>gi|26553518|ref|NP_757452.1| S-adenosylmethionine-dependent methyltransferase [Mycoplasma penetrans HF-2] >gi|26453524|dbj|BAC43856.1| S-adenosylmethionine-dependent methyltransferase [Mycoplasma penetrans HF-2] (290 aa)
Score = 1342, Expect = 2.2e-146, Identities = 290/290 (100%), Positives = 290/290 (100%)
  Q:     1 MKQLKCKRQKSSMTFSELTKRLNPLDDSQIKWILKELILFNSKIIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYIKK 290
           MKQLKCKRQKSSMTFSELTKRLNPLDDSQIKWILKELILFNSKIIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYIKK
  S:     1 MKQLKCKRQKSSMTFSELTKRLNPLDDSQIKWILKELILFNSKIIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYIKK 290
>gi|20806671|ref|NP_621842.1| rRNA or tRNA methylase [Thermoanaerobacter tengcongensis MB4] >gi|20515121|gb|AAM23446.1| predicted rRNA or tRNA methylase [Thermoanaerobacter tengcongensis MB4] (285 aa)
Score = 279, Expect = 3.8e-23, Identities = 83/225 (36%), Positives = 122/225 (54%)
  Q:    62 EYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKL--KTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKND-PNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVL 286
           E ++ LK + K  ++ IP QYI K   F G  F++ +   +PR ETE +++ A+K+ K  D   ILD+ +GSG +A  IS  K   D  V  V+ +    +V   N   L +  K  FIKSDIF  +     K D I+ NPPYI K +  N+    K EP  AL   ++G +FY R + +    L  G   +FEIG+ Q+EE+EK  ++N     + +KDL   DRV+
  S:    58 ELERFLKYIEKRKSR-IPYQYIVKKQHFMGFEFYVDERVLIPRPETEILVEEALKRMKSGD--LILDIGTGSGAIA--ISIAKLFPDCKVYAVDVSEEALEVAKYNAEKLGVAEKIIFIKSDIFS-NIPQDVKFDLIVSNPPYIKKAELENLQEEVKKEPILALDGGEDGLFFYKRIIPDCKFYLKKGGRGLFEIGYGQREEVEKIFLENGFDEIEVIKDLAHIDRVI 279
>gi|188159783|ref|ZP_02998885.1| protoporphyrinogen oxidase [Mycoplasma mycoides subsp. mycoides LC str. GM12] (282 aa)
Score = 270, Expect = 4.9e-22, Identities = 90/230 (39%), Positives = 124/230 (53%)
  Q:    60 DFEYKKILKQLNKV------LNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKL-KTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPST-KCEPKQALFAPQNGYYFYFRFLSEIYPILANGTE--IIFEIGFNQKEEIEKFLIKNNITV-FKFLKDLDDKDRVLYIK 289
           + +YK   KQ+ K+      L +N P+ YI KS  FY  +FFI K   +PR E+E ++D A +  K  +   I+DLC+GSG L   IS    N    VI  + +    KV  KN +   L  T  +  +   +   +  K + IICNPPYID ND N+D +    EP  ALFAP  G YFY   +  I  IL       I+ E G+ QK+ IE+ LI N +   ++F KD +D  R L IK
  S:    42 NLDYKLTKKQIYKIDQILDLLKQNYPLAYILKSKYFYSNNFFINKDVLIPRNESELIIDHASEFVKNNNDLLIVDLCTGSGCLG--ISCALLNDQNKVILTDISYKALKVANKNIKKFNLTNTSCLNGNFIDVLIKNNLKANLIICNPPYIDINDQNIDKNVIDFEPSIALFAPNKGLYFYEILIKNIDKILDTNKNFLIVLEFGWLQKDSIEQLLINNCLKYKWEFKKDYNDYWRNLIIK 280
>gi|160946321|ref|ZP_02093530.1| hypothetical protein PEPMIC_00281 [Peptostreptococcus micros ATCC 33270] >gi|158447437|gb|EDP24432.1| hypothetical protein PEPMIC_00281 [Peptostreptococcus micros ATCC 33270] (266 aa)
Score = 270, Expect = 4.9e-22, Identities = 79/232 (34%), Positives = 123/232 (53%)
  Q:    59 IDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKT-QFIKSDIF-KIDRSHYEKCDFIICNPPYIDKND-PNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYIKK 290
           +D  Y   L+ + K   +N P+QYI   + FYGL  F+ +   +PR ETE ++D  VK     DK  ILD+  GSG +  +++  K    + + GV+ ++    +  KN+  L L+  +F +SDIF K+D  H+   D I+ NPPYID  +   ++     EP+ AL+  Q+G +FY   +      L+    + FEIG+NQ E I   LI+N   +    KD    DR+L  K+
  S:    39 VDSIYNDFLEIIEK-RKQNYPLQYIFGKWEFYGLELFVDESALIPRFETEILVDEIVKLNCKKDK--ILDIGCGSGAI--SLALAKNLYKSYIYGVDISKEAINLSNKNKEKLNLQNIKFFESDIFSKVDEKHF---DIIVSNPPYIDDAEMKTLEKELSFEPQNALYGGQDGLFFYREIIINSLDYLSEKGVLAFEIGYNQMEIISNLLIENGFEILIAKKDFAGFDRILIAKR 265
>gi|53711799|ref|YP_097791.1| putative protoporphyrinogen oxidase [Bacteroides fragilis YCH46] >gi|52214664|dbj|BAD47257.1| putative protoporphyrinogen oxidase [Bacteroides fragilis YCH46] (278 aa)
Score = 269, Expect = 5.5e-22, Identities = 73/245 (29%), Positives = 122/245 (49%)
  Q:    46 ENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPN-VDPST-KCEPKQALFAPQNG-YYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYIKK 290
           +++ D +  KD  +    +  L+ + + L KN P+QYI     FYG  F +  G  +PR ETE ++D  VK+     +  +LD+ +GSG +A  IS  K    A+V   + +     +  +N R LK    F K D+   +    ++ D I+ NPPY+ +++ N ++P+    EP+ ALF P N    FY R  S    +L     + FEI     EE+ + L +      + +KD+   DR++  K+
  S:    35 QDAIDYYLGKDITLSANEQCDLESIVERLKKNEPIQYIQGETCFYGSMFRVAPGVLIPRPETEELVDLVVKEAATGTR--LLDIGTGSGCIA--ISLAKHIPQAVVTAWDVSEEALAIAGENNRELKAGVHFEKMDVLSAEPVDDDQYDMIVSNPPYVTESEKNEMEPNVLDWEPRLALFVPDNDPLRFYRRIASLGRKMLRLHGRLYFEINRAYGEEVLQMLHEQGYEELRLIKDISGNDRIVTAKR 278
>gi|60680030|ref|YP_210174.1| putative protoporphyrinogen oxidase [Bacteroides fragilis NCTC 9343] >gi|60491464|emb|CAH06214.1| putative protoporphyrinogen oxidase [Bacteroides fragilis NCTC 9343] (278 aa)
Score = 268, Expect = 9.1e-22, Identities = 73/245 (29%), Positives = 122/245 (49%)
  Q:    46 ENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPN-VDPST-KCEPKQALFAPQNG-YYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYIKK 290
           +++ D +  KD  +    +  L+ + + L KN P+QYI     FYG  F +  G  +PR ETE ++D  VK+     +  +LD+ +GSG +A  IS  K    A+V   + +     +  +N R LK    F K D+   +    ++ D I+ NPPY+ +++ N ++P+    EP+ ALF P N    FY R  S    +L     + FEI     EE+ + L +      + +KD+   DR++  K+
  S:    35 QDAIDYYLGKDITLSANEQCDLESIVERLKKNEPIQYIQGETCFYGSMFRVAPGVLIPRPETEELVDLIVKEAATGTR--LLDIGTGSGCIA--ISLAKHIPQAVVTAWDVSEEALAIAGENNRELKAGVHFEKMDVLSAEPVGDDQYDMIVSNPPYVTESEKNEMEPNVLDWEPRLALFVPDNDPLRFYRRIASLGRKMLRLHGRLYFEINRAYGEEVLQMLHEQGYEELRLIKDISGNDRIVTAKR 278
>gi|87160068|ref|YP_494717.1| HemK family modification methylase [Staphylococcus aureus subsp. aureus USA300] >gi|88196021|ref|YP_500834.1| HemK family modification methylase [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|87126042|gb|ABD20556.1| modification methylase, HemK family [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|87203579|gb|ABD31389.1| modification methylase, HemK family, putative [Staphylococcus aureus subsp. aureus NCTC 8325] (250 aa)
Score = 264, Expect = 2.4e-21, Identities = 65/188 (34%), Positives = 104/188 (55%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKND-PNVDPS-TKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLI 266
           P+QYI    SFYG +F +   C +PR ETE ++   ++Q  L D   I+D+ +GSGVLA T+   K   D  VI  + +     +   N    + + QF+  D  K   +   K + +I NPPYID+ D   + P+ T+ EP QALFA  +GY  Y   + ++  ++  G+ ++FEIG+NQ E ++  ++
  S:    40 PIQYIVGFASFYGRTFDVNSNCLIPRPETEEVMLHFLQQ--LEDDATIVDIGTGSGVLAITLKCEKP--DLNVIATDISLEAMNMARNNAEKHQSQIQFLTGDALKPLINEGIKLNGLISNPPYIDEKDMVTMSPTVTRFEPHQALFADNHGYAIYESIIEDLPHVMEKGSPVVFEIGYNQGEALKSIIL 225
>gi|90961567|ref|YP_535483.1| peptide release factor-glutamine N5-methyltransferase [Lactobacillus salivarius UCC118] >gi|90820761|gb|ABD99400.1| Peptide release factor-glutamine N5-methyltransferase [Lactobacillus salivarius UCC118] (279 aa)
Score = 263, Expect = 3.0e-21, Identities = 79/251 (31%), Positives = 132/251 (52%)
  Q:    39 LFNSKIIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIF-KIDRSHYEKCDFIICNPPYIDKNDP-NVDPST-KCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFL---IKNNITVFKFLKDLDDKDRVLYIK 289
           L   +++ + + +     T ID +  + L++  ++ N++ P+QY+     FYGL   + K   +PR ETE ++DW +      +   +LD+ +G+G +   +  I+ N +  +  + +     KV  +N +NL L   F  SD+F KI+     K D I+ NPPYI +N+   +D S    EP QALFA  NG   Y R  +E   +L  G++I  EIGF Q E ++K       N+    K  KD++  DR++ +K
  S:    30 LICGQMVWDKTQLLMNYRTRIDDKNYQELQEKIELYNQDYPLQYLIGYQDFYGLRLKVTKDTLIPRPETEELVDWILNDNSKNENYDVLDVGTGTGAIGLALKSIRSNWNIFLSDISE--PALKVAKENAQNLNLDVSFSTSDLFEKIE----GKKDIIVSNPPYISENEKIYMDKSVLNYEPHQALFAKNNGLEIYERIANESGKLLKQGSKIYMEIGFLQGEAVKKIFKDSFPNSEITLK--KDINGNDRMICVK 278
>gi|34763569|ref|ZP_00144504.1| METHYLTRANSFERASE [Fusobacterium nucleatum subsp. vincentii ATCC 49256] >gi|27886758|gb|EAA23896.1| METHYLTRANSFERASE [Fusobacterium nucleatum subsp. vincentii ATCC 49256] (370 aa)
