEV++ IN+SDLKID YRASGAGGQH+N T+SA+RITHIPTG+ V  Q+ +SQ +NR  AM++LRA+L++ + E+     +  RK  VG+G+R+E+IRTYN+PQ RVTDHRINLTL++L  ++ G + E+ID+LI+ D+A ++
  S:    14 ERHAALQARMATGDMAPADFVAASKEFAELEPVATAAREVVRLREELVALNEMLA---DPEMKAMAVEEIAAVEAALPAAEHDLALQLLPKDVADSRAAMLEIRAGTGGDEAALFAGDLLRMYSRYADTQGWKVEIISANEAEVGGYKEVVASVSGQGVFAKLKFESGVHRVQRVPVTESGGRIHTSAATVAVLPEAEEVDVAINDSDLKIDIYRASGAGGQHVNTTDSAIRITHIPTGLVVIQQDQRSQHKNRAKAMQVLRARLYDLEREKLHSAEASARKSMVGSGDRSERIRTYNFPQGRVTDHRINLTLHRLPEILEGAMDELIDALIAEDQAQRL 350
>gi|153887157|ref|ZP_02008309.1| peptide chain release factor 1 [Ralstonia pickettii 12D] >gi|151576245|gb|EDN40649.1| peptide chain release factor 1 [Ralstonia pickettii 12D] (360 aa)
Score = 752, Expect = 9.6e-78, Identities = 155/348 (44%), Positives = 238/348 (68%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGLS--VKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEV-ELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           + + L  + E+  ++N  L  E  +  + +  ++ +   E  P+V +F  +KR   DI +A++L     D ++    + EL   +  +E  E EL+ LLLPK+PND +N+ VE+R   GGDES++F GDL   Y RYA+   W+V+++    S   GY  +   + GE  YS++KFESG HRVQRVPATE++GR+HTS  TVA++PE + + ++ IN +DL+IDT+RASGAGGQHINKT+SAVRITH+PTG+ V CQ+ +SQ  N++ AM++L A+L +++E E +   +  RK  +G+G+R+++IRTYN+PQ RVTDHRINLTL K+D +M G+L E++ +L +  +A ++
  S:     5 MLSKLDQLAERIVEINALLAREDATANLDQYRKLTREHAELEPVVAQFAAWKRAEEDIATAQEL---AADPDMKAFGEDELRAARERMESLEGELQRLLLPKNPNDHRNIFVEIRAGTGGDESALFAGDLLRMYTRYAERQRWQVEIVSESASDLGGYKEVIARLVGEGAYSRLKFESGGHRVQRVPATEAQGRIHTSACTVAIMPEADALADIQINPADLRIDTFRASGAGGQHINKTDSAVRITHLPTGLVVECQDDRSQHRNKDRAMQVLAARLKDRQEREAQAKEASARKSLIGSGDRSDRIRTYNFPQGRVTDHRINLTLYKIDAIMDGDLDELVGALAAEHQAEQL 353
>gi|195953354|ref|YP_002121644.1| peptide chain release factor 1 [Hydrogenobaculum sp. Y04AAS1] >gi|195932966|gb|ACG57666.1| peptide chain release factor 1 [Hydrogenobaculum sp. Y04AAS1] (356 aa)
Score = 751, Expect = 1.0e-77, Identities = 168/320 (52%), Positives = 234/320 (73%)
  Q:    38 INKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQEA 357
           ++K +KE + I E +K+Y + L DI+  ++L+K   D ++ ELA+ EL      + + E EL  +L PKD ND KNVI+E+R  AGG+E+++F  DL   Y+RYA+  GWK  +LE  ++   GY  +   I G+NVYS +K+ESGVHRVQRVP TES GR+HTSTITVAVLPE +E ++VIN  DL+I+T+RASGAGGQ++N TESAVRITHIPTGI ++CQ+ +SQ++N+  AM++L A+L +  E++ ++     RK QVGTGER+EKIRTYN+ QNRVTDHRINLTL+KL +V+ G+L +II SL + +   K+  A
  S:    39 LSKDLKELSYIHELYKDYNKILKDIEDTKELLK---DKDLRELAEKELENLNTKLLQKEKELINVLTPKDANDSKNVILEIRAGAGGEEAALFAADLLRMYQRYAERKGWKFNILEANKTGLGGYKEVIVSIEGKNVYSHLKYESGVHRVQRVPITESGGRIHTSTITVAVLPEADETDVVINPQDLRIETFRASGAGGQYVNTTESAVRITHIPTGISISCQDERSQLQNKLKAMRILYARLKDFYEKQKKEETDKERKEQVGTGERSEKIRTYNFSQNRVTDHRINLTLHKLQDVLDGDLDDIISSLQAKELEEKLASA 356
>gi|90412790|ref|ZP_01220790.1| peptide chain release factor 1 [Photobacterium profundum 3TCK] >gi|90326149|gb|EAS42576.1| peptide chain release factor 1 [Photobacterium profundum 3TCK] (362 aa)
Score = 751, Expect = 1.1e-77, Identities = 160/341 (46%), Positives = 234/341 (68%)
  Q:    11 LLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           L ++ E++ ++   L   G+     +   ++K   +   I + F+ Y    +D+++AE++ K E D E+ E+AQ E+ E K  I + E EL+VLL+PKDPNDD+N  VE+R  AGGDE+ IF GDLF  Y RYA+  GW+++++    S  G Y  +   ++G+  Y  +KFESG HRVQRVPATES+GRVHTS  TVAV+PE+ E E+  IN  DLKIDT+R+SGAGGQH+N T+SA+RITH+PTGI V CQ+ +SQ +N+  AM +L A++ + +EE+     +  R+  +G+G+R+++IRTYNYPQ RV+DHRI LTL +L+ VM G+L  +I  +I   +A
  S:     9 LETLVERYEEIQHLLGDPGILSDQNKFRALSKEYSQLEDITQCFQAYLGAKDDLEAAEEMAK-EDDPEMREMAQEEVKESKANILRLEDELQVLLIPKDPNDDRNCFVEIRAGAGGDEAGIFAGDLFRMYSRYAERRGWRIEVINENRSEQGGYKEMIAKVSGDGAYGILKFESGGHRVQRVPATESQGRVHTSACTVAVMPEIPEAEIPEINTGDLKIDTFRSSGAGGQHVNTTDSAIRITHLPTGIVVECQDERSQHKNKAKAMSVLAARIIKAEEEKRHAEEASTRRNLLGSGDRSDRIRTYNYPQGRVSDHRITLTLYRLNEVMEGDLDSLIQPVIQEHQA 352
>gi|182677881|ref|YP_001832027.1| peptide chain release factor 1 [Beijerinckia indica subsp. indica ATCC 9039] >gi|182633764|gb|ACB94538.1| peptide chain release factor 1 [Beijerinckia indica subsp. indica ATCC 9039] (358 aa)
Score = 751, Expect = 1.1e-77, Identities = 160/329 (48%), Positives = 232/329 (70%)
  Q:    30 LSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIE-------------------KYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQE-SSHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGN-LSEIIDSLISHDEAVKMQEAK 358
           L ++R  EI+  + E  P    F    R L  +D   + I++ +D E+ E++ +E     P  E                    +E  L++ LLPKD +D+K+ I+E+R   GGDE+++F GDLF  Y+RYA++ GW V++L V E ++ GY  I   I G+ V++K+KFESG HRVQRVP TE++GR+HTS  TVAVLP+ EEV++ IN +DLKIDT RA GAGGQH+NKTESA+RITH+PTG  +  Q+ +SQ +NR  AM +LR+++++ K ++     +  RK QVG+G+R+E+IRTYN+PQ R+TDHRINLTL KLD VM G  L E+ID+LI+  +A ++  ++
  S:     9 LILRRHEEISARLTEN-PDAATFVSLSRELAGLDEVAQAIRAYRD-EMTEISGMEAMLADPATEPELLALAEEELQDARQRLGAFEQHLRIALLPKDADDEKSAILEIRAGTGGDEAALFAGDLFRMYQRYAEAKGWGVEILSVSEGTAGGYKEIVAEITGKGVFAKLKFESGTHRVQRVPDTETQGRIHTSAATVAVLPQAEEVDVEINEADLKIDTMRAQGAGGQHVNKTESAIRITHLPTGTVIFVQDERSQHKNRARAMSLLRSRIYDAKRQQLEAERAADRKAQVGSGDRSERIRTYNFPQGRLTDHRINLTLYKLDKVMTGEALDEVIDALITDYQAAQLAASE 356
>gi|83644569|ref|YP_433004.1| peptide chain release factor 1 [Hahella chejuensis KCTC 2396] >gi|119361548|sp|Q2SL95|RF1_HAHCH Peptide chain release factor 1 (RF-1) >gi|83632612|gb|ABC28579.1| peptide chain release factor 1 [Hahella chejuensis KCTC 2396] (360 aa)
Score = 751, Expect = 1.1e-77, Identities = 159/319 (49%), Positives = 231/319 (72%)
  Q:    33 KRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEV-ELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           ++  E++K   E  P+V+ ++EY+  LN I+ + KL+ ++ D ++ E+A+ EL+  +   E+ E +L++LLLP+DP D  NV +E+R   GGDE++IF GDLF  Y RYA+   WKV+++      HG Y  +   + G+NV++ +KFESG HRVQRVP TES+GR+HTS  TVA+LPE+EEV ++ IN +DL++DTYRASGAGGQH+NKT+SA+RITH+P+GI V CQ+ +SQ +NR  AM +L+AKL    +E+  K  +  RK  VG+G+R+E+IRTYNYPQ R+TDHRINLTL KL+ V+ G+L  +I  L+   +A
  S:    33 EKFKELSKEYAELEPVVQCYQEYQNALNAIEES-KLLLNDSDADMREMAKEELAAAEESSEQLEKDLQILLLPRDPRDGSNVFLEIRAGTGGDEAAIFAGDLFRMYSRYAELKKWKVEIVSESPGEHGGYKEVISRVAGDNVFNLLKFESGAHRVQRVPETESQGRIHTSACTVAILPEVEEVGDVDINPADLRVDTYRASGAGGQHVNKTDSAIRITHLPSGIVVECQDERSQHKNRAKAMSLLKAKLLSSAQEKQAKEQAQTRKSLVGSGDRSERIRTYNYPQGRITDHRINLTLYKLEEVVQGDLDPVIQPLLQEYQA 352
>gi|53717070|ref|YP_105275.1| peptide chain release factor 1 [Burkholderia mallei ATCC 23344] >gi|67639917|ref|ZP_00438745.1| COG0216: Protein chain release factor A [Burkholderia mallei GB8 horse 4] >gi|121597849|ref|YP_990282.1| peptide chain release factor 1 [Burkholderia mallei SAVP1] >gi|124382410|ref|YP_001024781.1| peptide chain release factor 1 [Burkholderia mallei NCTC 10229] >gi|126447218|ref|YP_001079120.1| peptide chain release factor 1 [Burkholderia mallei NCTC 10247] >gi|194316014|ref|YP_002011963.1| peptide chain release factor 1 [Burkholderia mallei ATCC 10399] >gi|194522274|ref|YP_002057808.1| peptide chain release factor 1 [Burkholderia mallei FMH] >gi|194527251|ref|YP_002062775.1| peptide chain release factor 1 [Burkholderia mallei JHU] >gi|194577689|ref|YP_002112567.1| peptide chain release factor 1 [Burkholderia mallei 2002721280] >gi|166223532|sp|A3MFT4|RF1_BURM7 Peptide chain release factor 1 (RF-1) >gi|166223533|sp|A2RYL2|RF1_BURM9 Peptide chain release factor 1 (RF-1) >gi|166223534|sp|A1UWC9|RF1_BURMS Peptide chain release factor 1 (RF-1) >gi|61214592|sp|Q62DF3|RF1_BURMA Peptide chain release factor 1 (RF-1) >gi|52423040|gb|AAU46610.1| peptide chain release factor 1 [Burkholderia mallei ATCC 23344] >gi|121225647|gb|ABM49178.1| peptide chain release factor 1 [Burkholderia mallei SAVP1] >gi|124290430|gb|ABM99699.1| peptide chain release factor 1 [Burkholderia mallei NCTC 10229] >gi|126240072|gb|ABO03184.1| peptide chain release factor 1 [Burkholderia mallei NCTC 10247] >gi|147746284|gb|EDK53362.1| peptide chain release factor 1 [Burkholderia mallei FMH] >gi|147751261|gb|EDK58329.1| peptide chain release factor 1 [Burkholderia mallei JHU] >gi|148024761|gb|EDK82944.1| peptide chain release factor 1 [Burkholderia mallei 2002721280] >gi|160696865|gb|EDP86835.1| peptide chain release factor 1 [Burkholderia mallei ATCC 10399] (360 aa)
Score = 751, Expect = 1.3e-77, Identities = 156/345 (45%), Positives = 238/345 (68%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGLS--VKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEV-ELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           + + L  +  +  +LN  L  E ++  + +  ++ +   E  P+VE + ++++   D  +A++L+    D  + + A+ EL   +  + +   EL+ +LLPKDPND++N+ VE+R   GGDES++F G+L   Y RYA+   W+V+M+    S   GY  +   I G   YS++KFESG HRVQRVPATE++GR+HTS  TVAV+PE +E+ E+ IN +DL+IDT+RASGAGGQHINKT+SAVR+THIPTGI V CQ+ +SQ +N++ A+K+L A++ +K+  E     +  RK  +G+G+R+E+IRTYN+PQ R+TDHRINLTL KL+ +M G+L E+I +L+S  +A
  S:     5 MQSKLDQLTTRLAELNDLLSRENVTADLDQYRKLTREHAEIGPVVEHYAQWRQARADELAAQELLA---DASMRDFAEDELRGARDRMGRLAAELQTMLLPKDPNDERNIFVEIRAGTGGDESALFAGNLLRMYLRYAERQRWQVEMMSESPSDLGGYKEVIVRIAGYGAYSRLKFESGGHRVQRVPATETQGRIHTSACTVAVMPEADEIGEVEINPADLRIDTFRASGAGGQHINKTDSAVRVTHIPTGIVVECQDDRSQHKNKDRALKVLAARIKDKQYHEQHAKEAATRKSLIGSGDRSERIRTYNFPQGRMTDHRINLTLYKLEQIMDGDLDELIAALVSEHQA 350
>gi|194099102|ref|YP_002002187.1| peptide chain release factor 1 [Neisseria gonorrhoeae NCCP11945] >gi|193934392|gb|ACF30216.1| peptide chain release factor 1 [Neisseria gonorrhoeae NCCP11945] (358 aa)
Score = 751, Expect = 1.3e-77, Identities = 160/315 (50%), Positives = 227/315 (72%)
  Q:    37 EINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVE-LVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           ++ +   E TP+VE F+ Y+   +D+  AE+++    D E+ + A  E+   K  I++ + EL+ LLLPKD +DDKN+ +E+R   GG E+++F GDL   Y RYA+   W+V+++   ES   GY  +   I G   YS++KFESG HRVQRVPATES+GR+HTS  TVAV+PE +E+E + +N +DL+ DT+RASGAGGQHINKT+SAVRITH+PTG+ V CQ+G+SQ  N+  AMK+L A+L + ++ E +   +  RK  +G+G+R+E+IRTYNYPQ RVTDHRINLTL+KLD VM G+L+EI D+LI+  +A
  S:    37 KLTREHAELTPVVEVFQNYRLAQSDLADAEEMLS---DPEMKDFAAEEIEAAKAKIDELDTELQKLLLPKDADDDKNIFIEIRAGTGGGEAALFAGDLLRMYSRYAERNRWQVEIVSANESELGGYKEVIARIVGLGAYSRLKFESGGHRVQRVPATESQGRIHTSACTVAVMPEADELEDIELNPADLRTDTFRASGAGGQHINKTDSAVRITHLPTGMVVECQDGRSQHANKAQAMKVLAARLNDAQKREVQAKEAAERKSLIGSGDRSERIRTYNYPQGRVTDHRINLTLHKLDFVMDGDLAEITDALIAEHQA 350
>gi|194398144|ref|YP_002037655.1| peptide chain release factor 1 [Streptococcus pneumoniae G54] >gi|194357811|gb|ACF56259.1| peptide chain release factor 1 [Streptococcus pneumoniae G54] (359 aa)
Score = 750, Expect = 1.3e-77, Identities = 169/350 (48%), Positives = 254/350 (72%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIK-SEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           +Y+ L ++E+++ +L + L    +    KR  E++K        V  ++EYK+ L +I  AE++IK S  D ++ E+A+ EL + K   E+YE +LK+LLLPKDPNDDKN+I+E+R AAGGDE+++F GDL + Y++YA++ GW+ +++E   +   G+  +  M++G++VYSK+K+ESG HRVQRVP TES+GRVHTST TV V+PE+EEVE  I+  DL++D Y ASGAGGQ++NK  +AVRI H+PT I V  QE ++Q +NRE AMK++RA++ +   +  +      RK  +GTG+R+E+IRTYN+PQNRVTDHRI LTL KLD ++ G L E++D+L+ +D+  K++E
  S:     3 IYDQLQAVEDRYEELGELLSDPDVVSDTKRFMELSKEEASNRDTVIAYREYKQVLQNIVDAEEMIKESGGDADLEEMAKQELKDAKAEKEEYEEKLKILLLPKDPNDDKNIILEIRGAAGGDEAALFAGDLLTMYQKYAEAQGWRFEVMEASMNGVGGFKEVVAMVSGQSVYSKLKYESGAHRVQRVPVTESQGRVHTSTATVLVMPEVEEVEXDIDPKDLRVDIYHASGAGGQNVNKVATAVRIVHLPTNIKVEMQEERTQQKNREKAMKIIRARVADHFAQIAQDEQDAERKSTIGTGDRSERIRTYNFPQNRVTDHRIGLTLQKLDTILSGKLDEVVDALVLYDQTQKLEE 356
>gi|149280703|ref|ZP_01886814.1| peptide chain release factor 1 [Pedobacter sp. BAL39] >gi|149228568|gb|EDM33976.1| peptide chain release factor 1 [Pedobacter sp. BAL39] (380 aa)
Score = 750, Expect = 1.4e-77, Identities = 152/328 (46%), Positives = 234/328 (71%)
  Q:    32 VKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQE-SSHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQEAKI 359
           +KR + +NK  K+   IV+++K YK  +++I++ ++++ +EKD E+ E+A+ EL       E+ E +++++L+P DP D KN + E+R   GGDE+++F GDL+  Y R+ +  GWKV+ ++V E ++ GY  +   ++GE+VY ++K+ESGVHRVQRVP TE++GRVHTS  +VAVLPE EE++L IN +D+ + T R+ GAGGQ++NK E+ V++TH P+GI V CQ+ +SQ+ NR  AM+MLR+KL++ + ++   +I+  RK  V TG+R+ KIRTYNYPQ RVTDHRI LTL  L  VM G + E+ID+L   + A KM+E  +
  S:    51 MKRFAALNKEYKDLGKIVDEYKIYKNVMSNIEANKEILSNEKDAELREMAKEELDLLLKQQEEMEEKVRLMLIPVDPEDAKNAVFEIRGGTGGDEAALFAGDLYRMYSRFFEQKGWKVETVDVTEGTAGGYKEVILKVSGEDVYGQLKYESGVHRVQRVPDTETQGRVHTSAASVAVLPEAEEIDLYINPADIDLQTSRSGGAGGQNVNKVETKVQLTHRPSGIVVVCQQERSQLGNRVIAMEMLRSKLYDIELQKKNGDIAARRKTMVSTGDRSAKIRTYNYPQGRVTDHRIGLTLYNLSGVMDGGVQELIDALQFAENAEKMKEGSV 379
>gi|139439315|ref|ZP_01772757.1| Hypothetical protein COLAER_01773 [Collinsella aerofaciens ATCC 25986] >gi|133775339|gb|EBA39159.1| Hypothetical protein COLAER_01773 [Collinsella aerofaciens ATCC 25986] (355 aa)
Score = 750, Expect = 1.4e-77, Identities = 163/351 (46%), Positives = 244/351 (69%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGLS--VKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQES-SHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGN-LSEIIDSLISHDEAVKMQEA 357
           + + L  + + + +L K+L    ++  +K  + +NK     + ++   +EY   L+DI++A+++++   D +  E+ Q+++SE +  + + E ++K +L+P DPNDDKN IVE+R AAGGDE++IF GDL+  Y+R+ +S GWK  +L+   S + G+  I F + G+ VYS MKFESGVHRVQRVP TES+GR+ TST TVAVLPE EE+++ IN SDL+IDTY ASG GGQ +N T SAVRITH+PT   V  QE +SQI+NRE  M+MLRA+L+E + E+ +  +   R+ Q+G G R+EKIRTYN PQ+RVTDHRI    +  + V+LG+ L  +I++L + + A K+ +A
  S:     1 MRDKLEKIIKAYEELEKKLSDPAVASDIKEFTRLNKEYAHQSDLIAASREYIGALDDIEAAKEMLRDTTDADEKEMLQMDISENEEKLPQLEEDIKYMLIPSDPNDDKNTIVEIRSAAGGDEAAIFAGDLYKMYQRFCESRGWKTTVLDSSPSEAGGFKSIEFKVEGDRVYSVMKFESGVHRVQRVPKTESQGRIQTSTATVAVLPEAEEIDVQINQSDLRIDTYCASGPGGQCVNTTYSAVRITHLPTNTVVQSQEQRSQIQNREVCMQMLRARLYEMELEKQQAELGAERQSQIGHGNRSEKIRTYNQPQDRVTDHRIGFN-STYNGVLLGDQLGTVIEALAAAERAEKLAQA 354
>gi|148266072|ref|YP_001232778.1| peptide chain release factor 1 [Geobacter uraniireducens Rf4] >gi|189039974|sp|A5G8T7|RF1_GEOUR Peptide chain release factor 1 (RF-1) >gi|146399572|gb|ABQ28205.1| bacterial peptide chain release factor 1 (bRF-1) [Geobacter uraniireducens Rf4] (355 aa)
Score = 750, Expect = 1.4e-77, Identities = 163/349 (46%), Positives = 243/349 (69%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGF--ISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSL--ISHDEAVKMQ 355
           ++  +  +E ++ +L   L    +  +     ++++   + + +VE ++ YK+ L +I    +L+    D E+ E+A+ EL   +      E E+K+LLLPKDPND+K+VI+E+R   GGDE+++F GDLF  Y RYA+S  W+V+++   ES  G GF  I   + G+ V++K+K+ESG HRVQRVP TE++GR+HTS  TVA++PE E+V++ IN +DLKID YR+SGAGGQH+N T+SAVRITH+PTG  VACQE +SQI+NR  AMK+L+ ++ +   +E    ++  RK QVG+G+R+E+IRTYN+PQ R+TDHRI LTL +LD +M G++ EI DSL      EA+K Q
  S:     1 MFEKIEELERRYQELEALLADPAVLGNQPEFRKLSREHSDLSALVESYRNYKKVLVEITGNRELLA---DPEMKEMAEAELEALEEQQAALEAEIKLLLLPKDPNDNKSVILEIRAGTGGDEAALFAGDLFRMYGRYAESNRWRVEVISASESEKG-GFKEIVASVEGDGVFAKLKYESGTHRVQRVPETEAQGRIHTSACTVAIMPEAEDVDIDINPADLKIDVYRSSGAGGQHVNTTDSAVRITHLPTGTVVACQEERSQIKNRAKAMKVLKTRILDTIMQEQSARLAADRKQQVGSGDRSERIRTYNFPQGRMTDHRIGLTLYRLDAIMAGDIGEITDSLRVYYQMEALKQQ 351
