>gi|26554108|ref|NP_758042.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454116|dbj|BAC44446.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (378 aa)
Score = 1249, Expect = 2.1e-135, Identities = 365/365 (100%), Positives = 365/365 (100%)
  Q:    14 MTGAFGIVATVPVIVSSCSSTSDNNTGGDNNGGGNTQNQTISTQLRSSVTLSGALSNIYNPTSGSNTNTLLAAQIKSNLNSVFENGEALANVDDLEITVNGNFPTTSEWTGTTAFAGNNGWNATQGLTDVLYDWNTAALNISSLNDLKTQLTSEKITSIITEASSAPASGTVFTVVENSALGLTNNADSIDANASRDLLHIHVTGTEGSNTTNYDLQIPVSDLNLVVSDLTVTVTGTNVEQTGSTTTNFTYNIGINETANFVQPTQAPSINSADTNGDGNKALVALGYANESDGNYTLNNEAISAGIGVYNSEFSNPTIAATQGGSSNQFTITLSATPKEGYVWEDGTRDAKSISFPVTFTVTTA 378
           MTGAFGIVATVPVIVSSCSSTSDNNTGGDNNGGGNTQNQTISTQLRSSVTLSGALSNIYNPTSGSNTNTLLAAQIKSNLNSVFENGEALANVDDLEITVNGNFPTTSEWTGTTAFAGNNGWNATQGLTDVLYDWNTAALNISSLNDLKTQLTSEKITSIITEASSAPASGTVFTVVENSALGLTNNADSIDANASRDLLHIHVTGTEGSNTTNYDLQIPVSDLNLVVSDLTVTVTGTNVEQTGSTTTNFTYNIGINETANFVQPTQAPSINSADTNGDGNKALVALGYANESDGNYTLNNEAISAGIGVYNSEFSNPTIAATQGGSSNQFTITLSATPKEGYVWEDGTRDAKSISFPVTFTVTTA
  S:    14 MTGAFGIVATVPVIVSSCSSTSDNNTGGDNNGGGNTQNQTISTQLRSSVTLSGALSNIYNPTSGSNTNTLLAAQIKSNLNSVFENGEALANVDDLEITVNGNFPTTSEWTGTTAFAGNNGWNATQGLTDVLYDWNTAALNISSLNDLKTQLTSEKITSIITEASSAPASGTVFTVVENSALGLTNNADSIDANASRDLLHIHVTGTEGSNTTNYDLQIPVSDLNLVVSDLTVTVTGTNVEQTGSTTTNFTYNIGINETANFVQPTQAPSINSADTNGDGNKALVALGYANESDGNYTLNNEAISAGIGVYNSEFSNPTIAATQGGSSNQFTITLSATPKEGYVWEDGTRDAKSISFPVTFTVTTA 378
>gi|26554125|ref|NP_758059.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454133|dbj|BAC44463.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (378 aa)
Score = 620, Expect = 2.0e-62, Identities = 209/363 (57%), Positives = 261/363 (71%)
  Q:    15 TGAFGIVATVPVIVSSCSSTSDNNTGGDNNGGGNTQNQTISTQLRSSVTLSGALSNIYNP--TSGSNTNTLLAAQIKSNLNSVFENGEALANVDDLEITVNGNFPTTSEWTGTTAFAGNNGWNATQGLTDVLYDWNTAALNISSLNDLKTQLTSEKITSIITEASSAPASGTVFTVVENSALGLTNNADSIDANASRDLLHIHVTGT------EGSNTTNYDLQIPVSDLNLVVSDLTVTVTGTNVEQTGSTTTNFTYNIGINETANFVQPTQAPSINSADTNGD----GNKALVALGYANESDGNYTLNNEAISAGIGVYNSEFSNPTIAATQGGSSNQFTITLSATPKEGYVWEDGTRDAKSISFPVTFTVTT 377
           TGAFGIVATVPVIVSSCSSTSDNNT G +N GG TQ QTI+ Q++S+VTL+GALS+IY+   +S  NTN  +A +IK+NL +VF NG AL++V DLEITV+ NFP  S W G TA++G++GW + Q +  VLYD+    L ISSL+DLKTQL+  KI  I T A +   +   + V   +ALG TN  +  +   +RDLLH++V  T          T NYDLQIPVSDLNL + DL+VTV GTNV +T  TTT  TYNIGINE  NF QPT  P++  +D   D     NKALVAL YA E+DG  TL+NE ISA +G+YNS F+  +I    GG +NQ+TITLSATPK+GYVWEDG+  AK +SF VTFTV +
  S:    15 TGAFGIVATVPVIVSSCSSTSDNNT-GGDNNGGGTQTQTITPQIQSAVTLNGALSDIYDTANSSSENTNAKIAEEIKNNLETVFTNGAALSDVSDLEITVSHNFP-ESTWIG-TAYSGDSGWYSAQ-MDTVLYDYTLNPLTISSLSDLKTQLSDSKIQEIFTAAGTTTTTNATYAV--QNALGFTNKNNGAE---NRDLLHVNVLETVPGQSGGDPTTKNYDLQIPVSDLNLELKDLSVTVKGTNVAETTLTTTL-TYNIGINEAQNFTQPTTNPTVQGSDIQNDDANAANKALVALTYATEADGQTTLDNEKISAELGIYNSVFTAVSIKPVDGG-NNQYTITLSATPKDGYVWEDGSNTAKQVSFNVTFTVNS 378
>gi|26554112|ref|NP_758046.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454120|dbj|BAC44450.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (399 aa)
Score = 572, Expect = 6.4e-57, Identities = 194/364 (53%), Positives = 250/364 (68%)
  Q:    15 TGAFGIVATVPVIVSSCSSTSDNNTGGDNNGGGNTQNQTISTQLRSSVTLSGALSNIYNPTSGSNTNTLLAAQIKSNLNSVFENGEALANVDDLEITVNGNFPTTSEWTGTTAFAGNNGWNATQGLTD---------VLYDWNTAALNISSLNDLKTQLTSE-KITSIITEASSAPASGTVFTVVENSALGLTNNADSIDANASRDLLHIHVTGTE-------GSNTTNYDLQIPVSDLNLVVSDLTVTVTGTNVEQTGSTTTNFTYNIGINETANFVQPTQAPSINSADTNGDGNKALVALGYANESDG---NYTLNNEAISAGIGVYNSEFSNPTIAATQG----------GSSNQFTITLSATPKEGYVWEDGTRDAKSISFPVTFTVTTA 378
           TGAFGIVATVPVIVS+CSSTSDNNTGG    G NTQ +TI+ Q++S+ TLSGALS+IYNP + SNTN L+A +IK NL  VF+NG+AL NV+DLEITV  +FP  S WTG T  +    W  +    D         +LY   T  LNISSL+DLK QL  + K+  I+ +A +   + TV++V  N+ LG TN       + +RDLLH++V GT+        + TTNYDLQIPVSDL+L +S+L+VTV G+NV +T +TT   TYNIGIN+  N+V P+  P+    +  G  +  LV LGYA  + G     TLNN+AI  G+G+YN  F+  T    QG          G+   +TITLSATP +GYVWEDGT +AK ISF V   +T A
  S:    15 TGAFGIVATVPVIVSACSSTSDNNTGG----GDNTQTKTITPQIKSTSTLSGALSSIYNPANSSNTNALIADEIKKNLTEVFDNGDALNNVNDLEITVTHSFP-ESTWTGLTFNSDTGNWGNSTNAQDNVEIQEANKLLYPTQTTELNISSLSDLKEQLNDDAKLEKILDDAGATVDADTVYSV--NNGLGFTNKN---SGSENRDLLHVNVVGTKTTAGQTPTTTTTNYDLQIPVSDLDLEISNLSVTVKGSNVTETTATTNF-TYNIGINDAENYVDPSTKPTATEEEA-GKLDDVLVKLGYATAATGGATETTLNNDAIIQGLGIYNVTFARTTTEGVQGIVPKEDASNNGNEKTYTITLSATPNQGYVWEDGTSNAKDISFDVILDITAA 396
>gi|26554127|ref|NP_758061.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454135|dbj|BAC44465.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (384 aa)
Score = 565, Expect = 4.6e-56, Identities = 185/363 (50%), Positives = 244/363 (67%)
  Q:    14 MTGAFGIVATVPVIVSSCSSTSDNNTGGDNNGGGNTQNQTISTQLRSSVTLSGALSNIYNPTSGSNTNTLLAAQIKSNLNSVFENGEALANVDDLEITVNGNFPTTSEWTGTTAFAGNNGW------NATQGLTD---VLYDWNTAALNISSLNDLKTQLTSEKITSIITEASSAPASGTVFTVVENSALGLTNNADSIDANASRDLLHIHVTGTE-GSN--TTNYDLQIPVSDLNLVVSDLTVTVTGTNVEQTGSTTTNFTYNIGINETANFVQPTQAPSI-NSADTNGDGNKALVALGYANESDGNYTLNNEAISAGIGVYNSEFS----NPTIAATQGGSSNQFTITLSATPKEGYVWEDGTRDAKSISFPVTFTVT 376
           MTGAFGIVATVPVIVS+CSSTSDNN   +N G  N Q Q+I+ ++++   LSGALSNIY+  +   TN L+A +IK NL+ VFENGE L+ V+DL+++V   FP  S WTG +  A +  W      N    +TD   +LY   T AL+ISSL+DLKTQL   K+ +I+T+    PA+ T ++V   +ALG TN     D   +RDLLH++V GT+ GSN  TTNYDLQIPVSDLNL ++DL+VTV GTNV +T   TT  TYNIGIN+   FV P+  P++  S  TN +   AL ALGY     G   ++N+ ++A +G+YN  F+    NP +      ++N+FT  L ATP  GYVWEDGT  AK + F   FTV+
  S:    14 MTGAFGIVATVPVIVSACSSTSDNNGNNNNGGDTNQQTQSITPKIKTESKLSGALSNIYDTANTGKTNELIANEIKKNLSEVFENGEDLSKVNDLQVSVTHTFP-ASTWTGLSFDAASGNWKHSTDSNQDVTITDANKLLYASKTQALDISSLSDLKTQLDDTKLKAILTDTGVTPAADTTYSVA--NALGFTNKKK--DDTNNRDLLHVNVVGTKTGSNPGTTNYDLQIPVSDLNLKLTDLSVTVKGTNVAETTEKTT-LTYNIGINDVVEFVDPSAKPTVAASVKTNKETMNALKALGYTATVSGQDQIDNDKVAAALGIYNCTFTLAAENPLVI---DDATNKFTFNLVATPNSGYVWEDGTNTAKPVQFATDFTVS 384
>gi|26553722|ref|NP_757656.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26453729|dbj|BAC44060.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (368 aa)
Score = 518, Expect = 1.4e-50, Identities = 161/359 (44%), Positives = 224/359 (62%)
  Q:    15 TGAFGIVATVPVIVSSCSSTSDNNTGGDNNGGGNT-------QNQTISTQLRSSVTLSGALSNIYNPTSGSNTNTLLAAQIKSNLNSVFENGEALANVDDLEITVNGNFPTTSEWTGTTAFAGNNGWNATQGLTDVLYDWNTAALNISSLNDLKTQL-TSEKITSIITEASSAPASGTVFTVVENSALGLTNNADSIDANASRDLLHIHVTGTEGSNTTNYDLQIPVSDLNLVVSDLTVTV------TGTNVEQTGSTTTNFTYNIGINETANFVQPTQAPSINSADTNGDGNKALVALGYANESDGNYTLNNEAISAGIGVYNSEFSNPTIAATQGGSSNQFTITLSATPKEGYVWEDGTRDAKSISFPVTF 373
           TGAFGIVATVPVIVSSCSST +N   G+NN  G         Q QTI+ +L++ VT  GALS IY+ T+  +TNTL+A  IK+N  + FENG  L +++   +TV+GNF + + W G T     + W+ T  +   +Y+  +A LNI+SL DLK+QL TSE+I  +  +++   +  T + V   + LG T+           DLLH++VT  + +     D+ IPVSDLNL ++ L V+V      TG NV +    TTNFTYNIGIN+T   + PT       A    D NK L ALGYA E+   YTL+N+ +S  +G+YN +F   +  AT    +N++T+TL ATP +GYVWE+GT+DAK +SF  T 
  S:    15 TGAFGIVATVPVIVSSCSSTDNNGGTGNNNNQGGGNGGNTDTQQQTITPKLKADVTTQGALSKIYDTTAKEDTNTLIAKDIKANPETYFENGADLKSIEGWTVTVDGNFDSAASWEGQTY----DEWSKTANIKKGVYEQTSAQLNIASLKDLKSQLSTSEQIKKLCEDSNLTFSDATEYKV--QNQLGFTDG----------DLLHVNVTAKQNTTNLVMDVAIPVSDLNLKITGLKVSVSKTENQTGNNVAEVKDLTTNFTYNIGINDTVKEITPTAV----LAQDKTDANKVLKALGYATEAANVYTLDNDKLSDALGLYNCKFEAVSSKATN--EANKYTVTLKATPNDGYVWENGTKDAKEVSFVATL 365
>gi|26554107|ref|NP_758041.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454115|dbj|BAC44445.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (386 aa)
Score = 475, Expect = 1.3e-45, Identities = 170/360 (47%), Positives = 237/360 (65%)
  Q:    15 TGAFGIVATVPVIVSSCSSTSDNNTGGDNNGGGNTQNQTISTQLRSSVTLSGALSNIYNPTSGSNTNTLLAAQIKSN-LNSVFENGEALANVDDLEITVNGNFPTTSEWTGTTAFAGNNGWNAT------------QGLTDVLYDWNTAALNISSLNDLKTQLTSEKITSIITEASSAPASGTVFTVVENSALGLTNNADSIDANASRDLLHIHVTGTEGSNT---TNYDLQIPVSDLNLVVSDLTVTVTGTNVEQTGSTTTNFTYNIGINETANFVQPTQAPSINSADTNGDGNKALVALGYANES----DGNYTLNNEAISAGIGVYNSEFS-NPTIAATQGGSSNQFTITLSATPKEGYVWEDGTRDAKSISFPVTFT 374
           TGAFGIVATVPVIVS+CSSTSDNNT G N GG  TQNQTI+ +LR SV LSGALS+I++ T   N N  +AA I+ N LN VF NG+ L+ V+DL ++V GNF + S W G T    +  W +             +    ++Y   +   +ISSL+D KT+L++        EA+ A       T+   + +G T++          DLLHI+VT T   ++   TNYDLQIPVS+LN+VV +LT+TV GTN+ +   TTTNF++NIGI++T +  +  ++ S+ +A+ N D  +ALVALG A+ S    +  YT++N+A+SA +GVYN  F  +    A  G S++ FTITL ATP EGYVW+DG+  +K ++   TFT
  S:    15 TGAFGIVATVPVIVSACSSTSDNNT-GGNTGGDGTQNQTINPELRESVNLSGALSDIFDSTGAQNANQKIAADIQQNHLNDVFVNGQELSQVEDLTVSVTGNF-SRSSWDGLTFNGESGNWGSVGEDGNITDSVNIEEANKLIYTSESEQFDISSLDDFKTKLSTGDKLKTALEAAGAGTIDNTTTLAVANNIGFTDD----------DLLHINVTATPAGDSPTVTNYDLQIPVSNLNIVVPNLTITVAGTNIGEANRTTTNFSFNIGIDDTVS--ESNESASLATANRN-DAKQALVALGLASSSTEGGNTTYTIDNDAVSAVVGVYNCRFDIDSATIAPVGESNDNFTITLQATPLEGYVWDDGSNGSKPVTINATFT 380
>gi|26554126|ref|NP_758060.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454134|dbj|BAC44464.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (388 aa)
Score = 472, Expect = 2.8e-45, Identities = 171/365 (46%), Positives = 236/365 (64%)
  Q:    14 MTGAFGIVATVPVIVSSCSSTSDNNTGGDNNGGGNTQNQTISTQLRSSVTLSGALSNIYNPTSGSNTNTLLAAQIKSN-LNSVFENGEALANVDDLEITVNGNFPTTSEWTGTTAFAGNNGWNATQG------LTDVLYDWNTAALNISSLNDLKTQLTSEKITSIITEASSAPASGTVFTVVENSALGLTNNADSIDANASRDLLHIHVTGT------EGSNTTNYDLQIPVSDLNLVVSDLTVTVTGTNVEQTGSTTTNFTYNIGINETANFVQPTQAPSINSADTNGD----GNKALVALGYANESDGNYTLNNEAISAGIGVYNSEFS------NPTIAATQG--GSSNQFTITLSATPKE-GYVWEDGTRDAKSISFPVTFTVTTA 378
           MTGAFGIVATVPVIVSSCSSTSDNNT G +  GG TQ QTI+ QL+ SV+LSG LS+I++ T   N N  +AA IK N L+ VF+NG+AL  V DL++TV G+F   S W+G T  A + GW +  G         ++Y   +  LNISSLNDLKTQL+ +       E +         T+  N+ +GLT+           DLLHI+V+ T      + + TTNYDLQIPVS++NLVV++LT+TV GTNV +   TTTNF +N+GI+ T +F Q   AP ++  ++  +     +  L  LGY +  +   TL+++ ISA +G+YN +F+      N  +    G  GS+  + +T++ATP +  YVW+DGT   K ISF V   V T+
  S:    14 MTGAFGIVATVPVIVSSCSSTSDNNT-GGDGNGGGTQTQTITPQLKDSVSLSGPLSDIFDSTGTQNANEKIAADIKDNHLSDVFDNGDALKQVSDLKVTVAGDFKRDS-WSGGTYDAASGGWKSDSGDVTISAANKLVYASESPQLNISSLNDLKTQLSVKATLKEALEKAGVSTIADTTTLAVNNNIGLTD-----------DLLHINVSSTPQVASGQTATTTNYDLQIPVSNINLVVNNLTITVAGTNVGEATKTTTNFKFNVGIDATLSFKQTGTAPDVSKTESEAEQATLASTILQKLGYVSSGN---TLSDDKISAALGIYNCKFTPKSATENTEVQPDSGITGSNKVYKVTVTATPYDTNYVWDDGTTGPKDISFDVNLKVATS 388