Score = 263, Expect = 3.0e-21, Identities = 78/226 (34%), Positives = 125/226 (55%)
  Q:    65 KILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKT-QFIKSDIF-KIDRSHYEKCDFIICNPPYIDKND-PNVDPSTK-CEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYIKK 290
           KI + L     K  P+QYI   + FYGL F + +G  +PR +TE +++  ++  + +++  ILD+ SGSG +  +I+   + K + V G++ N    ++  +N+   K++   FIKSD+F KID+    K D I+ NPPYI KN+   + P  K  EP+ AL    +G YFY          L +   + +EIG+NQ +++ K L  NN  +   +KD    DRV+  KK
  S:   125 KIREMLVLRAKKRKPLQYILGEWEFYGLPFKVSEGVLIPRADTEILVEQCIQLMREVEEPNILDIGSGSGAI--SIAIANELKSSSVTGIDINEKAIELANENKTLNKIENVNFIKSDLFEKIDKDF--KYDLIVSNPPYISKNEYETLMPEVKNYEPQNALTDLGDGLYFYREISKLAGEYLKDTGYLAYEIGYNQAKDVTKILQNNNFDILSVIKDYGGNDRVVIAKK 350
>gi|83319283|ref|YP_424136.1| HemK family modification methylase [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|83283169|gb|ABC01101.1| modification methylase, HemK family [Mycoplasma capricolum subsp. capricolum ATCC 27343] (270 aa)
Score = 263, Expect = 3.4e-21, Identities = 80/202 (39%), Positives = 112/202 (55%)
  Q:    67 LKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLK-TQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPST-KCEPKQALFAPQNGYYFYFRFLSEIYPILANGTE--IIFEIGFNQKEEIEKFLIKN 268
           L+Q++K+L K  P+ YI K+  FY  +FFI K   +PR E+E ++D+  +  K  +   I+DLC+GSG L   IS    NK   VI  + +    KV  KN +   LK T  +  D   +      K + II NPPYID ND N+D +  + EP  ALFAP  G YFY   +  I  I+    +  I+ E G+ QK+ IE+ LIKN
  S:    55 LEQISKLLEKKYPLAYILKNKYFYSNNFFINKDVLIPRNESELIIDYVSEFIKNNNDLLIVDLCTGSGCLG--ISCALLNKQNKVILTDISYKALKVANKNIKRFNLKNTACLSGDFISVLIKDNIKANVIISNPPYIDINDQNLDKNVIEYEPSIALFAPNKGLYFYEILIKNIDQIVDVNKKFLIVLEFGWLQKDSIEQLLIKN 258
>gi|57652139|ref|YP_186924.1| HemK family modification methylase [Staphylococcus aureus subsp. aureus COL] >gi|151222233|ref|YP_001333055.1| modification methylase HemK family protein [Staphylococcus aureus subsp. aureus str. Newman] >gi|161510322|ref|YP_001575981.1| HemK family methyltransferase [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|168728877|ref|ZP_02761154.1| HemK family methyltransferase [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|57286325|gb|AAW38419.1| modification methylase, HemK family [Staphylococcus aureus subsp. aureus COL] >gi|150375033|dbj|BAF68293.1| modification methylase HemK family protein [Staphylococcus aureus subsp. aureus str. Newman] >gi|160369131|gb|ABX30102.1| HemK family methyltransferase [Staphylococcus aureus subsp. aureus USA300_TCH1516] (278 aa)
Score = 262, Expect = 3.7e-21, Identities = 65/188 (34%), Positives = 104/188 (55%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKND-PNVDPS-TKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLI 266
           P+QYI    SFYG +F +   C +PR ETE ++   ++Q  L D   I+D+ +GSGVLA T+   K   D  VI  + +     +   N    + + QF+  D  K   +   K + +I NPPYID+ D   + P+ T+ EP QALFA  +GY  Y   + ++  ++  G+ ++FEIG+NQ E ++  ++
  S:    68 PIQYIVGFASFYGRTFDVNSNCLIPRPETEEVMLHFLQQ--LEDDATIVDIGTGSGVLAITLKCEKP--DLNVIATDISLEAMNMARNNAEKHQSQIQFLTGDALKPLINEGIKLNGLISNPPYIDEKDMVTMSPTVTRFEPHQALFADNHGYAIYESIIEDLPHVMEKGSPVVFEIGYNQGEALKSIIL 253
>gi|15925107|ref|NP_372641.1| protoporphyrinogen oxidase [Staphylococcus aureus subsp. aureus Mu50] >gi|15927691|ref|NP_375224.1| hypothetical protein SA1919 [Staphylococcus aureus subsp. aureus N315] >gi|148268568|ref|YP_001247511.1| HemK family modification methylase [Staphylococcus aureus subsp. aureus JH9] >gi|150394632|ref|YP_001317307.1| HemK family modification methylase [Staphylococcus aureus subsp. aureus JH1] >gi|156980432|ref|YP_001442691.1| hypothetical protein SAHV_2101 [Staphylococcus aureus subsp. aureus Mu3] >gi|13701911|dbj|BAB43203.1| SA1919 [Staphylococcus aureus subsp. aureus N315] >gi|14247890|dbj|BAB58279.1| similar to protoporphyrinogen oxidase [Staphylococcus aureus subsp. aureus Mu50] >gi|147741637|gb|ABQ49935.1| modification methylase, HemK family [Staphylococcus aureus subsp. aureus JH9] >gi|149947084|gb|ABR53020.1| modification methylase, HemK family [Staphylococcus aureus subsp. aureus JH1] >gi|156722567|dbj|BAF78984.1| hypothetical protein [Staphylococcus aureus subsp. aureus Mu3] (278 aa)
Score = 262, Expect = 3.8e-21, Identities = 65/188 (34%), Positives = 103/188 (54%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKND-PNVDPS-TKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLI 266
           P+QYI    SFYG +F +   C +PR ETE ++   ++Q  L D   I+D+ +GSGVLA T+   K   D  VI  + +     +   N    + + QF+  D  K       K + +I NPPYID+ D   + P+ T+ EP QALFA  +GY  Y   + ++  ++  G+ ++FEIG+NQ E ++  ++
  S:    68 PIQYIVGFASFYGRTFDVNSNCLIPRPETEEVMLHFLQQ--LEDDATIVDIGTGSGVLAITLKCEKP--DLNVIATDISLEAMNMARNNAEKHQSQIQFLTGDALKPLIKEGIKLNGLISNPPYIDEKDMVTMSPTVTRFEPHQALFADNHGYAIYESIIGDLPHVMEKGSPVVFEIGYNQGEALKSIIL 253
>gi|187932826|ref|YP_001884695.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Clostridium botulinum B str. Eklund 17B] >gi|187720979|gb|ACD22200.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Clostridium botulinum B str. Eklund 17B] (287 aa)
Score = 262, Expect = 4.0e-21, Identities = 70/223 (31%), Positives = 125/223 (56%)
  Q:    64 KKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKN--QRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPN--VDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVL 286
           +K ++ +NK   K +PV+YI     F  ++F+++ G  +PR +TE +++  +K     D K I DLC GSG +   ++ ++KN +  +I  +   TP KV + N  + N+  +  F+KSD+     +  ++ D I+ NPPYI++ + N  ++     EP  AL   ++G  FY R ++E   +L     + FEIG+NQ  ++++ + + N    K +KDL   DRV+
  S:    58 EKYMELINKRKEK-MPVKYILNECEFMNINFYVEPGVLIPRADTEILVEEVLKHIDENDSKKICDLCCGSGAIGIALANLRKNINVDLI--DYYETPEKVTLINIEKSNILDRASFMKSDLLNKSINDAKRYDIIVSNPPYIEECEINDLMEDVKNYEPHTALSGGKDGLDFYKRIINESINVLNKNGILAFEIGYNQGTDVKELMEEKNFIEVKIVKDLAGLDRVV 281
>gi|16804580|ref|NP_466065.1| hypothetical protein lmo2542 [Listeria monocytogenes EGD-e] >gi|153197152|ref|ZP_01941422.1| hypothetical protein LMRG_01705 [Listeria monocytogenes 10403S] >gi|167213178|ref|ZP_02283485.1| hypothetical protein LmonL_22771 [Listeria monocytogenes LO28] >gi|16412030|emb|CAD00620.1| lmo2542 [Listeria monocytogenes] >gi|127633203|gb|EBA22620.1| hypothetical protein LMRG_01705 [Listeria monocytogenes 10403S] (283 aa)
Score = 262, Expect = 4.5e-21, Identities = 81/257 (31%), Positives = 135/257 (52%)
  Q:    28 SQIKWILK--ELILFNSKIIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKN---------------IPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPN--VDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNI-TVFKFLKDLDDKDR 284
           +QI  +LK  E ILF   + +N+++I  E  T +     ++  ++++ L  N                PVQYI K+  FYG  F + +   +PR ETE ++  A    K    K +LD+C+GSG++A  I+  K   +  V   + +     V  KN   L    +F+++D+ +  + + E+ D I+ NPPYI + +     D   K EP  ALFA  +G   Y RF+  +  +L +   +  EIG+ Q E +++   K+   T     KD++ KDR
  S:     2 TQISQLLKKAEAILFEKGLDQNAAEILLE--TRMGLSRSELWMEISRELEPNHEKQFEEDFARYLAGEPVQYILKTAPFYGYDFLVTEDVLIPRPETEELVACAEAFLKKHPVKNVLDVCTGSGIIA--IALKKAFPEISVTASDISAPALVVARKNALLLNADVRFVETDLLEAFKQNEERFDMIVANPPYISEAEKAEMSDYVLKNEPSLALFAENDGLAIYERFVDNLKYVLNSSFWVGVEIGYTQGERVKQLFEKSYPHTTVVIHKDINSKDR 274
>gi|21283770|ref|NP_646858.1| hypothetical protein MW2041 [Staphylococcus aureus subsp. aureus MW2] >gi|49486910|ref|YP_044131.1| hypothetical protein SAS2020 [Staphylococcus aureus subsp. aureus MSSA476] >gi|21205212|dbj|BAB95906.1| MW2041 [Staphylococcus aureus subsp. aureus MW2] >gi|49245353|emb|CAG43828.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus MSSA476] (278 aa)
Score = 261, Expect = 5.0e-21, Identities = 65/188 (34%), Positives = 104/188 (55%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKND-PNVDPS-TKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLI 266