>gi|73542728|ref|YP_297248.1| peptide chain release factor 1 [Ralstonia eutropha JMP134] >gi|119361585|sp|Q46WS9|RF1_RALEJ Peptide chain release factor 1 (RF-1) >gi|72120141|gb|AAZ62404.1| bacterial peptide chain release factor 1 (bRF-1) [Ralstonia eutropha JMP134] (360 aa)
Score = 750, Expect = 1.6e-77, Identities = 152/344 (44%), Positives = 242/344 (70%)
  Q:    11 LLSMEEKFNDLNKELETEGLS--VKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEV-ELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           L  + E+  ++N  L  E  +  + +  ++++   E +P+ E++  Y++  +D+ +A+ L+    D E+ + A  E++  +  +E  E  L+ LLLPKDPNDD+N+I+E+R   GG+ES++F GDL   Y R+A+   W+V+++   ES   GY  +   I G+  +S++KFESG HRVQRVPATE++GR+HTS  TVAV+PE +EV ++ IN SDL+IDT+RASGAGGQH+NKT+SAVR+TH+PTGI V CQ+ +SQ  N++ AMK+L A++ +++    +   +  R+  +G+G+R+++IRTYN+PQ RVTDHRINLTL K+D +M G+L E++ +L +  +A ++
  S:     9 LDQLAERLEEVNALLAREDATANIDQYRKLSREHAELSPVAEQYGFYRQAQDDLATAQALLD---DPEMKDFAADEIASARERLESLEGSLQKLLLPKDPNDDRNLILEIRAGTGGEESALFAGDLLRMYTRFAERQRWQVEIMSESESDLGGYKEVIVRIAGDAAFSRLKFESGGHRVQRVPATEAQGRIHTSACTVAVMPEADEVGDVEINPSDLRIDTFRASGAGGQHVNKTDSAVRLTHLPTGIVVECQDDRSQHRNKDKAMKVLAARIKDQQMRAAQAKEASTRRNLIGSGDRSDRIRTYNFPQGRVTDHRINLTLYKIDMIMDGDLEELVSALAAEHQADQL 353
>gi|93355984|gb|ABF10073.1| bacterial peptide chain release factor 1 (bRF-1) [Ralstonia metallidurans CH34] (371 aa)
Score = 750, Expect = 1.6e-77, Identities = 153/344 (44%), Positives = 241/344 (70%)
  Q:    11 LLSMEEKFNDLNKELETEGLS--VKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEV-ELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           L  + E+ +++N  L  E  +  + +  ++++   E +P+ E++ +Y++  +D+ +A+ L+    D E+ E A  E+   +  ++  E  L+ LLLPKDPNDD+N+++E+R   GG+ES++F  DL   Y RYA+   W+V+++    S   GY  +   I G+  +S++KFESG HRVQRVPATES+GR+HTS  TVAV+PE +EV E+ IN SDL++DT+RASGAGGQH+NKT+SAVR+TH+PTGI V CQ+ +SQ  N+E AMK+L A++ + +    +   ++ R+  +G+G+R+++IRTYN+PQ RVTDHRINLTL K+D +M G+L E+I +L +  +A ++
  S:    20 LDQLAERLDEVNALLAREDATANMDQYRKLSREHAELSPVAEQYGQYRQAQDDLATAQALLD---DPEMKEFAADEIDAARERLQSLENSLQTLLLPKDPNDDRNLLLEIRAGTGGEESALFAADLLRMYTRYAERRRWQVEIMSESPSDLGGYKEVIVRIAGDAAFSRLKFESGGHRVQRVPATESQGRIHTSACTVAVMPEADEVGEVEINPSDLRVDTFRASGAGGQHVNKTDSAVRLTHLPTGIVVECQDDRSQHRNKEKAMKVLAARIKDMQLRAAQAKEANTRRNLIGSGDRSDRIRTYNFPQGRVTDHRINLTLYKIDMIMDGDLDELISALSAEHQADQL 364
>gi|118588514|ref|ZP_01545923.1| peptide chain release factor 1 [Stappia aggregata IAM 12614] >gi|118439220|gb|EAV45852.1| peptide chain release factor 1 [Stappia aggregata IAM 12614] (357 aa)
Score = 749, Expect = 1.7e-77, Identities = 154/305 (50%), Positives = 222/305 (72%)
  Q:    47 PIVEKFKEYKRTLNDIDSAEKLIKS-EKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGN-LSEIIDSLISHDEA 351
           P+V K +   +   D+  A+ L++    D E+ ELA++E  E +  +E+   ++++ LLPKD  D  + I+E+R   GGDE+++F GDLF  Y+RYA+  GWKV++L   E    GY  +   ++GENV++K+KFESGVHRVQRVPATES GR+HTS  TVAVLP+ E+V++ +  SDL+IDTYRASGAGGQH+N T+SAVRITH+PTGI VA Q+ +SQ +N+  AM++LRA++++++ E      ++ R+ QVG+G+R+E+IRTYNYPQ RVTDHRI LTL KL+ ++ G  L E+I+ LI   +A
  S:    42 PLVGKIRALIKAEQDLAGAKALLQDPSSDAEMRELAEMERDELEERVEELAQDVRIGLLPKDEADSNDAILEVRAGTGGDEAALFAGDLFRMYQRYAELQGWKVEILSASEGEVGGYKEVIASVSGENVFAKLKFESGVHRVQRVPATESGGRIHTSAATVAVLPQAEDVDIDVQESDLRIDTYRASGAGGQHVNTTDSAVRITHLPTGIVVAVQDERSQHKNKARAMQLLRARIYDEERERAASERTEARRLQVGSGDRSERIRTYNYPQGRVTDHRIGLTLYKLEQILSGEALGEVIEPLILDHQA 349
>gi|67459154|ref|YP_246778.1| peptide chain release factor 1 [Rickettsia felis URRWXCal2] >gi|75536414|sp|Q4ULG0|RF1_RICFE Peptide chain release factor 1 (RF-1) >gi|67004687|gb|AAY61613.1| Peptide chain release factor RF-1 [Rickettsia felis URRWXCal2] (355 aa)
Score = 749, Expect = 1.7e-77, Identities = 165/348 (47%), Positives = 248/348 (71%)
  Q:     9 NSLLSMEEKFNDLNKELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKL-IKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVML-GNLSEIIDSLISHDEAVKMQE 356
           ++L  + +K+ +L K+L + G+      + +K   E   +V K KEY +  ++++ A    ++   DN  +E+ + E+   +  + K E  +K+ LLPKD  D K+ I+E+R  +GG+E+++F   LF+ Y+RYA+  GW+ ++L + ++   GY   S  I G++V+SK+KFESGVHRVQRVP TES+GR+HTS  TVAVLPE EEV++ I + DL+IDTYRASGAGGQH+N T+SAVRITHIPTGI VA Q+ KSQ +N+  A+K+LRA+++E++  +  +  +D R+GQVG+G+R+E+IRTYN+PQ RV+DHRINLTL K+D V+  G L E +++LI+ DEA K+ E
  S:     5 DNLAKILDKYENLGKKLSS-GIMGDEFVKASKEYAELEDVVAKIKEYNKAKSELEEANNFKLEVGLDNATLEMIEDEIHTLENSLPKLERAVKIALLPKDDADSKSAIIEVRAGSGGEEAALFAAVLFNMYQRYAELKGWRFEILAISDTGIGGYKEASASIKGKDVFSKLKFESGVHRVQRVPETESQGRIHTSAATVAVLPEAEEVDIKIEDKDLRIDTYRASGAGGQHVNTTDSAVRITHIPTGITVALQDEKSQHKNKAKALKILRARIYEEERRKKEQERADSRRGQVGSGDRSERIRTYNFPQGRVSDHRINLTLYKIDEVVKNGQLDEFVEALIADDEAKKLSE 354
>gi|194290876|ref|YP_002006783.1| peptide chain release factor RF-1 [Cupriavidus taiwanensis] >gi|193224711|emb|CAQ70722.1| peptide chain release factor RF-1 [Cupriavidus taiwanensis] (360 aa)
Score = 749, Expect = 1.7e-77, Identities = 149/344 (43%), Positives = 242/344 (70%)
  Q:    11 LLSMEEKFNDLNKELETEGLS--VKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEV-ELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           L  + E+ +++N  L  E  +  + +  ++++   E +P+ E++ +Y++  +D+ +A+ L+    D E+ + A  E++  +  +E  +  L+ LLLPKDPNDD+N+++E+R   GG+ES++F  DL   Y RYA+   W+V+++   ES   GY  +   I G+  +S++KFESG HRVQRVPATE++GR+HTS  TVAV+PE +EV E+ IN +DL+IDT+RASGAGGQH+NKT+SAVR+TH+PTGI V CQ+ +SQ  N++ AMK+L A++ + +    +   +  R+  +G+G+R+++IRTYN+PQ RVTDHRINLTL K+D +M G++ E++ +L +  +A ++
  S:     9 LDQLAERLDEVNALLAREDATANIDQYRKLSREHAELSPVAEQYSQYRQAQDDLATAQALLD---DPEMKDFAADEIAAARDRLEALQASLQRLLLPKDPNDDRNLLLEIRAGTGGEESALFAADLLRMYTRYAERQRWQVEVMSESESDLGGYKEVIIRIAGDAAFSRLKFESGGHRVQRVPATEAQGRIHTSACTVAVMPEADEVGEVEINPADLRIDTFRASGAGGQHVNKTDSAVRLTHLPTGIVVECQDDRSQHRNKDKAMKVLAARIKDMQTRAAQAREASTRRNLIGSGDRSDRIRTYNFPQGRVTDHRINLTLYKIDMIMDGDMDELLSALSAEHQADQL 353
>gi|42527989|ref|NP_973087.1| peptide chain release factor 1 [Treponema denticola ATCC 35405] >gi|81570139|sp|Q73JU6|RF1_TREDE Peptide chain release factor 1 (RF-1) >gi|41819034|gb|AAS13006.1| peptide chain release factor 1 [Treponema denticola ATCC 35405] (361 aa)
Score = 749, Expect = 1.8e-77, Identities = 163/335 (48%), Positives = 241/335 (71%)
  Q:    11 LLSMEEKFNDLNKELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLN---DIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSL 345
           L ++ ++  ++ KE+E   L +K +++  ++++E + + +  +EY   L+    I+ ++ LI+ E D E+ E+A+ EL   +   EK E +LK+LL+P DP ++KN+I+E+R   GGDE+++F  DLF  Y  YA+   WK ++L + E+   GY  I+F I+G+ VY  +++ESGVHRVQRVP TE  GR+HTS +TVAVLPE EE E+ IN  DL+ID  RA G GGQ +N T+SAVRITHIPTG+ V CQ+ KSQI+N+  AM++LR++L++ +E + +   +  RK QVG+G+R+E+IRTYN+PQNRVTDHRINLTL KLD VM G+L E+ID+L
  S:     5 LDNLRKRLVEVEKEVENPNL-IKDVAKYKETMREHSYLSKLMEEYDNYLSIEKQIEDSKLLIQEESDAELKEMAREELHSLEAAFEKSEADLKMLLIPPDPLEEKNIIMEIRGGTGGDEAALFAADLFRMYTHYAEMKNWKYEVLSLNETELGGYKEITFSISGKYVYGSLRYESGVHRVQRVPETEGSGRIHTSAVTVAVLPEAEETEIEINQEDLRIDVMRAGGPGGQCVNTTDSAVRITHIPTGLVVICQDEKSQIKNKAKAMRVLRSRLYDLEESKKQAERAQNRKSQVGSGDRSERIRTYNFPQNRVTDHRINLTLYKLDAVMQGSLDELIDAL 342
>gi|83747499|ref|ZP_00944537.1| Bacterial Peptide Chain Release Factor 1 (RF-1) [Ralstonia solanacearum UW551] >gi|83725813|gb|EAP72953.1| Bacterial Peptide Chain Release Factor 1 (RF-1) [Ralstonia solanacearum UW551] (374 aa)
Score = 749, Expect = 1.9e-77, Identities = 154/348 (44%), Positives = 240/348 (68%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGLS--VKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEV-ELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           + + L  + E+  ++N  L  E  +  + +  ++ +   E  P+V ++  +K+  ND+ +A++L+    D ++   A+ EL   +  +   E EL+ LLLPKDPND +N+ +E+R   GGDES++F GDL   Y RYA+   W+V+++    S   GY  +   + GE  YS++KFESG HRVQRVPATE++GR+HTS  TVAV+PE + + ++ IN +DL+IDT+RASGAGGQHINKT+SAVRITH+PTG+ V CQ+ +SQ  N++ AM++L A+L +++E E +   +  RK  +G+G+R+++IRTYN+PQ RVTDHRINLTL K+D +M G+L E++ +L +  +A ++
  S:    19 MLSKLDQLAERTIEINALLAREDATANLDQYRKLTREHAELEPVVTQYAVWKQAENDVATAQELLA---DPDMKAFAEDELRVARDRMTALEAELQRLLLPKDPNDHRNIFLEIRAGTGGDESALFAGDLLRMYTRYAERQRWQVEIVSESASDLGGYKEVIARLVGEGAYSRLKFESGGHRVQRVPATEAQGRIHTSACTVAVMPEADALADIQINPADLRIDTFRASGAGGQHINKTDSAVRITHLPTGLVVECQDDRSQHRNKDRAMQVLAARLKDRQEREAQAKEASARKSLIGSGDRSDRIRTYNFPQGRVTDHRINLTLYKIDALMDGDLDELLGTLAAEHQAEQL 367
>gi|85705322|ref|ZP_01036421.1| peptide chain release factor 1 [Roseovarius sp. 217] >gi|85670195|gb|EAQ25057.1| peptide chain release factor 1 [Roseovarius sp. 217] (426 aa)
Score = 749, Expect = 1.9e-77, Identities = 157/348 (45%), Positives = 232/348 (66%)
  Q:     9 NSLLSMEEKFNDLNKELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           + L  + E+F  +  ++   G  + R+    +   E  P+VE+ + Y++ L DI+ A  ++    D E+ +LA+ EL   +  +   E  L++ LLP+D  + +  I+E+RP  GG+E+++F  DL   Y+RYA++ GW   ++E Q+S   G   +   I GE V++++KFESGVHRVQRVP TES GR+HTS  TVAVLPE E+V++ IN +DL+IDT R+SGAGGQH+N T+SAVRITHIP+GI V   E KSQ  NRE AM++L+++L++ +        S  R  QVG+G+R+E+IRTYN+PQ R+TDHRINLTL KL+ VM G+L E+ID+L +  +A  + E
  S:    83 DRLQQIAERFEFIEAQMMQGGGDIARLG---REYSELRPLVEEIRAYRQILADIEGARAMLG---DPEMRDLARDELEVLEARLPGMEAALQLALLPRDEANARPAILEIRPGTGGEEAALFAADLMRMYQRYAEARGWVFDVIEEQQSELGGIRELVVHIKGEGVFARLKFESGVHRVQRVPETESGGRIHTSAATVAVLPEAEDVDVQINPNDLRIDTMRSSGAGGQHVNTTDSAVRITHIPSGIVVTSSE-KSQHRNREIAMQVLKSRLFDMERSRVDSERSANRAAQVGSGDRSERIRTYNFPQGRMTDHRINLTLYKLEQVMGGDLDEVIDALTADAQATLLAE 424
>gi|84704037|ref|ZP_01017865.1| peptide chain release factor 1 [Parvularcula bermudensis HTCC2503] >gi|84690471|gb|EAQ16312.1| peptide chain release factor 1 [Parvularcula bermudensis HTCC2503] (360 aa)
Score = 749, Expect = 2.0e-77, Identities = 165/346 (47%), Positives = 241/346 (69%)
  Q:     9 NSLLSMEEKFNDLNKELE--TEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGN-LSEIIDSLISHDEAVKM 354
           + L +++ +F ++  ++   TE   + R+S+ +  +K          + ++ L D   AE L KS  D E+ E+A+ E++     IE+ E +L+++LLPKD  D   VI+E+R   GGDE+++F GDLF  Y+RYA + GW+V++L   ES   GY  I   ++G+NV+ ++KFESGVHRVQRVP TE++GR+HTS  TVAVLPE E++++ I  SDL+ID +RASG GGQ +N T+SAVRITHIPTG+ V+ Q+ KSQ +NR  AMK+LRA+L+E +        +  RKGQVG+G+R+E+IRTYN+PQ RVTDHRINLTL KLD V+ G  + ++ID+LI  D+A ++
  S:     5 DKLNALKTRFAEVEAKMAKATEADEIVRLSKEHAELKPVAEAALLLTDARQGLLD---AEGLTKS-TDPEMAEMAKEEIASLTGQIERLEADLQLMLLPKDKADQAPVILEVRAGTGGDEAALFAGDLFRMYQRYAATRGWRVEILSATESGVGGYKEIQANVSGDNVFGRLKFESGVHRVQRVPETETQGRIHTSAATVAVLPEPEDIDIDIQESDLRIDVFRASGPGGQSVNTTDSAVRITHIPTGVVVSQQDEKSQHKNRAKAMKVLRARLYEAERSRVAAERAAERKGQVGSGDRSERIRTYNFPQGRVTDHRINLTLYKLDKVIAGEAVDDLIDALIVEDQAERL 350
>gi|75674575|ref|YP_316996.1| peptide chain release factor 1 [Nitrobacter winogradskyi Nb-255] >gi|119361570|sp|Q3SVP7|RF1_NITWN Peptide chain release factor 1 (RF-1) >gi|74419445|gb|ABA03644.1| bacterial peptide chain release factor 1 (bRF-1) [Nitrobacter winogradskyi Nb-255] (358 aa)
Score = 748, Expect = 2.3e-77, Identities = 158/330 (47%), Positives = 228/330 (69%)
  Q:    25 LETEGLS---VKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKS-EKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGN-LSEIIDSLISHDEAVKM 354
           LE+E LS     R  ++ + + E  PIV+  K ++    +I   + +I     D E+  +A+ E    +   ++   +++V LLPKD  D++NV++E+R   GGDE+S+F GDLF  Y+R+A   GWKV+++   E + G Y  I   + G   Y++MKFESGVHRVQRVP TE++GRVHTS  TVAVLPE EEV++ I   DL+I+T RA GAGGQH+NKTESA+RITHIPTGI V+ Q+ +SQ +NR +AM +LR+++++ + +      S  RK QVG+G+R+E+IRTYN+PQ RVTDHRINLTL KL  V+ G+ L E+ID+L +  +A ++
  S:    17 LESELLSHVSADRYVQMTRELAELNPIVDAVKNWRAVTAEIAGIDAMIADPATDAEMRAMAEAERPALEARNDELMQKIRVALLPKDAMDERNVMLEVRAGTGGDEASLFAGDLFRMYERFAALQGWKVEVISASEGTMGGYKEIVAQVQGRGAYARMKFESGVHRVQRVPDTEAQGRVHTSAATVAVLPEAEEVDVDIRPDDLRIETMRAQGAGGQHVNKTESAIRITHIPTGIVVSMQDSRSQHKNRASAMNILRSRIYDAERQRINAARSADRKDQVGSGDRSERIRTYNFPQGRVTDHRINLTLYKLPQVIAGDALHELIDALTTEHQAAQL 352
>gi|116254019|ref|YP_769857.1| peptide chain release factor 1 [Rhizobium leguminosarum bv. viciae 3841] >gi|119361588|sp|Q1MBB2|RF1_RHIL3 Peptide chain release factor 1 (RF-1) >gi|115258667|emb|CAK09771.1| putative peptide chain release factor 1 [Rhizobium leguminosarum bv. viciae 3841] (359 aa)
Score = 748, Expect = 2.4e-77, Identities = 160/343 (46%), Positives = 237/343 (69%)
  Q:    14 MEEKFNDLNKELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEK-DNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQE-SSHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           +E +F ++   + + G +     ++     E  P+V K + Y++ + ++   E L++    D E+ +LA+LEL E K  IE  E E+++LLLPKD  D+K+ I+E+R   GG E+++F GDLF  Y+R+A   GWKV++L   E  + GY  I   I G+ V++K+KFESGVHRVQRVP TE+ GR+HTS  TVAVLPE EE+++ I   D++IDT R+SGAGGQH+N T+SAVRITH+P+GI V   E KSQ +NR  AM++LR++L++ + +      S  RK QVG+G+R+E+IRTYN+PQ RVTDHRINLTL KLD +M G + E++D+L++  +A ++ +
  S:    12 LERRFGEIEARM-SAGPAADVYVKLASEYSELQPVVTKIRVYEKAVTELADLETLLEDRSVDREMRDLAELELPEVKEQIEALEQEMQILLLPKDAADEKSAILEIRAGTGGSEAALFAGDLFRMYERFAAEKGWKVEVLSASEGEAGGYKEIIATITGKGVFAKLKFESGVHRVQRVPETEAGGRIHTSAATVAVLPEAEEIDIEIRAEDIRIDTMRSSGAGGQHVNTTDSAVRITHLPSGIVVTSSE-KSQHQNRAKAMQVLRSRLYDAERQRADSERSADRKSQVGSGDRSERIRTYNFPQGRVTDHRINLTLYKLDRMMEGEIEEVVDALMADYQASQLAQ 354
>gi|54309994|ref|YP_131014.1| peptide chain release factor 1 [Photobacterium profundum SS9] >gi|61214628|sp|Q6LNB4|RF1_PHOPR Peptide chain release factor 1 (RF-1) >gi|46914433|emb|CAG21212.1| putative peptide chain release factor A [Photobacterium profundum SS9] (362 aa)
Score = 748, Expect = 2.5e-77, Identities = 158/341 (46%), Positives = 234/341 (68%)
  Q:    11 LLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           L ++ E++ ++   L   G+     +   ++K   +   I + F+ Y    +D+++AE++ K + D E+ E+AQ E+ E K  I + E EL+VLL+PKDPNDD+N  VE+R  AGGDE+ IF GDLF  Y RYA+  GW+++++    S  G Y  +   ++G+  Y  +KFESG HRVQRVPATES+GRVHTS  TVAV+PE+ E E+  IN  DLKIDT+R+SGAGGQH+N T+SA+RITH+PTGI V CQ+ +SQ +N+  AM +L A++ + +EE+     +  R+  +G+G+R+++IRTYNYPQ RV+DHRI LTL +L+ VM G++  +I  +I   +A
  S:     9 LETLVERYEEIQHLLGDPGIIGDQNKFRALSKEYSQLEDITQCFQAYLGAKDDLEAAEEMAKDD-DPEMREMAQEEVKESKANILRLEDELQVLLIPKDPNDDRNCFVEIRAGAGGDEAGIFAGDLFRMYSRYAERRGWRIEVINENRSEQGGYKEMIAKVSGDGAYGVLKFESGGHRVQRVPATESQGRVHTSACTVAVMPEVPEAEIPEINTGDLKIDTFRSSGAGGQHVNTTDSAIRITHLPTGIVVECQDERSQHKNKAKAMSVLAARITKAEEEKRHAEEASTRRNLLGSGDRSDRIRTYNYPQGRVSDHRITLTLYRLNEVMEGDMDSLIQPVIQEHQA 352
>gi|85711946|ref|ZP_01043000.1| Protein chain release factor A [Idiomarina baltica OS145] >gi|85694132|gb|EAQ32076.1| Protein chain release factor A [Idiomarina baltica OS145] (362 aa)
Score = 748, Expect = 2.6e-77, Identities = 154/321 (47%), Positives = 228/321 (71%)