>gi|26554109|ref|NP_758043.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454117|dbj|BAC44447.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (353 aa)
Score = 466, Expect = 1.4e-44, Identities = 172/342 (50%), Positives = 216/342 (63%)
  Q:    15 TGAFGIVATVPVIVSSCSSTSDNNTGGDNNGGGNTQNQTISTQLRSSVTLSGALSNIYNPTSGSNTNTLLAAQIKSN-LNSVFENGEALANVDDLEITVNGNFPTTSEWTGTTAFAGNNGWNATQG---------LTDVLYDWNTAALNISSLNDLKTQLTSEKITSIITEASSAPASGTVFTVVENSALGLTNNADSIDANASRDLLHIHVTGT-EGSN--TTNYDLQIPVSDLNLVVSDLTVTVTGTNVEQTGSTTTNFTYNIGINETANFVQPTQAPSINSADTNGDGNKALVALGYANES----DGNYTLNNEAISAGIGVYNSEFSNPTIAATQGGSSNQFTITLSATPKEGYV 356
           TGAFGIVATVPVIVSSCSSTSDNNTGGD+    NTQ QTI+ +LR +V LSGAL++IY+ T   N N  +AA IK N L  VF NGEAL+ V DL +TVNGNF   S W G T       W  +              ++Y   +  ++I SLNDL  +L+         E +         T+  N+ LG TN           DLLH++V+ T  GSN   TNYDLQIPVS+LNLVV +LT+TV+GTNV +   TTTNF +NIGIN+T   V  T      +AD N   N+ALVALG A  S    +  YT++N+A+SA +GVYN  F++PTI A    S+  +TITL ATP +GYV
  S:    15 TGAFGIVATVPVIVSSCSSTSDNNTGGDS----NTQTQTITPELRETVNLSGALTDIYDSTGAQNANQKIAADIKENHLGDVFTNGEALSQVSDLTVTVNGNFSRDS-WAGLTFNGETGNWEDSANNQNNITIAEANKLVYTSESEQIDIESLNDLHEKLSVRDTLKTALENAGVAQIPETTTLAINNNLGFTNG----------DLLHVNVSATPTGSNPTITNYDLQIPVSNLNLVVPNLTITVSGTNVGEANRTTTNFNFNIGINDT---VSETDEKGELAAD-NRSANEALVALGLATSSTDSGNTTYTIDNDAVSAVVGVYNCNFASPTIQAVD-ESAGTYTITLQATPLDGYV 353
>gi|26554134|ref|NP_758068.1| P35 lipoprotein homolog reported as gene for P33 lipoprotein [Mycoplasma penetrans HF-2] >gi|27805657|sp|Q50368|P33_MYCPE Lipoprotein p33 precursor >gi|26454142|dbj|BAC44472.1| P35 lipoprotein homolog reported as gene for P33 lipoprotein [Mycoplasma penetrans HF-2] (376 aa)
Score = 465, Expect = 1.7e-44, Identities = 169/362 (46%), Positives = 215/362 (59%)
  Q:    15 TGAFGIVATVPVIVSSCSS------TSDNNTGGDNNGGGNTQNQTISTQLRSSVTLSGALSNIYNPT----SGSNTNTLLAAQIKSNLNSVFENGEALANVDDLEITVNGNFPTTSEWTGTTAFAGNNGWNATQGLTDVLYDWNTAALNISSLNDLKTQL-TSEKITSIITEASSAPASGTVFTVVENSALGLTNNADSIDANASRDLLHIHVTGTEGSNTTNYDLQIPVSDLNLVVSDLTVTV------TGTNVEQTGSTTTNFTYNIGINETANFVQPTQAPSINSADTNGDGNKALVALGYANESDGNYTLNNEAISAGIGVYNSEFSNPTIAATQGGSSNQFTITLSATPKEGYVWEDGTRDAKSISFPVTFTVT 376
           TGAFGIVATVPVIVSSCSS      T DNNTGG  +G    Q  T +  ++S VTLSGALS IY+ T    S  NTNTL+A  IK+N  + F NGE L  V+   +TV+G+F + S WTG       + W+A       +Y   +  LNI+SL DLK+QL TS KI +I  E++   ++    +    + LG T            DLLHI+VT T+   T N DL IPVSDLNL ++DL V+V      TG NV      TTNFTYNIGI E      PT+ P++   D  G+  K L ALGY    D    L+N+ +S  +G+YN EF+  +    + GS ++FTI L A P   YVWEDGT   K ISF  TFT+T
  S:    15 TGAFGIVATVPVIVSSCSSTDNNGGTGDNNTGGGGSGTDQQQGTTYTPAIKSDVTLSGALSKIYDTTNTGDSRKNTNTLIAEDIKANPENYFTNGEDLKKVEGWSVTVDGSFDSNSVWTGDAY----SKWSAVADTHKGVYKSTSKQLNINSLKDLKSQLDTSAKIKAICDESNLVFSTADADSYKIQNELGFTGG----------DLLHINVTATQAGKTLNMDLGIPVSDLNLKITDLKVSVTASNNSTGNNVAAVSDLTTNFTYNIGIKEEVT--APTEKPNLAKTD-KGEVMKVLKALGYTQTGD-ETKLDNDKVSNSLGLYNCEFTAVSATPVE-GSEDKFTIKLKAKPLTDYVWEDGTNTEKEISFEATFTMT 374
>gi|26554133|ref|NP_758067.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454141|dbj|BAC44471.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (439 aa)
Score = 458, Expect = 1.1e-43, Identities = 159/327 (48%), Positives = 211/327 (64%)
  Q:    52 QTISTQLRSSVTLSGALSNIYNPTSGSNTNTLLAAQIKSNLNSVFENGEALANVDDLEITVNGNFPTTSEWT---------GTTAFAGNNGWNATQGLTD----VLYDWNTAALNISSLNDLKTQLTSEKITSIITEASSAPASGTVFTVVENSALGLTNNADSIDANASRDLLHIHVTGT---EGS--NTTNYDLQIPVSDLNLVVSDLTVTVTGTNVEQTGSTTTNFTYNIGINETANFVQPTQAPSINSADTNGDGNKALVALGYANESDGNY--TLNNEAISAGIGVYNSEFSN-------PTIAATQGGSSNQFTITLSATPKEGYVWEDGTRDAKSISFPVTFTVTTA 378
           +TI+ +++S+VTL GALSNIY+  + SNTN L+A +IK NL+ VF+NGEAL ++  L+I+VN  FP  S WT         G++ F GN+  + T  L +    +LY   T  L ISSL+DLKTQL   K+  I+ +  + P + T ++V  ++ALG TN A   D   ++DLLH++V GT   EGS   TTNYDLQIPVSDLNL ++DL VTV G NV  +   TT  TYNIGIN++ N       P    +D  G  +  LV  GYANE       TLNNE +  G+G+YN  FS        P   +    +   +TITLSA P +GYVWEDGT  AK+ISF V   +T A
  S:    91 ETITPKIKSTVTLGGALSNIYDTANTSNTNNLIADEIKKNLSEVFDNGEALKDISSLDISVNHKFP-DSTWTGLPFNHSSDGSSVFWGNDQADQTSILIEPENKLLYPSKTQPLTISSLSDLKTQLNDSKLKEILKDTETKPEANTTYSV--DNALGFTNKALGSD---NKDLLHVNVVGTTKVEGSEDTTTNYDLQIPVSDLNLKLTDLEVTVKGDNVTTSTLRTTL-TYNIGINDSTNQDNEGAKPQATESDA-GKLDTILVKFGYANEGTQGQEATLNNENLIEGLGIYNVTFSKDSNSKIEPKTNSGNEENEKTYTITLSAKPNDGYVWEDGTSTAKNISFDVILDITAA 436
>gi|26554136|ref|NP_758070.1| P35 lipoprotein homolog reported as IMP14 [Mycoplasma penetrans HF-2] >gi|26454144|dbj|BAC44474.1| P35 lipoprotein homolog reported as IMP14 [Mycoplasma penetrans HF-2] (375 aa)
Score = 458, Expect = 1.2e-43, Identities = 175/361 (48%), Positives = 226/361 (62%)
  Q:    15 TGAFGIVATVPVIVSSCSSTSDNNTGGDNNGGGNT--------QNQTISTQLRSSVTLSGALSNIYNPTSG---SNTNTLLAAQIKSNLNSVFENGEALANVDDLEITVNGNFPTTSEWTGTTAFAGNNGWNATQGLTDVLYDWNTAALNISSLNDLKTQLTSEKITSIITEASSAPASGTVFTVVENSALGLTNNADSIDANASRDLLHIHVTGTEGSNTTNYDLQIPVSDLNLVVSDLTVTV------TGTNVEQTGSTTTNFTYNIGINETANFVQPTQAPSINSADTNGDGNKALVALGYANESDGNYTLNNEAISAGIGVYNSEFSNPTIAATQGGSSNQFTITLSATPKEGYVWEDGTRDAKSISFPVTFTV 375
           TGAFGIVATVPVIVSSCSSTSDNN  G+NN   N         Q  T +  +++ V+LSG+LS IY+ T+G    NTN ++A  I SN    F NG  L NV    +TV+GNF + S WTG    A    W+A    + V Y   +  LNI+SLNDLKTQL+       I +A      G  F+    S+  + N           DLLHI+VT  +G+NT N +L IPVSDLNL ++ L V+V      TG NVE   + TT+FTYNIGI +T +F QPT  P+   A+ N + N+AL ALGY  ++DG  +L+N+ I+A +G+YN  F   +I      + N+FTITL ATP E YVWEDGTR+AK +SF VTFTV
  S:    15 TGAFGIVATVPVIVSSCSSTSDNNGNGNNNNDNNGGGSGTDQQQGTTYTPAIKTEVSLSGSLSKIYDTTTGDSRKNTNEMIAQDILSNPEDYFTNGADLKNVQGWSVTVDGNFDSQSTWTGEAYSA----WSANATFSGV-YAIASEQLNITSLNDLKTQLSDSTKLKAICDA----IPGLRFSSATASSYQVQNQV----GFTGDDLLHINVTAQDGNNTRNMNLGIPVSDLNLKITGLKVSVNGTNNETGNNVESVENLTTDFTYNIGIKDTVDFTQPTTTPTTTEANKN-NVNEALKALGY-TKTDG--SLDNDKIAAAVGIYNCTFVASSI-QEDSNTPNKFTITLKATPNENYVWEDGTREAKDVSFDVTFTV 374
>gi|26554193|ref|NP_758127.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454202|dbj|BAC44531.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (365 aa)
Score = 456, Expect = 1.9e-43, Identities = 161/358 (44%), Positives = 224/358 (62%)
  Q:    15 TGAFGIVATVPVIVSSCSSTSDNNTGGDNNGGG------NTQNQTISTQLRSSVTLSGALSNIYNPTSGSN---TNTLLAAQIKSNLNSVFENGEALANVDDLEITVNGNFPTTSEWTGTTAFAGNNGWNATQGLTDVLYDWNTAALNISSLNDLKTQLTSEKITSIITEASSAPASGTVFTVVENSALGLTNNADSIDANASRDLLHIHVTGTEGSNTTNY--DLQIPVSDLNLVVSDLTVTVTGTNVEQTGSTTTNFTYNIGINETANFVQPTQAPSINSADTNGDGNKALVALGYANESDGNYTLNNEAISAGIGVYNSEFSNPTIAATQGGSSNQFTITLSATPKEGYVWEDGTRDAKSISFPVT 372
           TGAFGIV+ VP+IVSSCSST ++ T  +NNG        N QNQ ++ +L+SS+  SG L  IY+ +SG+N   T+TLL  +   N + +F N + L +  D +I V+G F T + WTG T ++G  GW  T  L  V Y  + ++++I+SLNDLKT+L +  I+ IIT A+S   S T +TV   + L L N           DLLH++V GT G+++ ++  DLQIP+SDLNLV+ +L+++V+GT+VE       N  +NIGINE  NF    Q  +  + D   D +KALVALGYA  S+   TLNN  IS+ IG+YN  FS  T+   +   +N +TI L A P   YVWEDGT  +K IS  VT
  S:    15 TGAFGIVSAVPLIVSSCSSTDNDETNNNNNGQDNQGNTENPQNQKVTPKLKSSINFSGDLGKIYDSSSGTNRKTTDTLLEEEFTKNPDLIFTNAKELED-KDFKIEVDGGFDTNNAWTG-TPYSGTGGWK-TSVLRSVFYAESLSSIDITSLNDLKTKLDNATISKIIT-AASLQFSNTTYTV--QNQLSLENG----------DLLHVNVLGTIGNSSRSFTLDLQIPISDLNLVIPNLSISVSGTDVELIDKQEVNLDFNIGINENTNF---NQGATTLTKDNVVDADKALVALGYATTSNNVTTLNNTKISSAIGIYNCTFSASTV-VLKSTDTNTYTINLVAKPNTEYVWEDGTNTSKIISLDVT 363
>gi|26554119|ref|NP_758053.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454127|dbj|BAC44457.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (386 aa)
Score = 450, Expect = 8.7e-43, Identities = 167/364 (45%), Positives = 219/364 (60%)
  Q:    14 MTGAFGIVATVPVIVSSCSSTSDNNTGGDNNGGGNTQNQTISTQLRSSVTLSGALSNIYNPTSGSN---TNTLLAAQIKSNLNSVFENGEALA---NVDDLEITVNGNFPTT-------------SEWTGTTAFAGNNGWNATQGLTDVLYDWNTAALNISSLNDLKTQLTSEKITSIITEASSAPASGTVFTVVENSALGLTNNADSIDANASRDLLHIHVTGTEGSNTTNYDLQIPVSDLNLVVSDLTVTVTGTNVEQTGSTTTNFTYNIGINETANFVQPTQAPSINSADTNGDGNKALVALGYANESDGNYTLNNEAISAGIGVYNSEFSNPTIAATQGGSS---NQFTITLSATPK-EGYVWEDG--TRDAKSISFPVTFTVTT 377
           MTGAFGIVATVPVIVSSCSSTSDNNTGG+NN   N Q Q ++  L+ SV+LSG+LS IY+ T+G N   TN L+   IK N  + F NG   A    V +  +TV GNF T              S  T   A A  + W AT GL +V Y  N+  + I SL+DL T+L+ E+      + +    + T    ++N A G TN           DL+H++V G +    T YDLQIP SD+NL V+DLT+ V GTN+E +  TTTN+ +NIGI    ++ Q +   +  + D     NK L  L  A  +D N TLNNEA+   +GVYN  FSNPTIA  +G ++     +TITL A P+ E YVW DG  +   K ++F V   VTT
  S:    14 MTGAFGIVATVPVIVSSCSSTSDNNTGGENN---NQQTQKVTPVLKDSVSLSGSLSKIYDTTTGENRKTTNDLITEDIKENPENYFTNGSESAVKEAVKNATVTVEGNFTTAGSESPWKELPYLDSSETSENATAAKS-WKATTGLQEVTYATNSDQIEIKSLDDLHTKLSVEQTLKDAMKGAGVADTDTTTFTIKNRA-GFTNG----------DLIHVNVEGDKSGTKTQYDLQIPTSDINLSVTDLTIKVEGTNIETSQKTTTNYDFNIGIEPETHYDQGSTTVTA-ANDAAVTVNKVLQDLSLA--TDANGTLNNEALIKALGVYNVNFSNPTIAPKEGATTRAEKTYTITLDAKPQSEKYVWSDGSDSNTTKKVTFDVKVDVTT 384
>gi|3850057|emb|CAA07195.1| putative lipoprotein [Mycoplasma penetrans] (360 aa)
Score = 447, Expect = 2.0e-42, Identities = 169/352 (48%), Positives = 219/352 (62%)
  Q:    14 MTGAFGIVATVPVIVSSCSSTSDNNTGGDNNGGGNT--------QNQTISTQLRSSVTLSGALSNIYNPTSG---SNTNTLLAAQIKSNLNSVFENGEALANVDDLEITVNGNFPTTSEWTGTTAFAGNNGWNATQGLTDVLYDWNTAALNISSLNDLKTQLTSEKITSIITEASSAPASGTVFTVVENSALGLTNNADSIDANASRDLLHIHVTGTEGSNTTNYDLQIPVSDLNLVVSDLTVTV------TGTNVEQTGSTTTNFTYNIGINETANFVQPTQAPSINSADTNGDGNKALVALGYANESDGNYTLNNEAISAGIGVYNSEFSNPTIAATQGGSSNQFTITLSATPKEGYVWEDGTRDAK 365
           +TGAFGIVATVPVIVSSCSSTSDNN  G+NN   N         Q  T +  +++ V+LSG+LS IY+ T+G    NTN ++A  I SN    F NG  L NV    +TVNGNF + S WTG    A    W+A    + V Y   +  LNI+SLNDLKTQL+       I +A      G  F+    S+  + N           DLLHI+VT  +G+NT N +L IPVSDLNL ++ L V+V      TG NVE   + TT+FTYNIGI +T +F QPT  P+   A+ N + N+AL ALGY  ++DG  +L+N+ I+A +G+YN  F   +I      + N+FTITL ATP E YVWEDGTR+AK