           P+QYI    SFYG +F +   C +PR ETE ++   ++Q  L D   I+D+ +GSGVLA T+   K   D  VI  + +     +   N    + + QF+  D  K   +   K + +I NPPYID+ D   + P+ T+ EP QALFA  +GY  Y   + ++  ++  G+ ++FEIG+NQ E ++  ++
  S:    68 PIQYIVGFASFYGRTFDVNSNCLIPRPETEEVMLHFLQQ--LEDDATIVDIGTGSGVLAITLKCEKP--DLNVIATDISLEAMNMARNNAEKHQSQIQFLTGDALKPLINEDIKLNGLISNPPYIDEKDMVTMSPTVTRFEPHQALFADNHGYAIYESIIEDLPHVMEKGSPVVFEIGYNQGEALKSIIL 253
>gi|82751718|ref|YP_417459.1| hypothetical protein SAB2001c [Staphylococcus aureus RF122] >gi|82657249|emb|CAI81690.1| conserved hypothetical protein [Staphylococcus aureus RF122] (278 aa)
Score = 261, Expect = 5.1e-21, Identities = 65/188 (34%), Positives = 103/188 (54%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKND-PNVDPS-TKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLI 266
           P+QYI    SFYG +F +   C +PR ETE ++   ++Q  L D   I+D+ +GSGVLA T+   K   D  VI  + +     +   N    + + QF+  D  K       K + +I NPPYID+ D   + P+ T+ EP QALFA  +GY  Y   + ++  ++  G+ ++FEIG+NQ E ++  ++
  S:    68 PIQYIVGFASFYGRTFDVNSNCLIPRPETEEVMLHFLQQ--LEDDATIVDIGTGSGVLAITLKCEKP--DLNVIATDISLEAMNMARNNAEKHQSQIQFLTGDALKPLIKEGIKLNGLISNPPYIDEKDMVTMSPTVTRFEPHQALFADNHGYAIYESIIEDLPHVMEKGSPVVFEIGYNQGEALKSIIL 253
>gi|19704666|ref|NP_604228.1| methyltransferase [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >gi|19714974|gb|AAL95527.1| Methyltransferase [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] (354 aa)
Score = 261, Expect = 5.6e-21, Identities = 85/268 (31%), Positives = 144/268 (53%)
  Q:    23 NPLDDSQIKWILKELILFNSKIIENSSDIFFEKDTEIDFEYK-KILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKT-QFIKSDIF-KIDRSHYEKCDFIICNPPYIDKND-PNVDPSTK-CEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYIKK 290
           NPL D++         +F+  +  N + + +    EI  E K KI + L     K  P+QYI   + FYGL F + +G  +PR +TE +++  ++  + +++  ILD+ SGSG +  +I+   + K + V G++ N    K+ ++N+   K++   FI+S++F K+D+    K D I+ NPPYI K++   + P  K  EP+ AL    +G +FY          L +   + FEIG+NQ +++ K L  NN  +   +KD    DRV+  KK
  S:    74 NPLLDTEY--------IFSDVLKVNKNTLKYSMSREIKEEDKNKIREMLVLRAKKRKPLQYILGEWEFYGLPFKMSEGVLIPRADTEILVEQCIQLMREVEEPNILDIGSGSGAI--SIAVANELKSSSVTGIDINEKAIKLAIENKILNKIENVNFIESNLFGKLDKDF--KYDLIVSNPPYISKDEYETLMPEVKNYEPQNALTDLGDGLHFYKEISKLAGEYLKDTGYLAFEIGYNQAKDVSKILQDNNFAILSIVKDYGGNDRVIIAKK 334
>gi|49484341|ref|YP_041565.1| hypothetical protein SAR2205 [Staphylococcus aureus subsp. aureus MRSA252] >gi|49242470|emb|CAG41186.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus MRSA252] (278 aa)
Score = 261, Expect = 5.8e-21, Identities = 65/188 (34%), Positives = 103/188 (54%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKND-PNVDPS-TKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLI 266
           P+QYI    SFYG +F +   C +PR ETE ++   ++Q  L D   I+D+ +GSGVLA T+   K   D  VI  + +     +   N    + + QF+  D  K       K + +I NPPYID+ D   + P+ T+ EP QALFA  +GY  Y   + ++  ++  G+ ++FEIG+NQ E ++  ++
  S:    68 PIQYIVGFASFYGRTFDVNSNCLIPRPETEEVMLHFLQQ--LEDDATIVDIGTGSGVLAITLKCEKP--DLNVIATDISLEAMNMARNNAEKHQSQIQFLTGDALKPLIKEGIKLNGLISNPPYIDEKDMVTMSPTVTRFEPHQALFADNHGYAIYESIIEDLPHVMEKGSPVVFEIGYNQGEALKSIIL 253
>gi|153814376|ref|ZP_01967044.1| hypothetical protein RUMTOR_00586 [Ruminococcus torques ATCC 27756] >gi|145848772|gb|EDK25690.1| hypothetical protein RUMTOR_00586 [Ruminococcus torques ATCC 27756] (287 aa)
Score = 260, Expect = 6.6e-21, Identities = 82/263 (31%), Positives = 146/263 (55%)
  Q:    25 LDDSQIK-WILKELILFNSKIIENSSDIFFE-KDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAV----KQKKLIDKKYILDLCSGSG-VLANTISYIKKNK--DAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKND-PNVDPSTKC-EPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLY 287
           +++S+I  W L E +   +KI   S  +F+   + E+  E K   ++  K   + IP+Q+IT    F GL F + +   +PRQ+TE +++ A+    K+KK  +   ILDLC+GSG +L + + Y+++ +  D   +G + ++    V V+N + L ++ +F++ D+F+     +   D I+ NPPYI  ++   +    +  +P +AL   ++G YFY   + E    L  G  +IFEIG +Q E ++  L +      +  KDL   DRV+Y
  S:    19 VEESKIDAWYLLEYV---TKI---SRAVFYAYPEKELTEEEKIQYEECIKRRAERIPLQHITGVQEFMGLPFLVNEHVLIPRQDTEVLVEQALCLLEKEKKHKEIVRILDLCTGSGCILLSMLHYVRRKRKIDIYGVGSDISKEALAVAVENAKKLGIEAKFVQGDLFENVEGSF---DMILSNPPYIRTSEIERLQEEVRFHDPIKALDGKEDGLYFYRIIVKESRQYLKRGGWLIFEIGSDQAEAVKTLLQEAGYENIEVKKDLAGLDRVVY 283
>gi|154502574|ref|ZP_02039634.1| hypothetical protein RUMGNA_00387 [Ruminococcus gnavus ATCC 29149] >gi|153796766|gb|EDN79186.1| hypothetical protein RUMGNA_00387 [Ruminococcus gnavus ATCC 29149] (283 aa)
Score = 260, Expect = 7.3e-21, Identities = 67/228 (29%), Positives = 127/228 (55%)
  Q:    60 DFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAV---KQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKN--DPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLY 287
           D E ++ L+ + K  +  IP+Q++T    F GL F + +   +PRQ+TE +++ A+   KQ+++ + + +LD+C+GSG +  ++ +  K +    +GV+ ++    V  KN   LK+  +F++SD+F+  +  Y   D ++ NPPYI  +  +   +     +P  AL   ++G YFY R + +    L     ++FEIG +Q E+++  + +   T     KDL   DRV++
  S:    51 DQEEREYLELIRK-RSTRIPLQHLTGVQEFMGLEFLVNEHVLIPRQDTEVLVETALDVCKQEQMGEIR-LLDMCTGSGCILLSLLHELKPRTVTGVGVDLSKEALCVAEKNAEKLKIDAEFLESDLFENVKGTY---DVVVSNPPYIRTSVIETLQEEVKDHDPYLALDGKEDGLYFYRRIIEQAPAYLKKKGWLLFEIGSDQGEDVKNLMEQAGYTGVSVKKDLAGLDRVVF 278
>gi|153168645|ref|ZP_01928468.1| hypothetical protein LMHG_01592 [Listeria monocytogenes FSL N1-017] >gi|133726208|gb|EBA27906.1| hypothetical protein LMHG_01592 [Listeria monocytogenes FSL N1-017] (283 aa)
Score = 259, Expect = 8.1e-21, Identities = 82/257 (31%), Positives = 136/257 (52%)
  Q:    28 SQIKWILK--ELILFNSKIIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKN---------------IPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPN--VDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKN--NITVFKFLKDLDDKDR 284
           +QI  +LK  E IL    + +N+++I  E  T +     ++  ++++ L  N                PVQYI K+  FYG  F + +   +PR ETE ++  A    K    K +LD+C+GSG++A  I+  K   D  V   + +     V  KN   L    +F+++D+ +  + + E+ D I+ NPPYI + +     D   K EP  ALFA  +G   Y RF+  +  +L +   +  EIG+ Q E +++   K+  + TV    KD++ KDR
  S:     2 TQISQLLKKAEAILLEKGLDQNAAEILLE--TRMGLSRSELWMEISRELEPNHEKQFEEDFARYLAGEPVQYILKTAPFYGYDFLVTEDVLIPRPETEELVACAEDFLKKHPVKNVLDVCTGSGIIA--IALKKAFPDISVTASDISAPALAVAKKNALLLNADVRFVETDLLEAFKQNEERFDMIVANPPYISEAEKAEMSDYVLKNEPSLALFAENDGLAIYERFVDNLQYVLNSSFWVGVEIGYTQGERVKQLFEKSYPHSTVI-IHKDINSKDR 274
>gi|182420255|ref|ZP_02951484.1| methyltransferase, HemK family [Clostridium butyricum 5521] >gi|182375850|gb|EDT73442.1| methyltransferase, HemK family [Clostridium butyricum 5521] (585 aa)
Score = 258, Expect = 1.2e-20, Identities = 65/211 (30%), Positives = 115/211 (54%)
  Q:    76 KNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKN--QRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPN--VDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVL 286
           K +PV+YI     F G+   +++G  +PR +TE ++D  +K     D+K I DLC GSG +  +++ ++KN    ++  +    P KV + N  + NL+ +  F KSD+  +     +K D I+ NPPYI++ +    +D   K EP  AL    +G  FY + +++   +L     + FEIG+NQ + ++  + +NN    + +KD    DR++
  S:   369 KKMPVKYILNKCEFMGIDLHVEEGVLIPRDDTELLVDEVLKNISEDDEKQICDLCCGSGAIGISLACLRKNIKVDLL--DYYPIPEKVTLINIEKHNLQERVSFSKSDLLDVSIKASKKYDIIVSNPPYIEEEEIEKLMDDVQKYEPHTALSGGIDGLDFYKKIVNQSIEVLNENGILAFEIGYNQGKAVKSLMEENNFKDVRVIKDFASLDRIV 581
>gi|16801747|ref|NP_472015.1| hypothetical protein lin2686 [Listeria innocua Clip11262] >gi|16415222|emb|CAC97912.1| lin2686 [Listeria innocua] (283 aa)
Score = 257, Expect = 1.3e-20, Identities = 73/247 (29%), Positives = 126/247 (51%)
  Q:    38 ILFNSKIIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPN--VDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKN--NITVFKFLKDLDDKDR 284
           IL  +++    S+++ E   E++  ++K  ++         PVQYI K+  FYG  F + +   +PR ETE ++  A    K    + +LD+C+GSG++A  I+  K   D  V   + +     +  KN   L    +F+++D+ +  + + E+ D I+ NPPYI + +     D   K EP  ALFA  +G   Y RF+  +  +L     +  EIG+ Q E +++   K+  + TV    KD++ KDR