  Q:    34 RMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           +   ++K   +   +V  F  Y++  +D+ +A ++   + D E+ E+A  E+++ K  +E  E  L+VLLLPKDPNDD+   +E+R  AGGDE++IF GDLF  Y RYA+  GW+V  +   E  HG Y  +   ++G+ VY +MKFESG HRVQRVP TES+GR+HTS  TVAVLPE+ E E + IN +DL++DT+RASGAGGQH+N+T+SA+RITH+P+G+ V CQE +SQ +NR  AM +L+++L   ++E+  +  +  R+  VG+G+R+E+IRTYNYPQ+RVTDHRINLTL +LD V+ G L  ++D +I+  +A ++
  S:    34 KFRSLSKEYAQLEEVVSAFNSYRQAQSDLTAAHEM-ADDDDPEMREMANEEIADAKQRVESLENSLQVLLLPKDPNDDRACYLEIRAGAGGDEAAIFAGDLFRMYSRYAEQHGWRVSTVSANEGEHGGYKEVIAQLSGDGVYGRMKFESGGHRVQRVPETESQGRIHTSACTVAVLPEIPEAEAIEINPADLRVDTFRASGAGGQHVNRTDSAIRITHLPSGVVVECQEERSQHKNRAKAMSVLQSRLQRMEDEKRAQEEASTRRSLVGSGDRSERIRTYNYPQSRVTDHRINLTLYRLDEVLEGGLDLLLDPIITEHQADQL 355
>gi|126642199|ref|YP_001085183.1| peptide chain release factor 1 [Acinetobacter baumannii ATCC 17978] (296 aa)
Score = 748, Expect = 2.6e-77, Identities = 149/274 (54%), Positives = 205/274 (74%)
  Q:    72 EKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGFISFM--INGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELE-EVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSL 345
           + D +  ++A+ E+   K L+E+ E +L +L++PKDPND     +E+R   GGDE++IF GDLF  Y +YA+S GW++++L   E  HG GF   +  ++G+ VY ++KFESG HRVQRVPATES+GRVHTS  TVA+LPE++ +  + IN +DL+IDTYRASGAGGQHINKT+SAVRITHIPTG  V CQE +SQ +N+  AM +L ++L   K        S++R+  VG+G+R+E+IRTYNYPQ R+TDHRINLTL KLD +M G+L+E++DSL
  S:     3 KSDPDFKDMAEEEIQANKALLEELESQLNILMIPKDPNDSNAAYLEIRAGTGGDEAAIFSGDLFRMYSKYAESQGWRIEVLSENEGEHG-GFKEVICRVDGDGVYGRLKFESGAHRVQRVPATESQGRVHTSACTVAILPEIDVDTNVEINPADLRIDTYRASGAGGQHINKTDSAVRITHIPTGTVVECQEERSQHKNKAKAMALLVSRLENAKRAAADAATSEMRRDLVGSGDRSERIRTYNYPQGRMTDHRINLTLYKLDAIMEGDLTELLDSL 278
>gi|161621297|ref|YP_585342.2| peptide chain release factor 1 [Ralstonia metallidurans CH34] >gi|119361586|sp|Q1LIF3|RF1_RALME Peptide chain release factor 1 (RF-1) (360 aa)
Score = 748, Expect = 2.7e-77, Identities = 153/344 (44%), Positives = 241/344 (70%)
  Q:    11 LLSMEEKFNDLNKELETEGLS--VKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEV-ELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           L  + E+ +++N  L  E  +  + +  ++++   E +P+ E++ +Y++  +D+ +A+ L+    D E+ E A  E+   +  ++  E  L+ LLLPKDPNDD+N+++E+R   GG+ES++F  DL   Y RYA+   W+V+++    S   GY  +   I G+  +S++KFESG HRVQRVPATES+GR+HTS  TVAV+PE +EV E+ IN SDL++DT+RASGAGGQH+NKT+SAVR+TH+PTGI V CQ+ +SQ  N+E AMK+L A++ + +    +   ++ R+  +G+G+R+++IRTYN+PQ RVTDHRINLTL K+D +M G+L E+I +L +  +A ++
  S:     9 LDQLAERLDEVNALLAREDATANMDQYRKLSREHAELSPVAEQYGQYRQAQDDLATAQALLD---DPEMKEFAADEIDAARERLQSLENSLQTLLLPKDPNDDRNLLLEIRAGTGGEESALFAADLLRMYTRYAERRRWQVEIMSESPSDLGGYKEVIVRIAGDAAFSRLKFESGGHRVQRVPATESQGRIHTSACTVAVMPEADEVGEVEINPSDLRVDTFRASGAGGQHVNKTDSAVRLTHLPTGIVVECQDDRSQHRNKEKAMKVLAARIKDMQLRAAQAKEANTRRNLIGSGDRSDRIRTYNFPQGRVTDHRINLTLYKIDMIMDGDLDELISALSAEHQADQL 353
>gi|32267276|ref|NP_861308.1| peptide chain release factor 1 [Helicobacter hepaticus ATCC 51449] >gi|46576742|sp|Q7VFA0|RF1_HELHP Peptide chain release factor 1 (RF-1) >gi|32263329|gb|AAP78374.1| peptide chain release factor 1 [Helicobacter hepaticus ATCC 51449] (355 aa)
Score = 747, Expect = 2.9e-77, Identities = 161/324 (49%), Positives = 231/324 (71%)
  Q:    31 SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGN-LSEIIDSLISHDEAVKM 354
           ++K+++E++K   +   I +  K Y   L +I   + L++   D E+ ELA+ EL + +      E E+K+LL+PKDPND+KN+ +E+R   GGDE+ IFVGDLF AY RYAD   WKV+++   E++  GY  +  ++ G   YSK+KFE G HRVQRVP TES+GR+HTS ITVA++PE+++VE+ IN +DLKID +R+ G GGQ +N T+SAVRITHIPTGI V+ Q+ KSQ +N++ A+K+L+A+L+E + E       + RK QVG+G+R+E+IRTYNYPQNR+TDHRI LTL  L+ +MLG  L E I+ LI+H ++  M
  S:    28 NIKQLTELSKEQSDIESIAQNAKTYFSILENIVQNKALLE---DKELGELAKEELKDLESAKATLEEEIKLLLIPKDPNDNKNIYLEIRAGTGGDEAGIFVGDLFKAYCRYADLQKWKVEIISSNENNVGGYKEVIALVKGNGAYSKLKFEGGTHRVQRVPETESQGRIHTSAITVAIMPEVDDVEININPNDLKIDVFRSGGHGGQSVNTTDSAVRITHIPTGISVSMQDEKSQHKNKDKALKILKARLYEAELEAQNAQNKEARKTQVGSGDRSERIRTYNYPQNRLTDHRIGLTLYSLEEIMLGGLLDEFINPLIAHAQSQAM 350
>gi|113461093|ref|YP_719161.1| peptide chain release factor 1 [Haemophilus somnus 129PT] >gi|119361547|sp|Q0I3B5|RF1_HAES1 Peptide chain release factor 1 (RF-1) >gi|112823136|gb|ABI25225.1| bacterial peptide chain release factor 1 (bRF-1) [Haemophilus somnus 129PT] (360 aa)
Score = 747, Expect = 3.2e-77, Identities = 159/316 (50%), Positives = 224/316 (70%)
  Q:    39 NKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           +K   +   +V+ F  +    N+I+  + L+    D ++ E+A+LE+ E K  IE  E +L++LLLPKDPND+ N  +E+R   GGDE+ IF GDLF  Y RYA+S  W+V++L   ES  G Y  I   +NGE VY ++KFESG HRVQRVP TES+GR+HTS  TVAV+PEL E E+  IN SDL+IDTYR+SGAGGQH+N T+SAVRITHIPTGI V CQ+ +SQ +N+  A+ +L +++ + ++E   +  +D R+  +G+G+R++KIRTYNYPQ RVTDHRINLT+ +LD VM G + E+I  +I+  +A ++
  S:    39 SKEYAQLEDVVKCFARWNWLNNNIEETQLLLD---DPDMKEMAELEIEESKAEIENAEQQLQILLLPKDPNDEYNAYLEIRAGTGGDEAGIFAGDLFRMYSRYAESKRWRVEVLNANESEQGGYKEIIVKVNGEGVYGQLKFESGGHRVQRVPKTESQGRIHTSACTVAVMPELPENEMPEINPSDLRIDTYRSSGAGGQHVNTTDSAVRITHIPTGIVVECQDERSQHKNKAKALSVLASRIAQAEQERQAQAQADTRRNLLGSGDRSDKIRTYNYPQGRVTDHRINLTVYRLDEVMNGKIDELIQPIITEYQADQL 353
>gi|167362025|ref|ZP_02296579.1| peptide chain release factor 1 [Rhizobium leguminosarum bv. trifolii WSM1325] >gi|167071134|gb|EDR75056.1| peptide chain release factor 1 [Rhizobium leguminosarum bv. trifolii WSM1325] (359 aa)
Score = 747, Expect = 3.4e-77, Identities = 161/343 (46%), Positives = 236/343 (68%)
  Q:    14 MEEKFNDLNKELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEK-DNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQE-SSHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           +E +F ++   + + G +     ++     E  P+V K + Y++ + ++   E L++    D E+ ELA+LEL E K  IE  E E+++LLLPKD  D+K+ I+E+R   GG E+++F GDLF  Y+R+A   GWKV++L   E  + GY  I   I G  V++K+KFESGVHRVQRVP TE+ GR+HTS  TVAVLPE EE+++ I   D++IDT R+SGAGGQH+N T+SAVRITH+P+GI V   E KSQ +NR  AM++LR++L++ + +      S  RK QVG+G+R+E+IRTYN+PQ RVTDHRINLTL KLD +M G + E++D+L++  +A ++ +
  S:    12 LERRFGEIEARM-SAGPAADVYVKLASEYSELQPVVTKIRVYEKAVAELADLETLLEDRSVDREMRELAELELPEVKEQIEVLEQEMQILLLPKDAADEKSAILEIRAGTGGSEAALFAGDLFRMYERFAAEKGWKVEVLSASEGEAGGYKEIIATITGRGVFAKLKFESGVHRVQRVPETEAGGRIHTSAATVAVLPEAEEIDIEIRAEDIRIDTMRSSGAGGQHVNTTDSAVRITHLPSGIVVTSSE-KSQHQNRAKAMQVLRSRLYDAERQRADSERSADRKSQVGSGDRSERIRTYNFPQGRVTDHRINLTLYKLDRMMEGEIEEVVDALMADYQASQLAQ 354
>gi|152997601|ref|YP_001342436.1| peptide chain release factor 1 [Marinomonas sp. MWYL1] >gi|189039978|sp|A6W1C2|RF1_MARMS Peptide chain release factor 1 (RF-1) >gi|150838525|gb|ABR72501.1| peptide chain release factor 1 [Marinomonas sp. MWYL1] (362 aa)
Score = 747, Expect = 3.5e-77, Identities = 162/316 (51%), Positives = 225/316 (71%)
  Q:    39 NKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVE-LVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           +K   E  P+V+ F E+++   +I  AE L+ ++ D +I E+   E        E+ +  L+ LLLPKDPND +NV +E+R   GGDE+SIF GDLF  Y RYA++  WKV+++   +  HG Y  +   I GE  YSK+KFESG HRVQRVPATES+GR+HTS  TVAV+PE++EV+ ++IN SDL+IDT+RASGAGGQH+NKT+SA+R+THIPTG+ V CQE +SQ +NR  AM +L ++L   + E+     S+ RK  VG+G+R+E+IRTYNYPQ RVTDHRINLTL KLD ++ G L  +I+ L++  +A ++
  S:    39 SKEYAELEPVVKCFNEFQQIDENIAEAE-LMMTDADPDIKEMGVEEYKAGLAQKEELQLVLQKLLLPKDPNDSRNVFLEVRAGTGGDEASIFSGDLFRMYSRYAETQRWKVEIVSASDGEHGGYKEVIARIVGEGAYSKLKFESGAHRVQRVPATESQGRIHTSACTVAVMPEMDEVDDIIINKSDLRIDTFRASGAGGQHVNKTDSAIRLTHIPTGVVVECQEERSQHKNRAKAMSLLASRLQAAELEKAASEQSETRKSLVGSGDRSERIRTYNYPQGRVTDHRINLTLYKLDEIVAGELDSLINPLVNEFQAEQL 355
>gi|149204050|ref|ZP_01881018.1| peptide chain release factor 1 [Roseovarius sp. TM1035] >gi|149142492|gb|EDM30537.1| peptide chain release factor 1 [Roseovarius sp. TM1035] (417 aa)
Score = 747, Expect = 3.6e-77, Identities = 155/348 (44%), Positives = 235/348 (67%)
  Q:     9 NSLLSMEEKFNDLNKELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           + L  + E+F+ +  ++   G  + R+    +   E  P+VE+ + Y+  +ND+D A  ++    D E+ +LA+ E++  +  + + E  L++ LLP+D  D +  I+E+RP  GG+E+++F  DL   Y+RY+++ GW  +++E Q+S   G   +   I GE V++++KFESGVHRVQRVP TES GR+HTS  TVAVLPE E+V++ IN +DL+IDT R+SGAGGQH+N T+SAVRITH+PTGI V   E KSQ  NRE AM++L+ +L++ +        S  R  QVG+G+R+E+IRTYN+PQ R+TDHRINLTL KL+ V+ G+L E+ID+L +  +A  + E
  S:    74 DRLQQIVERFDYVEAQMMQGGGDIARLG---REYSELRPVVEEIRAYRLAVNDLDGARAMLA---DPEMRDLAREEVAVLEARLPEMEQRLQLALLPRDEADARPAILEIRPGTGGEEAALFGADLMRMYQRYSEARGWSFEVIEEQQSELGGIRELVVRIGGEGVFARLKFESGVHRVQRVPETESGGRIHTSAATVAVLPEAEDVDIQINANDLRIDTMRSSGAGGQHVNTTDSAVRITHLPTGIVVTSSE-KSQHRNREIAMQVLKTRLYDLERNRVDSERSANRAAQVGSGDRSERIRTYNFPQGRMTDHRINLTLYKLEQVLGGDLDEVIDALTADAQASLLAE 415
>gi|15602420|ref|NP_245492.1| peptide chain release factor 1 [Pasteurella multocida subsp. multocida str. Pm70] >gi|13431785|sp|P57852|RF1_PASMU Peptide chain release factor 1 (RF-1) >gi|12720821|gb|AAK02639.1| PrfA [Pasteurella multocida subsp. multocida str. Pm70] (360 aa)
Score = 747, Expect = 3.6e-77, Identities = 160/316 (50%), Positives = 224/316 (70%)
  Q:    39 NKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           +K   +   +V+ F  + +  ++++ A+ L+    D  + E+AQ E+   K  IE+ E +L++LLLPKDPND+ N  +E+R   GGDE+ IF GDLF  Y RYA+S  WKV++L   ES  G Y  I   +NGE VY ++KFESG HRVQRVP TES+GR+HTS  TVAV+PEL E EL  IN SDL+IDTYR+SGAGGQH+N T+SAVRITHIPTGI V CQ+ +SQ +N+  AM +L +++ + ++E   +  +D R+  +G+G+R++KIRTYNYPQ RVTDHRINLT+ +LD VM G + E+I  +I+  +A ++
  S:    39 SKEYAQLEDVVKCFARWNQLNSNMEEAQLLLD---DPSMKEMAQEEIEACKTEIEQVEQQLQILLLPKDPNDEYNCYLEIRAGTGGDEAGIFAGDLFRMYSRYAESKRWKVEVLSANESEQGGYKEIIVKVNGEGVYGQLKFESGGHRVQRVPKTESQGRIHTSACTVAVMPELPESELPEINPSDLRIDTYRSSGAGGQHVNTTDSAVRITHIPTGIVVECQDERSQHKNKAKAMSVLASRIVQAEKERQEQAQADTRRNLLGSGDRSDKIRTYNYPQGRVTDHRINLTVYRLDEVMNGKIDELIQPIITEYQADQL 353
>gi|84394465|ref|ZP_00993179.1| peptide chain release factor 1 [Vibrio splendidus 12B01] >gi|84374906|gb|EAP91839.1| peptide chain release factor 1 [Vibrio splendidus 12B01] (362 aa)
Score = 747, Expect = 3.6e-77, Identities = 156/344 (45%), Positives = 239/344 (69%)
  Q:    11 LLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGFISFM--INGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           L ++ E++ ++   L   G+  +  +   ++K   +   +   FK Y++   D+++AE++  +E D E+ E+AQ E+ + K  IE+   EL++LL+PKDPND++N  +E+R  AGGDE+ IF G+LF  Y R+A+  GW+V+++    S  G GF   +  I+G+ VY  MKFESG HRVQRVP TES+GRVHTS  TVAV+PE+ E +L  I   DLKIDT+RASGAGGQH+N T+SA+RITH+PTG  V CQ+ +SQ +N+  AM +L A++ + +EE     ISD R+  +G+G+R+++IRTYNYPQ RV+DHRINLT+ +L+ V+ G++  ++D ++   +A ++
  S:     9 LETLVERYEEVQHLLGDPGVLGNQDKFRALSKEYSQLEEVTGCFKSYQQAQEDLEAAEEM-ANEDDAEMREMAQEEIKDAKANIERLTDELQILLIPKDPNDERNCFLEIRAGAGGDEAGIFAGNLFRMYSRFAEKKGWRVEVMSSNVSEQG-GFKEMIAKISGDAVYGTMKFESGGHRVQRVPETESQGRVHTSACTVAVMPEIPEADLPEIKAGDLKIDTFRASGAGGQHVNTTDSAIRITHLPTGTVVECQDERSQHKNKAKAMAVLAARIVQAEEERRAAAISDTRRNLLGSGDRSDRIRTYNYPQGRVSDHRINLTIYRLNEVLEGDMQSLLDPVLQEHQADQL 355
>gi|170717669|ref|YP_001784745.1| peptide chain release factor 1 [Haemophilus somnus 2336] >gi|189039976|sp|B0UUE6|RF1_HAES2 Peptide chain release factor 1 (RF-1) >gi|168825798|gb|ACA31169.1| peptide chain release factor 1 [Haemophilus somnus 2336] (360 aa)
Score = 746, Expect = 3.7e-77, Identities = 159/316 (50%), Positives = 224/316 (70%)
  Q:    39 NKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           +K   +   +V+ F  +    N+I+  + L+    D ++ E+A+LE+ E K  IE  E +L++LLLPKDPND+ N  +E+R   GGDE+ IF GDLF  Y RYA+S  W+V++L   ES  G Y  I   +NGE VY ++KFESG HRVQRVP TES+GR+HTS  TVAV+PEL E E+  IN SDL+IDTYR+SGAGGQH+N T+SAVRITHIPTGI V CQ+ +SQ +N+  A+ +L +++ + ++E   +  +D R+  +G+G+R++KIRTYNYPQ RVTDHRINLT+ +LD VM G + E+I  +I+  +A ++
  S:    39 SKEYAQLEDVVKCFARWNWLNNNIEETQLLLD---DPDMKEMAELEIEESKAEIENAEQQLQILLLPKDPNDEYNAYLEIRAGTGGDEAGIFAGDLFRMYSRYAESKRWRVEVLNANESEQGGYKEIIVKVNGEGVYGQLKFESGGHRVQRVPKTESQGRIHTSACTVAVMPELPENEMPEINPSDLRIDTYRSSGAGGQHVNTTDSAVRITHIPTGIVVECQDERSQHKNKAKALSVLASRIAQAEQERQAQAQADTRRNLLGSGDRSDKIRTYNYPQGRVTDHRINLTVYRLDEVMNGKIDELIQPIITEYQADQL 353
>gi|193211744|ref|YP_001997697.1| peptide chain release factor 1 [Chlorobaculum parvum NCIB 8327] >gi|193085221|gb|ACF10497.1| peptide chain release factor 1 [Chlorobaculum parvum NCIB 8327] (357 aa)
Score = 746, Expect = 4.0e-77, Identities = 160/349 (45%), Positives = 234/349 (67%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGLSV--KRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS--HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQ 355
           +++ L S+++K+  + ++L    ++    R  ++NK       IV  +  ++     +D    + KSE+D E+  LA  E  E +  + + E  LK+LLLPKD  D +N I+E+R   GGDE+ +F  DL   Y+RYA+  GW  + L+V E S       +S  ++G +VY  +KFESGVHRVQRVP TE++GR+HTS  +VAVLPE EEV++ I   DL++DT+R+ G GGQ++NK E+AVRITH+P+GI VACQE +SQ++NRE AMKMLR+KL++ K  E  ++ +DLR+  V TG+R+ KIRTYN+PQ+RVTDHRI  T + L  VM G L  IID+L  HD+A +++
  S:     1 MFDKLQSIKDKYLTIEQQLSDPEVAADQNRFRKLNKEYSGLREIVRAYDNWRSAKQQLDETLAMQKSEEDPEMRALAAAEAEELQERLPELEQNLKILLLPKDEADTRNAIIEIRAGTGGDEAGLFAADLMRMYQRYAERQGWSCQTLDVSEGSVPGSLKEVSLEVSGHDVYGILKFESGVHRVQRVPETETQGRIHTSAASVAVLPEAEEVDVEIRKDDLQMDTFRSGGKGGQNVNKVETAVRITHVPSGIVVACQEERSQLQNRERAMKMLRSKLYDIKITEQLQSRADLRRSMVATGDRSAKIRTYNFPQSRVTDHRIGFTTHALPQVMQGELEPIIDALRMHDQAERLK 353
>gi|154246564|ref|YP_001417522.1| peptide chain release factor 1 [Xanthobacter autotrophicus Py2] >gi|154160649|gb|ABS67865.1| peptide chain release factor 1 [Xanthobacter autotrophicus Py2] (360 aa)
Score = 746, Expect = 4.2e-77, Identities = 154/313 (49%), Positives = 219/313 (69%)
  Q:    38 INKSIKETTPIVEKFKEYKRTLNDIDSAEKLI-KSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGN-LSEIIDSLISHDE 350
           + +   + +P+VE+ +  K    D++ A +L+ +S  D E+ E+A+ E+   +  IE     +++ LLPKD  D++ +I+E+R   GGDE+++F GDL+  Y RYA   GW V++L   E + G Y  I   ++G   Y+++KFESGVHRVQRVPATE+ GR+HTS  TVAVLPE E+V++ IN +DL+ID YRA GAGGQH+NKTESAVRITH+PT   VA Q+ +SQ  N+  AM +LRA+L + + ++     +  RKGQVG+G+R+E+IRTYN+PQ RVTDHRINLTL KLD V+ G  L EIID L++  +
  S:    35 LGREFSDLSPVVEQVRALKDAERDLEGANELLAESAADPEMREMAEAEVERLQDRIEALATAVRLALLPKDAMDERGIILEVRAGTGGDEAALFAGDLYRMYTRYAAEKGWSVEILSESEGTMGGYKEIVAALHGRGAYARLKFESGVHRVQRVPATETSGRIHTSAATVAVLPEAEDVDVDINEADLRIDVYRAQGAGGQHVNKTESAVRITHLPTNTVVAVQDERSQHRNKARAMALLRARLLDDERQKKEAGRAAERKGQVGSGDRSERIRTYNFPQGRVTDHRINLTLYKLDEVIAGTALDEIIDPLLTEHQ 350
>gi|157964580|ref|YP_001499404.1| peptide chain release factor 1 [Rickettsia massiliae MTU5] >gi|166977368|sp|A8F1S1|RF1_RICM5 Peptide chain release factor 1 (RF-1) >gi|157844356|gb|ABV84857.1| Peptide chain release factor RF-1 [Rickettsia massiliae MTU5] (361 aa)
Score = 746, Expect = 4.3e-77, Identities = 163/349 (46%), Positives = 247/349 (70%)
  Q:     6 KLYNSLLSMEEKFNDLNKELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKL-IKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVML-GNLSEIIDSLISHDEAVKM 354
           +  ++L  + +K+ +L  +L + G+      + +K   E   +V K KEY +  ++++ A    ++   DN  +E+ + E+   +  + K E  +K+ LLPKD  D K+ I+E+R  +GG+E+++F   LF+ Y+RYA+  GW+ ++L + ++   GY   S  I G++V+SK+KFESGVHRVQRVP TES+GR+HTS  TVAVLPE EEV++ I + DL+IDTYRASGAGGQH+N T+SAVRITHIPTGI VA Q+ KSQ +N+  A+K+LRA+++E++  +  +  +D R+GQVG+G+R+E+IRTYN+PQ RV+DHRINLTL K+D V+  G L E +++LI+ DEA K+