  S:     1 LTGAFGIVATVPVIVSSCSSTSDNNGNGNNNNDNNGGGSGTDQQQGTTYTPAIKTEVSLSGSLSKIYDTTTGDSRKNTNEMIAQDILSNPEDYFTNGADLKNVQGWSVTVNGNFDSQSTWTGEAYSA----WSANATFSGV-YAMASEQLNITSLNDLKTQLSDSTKLKAICDA----IPGLRFSSATASSYQVQNQV----GFTGDDLLHINVTAQDGNNTRNMNLGIPVSDLNLKITGLKVSVNGTNNETGNNVESVENLTTDFTYNIGIKDTVDFTQPTTTPTTTEANKN-NVNEALKALGY-TKTDG--SLDNDKIAAAVGIYNCTFVASSI-QEDSNTPNKFTITLKATPNENYVWEDGTREAK 351
>gi|26554160|ref|NP_758094.1| signal-peptide-less P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454169|dbj|BAC44498.1| signal-peptide-less P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (692 aa)
Score = 447, Expect = 2.1e-42, Identities = 155/366 (42%), Positives = 219/366 (59%)
  Q:    10 KALAMTGAFGIVATVP-------VIVSSCSSTSDNNTGGDNNGGGNTQNQTISTQLRSSVTLSGALSNIYNPTSGSNTNTLLAAQIKSNLNSVFENGEALANVDDLEITVNGNFPTTSEWTGTTAFAGNNGWNATQGLTDVLYDWNTAALNISSLNDLKTQLTSEKITSIITEASSAPASGTVFTVVENSALGLTNNADSIDANASRDLLHIHVTGTEGSNTTNYDLQIPVSDLNLVVSDLTVTVTGTNVEQTGSTTTNFTYNIGINETANFVQPTQAPSINSADTNGDGNKALVALGYAN-ESDGNYTLNNEAISAGIGVYNSEFSNPTIA---ATQGGSSNQFTITLSATP--KEGYVWEDGTRDAKSISFPVTFTV 375
           K LA+TG F + A  P       VI  + S+ + NN   +  G  N QNQTI+ +L+SS+ LSG++  IY+  + S+T TL+A +IK+NL+S FEN E L +V++L I+V G+F   S W G   ++G NGW++T    +VLY  +   LNISSLNDLK QLT  KI  I+  + S+         V+N     +NN           L+HI+V    GS+  N DLQIP S +N  +S++ ++V+G NV+ T +TTT   YN+ IN   N  Q    P+  +++ + D NK LV LG+A   SD N TLN +A+   +G+YN  FSN +IA    T  G S  + I+  ATP   +G+VWEDGT  AKS+SF V   V
  S:    16 KILAITGIFTVSAATPIALVSKYVIFKNSSNGNSNNNNNNGGGNTNPQNQTITPKLKSSINLSGSIDKIYSSQNSSDTKTLIAQEIKNNLDSAFENSEELKSVNNLNISVEGDFGDNSSWAG-IEYSGTNGWSSTVSGNEVLYSTDLNTLNISSLNDLKYQLTDAKIKEILNASDSSKLKTNAEYTVKNKPGFTSNN-----------LIHINVFEILGSSVKNLDLQIPYSSVNFNISNMQISVSGDNVQTTNATTT-LNYNVAINTETNSTQIASRPTATASEIS-DVNKVLVKLGFAEIGSDNNVTLNQKALQEELGIYNVVFSNASIAPSGTTTDGQSGAYKISFDATPIANKGFVWEDGTSTAKSVSFDVNVDV 380
Score = 346, Expect = 1.1e-30, Identities = 127/324 (39%), Positives = 186/324 (57%)
  Q:    48 NTQNQTISTQLRSSVTLSGALSNIYNPTSGS----NTNTLLAAQIKSNLNSVFENGEALANVDDLEITVNGNFPTTSEWTGTTAFAGNNGWNATQGLTDV-LYDWNTAALNISSLNDLKTQLTSEKITSIITEASSAPASGTVFTVVENSALGLTNNADSIDANASRDLLHIHVTGTEGSNTTNYDLQIPVSDLNLVVSDLTVTVTGTNVEQTGSTTTNFTYNIGINETANFVQPTQAPSINSADTNGDGNKALVALGYA----NESDGNYTLNNEAISAGIGVYNSEFSNPTIAATQGGSSNQFTITLSATPKEGYVWEDGTRDAKSISFPV 371
           N     I+  L  ++ L+G++S I++ T+ S    +TNT++A  IK+N  + F NG  L  + DL +TVNGNFPT S WTG+        W +T   T+V +Y  +   LNISSL+DLKT++    I +++   S    SG  F     + LG T++          DLLH+ V  T      N DL IP+S +NL VS L V+V GT V+   +  TN+TYNIGI++T NF +PT    + + +   + N+ALV+LG+A    N +   YTL++  IS  +GVYN  F      A Q  S+N +TITL ATP   Y W+ GT +++ ++F V
  S:   377 NVDVGNITPDLNQTINLTGSVSKIFDTTTTSGTRKDTNTVIAEDIKANPENYFSNGSDLKTISDLAVTVNGNFPT-STWTGSPY----ETWKSTVTSTNVGIYSPSLPQLNISSLSDLKTKINQLGIYNVLL-TSGLTYSGATFAF--QNELGFTDD----------DLLHVCVRVTSTYGNVNVDLGIPLSSINLTVSALAVSVNGTGVQTLTNGNTNYTYNIGIDDTVNFTKPTTVSPL-TEENKTNVNEALVSLGFATKNTNSNPNTYTLDSTKISKALGVYNCTFEG---IAIQEDSANNYTITLKATPNANYNWDSGTNESRELTFKV 687
>gi|26554159|ref|NP_758093.1| signal-peptide-less P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454168|dbj|BAC44497.1| signal-peptide-less P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (713 aa)
Score = 446, Expect = 2.8e-42, Identities = 156/375 (41%), Positives = 226/375 (60%)
  Q:     1 MKIKKIKLLKALAMTGAFGIVATVPV------IVSSCSSTSDNNTGGDNNGGGNT-------------------------QNQTISTQLRSSVTLSGALSNIYNPTSGSNTNTLLAAQIKSNLNSVFENGEALANVDDLEITVNGNFPTTSEWTGTTAFAGNNGWNATQGLTDVLYDWNTAALNISSLNDLKTQLTSEKITSIITEASSAPASGTVFTVVENSALGLTNNADSIDANASRDLLHIHVTGTEGSNTTNYDLQIPVSDLNLVVSDLTVTVTGTNVEQTGSTTTNFTYNIGINET-ANFVQPTQAPSINSADTNGDGNKALVALGYANESDGN-YTLNNEAISAGIGVYNSEFSNPTIAATQGGSSN--QFTITLSATP--KEGYVWEDGTRDAKSISFPVTFTV 375
           MK K+ KLLK L++ G F + A VP+      ++ + +S+S+ N   ++                               Q+ +I  +L+SS+ LSG +  IYN  + S TN L+A +IK+NL   F+N   L NV+DL ITVNGNF  TS W G   + G NGW+ +    ++LY  +   LNISSLNDLK QLT  KI  I+  + S+  + +    V+N  LG TNN          +L+H+++    GS   N+DLQIP+S +N  VS+++++V+GT+V QT + TTNF YNI IN T +N  QPT  P  +S++   + +K LV LGYA+    N   LN E +    G+YN EFSN  IA     +     + ITL ATP   +G++W+DGT   KS+SF V   +
  S:     1 MKSKRSKLLKILSVIGIFAVSAAVPITLVSKYVIFTKTSSSNGNVDDNSGNNNGNDNSNPNDNNGNNDGGNDSNNNNTTPQDGSIVPRLKSSINLSGTVDKIYNSQNASETNNLIAEEIKTNLEQAFDNSTELENVNDLNITVNGNFADTSSW-GGNPYDGTNGWSGSTTGNEILYSTSLNQLNISSLNDLKHQLTDAKIKEILRSSDSSKLNESAEYTVKNK-LGFTNN----------NLVHVNIMEILGSGVRNFDLQIPISSINFNVSNMSISVSGTDV-QTTNATTNFNYNIAINNTESNTPQPTSTPKASSSEVT-NADKILVKLGYADVGTNNSIVLNQELLQEEFGIYNVEFSNAKIAPNTSTNRQVGSYKITLDATPIANKGFIWQDGTTSTKSVSFDVNVDI 398
Score = 360, Expect = 2.4e-32, Identities = 130/318 (40%), Positives = 187/318 (58%)
  Q:    54 ISTQLRSSVTLSGALSNIYN--PTSGS--NTNTLLAAQIKSNLNSVFENGEALANVDDLEITVNGNFPTTSEWTGTTAFAGNNGWNATQGLTDVLYDWNTAALNISSLNDLKTQLTSEKITSIITEASSAPASGTVFTVVENSALGLTNNADSIDANASRDLLHIHVTGTEGSNTT-NYDLQIPVSDLNLVVSDLTVTVTGTNVEQTGSTTTNFTYNIGINETANFVQPTQAPSINSADTNGDGNKALVALGYANESDGN----YTLNNEAISAGIGVYNSEFSNPTIAATQGGSSNQFTITLSATPKEGYVWEDGTRDAKSISFPV 371
           IS  L +++ L+G LS IY+   TSGS  +TNTL+A  IK+NL++ F NG  L  V++L ++ +G+FPTTS WTGT      + W+ +   + V Y  +   +NISSLNDLKT+  S+ I +++   S    S + FTV   + LG T            DLLH+++    G       DLQIP S++NL V  L VT  G+NV      TTNFTYNIGI +T +FV+PT   +  +     + N+ALV+LG+A  +  +    YTL++E ISA +GV+N  F   +I   +  + N +TI L A+P   Y WE G+ D K +SF V
  S:   401 ISPALNTTLNLTGPLSKIYDVEGTSGSRKSTNTLIAEDIKANLDTYFSNGNDLKTVENLSVSASGSFPTTSSWTGTEY----STWSTSVQYSAV-YGQSLGQINISSLNDLKTKWNSQGIYNVLL-GSGLRFSDSTFTV--QNLLGFTGG----------DLLHMNIFVNSGYTANFTVDLQIPASNINLTVPTLRVTANGSNVASLQVDTTNFTYNIGIKDTVDFVKPTTGVTALAPANKTNVNEALVSLGFATRNTSSNPYTYTLDSEKISAALGVFNCTFEGISITEDE-SNPNNYTIVLKASPNANYNWESGSSDPKELSFKV 708
>gi|26554120|ref|NP_758054.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454128|dbj|BAC44458.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (389 aa)
Score = 444, Expect = 5.1e-42, Identities = 164/361 (45%), Positives = 222/361 (61%)
  Q:    15 TGAFGIVATVPVIVSSCSSTSDNN----TGGDNNGGGNTQNQTISTQLRSSVTLSGALSNIYNPTSGSNTNTLLAAQIKSNLNSVFENGEALANVDDLEITVNGNFPTT-SEW--------TGTTAFAGNNGWNATQGLTDVLYDWNTAALNISSLNDLKTQLTSEKITSIITEASSAPASGTVFTVVENSALGLTNNADSIDANASRDLLHIHVTGTEGSNT---TNYDLQIPVSDLNLVVSDLTVTVTGTNVE--QTGSTTTNFTYNIGINETANFVQPTQAPSINSADTNGDGNKALVALGYANESDGNYTLNNEAISAGIGVYNSEFS--NPTIA----ATQGGSSNQFTITLSATP----KEGYVWEDGTRDAKSISFPVTFTV 375
           TGAFGIVATVPVIVSSCSSTSDNN    T      GG+TQ++ I+ +L   V+LSG+L +IY+ T  + TN LLA +IK N+N+VF+NGE L    DL+ITVNGNFP T S W        T  +       W+AT  L  V+Y  ++  +NI SL+DL TQL+ EK    I +A+    + T    ++N   GLTN+          DL+H++V GT        T YDLQIP SD+NLVVSDL+V V G N+E   +  TTT   +NIGI+ T ++ Q       +  + N + NK L  L +      + T++NEA+   +GVYN  FS    +IA      +  +  ++ +TL ATP    K  YVW+DGT   K I+FPVT  +
  S:    15 TGAFGIVATVPVIVSSCSSTSDNNTGGDTNQGGGTGGDTQSEKITPELNDKVSLSGSLKDIYDSTGATKTNELLAKEIKDNINTVFKNGEKLEAETDLKITVNGNFPETLSNWKDLPYIDSTEASNPTPAKSWSATTNLQTVVYATSSEQINIKSLDDLHTQLSVEKTLKDILKAAGVTNTDTSTYEIKNRP-GLTND----------DLIHVNVGGTANDTNKTKTIYDLQIPTSDINLVVSDLSVKVEGKNIETTDSTKTTTELDFNIGIDSTTHYNQTIDVTEAD--EKNVEVNKVLETLKFVKT---DKTIDNEALIKELGVYNVTFSLDGASIAKKETTARAATPTEYVVTLKATPNKNDKNTYVWDDGTSGTKDITFPVTIKI 387
>gi|26554118|ref|NP_758052.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454126|dbj|BAC44456.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (388 aa)
Score = 442, Expect = 8.6e-42, Identities = 152/361 (42%), Positives = 211/361 (58%)
  Q:    15 TGAFGIVATVPVIVSSCSSTSDNNTGGDNNGGGNTQNQTISTQLRSSVTLSGALSNIYNPTSGSNTNTLLAAQIKSNLNSVFENGEALANVDDLEITVNGNFPTT-SEWTGTTAF---------AGNNGWNATQGLTDVLYDWNTAALNISSLNDLKTQLTSEKITSIITEASSAPASGTVFTVVENSALGLTNNADSIDANASRDLLHIHVTGTEGSNT-TNYDLQIPVSDLNLVVSDLTVTVTGTNV--EQTGSTTTNFTYNIGINETANFVQPTQAPSINSADTNGDGNKALVALGYANESDGNYTLNNEAISAGIGVYNSEFSNPTIAATQGGSSN------QFTITLSATPKEG----YVWEDGTRDAKSISFPVTFTV 375
           TGAFGIVATVPVIVS+CSST++         GG TQ + I+ +L   V+L G+L +IY+ T    TN L+A +IK+N+NSVF+NGE LA   DL+ITVNGNFP T S W                 +  W+AT  L  VLY   +  ++I SL+DL T+L    I + + E        +    ++N   GLTN+          DL+H++V  T+  +T   +DLQIP SD+NLVVSDLTV V G N+   +   TTT F +NIGI+ T ++ Q ++  +  + D      + L  L  A     N  L+NEA+   +GVY   FS      T+    +      ++T+TL ATP +     YVW+DGT DAK I+FPVT  +
  S:    15 TGAFGIVATVPVIVSACSSTNNGGNNQGGGSGGTTQTEKITPELNEKVSLGGSLKDIYDSTGTKKTNELIAEEIKANINSVFKNGEKLAAESDLKITVNGNFPETLSNWKDLPYLDSSETADNATADKSWSATASLNKVLYPTTSKQIDIKSLDDLYTKLDEATIKAALKEGGVTTTETSKSFTIKNRP-GLTND----------DLIHVNVEETKSDDTKVQHDLQIPTSDINLVVSDLTVKVEGQNIETTENTKTTTEFDFNIGIDTTTHYNQGSETSTAQTEDAV-KVEQVLKDLKLATADGNNTKLDNEALIKALGVYTVTFSLDDAKVTKDSVQSRAPVDTKYTVTLKATPNKDSNNTYVWDDGTSDAKDITFPVTIKI 386
>gi|26554117|ref|NP_758051.1| P35 lipoprotein homolog reported as putative lipoprotein IMP13 [Mycoplasma penetrans HF-2] >gi|26454125|dbj|BAC44455.1| P35 lipoprotein homolog reported as putative lipoprotein IMP13 [Mycoplasma penetrans HF-2] >gi|27260911|dbj|BAC45034.1| lipoprotein P42 [Mycoplasma penetrans] (390 aa)
Score = 440, Expect = 1.2e-41, Identities = 156/361 (43%), Positives = 219/361 (60%)
  Q:    15 TGAFGIVATVPVIVSSCSST-----SDNNTGGDNNGGGNTQNQTISTQLRSSVTLSGALSNIYNPTSGSNTNTLLAAQIKSNLNSVFENGEALANVDDLEITVNGNFPTT-SEWT---------GTTAFAGNNGWNATQGLTDVLYDWNTAALNISSLNDLKTQLTSEKI--TSIITEASSAPASGTVFTVVENSALGLTNNADSIDANASRDLLHIHVTGTEGSNTT-NYDLQIPVSDLNLVVSDLTVTVTGTNVEQ--TGSTTTNFTYNIGINETANFVQPTQAPSINSADTNGDGNKALVALGYANESDGNYTLNNEAISAGIGVYNSEFSNPTI----AATQGGSSNQFTITLSATP-KEG---YVWEDGTRDAKSISFPVTFTV 375
           TGAFGIVATVPVIVSSCSST      + N        GNTQ++ I+ +L   V+L+G+L +IY+ T    +N L+A +IK+N+  VF+NGE LA   DL+ITV+G FP   + WT           +    N  W+A   L  VLY   +  +NI SL+DLKT+L    +   ++     S   + T F +    AL             + DL+H++V  T+   +T  +DLQIP SD+NLVVS+L+V V G N+E   T  TTT F +NIGI+ T ++ Q + A S  + + + D NK L  L  A +  G   LNNEA+   +G+YN  FS+P+I       +  ++  + ITL ATP KEG   YVW+DGT +AK I+FPVT  +
  S:    15 TGAFGIVATVPVIVSSCSSTSDNNNGNGNNNNGGGSDGNTQSEKITPELNDKVSLAGSLKDIYDSTGTKKSNELIAEEIKNNIKDVFKNGEKLAAETDLKITVDGGFPEKLTNWTDLPYVDNTDDASKKDPNKSWSAITDLNPVLYSTKSNQINIKSLDDLKTELQKTDVLKNALKDAGVSTAETSTAFEIKNQPAL------------TNDDLVHVNVIETKSDKSTVQHDLQIPTSDINLVVSNLSVKVEGKNIESTDTTKTTTEFNFNIGIDSTQHYDQGS-AKSAATTEGDVDVNKVLKDLNLATDDKG--ALNNEALIKALGIYNVTFSSPSIKKATVTARAATATSYEITLKATPNKEGNNTYVWDDGTTEAKDITFPVTIDI 388