  S:    27 ILLETRMGLTRSELWMEMSRELEPNHEKQFQEDFARYLAGEPVQYILKTAPFYGYDFLVTEDVLIPRPETEELVATAEAFLKQHPLRSLLDVCTGSGIIA--IALKKAFPDMTVTASDISAAALAIAKKNSLLLNADVRFVETDLLESFKQNNERFDMIVANPPYISEAEKAEMSDYVLKNEPSIALFAENDGLAIYERFVDNLKYVLNPSFWVGVEIGYTQGERVKQLFEKSYPHATVL-IHKDINSKDR 274
>gi|73662076|ref|YP_300857.1| putative rRNA or tRNA methylase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|72494591|dbj|BAE17912.1| putative rRNA or tRNA methylase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (278 aa)
Score = 257, Expect = 1.3e-20, Identities = 72/262 (27%), Positives = 136/262 (51%)
  Q:    25 LDDSQIKWILKELILFNSKIIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPST--KCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITV-FKFLKDLDDKDRVL 286
           ++ ++ +W++  L LFN     + ++     D E+  ++K +     + +  + P+QYI    +FYG  F + K C +PR ETE ++     Q  L     ++D+ +GSG +   IS  K +    V   +   +   V   N +  +++ +F+  D       H  K + +I NPPYID ND  +  +T    EP  ALFA  NGY  Y + + ++  +L    +++FEIGFNQ + +++ +I+   ++  + +KD+++ DR++
  S:    20 IESTRAEWLM--LDLFNW----SKANYLMHMDDEVTLQHKNLFDDATQRMLNDEPIQYILGKQTFYGEVFKVNKHCLIPRPETEEVMLHFYNQ--LHSGDCVVDIGTGSGNIP--ISLKKLDPSLEVYATDLYTSALSVAKANAKMHQVEIRFLLGDTLMPLIEHGIKVNGLISNPPYIDDNDALIMDNTVLNYEPHTALFAKNNGYDIYDKIIDQLREVLLPNAKVVFEIGFNQGQTLKQRIIEKYPSLDVQIIKDINNNDRII 274
>gi|42560703|ref|NP_975154.1| protoporphyrinogen oxidase [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|42492199|emb|CAE76796.1| protoporphyrinogen oxidase [Mycoplasma mycoides subsp. mycoides SC str. PG1] (282 aa)
Score = 257, Expect = 1.3e-20, Identities = 91/249 (36%), Positives = 131/249 (52%)
  Q:    41 NSKIIENSSDIFFEKDTEIDFEYKKILKQLNKVLNK---------------NIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKL-KTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPST-KCEPKQALFAPQNGYYFYFRFLSEIYPILANGTE--IIFEIGFNQKEEIEKFLIKNNITV-FKFLKDLDDKDRVLYIK 289
           N+ I  N +D++   +  I+ +Y+ I+  L+  L K               N P+ YI KS  FY   FF+ K   +PR E+E ++D   +  K  +   I+DLC+GSG L   IS    N    VI  + +    KV  KN +   L  T  +  +   +   +  K + IICNPPYID ND N+D +    EP  ALFAP  G YFY   +  I  I+       I+ E G+ QK+ IE+ LI N +   ++F KD +D  R L IK
  S:    14 NTNISLNKADVYHILEHIINKDYQWIISNLDHKLTKKQIYKIDQILDLLKQNYPLAYILKSKYFYSNIFFVNKDVLIPRNESELIIDHVSEFVKNNNDLLIVDLCTGSGCLG--ISCALLNDQNKVILTDISYKSLKVANKNIKKFNLINTSCLNGNFIDVLIKNNLKANLIICNPPYIDINDQNIDKNVIDFEPSIALFAPNKGLYFYEILIKNIDKIVDTNKNFLIVLEFGWLQKDSIEQLLINNCLKYKWEFKKDYNDYWRNLIIK 280
>gi|188589649|ref|YP_001919882.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Clostridium botulinum E3 str. Alaska E43] >gi|188499930|gb|ACD53066.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Clostridium botulinum E3 str. Alaska E43] (288 aa)
Score = 257, Expect = 1.4e-20, Identities = 71/223 (31%), Positives = 122/223 (54%)
  Q:    64 KKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKL--KTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPN--VDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVL 286
           +K +K ++K   K +PV+YI     F  ++F+++ G  +PR +TE +++  +K     D K I DLC GSG +  +++ ++KN +  +I  +    P KV + N +   +  +T FIKSD+     +  +K D I+ NPPYI++ + N  +D     EP  AL   ++G  FY R   +   +L     + FEIG+NQ   +++ + + N    K +KDL   DRV+
  S:    59 EKYMKLISKRKEK-MPVKYILNECEFMNMNFYVEPGVLIPRADTEILVEEVLKNIDENDSKKICDLCCGSGAIGISLANLRKNINVDLI--DYYEIPEKVTLINIKKYDILDRTNFIKSDLLNKSINDAKKYDIIVSNPPYIEECEINDLMDDVKNYEPHTALSGGRDGLDFYKRITEQSINVLNESGILAFEIGYNQGTAVKELMEEKNFIEVKIVKDLAGLDRVV 282
>gi|47096964|ref|ZP_00234540.1| modification methylase, HemK family [Listeria monocytogenes str. 1/2a F6854] >gi|153175795|ref|ZP_01931099.1| hypothetical protein LMIG_01616 [Listeria monocytogenes FSL N3-165] >gi|153184881|ref|ZP_01935529.1| hypothetical protein LMOG_01447 [Listeria monocytogenes J0161] >gi|153192198|ref|ZP_01939243.1| hypothetical protein LMPG_01329 [Listeria monocytogenes J2818] >gi|47014674|gb|EAL05631.1| modification methylase, HemK family [Listeria monocytogenes str. 1/2a F6854] >gi|126942393|gb|EBA20132.1| hypothetical protein LMOG_01447 [Listeria monocytogenes J0161] >gi|127764526|gb|EBA25058.1| hypothetical protein LMPG_01329 [Listeria monocytogenes J2818] >gi|133729220|gb|EBA30918.1| hypothetical protein LMIG_01616 [Listeria monocytogenes FSL N3-165] (283 aa)
Score = 257, Expect = 1.6e-20, Identities = 80/257 (31%), Positives = 134/257 (52%)
  Q:    28 SQIKWILK--ELILFNSKIIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKN---------------IPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPN--VDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNI-TVFKFLKDLDDKDR 284
           +QI  +LK  E IL    + +N+++I  E  T +     ++  ++++ L  N                PVQYI K+  FYG  F + +   +PR ETE ++  A    K    K +LD+C+GSG++A  I+  K   +  V   + +     V  KN   L    +F+++D+ +  + + E+ D I+ NPPYI + +     D   K EP  ALFA  +G   Y RF+  +  +L +   +  EIG+ Q E +++   K+   T     KD++ KDR
  S:     2 TQISQLLKNAEAILLEKGLDQNAAEILLE--TRMGLSRSELWMEISRELEPNHEKQFEEDFARYLAGEPVQYILKTAPFYGYDFLVTEDVLIPRPETEELVACAEAFLKKHPVKNVLDVCTGSGIIA--IALKKAFPEISVTASDISAPALVVARKNALLLNADVRFVETDLLEAFKQNEERFDMIVANPPYISEAEKAEMSDYVLKNEPSLALFAENDGLAIYERFVDNLKYVLNSSFWVGVEIGYTQGERVKQLFEKSYPHTTVVIHKDINSKDR 274
>gi|153204127|ref|ZP_01944977.1| hypothetical protein LMSG_02317 [Listeria monocytogenes HPB2262] >gi|167015628|ref|ZP_02278161.1| modification methylase, HemK family protein [Listeria monocytogenes FSL J1-194] >gi|133734359|gb|EBA36057.1| hypothetical protein LMSG_02317 [Listeria monocytogenes HPB2262] (283 aa)
Score = 256, Expect = 1.8e-20, Identities = 81/257 (31%), Positives = 136/257 (52%)
  Q:    28 SQIKWILK--ELILFNSKIIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKN---------------IPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPN--VDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKN--NITVFKFLKDLDDKDR 284
           +QI  +LK  E IL    + +N+++I  E  T +     ++  ++++ L  N                PVQYI K+  FYG  F + +   +PR ETE ++  A    K    K +LD+C+GSG++A  I+  K   D  +   + +     V  KN   L    +F+++D+ +  + + E+ D I+ NPPYI + +     D   K EP  ALFA  +G   Y RF+  +  +L +   +  EIG+ Q E +++   K+  + TV    KD++ KDR
  S:     2 TQISQLLKNAEAILLEKGLDQNAAEILLE--TRMGLSRSELWMEISRELEPNHEKQFEEDFARYLAGEPVQYILKTAPFYGYDFLVTEDVLIPRPETEELVACAEDFLKKHPVKNVLDVCTGSGIIA--IALKKAFPDISMTASDISAPALAVAKKNALLLNADVRFVETDLLEAFKQNEERFDMIVANPPYISEAEKAEMSDYVLKNEPSLALFAENDGLAIYERFVDNLQYVLNSSFWVGVEIGYTQGERVKQLFEKSYPHSTVI-IHKDINSKDR 274
>gi|46908714|ref|YP_015103.1| HemK family modification methylase [Listeria monocytogenes str. 4b F2365] >gi|46881986|gb|AAT05280.1| modification methylase, HemK family [Listeria monocytogenes str. 4b F2365] (283 aa)
Score = 256, Expect = 1.8e-20, Identities = 81/257 (31%), Positives = 136/257 (52%)
  Q:    28 SQIKWILK--ELILFNSKIIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKN---------------IPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPN--VDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKN--NITVFKFLKDLDDKDR 284
           +QI  +LK  E IL    + +N+++I  E  T +     ++  ++++ L  N                PVQYI K+  FYG  F + +   +PR ETE ++  A    K    K +LD+C+GSG++A  I+  K   D  +   + +     V  KN   L    +F+++D+ +  + + E+ D I+ NPPYI + +     D   K EP  ALFA  +G   Y RF+  +  +L +   +  EIG+ Q E +++   K+  + TV    KD++ KDR
  S:     2 TQISQLLKKAEAILLEKGLDQNAAEILLE--TRMGLSRSELWMEISRELEPNHEKQFEEDFARYLAGEPVQYILKTAPFYGYDFLVTEDVLIPRPETEELVACAEDFLKKHPVKNVLDVCTGSGIIA--IALKKAFPDISMTASDISAPALAVAKKNALLLNADVRFVETDLLEAFKQNEERFDMIVANPPYISEAEKAEMSDYVLKNEPSLALFAENDGLAIYERFVDNLQYVLNSSFWVGVEIGYTQGERVKQLFEKSYPHSTVI-IHKDINSKDR 274
>gi|28210062|ref|NP_781006.1| methyltransferase [Clostridium tetani E88] >gi|28202497|gb|AAO34943.1| methyltransferase [Clostridium tetani E88] (292 aa)