  S:     2 RFSDNLAKILDKYENLGNKLSS-GIMGDEFVKASKEYAELEDVVAKIKEYNKAKSELEEANNFKLEVGLDNATLEMIEDEIHTLENSLPKLERAVKIALLPKDDADSKSAIIEVRAGSGGEEAALFAAVLFNMYQRYAELKGWRFEILAISDTGIGGYKEASASIKGKDVFSKLKFESGVHRVQRVPETESQGRIHTSAATVAVLPEAEEVDIQIEDKDLRIDTYRASGAGGQHVNTTDSAVRITHIPTGITVALQDEKSQHKNKAKALKILRARIYEEERRKKEQERADSRRGQVGSGDRSERIRTYNFPQGRVSDHRINLTLYKIDEVVKNGQLDEFVEALIADDEAKKL 352
>gi|194505142|ref|YP_002034713.1| peptide chain release factor 1 [Burkholderia pseudomallei 1655] >gi|184211029|gb|EDU08072.1| peptide chain release factor 1 [Burkholderia pseudomallei 1655] (360 aa)
Score = 746, Expect = 4.5e-77, Identities = 156/345 (45%), Positives = 237/345 (68%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGLS--VKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEV-ELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           + + L  +  +  +LN  L  E ++  + +  ++ +   E  P+VE + ++++   D  +A++L+    D  + + A+ EL   +  + +   EL+ +LLPKDPND++N+ VE+R   GGDES++F GDL   Y RYA+   W+V+M+    S   GY  +   I G   YS++KFESG HRVQRVPATE++GR+HTS  TVAV+PE +E+ E+ IN +DL+IDT+RASGAGGQHINKT+SAVR+THI TGI V CQ+ +SQ +N++ A+K+L A++ +K+  E     +  RK  +G+G+R+E+IRTYN+PQ R+TDHRINLTL KL+ +M G+L E+I +L+S  +A
  S:     5 MQSKLDQLTTRLAELNDLLSRENVTADLDQYRKLTREHAEIGPVVEHYAQWRQARADELAAQELLA---DASMRDFAEDELRGARDRMGRLAAELQTMLLPKDPNDERNIFVEIRAGTGGDESALFAGDLLRMYLRYAERQRWQVEMMSESPSDLGGYKEVIVRIAGYGAYSRLKFESGGHRVQRVPATETQGRIHTSACTVAVMPEADEIGEVEINPADLRIDTFRASGAGGQHINKTDSAVRVTHISTGIVVECQDDRSQHKNKDRALKVLAARIKDKQYHEQHAKEAATRKSLIGSGDRSERIRTYNFPQGRMTDHRINLTLYKLEQIMDGDLDELIAALVSEHQA 350
>gi|78065073|ref|YP_367842.1| peptide chain release factor 1 [Burkholderia sp. 383] >gi|119361516|sp|Q39K18|RF1_BURS3 Peptide chain release factor 1 (RF-1) >gi|77965818|gb|ABB07198.1| bacterial peptide chain release factor 1 (bRF-1) [Burkholderia sp. 383] (360 aa)
Score = 746, Expect = 4.6e-77, Identities = 154/341 (45%), Positives = 240/341 (70%)
  Q:    11 LLSMEEKFNDLNKELETEGLS--VKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEV-ELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           L  +  +  +LN  L  E ++  + +  ++ +   E  P+VE++  ++++ +D  +A++L+    D  + + A+ E+   +  + + E EL+ +LLPKDPND++N+ +E+R   GGDES++F GDL   Y R+A+   W+V+M+    S   GY  +   I G+  YS++KFESG HRVQRVPATE++GR+HTS  TVAV+PE +E+ E+ IN +DL+IDT+RASGAGGQHINKT+SAVR+THIPTGI V CQ+ +SQ +N++ A+K+L A++ +K+  E     +  RK  +G+G+R+E+IRTYN+PQ R+TDHRINLTL +L+ +M G+L E+I +L+S  +A
  S:     9 LDQLSTRLAELNDLLSRENVTADLDQYRKLTREHAELGPVVEQYALWRQSRSDETAAQELLG---DLSMRDFAEDEIRSARESMSRLETELQKMLLPKDPNDERNIFLEIRAGTGGDESALFAGDLLRMYLRFAERQRWQVEMMSESASDLGGYKEVIVRIAGQGAYSRLKFESGGHRVQRVPATETQGRIHTSACTVAVMPEADEIGEVEINPADLRIDTFRASGAGGQHINKTDSAVRVTHIPTGIVVECQDDRSQHKNKDRALKVLAARIKDKQYHEQHAKEAATRKSLIGSGDRSERIRTYNFPQGRMTDHRINLTLYRLEALMDGDLDELISALVSEHQA 350
>gi|149185458|ref|ZP_01863774.1| protein chain release factor A [Erythrobacter sp. SD-21] >gi|148830678|gb|EDL49113.1| protein chain release factor A [Erythrobacter sp. SD-21] (355 aa)
Score = 746, Expect = 4.7e-77, Identities = 155/344 (45%), Positives = 234/344 (68%)
  Q:    11 LLSMEEKFNDLNKELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLG-NLSEIIDSLISHDEAVKM 354
           L  +  +F +L   + +  L      + ++   E  P+ +   E K    +I S E ++    D E+  +A+ EL+E +  +   E +L + +LP+D  D+K  ++E+R   GGDE+++F GDLF  Y+RYA  +GWKV+ + +  S   G+  I   + G NV++K+KFESGVHRVQRVP TES GR+HTS  TVAVLPE +EV++ ++ ++LKIDTYRASGAGGQH+N T+SA+RITH+PTG  V CQ+G+SQ +N+E AM++LR +L++ + E  +   ++ RK  VG+G+R+E+IRTYNYPQ RVTDHRI LTL KL  ++ G  L+E++++LI+ DEA ++
  S:     8 LDQIAHRFAELEARMASGTLEGDEFVQASRDYAELEPVAKVAAEVKAAREEIASLEDMLA---DPEMKAMAEEELAELQKRLPAAERQLAIAMLPRDSADNKPAMLEIRAGTGGDEAALFAGDLFRMYERYAAEMGWKVEPVSMNASEVGGFKEIVASVTGPNVFAKLKFESGVHRVQRVPETESGGRIHTSAATVAVLPEPDEVDVQLDPTELKIDTYRASGAGGQHVNTTDSAIRITHLPTGTVVTCQDGRSQHKNKEKAMQVLRTRLYDAQREATQGAEAEARKAMVGSGDRSERIRTYNYPQGRVTDHRIGLTLQKLPQIIAGPGLAELVEALIAEDEAKRL 350
>gi|52425247|ref|YP_088384.1| peptide chain release factor 1 [Mannheimia succiniciproducens MBEL55E] >gi|61214602|sp|Q65TB1|RF1_MANSM Peptide chain release factor 1 (RF-1) >gi|52307299|gb|AAU37799.1| PrfA protein [Mannheimia succiniciproducens MBEL55E] (360 aa)
Score = 745, Expect = 4.9e-77, Identities = 163/348 (46%), Positives = 241/348 (69%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           + + L S+ E++ +L   L    +     +    +K   +   +V+ F  +K+  ++I+ AE L+    D E+ E+AQ+E+ E K  +E+ E  L++LLLP+DPND+ N  +E+R   GGDE+ IF GDLF  Y RYA+   W+V++L   ES  G Y  I  +++G+NVY ++KFESG HRVQRVP TES+GR+HTS  TVAV+PEL E E+  IN +DL+IDTYRASGAGGQHINKT+SAVRITHIPTG+ V CQ+ +SQ +N+  A+ +L ++L + ++++     +  R+  +G+G+R++KIRTYNYPQ RVTDHRINLT+ +LD VM G + E+I  +I+  +A ++
  S:     5 IISKLDSLNERYEELEALLGDASVISDQDKFRAYSKEYSQLEEVVKTFSRWKQLNSNIEEAELLLD---DPEMKEMAQMEIEESKNELEEVEQHLQILLLPRDPNDEYNAYLEIRAGTGGDEAGIFAGDLFRMYSRYAEMKRWRVEVLSENESEQGGYKEIIALVSGDNVYGQLKFESGGHRVQRVPKTESQGRIHTSACTVAVMPELPESEMPEINPADLRIDTYRASGAGGQHINKTDSAVRITHIPTGMVVECQDERSQHKNKAKALAVLASRLVQAEQDKLAAEQATTRRNLLGSGDRSDKIRTYNYPQGRVTDHRINLTVYRLDEVMNGKIDELIQPIITEYQADQL 353
>gi|57504876|ref|ZP_00370851.1| peptide chain release factor 1 [Campylobacter coli RM2228] >gi|57019304|gb|EAL56006.1| peptide chain release factor 1 [Campylobacter coli RM2228] (355 aa)
Score = 745, Expect = 5.1e-77, Identities = 167/326 (51%), Positives = 241/326 (73%)
  Q:    34 RMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVML-GNLSEIIDSLISHDEAVKMQEAKI 359
           +M+ ++K  K   PIV K KEY +TL+ I+  + L+    D E+ ELA+ EL   + L  K E ELK+LLLPKDPND++N+ +E+R   GGDE+S+FVGDL  AY RYA++ G+K++++   E S  G+  I  ++ G   +S++K+E G HRVQRVP TES+GR+HTS IT+AV+PE++++E+ IN +DLKID  R+SG GGQ +N T+SAVRITH+PTGI V  Q+GKSQ +N+E+AMK+L+A+L+E +E E     S+ RK QVG+G+R+E+IRTYN+PQNR++DHRINLTL +LD ++  G   E+I+ LI+H +A  +QE  +
  S:    31 KMTALSKEQKNLEPIVLKAKEYLKTLDSIEENKTLLN---DAELGELAKEELKNLEELKPKLEEELKILLLPKDPNDERNIFLEIRAGTGGDEASLFVGDLVKAYARYAENRGYKLEIVSSSEGSVGGFKEIIMLVKGAGAFSRLKYEGGTHRVQRVPQTESQGRIHTSAITIAVMPEVDDIEIEINPNDLKIDVMRSSGHGGQSVNTTDSAVRITHLPTGIVVVNQDGKSQHKNKESAMKVLKARLYEMQESERLAQESEARKSQVGSGDRSERIRTYNFPQNRISDHRINLTLYRLDAILQDGLFDEVIEPLIAHYQAESLQEQNL 355
>gi|169201391|ref|ZP_02860564.1| peptide chain release factor 1 [Rhizobium leguminosarum bv. trifolii WSM2304] >gi|169084208|gb|EDS64933.1| peptide chain release factor 1 [Rhizobium leguminosarum bv. trifolii WSM2304] (359 aa)
Score = 745, Expect = 5.2e-77, Identities = 158/343 (46%), Positives = 237/343 (69%)
  Q:    14 MEEKFNDLNKELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEK-DNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQE-SSHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           +E +F ++   + + G +     ++     E  P+V K + Y++ + ++   E L++ +  D E+ +LA+LEL E K  IE  E E+++LLLPKD  D+K+ I+E+R   GG E+++F GDLF  Y+R++   GWKV++L   E  + GY  I   I G  V++K+KFESGVHRVQRVP TE+ GR+HTS  TVAVLPE EE+++ I   D++IDT R+SGAGGQH+N T+SAVRITH+P+GI V   E KSQ +NR  AM++LR++L++ + +      S  RK QVG+G+R+E+IRTYN+PQ R+TDHRINLTL KLD +M G + E++D+L++  +A ++ +
  S:    12 LERRFGEIEARM-SAGPAADVYVKLASEYSELQPVVTKIRAYEKAIAELADLETLLEDKSVDREMRDLAELELPEVKEQIEALEQEMQILLLPKDAADEKSAILEIRAGTGGSEAALFAGDLFRMYERFSAEKGWKVEVLSASEGEAGGYKEIIATITGRGVFAKLKFESGVHRVQRVPETEAGGRIHTSAATVAVLPEAEEIDIEIRPEDIRIDTMRSSGAGGQHVNTTDSAVRITHLPSGIVVTSSE-KSQHQNRAKAMQVLRSRLYDAERQRADSERSADRKSQVGSGDRSERIRTYNFPQGRITDHRINLTLYKLDRMMEGEIEEVVDALMADYQASQLAQ 354
>gi|33152002|ref|NP_873355.1| peptide chain release factor 1 [Haemophilus ducreyi 35000HP] >gi|46576749|sp|Q7VMV9|RF1_HAEDU Peptide chain release factor 1 (RF-1) >gi|33148224|gb|AAP95744.1| peptide chain release factor 1 (RF-1) [Haemophilus ducreyi 35000HP] (360 aa)
Score = 745, Expect = 5.2e-77, Identities = 156/316 (49%), Positives = 223/316 (70%)
  Q:    39 NKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           +K   +   +V  F  +K+  +DI+ AE L+    D ++ E+A  E+++ K  IE  E  L++LLLPKDPND+ N  +E+R   GGDE+ IF GDL+  Y RYA+S  W+++ +   ES  G Y  I   I+GE+VY ++KFESG HRVQRVP TES+GR+HTS  TVAV+PEL E E+  IN +DL+IDTYR+SGAGGQH+N T+SAVRITH+PTGI V CQ+ +SQ +N+  A+ +L +++ + ++E      +D R+  +GTG+R++KIRTYNYPQ RVTDHRINLT+ +LD VM G + E+I  +I+  +A ++
  S:    39 SKEYAQLEEVVATFNRWKKLNSDIEEAELLLD---DPDMKEMATEEITQNKAEIECLEQHLQILLLPKDPNDEYNAFLEIRAGTGGDEAGIFAGDLYRMYSRYAESKRWRIEEMSANESEQGGYKEIIVKISGESVYGQLKFESGGHRVQRVPKTESQGRIHTSACTVAVMPELPESEMPEINPADLRIDTYRSSGAGGQHVNTTDSAVRITHLPTGIVVECQDERSQHKNKAKALAVLASRIVQVEQERQAMAQADTRRNLLGTGDRSDKIRTYNYPQGRVTDHRINLTVYRLDEVMNGKIDELIQPIITEYQADQL 353
>gi|144897745|emb|CAM74609.1| peptide chain release factor RF-1 [Magnetospirillum gryphiswaldense MSR-1] (352 aa)
Score = 745, Expect = 5.3e-77, Identities = 156/340 (45%), Positives = 235/340 (69%)
  Q:    17 KFNDLNKELET-EGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGN-LSEIIDSLISHDEAVKMQE 356
           ++++L ++L   +G S  R+S   K   +  P+V   +  K+   D+  AE ++    D ++ +LA  E    K  +   E +++++LLPKD  D+KN I+E+R   GG+E+++F  +LF  Y+RYA   GW+ ++++V E+   G    S  I G  V++++KFESGVHRVQRVPATES GR+HTS  TVA++PE EEV++ I++ DL+ D YR+ G+GGQ +N T+SAVR+THIPTG+ VACQ+ KSQ +N+ TAMK+LRA+L+E +        +  RK QVG+G+R+E+IRTYN+PQ RVTDHRINLTL K+D++M G  L E+ D+LI+ D+A ++ E
  S:    13 RYDELREQLAAGDGGSFARLS---KEFSDIEPVVHAVQALKKARADMAEAEAMMA---DPDMKDLAAEEYYALKETLPGLERDVQLMLLPKDEADEKNAILEVRAGTGGEEAALFAAELFRMYERYASVRGWRFEVMDVNETGIGGMKEASATITGRGVFARLKFESGVHRVQRVPATESGGRIHTSAATVAIMPEAEEVDIQIDDKDLRFDVYRSQGSGGQSVNTTDSAVRVTHIPTGLAVACQQEKSQHKNKATAMKLLRARLYEMERASKAAERAANRKSQVGSGDRSERIRTYNFPQGRVTDHRINLTLYKIDDMMNGTALDEVADALIAADQAERLAE 349
>gi|183222627|ref|YP_001840623.1| peptide chain release factor 1 [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] >gi|189912661|ref|YP_001964216.1| Peptide chain release factor 1 [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] >gi|167777337|gb|ABZ95638.1| Peptide chain release factor 1 [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] >gi|167781049|gb|ABZ99347.1| Peptide chain release factor 1 [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] (353 aa)
Score = 745, Expect = 5.9e-77, Identities = 158/352 (44%), Positives = 237/352 (67%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQEAK 358
           + + L  ++EK+  +  EL  +  +   +  ++K     TP+  K  EY +   D   A+ L++SE D ++  + + E+ E +  +E+   EL+++LLP DPN  K+++VE+R   GG+ES +F  DLF  Y +YAD  G +V+++++ ++   GY  I F ++ +  Y   KFESG HRVQR+P TES GR+HTS +TVA+LPE EE E+ I  SDL+ID YR+SGAGGQH+N T+SAVRITHIPTGI VA QE +SQI+NR+ AM++LRA++ ++  E  + +   L+K QVG+G+R+E+IRTYN+PQ R TDHRI  T + L  +M G+L E+ID+LI  D + ++ EAK
  S:     1 MIDRLKKIQEKYLRIEDEL-AKATASDTLKNLSKERSRLTPVYTKADEYLKITKDCQDAKSLLESENDPDMHSMLKSEIEEGEKKLEELAKELEIMLLPPDPNSGKSILVEIRAGTGGEESGLFCADLFRMYNKYADKKGLRVEIIDMSQTGIGGYKEIVFSLDDDKAYDLFKFESGTHRVQRIPETESGGRIHTSAVTVAILPEAEEKEVEIKESDLRIDVYRSSGAGGQHVNTTDSAVRITHIPTGIVVASQEERSQIKNRDKAMRVLRARIADQAAETAKLSADALKKAQVGSGDRSERIRTYNFPQGRCTDHRIGFTSHNLPAIMEGDLDELIDALIQEDRSKRLAEAK 352
>gi|148558947|ref|YP_001259697.1| peptide chain release factor 1 [Brucella ovis ATCC 25840] >gi|148370204|gb|ABQ60183.1| peptide chain release factor 1 [Brucella ovis ATCC 25840] (377 aa)
Score = 744, Expect = 6.4e-77, Identities = 154/286 (53%), Positives = 208/286 (72%)
  Q:    71 SEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQE-SSHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           +  D E+  LA  EL E +  I   E ++++LLLPKD  DDKN I+E+R   GG E+++F GDLF  Y+RYA   GW+V+++   E  + GY  I   ++G+ V+SK+KFESGVHRVQRVP TE+ GR+HTS  TVAVLPE E++++ I N D++IDT RASGAGGQH+N T+SAVRITHIPTGI V  Q  KSQ +NR  AM++LRA+L++ + ++     S  R+ QVG+G+R+E+IRTYN+PQ RVTDHRINLTL KLD VM G+L E++D+LIS  +   + E
  S:    87 ASTDAEMRALAVEELPEVEKRIAVLEQDVQILLLPKDAADDKNAILEIRAGTGGLEAALFAGDLFRMYERYAAEKGWRVELVSASEGDAGGYKEIIATVSGKGVFSKLKFESGVHRVQRVPETEAGGRIHTSAATVAVLPEAEDIDIEIRNEDIRIDTMRASGAGGQHVNTTDSAVRITHIPTGIMVV-QAEKSQHQNRARAMQILRARLYDMERQKAESERSQARRSQVGSGDRSERIRTYNFPQGRVTDHRINLTLYKLDRVMEGDLDELVDALISDHQTALLAE 372
>gi|15890803|ref|NP_356475.1| peptide chain release factor 1 [Agrobacterium tumefaciens str. C58] >gi|22096038|sp|Q8U8B8|RF1_AGRT5 Peptide chain release factor 1 (RF-1) >gi|15159088|gb|AAK89260.1| peptide chain release factor 1 [Agrobacterium tumefaciens str. C58] (360 aa)
Score = 744, Expect = 6.4e-77, Identities = 158/343 (46%), Positives = 240/343 (69%)
  Q:    14 MEEKFNDLNKELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEK-DNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQE-SSHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           +E +F ++   + + G +     ++     E  P+V+K ++Y++ +++    E L+  +  D ++ +LA++EL E +  I + E +++VLLLPKD  D+K+ I+E+R   GG E+++F GDLF  Y+R+A + GWKV++L   E  + GY  I   I G  V+SK+KFESGVHRVQRVP TE+ GR+HTS  TVAVLPE E++++ I   D++IDT RASGAGGQH+N T+SAVRITH+PTG+ V   E KSQ +NR  AM++LR++L++ + ++     S  RK QVG+G+R+E+IRTYN+PQ RVTDHRINLTL KLD V+ G + E++D+LI+  +A ++ +
  S:    12 LERRFGEIEARM-SAGPAADVYVKLASEYSELEPVVKKIRDYEKAISEAADLEALLADKTTDKDMRDLAEMELPEVETRIRELEKDMQVLLLPKDAADEKSAILEIRAGTGGSEAALFAGDLFRMYERFAATKGWKVEVLSASEGEAGGYKEIIATITGRGVFSKLKFESGVHRVQRVPETEASGRIHTSAATVAVLPEAEDIDVEIRPEDIRIDTMRASGAGGQHVNTTDSAVRITHLPTGLIVTSSE-KSQHQNRAKAMQVLRSRLYDIERQKVDSERSADRKSQVGSGDRSERIRTYNFPQGRVTDHRINLTLYKLDRVIEGEIDELVDALIADYQAGQLAQ 354
>gi|83942386|ref|ZP_00954847.1| peptide chain release factor 1 [Sulfitobacter sp. EE-36] >gi|83846479|gb|EAP84355.1| peptide chain release factor 1 [Sulfitobacter sp. EE-36] (351 aa)
Score = 744, Expect = 6.4e-77, Identities = 160/348 (45%), Positives = 239/348 (68%)
  Q:     9 NSLLSMEEKFNDLNKELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           + L  + ++F  L   + + G      +++ K   +  P+VE+   Y++ L D+D A  ++K   D E+ ELA+ EL   K  + + E +L++ LLP+D  D K  ++E+RP  GGDE+++F  DL   Y+RYA++ GWKV+++E Q +   G   +   I GENV++++K+ESGVHRVQRVP+TES GR+HTS  TVAVLPE E+V++ I+ +DL+IDT R+SGAGGQH+N T+SAVRITH+PTG+ V   E KSQ  NRE AM++L+A+L++ + +      S  R  QVG+G+R+E+IRTYN+PQ R+TDHRINLTL +L+ VM G+L EI+D+L +  +A  + E
  S:     5 DRLAQITQRFQFLEASM-SAGSDGADFAKLAKEYADLRPVVEQIDAYRQLLQDMDDARAMLK---DPEMAELAEEELPRLKAALPQAEADLQLALLPRDEADKKPAMLEIRPGTGGDEAALFAADLLRMYQRYAEARGWKVELIEQQFTELGGVKEVVAHIKGENVFARLKYESGVHRVQRVPSTESGGRIHTSAATVAVLPEAEDVDIHIDANDLRIDTMRSSGAGGQHVNTTDSAVRITHLPTGLVVTSSE-KSQHRNREIAMQVLKARLYDMERQRVDSERSASRAAQVGSGDRSERIRTYNFPQGRLTDHRINLTLYRLEAVMQGDLDEIVDALTADAQAQLLAE 348
>gi|89073091|ref|ZP_01159630.1| peptide chain release factor 1 [Photobacterium sp. SKA34] >gi|89051044|gb|EAR56501.1| peptide chain release factor 1 [Photobacterium sp. SKA34] (362 aa)
Score = 744, Expect = 6.9e-77, Identities = 154/321 (47%), Positives = 225/321 (70%)