>gi|26554156|ref|NP_758090.1| signal-peptide-less P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454165|dbj|BAC44494.1| signal-peptide-less P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (697 aa)
Score = 436, Expect = 3.6e-41, Identities = 142/329 (43%), Positives = 204/329 (62%)
  Q:    48 NTQNQTISTQLRSSVTLSGALSNIYNPTSGS----NTNTLLAAQIKSNLNSVFENGEALANVDDLEITVNGNFPTTSEWTGTTAFAGNNGWNATQGLTDVLYDWNTAALNISSLNDLKTQLTSEKITSIITEASSAPASGTVFTVVENSALGLTNNADSIDANASRDLLH--IHVTGTEGSNTTNYDLQIPVSDLNLVVSDLTVTVTGTNVEQTGSTTTNFTYNIGINETANFVQPTQAPSINSADTNGDGNKALVALGYANESDGNYTLNNEAISAGIGVYNSEFSNPTIAATQGGSSNQFTITLSATPKEGYVWEDGTRDAKSISFPVTFTVT 376
           N     I+  L S++ L G+LS I++ TSGS    +TNT++A  IKSNLN+ F NG  L  V+DL++TVNGNFPT S WTG       + W ++   T + Y   +A ++I+SLNDLKT+LT++ +  I+  A+    SG+ F +   + +GL+            DLLH  I +T    +N    DL IPVSD+NL VS+L V+V+G+NV+   + + N+TYN+GI++T NFV+PT   +  S+    + N+ALV+LG+A +S  NYTLN + ISA +GV+N  F   +I      ++N FTITL ATP   Y WEDGT   K +SF V  TV+
  S:   384 NVSVDEITPSLNSTLDLKGSLSRIFD-TSGSGTRKDTNTVIAEDIKSNLNNYFSNGNDLKTVEDLDVTVNGNFPT-STWTGVAY----DTWKSSTSYTGI-YSSESAQIDITSLNDLKTKLTTKGLYGILL-AAGLKFSGSSFAI--QNEIGLSGG----------DLLHVNIRITSEWTTNPFTVDLAIPVSDINLKVSNLGVSVSGSNVKALSNGSVNYTYNVGIDDTVNFVKPTTGVTALSSANKTNVNEALVSLGFATKSGTNYTLNKDKISAALGVFNCTFEGISI-QEDASTANNFTITLKATPNTNYYWEDGTNVPKELSFKVDLTVS 697
Score = 394, Expect = 2.7e-36, Identities = 147/375 (39%), Positives = 225/375 (60%)
  Q:     1 MKIKKIKLLKALAMTGAFGIVATVPVIVSSCSSTSDNNTGGDNNGGGNT-----------QNQTISTQLRSSVTLSGALSNIYNP--TSGSNTNTLLAAQIKSNLNSVFENGEALANVDDLEITVNGNFPTTSEWTGTTAFAGNNGWNATQGLTDVLYDWNTAALNISSLNDLKTQLTSE-KITSIITEASSAPASGT-VFTVVENSALGLTNNADSIDANASRDLLHIHVTGTEGS-NTTNYDLQIPVSDLNLVVSDLTVTVTGTNVEQTGSTTTNFTYNIGINETANFVQPTQAPSINSADTNGDGNKALVALGYANESDGN-YTLNNEAISAGIGVYNSEFSNPTIA-----ATQGGSSNQFTITLSA--TPKEGYVWEDGTRDAKSISFPVTFTV 375
           MK ++ KLLK L++TG F   A VP+ + S    S + T   N    +            Q QTI  +L+SS+ LSG+L  I++   +S SNTN+L+A +IK+NL+  F+N   L  V++L I+V+G F     W G   +  N GW       ++LY  +    NISSL+D K+QL ++ K+  II+++ ++    T  +++   S LGL  +          +L+H++V  T+ S NT + DLQIP+S++NL VS++ V+V+G NVE   + TTNF+YN+GI++ + F  P  AP + SA      NK LV LGYA  +  N  TLN + +   +G+YN  FSN   +     +T  G++  + I+L A  TP + +VWEDGT D K +SF V  +V
  S:     1 MKSQRKKLLKILSITGIFVATAAVPITLLSKYVISASLTNSKNQNNQDNNNQDGGGDTTPQAQTIVPKLKSSINLSGSLDKIFDAKNSSSSNTNSLIAQEIKNNLDKSFDNASDLEKVNNLSISVDGGFSGGVTW-GNKQYDQNIGWGKETVGNEILYGSSLDQFNISSLDDFKSQLNNDTKLKDIISKSDASKFDSTATYSIASGSNLGLVGD----------NLVHVNVIETDASSNTKSIDLQIPISNINLNVSNMIVSVSGDNVETQTNKTTNFSYNVGISDQSQFTNPVDAP-VASASEVKSANKILVKLGYAEVAANNQITLNQDLLKEELGIYNVTFSNANASIAPNGSTTDGTTGSYKISLDATPTPNKDFVWEDGTSDTKPVSFNVNVSV 387
>gi|26554162|ref|NP_758096.1| signal-peptide-less P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454171|dbj|BAC44500.1| signal-peptide-less P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (685 aa)
Score = 434, Expect = 7.4e-41, Identities = 136/369 (36%), Positives = 207/369 (56%)
  Q:     7 KLLKALAMTGAFGIVATVPVIVSSCSSTSDNNTGGDNNGGGNTQNQTISTQLRSSVTLSGALSNIYNPTSGSNTNTLLAAQIKSNLNSVFENGEALANVDDLEITVNGNFPTTSEWTGTTAFAGNNGWNATQGLTDVLYDWNTAALNISSLNDLKTQLTSE-KITSIITEASSAPASGTVFTVVENSALGLTNNADSIDANASRDLLHIHVTGTEGSNTTNYDLQIPVSDLNLVVSDLTVTVTGTNVEQTGSTTTNFTYNIGINETANFVQPTQAPSINSADTNGDGNKALVALGYANESDGN-YTLNNEAISAGIGVYNSEFSNPTIA---ATQGGSSNQFTITLSATP--KEGYVWEDGTRDAKSISFPVTFTV 375
           K +K   +TG F   A +PV++ S      N++  +N    +  +Q I+ +L+SS++LSG +  IY+    + TNTL+A +I +NL+ VFEN + L  V++L+I V G+F  +S W+G   + G+NGW        +LY      LNISSLNDLKTQL ++ KI  II E  S+  +      ++N             A  + +LLH++V    GSNT  +DLQIP S +NL +S+++++V+G NV+   S   +F YN+ +   + F+ P   P + SA    + NK LV LG A  +  N   L  +AI   +G+YN EFSN +IA    T  G S  + I+L ATP     +VW+DG    ++I+F V   V
  S:     6 KKIKTWGLTGIFAASAAIPVVLISRYVLFRNSSSINNQNSESDNSQFITPKLKSSISLSGTIDKIYDSQKATVTNTLVAQEIHNNLDQVFENSQDLQKVNNLKIAVEGDFTNSSSWSGVD-YEGDNGWKGLTKGNVILYSSKFGQLNISSLNDLKTQLDNDAKIKEIIREFDSSKLNQNAIYSIQNKP-----------AVTNDNLLHVNVIAILGSNTKYFDLQIPTSSINLNISNMSISVSGNNVKPLTSAVASFNYNVSLAPKSYFMNPASTP-VASASEVTNANKILVKLGLAEVTTRNQIVLTQKAIQEQLGIYNVEFSNASIAPSGTTTNGKSGLYQISLQATPIANGDFVWDDGQNTVRTITFEVWVNV 368
Score = 372, Expect = 9.4e-34, Identities = 123/323 (38%), Positives = 180/323 (55%)
  Q:    54 ISTQLRSSVTLSGALSNIYNPTSGSN-----TNTLLAAQIKSNLNSVFENGEALANVDDLEITVNGNFPTTSEWTGTTAFAGNNGWNATQGLTDVLYDWNTAALNISSLNDLKTQLTSEKITSIITEASSAPASGTVFTVVENSALGLTNNADSIDANASRDLLHIH--VTGTEGSNTTNYDLQIPVSDLNLVVSDLTVTVTGTNVEQTGSTTTNFTYNIGINETANFVQPTQAPSINSADTNGDGNKALVALGYA----NESDGNYTLNNEAISAGIGVYNSEFSNPTIAATQGGSSNQFTITLSATPKEGYVWEDGTRDAKSISFPVTFTVT 376
           I+  + S++ ++G  S I+   +G+      TN ++A  IKSNL+  F NG  L  V++L I V GNFP TS WTG         W+ T     + Y  ++  +NI+SLNDLKT+L S  +   + + S+       FT++  + LG T            DL+H++  V       T   D+ IP SD+NL++S+L +   G NV    S   NFTYNIGIN++ +F++PT   +  S     + N+ALV+LG+A    + + G YTLN + ISA +GV+N  F   +I     GSS  FTI+L ATP   Y WEDGT  +K +SF V  T +
  S:   371 ITPTVNSTLNITGPFSKIFAANTGTGNNRVRTNDVIADDIKSNLSKYFSNGNDLKTVENLNIRVEGNFPETSVWTGEPYEV----WSKTTRFKGI-YSSSSQKINITSLNDLKTKLNSIGLGKFLLD-SNLLFRDASFTIL--NQLGFTGG----------DLIHVNILVNSPYTQGTFTVDVGIPTSDINLIISNLKIASFGDNV-TLQSVPVNFTYNIGINDSVDFIKPTTGVTPLSDANKNNVNEALVSLGFATRNIDSNPGTYTLNPDKISAALGVFNCTFEGISIKDVSNGSSRSFTISLIATPNNNYYWEDGTNTSKELSFTVNLTAS 685
>gi|26554196|ref|NP_758130.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454205|dbj|BAC44534.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (382 aa)
Score = 430, Expect = 2.0e-40, Identities = 163/363 (44%), Positives = 214/363 (58%)
  Q:    15 TGAFGIVATVPVIVSSCSSTSDNNTGGDNNGGGNTQNQTISTQLRSSVTLSGALSNIYN--PTSGSNTNTLLAAQIKSNLNSVFENGEALANV-DDLEITVNGNFPTTSEWTGTTAFAGNNGWN------ATQGLTDVLYDWNTAALNISSLNDLKTQLTSEKITSIITEASSAPASGTVFTVVENSALGLTNNADSIDANASRDLLHIHVTGTEGSNT-TNYDLQIPVSDLNLVVSDLTVTVTGTNVEQTGSTTTNFTYNIGINETANFVQPTQAPSINSADTNGDGNKALVALGYANESDGNYTLNNEAISAGIGVYNSEFSNPTI----AATQGGSSNQFTITLSATPKEG-YVWEDGT--RDAKSISFPVTFTVTT 377
           TGAFGIVATVPVIVSSCSSTS+NN G  N G    Q Q ++  L+  V+L GAL+ IY+   T   NTNTL+A  IK+N  + F NG  L NV  D  +TV+G F   S  +G +  A    W         Q    ++Y  ++  +NI+SL+ LKT+L    +     EA+ A    +  T+   + LG TN+          DL+HI+V  T  S   TNYDLQIP SD+NL V+DL+VTVTG N+E    TTTNFTYNIGI+   +F Q     +  S D   D NK L  L Y + +   ++L+N AI  G+G+YN  FSNP+I     +++  S   +TITL A P+   YVW DG+    AK ISF V   VTT
  S:    15 TGAFGIVATVPVIVSSCSSTSENNNGNGNGGA--DQTQKVTPVLKDDVSLEGALNKIYDTSTTDRKNTNTLIADDIKANPENYFTNGAELKNVISDATVTVDGKFSNASWASGLSYDATTGNWKDDTTTVTIQDSNKLVYASSSKQINITSLDGLKTELEKTDVLKNALEAAGATTIASGTTLTVENKLGFTND----------DLIHINVKATPTSGAETNYDLQIPTSDINLSVTDLSVTVTGNNIEAATKTTTNFTYNIGIDSEVHFNQGANLTAA-SEDDAKDVNKVLEQLKYGSTTGSTFSLDNNAIIKGLGIYNVNFSNPSIQEKTVSSRATSEKTYTITLDAKPQSSEYVWADGSDVNTAKKISFDVKIDVTT 381
>gi|26554129|ref|NP_758063.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454137|dbj|BAC44467.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (384 aa)
Score = 416, Expect = 8.4e-39, Identities = 158/362 (43%), Positives = 222/362 (61%)
  Q:    14 MTGAFGIVATVPVIVSSCSSTSDNNTGGDNNGGGNTQNQTISTQLRSSVTLSGALSNIYNPTSGSNTNTLLAAQIKSN-LNSVFENGEALANVDDLEITVNGNFPTTSEWTGTTAFAGNNGWNATQGLTD---------VLYDWNTAALNISSLNDLKTQLTSEKITSIITEASSAPASGTVFTVVENSALGLTNNADSIDANASRDLLHIHVTGT---EGSNTTNYDLQIPVSDLNLVVSDLTVTVTGTNVEQTGSTTTNFTYNIGINETANFVQPTQAPSINSADTNGD--GNKALVALGYANESDGNYTLNNEAISAGIGVYNSEF-----SNPTIAATQGGSSNQFTITLSATPKE-GYVWEDGTRDAKSISFPVTFTV 375
           MTGAFGIVATVPVIVSSCSSTSDNN   +   G N Q QTI+ +L  +V LSG+LS+IY+ T   N N  +AA IK N L+ VF NG+AL+ V DL +TV+G F + + WTG T       W  ++  ++         ++Y   +  +NI SL+DL  +L+  +      E +   +     T+  ++ LG TN           DLLH++VT T     +  TNYDLQIPVS+LNLVV +LT+TV GTNV +   TTTNF +N+GI+ T NF Q   APS  + +  GD   +  L  LGY   + G+  L+N+ ISA +G+YN +F     +  T A      +  +T+T++A P +  YVW+DG+  +K  +F V+ TV
  S:    14 MTGAFGIVATVPVIVSSCSSTSDNNGNNNGGNG-NQQTQTITPELNETVNLSGSLSDIYDSTGTLNANQKIAADIKDNHLSDVFANGQALSEVSDLSVTVSGEF-SRALWTGLTFNGETGNWEDSEDNSNNITIADANKLVYTSESDQINIESLDDLHNKLSVRETLKTALENAGVASIPETTTLAVSNNLGFTNG----------DLLHVNVTATPTGASATATNYDLQIPVSNLNLVVPNLTITVAGTNVGEANRTTTNFNFNVGIDPTLNFSQTGNAPSATTDEVTGDDAASTILQKLGYTTAT-GSTDLSNDKISAALGIYNCKFTPTNATENTSATATNNGNKVYTVTVTAEPYDTSYVWDDGSSGSKEFTFDVSLTV 383
>gi|26554101|ref|NP_758035.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454109|dbj|BAC44439.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (394 aa)
Score = 415, Expect = 1.0e-38, Identities = 144/363 (39%), Positives = 210/363 (57%)
  Q:    15 TGAFGIVATVPVIVSSCSST------SDNNTGGDNNGGGNTQNQTISTQLRSSVTLSGALSNIYNPTSG--SNTNTLLAAQIKSNLNSVFENG---EALANVDDLEITVNGNFPTTS------------EWTGTTAFAGNNGWNATQGLTDVLYDWNTAALNISSLNDLKTQLTSEKITSIITEASSAPASGTVFTVVENSALGLTNNADSIDANASRDLLHIHVTGTEGSNTTNYDLQIPVSDLNLVVSDLTVTVTGTNVEQTGSTTTNFTYNIGINETANFVQPTQAPSINSADTNGDGNKALVALGYANESDGNYTLNNEAISAGIGVYNSEFSNPTI----AATQGGSSNQFTITLSATPKEG-YVW-EDGTRDAKSISFPVTFTVTT 377
           TGAFGIVATVP+IVSSCSST      S +N  G+  G    Q + ++ +L+S V+LSG+L  IY+ ++     TN L+A  +K++  + F NG   E    + +  +TV+G F T              E +       N  W+AT+ L  VL+   +  ++I SL+DL ++L   K+  + T A  A A  T FTV   + LG TN+          DL+H++V G      T YDLQIP SD+NL VSDL++ V GTN+E    T+T F +NIGI+   NF Q +   + N+ D     ++ L  LG+A ++  +  L+N+AI  G+G+YN  FS   I      T+      +T++L A P    YVW +D T D K+ISF VT  + T
  S:    15 TGAFGIVATVPIIVSSCSSTGDNNGGSGDNNNGNQGGQDGQQTEKVTPELKSEVSLSGSLDKIYDSSTKDRKTTNQLIADDVKAHPENYFTNGDKTEVKETIKNATVTVDGKFTTEETESPWKDVAYLDESSDANKTDANKSWSATKDLKPVLFPTTSDQIDIKSLDDLHSKLNEAKLKEVFTNAKIANADKTTFTV--KNKLGFTNS----------DLIHVNVEGDNSGTKTQYDLQIPTSDINLSVSDLSIKVEGTNIEAQEKTSTKFDFNIGIDSKENFNQGSTEIAYNTKDLV-KVDEVLEKLGFAKKNGSSTELDNDAIIKGLGIYNVNFSGQEIKEKTVTTREQKDTTYTVSLKAKPTSNKYVWADDSTSDEKTISFDVTIKIGT 393
>gi|986921|gb|AAC16392.1| p35 lipoprotein [Mycoplasma penetrans] >gi|1583185|prf||2120285A lipoprotein (362 aa)