Score = 255, Expect = 2.4e-20, Identities = 78/255 (30%), Positives = 132/255 (51%)
  Q:    32 WILKELILFNSKIIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQR--NLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPN--VDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVL 286
           +IL+  +L    I ++   I   KD ++  E K    +L  +  + +P++YI     F GLSF I++G  +PR +TE +++ +++  +    K I D+C GSG++  +I+      +     VE+   P KV  +N +   L+ K +  KS++ +    +  K D I+ NPPYI K +    ++     EP  AL   ++G YFY   + +   +L +G  I FEIG++QKEE+   L  N     +  KDL   DRV+
  S:    28 YILESQLLLGKVINKDRLFIMINKDYKVSKEEKDQYLKLIDIRKEKMPIKYILGICEFMGLSFKIREGVLIPRPDTEILVEKSIEIIRKNHYKNISDVCCGSGIIGISIATFVDKVNVECFDVEE--IPLKVTEENIKLNRLEGKVKVFKSNLLEYAIKNSIKYDMIVSNPPYIKKREITNLMEDVKNYEPHIALDGGEDGLYFYKNIVKQSKHLLNSGGTIAFEIGYDQKEEVSCILESNGFVNIECYKDLAGLDRVV 284
>gi|169335809|ref|ZP_02863002.1| hypothetical protein ANASTE_02235 [Anaerofustis stercorihominis DSM 17244] >gi|169258547|gb|EDS72513.1| hypothetical protein ANASTE_02235 [Anaerofustis stercorihominis DSM 17244] (279 aa)
Score = 255, Expect = 2.5e-20, Identities = 79/237 (33%), Positives = 129/237 (54%)
  Q:    50 DIFFEKDTEIDFEYKKILKQLNKVLNK---NIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKN--QRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKN--DPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVL 286
           D+FF  D   +   ++I  +  +++NK   ++P  YIT    F GL F + +   +PR ETE ++++ ++  K I    IL++  GSG +  +IS  K  ++  ++GV+ N     +  KN    N+  + +FI+SDI++   +   K D II NPPYI K+  +   D   K EP  AL   ++G YFY   +      L     IIFEIG++Q E+++  LI+NN T  + + DL   DR +
  S:    38 DVFFITDLNYELTDEEI-NEYEQLVNKRCAHVPFGYITGIKEFMGLDFHVDRETLIPRPETEIIVEYMIEHFKGITLD-ILEIGVGSGCI--SISTAKYLENVNILGVDINEKALSIANKNIEYHNVDDRVKFIRSDIYE---NVEGKFDVIISNPPYIRKDIIETLEDDVKKYEPILALDGGEDGLYFYREIIKNASKYLNESGHIIFEIGYDQGEQVKDLLIQNNFTNIEIINDLAGFDRTV 274
>gi|167038491|ref|YP_001666069.1| HemK family modification methylase [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|167038766|ref|YP_001661751.1| HemK family modification methylase [Thermoanaerobacter sp. X514] >gi|166853006|gb|ABY91415.1| modification methylase, HemK family [Thermoanaerobacter sp. X514] >gi|166857325|gb|ABY95733.1| modification methylase, HemK family [Thermoanaerobacter pseudethanolicus ATCC 33223] (279 aa)
Score = 255, Expect = 2.6e-20, Identities = 77/225 (34%), Positives = 118/225 (52%)
  Q:    62 EYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQR--NLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKND-PNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVL 286
           E  K L  LN +   +IP QYI K   F GL FF+ +   +PR ETE +++  +  K+L     ++D+ +GSG +A  +S +K   D  V  V+ +R   +V   N +  N+  K  FI+SD+F     +  K DFI+ NPPYI + +   +    K EP  AL   ++G +FY + +      L     I FE+G++QKEE+   L K      + +KDL   DRV+
  S:    52 ELAKFLGLLN-MRKSHIPYQYIVKKHYFMGLEFFVDENVLIPRPETEILVEEVL--KRLKKGNTLIDIGTGSGAIA--VSVVKYFPDCFVYAVDISRKALEVAKYNAKKHNVLDKIVFIESDVFSQVPKNI-KFDFIVSNPPYIKRGELETLQEEVKKEPIIALDGGEDGLFFYKKIIEGAPFYLNPEGAICFEMGYDQKEEVTDLLTKGGFKNIEVIKDLSGIDRVV 273
>gi|153854178|ref|ZP_01995486.1| hypothetical protein DORLON_01477 [Dorea longicatena DSM 13814] >gi|149753227|gb|EDM63158.1| hypothetical protein DORLON_01477 [Dorea longicatena DSM 13814] (287 aa)
Score = 255, Expect = 2.7e-20, Identities = 72/211 (34%), Positives = 113/211 (53%)
  Q:    76 KNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIV--IGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKND-PNVDPSTKC-EPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVL 286
           + IP+Q+IT    F GL+F + +   VPRQ+TE +++ A+K  ++     ILD+C+GSG +  +I    + K   +   G + +    KV  +N   L    +FIKSD+F+   S  EK D I+ NPPYI   +   +D   K  +P  AL   ++G YFY   + +    L  G  I+FEIGF+Q +++ + L        +  KDL   DRV+
  S:    71 RRIPLQHITGEQEFMGLNFKVNENVLVPRQDTEILVEEALK--RIRPDMQILDMCTGSGCILESILKFGEKKQMHLKGTGCDISEEALKVARENNSRLGTDARFIKSDLFE---SVTEKYDMIVSNPPYIRTEEISRLDEEVKLHDPWIALDGKEDGLYFYRLIVKDSIRYLNKGGYILFEIGFDQGKDVSELLKNEGYEEIEIKKDLAGLDRVV 280
>gi|167766741|ref|ZP_02438794.1| hypothetical protein CLOSS21_01247 [Clostridium sp. SS2/1] >gi|167711495|gb|EDS22074.1| hypothetical protein CLOSS21_01247 [Clostridium sp. SS2/1] (283 aa)
Score = 254, Expect = 3.0e-20, Identities = 76/249 (30%), Positives = 128/249 (51%)
  Q:    39 LFNSKIIENSSDIFFEKDTEI-DFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAV-KQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKND-PNVDPSTK-CEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLY 287
           LF+     +  D  F    EI D E ++  K+L +   +++P+QYI  +  F G +F +     +PR +TE +L+  + K  + +    ILDLC+GSG +A +++ I K +  + +G + +    K+   N  NL    +FI+SD+F+     Y   D II NPPYI   +   + P  K  EP  AL   ++G YFY + + E    L     + FEIG++Q E ++  +   +    +  KDL   DR+++
  S:    29 LFSECFHISREDYLFGMTDEINDKEAEERYKELIQKRKEHVPLQYILGTQEFMGYTFKVTPDVLIPRADTETVLEEVLLKVPQTLKNLKILDLCTGSGCIAISLALILKPE--VCVGTDISEKALKIAKANGENLAPMVKFIQSDLFENVTGSY---DLIISNPPYITTEECGKLMPEVKDYEPMLALDGKEDGLYFYKKIIKEAKNYLNPQGMLAFEIGYDQGEAVKNLMEAQDFACVEIKKDLAGLDRLVF 276
>gi|110798817|ref|YP_696881.1| HemK family methyltransferase [Clostridium perfringens ATCC 13124] >gi|168210132|ref|ZP_02635757.1| methyltransferase, HemK family [Clostridium perfringens B str. ATCC 3626] >gi|110673464|gb|ABG82451.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Clostridium perfringens ATCC 13124] >gi|170711816|gb|EDT23998.1| methyltransferase, HemK family [Clostridium perfringens B str. ATCC 3626] (587 aa)
Score = 254, Expect = 3.0e-20, Identities = 77/231 (33%), Positives = 119/231 (51%)
  Q:    54 EKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQ--FIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPN--VDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDR 284
           +K  EI F     L  L K  +K +P+QYI  +  F GL F++++G  +PR +TE +++  +       +  + DLC GSG +  +++  +KN   IV  V+ +  P KV  KN R L+L  +  FIKSD+         K D ++ NPPYI     N  ++     EP  AL   ++G  FY R + E   IL     + FEIG +Q E+++  +I+      K +KDL   DR
  S:   351 KKSDEIHF-----LNLLEKRKSK-MPMQYILGTCEFMGLDFYVEEGVLIPRGDTEIIVEEVLNNIDEDAEINVCDLCCGSGAIGLSLANYRKN--IIVDLVDIDDIPEKVTRKNIRELELSKRCGFIKSDLLSEVIKKGNKYDILVSNPPYIRTEVINTLMEDVKDYEPHLALDGGEDGLIFYRRIIDESLEILKENGILAFEIGHDQGEDVKNLMIEKGYYDVKVIKDLAGLDR 577
>gi|166032747|ref|ZP_02235576.1| hypothetical protein DORFOR_02462 [Dorea formicigenerans ATCC 27755] >gi|166027104|gb|EDR45861.1| hypothetical protein DORFOR_02462 [Dorea formicigenerans ATCC 27755] (299 aa)
Score = 254, Expect = 3.0e-20, Identities = 69/211 (32%), Positives = 115/211 (54%)
  Q:    76 KNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSG-VLANTISYIKKNKDAI---VIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKN-DPNVDPSTKC-EPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVL 286
           + IP+Q+IT S  F G  F + +   +PRQ+TE +++ A+K  +     ++LD+C+GSG +L + + Y  + K       +G + +    +V  KN + LK+   +++SDIF+   +  E  D I+ NPPYI       ++   K  +P  AL   ++G YFY R +SE    L +G  ++FEIG +Q E++ K +           KDL   DRV+
  S:    71 RRIPLQHITGSQEFMGYEFLVNEHVLIPRQDTENLVEEALKVIR--PDMHVLDMCTGSGCILISLLKYAAERKHITGGKAVGADISADALEVAKKNAQRLKVPVIWVQSDIFE---NVSESFDLIVSNPPYIRTEVIQGLEDEVKLHDPWIALDGHEDGLYFYRRIVSESISHLNDGAWLMFEIGHDQAEDVSKLMKNAGFCNIYVKKDLAGLDRVV 282
>gi|116493077|ref|YP_804812.1| methylase of polypeptide chain release factor [Pediococcus pentosaceus ATCC 25745] >gi|116103227|gb|ABJ68370.1| Methylase of polypeptide chain release factor [Pediococcus pentosaceus ATCC 25745] (283 aa)
Score = 254, Expect = 3.5e-20, Identities = 78/255 (30%), Positives = 136/255 (53%)
  Q:    36 ELILFNSKIIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAV-KQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPN-VDPST-KCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEK-FLIKNNITVFKFLKDLDDKDRVLYIKK 290