  Q:    34 RMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           R   ++K   +   + + F+ Y++   D+ +AE++ + E D E+ E+AQ E+ E K  IE+   EL+VLL+PKDPNDD+N  VE+R  AGGDE+ IF GDLF  Y +YA+  GW+++++    S  G Y  +   +NG+  Y  +KFESG HRVQRVPATES+GRVHTS  TVAVLPE+ E E+  IN  DL+IDT+R+SGAGGQH+N T+SA+RITH+PTGI V CQ+ +SQ +N+  AM +L A++ + +EE+     +  R+  +G+G+R+++IRTYNYPQ RV+DHRI LTL +L+ VM G+L  +I  + +  +A ++
  S:    34 RFRALSKEYSQLEEVTKCFQAYQQAKEDLVAAEEMAQ-EDDAEMREMAQEEIKEAKAEIERLADELQVLLIPKDPNDDRNCFVEIRAGAGGDEAGIFAGDLFRMYSKYAERRGWRIEIINENRSEQGGYKEMIAKVNGDGAYGILKFESGGHRVQRVPATESQGRVHTSACTVAVLPEIPEAEIPEINAGDLRIDTFRSSGAGGQHVNTTDSAIRITHLPTGIVVECQDERSQHKNKAKAMSVLAARIIKAEEEKRNAEEASTRRNLLGSGDRSDRIRTYNYPQGRVSDHRITLTLYRLNEVMEGDLDALIQPVFTEYQADQL 355
>gi|34580401|ref|ZP_00141881.1| peptide chain release factor RF-1 [Rickettsia sibirica 246] >gi|28261786|gb|EAA25290.1| peptide chain release factor RF-1 [Rickettsia sibirica 246] (355 aa)
Score = 744, Expect = 7.0e-77, Identities = 164/351 (46%), Positives = 248/351 (70%)
  Q:     6 KLYNSLLSMEEKFNDLNKELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKL-IKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVML-GNLSEIIDSLISHDEAVKMQE 356
           +  ++L  + +K+ +L  +L + G+      + +K   E   +V K KEY +  ++++ A    ++   DN  +E+ + E+   +  + K E  +K+ LLPKD  D K+ I+E+R  +GG+E+++F   LF+ Y+RYA+  GW+ ++L + ++   GY   S  I G++V+SK+KFESGVHRVQRVP TES+GR+HTS  TVAVLPE EEV++ I + DL+IDTYRASGAGGQH+N T+SAVRITHIPTGI VA Q+ KSQ +N+  A+K+LRA+++E++  +  +  +D R+GQVG+G+R+E+IRTYN+PQ RV+DHRINLTL K+D V+  G L E +++LI+ DEA K+ E
  S:     2 RFSDNLAKILDKYENLGNKLSS-GIMGDEFVKASKEYAELEDVVAKIKEYNKAKSELEEANNFKLEVGLDNATLEMIEDEIYTLENSLPKLERAVKIALLPKDDADSKSAIIEVRAGSGGEEAALFAAVLFNMYQRYAELKGWRFEILAISDTGIGGYKEASASIKGKDVFSKLKFESGVHRVQRVPETESQGRIHTSAATVAVLPEAEEVDIKIEDKDLRIDTYRASGAGGQHVNTTDSAVRITHIPTGITVALQDEKSQHKNKAKALKILRARIYEEERRKKEQERADSRRGQVGSGDRSERIRTYNFPQGRVSDHRINLTLYKIDEVVKNGQLDEFVEALIADDEAKKLLE 354
>gi|114768932|ref|ZP_01446558.1| peptide chain release factor 1 [alpha proteobacterium HTCC2255] >gi|114549849|gb|EAU52730.1| peptide chain release factor 1 [alpha proteobacterium HTCC2255] (351 aa)
Score = 744, Expect = 7.2e-77, Identities = 160/329 (48%), Positives = 232/329 (70%)
  Q:    28 EGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGFISFMIN--GENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           +G +V  +++++K   +  P+V++ + YK TL DI  AE+++    D E+  LA+ EL   K  +   E++L + LLPKD  DDK  I+E+R   GGDE+++F GDL   Y R+ +  GWK +++E  E+  G G+   +IN  G  V++++K+ESGVHRVQRVP TES GRVHTS  TVA++PE E ++L I  +D+++DTYR+SGAGGQH+N T+SAVRITH+PTG+ V   E KSQ  NRE AM +LR +L++ + ++     +  RK QVG+G+R+E+IRTYN+PQ RV+DHRINLTL KLD VM G+L+E ID+L + D+A K+ E
  S:    23 DGSAVDEIAKLSKEYSDLKPVVDQIENYKATLLDISEAEEMLL---DPELKVLAEEELPNLKEKLPILEHKLLLSLLPKDEADDKPAIIEIRAGTGGDEAALFAGDLLRMYNRFCEDQGWKFEIVEGNETELG-GYKEAIINVKGVGVFARLKYESGVHRVQRVPTTESGGRVHTSAATVAIMPEAENIDLEIPTTDIRLDTYRSSGAGGQHVNTTDSAVRITHLPTGLIVTSSE-KSQHRNREIAMNVLRTRLYDLQRQQAADERAATRKDQVGSGDRSERIRTYNFPQGRVSDHRINLTLYKLDQVMQGDLNEFIDALTADDQATKLSE 348
>gi|108759492|ref|YP_633064.1| peptide chain release factor 1 [Myxococcus xanthus DK 1622] >gi|20139339|sp|Q93NC7|RF1_MYXXA Peptide chain release factor 1 (RF-1) >gi|119361565|sp|Q1D2Q9|RF1_MYXXD Peptide chain release factor 1 (RF-1) >gi|14517940|gb|AAK64443.1|AF377339_4 peptide chain release factor RF-1 [Myxococcus xanthus] >gi|108463372|gb|ABF88557.1| peptide chain release factor 1 [Myxococcus xanthus DK 1622] (362 aa)
Score = 744, Expect = 8.2e-77, Identities = 156/351 (44%), Positives = 238/351 (67%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQE-SSHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLIS--HDEAVKMQEA 357
           + + L  +E +F  L  +L    +     R+ +++K       +VE F+ Y++ L D+   E  + S   +E    A+  L   K   ++ E  LK+LLLPKDPND+KNVI+E+R  AGGDE+++F  ++   Y RYAD  GWK  +L++   ++ G    +  ++G+ V+S MK+ESGVHRVQRVPATE++GR+HTSTITV+V+PE E+V++ +N +D+++   R++G+GGQ +N T+SAVR+ H PTGI V CQ+ KSQ++NR  AM+MLRAKL++ ++E  R      R+ QVGTG+R+EKIRTYN+PQ+R+TDHRI LT++ L  VM G++ ++I +  +    EA+K Q A
  S:     1 MIDKLEDVERRFERLTADLSNPDVLADSARLQKVSKERAGLEKLVEAFRTYRKVLADLSEVEAWLGSSDADEK-AFARESLPGLKEQRDELEASLKILLLPKDPNDEKNVILEIRAGAGGDEAALFAEEVMQMYLRYADRRGWKADILDMSPGNAGGVKDATVTLSGDAVFSSMKYESGVHRVQRVPATETQGRIHTSTITVSVMPEAEDVDVQVNPADIEMQVMRSTGSGGQSVNTTDSAVRLIHHPTGIVVKCQQEKSQLKNRTMAMRMLRAKLYDIEQERIRNERDSARRAQVGTGDRSEKIRTYNFPQDRLTDHRIGLTVHNLPGVMAGDVEDVITACRTFYQAEALKAQTA 355
>gi|110635328|ref|YP_675536.1| peptide chain release factor 1 [Mesorhizobium sp. BNC1] >gi|119361558|sp|Q11E04|RF1_MESSB Peptide chain release factor 1 (RF-1) >gi|110286312|gb|ABG64371.1| bacterial peptide chain release factor 1 (bRF-1) [Mesorhizobium sp. BNC1] (359 aa)
Score = 744, Expect = 8.2e-77, Identities = 162/320 (50%), Positives = 226/320 (70%)
  Q:    32 VKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQE-SSHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           VK  SE ++ ++E    +   ++ +  L D+D+   L     D EI ELA+++  E +  +E  + +L+VLLLPKD  D+KN I+E+R   GGDE+++F GDLF  Y+RYA   GW+V+++   E  + GY  I   + G  V+S++KFESGVHRVQRVPATE++GR+HTS  TVAVLPE E++++ I   D++IDT RASGAGGQH+N T+SAVRITH+PTGI V   E KSQ +NR  AM++LRA+L++ +        S+ R+ QVGTG+R+E+IRTYN+PQ RVTDHRINLTL KLD VM G L E+ID+LI+  ++
  S:    33 VKLASEYSE-LQEVANSIRALRKAEAELEDLDTM--LADKSIDREIRELAEIDREEVESRVEDMQQKLQVLLLPKDEADEKNAILEIRAGTGGDEAALFAGDLFRMYERYASERGWRVEVVSASEGEAGGYKEIIASVTGRGVFSRLKFESGVHRVQRVPATEAQGRIHTSAATVAVLPEAEDIDVDIKPEDIRIDTMRASGAGGQHVNTTDSAVRITHLPTGIMVVSAE-KSQHQNRARAMQILRARLFDMERSRAANERSEARRLQVGTGDRSERIRTYNFPQGRVTDHRINLTLYKLDRVMEGELDEVIDALIADHQS 349
>gi|110680314|ref|YP_683321.1| peptide chain release factor 1 [Roseobacter denitrificans OCh 114] >gi|119361597|sp|Q164F8|RF1_ROSDO Peptide chain release factor 1 (RF-1) >gi|109456430|gb|ABG32635.1| peptide chain release factor 1 [Roseobacter denitrificans OCh 114] (351 aa)
Score = 743, Expect = 9.5e-77, Identities = 155/317 (48%), Positives = 227/317 (71%)
  Q:    40 KSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           K   +  P+VE+   Y++ L+D++ A +++    D ++  LA+ E+   K  + + E  L++ LLPKD  D K  ++E+RP  GGDE+++F GDLF  Y+RYA++ GWKV ++E+QE+   G   +   I G +V++++K+ESGVHRVQRVP+TES GR+HTS  TVAVLPE E+V++ I+ +DL+IDT R+SGAGGQH+N T+SAVRITH+PTG+ V   E KSQ  NRE AM++L+A+L++ +        S  R  QVG+G+R+E+IRTYN+PQ R+TDHRINLTL +LD V+ G+L EIID+L +H +A  M +
  S:    35 KEYSDLRPVVEQISAYQQLLSDLEDAAEMLG---DPDMAPLAEEEIPRLKSALPQAEAALQLALLPKDKADAKPAMLEIRPGTGGDEAALFAGDLFRMYQRYAETQGWKVDLIELQETELGGIKEVVAHIKGADVFARLKYESGVHRVQRVPSTESGGRIHTSAATVAVLPEAEDVDIHIDANDLRIDTMRSSGAGGQHVNTTDSAVRITHLPTGLVVTSSE-KSQHRNREIAMQVLKARLYDLERSRVDDERSADRAAQVGSGDRSERIRTYNFPQGRMTDHRINLTLYRLDAVLQGDLDEIIDALTAHAQAQLMAD 348
>gi|145639103|ref|ZP_01794711.1| peptide chain release factor 1 [Haemophilus influenzae PittII] >gi|145272075|gb|EDK11984.1| peptide chain release factor 1 [Haemophilus influenzae PittII] (361 aa)
Score = 743, Expect = 9.8e-77, Identities = 164/344 (47%), Positives = 239/344 (69%)
  Q:    11 LLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGF--ISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           L S++E++ +L   L    +     +    +K   +   +V+ F  + +   +I+ AE L+    D E+ E+AQ+E+ E K  IE+ E +L++LLLPKDPND+ N  +E+R   GGDE+ IF GDLF  Y RYA+S  W +++L   ES  G GF  I  +++GE VY ++KFESG HRVQRVP TES+GR+HTS  TVAV+PEL E E+  IN +DL+IDTYR+SGAGGQH+N T+SAVRITHIPTGI V CQ+ +SQ +N+  AM +L +++ + ++E      +D+R+  +G+G+R++KIRTYNYPQ RVTDHRINLT+ +LD V+ G + E+I  +I+  +A ++
  S:    10 LESLKERYEELEALLGDVSVISDQDKFRAYSKEYSQLEEVVKCFNRWTQLNQNIEEAEILLD---DPEMKEMAQMEIEESKAEIEEVEQQLQILLLPKDPNDEYNCYLEIRAGTGGDEAGIFAGDLFRMYSRYAESKRWSMEVLSENESEQG-GFKEIIVLVSGEGVYGQLKFESGGHRVQRVPKTESQGRIHTSACTVAVMPELPESEMPEINPADLRIDTYRSSGAGGQHVNTTDSAVRITHIPTGIVVECQDERSQHKNKAKAMSVLASRIVQAEQERQAAEQTDMRRNLLGSGDRSDKIRTYNYPQGRVTDHRINLTIYRLDEVINGKIDELIQPIITEYQADQL 354
>gi|114330834|ref|YP_747056.1| peptide chain release factor 1 [Nitrosomonas eutropha C91] >gi|122314234|sp|Q0AHU1|RF1_NITEC Peptide chain release factor 1 (RF-1) >gi|114307848|gb|ABI59091.1| bacterial peptide chain release factor 1 (bRF-1) [Nitrosomonas eutropha C91] (359 aa)
Score = 743, Expect = 9.8e-77, Identities = 155/351 (44%), Positives = 234/351 (66%)
  Q:     4 NEKLYNSLLSMEEKFNDLNKELETEGLS--VKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVE-LVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           N+ + + L  +  +  +L+K L  E ++  +    ++++   E  P+   +  Y++   D+ +A ++     D +  + A+ E+   K  +   E E+   LLP+DPND++N+ +E+R   GGDES++F GDLF  Y RYA+  GW+V+++    S   GY  I   I G   YS++KFESG HRVQRVPATE++GRVHTST TVAVLPE +E+  + +N +DL+IDT+RASGAGGQHINKT+SAVRITH+PTGI   CQEG+SQ +N+  AM +L +++ +K+    +   +  RK  VG+GER+E+IRTYN+PQ R+TDHRINLTL K++ +M G L E+  +L +  +A ++
  S:     2 NKGIVDQLTRLSIRLEELDKLLSNEKITADLDNYRKLSRERSEIEPVTRFYHTYQQVEQDLATAMEM---SVDPQFRDFAEAEIDADKQKLADIETEILKQLLPRDPNDERNIFLEIRAGTGGDESALFAGDLFRMYSRYAEREGWQVEIVSQNPSEVGGYKEIIARIIGHGAYSRLKFESGAHRVQRVPATETQGRVHTSTCTVAVLPEADEISGVTLNPADLRIDTFRASGAGGQHINKTDSAVRITHLPTGIVAECQEGRSQHKNKAQAMSVLISRILDKQVRAQQAEQAAARKSLVGSGERSERIRTYNFPQGRITDHRINLTLYKIEQIMDGELDELCSTLAAEHQAAQL 353
>gi|118594305|ref|ZP_01551652.1| peptide chain release factor 1 [Methylophilales bacterium HTCC2181] >gi|118440083|gb|EAV46710.1| peptide chain release factor 1 [Methylophilales bacterium HTCC2181] (359 aa)
Score = 743, Expect = 1.0e-76, Identities = 165/345 (47%), Positives = 243/345 (70%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGLS--VKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           + N L +++ +  +LN EL +E  +  + R  +I+K   +  P+V+ ++E+ R   D++ A++++    D E+   AQ E+   K  I   E +L+ LLLPKDPND+KN+ +E+R  AGGDES++F GD+F  Y RYA+ + W+++++   ES   G+  I   + G+  YSK+KFESG HRVQRVP TE++GR+HTS  TVAVL E +E+  V IN +D++IDTYRASGAGGQHINKT+SAVRITH PTGI V CQ+ +SQ  N+  AM +L A++ + +  + +  I+  RK  +G+G+R+E+IRTYN+PQ R+TDHRINLTL K+D VM G+L+E+ID+L S  +A
  S:     5 MQNKLNALQNRLEELNDELSSEEATKDMDRYKKISKEHSDILPVVDIYQEFTRHTKDMNDAKEMLS---DPEMKSFAQDEIDANKAKIIMLEEQLQTLLLPKDPNDEKNIFLEIRAGAGGDESALFAGDIFRMYSRYAERMRWQLEVISSNESEVGGFKEIIAKVIGQGAYSKLKFESGGHRVQRVPDTETQGRIHTSACTVAVLAEADEISDVDINPADIRIDTYRASGAGGQHINKTDSAVRITHAPTGIVVECQDDRSQHRNKAQAMSILAARIKDAQINDQQSKIATERKSLIGSGDRSERIRTYNFPQGRITDHRINLTLYKIDFVMDGDLTELIDNLTSEHQA 350
>gi|157825817|ref|YP_001493537.1| peptide chain release factor 1 [Rickettsia akari str. Hartford] >gi|166223595|sp|A8GNQ4|RF1_RICAH Peptide chain release factor 1 (RF-1) >gi|157799775|gb|ABV75029.1| peptide chain release factor 1 [Rickettsia akari str. Hartford] (355 aa)
Score = 743, Expect = 1.0e-76, Identities = 164/348 (47%), Positives = 247/348 (70%)
  Q:     9 NSLLSMEEKFNDLNKELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKL-IKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVML-GNLSEIIDSLISHDEAVKMQE 356
           ++L  + +K+++L K+L + G+      + +K   E   +V K KEY +  ++++ A    ++   DN  + + + E+   +  + K E  +K+ LLPKD  D K+ I+E+R  +GG+E+++F   LF+ Y+RYA+  GW+ ++L + ++   GY   S  I G++V+SK+KFESGVHRVQRVP TES+GR+HTS  TVAVLPE EEV++ I + DL+IDTYRASGAGGQH+N T+SAVRITHIPTGI VA Q+ KSQ +N+  A+K+LRA+++E++     +  +D R+GQ+G+G+R+E+IRTYN+PQ RV+DHRINLTL K+D V+  G L E I++LI+ DEA K+ E
  S:     5 DNLAKILDKYDNLGKKLSS-GIMGDEFVKASKEYAELEDVVVKIKEYNKAKSELEEANNFKLELGFDNATLAMIEDEIHILENSLPKLERAVKIALLPKDDADSKSAIIEVRAGSGGEEAALFAAVLFNMYQRYAELKGWRFEILAISDTGIGGYKEASASIKGKDVFSKLKFESGVHRVQRVPETESQGRIHTSAATVAVLPEAEEVDIKIEDKDLRIDTYRASGAGGQHVNTTDSAVRITHIPTGITVALQDEKSQHKNKAKALKILRARIYEEERRNKEQERADSRRGQIGSGDRSERIRTYNFPQGRVSDHRINLTLYKIDEVVKNGQLDEFIEALIAEDEAKKLSE 354
>gi|46133404|ref|ZP_00157143.2| COG0216: Protein chain release factor A [Haemophilus influenzae R2866] (360 aa)
Score = 742, Expect = 1.1e-76, Identities = 164/344 (47%), Positives = 239/344 (69%)
  Q:    11 LLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGF--ISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           L S++E++ +L   L    +     +    +K   +   +V+ F  + +   +I+ AE L+    D E+ E+AQ+E+ E K  IE+ E +L++LLLPKDPND+ N  +E+R   GGDE+ IF GDLF  Y RYA+S  W +++L   ES  G GF  I  +++GE VY ++KFESG HRVQRVP TES+GR+HTS  TVAV+PEL E E+  IN +DL+IDTYR+SGAGGQH+N T+SAVRITHIPTGI V CQ+ +SQ +N+  AM +L +++ + ++E      +D+R+  +G+G+R++KIRTYNYPQ RVTDHRINLT+ +LD V+ G + E+I  +I+  +A ++
  S:     9 LESLKERYEELEALLGDVSVISDQDKFRAYSKEYSQLEEVVKCFNRWTQLNQNIEEAEILLD---DPEMKEMAQMEIEESKAEIEEVEQQLQILLLPKDPNDEYNCYLEIRAGTGGDEAGIFAGDLFRMYSRYAESKRWSMEVLSENESEQG-GFKEIIVLVSGEGVYGQLKFESGGHRVQRVPKTESQGRIHTSACTVAVMPELPESEMPEINPADLRIDTYRSSGAGGQHVNTTDSAVRITHIPTGIVVECQDERSQHKNKAKAMSVLASRIVQAEQERQAAEQTDMRRNLLGSGDRSDKIRTYNYPQGRVTDHRINLTIYRLDEVINGKIDELIQPIITEYQADQL 353
>gi|15606216|ref|NP_213594.1| peptide chain release factor RF-1 [Aquifex aeolicus VF5] >gi|6225940|sp|O67032|RF1_AQUAE Peptide chain release factor 1 (RF-1) >gi|2983407|gb|AAC06991.1| peptide chain release factor RF-1 [Aquifex aeolicus VF5] (362 aa)
Score = 742, Expect = 1.1e-76, Identities = 177/351 (50%), Positives = 254/351 (72%)
  Q:     5 EKLYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQ 355
           E   + L  ++EK+  L +EL    +   V++  +++K +KE   I E ++ YK+   ++  A++L+KS  D ++ ELA+ E++     ++K E ELKV L+PKDPND KNVI+E+R  AGG+E+++F  DLF  Y++YA+  GWKV +L   ++   GY  +  +I GE  YS++K+ESGVHRVQRVP TES GR+HTST TVAVLPE++E ++ I   +LKI+T+RASGAGGQ++N TE+AVRITHIPTGI V CQ+ +SQ +N++ A+K+L AKL +  E + ++ I+  RK QVGTGER+EKIRTYN+PQNRVTDHRINLTL KL +V+ G L EIID+L + +   K++
  S:     4 EAYISRLDKLQEKYRKLQEELSKPEVIQDVEKYKKLSKELKELQEINELYERYKKAQKELKEAKELLKSS-DKDLRELAEEEVNRLTEEMKKLEEELKVHLVPKDPNDTKNVILEIRAGAGGEEAALFAADLFRMYQKYAEEKGWKVSILSSNKTGLGGYKEVIALIEGEGAYSRLKYESGVHRVQRVPVTESSGRIHTSTATVAVLPEVDETDIKIKPEELKIETFRASGAGGQYVNTTETAVRITHIPTGIVVQCQDERSQFQNKQKALKILYAKLKDYYERKKQEEIAKERKEQVGTGERSEKIRTYNFPQNRVTDHRINLTLYKLQDVLEGKLDEIIDALRAKEIEKKLE 356
>gi|15892685|ref|NP_360399.1| peptide chain release factor 1 [Rickettsia conorii str. Malish 7] >gi|20139335|sp|Q92HK9|RF1_RICCN Peptide chain release factor 1 (RF-1) >gi|15619858|gb|AAL03300.1| peptide chain release factor RF-1 [Rickettsia conorii str. Malish 7] (355 aa)
Score = 742, Expect = 1.1e-76, Identities = 164/351 (46%), Positives = 247/351 (70%)
  Q:     6 KLYNSLLSMEEKFNDLNKELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKL-IKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVML-GNLSEIIDSLISHDEAVKMQE 356
           +  ++L  + +K+ +L  +L + G+      + +K   E   +V K KEY +  ++++ A    ++   DN  +E+ + E+   +  + K E  +K+ LLPKD  D K+ I+E+R  +GG+E+++F   LF+ Y+RYA+  GW  ++L + ++   GY   S  I G++V+SK+KFESGVHRVQRVP TES+GR+HTS  TVAVLPE EEV++ I + DL+IDTYRASGAGGQH+N T+SAVRITHIPTGI VA Q+ KSQ +N+  A+K+LRA+++E++  +  +  +D R+GQVG+G+R+E+IRTYN+PQ RV+DHRINLTL K+D V+  G L E +++LI+ DEA K+ E
  S:     2 RFSDNLAKILDKYENLGNKLSS-GIMGDEFVKASKEYAELEDVVAKIKEYNKAKSELEEANNFKLEVGLDNATLEMIEDEIYTLENSLPKLERAVKIALLPKDDADSKSAIIEVRAGSGGEEAALFAAVLFNMYQRYAELKGWHFEILAISDTGIGGYKEASASIKGKDVFSKLKFESGVHRVQRVPETESQGRIHTSAATVAVLPEAEEVDIKIEDKDLRIDTYRASGAGGQHVNTTDSAVRITHIPTGITVALQDEKSQHKNKAKALKILRARIYEEERRKKEQERADSRRGQVGSGDRSERIRTYNFPQGRVSDHRINLTLYKIDEVVKNGQLDEFVEALIADDEAKKLLE 354