Score = 400, Expect = 6.0e-37, Identities = 145/360 (40%), Positives = 205/360 (56%)
  Q:    15 TGAFGIVATVPVIVSSCSSTSD--NNTGGDNNGGGNTQNQTISTQLRSSVTLSGALSNIYNPTSGSN---TNTLLAAQIKSNLNSVFENGEALANV-DDLEITVNGNFPTTSEWTGTTAFAGNNGWNATQGLTDVLYDWNTAALNISSLNDLKTQL-TSEKITSIITEASSAPASGTVFTVVENSALGLTNNADSIDANASRDLLHIHVTGTEGSNTTNYDLQIPVSDLNLVVSDLTVTVTGTNVEQTGSTTTNFTYNIGINETANFVQPTQAPSINSADTNGDGNKALVALGYANESDGNYTLNNEAISAGIGVYNSEFSNPTIAATQGGSSNQFTITLSATPKEGYVWEDGTRDAK-SISFPVTFT 374
           TGAFGIVATVPVIVSSCSSTS+   N  G+    GNTQ   ++  ++S V+L+GALS IY+  +G++   T+ L+   IK+N  + F NGEAL +V     +TV+G F T S +TG       + W+A   +    Y   +  L+I S+NDL+T L  S  I  I     +   +      V N+ L L           S DLLHI+VT  +G    + DL IPVSDLNL +  L ++V+GT + +T   TTN+ +NIGI+ T   + P       +  TN +  K L  LGYA  S   YTL+ + ++  +G+YN +F     +     ++N++T+TL ATP +GY WEDGT  AK  ISF  TF+
  S:    15 TGAFGIVATVPVIVSSCSSTSENNGNGNGNGGTDGNTQQTEVTPAIKSEVSLTGALSKIYDTKTGTDRETTSQLIVKDIKANPENYFTNGEALKDVIASATVTVDGGF-TESTFTGEAY----SVWSAKADVKKGTYSQASKQLDIKSINDLQTVLGDSAAIKGICDLIPNLKLNNGTDYKVTNNGLSL-----------SEDLLHINVTAKDGQTDVSMDLAIPVSDLNLKIDGLKISVSGTGI-KTSELTTNYKFNIGIDNTVKTLTPAAVTLAEADRTNAE--KVLEKLGYATVSGSTYTLDQDKLADALGLYNCKFE-AVKSEKDSTNNNKYTVTLKATPNDGYFWEDGTNGAKEEISFVATFS 362
>gi|26554135|ref|NP_758069.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|27805656|sp|Q50367|P35_MYCPE Lipoprotein p35 precursor >gi|26454143|dbj|BAC44473.1| P35 lipoprotein [Mycoplasma penetrans HF-2] (362 aa)
Score = 399, Expect = 7.0e-37, Identities = 145/360 (40%), Positives = 205/360 (56%)
  Q:    15 TGAFGIVATVPVIVSSCSSTSD--NNTGGDNNGGGNTQNQTISTQLRSSVTLSGALSNIYNPTSGSN---TNTLLAAQIKSNLNSVFENGEALANV-DDLEITVNGNFPTTSEWTGTTAFAGNNGWNATQGLTDVLYDWNTAALNISSLNDLKTQL-TSEKITSIITEASSAPASGTVFTVVENSALGLTNNADSIDANASRDLLHIHVTGTEGSNTTNYDLQIPVSDLNLVVSDLTVTVTGTNVEQTGSTTTNFTYNIGINETANFVQPTQAPSINSADTNGDGNKALVALGYANESDGNYTLNNEAISAGIGVYNSEFSNPTIAATQGGSSNQFTITLSATPKEGYVWEDGTRDAKS-ISFPVTFT 374
           TGAFGIVATVPVIVSSCSSTS+   N  G+    GNTQ   ++  ++S V+L+GALS IY+  +G++   T+ L+   IK+N  + F NGEAL +V     +TV+G F T S +TG       + W+A   +    Y   +  L+I S+NDL+T L  S  I  I     +   +      V N+ L L           S DLLHI+VT  +G    + DL IPVSDLNL +  L ++V+GT + +T   TTN+ +NIGI+ T   + P       +  TN +  K L  LGYA  S   YTL+ + ++  +G+YN +F     +     ++N++T+TL ATP +GY WEDGT  AK  ISF  TF+
  S:    15 TGAFGIVATVPVIVSSCSSTSENNGNGNGNGGTDGNTQQTEVTPAIKSEVSLTGALSKIYDTKTGTDRETTSQLIVKDIKANPENYFTNGEALKDVIASATVTVDGGF-TESTFTGEAY----SVWSAKADVKKGTYSQASKQLDIKSINDLQTVLGDSAAIKGICDLIPNLKLNNGTDYKVTNNGLSL-----------SEDLLHINVTAKDGQTDVSMDLAIPVSDLNLKIDGLKISVSGTGI-KTSELTTNYKFNIGIDNTVKTLTPAAVTLAEADRTNAE--KVLEKLGYATVSGSTYTLDQDKLADALGLYNCKFE-AVKSEKDSTNNNKYTVTLKATPNDGYFWEDGTNGAKEDISFVATFS 362
>gi|26554123|ref|NP_758057.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454131|dbj|BAC44461.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (388 aa)
Score = 394, Expect = 3.0e-36, Identities = 146/361 (40%), Positives = 208/361 (57%)
  Q:    15 TGAFGIVATVPVIVSSCSSTSDNNTGGDNNGGGNTQNQTISTQLRSSVTLSGALSNIYNPT-----SGSNTNTLLAAQIKSNLNSVFENGEALANVDDLE---ITVNGNFPTTSEWTGTTAFAGNNGWNAT--QGLTDVLYDWNTAALNISSLNDLKTQLTSEKITSIITEASSAPASGTVFTVVENSALGLTNNADSIDANASRDLLHIHVTGTEGSNTTNYDLQIPVSDLNLVVSDLTVTVTGTNVEQTGSTTTNFTYNIGINETANFVQPTQAPSINSADTNGDGNKA----LVALGYANESDGNYTLNNEAISAGIGVYNSEFSNPTIAATQGGSSNQ--------FTITLSATP-KEGYVWEDGTRDAKSISFPVTFTV 375
           TGAFGIVATVP+IVSSCSSTSDNNTGG+ +G    Q Q ++  L+  V L G+LS I++ T     S  +TNTL++  IK+N  + F NG      + +E   I V GNF   S WTG      +NGW+    +    ++Y  ++A L    L+ LKT+L      +     ++  A+G   T+  ++ L + N         S DL+HI+V   +    T YDLQIP S+LNL V+ LT+ V+G N+     TTTNF YNIGI+ T  F Q   A    +A+   D   A    LV LGY   + G+  L+N+ ISA +G+YN  F+  +    QG + +         +T+T++ATP  + YVW+DG+   K  SF V+  V
  S:    15 TGAFGIVATVPIIVSSCSSTSDNNTGGNQDG---QQTQKVTPVLKDEVDLKGSLSKIFDTTATDASSRKSTNTLISEDIKANPENYFTNGNETNVKEAIEKATIDVEGNFSNAS-WTGNAYNTTSNGWDGVTIEDANKLIYTTSSAQLTFKDLDGLKTELEKNGTDNKTVLQNALEAAGA--TIEADTTLTIKNRV----GFTSGDLIHINVEADKSGTQTQYDLQIPTSNLNLSVTGLTIKVSGDNINTNEKTTTNFKYNIGIDSTLGFEQAKGAAPEETANNLSDAATAAKNILVKLGYVTTTGGS-DLSNDKISAALGIYNCNFTPKSATEKQGATPDAGVTDANKVYTVTVTATPFNDTYVWDDGSSGEKDFSFDVSLKV 387
>gi|26554110|ref|NP_758044.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454118|dbj|BAC44448.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (391 aa)
Score = 387, Expect = 1.8e-35, Identities = 163/364 (44%), Positives = 215/364 (59%)
  Q:    14 MTGAFGIVATVPVIVSSCSSTSDNNTGGDNNGGGNTQNQTISTQLRSSVTLSGALSNIY-----NPTSGSNTNTLLAAQIKSN-----LNSVFENGEALANVDDLEITVNGNFPTTSEWTGTTAFAGNNGWNATQGLTDV------LYDWNTAALNISSLNDLKTQL-----TSEKITSIITEASSAPASGTVFTVVENSALGLTNNADSIDANASRDLLHIHVTGTEGSNT-TNYDLQIPVSDLNLVVSDLTVTVTGTNVEQTGSTTTNFTYNIGINETANFVQPTQAPSINSADTNGDGNKALVALGYANESDGNYTLNNEAISAGIGVYNSEFSNPTIA----ATQGGSSNQFTITLSATP--KEGYVWED-GTRDAKSISFPVTFTVTT 377
           MTGAFGIVATVPVIVSSCSSTSDNNT G  N GG+TQ Q +S QL+ SV L G+LS I+     N +S  +TNTL++  IK+N       +          + +  + V GNF ++S W G      +  W A   +  +      LY  N   L    L+ LKT+L      ++ +     E + A         +EN  LGLTN+          DLLH++V  T+ +    NYDLQIPVSDLNL VSDL++ VT  N+E    TTT + YNIGI+ T ++VQ T  PS N  + + D NK L  L  A  +D N TL+NEA+   +GVYN +FSNPTIA     T+      +TITL ATP   + YVW D G  + + I+F VT  + T
  S:    14 MTGAFGIVATVPVIVSSCSSTSDNNT-GGGNNGGDTQTQKVSLQLKDSVDLKGSLSKIFDTEATNASSRKSTNTLISEDIKANPGTYFTFTETTEETVKETIQNATVEVEGNF-SSSSWEGQAYNQESGNWGADSSVVTIDPANKYLYPTNLDQLTFKDLDGLKTELEKTGTNNKTVLQNALETAGATIDAGAQLSIENR-LGLTND----------DLLHVNVKETKANTADKNYDLQIPVSDLNLSVSDLSIKVTSDNIETGEKTTTKYDYNIGIDPTTHYVQGTTKPSAND-EASVDVNKVLEDLSLA--TDANGTLDNEALIKALGVYNVQFSNPTIAKKATTTRAIEDTVYTITLKATPTANKNYVWSDNGNSEERDITFDVTLAIGT 390
>gi|26554111|ref|NP_758045.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454119|dbj|BAC44449.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (374 aa)
Score = 387, Expect = 2.1e-35, Identities = 142/362 (39%), Positives = 207/362 (57%)
  Q:    15 TGAFGIVATVPVIVSSCSSTSDNNTGGDNNGGGNT------------QNQTISTQLRSSVTLSGALSNIYNPTSGS-NTNTLLAAQIKSNLNSVFENGEALANV-DDLEITVNGNFPTTSEWTGTTAFAGNNGWNATQGLTDVLYDWNTAALNISSLNDLKTQLTSEK--ITSIITEASSAPASGTVFTVVENSALGLTNNADSIDANASRDLLHIHVTGTEGSNTTNYDLQIPVSDLNL-----VVSDLTVTVTGTNVEQTGSTTTNFTYNIGINETANFVQPTQAPSINSADTNGDGNKALVALGYANESDGNYTLNNEAISAGIGVYNSEFSNPTIAATQGGSSNQFTITLSATP-KEGYVWEDGTRDAKSISFPVTFTVT 376
           TGAFGIVATVPVIVSSCSST +  +G +  G GN             +N+T+  +L   V+L G+LS IY+  S S  TN L++  +K+N    F NG  L +V    ++TV+G F + SEW     ++    W+ + G+  V Y      ++I+SLNDLK +   +   I + +T A+      T +TV    +L            +S DLLH+++ GT+     N DLQIPVS++NL     +  D T   +GTN+E     TTNF+YNIGI+ T NF Q    P+   A+   D  K L  LGY +       L+N+ ISA +GVYN +F      +++ G   ++ +TL+ATP    Y+W+DGT   K + FPV+ TV+
  S:    15 TGAFGIVATVPVIVSSCSSTDNGGSGNNTGGNGNQGDGGGSGGTGQQENKTVKPELLKDVSLGGSLSTIYSSGSDSKTTNELISEDVKTNPEKYFTNGTELKDVIKQTKVTVDGGF-SASEWQNGDPYS---TWSTSNGIVKVTYPAAAPQIDIASLNDLKQKTFKDDAAIQTFLTAANLTFTGVTNYTVENQLSL------------SSGDLLHVNLKGTKSGGNLNVDLQIPVSNINLKATLKISVDATNNESGTNIEAVTDLTTNFSYNIGIDSTVNFTQTGATPTATEAEAK-DAQKVLEKLGYVSSG----ALDNDKISAALGVYNCKF---VAKSSEPGEGGKYNVTLTATPFDSNYIWDDGTSGPKDLQFPVSLTVS 374
>gi|26554137|ref|NP_758071.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454145|dbj|BAC44475.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (361 aa)
Score = 386, Expect = 2.8e-35, Identities = 143/360 (39%), Positives = 205/360 (56%)
  Q:    15 TGAFGIVATVPVIVSSCSSTSDNNTGGDNNGGGNTQNQTISTQ----LRSSVTLSGALSNIYNPTSGSNTNTLLAAQIKSNLNSVFENGEALAN-VDDLEITVNGNFPTTSEWTGTTAFAGNNGWNATQGLTDVLYDWNTAALNISSLNDLKTQLTSEKITSIITEASSAPASGTVFTVVENSALGLTNNADSIDANASRDLLHIHVTGTEGSNT--TNYDLQIPVSDLNLVVSDLTVTVTGTNVEQTGSTTTNFTYNIGINETANFVQPTQAPSINSADTNGDGNKALVALGYANESDGNYTLNNEAISAGIGVYNSEFSNPTIAATQGGSSNQFTITLSATPKEGYVWEDGTRDAKS-ISFPVTFT 374
           TGAFGIVATVPVIVSSCSSTSDNN   DNN GG        T+    +++ V+LSGALS IY+      T+ L+A  IK+N  + F+NG+AL   + D  ++VNG F T S + G T    +   +A +G     Y  + A LNI S+NDL+TQL   K    + E+ S+        +   S   +  NA  +D     DLLH+++T  E   T     DL IPVSDLNL + DL ++V GT ++ +   TT +T+N+GI+ T   +  T A  + + +   +  K + ALGY + +  N  L+N+ +S  +G+YN  F    +    G +S ++TI L ATP + YVWEDGT   K+ +SF  T +
  S:    15 TGAFGIVATVPVIVSSCSSTSDNNGNSDNNPGGQGDGGQQQTEVTPTIKTEVSLSGALSKIYD--GKKTTSDLIAEDIKANPTNYFDNGDALKELIKDATVSVNGGF-TESTFKGETYDVWSK--DAKKG----TYPQSAAQLNIKSINDLETQLGDSKAIQTLCESISS------LKITNGSDYKVEKNALKLDG----DLLHVNITAKEDGKTDRVKMDLAIPVSDLNLKIDDLKISVNGTGIKTSTDLTTKYTFNVGIDNTVKTI--TGAKGVLAENERKEFLKVMKALGYTDTAGTN--LDNDKLSDALGLYNCSFEVTGVDPVTGSTSGEYTIKLKATPNKDYVWEDGTNTPKTDVSFVATLS 359
>gi|26553715|ref|NP_757649.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26453722|dbj|BAC44053.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (519 aa)
Score = 384, Expect = 3.8e-35, Identities = 141/364 (38%), Positives = 218/364 (59%)
  Q:    15 TGAFGIVATVPVIVSSCSSTSD----NNTGGDNNGGGNTQNQTISTQLRSSVTLSGALSNIYNPTSGSNTNTLLAAQIKSNLNSVFENGEALANVDDLEITVNGNFPTTSEWTGTTAFAGNNGWNATQGLTD--VLYDWNTAALNISSLNDLKTQLTSE-KITSIITEASSAPASGTVFTVVENSALGLTNNADSIDANASRDLLHIHVTGTEGSNTTNYDLQIPVSDLNLVVSDLTVTVTGTNVEQTGSTTTNFTYNIGINETANFVQPTQAPSINS-------------ADTNGDGNKALVALGYANESDGNYT----LNNEAISAGIGVYNSEFSNPTIA----------ATQGGSSNQFTITLSATPKEGYVWEDGTRDAKSISFPVTFTVTTA 378
           TGAFGI+ATVPVIVSSCS+TSD    NN  G  +GGG TQ + ++ + +SS+ L GAL++IYNP+ G NTNTLL  +IK+NL+S FEN   L N  +  +TV GNF + S W G     GN  WN      D  + YD  +  ++ISSLNDLK +L+ E  +   +++A  A   G+ +T+   + LGLT+N          +L+H++V G   + TT YDLQIPVSD+NL +S++ ++++G +V      + N  +NIGIN    +  PT+   +                 T+   N    ++    ++  + T    L+ + I+  +G++N+EF N T+             +  +   + I ++ +PK+GY ++DG  + K+ SF V     TA
  S:    15 TGAFGIIATVPVIVSSCSTTSDNNGGNNNTGGGSGGGTTQTEKVTPKFKSSINLIGALTDIYNPSEGKNTNTLLGEEIKNNLDSAFENSNELEN-KNFAVTVKGNF-SNSSWGGEQYTNGN--WNGVTITDDNKLYYDSESPQIDISSLNDLKNKLSDETTLKEALSKAGVADTEGSTYTI--KNRLGLTDN----------NLIHVNVEGKSSTATTQYDLQIPVSDINLDLSNVDISISGDDVNPV-EESVNLNFNIGINSKTTYTAPTETQKLTKKATVDSVMEQLGFKATSTTKNVVRTSITLTQDNGASTTSLVGLDTDKIAESLGIFNTEFKNITLTRVSEWNPYDEVQENQNYLTYRIDITGSPKQGYYFDDGKTEDKTFSFNVNINQQTA 395