           ELIL ++     +  I   ++     +++K    + +V  K  PVQY+T   +F+G  F++ K   +PR ETE +++  + K K+   +  +LD+ +GSG +A T+    +  + +V  V+ ++    V  +N  + +    F    +F+  +   E+ D II NPPYI  N+ + +D S    EP QALFA  +G ++Y R   ++   L    E+  EIG+ Q  +++K FL K  I   + +KDL   DR+L++KK
  S:    29 ELILMDTMEWSRTELIMHYREKLFPEQWEKFQTAVKRVA-KGEPVQYVTNKATFFGREFYVDKRVLIPRVETEELVETILSKTKRSRQRLRVLDIGTGSGDIAITLKL--ERPEWLVTAVDISKDALTVAQRNAESHEAIVDFRLGSLFEPVQG--ERFDLIISNPPYIADNEKHEMDQSVIDFEPHQALFADDHGLFWYKRIADQLDQYLVEHGELGCEIGYRQGTDLKKYFLEKKYIDQAEVIKDLSQHDRILWVKK 282
>gi|167745422|ref|ZP_02417549.1| hypothetical protein ANACAC_00113 [Anaerostipes caccae DSM 14662] >gi|167655143|gb|EDR99272.1| hypothetical protein ANACAC_00113 [Anaerostipes caccae DSM 14662] (278 aa)
Score = 254, Expect = 3.6e-20, Identities = 73/233 (31%), Positives = 122/233 (52%)
  Q:    54 EKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKC-DFIICNPPYIDKND-PNVDPSTK-CEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVL 286
           E+  E++ +YK +L   ++ +++ IP+QY+  +  F G +F +     +PRQ+TE +++  V+       + ILD+C+GSG +A  IS     K  + IG + +    K+  +N R L    +F KSD+F    S  + C D II NPPYI   D   + P  K  EP  AL   ++G YFY +        L  G  ++FEIG++Q   ++  + +   +  +  KDL   DR++
  S:    50 EEGEELE-QYKALL---DRRISERIPLQYLIGTQDFMGYTFRVTPDVLIPRQDTESVIEAVVEGN--YPHESILDVCTGSGCIA--ISLCLMLKPDVCIGTDIDEKALKIAKENGRRLAPMVKFKKSDLF----SGVDGCFDLIISNPPYIPTKDCMELMPEVKDHEPMLALDGREDGLYFYRKLAGTAPKHLNAGGTLVFEIGYDQGAAVKTMMEEAGFSSVEIKKDLAGLDRMV 273
>gi|168213693|ref|ZP_02639318.1| protein- methyltransferase, release factor-specific [Clostridium perfringens CPE str. F4969] >gi|170714843|gb|EDT27025.1| protein- methyltransferase, release factor-specific [Clostridium perfringens CPE str. F4969] (587 aa)
Score = 253, Expect = 4.4e-20, Identities = 76/231 (32%), Positives = 119/231 (51%)
  Q:    54 EKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQ--FIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPN--VDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDR 284
           +K  EI F     L  L K  +K +P+QYI  +  F GL F++++G  +PR +TE +++  +       +  + DLC GSG +  +++  +KN   IV  V+ +  P KV  KN R L+L  +  FIKSD+         K D ++ NPPYI     N  ++     EP  AL   ++G  FY R + E   +L     + FEIG +Q E+++  +I+      K +KDL   DR
  S:   351 KKSDEIHF-----LNLLEKRKSK-MPMQYILGTCEFMGLDFYVEEGVLIPRGDTEIIVEEVLNNIDEDAEINVCDLCCGSGAIGLSLANYRKN--IIVDLVDIDDIPEKVTRKNIRELELSKRCGFIKSDLLSEVIKKGNKYDILVSNPPYIRTEVINTLMEDVKDYEPHLALDGGEDGLIFYRRIIDESLEVLKENGILAFEIGHDQGEDVKNLMIEKGYYDVKVIKDLAGLDR 577
>gi|168164300|ref|ZP_02599533.1| modification methylase, HemK family protein [Bacillus cereus H3081.97] (283 aa)
Score = 253, Expect = 4.8e-20, Identities = 71/241 (29%), Positives = 126/241 (52%)
  Q:    47 NSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQ--KKLIDKK-YILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKND-PNVDPSTK-CEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITV-FKFLKDLDDKDRVLY 287
           N + +      EI  E +K   +      + IP+QY+     FYG SFF+ +   +PR ETE ++   +++  +   D+K ++ D+ +GSG ++ T+S   +NK+  V  V+  +   KV  +N + L  +  F   D+        +K D ++ NPPYI + D   + P  K  EPK+AL   ++G  FY RF+ E+  +L     + FEIG  Q E+++  L +       + + D++ KDR+++
  S:    35 NRTGLLMNMREEITAEQEKSFTEFIHKHVEGIPIQYMIGHEMFYGRSFFVNEEVLIPRPETEELIVGVLERIDRHFNDEKLHVADIGTGSGAISITLSL--ENKNLHVYTVDIAQESIKVAKENAKTLGAEVTFYHGDLLSPFYETGQKLDVVVSNPPYIPEEDWRGLSPVVKEHEPKRALVGGEDGLDFYRRFMEELPNVLQKKAIVAFEIGIGQGEDVKGLLQQAFPHAHVEVVFDINGKDRMVF 279
>gi|167215212|ref|ZP_02285519.1| modification methylase, HemK family protein [Listeria monocytogenes FSL R2-503] (251 aa)
Score = 253, Expect = 4.8e-20, Identities = 73/236 (30%), Positives = 122/236 (51%)
  Q:    49 SDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPN--VDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKN--NITVFKFLKDLDDKDR 284
           S+++ E   E++  ++K  ++         PVQYI K+  FYG  F + +   +PR ETE ++  A    K    K +LD+C+GSG++A  I+  K   D  V   + +     V  KN   L    +F+++D+ +  + + E+ D I+ NPPYI + +     D   K EP  ALFA  +G   Y RF+  +  +L +   +  EIG+ Q E +++   K+  + TV    KD++ KDR
  S:     6 SELWMEISRELEPNHEKQFEEDFARYLAGEPVQYILKTAPFYGYDFLVTEDVLIPRPETEELVACAEDFLKKHPVKNVLDVCTGSGIIA--IALKKAFPDISVTASDISAPALAVAKKNALLLNADVRFVETDLLEAFKQNEERFDMIVANPPYISEAEKAEMSDYVLKNEPSLALFAENDGLAIYERFVDNLQYVLNSSFWVGVEIGYTQGERVKQLFEKSYPHSTVI-IHKDINSKDR 242
>gi|81428745|ref|YP_395745.1| putative protoporphyrinogen oxidase, HemK [Lactobacillus sakei subsp. sakei 23K] >gi|78610387|emb|CAI55437.1| Putative protoporphyrinogen oxidase, HemK [Lactobacillus sakei subsp. sakei 23K] (289 aa)
Score = 252, Expect = 5.1e-20, Identities = 69/210 (32%), Positives = 109/210 (51%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKY-ILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNV-DPST-KCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEK-FLIKNNITVFKFLKDLDDKDRVLYI 288
           P QYI    +FYG  F +     +PR ETE +++W +    + D+   +LD+ +GSG +A T++   +  D  V  V+ +     V  +N + L  K  FI+ D         ++ D I+ NPPYI +++ +V D S  K EP  ALFAP NG  FY RF  E+   L     +  E G+ QKE I + F  K+ +   +  KD+ +  R++ +
  S:    70 PAQYILGYANFYGRDFKVTPATLIPRLETEELVEWVLSVAPVKDRPLKVLDVGTGSGAIAITLAC--ERPDWQVSAVDISPAAIAVAQQNAQTLGAKVDFIEGDFLTPVMG--QQFDVIVSNPPYIAEDERSVMDASVLKHEPDLALFAPNNGLAFYERFAQEVPAFLEPDGALFLEFGYQQKEAIVRIFEQKDPLFSLEVQKDMANWSRMMRV 279
>gi|182623922|ref|ZP_02951710.1| methyltransferase, HemK family [Clostridium perfringens D str. JGS1721] >gi|177910815|gb|EDT73169.1| methyltransferase, HemK family [Clostridium perfringens D str. JGS1721] (587 aa)
Score = 252, Expect = 5.4e-20, Identities = 68/207 (32%), Positives = 109/207 (52%)
  Q:    78 IPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQ--FIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPN--VDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDR 284
           +P+QYI  +  F GL F++++G  +PR +TE +++  +       +  + DLC GSG +  +++  +KN   IV  V+ +  P KV  KN R L+L  +  FIKSD+         K D ++ NPPYI     N  ++     EP  AL   ++G  FY R + E   +L     + FEIG +Q E+++  +I+      K +KDL   DR
  S:   369 MPMQYILGTCEFMGLDFYVEEGVLIPRGDTEIIVEEVLNNIDEDAEINVCDLCCGSGAIGLSLANYRKN--IIVDLVDIDDIPEKVTRKNIRELELSKRCGFIKSDLLSEVIKKGNKYDILVSNPPYIRTEVINTLMEDVKDYEPHLALDGGEDGLIFYRRIIDESLEVLKENGILAFEIGHDQGEDVKNLMIEKGYYDVKVIKDLAGLDR 577
>gi|153809901|ref|ZP_01962569.1| hypothetical protein RUMOBE_00282 [Ruminococcus obeum ATCC 29174] >gi|149834079|gb|EDM89159.1| hypothetical protein RUMOBE_00282 [Ruminococcus obeum ATCC 29174] (300 aa)
Score = 252, Expect = 6.0e-20, Identities = 74/247 (29%), Positives = 133/247 (53%)
  Q:    44 IIENSSDI-----FFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKL--KTQFIKSDIFKID-------RSHYEKCDFIICNPPYIDKNDPN--VDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYIKK 290
           ++E ++DI     +   D  +D + ++  + L     ++IP+Q+IT    F G  F + +   VPRQ+TE +++ A+ + + ++K  ILD+C+GSG +  ++    +   A+  GV+ +     V  +N++ L L  + + I+SD+F  D         H E  D +I NPPYI   D    ++     +P  AL   +NG YFY +   +    L  G  +++EIG +Q  ++ + + KN     +  KDL   DRV+  +K
  S:    34 LLEYTADITRAWYYAHMDDGLDAKTEERYRTLCTKRAQHIPLQHITGRAYFMGYEFCVDERVLVPRQDTEVLVEEAISRMRNLEKPQILDMCTGSGCILLSLL--LELPQALGTGVDVSEGALCVAKENRKRLGLEQRAELIQSDLFSADYFRKNSGNDHMEY-DMLISNPPYIRTEDIEGLMEEVRFHDPVLALDGKENGLYFYEKITEQAGTYLKPGGWLMYEIGCDQGMDVSEIMKKNGFEQIEIKKDLAGLDRVVTGRK 293
>gi|42784500|ref|NP_981747.1| HemK family modification methylase [Bacillus cereus ATCC 10987] >gi|42740432|gb|AAS44355.1| modification methylase, HemK family [Bacillus cereus ATCC 10987] (283 aa)
Score = 251, Expect = 7.0e-20, Identities = 70/241 (29%), Positives = 126/241 (52%)
  Q:    47 NSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVK--QKKLIDKK-YILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKND-PNVDPSTK-CEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITV-FKFLKDLDDKDRVLY 287