>gi|92116091|ref|YP_575820.1| peptide chain release factor 1 [Nitrobacter hamburgensis X14] >gi|119361567|sp|Q1QQY7|RF1_NITHX Peptide chain release factor 1 (RF-1) >gi|91798985|gb|ABE61360.1| bacterial peptide chain release factor 1 (bRF-1) [Nitrobacter hamburgensis X14] (361 aa)
Score = 742, Expect = 1.2e-76, Identities = 157/334 (47%), Positives = 227/334 (67%)
  Q:    21 LNKELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKS-EKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGN-LSEIIDSLISHDEAVKM 354
           L  EL ++ +S +R  ++ + + E  P+VE  K ++    +I   + +I     D E+  +A+ E        ++   +++V LLPKD  D++NV++E+R   GGDE+S+F GDLF  Y+R+A   GWKV+ +   E + G Y  I   + G   Y+K+KFESGVHRVQRVP TE++GRVHTS  TVAVLPE EEV++ I   DL+I+T RA GAGGQH+NKTESA+RITHIPTGI V  Q+ +SQ +NR +AM +LR+++++ + +      S  RK QVG+G+R+E+IRTYN+PQ RVTDHRINLTL KL  V+ G+ L E+ID+L +  +A ++
  S:    19 LENELLSQ-ISAERYVQMTRELSELNPVVEAVKNWRAVKTEIAGIDAMIADPATDAEMRAMAEAERPALGARGDELAQKIRVALLPKDAMDERNVMLEIRAGTGGDEASLFAGDLFRMYERFAGLQGWKVEAISASEGTMGGYKEIVAEVRGRGAYAKLKFESGVHRVQRVPDTETQGRVHTSAATVAVLPEAEEVDVDIKTDDLRIETMRAQGAGGQHVNKTESAIRITHIPTGIVVMMQDSRSQHKNRASAMNILRSRIYDAERQRINAARSADRKDQVGSGDRSERIRTYNFPQGRVTDHRINLTLYKLPQVIAGDALHELIDALTTEHQAAQL 354
>gi|167471826|ref|ZP_02336530.1| peptide chain release factor 1 [Rickettsia africae ESF-5] (355 aa)
Score = 742, Expect = 1.3e-76, Identities = 164/351 (46%), Positives = 247/351 (70%)
  Q:     6 KLYNSLLSMEEKFNDLNKELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKL-IKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVML-GNLSEIIDSLISHDEAVKMQE 356
           +  ++L  + +K+ +L  +L + G+      + +K   E   +V K KEY +  ++++ A    ++   DN  +E+ + E+   +  + K E  +K+ LLPKD  D K+ I+E+R  +GG+E+++F   LF+ Y+RYA+  GW+ ++L + ++   GY   S  I G++V+SK+KFESGVHRVQRVP TES+GR+HTS  TVAVLPE EEV++ I + DL+IDTYRASGAGGQH+N T+SAVRITHIPTGI VA Q+ KSQ +N+  A+K+LRA+++E++  +  +  +D R+GQVG+G R+E+IRTYN+PQ RV+DHRINLTL K+D V+  G L E +++LI+ DEA K+ E
  S:     2 RFSDNLAKILDKYENLGNKLSS-GIMGDEFVKASKEYAELEDVVAKIKEYNKAKSELEEANNFKLEVGLDNATLEMIEDEIYTLENSLPKLERAVKIALLPKDDADSKSAIIEVRAGSGGEEAALFAAVLFNMYQRYAELKGWRFEILAISDTGIGGYKEASASIKGKDVFSKLKFESGVHRVQRVPETESQGRIHTSAATVAVLPEAEEVDIKIEDKDLRIDTYRASGAGGQHVNTTDSAVRITHIPTGITVALQDEKSQHKNKAKALKILRARIYEEERRKKEQERADSRRGQVGSGNRSERIRTYNFPQGRVSDHRINLTLYKIDEVVKNGQLDEFVEALIADDEAKKLLE 354
>gi|114569197|ref|YP_755877.1| peptide chain release factor 1 [Maricaulis maris MCS10] >gi|119361557|sp|Q0ARZ8|RF1_MARMM Peptide chain release factor 1 (RF-1) >gi|114339659|gb|ABI64939.1| bacterial peptide chain release factor 1 (bRF-1) [Maricaulis maris MCS10] (357 aa)
Score = 742, Expect = 1.3e-76, Identities = 149/339 (43%), Positives = 234/339 (69%)
  Q:    16 EKFNDLNKELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGN-LSEIIDSLISHDEAVKM 354
           ++F+ +   L   G     + +++K   E  P+ EK    K    ++    ++++ + D E+ E+A+ E    K  + + E+ + ++LLPKD +D  N ++E+R   GGDE++IF G+L+  Y+RYA   GW  +++   E  HG Y  +   I+G  V+ ++KFESGVHRVQRVPATES+GR+HTS  TVA++P+ E++++ ++  D+++DT RASGAGGQH+NKT+SAVR+THIPTG+ V CQE KSQ +NR  A ++L+AKL++ + E      +  RKGQ+G+G+R+E+IRTYNYPQ RV+DHRINLTL KLD+++ G+ L E++ +LI+ D+A ++
  S:    13 DRFDQVEARLGAAG-DADEIVKLSKEHAELKPVAEKANALKSARAELAELAEMMEGD-DAEMAEMAREEFYALKERLPELEHAMSLMLLPKDKDDSANAMIEIRAGTGGDEAAIFAGNLYGMYQRYAQLQGWSWELVSASEGEHGGYKEVVAAISGNGVFGRLKFESGVHRVQRVPATESQGRIHTSAATVAIMPQPEDIDIELDMGDVRVDTMRASGAGGQHVNKTDSAVRMTHIPTGLVVVCQE-KSQHQNRARAQEILKAKLYDMQREAANAERAAERKGQIGSGDRSERIRTYNYPQGRVSDHRINLTLYKLDDIVAGDGLDEVVAALIAEDQAARL 350
>gi|17982074|gb|AAL51373.1| Bacterial Peptide Chain Release Factor 1 (RF-1) [Brucella melitensis 16M] (377 aa)
Score = 742, Expect = 1.4e-76, Identities = 154/286 (53%), Positives = 207/286 (72%)
  Q:    71 SEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQE-SSHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           +  D E+  LA  EL E +  I   E ++++LLLPKD  DDKN I+E+R   GG E+++F GDLF  Y+RYA   GW+V+++   E  + GY  I   ++G+ V+SK+KFESGVHRVQRVP TE+ GR+HTS  TVAVLPE E++++ I N D++IDT RASGAGGQH+N T+SAVRITHIPTGI V  Q  KSQ +NR  AM++LRA+L++ + ++     S  R+ QVG+G+R+E+IRTYN+PQ RVTDHRINLTL KLD VM G L E++D+LIS  +   + E
  S:    87 ASTDAEMRALAVEELPEVEKRIAVLEQDVQILLLPKDAADDKNAILEIRAGTGGLEAALFAGDLFRMYERYAAEKGWRVELVSASEGDAGGYKEIIATVSGKGVFSKLKFESGVHRVQRVPETEAGGRIHTSAATVAVLPEAEDIDIEIRNEDIRIDTMRASGAGGQHVNTTDSAVRITHIPTGIMVV-QAEKSQHQNRARAMQILRARLYDMERQKAESERSQARRSQVGSGDRSERIRTYNFPQGRVTDHRINLTLYKLDRVMEGELDELVDALISDHQTALLAE 372
>gi|83953606|ref|ZP_00962327.1| peptide chain release factor 1 [Sulfitobacter sp. NAS-14.1] >gi|83841551|gb|EAP80720.1| peptide chain release factor 1 [Sulfitobacter sp. NAS-14.1] (351 aa)
Score = 742, Expect = 1.4e-76, Identities = 159/348 (45%), Positives = 238/348 (68%)
  Q:     9 NSLLSMEEKFNDLNKELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           + L  + ++F  L   + + G      +++ K   +  P+VE+   Y++ L D+D A  ++K   D E+ ELA+ EL   K  + + E +L++ LLP+D  D K  ++E+RP  GGDE+++F  DL   Y+RYA++ GWK +++E Q +   G   +   I GENV++++K+ESGVHRVQRVP+TES GR+HTS  TVAVLPE E+V++ I+ +DL+IDT R+SGAGGQH+N T+SAVRITH+PTG+ V   E KSQ  NRE AM++L+A+L++ + +      S  R  QVG+G+R+E+IRTYN+PQ R+TDHRINLTL +L+ VM G+L EI+D+L +  +A  + E
  S:     5 DRLAQITQRFQFLEASM-SAGSDGADFAKLAKEYADLRPVVEQIDAYRQLLQDMDDARAMLK---DTEMAELAEEELPRLKAALPQAEADLQLALLPRDEADKKPAMLEIRPGTGGDEAALFAADLLRMYQRYAEARGWKFELIEQQFTELGGVKEVVAHIKGENVFARLKYESGVHRVQRVPSTESGGRIHTSAATVAVLPEAEDVDIHIDANDLRIDTMRSSGAGGQHVNTTDSAVRITHLPTGLVVTSSE-KSQHRNREIAMQVLKARLYDMERQRVDSERSASRAAQVGSGDRSERIRTYNFPQGRLTDHRINLTLYRLEAVMQGDLDEIVDALTADAQAQLLAE 348
>gi|73667064|ref|YP_303080.1| peptide chain release factor 1 [Ehrlichia canis str. Jake] >gi|119361538|sp|Q3YS23|RF1_EHRCJ Peptide chain release factor 1 (RF-1) >gi|72394205|gb|AAZ68482.1| bacterial peptide chain release factor 1 (bRF-1) [Ehrlichia canis str. Jake] (359 aa)
Score = 742, Expect = 1.4e-76, Identities = 167/351 (47%), Positives = 245/351 (69%)
  Q:     9 NSLLSMEEKFNDLNKELETEG-LSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKS-EKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGF---ISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVML-GNLSEIIDSLISHDEAVKMQEAKI 359
           ++L  + +KF  L   LE    LSV      +K   E  P++    +Y     DI   E+LI + E D+E+  LA+ E  E++  + K + +LK+ L+PKD +D +N I+E+R   GG+E+++FV DL+  Y +YA+   WK +  ++  SS G G    +S  I+G NV++++KFESGVHRVQRVP TE+ GR+HTS  TVAVLPE+EEV+L I+  DL+ID YR+SG GGQ +N T+SAVRITHIP+GI V  Q+ KSQ +N+  A+K+LRA+L+  ++++    IS +RK Q+G+G+R+E+IRTYN+PQ+R+TDHRINLTL +L+++M  GNL E ID+LI+ DEA K++   I
  S:     5 SNLEELYQKFCKLKSILEDPSQLSVDSFVAASKEYSELLPVISVIDQYNSLQKDIADLEELINNPETDHELKSLAKEEFYERQKQLPKIKNKLKLSLIPKDRDDARNAILEIRAGTGGEEAALFVTDLYRMYTKYAEQKNWKFE--QINSSSTGIGGHKEVSLCISGSNVFARLKFESGVHRVQRVPETEASGRLHTSAATVAVLPEIEEVDLKIDEKDLRIDVYRSSGPGGQSVNTTDSAVRITHIPSGIVVIQQDEKSQHKNKNKALKVLRARLYNLEKQKRDSEISQMRKSQIGSGDRSERIRTYNFPQSRITDHRINLTLYRLEDIMKEGNLDEFIDALIAEDEANKLKNLHI 359
>gi|88606704|ref|YP_505023.1| peptide chain release factor 1 [Anaplasma phagocytophilum HZ] >gi|119361507|sp|Q2GKS8|RF1_ANAPZ Peptide chain release factor 1 (RF-1) >gi|88597767|gb|ABD43237.1| peptide chain release factor 1 [Anaplasma phagocytophilum HZ] (359 aa)
Score = 741, Expect = 1.5e-76, Identities = 163/341 (47%), Positives = 242/341 (70%)
  Q:    16 EKFNDLNKELET-EGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKS-EKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVML-GNLSEIIDSLISHDEAVKMQE 356
           EKF  L ++L   E L  +     ++   +  PI+   ++YK T  +I   E+L+ S   D E+  LA+ E   K+ L+ K  +EL++ LLPKD +D +N I+E+R   GG+E+++FVG+L+  Y +YA+   WKV+ + +  +   GY   SF I G++V++++KFESGVHRVQRVP TES GR+HTS  TVAVLPE+EEV+L I+  DL+ID YR+SG GGQ +N T+SAVRITHIPTGI V  Q+ KSQ +N+  A+K+LRA+L+  ++++  + IS +RK Q+G+G+R+E+IRTYN+ Q+R+TDHRINLT  +LD VM  G+L E ID+L++ D+A K+++
  S:    12 EKFRILKQQLSAPETLGTQAFVVASREYSDLLPIMSLIEKYKSTQKEIAELEELVNSASTDPELRSLAKDESHIKQKLLPKLRHELQLSLLPKDRDDSRNAILEIRAGTGGEEAALFVGNLYRMYLKYAERKNWKVETINISTTGIGGYKEASFSIGGKDVFARLKFESGVHRVQRVPETESSGRLHTSAATVAVLPEVEEVDLKIDEKDLRIDVYRSSGPGGQSVNTTDSAVRITHIPTGIVVIQQDEKSQHKNKSKALKVLRARLYNLEKQKREEEISKMRKSQIGSGDRSERIRTYNFLQSRITDHRINLTSYRLDYVMKEGDLDEFIDALVADDQANKLKQ 356
>gi|157828568|ref|YP_001494810.1| peptide chain release factor 1 [Rickettsia rickettsii str. 'Sheila Smith'] >gi|165933282|ref|YP_001650071.1| peptide chain release factor 1 [Rickettsia rickettsii str. Iowa] >gi|166223598|sp|A8GSC7|RF1_RICRS Peptide chain release factor 1 (RF-1) >gi|189039987|sp|B0BXT9|RF1_RICRO Peptide chain release factor 1 (RF-1) >gi|157801049|gb|ABV76302.1| peptide chain release factor 1 [Rickettsia rickettsii str. 'Sheila Smith'] >gi|165908369|gb|ABY72665.1| bacterial peptide chain release factor 1 (RF-1) [Rickettsia rickettsii str. Iowa] (355 aa)
Score = 741, Expect = 1.5e-76, Identities = 163/351 (46%), Positives = 248/351 (70%)
  Q:     6 KLYNSLLSMEEKFNDLNKELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKL-IKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVML-GNLSEIIDSLISHDEAVKMQE 356
           +  ++L  + +K+ +L  +L + G+      + +K   E   +V K KEY +  ++++ A    ++   DN  +E+ + E+   +  + K E  +K+ LLPKD  D K+ I+E+R  +GG+E+++F   LF+ Y+RYA+  GW+ ++L + ++   GY   S  I G++V+SK+KFESGVHRVQRVP TES+GR+HTS  TVAVLPE EEV++ I + DL+IDTYRASGAGGQH+N T+SAVRITHIPTGI VA Q+ KSQ +N+  A+K+LRA+++E++  +  +  +D R+GQVG+G+R+E+IRTYN+PQ RV+DHRI+LTL K+D V+  G L E +++LI+ DEA K+ E
  S:     2 RFSDNLAKILDKYENLGNKLSS-GIMGDEFVKASKEYAELEDVVAKIKEYNKAKSELEEANNFKLEVGLDNATLEMIEDEIYTLENSLPKLERAVKIALLPKDDADSKSAIIEVRAGSGGEEAALFAAVLFNMYQRYAELKGWRFEILAISDTGIGGYKEASASIKGKDVFSKLKFESGVHRVQRVPETESQGRIHTSAATVAVLPEAEEVDIKIEDKDLRIDTYRASGAGGQHVNTTDSAVRITHIPTGITVALQDEKSQHKNKAKALKILRARIYEEERRKKEQARADSRRGQVGSGDRSERIRTYNFPQGRVSDHRIHLTLYKIDEVVKNGQLDEFVEALIADDEAKKLLE 354
>gi|57239178|ref|YP_180314.1| peptide chain release factor 1 [Ehrlichia ruminantium str. Welgevonden] >gi|58579136|ref|YP_197348.1| peptide chain release factor 1 [Ehrlichia ruminantium str. Welgevonden] >gi|58617189|ref|YP_196388.1| peptide chain release factor 1 [Ehrlichia ruminantium str. Gardel] >gi|75432752|sp|Q5FGZ2|RF1_EHRRG Peptide chain release factor 1 (RF-1) >gi|81557311|sp|Q5HB80|RF1_EHRRW Peptide chain release factor 1 (RF-1) >gi|57161257|emb|CAH58178.1| peptide release factor 1 [Ehrlichia ruminantium str. Welgevonden] >gi|58416801|emb|CAI27914.1| Peptide chain release factor 1 (RF-1) [Ehrlichia ruminantium str. Gardel] >gi|58417762|emb|CAI26966.1| Peptide chain release factor 1 (RF-1) [Ehrlichia ruminantium str. Welgevonden] (359 aa)
Score = 741, Expect = 1.6e-76, Identities = 169/351 (48%), Positives = 247/351 (70%)
  Q:     9 NSLLSMEEKFNDLNKELETEG-LSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKS-EKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGF---ISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVML-GNLSEIIDSLISHDEAVKMQEAKI 359
           + L  + EKF  L   LE    LSV+     +K   E  PI+    EY     DI   ++LI + E D E+  LA+ E  E +  + K +++LK+ LLPKD +D +N I+E+R   GG+E+++FV DL+  Y +YA+   WK++  ++  SS G G    +S  ++G NV++K+KFESGVHRVQRVP TE+ GR+HTS  TVAVLPE+EEV+L I+  DL+ID YR+SG GGQ +N T+SAVRITHIP+GI V  Q+ KSQ +N+  A+K+LRA+L++ ++++    IS LRK Q+G+G+R+E+IRTYN+PQ+R+TDHRINLTL +L+++M  G+L E+I++LI+ DEA K++   I
  S:     5 SGLEELSEKFYKLKHLLEDPSQLSVESFVNASKEYSELLPIISVIDEYNAVQKDIKDLQELINNQETDTELKNLAKEEFYELQKQLPKVKHKLKLSLLPKDKDDARNAILEIRAGTGGEEAALFVTDLYRMYIKYAEKKNWKIE--QINSSSTGIGGHKEVSLCVSGSNVFAKLKFESGVHRVQRVPETEASGRLHTSAATVAVLPEIEEVDLKIDEKDLRIDVYRSSGPGGQSVNTTDSAVRITHIPSGIVVIQQDEKSQHKNKNKALKVLRARLYDLEKQKRDAEISQLRKSQIGSGDRSERIRTYNFPQSRITDHRINLTLYRLEDIMKEGDLDELIEALIAEDEANKLKNLNI 359
>gi|90022891|ref|YP_528718.1| peptide chain release factor 1 [Saccharophagus degradans 2-40] >gi|119361599|sp|Q21FM3|RF1_SACD2 Peptide chain release factor 1 (RF-1) >gi|89952491|gb|ABD82506.1| bacterial peptide chain release factor 1 (bRF-1) [Saccharophagus degradans 2-40] (360 aa)
Score = 741, Expect = 1.7e-76, Identities = 170/344 (49%), Positives = 236/344 (68%)
  Q:    11 LLSMEEKFNDLNKELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEV-ELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           ++S ++KF DL +E                   E  P+++ + EY   L +I  A+ LI S+ D ++  + Q EL E +  +E  E EL+ LLLPKDPND KNV +E+R   GGDE++IF GDLF  Y RYA+S GWKV+++   +  HG Y  I   + G+ VYS++KFESG HRVQRVP TES+GR+HTS  TVAV+PE +E+ E+ IN +DL+IDT+RASGAGGQH+NKT+SA+R+THIPTG+ V CQ+ +SQ +NR  AM +L ++L   +EE+     +  RK  VG+G+R+E+IRTYN+PQ RVTDHRINLTL KLD VM G L ++I  L++  +A ++
  S:    28 VISNQDKFRDLGREY-----------------AELEPVIKCYNEYNTVLGNIAEAKVLI-SDSDPDMRAMGQDELKENEAALEPLELELQKLLLPKDPNDGKNVFLEIRAGTGGDEAAIFSGDLFRMYSRYAESKGWKVEIISENQGEHGGYKEIITRVVGQGVYSELKFESGAHRVQRVPETESQGRIHTSACTVAVMPEADEMAEVNINKADLRIDTFRASGAGGQHVNKTDSAIRLTHIPTGVVVECQDERSQHKNRAKAMSLLASRLSMAQEEKAAAEQASARKSLVGSGDRSERIRTYNFPQGRVTDHRINLTLYKLDEVMQGALGDVIQPLVNEYQADQL 355
>gi|153093888|gb|EDN74816.1| peptide chain release factor RF1 [Mannheimia haemolytica PHL213] (360 aa)
Score = 741, Expect = 1.8e-76, Identities = 162/350 (46%), Positives = 234/350 (66%)
  Q:     5 EKLYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           + + N L S+ E+  +L   L    +     +    +K   +   +V  F  +K+  NDI+ A+ L+    D ++ ++A  E++E K  IE  E  L++LLLPKDPND+ N  +E+R   GGDE+ IF GDL+  Y RY +S  W+++ +   ES  G Y  I   I+GE VY ++KFESG HRVQRVP TES+GR+HTS  TVAV+PEL E E+  IN SDL+IDTYR+SGAGGQH+N T+SAVRITHIPTGI V CQ+ +SQ +N+  A+ +L +++ + ++E      +D R+  +G+G+R++KIRTYNYPQ RVTDHRINLT+ +LD VM G + E+I  +I+  +A ++
  S:     3 DSIINKLESLSERHEELQALLGDASIISDQDKFRAYSKEYSQLEEVVGTFNRWKKLNNDIEEAQLLLD---DPDMKDMAAEEIAENKAEIENLEQHLQILLLPKDPNDEYNAFLEIRAGTGGDEAGIFAGDLYRMYSRYCESKRWRIEEMSANESEQGGYKEIIVKISGEGVYGQLKFESGGHRVQRVPKTESQGRIHTSACTVAVMPELPESEMPEINPSDLRIDTYRSSGAGGQHVNTTDSAVRITHIPTGIVVECQDERSQHKNKAKALAVLASRIVQVEQERQAAEQADTRRNLLGSGDRSDKIRTYNYPQGRVTDHRINLTVYRLDEVMNGKIDELIQPIITEYQADQL 353
>gi|86148712|ref|ZP_01066989.1| peptide chain release factor 1 [Vibrio sp. MED222] >gi|85833505|gb|EAQ51686.1| peptide chain release factor 1 [Vibrio sp. MED222] (362 aa)
Score = 741, Expect = 1.8e-76, Identities = 151/321 (47%), Positives = 227/321 (70%)
  Q:    34 RMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGFISFM--INGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           +   ++K   +   +   FK Y++   D+++AE++  +E D E+ E+AQ E+ + K  IE+   EL++LL+PKDPND++N  +E+R  AGGDE+ IF G+LF  Y ++A+  GW+V+++    S  G GF   +  I+G+ VY  MKFESG HRVQRVP TES+GRVHTS  TVAV+PE+ E +L  I   DLKIDT+RASGAGGQH+N T+SA+RITH+PTG  V CQ+ +SQ +N+  AM +L A++ + +EE     ISD R+  +G+G+R+++IRTYNYPQ RV+DHRINLT+ +L+ V+ G++  ++D ++   +A ++