>gi|3850055|emb|CAA07194.1| putative lipoprotein [Mycoplasma penetrans] (336 aa)
Score = 380, Expect = 1.2e-34, Identities = 139/319 (43%), Positives = 194/319 (60%)
  Q:    14 MTGAFGIVATVPVIVSSCSSTSDNNTGGDNNGGGN-----TQNQTISTQLRSSVTLSGALSNIYNPTSGSNTNTLLAAQIKSNLNSVFENGEALANVDDLEITVNGNFPTT-SEWT---------GTTAFAGNNGWNATQGLTDVLYDWNTAALNISSLNDLKTQLTSEKI--TSIITEASSAPASGTVFTVVENSALGLTNNADSIDANASRDLLHIHVTGTEGSNTT-NYDLQIPVSDLNLVVSDLTVTVTGTNVEQ--TGSTTTNFTYNIGINETANFVQPTQAPSINSADTNGDGNKALVALGYANESDGNYTLNNEAISAGIGVYNSEFSNPTI 332
           +TGAFGIVATVPVIVSSCSSTSDNN G  NN  G      TQ++ I+ +L   V+L+G+L +IY+ T    +N L+A +IK+N+  VF+NGE LA   DL+ITV+G FP   + WT           +    N  W+A   L  VLY   +  +NI SL+DLKT+L    +   ++     S   + T F +    AL             + DL+H++V  T+   +T  +DLQIP SD+NLVVS+L+V V G N+E   T  TTT F +NIGI+ T ++ Q + A S  + + + D NK L  L  A +  G   LNNEA+   +G+YN  FS+P+I
  S:     1 LTGAFGIVATVPVIVSSCSSTSDNNNGNGNNNNGGGSDGNTQSEKITPELNDKVSLAGSLKDIYDSTGTKKSNELIAEEIKNNIKDVFKNGEKLAAETDLKITVDGGFPEKLTNWTDLPYVDNTDDASKKDPNKSWSAITDLNPVLYSTKSNQINIKSLDDLKTELQKTDVLKNALKDAGVSTAETSTAFEIKNQPAL------------TNDDLVHVNVIETKSDKSTVQHDLQIPTSDINLVVSNLSVKVEGKNIESTDTTKTTTEFNFNIGIDSTQHYDQGS-AKSAATTEGDVDVNKVLKDLNLATDDKG--ALNNEALIKALGIYNVTFSSPSI 324
>gi|26554157|ref|NP_758091.1| signal-peptide-less P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454166|dbj|BAC44495.1| signal-peptide-less P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (448 aa)
Score = 380, Expect = 1.2e-34, Identities = 123/324 (37%), Positives = 185/324 (57%)
  Q:    48 NTQNQTISTQLRSSVTLSGALSNIYNPTSGSN----TNTLLAAQIKSNLNSVFENGEALANVDDLEITVNGNFPTTSEWTGTTAFAGNNGWNATQGLTDVLYDWNTAALNISSLNDLKTQLTSEKITSIITEASSAPASGTVFTVVENSALGLTNNADSIDANASRDLLHIHVTGTEG-SNTTNYDLQIPVSDLNLVVSDLTVTVTGTNVEQTGSTTTNFTYNIGINETANFVQPTQAPSINSADTNGDGNKALVALGYANESDGNYTLNNEAISAGIGVYNSEFSNPTIAATQGGSSNQFTITLSATPKEGYVWEDGTRDAKSISFPV 371
           N     I+  +  ++ L+G+L+ I++  + ++    T+ ++A  I +NL   F NG  +  V++L I  +G+FP+ S WTG  A+A    W++    + V Y  +   +NI+SLNDLKT+  S+ + +I+ E S    S + FT+   + LG T+           DL+H+++    G       DLQIPVSD+NL +  L VT  G NV+     TTNFTYNIGI++T NFV+P    +  S+      N+ALV+LG+A  + G+YTLN+  ISA +GV+N  F   +I   Q    N FTI L ATP   Y WE+G+RD K +SF V
  S:   134 NVDVALITPAINKTINLTGSLTRIFDVNTPASYRKSTDIMIAQDIHANLEKYFSNGNDIKTVNNLTIDASGSFPSVSSWTGL-AYAN---WSSNVKHSTV-YASSLPQINITSLNDLKTKWDSQGLQNILLE-SGLKFSNSTFTI--QNLLGFTDG----------DLVHMNIFVESGYGEDFTVDLQIPVSDINLTIPGLRVTANGENVQYLLIDTTNFTYNIGIDDTVNFVKPKTGVTSLSSANKNKVNEALVSLGFATRNSGSYTLNSNKISAALGVFNCTFEGVSITEDQ-SKPNNFTIVLRATPNVNYYWENGSRDYKELSFKV 443
Score = 196, Expect = 2.5e-13, Identities = 62/133 (46%), Positives = 84/133 (63%)
  Q:   243 LTVTVTGTNVEQTGSTTTNFTYNIGINETANFVQPTQAPSINSADTNGDGNKALVALGYAN-ESDGNYTLNNEAISAGIGVYNSEFSNPTIAA---TQGGSSNQFTITLSATP--KEGYVWEDGTRDAKSISFPVTFTV 375
           + ++V+GT+V +T +TT NF YNIGIN  ++  Q T  P  +S++   D NK LV LGYA   S+   TLN E +    G+YN EFSN +I+    TQ G S  +TITL  TP   +G+VWEDG+ + K ISF     V
  S:     1 MQISVSGTDV-RTTNTTINFNYNIGINSQSSLPQLTSTPRGSSSEAK-DPNKILVKLGYAEIASNKEITLNQEVLQEEFGIYNVEFSNASISPSKNTQNGYSGVYTITLDVTPITNKGFVWEDGSSNTKKISFDTNVDV 137
>gi|26554138|ref|NP_758072.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454146|dbj|BAC44476.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (362 aa)
Score = 378, Expect = 2.4e-34, Identities = 146/359 (40%), Positives = 209/359 (58%)
  Q:    15 TGAFGIVATVPVIVSSCSSTSDNNTGGDNNGGGNTQNQT------ISTQLRSSVTLSGALSNIYNPTSGSNTNTLLAAQIKSNLNSVFENGEALAN-VDDLEITVNGNFPTTSEWTGTTAFAGNNGWNATQGLTDVLYDWNTAALNISSLNDLKTQLTSEKITSIITEASSAPASGTVFTVVENSALGLTNNAD-SIDANASR---DLLHIHVTGTE-GSNTTNYDLQIPVSDLNLVVSDLTVTVTGTNVEQTGSTTTNFTYNIGINETANFVQPTQAPSINSADTNGDGNKALVALGYANESDGNYTLNNEAISAGIGVYNSEFSNPTIAATQGGSSNQFTITLSATPKEGYVWEDGTRDAKS-ISFPVTF 373
           TGAFGIVATVPVIVSSCSSTSDNN G  NN     Q+        I+  ++  V+LSGALS IY+  +  +T+ L+A  IK+N  + F+NGEAL + + D  ++VNG F T S + G T       W+A  G     Y   +  L+I S+NDL+TQL       II +A                 L LTN +D  ++ NA +   DLLH++++  E G+   + DL IPVSDLNL +  L ++V+GT ++++   TTN+ +N+GI+ T   +  T A    +A         + ALGY   S  +  L+N+ +S  +G+YN  F   + +    G +N++TITL ATP EGYVWEDGT + K+ I+F  T 
  S:    15 TGAFGIVATVPVIVSSCSSTSDNNGGNGNNNNNGNQDGNGQQQTEITPTIKKEVSLSGALSKIYD--ANKSTSDLIAEDIKANPTNYFDNGEALKDLIKDATVSVNGGF-TESTFKGDTY----ETWSAKVGDKKGTYAQASKQLDIKSINDLETQLGDSNNIKIICDAI--------------PTLKLTNGSDYKVEKNALKLDGDLLHVNISAKENGTTAVSMDLAIPVSDLNLKIDALKISVSGTGIKESTDLTTNYKFNVGIDNTVKPI--TNATGTVTAGDREKVMTVMKALGY-TVSGQDDKLDNDKLSDALGLYNCNFEAVS-SKPVSGQANKYTITLKATPNEGYVWEDGTNNPKTDITFEATL 361
>gi|26554189|ref|NP_758123.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454198|dbj|BAC44527.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (517 aa)
Score = 377, Expect = 2.6e-34, Identities = 133/364 (36%), Positives = 198/364 (54%)
  Q:    15 TGAFGIVATVPVIVSSCSSTSDNNTGGDNNGGGNTQ----------------NQTISTQLRSSVTLSGALSNIYNPTSGSNTNTLLAAQIKSNLNSVFENGEALANVDDLEITVNGNFPTTSEWTGTTAFAGNNGWNATQGL---TDVLYDWNTAALNISSLNDLKTQLTSEKITSIITEASSAPASGTVFTVVENSALGLTNNADSIDANASRDLLHIHVTGTEGSNTT---NYDLQIPVSDLNLVVSDLTVTVTGTNVEQTGSTTTNFTYNIGINETANFVQPTQAPSINSADTNGDGNKALVALGYANE---SDGNYTLNNEAISAGIGVYNSEFSNPTIAATQG------GSSNQFTITLSATPKEGYVWEDGTRDAKSISFPVTFTVTTA 378
           TG FGIV T+P IVS+CSS  + N G  +N G N                  NQ I  ++ SSV L G+L++IY+ T   + N LL  ++ +N + +F N + L N  +  I V GNF   S W+G    AGNN W +   +     V+Y   +  LNISSL+DLK+QLT++ +   + +A         + V   + LGLT++           LLH++VT T    T+   N+DLQIPVSD+ L + DL V V+G++VEQ  S   N  +NIGI    N+        I   +   + +  +  LG+ +    S     LN+EA+   +GVYN+ FS P +           GS   +T+ +  +P +GY ++D T  +K   F +  T TTA
  S:    15 TGTFGIVITIPAIVSACSSIKEKNDGSQSNNGNNQDNSKDQGSEGSGNGGITNQKIVPKINSSVDLIGSLTDIYDSTGNKDINVLLGEKLSNNASKIFTNADELEN-KNYAIAVKGNFSRDS-WSGDQYDAGNNKWGSGSKIDPANQVVYSSKSKQLNISSLDDLKSQLTNDFLKKELEKAGVTVNQSATYAVA--NKLGLTDDI----------LLHVNVTETASGTTSVSKNFDLQIPVSDIKLDIKDLKVIVSGSDVEQIES-DINLKFNIGIKSKTNY----SPRDIKKFNVTPNVDSIIATLGFKDSSVTSTEGVALNSEALGKALGVYNTTFSKPALTLNSDIKPDVTGSFLTYTVIVDGSPNQGYYFDDETDYSKKFIFNIKVTETTA 390
>gi|26554104|ref|NP_758038.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454112|dbj|BAC44442.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (394 aa)
Score = 365, Expect = 7.7e-33, Identities = 151/362 (41%), Positives = 215/362 (59%)
  Q:    14 MTGAFGIVATVPVIVSSCSSTSDNNT---GGDNNGGGNTQNQTISTQLRSSVTLSGALSNIYNPTSGSN----TNTLLAAQIKSNLNSVFENG---EALANVDDLEITVNGNFPTTSEWT--GTTAFAGNNGWNAT------QGLTDVLYDWNTAALNISSLNDLKTQLTSEKITSIITEASSAPASGTVFTVVENSALGLTNNADSIDANASRDLLHIHVTGTEGS-NTTNYDLQIPVSDLNLVVSDLTVTVTGTNVEQTGSTTTNFTYNIGINETANFVQPTQAPSINSADTNGDGNKALVALGYA---NESDGNYTLNNEAISAGIGVYNSEFSNPTIAATQGGSSNQ-----FTITLSATP--KEGYVWED-GTRDAKSISFPVTFTV 375
           MTGAFGIVATVPVIVS+CSSTSDNNT   GG + GGG+TQ + ++  L+  V LSG+LS I++ TS ++    T TL++  IK N  + F NG   +    V +  +TVNGNF + SEWT  G   F  +  W  +      +    ++Y  +   +NISSLNDLKTQLT +     I E S A       T+   + LG T            DLLH++V     + N TNYDLQIPVSD+NL V  L++ VTG N+E +  TTT + +NIGI+   N       P+  + D++   N+ L  L +     + +    L+NEA+   +G+YN  FS    +  +  ++ +     FT+TL ATP   + YVW D G  + + I+F VT ++
  S:    14 MTGAFGIVATVPVIVSACSSTSDNNTGGNGGTDQGGGSTQTEKVTPTLKDEVDLSGSLSKIFDTTSEASNRKTTATLISDDIKENPENYFTNGNDEKVKEAVKNANVTVNGNF-SNSEWTKEGLLPFGEDGNWKDSTTTVTIEAANKLVYATSLDQINISSLNDLKTQLTKDNGLKNILEKSGASTIAEGTTLSIENRLGFTGG----------DLLHVNVKAKPTTGNETNYDLQIPVSDINLSVPSLSIEVTGDNIEASNKTTTKYDFNIGIDPVVNNYNQGSKPTA-ATDSDVKVNQVLQDLKFGTIDTQDNTKINLDNEALIKALGIYNVTFSAEGASINKKSTTTRATDTVFTVTLKATPTANKNYVWADNGNSEERDITFDVTLSI 393
>gi|26554121|ref|NP_758055.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454129|dbj|BAC44459.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (378 aa)
Score = 361, Expect = 2.0e-32, Identities = 153/361 (42%), Positives = 211/361 (58%)
  Q:    15 TGAFGIVATVPVIVSSCSSTSDNNTGGDNNGGGNTQNQT-ISTQLRSSVTLSGALSNIY--NPTSGSNTNTLLAAQIKSNLNSVFENG-EALANVDDLEITVNGNFPTTSEWTGTTAFAGNNGWNATQGLTDVLYDWNTAALNISSLNDLKTQLTSEK--ITSIITEASSAPASGTVFTVVENSALGLTNNADSIDANASRDLLHIHVTGTEGSNT-TNYDLQIPVSDLNLVVSDLTVTVTGTNVEQTGSTTTNFTYNIGINETANFVQPT-QAPSINSADTNGD---GNKALVALGYANESDGNYTLNNEAISAGIGVYNSEFSNPTIA--------ATQGGSSNQFTITLSATPKEG-YVWEDGTRDAKSISFPVTFTV 375
           TGAFGIVATVPVIVSSCSSTSDNN G +NNG G+ Q QT ++  L+S+V L G L+ IY  N T   NT+TL+ A +K+N ++ F NG E    +   EITV+G F TTS W G       + W    G T V+Y      +NI+SLNDLK     ++  I    T+AS + +   V  +   + L L N           DLLH++V GT+   +    DLQIPVS+LNL  +       GTN+++     T+F+YNIGI+ T NF Q    AP + S+D + +       L  LGY   SD    ++N+ ISA +G+YN +F+  T          A   GS+  +T+T++ATP +  YVW+DG    K ISF V+  +
  S:    15 TGAFGIVATVPVIVSSCSSTSDNNGGSNNNGNGDNQQQTELTPALKSNVNLQGKLTGIYDTNTTDRKNTSTLIVADMKANPDNYFTNGNEIKEGIQSSEITVDGGFSTTSSWDGDAY----DTWKT--GATQVMYPTAAPQINIASLNDLKETTFKDETAINKFFTDASLSESVKDVTGLNVANKLHLENG----------DLLHVNVKGTKTDKSEVKIDLQIPVSNLNLKTTLKVSIKGGTNIKEVTDLETSFSYNIGIDATLNFTQTKGTAPEVTSSDVSDEAAAAKAILKKLGYTTGSDD--AIDNDKISAALGIYNCKFTAKTAKVNDKETPNAEVTGSNKVYTVTVTATPYDSTYVWDDGAEGGKDISFDVSLNL 377
>gi|26553716|ref|NP_757650.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26453723|dbj|BAC44054.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (518 aa)
Score = 359, Expect = 3.1e-32, Identities = 141/378 (37%), Positives = 211/378 (55%)
  Q:     1 MKIKKIKLLKALAMTGAFGIVATVPVIVSSCSSTSDNNTGGDNNGGGNTQN------QTISTQLRSSVTLSGALSNIYNPTSGSNTNTLLAAQIKSNLNSVFENGEALANVDDLEITVNGNFPTTSEWTGTTAFAGNNGWNATQGLTDVLYDWNTAALNISSLNDLKTQLTSEKITSIITEASSAPASGTVFTVVENSALGLTNNADSIDANASRDLLHIHVTGTEGSNTTNYDLQIPVSDLNLVVSDLTVTVTGTNVEQTGSTTTNFTYNIGINETANFVQPTQAPSINSADTNGDGNKALVALGY--------ANESDGNYT------------LNNEAISAGIGVYNSEFS----------NPTIAATQGGSSNQFTITLSATPKEGYVWEDGTRDAKSISFPVTFTVTTA 378