           N + I      EI  E +K   +      + IP+QY+     FYG SFF+ +   +PR ETE ++   ++  ++   D+K ++ D+ +GSG ++ T++   +NK+  V  V+  +   +V  +N + L  +  F   D+        +K D ++ NPPYI + D   + P  K  EPK+AL   ++G  FY RF+ E+  +L     + FEIG  Q E+++  L +       + + D++ KDR+++
  S:    35 NRTGILMNMREEITAEQEKSFTEFIHKHVEGIPIQYMIGHEMFYGRSFFVNEEVLIPRPETEELIVGVLERIERHFGDEKLHVADIGTGSGAISITLAL--ENKNLHVYTVDIAQESIEVAQENAKTLGAEVTFYHGDLLSPFYETGQKLDVVVSNPPYIPEEDWRGLSPVVKEHEPKRALVGGEDGLDFYRRFMEELPNVLQKKAIVAFEIGVGQGEDVKGLLQQAFPHAHVEVVFDINGKDRMVF 279
>gi|182420442|ref|ZP_02641457.2| protein-(glutamine-N5) methyltransferase, release factor-specific [Clostridium perfringens NCTC 8239] >gi|182382208|gb|EDT79687.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Clostridium perfringens NCTC 8239] (572 aa)
Score = 251, Expect = 7.5e-20, Identities = 76/231 (32%), Positives = 119/231 (51%)
  Q:    54 EKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQ--FIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPN--VDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDR 284
           +K  EI F     L  L K  +K +P+QYI  +  F GL F++++G  +PR +TE +++  +       +  + DLC GSG +  +++  +KN   IV  V+ +  P KV  KN R L+L  +  FIKSD+         K D ++ NPPYI     N  ++     EP  AL   ++G  FY R + E   +L     + FEIG +Q E+++  +I+      K +KDL   DR
  S:   336 KKSDEIHF-----LNLLEKRKSK-MPMQYILGTCEFMGLDFYVEEGVLIPRGDTEIIVEEVLNNIDEDAEINVCDLCCGSGAIGLSLANYRKN--IIVDLVDIDDIPEKVTRKNIRELELSKRCGFIKSDLLSEVIKKGNKYDILVSNPPYIRTEVINTLMEDVKDYEPHLALDGGEDGLIFYRRIIDESLEVLKENGILAFEIGHDQGEDVKNLMIEKGYYDVKVIKDLAGLDR 562
>gi|194468251|ref|ZP_03074237.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Lactobacillus reuteri 100-23] >gi|194453104|gb|EDX42002.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Lactobacillus reuteri 100-23] (288 aa)
Score = 250, Expect = 1.1e-19, Identities = 67/208 (32%), Positives = 106/208 (50%)
  Q:    58 EIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFK-IDRSHYEKCDFIICNPPYIDKNDP-NVDPST-KCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFL 265
           E+D+    I + LN     + P QYI     FYG +F + K   +P  ET  ++DW +++      K +LDL +GSGV+  T++  + N    +  +        V  +N     L+   IKSD+F+ ID+ +    D I+ NPPYID +D   +D +  + EP  ALFA + G  FY R   +    L    +I  E G++Q+E I++ L
  S:    57 EVDWWKDAITRLLN-----HEPAQYIVGQAPFYGRTFKVNKNVLIPEAETAELIDWVLQEMPSCPLK-VLDLGTGSGVIGITLALERPNWHVSLSDISP--AALAVAQENMAKFNLELPLIKSDLFENIDQQY----DLIVTNPPYIDPDDTGEIDQAILENEPALALFANERGLGFYHRLFKQAGQYLTTTGQIFGETGYDQEESIQELL 255
>gi|116873907|ref|YP_850688.1| HemK family modification methylase [Listeria welshimeri serovar 6b str. SLCC5334] >gi|116742785|emb|CAK21909.1| unnamed protein product [Listeria welshimeri serovar 6b str. SLCC5334] (283 aa)
Score = 249, Expect = 1.2e-19, Identities = 80/257 (31%), Positives = 133/257 (51%)
  Q:    28 SQIKWILK--ELILFNSKIIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKN---------------IPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNV--DPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKN--NITVFKFLKDLDDKDR 284
           +QI  +LK  E IL    + +N+++I  E  T +     ++  ++++ L  N                PVQYI K+  FYG  F + +   +PR ETE ++  A    K      +LD+C+GSG++A  I+  K   +      + +     V  KN   L    +F+++D+ +  + + E+ D II NPPYI + +     D   K EP  ALFA  +G   Y RF+  +  +L     +  EIG+ Q E +++   K+  + TV    KD++ KDR
  S:     2 TQISQLLKNAEAILLEKGLDQNAAEILLE--TRMGLSRSELWMEMSRELEPNHEEQFQADFDRYLAGEPVQYILKTAPFYGYDFLVTEDVLIPRPETEELVACAETFLKKHPVMNVLDVCTGSGIIA--IALKKAFPNITFTASDISGPALAVAKKNALLLNADIRFVETDLLETFKHNGERFDMIIANPPYISEAEKAAMSDYVLKNEPSLALFAENDGMAIYERFVDNLKYVLNTSFWVGVEIGYTQGERVKQLFEKSYPHSTVL-IHKDINSKDR 274
>gi|110803251|ref|YP_699477.1| HemK family modification methylase [Clostridium perfringens SM101] >gi|110683752|gb|ABG87122.1| modification methylase, HemK family [Clostridium perfringens SM101] (587 aa)
Score = 249, Expect = 1.3e-19, Identities = 76/231 (32%), Positives = 118/231 (51%)
  Q:    54 EKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQ--FIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPN--VDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDR 284
           +K  EI F     L  L K  +K +P+QYI  +  F GL F++++G  +PR +TE +++  +       +  + DLC GSG +  +++  +KN   IV  V+ +  P KV  KN R L+L  +  FIKSD+         K D ++ NPPYI     N  +      EP  AL   ++G  FY R + E   +L     + FEIG +Q E+++  +I+      K +KDL   DR
  S:   351 KKSDEIHF-----LNLLEKRKSK-MPMQYILGTCEFMGLDFYVEEGVLIPRGDTEIIVEEVLNNIDEDAEINVCDLCCGSGAIGLSLANYRKN--IIVDLVDIDDIPEKVTRKNIRELELSKRCGFIKSDLLSEVIKKGNKYDILVSNPPYIRTEVINTLMKDVKDYEPHLALDGGEDGLIFYRRIIDESLEVLKENGILAFEIGHDQGEDVKNLMIEKGYYDVKVIKDLAGLDR 577
>gi|148323011|gb|EDK88261.1| polypeptide chain release factor methyltransferase HemK [Fusobacterium nucleatum subsp. polymorphum ATCC 10953] (383 aa)
Score = 249, Expect = 1.3e-19, Identities = 75/226 (33%), Positives = 124/226 (54%)
  Q:    65 KILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKT-QFIKSDIF-KIDRSHYEKCDFIICNPPYIDKNDPNV-DPSTK-CEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYIKK 290
           KI + L     K  P+QYI   + FYGL F + +G  +PR +TE +++  ++  + I++  ILD+ +GSG +  +I+   + K + V G++ N    K+  +N+   K++   FI+S++F K+D+    K D I+ NPPYI K +  +  P  K  EP+ AL    +G YFY          L +   + +EIG+NQ +++ K L  NN  +   +KD    DRV+  KK
  S:   138 KIREMLVLRAKKRKPLQYILGEWEFYGLPFKVSEGVLIPRADTEILVEQCIQLMRDIEEPNILDIGTGSGAI--SIAIANELKSSSVTGIDINEKALKLANENKILNKIENVNFIESNLFEKLDKDF--KYDLIVSNPPYISKEEYEILMPEVKNYEPQNALTDLGDGLYFYREISKLAGEYLKDTGYLAYEIGYNQAKDVSKILQDNNFAILSIVKDYGGNDRVIIAKK 363
>gi|18311185|ref|NP_563119.1| hypothetical protein CPE2203 [Clostridium perfringens str. 13] >gi|18145868|dbj|BAB81909.1| conserved hypothetical protein [Clostridium perfringens str. 13] (569 aa)
Score = 249, Expect = 1.3e-19, Identities = 68/207 (32%), Positives = 109/207 (52%)
  Q:    78 IPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQ--FIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPN--VDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDR 284
           +P+QYI  +  F GL F++++G  +PR +TE +++  +       +  + DLC GSG +  +++  +KN   IV  V+ +  P KV  KN R L+L  +  FIKSD+         K D ++ NPPYI     N  ++     EP  AL   ++G  FY R + E   +L     + FEIG +Q E+++  +I+      K +KDL   DR
  S:   351 MPMQYILGTCEFMGLDFYVEEGVLIPRGDTEIIVEEVLNNIDEDAEINVCDLCCGSGAIGLSLANYRKN--IIVDLVDIDDIPEKVTRKNIRELELSKRCGFIKSDLLSEVIKKGNKYDILVSNPPYIRTEVINTLMEDVKDYEPHLALDGGEDGLIFYRRIIDESLEVLKENGILAFEIGHDQGEDVKNLMIEKGYYDVKVIKDLAGLDR 559
>gi|158321601|ref|YP_001514108.1| HemK family modification methylase [Alkaliphilus oremlandii OhILAs] >gi|158141800|gb|ABW20112.1| modification methylase, HemK family [Alkaliphilus oremlandii OhILAs] (289 aa)
Score = 248, Expect = 1.5e-19, Identities = 71/214 (33%), Positives = 119/214 (55%)
  Q:    77 NIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAV---KQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKN--QRNLKLKTQFIKSDIFK--IDRSHYEKCDFIICNPPYIDKNDPN-VDPSTK-CEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYIKK 290
           ++PVQYI K   F GL FF+++G  +PR +TE +++ A+   K+K    K  I+D+ +GSG +   +S  K  +++I+  ++ +   ++V  KN     +  K  F    +F+    +  +++ DFI+ NPPYI K   + +D   K  EP  AL    +G  FY          L +G  ++FEIG++Q E + + LI N++   +  KDL   DRV+  KK
  S:    68 HMPVQYIIKKQEFMGLDFFVEEGVLIPRGDTEILVEKAIEIYKEKFEPQKVRIMDIGTGSGAI--VVSLAKFIENSILTAIDISPKAFEVAKKNAAHHGVDHKIAFYLGSLFEALYGKDEHKEYDFIVSNPPYIPKAVVDTLDAGVKDYEPHLALDGGADGLDFYREITLGAKEYLKSGGWLLFEIGYDQGESVSELLIANDLKEVQVRKDLAGLDRVVLGKK 288
>gi|148543688|ref|YP_001271058.1| HemK family modification methylase [Lactobacillus reuteri F275] >gi|184153098|ref|YP_001841439.1| putative protoporphyrinogen oxidase [Lactobacillus reuteri F275] >gi|148530722|gb|ABQ82721.1| modification methylase, HemK family [Lactobacillus reuteri F275] >gi|183224442|dbj|BAG24959.1| putative protoporphyrinogen oxidase [Lactobacillus reuteri F275] (288 aa)
Score = 248, Expect = 1.5e-19, Identities = 67/208 (32%), Positives = 106/208 (50%)