  S:    34 KFRALSKEYSQLEEVTGCFKSYQQAQEDLEAAEEM-ANEDDAEMREMAQEEIKDAKANIERLTDELQILLIPKDPNDERNCFLEIRAGAGGDEAGIFAGNLFRMYSKFAEKKGWRVEVMSSNVSEQG-GFKEMIAKISGDAVYGTMKFESGGHRVQRVPETESQGRVHTSACTVAVMPEIPEADLPEIKAGDLKIDTFRASGAGGQHVNTTDSAIRITHLPTGTVVECQDERSQHKNKAKAMAVLAARIVQAEEERRAAAISDTRRNLLGSGDRSDRIRTYNYPQGRVSDHRINLTIYRLNEVLEGDMQSLLDPVLQEHQADQL 355
>gi|23502722|ref|NP_698849.1| peptide chain release factor 1 [Brucella suis 1330] >gi|161619787|ref|YP_001593674.1| peptide chain release factor 1 [Brucella canis ATCC 23365] >gi|189039960|sp|A9M8K5|RF1_BRUC2 Peptide chain release factor 1 (RF-1) >gi|32171563|sp|Q8FYK3|RF1_BRUSU Peptide chain release factor 1 (RF-1) >gi|23348737|gb|AAN30764.1| peptide chain release factor 1 [Brucella suis 1330] >gi|161336598|gb|ABX62903.1| peptide chain release factor 1 [Brucella canis ATCC 23365] (359 aa)
Score = 741, Expect = 1.8e-76, Identities = 154/286 (53%), Positives = 208/286 (72%)
  Q:    71 SEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQE-SSHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           +  D E+  LA  EL E +  I   E ++++LLLPKD  DDKN I+E+R   GG E+++F GDLF  Y+RYA   GW+V+++   E  + GY  I   ++G+ V+SK+KFESGVHRVQRVP TE+ GR+HTS  TVAVLPE E++++ I N D++IDT RASGAGGQH+N T+SAVRITHIPTGI V  Q  KSQ +NR  AM++LRA+L++ + ++     S  R+ QVG+G+R+E+IRTYN+PQ RVTDHRINLTL KLD VM G+L E++D+LIS  +   + E
  S:    69 ASTDAEMRALAVEELPEVEKRIAVLEQDVQILLLPKDAADDKNAILEIRAGTGGLEAALFAGDLFRMYERYAAEKGWRVELVSASEGDAGGYKEIIATVSGKGVFSKLKFESGVHRVQRVPETEAGGRIHTSAATVAVLPEAEDIDIEIRNEDIRIDTMRASGAGGQHVNTTDSAVRITHIPTGIMVV-QAEKSQHQNRARAMQILRARLYDMERQKAESERSQARRSQVGSGDRSERIRTYNFPQGRVTDHRINLTLYKLDRVMEGDLDELVDALISDHQTALLAE 354
>gi|148653259|ref|YP_001280352.1| peptide chain release factor 1 [Psychrobacter sp. PRwf-1] >gi|172048528|sp|A5WFG1|RF1_PSYWF Peptide chain release factor 1 (RF-1) >gi|148572343|gb|ABQ94402.1| bacterial peptide chain release factor 1 (bRF-1) [Psychrobacter sp. PRwf-1] (364 aa)
Score = 740, Expect = 1.9e-76, Identities = 152/318 (47%), Positives = 219/318 (68%)
  Q:    34 RMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           +  E++    E + I   ++ Y++   D   A+++I    D ++ E+ Q E+      IE  E EL V++LPKDPND     +E+R   GGDE++IF GDLF  Y+RYA S GW +++L   E  HG Y  I   ++G +VY ++KFESG HRVQRVP TES+GRVHTS  TVAV+PE+E  + V +N +D+++DT+R+SGAGGQH+N T+SAVR+THIPTG+   CQ+ +SQ +NR  AM+ML A++ + K +E       LR+  VG+G+R+E+IRTYN+PQ R+TDHRINLTL KLD +M G+L+E++D+L    +A
  S:    34 KFRELSMEHSELSEITALWQRYRQAEIDKKDAQEMINDASDPDMKEMMQEEIDSASRDIEAMEEELNVMMLPKDPNDKVPAFLEIRAGTGGDEAAIFSGDLFRMYERYASSQGWTIEVLSANEGEHGGYKEIISRVSGNDVYGRLKFESGAHRVQRVPETESQGRVHTSACTVAVMPEVEIDDTVELNPADIRMDTFRSSGAGGQHVNTTDSAVRLTHIPTGVVAECQQERSQHKNRAKAMQMLIARIQQAKVQEQVDTADALRRNLVGSGDRSERIRTYNFPQGRMTDHRINLTLYKLDAIMEGDLTELLDALNREHQA 353
>gi|188587462|ref|YP_001919007.1| peptide chain release factor 1 (bRF-1) [Natranaerobius thermophilus JW/NM-WN-LF] >gi|179352149|gb|ACB86419.1| peptide chain release factor 1 (bRF-1) [Natranaerobius thermophilus JW/NM-WN-LF] (357 aa)
Score = 740, Expect = 1.9e-76, Identities = 161/350 (46%), Positives = 261/350 (74%)
  Q:     7 LYNSLLSMEEKFNDL-----NKELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIK-SEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           + + L  +E+++ +L     + E+  +   +K+ S+ + S++E   IV K+++Y  T  + + A+++++ +++D ++ E  + E+   +  +++    LK+LLLPKDPND+KNVIVE+R  AGGDE+++F  DL+  Y RYA+ + WK ++++  E   G +  I FMI G+N YS++KFESGVHRVQRVP+TES GR+HTST TVAVLPE E+VE+ I+ ++L+IDT+ A+G GGQ +N T+SAVRITH PTG+ V+CQ+ KSQ +NR+ AMK+LRA++++   EE ++  ++ RK QVG+G+R+E+IRTYN+PQ R+TDHRIN T ++L+ V+ G + E+ID+LI+ ++A ++++
  S:     1 MLDKLEGIEKRYQELEDLMSDPEVINDPEKLKQYSKEHASLEE---IVNKYRQYLETKQEFEEAKEMLEENDEDPDMEEFLKDEIPRLENQMQEIYDSLKILLLPKDPNDEKNVIVEIRAGAGGDEAALFAADLYRMYTRYAEIMNWKTEIMDSHEKDMGGFKEIVFMIEGKNAYSRLKFESGVHRVQRVPSTESSGRIHTSTATVAVLPEAEDVEIEIDTNELRIDTFCATGPGGQSVNTTQSAVRITHEPTGVVVSCQDEKSQHKNRDKAMKVLRARIYDMYLEEQQQQEAEERKSQVGSGDRSERIRTYNFPQGRITDHRINFTTHRLEQVLEGEIDELIDALITTEQAEQLKK 354
>gi|146311983|ref|YP_001177057.1| peptide chain release factor 1 [Enterobacter sp. 638] >gi|166977363|sp|A4WBC6|RF1_ENT38 Peptide chain release factor 1 (RF-1) >gi|145318859|gb|ABP61006.1| bacterial peptide chain release factor 1 (bRF-1) [Enterobacter sp. 638] (360 aa)
Score = 740, Expect = 1.9e-76, Identities = 147/321 (45%), Positives = 226/321 (70%)
  Q:    34 RMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           R   +++   + + +   F ++++   DI++A+ ++    D E+ E+AQ EL E K   E+ E +L+VLLLPKDP+D++N  VE+R   GGDE+++F GDLF  Y RYA+S  W+V+++   E  HG Y  +   I+GE VY ++KFESG HRVQRVPATES+GR+HTS  TVAV+PE+ E EL  IN  DL+IDT+R+SGAGGQH+N T+SA+RITH+PTGI V CQ+ +SQ +N+  A+ +L +++   +  + ++  +  R+  +G+G+R+++ RTYN+PQ RVTDHRINLT+ +LD +M G L  +I+ ++   +A ++
  S:    34 RFRALSREYAQLSDVSRCFTDWQQVQEDIETAQMMLD---DPEMREMAQEELQEAKARAEEMEQQLQVLLLPKDPDDERNAFVEVRAGTGGDEAALFAGDLFRMYSRYAESRRWRVEIMSANEGEHGGYKEVIAKISGEGVYGRLKFESGGHRVQRVPATESQGRIHTSACTVAVMPEVPEAELPDINPGDLRIDTFRSSGAGGQHVNTTDSAIRITHLPTGIVVECQDERSQHKNKAKALSVLGSRIRAAEIAKRQQAEASTRRNLLGSGDRSDRNRTYNFPQGRVTDHRINLTIYRLDEIMEGKLDSLIEPIVQEYQADQL 353
>gi|62290730|ref|YP_222523.1| peptide chain release factor 1 [Brucella abortus bv. 1 str. 9-941] >gi|82700642|ref|YP_415216.1| peptide chain release factor 1 [Brucella melitensis biovar Abortus 2308] >gi|189024940|ref|YP_001935708.1| Class I peptide chain release factor domain protein [Brucella abortus S19] >gi|75496230|sp|Q57B22|RF1_BRUAB Peptide chain release factor 1 (RF-1) >gi|119361513|sp|Q2YLN8|RF1_BRUA2 Peptide chain release factor 1 (RF-1) >gi|62196862|gb|AAX75162.1| PrfA, peptide chain release factor 1 [Brucella abortus biovar 1 str. 9-941] >gi|82616743|emb|CAJ11828.1| Class I peptide chain release factor domain:Peptide chain release factor 1:PCRF domain [Brucella melitensis biovar Abortus 2308] >gi|189020512|gb|ACD73234.1| Class I peptide chain release factor domain protein [Brucella abortus S19] (359 aa)
Score = 740, Expect = 1.9e-76, Identities = 154/286 (53%), Positives = 208/286 (72%)
  Q:    71 SEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQE-SSHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           +  D E+  LA  EL E +  I   E ++++LLLPKD  DDKN I+E+R   GG E+++F GDLF  Y+RYA   GW+V+++   E  + GY  I   ++G+ V+SK+KFESGVHRVQRVP TE+ GR+HTS  TVAVLPE E++++ I N D++IDT RASGAGGQH+N T+SAVRITHIPTGI V  Q  KSQ +NR  AM++LRA+L++ + ++     S  R+ QVG+G+R+E+IRTYN+PQ RVTDHRINLTL KLD VM G+L E++D+LIS  +   + E
  S:    69 ASTDAEMRALAVEELPEVEKRIAVLEQDVQILLLPKDAADDKNAILEIRAGTGGLEATLFAGDLFRMYERYAAEKGWRVELVSASEGDAGGYKEIIATVSGKGVFSKLKFESGVHRVQRVPETEAGGRIHTSAATVAVLPEAEDIDIEIRNEDIRIDTMRASGAGGQHVNTTDSAVRITHIPTGIMVV-QAEKSQHQNRARAMQILRARLYDMERQKAESERSQARRSQVGSGDRSERIRTYNFPQGRVTDHRINLTLYKLDRVMEGDLDELVDALISDHQTALLAE 354
>gi|148377997|ref|YP_001256873.1| peptide chain release factor 1 [Mycoplasma agalactiae PG2] >gi|148292043|emb|CAL59435.1| Peptide chain release factor 1 [Mycoplasma agalactiae PG2] (358 aa)
Score = 740, Expect = 2.0e-76, Identities = 170/353 (48%), Positives = 255/353 (72%)
  Q:     5 EKLYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSH-GYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEE-VELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQEA 357
           + ++ SL  +++ + +L K+++   +  ++K  S INK I +   I EKF  Y+  L D++ A+ +++S K+ E +E A++ + E    +++ E +LK+L+LP+D NDDKN+IVE+R AAGGDE++IF GDLF  Y ++AD LG+++K+L    +S  G+  I F I GE  YSK KFESGVHRVQRVP TES+GR+HTST TV V+PE+++ VE+ I  SDLKID +R+SGAGGQ +N T+SAVRITH+PT I V  Q+ +SQI NRETA+ +L++KL++ + ++  +  S  RK   G G+R+EKIRTYNYPQ+RVTDHRI+ +   L  +M G L+ IID+L++ ++  K++E+
  S:     3 KTMFKSLSEIKQSYLELLKKIDDPEVISNIKEYSAINKEIAKIREISEKFITYENILKDVEQAKIMLES-KNEEEVEFAKMIIDENSLKLDELEEKLKILILPQDENDDKNIIVEIRGAAGGDEANIFAGDLFRMYSKFADELGFRLKILSTNSASAGGFSQIVFSIKGEKAYSKFKFESGVHRVQRVPVTESQGRIHTSTTTVTVMPEIDDSVEIEIKPSDLKIDVFRSSGAGGQSVNTTDSAVRITHLPTNIVVTSQDERSQIANRETALTILKSKLYDLEMQKKAEEESGYRK-LAGHGDRSEKIRTYNYPQDRVTDHRISFS-TSLKPIMEGKLTPIIDALLAEEQNQKIKES 356
>gi|163843895|ref|YP_001628299.1| peptide chain release factor 1 [Brucella suis ATCC 23445] >gi|189039961|sp|B0CIC3|RF1_BRUSI Peptide chain release factor 1 (RF-1) >gi|163674618|gb|ABY38729.1| peptide chain release factor 1 [Brucella suis ATCC 23445] (359 aa)
Score = 740, Expect = 2.0e-76, Identities = 154/286 (53%), Positives = 208/286 (72%)
  Q:    71 SEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQE-SSHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           +  D E+  LA  EL E +  I   E ++++LLLPKD  DDKN I+E+R   GG E+++F GDLF  Y+RYA   GW+V+++   E  + GY  I   ++G+ V+SK+KFESGVHRVQRVP TE+ GR+HTS  TVAVLPE E++++ I N D++IDT RASGAGGQH+N T+SAVRITHIPTGI V  Q  KSQ +NR  AM++LRA+L++ + ++     S  R+ QVG+G+R+E+IRTYN+PQ RVTDHRINLTL KLD VM G+L E++D+LIS  +   + E
  S:    69 ASTDAEMRALAVEELPEVEKRIAVLEQDVQILLLPKDAADDKNAILEIRAGTGGLEAALFAGDLFRMYERYAAEKGWRVELVSASEGDAGGYKEIITTVSGKGVFSKLKFESGVHRVQRVPETEAGGRIHTSAATVAVLPEAEDIDIEIRNEDIRIDTMRASGAGGQHVNTTDSAVRITHIPTGIMVV-QAEKSQHQNRARAMQILRARLYDMERQKAESERSQARRSQVGSGDRSERIRTYNFPQGRVTDHRINLTLYKLDRVMEGDLDELVDALISDHQTALLAE 354
>gi|126209498|ref|YP_001054723.1| peptide chain release factor 1 [Actinobacillus pleuropneumoniae L20] >gi|126098290|gb|ABN75118.1| Peptide chain release factor 1 (RF-1) [Actinobacillus pleuropneumoniae L20] (333 aa)
Score = 740, Expect = 2.0e-76, Identities = 155/316 (49%), Positives = 221/316 (69%)
  Q:    39 NKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           +K   +   +V  F  +K+  NDI+ A+ L+    D ++ ++A  E++E K  IE  E  L++LLLPKDPND+ N  +E+R   GGDE+ IF GDL+  Y RY +S  W+++ +   ES  G Y  I   I+GE VY ++KFESG HRVQRVP TES+GR+HTS  TVAV+PEL E E+  IN +DL+IDTYR+SGAGGQH+N T+SAVRITHIPTGI V CQ+ +SQ +N+  A+ +L +++ + ++E      +D R+  +G+G+R++KIRTYNYPQ RVTDHRINLT+ +LD VM G + E+I  +I+  +A ++
  S:    12 SKEYSQLEEVVTTFNRWKKLNNDIEEAQILLD---DPDMKDMAAEEIAENKAEIENLEQHLQILLLPKDPNDEYNAFLEIRAGTGGDEAGIFAGDLYRMYSRYCESKRWRIEEMSANESEQGGYKEIIVKISGEGVYGQLKFESGGHRVQRVPKTESQGRIHTSACTVAVMPELPESEMPEINPTDLRIDTYRSSGAGGQHVNTTDSAVRITHIPTGIVVECQDERSQHKNKAKALAVLASRIVQVEQERQAAEQADTRRNLLGSGDRSDKIRTYNYPQGRVTDHRINLTVYRLDEVMNGKIDELIQPIITEYQADQL 326
>gi|160872697|ref|ZP_02062829.1| peptide chain release factor 1 [Rickettsiella grylli] >gi|159121496|gb|EDP46834.1| peptide chain release factor 1 [Rickettsiella grylli] (363 aa)
Score = 740, Expect = 2.0e-76, Identities = 163/345 (47%), Positives = 240/345 (69%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVE-LVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           L+N L  + +++ +L   L    +         ++K   +  P+V+ F++Y+  L+ ++ AE  +K +KD  + ELA  E+   +    + E EL+ LLLP+DPNDD+NV +E+R AAGGDE++IF GDLF  Y RYA+S  W V+++    S  G Y  I   I+G  VY+ +KFESG HRVQRVP TE++GRVHTST TVA+LPE+E ++ + ++ SDLKIDT+RASGAGGQH+ KT+SA+RITH+P+G+ V CQ+ +SQ +NR  AM +L+AKL   ++ + R+  ++ R+  VGTG+R+E+IRTYN+PQ R+TDHRINLTL +L ++M G+L  +I SL    +A
  S:     5 LFNRLTLIVQRYEELTALLANIEVIKDQNHFRNLSKEYVQLGPLVQCFQQYQTNLDRLNQAEHCLK-DKDAIVQELAMEEMKIAQQKKIELEKELEHLLLPQDPNDDRNVFLEIRAAAGGDEAAIFAGDLFRMYSRYAESQHWHVEIIHRNPSEQGGYKEIIARISGTKVYAHLKFESGAHRVQRVPETEAQGRVHTSTCTVAILPEIESMDDITLHPSDLKIDTFRASGAGGQHVQKTDSAIRITHLPSGLVVECQDERSQHKNRARAMSLLQAKLLAAQKAKQRREEAETRRDLVGTGDRSERIRTYNFPQGRLTDHRINLTLYQLSDIMEGHLEPVIQSLTHEYQA 352
>gi|115375817|ref|ZP_01463069.1| peptide chain release factor 1 [Stigmatella aurantiaca DW4/3-1] >gi|115367205|gb|EAU66188.1| peptide chain release factor 1 [Stigmatella aurantiaca DW4/3-1] (366 aa)
Score = 740, Expect = 2.1e-76, Identities = 152/350 (43%), Positives = 237/350 (67%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           + + L  +E +F  L  +L    +     ++ +++K       +VE F+ Y++ L D+   E  +     +E    A+  L   K   E++E ELK+LLLPKDPND+K+VI+E+R  AGGDE+ +F  ++   Y RYA   GWK  ++++   S  G   ++  ++G  V+S MK+ESGVHRVQRVPATE++GR+HTSTITV+V+PE E+V++ IN +D+++   R++G+GGQ +N T+SAVR+ H P+GI V CQ+ KSQ +NR  AM+MLRAKL+E ++E  R     +R+GQVGTG+R+EKIRTYN+PQ+R+TDHRI+LT++ L  +M G + ++I +  +H +A  +++
  S:     1 MIDKLEEVERRFERLTADLSNPDVLADSAKLQKVSKERAALEKLVETFRTYRKVLGDLAEVEAWLDGGDADEK-AYAREALPGLKQQREEFEQELKILLLPKDPNDEKDVILEIRAGAGGDEAGLFAEEVMQMYLRYATRRGWKADIVDMSPGSVGGVKDVTITLSGAAVFSNMKYESGVHRVQRVPATETQGRIHTSTITVSVMPEAEDVDVQINPADIEMQVMRSTGSGGQSVNTTDSAVRLIHKPSGIVVKCQQEKSQTKNRAQAMRMLRAKLYEIEQERIRSERDSMRRGQVGTGDRSEKIRTYNFPQDRLTDHRISLTVHNLPGIMAGGIDDVITACRTHYQAEALKQ 352
>gi|15966364|ref|NP_386717.1| peptide chain release factor 1 [Sinorhizobium meliloti 1021] >gi|20139338|sp|Q92MK5|RF1_RHIME Peptide chain release factor 1 (RF-1) >gi|15075635|emb|CAC47190.1| Probable peptide chain release factor 1 (RF-1) protein [Sinorhizobium meliloti 1021] (360 aa)
Score = 740, Expect = 2.2e-76, Identities = 155/341 (45%), Positives = 234/341 (68%)
  Q:    14 MEEKFNDLNKELETEGLSVKRMSEINKSIKETTPIVEKFKEYKRTLNDI-DSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQE-SSHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           +E +F ++   + + G S     ++     E  P+V K + Y++   ++ D A  L     D ++ +LA++E  E +  IE  E E+++LLLPKD  D+K+ I+E+R   GG E+++F GDLF  Y+RYA S GW+V++L   E  + GY  I   ++G  V+S++KFESGVHRVQRVP TE+ GR+HTS  TVAVLPE EE+++ +   D+++DT R+SGAGGQH+N T+SAVRITHIPTGI V   E KSQ +NR  AM++LR++L++ + +      S  R+ QVG+G+R+E+IRTYN+PQ R+TDHRINLTL KLD +M G + +++D+L++  +A ++
  S:    12 LERRFGEIEARM-SAGPSADVYVKLASEYSELQPVVSKIRAYEKATAELADIAAMLADRATDKDMRDLAEMEKPEVEEKIEALEQEIQILLLPKDAADEKSAILEIRAGTGGSEAALFAGDLFRMYERYAASKGWRVEVLSASEGEAGGYKEIIATVSGRGVFSRLKFESGVHRVQRVPETEASGRIHTSAATVAVLPEAEEIDIDVRPEDIRVDTMRSSGAGGQHVNTTDSAVRITHIPTGIVVTSSE-KSQHQNRAKAMQVLRSRLYDMERQRADSERSADRRSQVGSGDRSERIRTYNFPQGRLTDHRINLTLYKLDRMMEGEIDDVVDALLADYQASQL 352
>gi|167855820|ref|ZP_02478572.1| peptide chain release factor 1 [Haemophilus parasuis 29755] >gi|167853033|gb|EDS24295.1| peptide chain release factor 1 [Haemophilus parasuis 29755] (360 aa)
Score = 740, Expect = 2.2e-76, Identities = 162/348 (46%), Positives = 236/348 (67%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           + N L S+ E+  +L   L    +    ++    +K   +   +V  F  +K+  +DI+ A+ L+    D ++ E+A  E+   K  IE+ E  L++LLLPKDPND+ N  +E+R   GGDE+ IF GDL+  Y RYA+S  W+++ L   ES  G Y  I   I+GE VY ++KFESG HRVQRVP TES+GR+HTS  TVAV+PEL E E+  IN +DL+IDTYR+SGAGGQH+N T+SAVRITHIPTGI V CQ+ +SQ +N+  A+ +L +++ + ++E+  +  +D R+  +G+G+R++KIRTYNYPQ RVTDHRINLT+ +LD VM G + E+I  +I+  +A ++
  S:     5 IINKLDSLSERHEELQALLGDATIISDQEKFCAYSKEYSQLEEVVSTFNRWKKLHSDIEEAQILLD---DPDMKEIAAEEIEANKAEIEQLEQNLQILLLPKDPNDEYNCFLEIRAGTGGDEAGIFAGDLYRMYSRYAESKRWRIEELSANESEQGGYKEIIVKISGEGVYGQLKFESGGHRVQRVPKTESQGRIHTSACTVAVMPELPESEMPEINPADLRIDTYRSSGAGGQHVNTTDSAVRITHIPTGIVVECQDERSQHKNKAKALAVLASRIVQVEKEKQAQEQADTRRNLLGSGDRSDKIRTYNYPQGRVTDHRINLTVYRLDEVMNGKIDELIQPIITEYQADQL 353
>gi|83951817|ref|ZP_00960549.1| peptide chain release factor 1 [Roseovarius nubinhibens ISM] >gi|83836823|gb|EAP76120.1| peptide chain release factor 1 [Roseovarius nubinhibens ISM] (349 aa)