           MK  K K+LK LA+TGAFGI+ATVPVI+S+CSS S+N+     N  G+         Q ++ +L+SS+ L G++++IYN    + ++ LL  +IKSNL  VFEN   L N  D+ I +  +F + SEW G T    N  W  +   T + Y  + A +N SSLNDLK QL+ +     I + S  P +      +EN   GLT N          ++LHI+V     S+  NYDLQIPVSDL LV+  + V V+  ++    +   +  +NIGI   +N+V P +   I   D     N  L  LG+        +N+++  +T            L+++ +   +GV+N+ FS          NP    +   +   + I L+  P +GY +EDGT ++K  SF V  T  TA
  S:     1 MKTAKKKVLKTLAITGAFGIIATVPVIISACSSASNNSNTNGGNNTGDNSGNGTRDPQKVTPKLKSSINLVGSITDIYNHEVNNTSHDLLIKKIKSNLGLVFENESELVN-KDINIKLESDF-SNSEWIGETYNVTNKNW-GSDTTTKLTYAHSLAQINFSSLNDLKMQLSDQIKIKEILKESGVPDTYLNTYKIENKT-GLTEN----------NILHINVIEVGKSSPKNYDLQIPVSDLKLVLPQVNVLVSENDINSI-NQPIDINFNIGIESHSNYVGPVETQII---DERASANSILEKLGFIKMTNTKNSNKTNMTFTEINGASVTTNIDLDSDKVGETLGVFNTTFSDVKLTRISEWNPYDVVSTEDNYLTYKIDLNGRPNKGYYFEDGTTESKEFSFNVKTTERTA 396
>gi|26554128|ref|NP_758062.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454136|dbj|BAC44466.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (353 aa)
Score = 355, Expect = 9.9e-32, Identities = 149/343 (43%), Positives = 200/343 (58%)
  Q:    14 MTGAFGIVATVPVIVSSCSSTSDNNTGGDNNGGGNTQNQTISTQLRSSVTLSGALSNIYNPT-----SGSNTNTLLAAQIKSNLNSVFENGE---ALANVDDLEITVNGNFPTTSEWTGTTAFAGNNGWNAT--QGLTDVLYDWNTAALNISSLNDLKTQLT------SEKITSIITEASSAP-ASGTVFTVVENSALGLTNNADSIDANASRDLLHIHVTGTEGS-NTTNYDLQIPVSDLNLVVSDLTVTVTGTNVEQTGSTTTNFTYNIGINETANFVQPTQAPSINSADTNGDGNKALVALGYANESDGNYTLNNEAISAGIGVYNSEFSNPTIAATQGGSSNQFTITLSATPKEGYV 356
           MTGAFGIVATVPVIVSSCSSTSDNN  G+ NG   TQ   ++  L+ SV L G+LS I++ T     S  +TNTL++  IK+N    F NG      + +    I V GNF   S WTG       N W+    +    ++Y  N+A L    L+ LK +L       S+ +  +  EA+ A  ASGT  T+   + LG TN+          DL+H++V     S N  NYDLQIP SDLNL V+ L++ VTG N+ +   TTTNFTYNIGI E    + PT  P++ +AD  G   K + ALGY N +     L++  IS  +G+YN +F+  + A     ++  FTI +SATP EGYV
  S:    14 MTGAFGIVATVPVIVSSCSSTSDNNGNGNTNGNTETQK--VTPVLKDSVDLKGSLSKIFDTTATDAASRKSTNTLISEDIKANPEDYFTNGSDSNVQSAIQSATIDVEGNFSNAS-WTGNAYDTNTNTWSGVTIEDANKLVYTSNSAQLTFKDLDGLKAELEKTTGTDSKTVAQVALEAAGATFASGTTITI--ENRLGFTND----------DLIHVNVKAAPSSGNPVNYDLQIPTSDLNLSVTGLSIKVTGENITEGEKTTTNFTYNIGIKE--GVIVPTDKPNLATAD-KGTQMKVMEALGYTNTAGD--ALDDNKISVKLGLYNCKFTLVS-ATEDTNNAGTFTIKISATPNEGYV 353
>gi|986922|gb|AAC16393.1| p33 lipoprotein [Mycoplasma penetrans] >gi|1583186|prf||2120285B lipoprotein (318 aa)
Score = 354, Expect = 1.4e-31, Identities = 134/285 (47%), Positives = 169/285 (59%)
  Q:    15 TGAFGIVATVPVIVSSCSS------TSDNNTGGDNNGGGNTQNQTISTQLRSSVTLSGALSNIYNPT----SGSNTNTLLAAQIKSNLNSVFENGEALANVDDLEITVNGNFPTTSEWTGTTAFAGNNGWNATQGLTDVLYDWNTAALNISSLNDLKTQL-TSEKITSIITEASSAPASGTVFTVVENSALGLTNNADSIDANASRDLLHIHVTGTEGSNTTNYDLQIPVSDLNLVVSDLTVTV------TGTNVEQTGSTTTNFTYNIGINETANFVQPTQAPSINSADTNGDGNKALVAL 299
           TGAFGIVATVPVIV SCSS      T DNNTGG  +G    Q  T +  ++S VTLSGALS IY+ T    S  NTNTL+A  IK+N  + F NGE L  V+   +TV+G+F + S WTG       + W+A       +Y   +  LNI+SL DLK+QL TS KI +I  E++   ++    +    + LG T            DLLHI+VT T+   T N DL IPVSDLNL ++DL V+V      TG NV      TTNFTYNIGI E      PT+ P++   D  G+  K L AL
  S:    15 TGAFGIVATVPVIVYSCSSTDNNGGTGDNNTGGGGSGTDQQQGTTYTPAIKSDVTLSGALSKIYDTTNTGDSRKNTNTLIAEDIKANPENYFTNGEDLKKVEGWSVTVDGSFDSNSVWTGDAY----SKWSAVADTHKGVYKSTSKQLNINSLKDLKSQLDTSAKIKAICDESNLVFSTADADSYKIQNELGFTGG----------DLLHINVTATQAGKTLNMDLGIPVSDLNLKITDLKVSVTASNNSTGNNVAAVSDLTTNFTYNIGIKEEVT--APTEKPNLAKTD-KGEVMKVLKAL 299
>gi|26554122|ref|NP_758056.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454130|dbj|BAC44460.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (383 aa)
Score = 345, Expect = 1.3e-30, Identities = 141/361 (39%), Positives = 204/361 (56%)
  Q:    15 TGAFGIVATVPVIVSSCSSTS-DNNTGGDNNGGGNTQNQTISTQLRSSVTLSGALSNIYNPTSGS--NTNTLLAAQIKSNLNSVFENGEALAN-VDDLEITVNGNFPTTSEWTGTTAFAGNNGWNATQGLTDVLYDWNTAALNISSLNDLKTQL--TSEKITSIITEASSAPASGTVFTVVENSALGLTNNADSIDANASRDLLHIHVTG---TEGSNTTNYDLQIPVSDLNLVVS-----DLTVTVTGTNVEQTGSTTTNFTYNIGINETANFVQPTQAPSINSADTNGDGNKALVALGYANESDGNYTLNNEAISAGIGVYNSEFS------NPTIAATQGGSSNQFTITLSATP-KEGYVWEDGTRDAKSISFPVTFTV 375
           TGAFGIVATVPVIVSSCSSTS +N  G    GG      ++   L+S V LSG L+ +Y+ ++ +  +TNTL++  IK+N +  F N   + + + D ++TVNGNF  +   T           + +Q +  V Y      ++I+SLN+LKT     S+ I++ ITE+       T+    E     + N        +S DLLH+++     T G    N DLQIPVS++NL  S     D T   TG  +E      TNF+YNIGI+ T NF  P  + S+   + + D  + L  LGYA  +DG  T++N+ +SA IGVYN +F+      + T++A  G  +  + +TLSA P    YVW+DG   AK + F V  TV
  S:    15 TGAFGIVATVPVIVSSCSSTSDNNVNGNGGQGGDQQTQTSVKPDLKSEVNLSGKLTGVYDTSADNRKDTNTLISDDIKANPDKYFNNAADIKDAIKDAKVTVNGNFSASEWNTQGAKDYAEWSKDNSQAIPTVTYPTAAKQIDIASLNELKTVTFKDSDTISTFITESKI-----TIDKFSEMEKFRVENKLHL----SSGDLLHVNLKADNKTTGQAGLNLDLQIPVSNINLKTSLTVSVDATTNTTGNKIEAVSDLKTNFSYNIGIDSTVNFTDPKISQSLTKTEAD-DATEVLKKLGYAG-TDG--TIDNDKVSAAIGVYNCKFTAVSSKEDTTVSAKTGKKA--YKVTLSAEPFDSNYVWDDGQIGAKQVDFTVQLTV 381
>gi|3850052|emb|CAA07192.1| putative lipoprotein [Mycoplasma penetrans] (353 aa)
Score = 344, Expect = 1.9e-30, Identities = 137/319 (42%), Positives = 188/319 (58%)
  Q:    14 MTGAFGIVATVPVIVSSCSSTSDNNTGGDNNGGGNT--------QNQTISTQLRSSVTLSGALSNIYNPTSG---SNTNTLLAAQIKSNLNSVFENGEALANVDDLEITVNGNFPTT-SEWT---------GTTAFAGNNGWNATQGLTDVLYDWNTAALNISSLNDLKTQLTSEKI--TSIITEASSAPASGTVFTVVENSALGLTNNADSIDANASRDLLHIHVTGTEGSNTT-NYDLQIPVSDLNLVVSDLTVTVTGTNVEQ--TGSTTTNFTYNIGINETANFVQPTQAPSINSADTNGDGNKALVALGYANESDGNYTLNNEAISAGIGVYNSEFSNPTI 332
           +TGAFGIVATVPVIVSSCSSTSDNN  G+NN   N         Q  T +  +++ V+LSG+LS IY+ T+G    NTN ++A  I SN    F NG  L NV    +TV+G FP   + WT           +    N  W+A   L  VLY   +  +NI SL+DLKT+L    +   ++     S   + T F +    AL             + DL+H++V  T+   +T  +DLQIP SD+NLVVS+L+V V G N+E   T  TTT F +NIGI+ T ++ Q + A S  + + + D NK L  L  A +  G   LNNEA+   +G+YN  FS+P+I
  S:     1 LTGAFGIVATVPVIVSSCSSTSDNNGNGNNNNDNNGGGSGTDQQQGTTYTPAIKTEVSLSGSLSKIYDTTTGDSRKNTNEMIAQDILSNPEDYFTNGADLKNVQGWSVTVDGGFPEKLTNWTDLPYVDNTDDASKKDPNKSWSAITDLNPVLYSTKSNQINIKSLDDLKTELQKTDVLKNALKDAGVSTAETSTAFEIKNQPAL------------TNDDLVHVNVIETKSDKSTVQHDLQIPTSDINLVVSNLSVKVEGKNIESTDTTKTTTEFNFNIGIDSTQHYDQGS-AKSAATTEGDVDVNKVLKDLNLATDDKG--ALNNEALIKALGIYNVTFSSPSI 330
>gi|26554113|ref|NP_758047.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454121|dbj|BAC44451.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (365 aa)
Score = 340, Expect = 4.8e-30, Identities = 128/377 (33%), Positives = 203/377 (53%)
  Q:     1 MKIKKIKLLKALAMTGAFGIVATVPVIVSSCSSTSDNNTGGDNNGGGNTQNQTISTQLRSSVTLSGALSNIYNPTSGS---NTNTLLAAQIKSNLNSVFENGEALANV-DDLEITVNGNFPTTSEWTGTTAFAGNNGWNA-TQGLTDVLYDWNTAALNISSLNDLKTQLTSEKITSIITEASSAPASGTVFTVVENSALGLTNNADSI-----DANASRDLLHIHVTGTEGSNTT---NYDLQIPVSDLNL-----VVSDLTVTVTGTNVEQTGSTTTNFTYNIGINETANFVQPTQAPSINSADTNGDGNKALVALGYANESDGNYTLNNEAISAGIGVYNSEFSNPTIAATQGGSSNQFTITLSATP-KEGYVWEDGTRDAKSISFPVTFTVTT 377
           MK KKIKLLK LA  G+F IV+TVP I+S+CSST+D  TG             I+  ++S V+L G L+ IY+ ++GS   +TNTL+A  IK+NL+  F N + L +V     ITV+G F   S W G         W+   +G+T   Y      ++I+SLN LK ++  +                ++   ++++ L  T+NA +          + DLLH+++      N     N DLQIPVS+ NL     V    +  V G N+ +  + TT+F Y+IGI+   N+     A  +    T  +   A   L  ++ +D +  L+N+ I++ +GV+NS+F+ P  +    GS + + ITL+A P  + Y W+DG+  +K+I F +   V +
  S:     1 MKNKKIKLLKTLATVGSFVIVSTVPAIISACSSTADQYTG-------------ITPVIKSEVSLQGKLTGIYDTSTGSDRKDTNTLIAEDIKANLDKYFVNVDELKDVIQTSTITVDGGFSEKSTWEGENF----ETWSTDARGVTKAPYPSAAPKIDITSLNALKDEILKD--------------DASIQKFLKDANLPFTSNASNFRLLNKPGLENGDLLHVNIKANRNRNNNSDLNLDLQIPVSNFNLKTTLKVSVSASNNVDGQNIGKDFNLTTHFNYSIGIDPAVNYKALKTALEV----TPQESVDATEILKLSDYTDFSGNLDNDKIASAVGVFNSKFT-PVSSVKVEGSQDMYNITLTAEPFSDLYFWDDGSTGSKTIQFQIKLNVKS 360
>gi|26553723|ref|NP_757657.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26453730|dbj|BAC44061.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (383 aa)
Score = 339, Expect = 7.8e-30, Identities = 142/362 (39%), Positives = 203/362 (56%)
  Q:    15 TGAFGIVATVPVIVSSCSS-----TSDNNTGGDNNGGGNTQNQTISTQLRSSVTLSGALSNIYNP--TSGSNTNTLLAAQIKSNLNSVFENGEALAN-VDDLEITVNGNFPTTSEWTGTTAFAGNNGWNATQGLTDVLYDWNTAALNISSLNDLK-TQLTSEKITSIITEASSAPASGTVFTVVENSALGLTNNADSIDANASRDLLHIHVTGTEGSNTTNYDLQIPVSDLNLVVS-----DLTVTVTGTNVEQTGSTTTNFTYNIGINETANFVQPT-QAPSINSADTNGDGNKA---LVALGYANESDGNYTLNNEAISAGIGVYNSEF--------SNPTIAATQGGSSNQFTITLSATP-KEGYVWEDGTRDAKSISFPVTFTVT 376
           TGAFGIVATVPVIVSSCSS      +   TGG+  GG   Q  T+  ++++ V LSG LS IY+   T   +TNTL+   +K+N  + F NG+ + + + D  +TV+G F   S W+G      + G  AT      LY      +NI+SLNDLK T+L          + ++   +G     V+N   GLT+           DLLHI++   + S   N DLQIPVS++NL  +     D T   TG  +E      T F+YNIGI+ T  F Q   +AP+  + + +     A   LV LGY +  D   TL+++ ISA +G+YN +F        +N    A    S+  +T+T++ATP  E YVW+DG+   K ISF V+  V+
  S:    15 TGAFGIVATVPVIVSSCSSTDNGNNNQGGTGGNGQGGDTQQQSTVKPEIKTDVKLSGKLSGIYDASETDRKDTNTLITNDVKTNPENYFTNGDQIKDAIKDATVTVDGGFKKESSWSGNPYSTWSTGTTAT------LYPSAAPQINIASLNDLKDTKLKDSTAIETFLKDANISFTGASGFSVQNQP-GLTDG----------DLLHINIKAKQNSQDLNLDLQIPVSNINLETTLKISIDATTNTTGNKIEAVKDLETKFSYNIGIDATLKFEQQKGEAPAATTNEVSDAATAAKNILVKLGYVSSGD---TLSDDKISAALGIYNCKFTPKSATENTNAKPNAEVTNSNKVYTVTVTATPYNETYVWDDGSTGPKDISFDVSLKVS 383
>gi|26554132|ref|NP_758066.1| P35 lipoprotein homolog reported as gene for P38 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454140|dbj|BAC44470.1| P35 lipoprotein homolog reported as gene for P38 lipoprotein [Mycoplasma penetrans HF-2] (383 aa)
Score = 324, Expect = 3.6e-28, Identities = 146/361 (40%), Positives = 214/361 (59%)
  Q:    15 TGAFGIVATVPVIVSSCSSTSDNNTGGDNNGGGNT------------QNQTISTQLRSSVTLSGALSNIYNPTSGSNTNTLLAAQIKSNLNSVFENGEALANV-DDLEITVNGNFPTTSEWTGTTAFAGNNGWNATQGLTDVLYDWNTAALNISSLNDLKTQLTSEKIT--SIITEASSAPASGTVFTVVENSALGLTNNADSIDANASRDLLHIHV----TGTEGSNTTNYDLQIPVSDLNL-----VVSDLTVTVTGTNVEQTGSTTTNFTYNIGINETANFVQPTQAPSINSADTNGDGNKALVALGYANESDGNYTLNNEAISAGIGVYNSEFSNPTIAATQG-----GSSNQFTITLSATPKEG-YVWEDGTRDAKSISFPVTFTV 375
           TGAFGIVATVP+IVSSCSST +  +G +  G GN             +N+T+  +L+ +V L+G LS IY  T    TN L++  IK+N  + F NG  L +V +   +TV+G F + S+WT  + +     W+A  G+  V Y      ++I+SLN LK +   +  T  + +T A+ + ++ + FTV   + LGLTN           DLLH+++    T   G N  N DLQIPVS++NL     V    T   TGTN+E     TTNF+YNIGI+ T NF Q   AP+  +A+ N +  + L  LGY   ++    L+N+ ISA +G+YN +F+  +    QG     G +  +T+ + A P +  YVW+DG+ D K  SF V+ TV
  S:    15 TGAFGIVATVPIIVSSCSSTDNGGSGNNTGGNGNQGDGGGSGNTDQQENKTVKPELKDNVELNGKLSTIYG-TDSKTTNELISEDIKANPENYFTNGSELKDVINQSTVTVDGGF-SASQWTEGSDY---TTWSAVTGVVKVTYPAAAPQIDIASLNALKQETFKDDTTIQAFLTAANLSFSNTSSFTV--ENKLGLTNG----------DLLHVNIKANRTAANGGN-LNLDLQIPVSNINLKTILKVSVSATNNSTGTNIEAVSDLTTNFSYNIGIDSTLNFTQTGTAPTATTAEAN-NATEVLKKLGYQTGNN----LDNDKISAALGIYNCKFTPKSATEKQGATAGLGGNKVYTVVVDAAPYDSNYVWDDGSTDTKEFSFDVSLTV 382
>gi|26554103|ref|NP_758037.1| putative P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|22901855|gb|AAN10106.1| putative lipoprotein mp8 [Mycoplasma penetrans] >gi|26454111|dbj|BAC44441.1| P35 lipoprotein homolog fragment [Mycoplasma penetrans HF-2] (329 aa)
Score = 310, Expect = 1.5e-26, Identities = 124/308 (40%), Positives = 171/308 (55%)
  Q:    14 MTGAFGIVATVPVIVSSCSSTS---DNNTGGDNNGGGNTQNQTISTQLRSSVTLSGALSNIYNP--TSGSNTNTLLAAQIKSNLNSVFENGEALAN-VDDLEITVNGNFPTTSEWTGTTAFAGNN-GWNATQGLTDVLYDWNTAALNISSLNDLKTQL--TSEKITSIITEASSAPASGTVFTVVENSALGLTNNADSIDANASRDLLHIHVTG---TEGSNTTNYDLQIPVSDLNL-----VVSDLTVTVTGTNVEQTGSTTTNFTYNIGINETANFVQPTQAPSINSADTNGDGNKALVALGYANESDGNYTLNNEAISAGIG 321
           MTGAFGIVATVPVIVSSCSSTS    N       GG      TI   ++S V LSG L+NIY+   T   +TNTL++  IK+N +  F NG  + + + D ++TVNGNF + SEW    A   +    +    ++ +LY    A ++I+SLN+LKT+    SE I   IT++            + N A       ++    +  DLLH+++     T   +  N DL+IPVS++NL     V  D T   TG  +E     TTNF+YNIGI+ T  F  P   P++ + D        L  LGYA  + GN TL+N+ ISA IG
  S:    14 MTGAFGIVATVPVIVSSCSSTSDNNGNGNNNGGQGGDQQTQTTIKPAIKSDVQLSGKLNNIYDASTTDRKDTNTLISDDIKANPDKYFTNGADIKDAIKDAKVTVNGNF-SASEWNDQGAKEYSEWSKDGNNNISKILYPTEAAQIDIASLNELKTKTFKDSETINKFITDSK---------ITIANLANMQNFRVENKLYLSDEDLLHVNLKADNKTANQSGLNLDLEIPVSNINLKTTLTVSVDATTNTTGNKIEAVSGLTTNFSYNIGIDSTVKFTDPKTYPTV-TTDEAKKAETVLEKLGYATNTSGNITLDNDKISAAIG 327
>gi|26554106|ref|NP_758040.1| putative P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454114|dbj|BAC44444.1| P35 lipoprotein homolog fragment [Mycoplasma penetrans HF-2] (179 aa)
Score = 288, Expect = 5.9e-24, Identities = 88/156 (56%), Positives = 110/156 (70%)
  Q:    14 MTGAFGIVATVPVIVSSCSSTSDNNTGGDNNGGGNTQNQTISTQLRSSVTLSGALSNIYNPTSGSNTNTLLAAQIKSNLNSVFENGEALANVDDLEITVNGNFPTTSEWTGTTAFAGNNGWNA--------TQGLTDVLYDWNTAALNISSLNDLKTQLTSEKI 169
           MTGAFGI+ATVPVIVSSCSSTSDNN G  +   G  Q+QTI  Q++SSVTLSGAL++IYNPT  S TN+L+A +IK+NL  VF+NG  L NV DLE++V   FP  S WTG +  + +  W A        T    + L   + + LNISSL+DLKTQL   K+
  S:    14 MTGAFGIIATVPVIVSSCSSTSDNNGGNGDTNQGGEQSQTIIPQIKSSVTLSGALTDIYNPTDISKTNSLIADEIKNNLADVFDNGSDLTNVSDLEVSVTHTFP-ASTWTGLSFDSTSGNWKAEGSSGNDVTIDNANKLVYSSESQLNISSLSDLKTQLDDTKL 176
>gi|26554161|ref|NP_758095.1| signal-peptide-less P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454170|dbj|BAC44499.1| signal-peptide-less P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (494 aa)
Score = 280, Expect = 5.0e-23, Identities = 111/371 (29%), Positives = 193/371 (52%)
  Q:     1 MKIKKIKLLKALAMTGAFGIVATVPVIVSSCSSTSDN---NTGGD----NNGGGNTQNQTISTQLRSSVTLSGALSNIYNPTSGSNTNTLLAAQIKSNLNSVFENGEALANVDDLEITVNGNFPTTSEWTGTTAFAGNNGW-NATQGLTDVLYDWNTAALNISSLNDLKTQLTS-EKITSIITEASSAPASGTVFTVVENSALGLTNNADSIDANASRDLLHIHVTGTEGSNTTNYDLQIPVSDLNLVVSDLTVTVTGTNVEQTGSTTTNFTYNIGINETANFVQPTQAPSINSADTNGDGNKALVALGYANESDGNYT---LNNEAISAGIGVYNSEFSNPTI----AATQGGSSNQFTITLSATPKEGYVWEDGTRDAKSISFPV 371
           MK ++ K+ K +A++G F + A VP  V S ++ + N   N  GD    +N  G+ +N  ++ +L+SS+ + G+  ++++  S   TN LLA +IK N +  FEN E LA   + ++ V  N  ++S WTG +       W N  +    +LY  ++    ISSL+D K +L +  ++   +T A     S T  ++   + +GL++            L HI+V  +  +   +YDLQIP S++N    +L + VTG +V +T      F Y+IGI   + +   ++   +  A  +      +  LG+ + S    +   L+N  +S  +GV+N+ FSN  +    +A   G+   F +T++      Y +EDGT  +K  SFPV
  S:     1 MKTQRSKIGKVIALSGIFTVTAAVPAAVLSSAALNGNFANNQSGDALIPSNPSGH-ENTKVTPKLKSSIQMMGS-EDLFDLGSNKTTNELLAQKIKDNPSLFFENPEVLAG-KNFDVVVEDNL-SSSAWTGQSYDVSKGNWGNTIEESNKLLYSSSSPNFTISSLDDFKAKLNAGSRLKDSLTAAGLNVDSNTTPSI--KNKIGLSDG-----------LFHINVEASVSNKKADYDLQIPTSNINFSFENLNIKVTGNDVVETKQRVA-FKYSIGIKSISKYNGSSEIMKMWYASESA----VMSGLGFLSSSKNESSELILDNNKVSKALGVFNTTFSNTKLELDNSAVNEGNYLTFKVTITGNANADYCFEDGT-TSKEFSFPV 364
>gi|7839543|gb|AAF70318.1|AF260642_1 P38 [Mycoplasma penetrans] (352 aa)
Score = 276, Expect = 1.3e-22, Identities = 123/326 (37%), Positives = 187/326 (57%)
  Q:    50 QNQTISTQLRSSVTLSGALSNIYNPTSGSNTNTLLAAQIKSNLNSVFENGEALANV-DDLEITVNGNFPTTSEWTGTTAFAGNNGWNATQGLTDVLYDWNTAALNISSLNDLKTQLTSEKIT--SIITEASSAPASGTVFTVVENSALGLTNNADSIDANASRDLLHIHV----TGTEGSNTTNYDLQIPVSDLNL-----VVSDLTVTVTGTNVEQTGSTTTNFTYNIGINETANFVQPTQAPSINSADTNGDGNKALVALGYANESDGNYTLNNEAISAGIGVYNSEFSNPTIAATQG-----GSSNQFTITLSATPKEG-YVWEDGTRDAKSISFPVTFTV 375
           +N+T+  +L+ +V L+G LS IY  T    TN L++  IK+N  + F NG  L +V +   +TV+G F + S+WT  + +     W+A  G+  V Y      ++I+SLN LK +   +  T  + +T A+ + ++ + FTV   + LGLTN           DLLH+++    T   G N  N DLQIPVS++NL     V    T   TGTN+E     TTNF+YNIGI+ T NF Q   AP+  +A+ N +  + L  LGY   ++    L+N+ ISA +G+YN +F+  +    QG     G +  +T+ + A P +  YVW+DG+ D K  SF V+ TV
  S:    31 ENKTVKPELKDNVELNGKLSTIYG-TDSKTTNELISEDIKANPENYFTNGSELKDVINQSTVTVDGGF-SASQWTEGSDYTT---WSAVTGVVKVTYPAAAPQIDIASLNALKQETFKDDTTIQAFLTAANLSFSNTSSFTV--ENKLGLTNG----------DLLHVNIKANRTAANGGNL-NLDLQIPVSNINLKTILKVSVSATNNSTGTNIEAVSDLTTNFSYNIGIDSTLNFTQTGTAPTATTAEAN-NATEVLKKLGYQTGNN----LDNDKISAALGIYNCKFTPKSATEKQGATAGLGGNKVYTVVVDAAPYDSNYVWDDGSTDTKEFSFDVSLTV 351
>gi|26554158|ref|NP_758092.1| signal-peptide-less P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454167|dbj|BAC44496.1| signal-peptide-less P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (204 aa)
Score = 250, Expect = 1.4e-19, Identities = 73/191 (38%), Positives = 104/191 (54%)
  Q:     1 MKIKKIKLLKALAMTGAFGIVATVPVIVSSCSSTSDNNTGGDNNGGGNT--QNQTISTQLRSSVTLSGALSNIYNPTSGSNTNTLLAAQIKSNLNSVFENGEALANVDDLEITVNGNFPTTSEWTGTTAFAGNNGWNATQGLTDVLYDWNTAALNISSLNDLKTQLTSEKITSIITEASSAPASGTVFTVVEN 191
           MK    KLLK  ++ G F      P+ + S    S+ +    N    NT  ++ +I  +L+SS+ LSG L  IYN  + S  N  +A +IK+NL+  FEN E L +V DL I +NG+F  +S W G   + GNNGW++      +LY  +   LN+SSL DLK QLT  KI  I+ E  S+  + T    V+N
  S:     1 MKSNVAKLLKISSVVGIFAASTAAPISLVSMYVFSNKSLSDSNGNDSNTNPEDGSIIPKLKSSINLSGPLDKIYNSQNASEANDWIAQEIKTNLDLAFENSEELKSVTDLNILINGDFLDSSSWDG-NPYDGNNGWSSLTKENQILYSASLEQLNVSSLTDLKNQLTDSKIKEILNEYDSSKLNWTAEYSVKN 192
>gi|26554194|ref|NP_758128.1| putative P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454203|dbj|BAC44532.1| P35 lipoprotein homolog fragment [Mycoplasma penetrans HF-2] (381 aa)
Score = 235, Expect = 7.8e-18, Identities = 88/234 (37%), Positives = 133/234 (56%)
  Q:   145 YDWNTAALNISSLNDLKTQLTSE-KITSIITEASSAPASGTVFTVVENSALGLTNNADSIDANASRDLLHIHVTGTEGSNT-TNYDLQIPVSDLNLVVSDLTVTVTGTNVEQTGSTTTNFTYNIGINETANFVQPTQAPSINSADTNGD-----GNKALVALGYANESDGNYT--LNNEAISAGIGVYNSEFSNPTI---AATQGGSSNQF---TITLSATPKEGYVWEDGTRDAKSISFPVTFTVTTA 378
           Y +N+  ++I SL+DLKTQL+ + K+   + EA +       +T+   +  GLT++          DL+H++V  ++ S T TNYDLQIP SD+NLV+SDL V V+G +V +  +   N  YNI I +  ++  P     +N+  T        G KA      + ++    T  LN+E I   +GV+N+EFSNP +   +     S+N F    IT++ TPKEGY +E G   +K  SF V  T  TA
  S:    21 YSYNSPQIDIKSLDDLKTQLSDQTKLKDALKEAGATVDETATYTI--KNQPGLTDD----------DLIHVNVESSKASATATNYDLQIPASDINLVISDLNVKVSGADVTEV-NEKVNLNYNIAIKDETSYTGPADIKKMNATPTEDSVMQELGFKATTRTKRSTDATPAATVALNSEKIGETLGVFNTEFSNPVLELDSTNNPSSTNNFFTYKITVTGTPKEGYHFEGG-ETSKQFSFLVKITEVTA 255
>gi|26554105|ref|NP_758039.1| putative P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454113|dbj|BAC44443.1| P35 lipoprotein homolog fragment [Mycoplasma penetrans HF-2] (159 aa)
Score = 229, Expect = 4.4e-17, Identities = 77/150 (51%), Positives = 100/150 (66%)
  Q:   229 LQIPVSDLNLVVSDLTVTVTGTNVEQTGSTTTNFTYNIGINETANFVQPTQAPSINSADTNG-DGNKALVALGYANESDGN---YTLNNEAISAGIGVYNSEFSNPTIAATQGGSSNQ------FTITLSATPKEGYVWEDGTRDAKSISFPVTFTVTTA 378
           +QIPVSDLNLV+S+L+VTV GTNV +T +  TNFTYNIGIN  +N+ +PT  PSI  A +   D N  L  LGY   S G    YT+NN+ I   +GVYN  F+N     T+   +N       +TITL+ATP +G+VWED T  +K I+F     +TTA
  S:     1 MQIPVSDLNLVISNLSVTVKGTNVTET-TLETNFTYNIGINSASNYEEPTNKPSITQAQSQTLDANVILEKLGYVTASSGTPTTYTVNNDTIVKALGVYNVTFTNTGATVTEKTDANNAANQKTYTITLNATPNDGHVWEDATNTSKPITFDAILGITTA 159
>gi|26554195|ref|NP_758129.1| putative P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454204|dbj|BAC44533.1| P35 lipoprotein homolog fragment [Mycoplasma penetrans HF-2] (144 aa)
Score = 198, Expect = 1.4e-13, Identities = 63/118 (53%), Positives = 82/118 (69%)
  Q:     9 LKALAMTGAFGIVATVPVIVSSCSSTSDNNTGGDNNGGG-----------NTQNQTISTQLRSSVTLSGALSNIYNPTSGSNTNTLLAAQIKSNLNSVFENGEALANVDDLEITVNGNFPTTSEWTGTT 126
           +KALA+TGAFGI+ATVPVIVSSCSSTS+NN G  N G G            T  Q ++ +L+SS+ L GAL +IYNP SG  T  LLA +IK+N +  FE+ E L N  + +++V   F + S WT  T
  S:     1 MKALALTGAFGIIATVPVIVSSCSSTSENNGGSGNGGTGDNQGGGGSGGGTTDTQKVTPKLKSSINLVGALKDIYNPASGKTTKDLLAQEIKNNPSLAFEDSEKL-NGKNFDVSVEATF-SRSSWTDKT 127
>gi|3850053|emb|CAA07193.1| putative lipoprotein [Mycoplasma penetrans] (120 aa)
Score = 173, Expect = 1.2e-10, Identities = 48/91 (52%), Positives = 65/91 (71%)
  Q:     8 LLKALAMTGAFGIVATVPVIVSSCSST-----SDNNTGGDNNGGGNTQNQTISTQLRSSVTLSGALSNIYNPTSGSNTNTLLAAQIKSNLNSVFEN 98
           LLKALA+TGAFGIVATVPVIVSSCSST      + N        GNTQ++ I+ +L   V+L+G+L +IY+ T    +N L+A +IK+N+  V E+
  S:     1 LLKALALTGAFGIVATVPVIVSSCSSTSDNNNGNGNNNNGGGSDGNTQSEKITPELNDKVSLAGSLKDIYDSTGTKKSNELIAEEIKNNIKDVIES 96
>gi|26554102|ref|NP_758036.1| putative P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454110|dbj|BAC44440.1| P35 lipoprotein homolog fragment [Mycoplasma penetrans HF-2] (69 aa)
Score = 103, Expect = 1.7e-02, Identities = 26/57 (45%), Positives = 36/57 (63%)
  Q:   320 IGVYNSEF----SNPTIAATQGGSSNQFTITLSATPKEG-YVWEDGTRDAKSISFPVTFTVT 376
           +GVYN +F    S+P  + T       + + LSA P +  YVW+DGT DAK +SF V  TV+
  S:     8 LGVYNCKFTAVSSDPDTSVTADAGKTAYKVVLSAEPYDSNYVWDDGTTDAKQVSFTVQLTVS 69