Score = 740, Expect = 2.4e-76, Identities = 153/324 (47%), Positives = 223/324 (68%)
  Q:    35 MSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLE-VQESSHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQEAK 358
           ++++ +   E  P+VE+ + Y+  L+  + AE ++    D E+ ELA+ EL   K  +   E  L++ LLPKD  D +  I+E+RP  GG+E+++F GDL   Y RYA++ GW+ +++E  Q    G       + G +V++++K+ESGVHRVQRVP TES GR+HTS  TVAVLPE E+V++ I+ SD++IDT RASGAGGQH+N T+SAVRITHIP+GI V   E KSQ  NRE AM++L+ +L++ + ++     S  R  QVG+G+R+E+IRTYN+PQ R+TDHRINLTL KLD VM G+L +IID+L +  +A  + E +
  S:    28 IAQLGREYAELRPVVEEIRAYRAALDAAEQAEAMLG---DPEMRELAEDELRTLKAELPGREKALQLALLPKDEADARPAIIEIRPGTGGEEAALFAGDLLRMYARYAEARGWQFEVIEEAQTELGGIKEAVVHVKGAHVFARLKYESGVHRVQRVPETESGGRIHTSAATVAVLPEAEDVDIHIDPSDIRIDTMRASGAGGQHVNTTDSAVRITHIPSGIVVTSSE-KSQHRNREIAMQVLKTRLYDLERQKVHDARSADRAAQVGSGDRSERIRTYNFPQGRMTDHRINLTLYKLDQVMAGDLDDIIDALTTDAQAALLAEMQ 348
>gi|17547620|ref|NP_521022.1| peptide chain release factor 1 [Ralstonia solanacearum GMI1000] >gi|20139328|sp|Q8XVD0|RF1_RALSO Peptide chain release factor 1 (RF-1) >gi|17429924|emb|CAD16608.1| probable peptide chain release factor 1 (rf-1) protein [Ralstonia solanacearum] (360 aa)
Score = 739, Expect = 2.7e-76, Identities = 150/348 (43%), Positives = 240/348 (68%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGLS--VKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEV-ELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           + + L  + E+  ++N  L  E  +  + +  ++ +   E  P+V ++  +K+  +D+ +A++L+    D ++   A+ E+   +  +   E EL+ LLLPKDPND +N+ +E+R   GGDES++F GDL   Y RYA+   W+V+++    S   GY  +   + GE  YS++KFESG HRVQRVPATE++GR+HTS  TVAV+PE + + ++ IN +DL+IDT+RASGAGGQHINKT+SAVR+TH+PTG+ V CQ+ +SQ  N++ AM++L A+L +++E E +   +  RK  +G+G+R+++IRTYN+PQ R+TDHRINLTL K+D +M G+L E++ +L +  +A ++
  S:     5 MLSKLDQLAERTVEINALLAREDATANLDQYRKLTREHAELEPVVAQYAAWKQAEDDVTTAQELLA---DPDMKAFAEDEIRAARERMTTLEAELQRLLLPKDPNDHRNIFLEIRAGTGGDESALFAGDLLRMYTRYAERQRWQVEIVSESASDLGGYKEVIVRLVGEGAYSRLKFESGGHRVQRVPATEAQGRIHTSACTVAVMPEADPLADIQINPADLRIDTFRASGAGGQHINKTDSAVRLTHLPTGLVVECQDDRSQHRNKDRAMQVLAARLKDRQEREAQAKEASARKSLIGSGDRSDRIRTYNFPQGRITDHRINLTLYKIDALMDGDLGELLGALAAEHQAEQL 353
>gi|32033818|ref|ZP_00134103.1| COG0216: Protein chain release factor A [Actinobacillus pleuropneumoniae serovar 1 str. 4074] (360 aa)
Score = 739, Expect = 2.9e-76, Identities = 161/350 (46%), Positives = 234/350 (66%)
  Q:     5 EKLYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELV-INNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           + + N L S+ E+  +L   L    +     +    +K   +   +V  F  +K+  NDI+ A+ L+    D ++ ++A  E++E K  IE  E  L++LLLPKDPND+ N  +E+R   GGDE+ IF GDL+  Y RY +S  W+++ +   ES  G Y  I   I+GE VY ++KFESG HRVQRVP TES+GR+HTS  TVAV+PEL E E+  IN +DL+IDTYR+SGAGGQH+N T+SAVRITHIPTGI V CQ+ +SQ +N+  A+ +L +++ + ++E      +D R+  +G+G+R++KIRTYNYPQ RVTDHRINLT+ +LD VM G + E+I  +I+  +A ++
  S:     3 DSIINKLESLSERHEELQALLGDPSVINDQDKFRAYSKEYSQLEEVVTTFNRWKKLNNDIEEAQILLD---DPDMKDMAAEEIAENKAEIENLEQHLQILLLPKDPNDEYNAFLEIRAGTGGDEAGIFAGDLYRMYSRYCESKRWRIEEMSANESEQGGYKEIIVKISGEGVYGQLKFESGGHRVQRVPKTESQGRIHTSACTVAVMPELPESEMPEINPTDLRIDTYRSSGAGGQHVNTTDSAVRITHIPTGIVVECQDERSQHKNKAKALAVLASRIVQVEQERQAAEQADTRRNLLGSGDRSDKIRTYNYPQGRVTDHRINLTVYRLDEVMNGKIDELIQPIITEYQADQL 353
>gi|148260023|ref|YP_001234150.1| peptide chain release factor 1 [Acidiphilium cryptum JF-5] >gi|166223523|sp|A5FX99|RF1_ACICJ Peptide chain release factor 1 (RF-1) >gi|146401704|gb|ABQ30231.1| bacterial peptide chain release factor 1 (bRF-1) [Acidiphilium cryptum JF-5] (352 aa)
Score = 739, Expect = 3.0e-76, Identities = 156/275 (56%), Positives = 213/275 (77%)
  Q:    76 EIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGFISFM--INGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDE 350
           E+ ELA  EL   +  + + E+E+++ LLP+D  D++  I+E+RPAAGGDE+++F  +LF+AY+RYAD  GW+ ++L+  E+  G G    +  I G  V++++KFESGVHRVQRVPATE++GR+HTST+TVAVLPE E+V++ +N +DL+ID +RASGAGGQH+NKTESAVRITH+PTGI VA QE +SQ +NR  AMK+LRA+L+E+         +  RK QVGTG+R+E+IRTYN+PQ RVTDHRINLTL+K+D VMLG   EIID+L   D+
  S:    68 ELRELADAELDSLRETLPRLEHEIRLALLPRDAADERPAILEIRPAAGGDEAALFAAELFAAYRRYADLRGWRFEILDYTETELG-GLREGIAEITGRAVFARLKFESGVHRVQRVPATETQGRIHTSTVTVAVLPEAEDVDVEVNEADLRIDVFRASGAGGQHVNKTESAVRITHLPTGIVVAMQEERSQHKNRAKAMKILRARLYEQTRAAAAAGRAADRKSQVGTGDRSERIRTYNFPQGRVTDHRINLTLHKIDRVMLGEFDEIIDALTEEDQ 343
>gi|23012458|ref|ZP_00052537.1| COG0216: Protein chain release factor A [Magnetospirillum magnetotacticum MS-1] (361 aa)
Score = 739, Expect = 3.1e-76, Identities = 153/315 (48%), Positives = 219/315 (69%)
  Q:    37 EINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEK-DNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLG-NLSEIIDSLISHDEA 351
           ++++ + E   +V     Y+    ++     LI     D E+  LA  E  + +  +E+    L+++LLPKD  D+K+ I+E+R   GGDE+++F GDLF  Y +YA+S GW+V+++   E +  GY  +   + G +V+S++KFESG HRVQRVP TE++GR+HTS  TVAVLPE EEV++VIN +DLKIDT RA GAGGQH+NKTESA+RITH+PTG+ V  QE +SQ +NR  AM +LRA+L++ +        +  RK QVG+G+R+E+IRTYN+PQ RVTDHRINLTL KL+ VM G  L E+ID+L++  +A
  S:    35 QLSRELSELDGVVAAIHAYRAAEANLAGIRALIDEPGGDPEMRALAAEEKPDAEEALEQAHRALQLMLLPKDAADEKSAILEIRAGTGGDEAALFAGDLFRMYAKYAESKGWRVEVISESEGTVGGYREVVAEVKGRSVFSRLKFESGAHRVQRVPDTETQGRIHTSAATVAVLPEAEEVDVVINEADLKIDTMRAQGAGGQHVNKTESAIRITHLPTGVVVFVQEERSQHKNRARAMALLRARLFDAERSAKDSARAADRKAQVGSGDRSERIRTYNFPQGRVTDHRINLTLYKLEEVMAGPALDEVIDALVTEHQA 352
>gi|13472970|ref|NP_104537.1| peptide chain release factor 1 [Mesorhizobium loti MAFF303099] >gi|20139342|sp|Q98G93|RF1_RHILO Peptide chain release factor 1 (RF-1) >gi|14023718|dbj|BAB50323.1| peptide chain release factor 1 [Mesorhizobium loti MAFF303099] (359 aa)
Score = 738, Expect = 3.3e-76, Identities = 152/308 (49%), Positives = 220/308 (71%)
  Q:    44 ETTPIVEKFKEYKRTLNDIDSAEKLIKSE-KDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQE-SSHGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEA 351
           E   +V K ++ +   ++    E ++  +  D E+  LA+ +L + +  IE  + ++++LLLPKD  DDKN I+E+R   GGDE+++F GDLF  Y+RYA   GW+ + +   +  + G+  I   ++G+ V++ +KFESGVHRVQRVPATE+ GR+HTS  TVAVLPE EEV++ I   D++IDT RASG+GGQH+N T+SAVRITH+PTGI V  Q  KSQ +NR  AM++LRA+L++ +  +  +  S+ RK QVG+G+R+E+IRTYN+PQ RVTDHRINLTL KLD VM+G L EI+D+LI+  ++
  S:    41 ELQDMVAKVRQLRSAEHEQADLEAMLADKGTDAEMRALAEADLPDVEERIEALQKDIQILLLPKDAADDKNAILEIRAGTGGDEAALFAGDLFRMYERYAAERGWRFETVSASDGDAGGFKEIIATVSGKGVFAHLKFESGVHRVQRVPATEASGRIHTSAATVAVLPEAEEVDIEIRAEDIRIDTMRASGSGGQHVNTTDSAVRITHLPTGIMVV-QAEKSQHQNRAKAMQILRARLYDLERSKADEERSESRKSQVGSGDRSERIRTYNFPQGRVTDHRINLTLYKLDRVMMGELDEIVDALIADHQS 349
>gi|89900074|ref|YP_522545.1| peptide chain release factor 1 [Rhodoferax ferrireducens T118] >gi|119361589|sp|Q21YY9|RF1_RHOFD Peptide chain release factor 1 (RF-1) >gi|89344811|gb|ABD69014.1| bacterial peptide chain release factor 1 (bRF-1) [Rhodoferax ferrireducens T118] (366 aa)
Score = 738, Expect = 3.3e-76, Identities = 149/323 (46%), Positives = 220/323 (68%)
  Q:    32 VKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIK-SEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEE-VELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKM 354
           +K+   +++   E   +  ++  Y++   D+  A++L++ S  D ++  +AQ E+      ++K E EL+ +LLPKDP+D +N  VE+R   GGDES++F  DL   Y RY +  GWK +++    S   GY  +   I G++VY  +KFESG HRVQRVP TE++GR+HTS  TVAVL E +E V + IN +DL+IDTYRASGAGGQHINKT+SAVRITH+PTGI   CQ+G+SQ  N+  A+K+L A++ EK   E     +  RKG +G+G+R+++IRTYN+PQ R+TDHRINLTL KL  +M G+L +++ +L + + A ++
  S:    32 MKQFLLLSREHTEVGAVASRWARYQQLEADLSGAQELLRGSVDDPDMTAMAQEEIDNASAELQKLENELQRMLLPKDPDDARNAFVEIRAGTGGDESALFAADLLRMYTRYCERRGWKAEIISESPSELGGYKEVVIKIEGDHVYGALKFESGGHRVQRVPVTETQGRIHTSACTVAVLAEPDEAVAIQINPADLRIDTYRASGAGGQHINKTDSAVRITHLPTGIVAECQDGRSQHSNKAQALKVLTARIHEKDRSERAAKDAAERKGLIGSGDRSDRIRTYNFPQGRLTDHRINLTLYKLLTIMEGDLDDVVQALQAFEAAQQL 357
>gi|188996904|ref|YP_001931155.1| peptide chain release factor 1 [Sulfurihydrogenibium sp. YO3AOP1] >gi|188931971|gb|ACD66601.1| peptide chain release factor 1 [Sulfurihydrogenibium sp. YO3AOP1] (360 aa)
Score = 738, Expect = 3.4e-76, Identities = 176/356 (49%), Positives = 251/356 (70%)
  Q:     4 NEKLYNSLLSMEEKFNDLNKELETEGLSVKRMSEIN---KSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQEAKI 359
           ++K    L S+EEK   L +EL  +   +K  S+I    K  KE + I+  + EYK+    I+  ++L+ S  D+++ ELA+ EL   K   E  E ++++ LLPKDPND+KNVI+E+R  AGGDE+S+F  +LF  Y+RYA+  GWK ++L +  +  G    +  +I G+  YS++K+ESGVHRVQRVP TES GR+HTST+TVAVLPE EEV++ I   +LKI+T RA GAGGQH+N T+SAVRITHIPTG+ V CQ+ +SQ++N+  AM++LRA+L +  E   ++ I+  RK QVGTGER+EKIRTYN+PQNRVTDHR+N T  +++++M G+L EIID LI+ +   K+   +I
  S:     2 DKKFLVQLESIEEKVKKL-EELMADPEVLKDQSKIQSIAKEHKELSEILNLYNEYKKVSRQIEEVKQLLNSTPDDDLRELAEEELESLKKQQEDLEKKIEIALLPKDPNDEKNVILEIRQGAGGDEASLFAAELFRMYQRYAERHGWKTEILSLHPTEKGGIKEVIALIKGKGAYSRLKYESGVHRVQRVPETESSGRIHTSTVTVAVLPEAEEVDIEIKPEELKIETMRAGGAGGQHVNTTDSAVRITHIPTGMVVTCQDERSQLQNKMKAMQILRARLKDYYERLEKEKIAKERKEQVGTGERSEKIRTYNFPQNRVTDHRVNYTSYRINDIMDGDLDEIIDVLIAKENEEKLANLEI 360
>gi|188526883|ref|YP_001909570.1| peptide chain release factor 1 [Helicobacter pylori Shi470] >gi|188143123|gb|ACD47540.1| peptide chain release factor 1 [Helicobacter pylori Shi470] (352 aa)
Score = 738, Expect = 3.7e-76, Identities = 170/345 (49%), Positives = 248/345 (71%)
  Q:     7 LYNSLLSMEEKFNDLNKELETEGL--SVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVML-GNLSEIIDSLISHDEA 351
           L   L S+ +++++L   L +  +   +K+++E++K       I    KEY   L +I   ++L++   D E+ ELA+ EL   +      E  +K LL+PKDPNDDKN+ +E+R   GGDE+ IFVGDLF AY RYAD   WKV+++   E+S  GY  I  +I G+ VYS++KFE+G HRVQRVP TES+GR+HTS ITVA++PE+++VE+ IN+SDLKI+ +RA G GGQ +N T+SAVRITH+PT I V+ Q+ KSQ +N++ A+K+L+A+L+EK+ EE +   +  RK QVG+G+R+E+IRTYNYPQNR+++HRINLTL  L+ +ML GNL E+I+ LI+H ++
  S:     4 LAEKLSSILKRYDELTALLSSAEVISDIKKLTELSKEQSSIEEISVASKEYLSVLENIKENKELLE---DKELSELAKEELKILEIKKSDLETAIKQLLIPKDPNDDKNIYLELRAGTGGDEAGIFVGDLFKAYCRYADLKKWKVEIVSSSENSVGGYKEIIALIKGKGVYSRLKFEAGTHRVQRVPETESQGRIHTSAITVAIMPEVDDVEVSINSSDLKIEVFRAGGHGGQCVNTTDSAVRITHLPTNISVSMQDEKSQHKNKDKALKILKARLYEKQIEEQQLANAKDRKEQVGSGDRSERIRTYNYPQNRLSEHRINLTLYSLEEIMLSGNLDEVINPLIAHAQS 349
>gi|170787440|gb|EDT28484.1| peptide chain release factor 1 [Oligotropha carboxidovorans OM5] (358 aa)
Score = 738, Expect = 3.8e-76, Identities = 149/312 (47%), Positives = 219/312 (70%)
  Q:    40 KSIKETTPIVEKFKEYKRTLNDIDSAEKLIKS-EKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGN-LSEIIDSLISHDEA 351
           + + E TP+V+  K Y+   +++   + +I     D E+  +A+ E    +   E  E ++++ LLPKD  D++NV++E+R   GGDE+S+F GDLF  Y+R+A   GWKV+++   E +  GY  I   + G   ++K+KFESGVHRVQRVP TE+ GR+HTS  TVAVLPE EE+++ I ++DL+I+T RA GAGGQH+NKTESA+RITHIPTGI V  Q+ +SQ +NR +AM +LR+++ + + +      S  R+GQVG+G+R+E++RTYN+PQ RVTDHRINLTL KL  V+ G  L+E+ID+L +  +A
  S:    35 RELAELTPVVDAVKAYRAGASELSDLDAMIDDPTTDAEMRAMAESERPVLQERQENLEQQIRIALLPKDAMDERNVVLEVRAGTGGDEASLFAGDLFRMYERFAALQGWKVEVISASEGTVGGYKEIVAQVQGRGAFAKLKFESGVHRVQRVPDTEASGRIHTSAATVAVLPEAEEIDIDIKDTDLRIETMRAQGAGGQHVNKTESAIRITHIPTGIVVMMQDSRSQHKNRASAMNILRSRILDAERQRAASERSADRRGQVGSGDRSERVRTYNFPQGRVTDHRINLTLYKLPQVIAGEALNELIDALTTEHQA 349
>gi|85713812|ref|ZP_01044802.1| Peptide chain release factor 1 [Nitrobacter sp. Nb-311A] >gi|85699716|gb|EAQ37583.1| Peptide chain release factor 1 [Nitrobacter sp. Nb-311A] (358 aa)
Score = 738, Expect = 3.8e-76, Identities = 158/325 (48%), Positives = 225/325 (69%)
  Q:    30 LSVKRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKS-EKDNEIIELAQLELSEKKPLIEKYEYEL----KVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHG-YGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGN-LSEIIDSLISHDEAVKM 354
           +S  R  ++ + + E  P+VE  K+++    +I   + +I     D E+  +A+ E    +P +E    EL    ++ LLPKD  D++NV++E+R   GGDE+S+F GDLF  Y+R+A   GWKV+++   E + G Y  I   + G   Y+KMKFESGVHRVQRVP TE++GRVHTS  TVAVLPE EEV++ I   DL+I+T RA GAGGQH+NKTESA+RITHIPTGI V  Q+ +SQ +NR +AM +LR+++++ + +      S  RK QVG+G+R+E+IRTYN+PQ RVTDHRINLTL KL  V+ G+ L E+ID+L +  +A ++
  S:    25 VSADRYVQMTRELAELNPVVEAVKDWRAITAEIAGIDAMIADPATDAEMRAMAEAE----RPALEARNNELMQQIRIALLPKDAMDERNVMLEVRAGTGGDEASLFAGDLFRMYERFAALQGWKVEVISASEGTMGGYKEIVAEVQGRGAYAKMKFESGVHRVQRVPDTEAQGRVHTSAATVAVLPEAEEVDVEIKPDDLRIETMRAQGAGGQHVNKTESAIRITHIPTGIVVNMQDSRSQHKNRASAMNILRSRIYDVERQRINAARSADRKDQVGSGDRSERIRTYNFPQGRVTDHRINLTLYKLPQVIAGDALHELIDALTTEHQAAQL 352
>gi|84516322|ref|ZP_01003682.1| peptide chain release factor 1 [Loktanella vestfoldensis SKA53] >gi|84510018|gb|EAQ06475.1| peptide chain release factor 1 [Loktanella vestfoldensis SKA53] (351 aa)
Score = 738, Expect = 3.9e-76, Identities = 152/322 (47%), Positives = 219/322 (68%)
  Q:    35 MSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESS-HGYGFISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           ++ + +   E  P+V+    YK  L  +   + L+K   D E+  LA+ EL E K  +   E+ +++ LLPKD  D +  ++E+RP  GGDE+S+F GDL   Y+RYA+++GW+ ++LE  ++   G   +   + GE V++++K+ESGVHRVQRVP TES GR+HTS  TVAVLPE ++V++ IN +DL+IDT RASG+GGQH+N T+SAVRI HIPTG+ V   E KSQ  NRE AM++L+ +L++ + +      S  RK QVG+G+R+E+IRTYN+PQ R+TDHRINLTL  L  VM G+L  IID+L S  +A  + E
  S:    30 IAALGREYAELRPVVDTVTAYKDLLAQMIDTQALLK---DPEMRALAEDELPELKAALAASEHAVQLALLPKDAADARPALLEIRPGTGGDEASLFAGDLLRMYQRYAENMGWRFEILEQSQTELGGIKEVVARVAGEGVFARLKYESGVHRVQRVPETESGGRIHTSAATVAVLPEAQDVDIQINPNDLRIDTMRASGSGGQHVNTTDSAVRILHIPTGLIVVSAE-KSQHRNREIAMQVLKTRLFDLERQRIDGERSADRKAQVGSGDRSERIRTYNFPQGRLTDHRINLTLYSLGQVMAGDLDTIIDALQSEAQAALLAE 348
>gi|86134218|ref|ZP_01052800.1| peptide chain release factor 1 [Tenacibaculum sp. MED152] >gi|85821081|gb|EAQ42228.1| peptide chain release factor 1 [Polaribacter dokdonensis MED152] (358 aa)
Score = 738, Expect = 4.0e-76, Identities = 152/324 (46%), Positives = 223/324 (68%)
  Q:    33 KRMSEINKSIKETTPIVEKFKEYKRTLNDIDSAEKLIKSEKDNEIIELAQLELSEKKPLIEKYEYELKVLLLPKDPNDDKNVIVEMRPAAGGDESSIFVGDLFSAYKRYADSLGWKVKMLEVQESSHGYGF--ISFMINGENVYSKMKFESGVHRVQRVPATESKGRVHTSTITVAVLPELEEVELVINNSDLKIDTYRASGAGGQHINKTESAVRITHIPTGIFVACQEGKSQIENRETAMKMLRAKLWEKKEEENRKNISDLRKGQVGTGERAEKIRTYNYPQNRVTDHRINLTLNKLDNVMLGNLSEIIDSLISHDEAVKMQE 356
           KR +++ K  K+   +V+K  EY+  +N+I+ A+++I    D E+ E+A++++ E    I + E E+K LL+PKDP D KN +VE+R   GGDE+SIF GDLF  Y +Y +S GWKV  ++  E ++G GF  I F +NG++VY  +KFE+GVHRVQRVP TE++GRVHTS  T  V PE EE ++ IN  D++ID + +SG GGQ +N T SAVR+THIPTG+   CQ+ KSQ +N+E A K+LR++L++ +  + +   +  R   V +G+R+ KIRTYNY Q RVTDHRI L+L  L N+M G++ +IID L+  +   K++E
  S:    29 KRYAQLMKEYKDLGDVVKKGDEYQTLMNNIEEAKEIIADGSDAEMTEMAKMQMEEANTRIPELEEEIKFLLIPKDPEDAKNAVVELRAGTGGDEASIFAGDLFRMYTKYCESKGWKVSTVDYSEGTNG-GFKEIQFEVNGDDVYGILKFEAGVHRVQRVPQTETQGRVHTSAATCMVFPEAEEFDVEINPKDVRIDFFCSSGPGGQSVNTTYSAVRLTHIPTGLVAQCQDQKSQHKNKEKAFKVLRSRLYDMELAKKQAEDALKRGSMVSSGDRSAKIRTYNYAQGRVTDHRIGLSLYDLPNIMNGDIQKIIDELMLAENTEKLKE 353