  Q:    58 EIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFK-IDRSHYEKCDFIICNPPYIDKNDP-NVDPST-KCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFL 265
           E+D+    I + LN     + P QYI     FYG +F + K   +P  ET  ++DW +++      K +LDL +GSGV+  T++  + N    +  +        V  +N     L+   IKSD+F+ ID+ +    D I+ NPPYID +D   +D +  + EP  ALFA + G  FY R   +    L    +I  E G++Q+E I++ L
  S:    57 EVDWWKDAITRLLN-----HEPAQYIVGQAPFYGRTFKVNKNVLIPEAETAELIDWVLQEMPSRPLK-VLDLGTGSGVIGITLALERPNWHVSLSDISP--AALAVAQENMAKFNLELPLIKSDLFENIDQQY----DLIVTNPPYIDPDDTGEIDQAVLENEPALALFANERGLGFYHRLFKQAGQYLTTTGQIFGETGYDQEESIQELL 255
>gi|52140234|ref|YP_086597.1| HemK family modification methylase [Bacillus cereus E33L] >gi|51973703|gb|AAU15253.1| modification methylase, HemK family [Bacillus cereus E33L] (283 aa)
Score = 248, Expect = 1.6e-19, Identities = 69/241 (28%), Positives = 125/241 (51%)
  Q:    47 NSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVK--QKKLIDKK-YILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKND-PNVDPSTK-CEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITV-FKFLKDLDDKDRVLY 287
           N + +      EI  E +    +      + IP+QY+     FYG SFF+ +   +PR ETE ++   ++  ++   D+K ++ D+ +GSG ++ T++   +NK+  V  V+  +   +V  +N + L  +  F   D+        +K D ++ NPPYI + D   + P  K  EPK+AL   ++G  FY RF+ E+  +L     + FEIG  Q E+++  L K       + + D++ KDR+++
  S:    35 NRTGLLMNMREEITVEQETSFTEFIHKHVEGIPIQYMIGHEMFYGRSFFVNEEVLIPRPETEELIVGVLERIERHFGDEKLHVADIGTGSGAISITLAL--ENKNLHVYTVDIAQESIEVAKENAKTLGAEVTFYHGDLLSPFYETGQKLDVVVSNPPYIPEEDWRGLSPVVKEHEPKRALVGGEDGLDFYRRFMEELPKVLQKKAIVAFEIGVGQGEDVKGLLQKAFPHAHVEVVFDINGKDRMVF 279
>gi|47570470|ref|ZP_00241103.1| hemK protein [Bacillus cereus G9241] >gi|47552866|gb|EAL11284.1| hemK protein [Bacillus cereus G9241] (283 aa)
Score = 248, Expect = 1.6e-19, Identities = 69/241 (28%), Positives = 126/241 (52%)
  Q:    47 NSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVK--QKKLIDKK-YILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKND-PNVDPSTK-CEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITV-FKFLKDLDDKDRVLY 287
           N + +      EI  E +   K+      + IP+QY+     FYG SFF+ +   +PR ETE ++   ++  ++   D+K ++ D+ +GSG ++ T++   +NK+  V  V+  +   +V  +N + L  +  F   D+        +K D ++ NPPYI + D   + P  K  EPK+AL   ++G  FY RF+ E+  +L     + FEIG  Q E+++  L +       + + D++ KDR+++
  S:    35 NRTGLLMNMREEITAEQETSFKEFIHKHVEGIPIQYMIGHEMFYGRSFFVNEEVLIPRPETEELIVGVLERIERHFDDEKLHVADIGTGSGAISITLAL--ENKNLHVYTVDIAQESIEVAKENAKTLGAEVTFYHGDLLSPFYETGQKLDVVVSNPPYIPEEDWRGLSPVVKEHEPKRALVGGEDGLDFYRRFMDELPNVLQKKAIVAFEIGVGQGEDVKGLLQQAFPHAHVEIVFDINGKDRMVF 279
>gi|150015293|ref|YP_001307547.1| HemK family modification methylase [Clostridium beijerinckii NCIMB 8052] >gi|149901758|gb|ABR32591.1| modification methylase, HemK family [Clostridium beijerinckii NCIMB 8052] (586 aa)
Score = 248, Expect = 1.6e-19, Identities = 74/243 (30%), Positives = 127/243 (52%)
  Q:    44 IIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQ--FIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPN--VDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVL 286
           +I +  D   ++D E  F+   I K+ NK     +PV+YI     F G+ F++++G  +PR +TE ++D  +K  +   +  I DLCSGSG +  ++++ ++N    +I  +    P KV + N    KL+ +  FIKSD+ +    + +  D I+ NPPYI++ +    ++     EP  AL    +G  FY + + +    L     + FEIG+NQ E ++  +  N  T  K +KD    DRV+
  S:   344 LITHKEDEVSKEDAEKYFDL--IEKRRNK-----MPVKYILNKCEFMGIEFYVEEGVLIPRGDTEILVDEVLKIIEENQEMQICDLCSGSGAVGISLAHFRQNIKVDLI--DYYPIPEKVSLINIEKNKLEDRVFFIKSDLLEESIKNNKIYDIIVSNPPYIEECEIGKLMEDVKNYEPHTALNGGNDGLDFYRKIIDQSQYTLRESGILAFEIGYNQGEAVKLLMENNGFTNVKIVKDFASLDRVV 581
>gi|187777271|ref|ZP_02993744.1| hypothetical protein CLOSPO_00823 [Clostridium sporogenes ATCC 15579] >gi|187774199|gb|EDU38001.1| hypothetical protein CLOSPO_00823 [Clostridium sporogenes ATCC 15579] (292 aa)
Score = 248, Expect = 1.8e-19, Identities = 80/240 (33%), Positives = 127/240 (52%)
  Q:    51 IFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKN--QRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKN--DPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYIKK 290
           I    D  I  E KK   QL  +    +P++YI  +  F GL F IKKG  +PR +TE +++  +++ K  + K I D+C GSG++  TI Y   N + I   +E    PY    +N  + NL+ + + +KSD+         K D I+ NPPYI ++  +  +D   K EP +AL   ++G +FY   + +   +L +G  I FEIG++QK ++   L +        +KDL  KDRV+  +K
  S:    50 ILTNPDYHIKEEEKKKYFQLIDLRKNKMPMKYILGTTEFMGLDFNIKKGVLIPRPDTEILVETVLEEIKNKNYKQICDVCCGSGIIGITIGYTLNNTEIICYDIED--VPYNTTKENILKHNLQDRIKVLKSDLLTEAIKGKRKFDIIVSNPPYIREDVIETLMDDVKKYEPFEALCGGKDGLFFYEGIIKQSLEVLNDGGTIAFEIGYDQKIQVSHILHEYGFKDILCIKDLAGKDRVIKARK 291
>gi|168144626|ref|ZP_02587855.1| Methyltransferase [Bacillus cereus G9842] (283 aa)
Score = 247, Expect = 2.1e-19, Identities = 68/241 (28%), Positives = 127/241 (52%)
  Q:    47 NSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVK--QKKLIDKK-YILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKND-PNVDPSTK-CEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITV-FKFLKDLDDKDRVLY 287
           N + +      EI+ E +    +      + IP+QY+     FYG SFF+ +   +PR ETE ++   ++  ++   DK+ ++ D+ +GSG ++ T++   +NK+  V  V+  +   +V  +N + L  +  F   D+        +K D ++ NPPYI + D   + P  K  EPK+AL   ++G  FY RF+ E+  +L     + FEIG  Q E++++ L +       + + D++ KDR+++
  S:    35 NRTGLLMNMREEINEEQEASFTEFIHKHVEGIPIQYMIGYEMFYGRSFFVNEEVLIPRPETEELIVGVLERIERHFGDKELHVADIGTGSGAISITLAL--ENKNLHVYTVDIAQESIEVAKENAKALGAEVTFYHGDLLSPFHKTGQKLDVVVSNPPYIPEEDWRGLSPVVKEHEPKRALVGGEDGLDFYRRFMEELPNVLQEKAIVAFEIGVGQGEDVKRLLQQAFPHAHVEVVFDINGKDRMVF 279
>gi|30023359|ref|NP_834990.1| modification methylase, HemK family [Bacillus cereus ATCC 14579] >gi|29898920|gb|AAP12191.1| Methyltransferase [Bacillus cereus ATCC 14579] (283 aa)
Score = 247, Expect = 2.2e-19, Identities = 69/241 (28%), Positives = 127/241 (52%)
  Q:    47 NSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVK--QKKLIDKK-YILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKND-PNVDPSTK-CEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITV-FKFLKDLDDKDRVLY 287
           N + +      EI  E +K   +      + IP+QY+     FYG SFF+ +   +PR ETE ++   ++  ++   D+K ++ D+ +GSG ++ T++   +NK+  V  V+  +   +V  +N + L  +  F   D+        +K D ++ NPPYI + D   + P  K  EPK+AL   ++G  FY RF+ E+  +L     + FEIG  Q E++++ L +       + + D++ KDR+++
  S:    35 NRTGLLMNMREEITEEQEKSFTEFIHKHVEGIPIQYMIGYEIFYGRSFFVNEEVLIPRPETEELIVGVLERIERHFGDEKLHVADIGTGSGAISITLAL--ENKNLHVYTVDIAQESIEVAKENAKALGAEVTFYHGDLLSPFHKTGQKLDVVVSNPPYIPEEDWRGLSPVVKEHEPKRALVGGEDGLDFYRRFMEELPNVLQKKAIVAFEIGVGQGEDVKRLLQQAFPHAHVEVVFDINGKDRMVF 279
>gi|167769700|ref|ZP_02441753.1| hypothetical protein ANACOL_01034 [Anaerotruncus colihominis DSM 17241] >gi|167668061|gb|EDS12191.1| hypothetical protein ANACOL_01034 [Anaerotruncus colihominis DSM 17241] (280 aa)
Score = 247, Expect = 2.2e-19, Identities = 66/212 (31%), Positives = 108/212 (50%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKN-QRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKND-PNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIY-PILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYIKK 290
           P+QY+   + FYGL F +  G  +PR +TE +++ A++  K      + DLC+GSG +A  I++ +   DA V  VE +   +   V+N  RN     + I  D F          D I+ NPPYI + +   + P  + EP+ AL   ++G  FY R L  I+ P+L  G  I FE+G+ Q + +   L ++        +DL    RV++ ++
  S:    68 PLQYLLGMWEFYGLPFEVGPGVLIPRPDTETLVETALRLLKGTAAPAVADLCAGSGCIAAAIAHAR--PDAHVYAVELSDAAFPYLVRNLARNAPGNAEAICGDAFA--PPPLPPLDLIVSNPPYIARAEMETLSPQVRWEPEMALLGGEDGLDFY-RALPRIWMPLLRPGGYIAFEVGYTQADTVAGLLGRSGYQSCSVERDLAGIRRVVWAQR 277
>gi|52082234|ref|YP_081025.1| YwkE [Bacillus licheniformis ATCC 14580] >gi|52787626|ref|YP_093455.1| YwkE [Bacillus licheniformis ATCC 14580] >gi|52005445|gb|AAU25387.1| YwkE [Bacillus licheniformis ATCC 14580] >gi|52350128|gb|AAU42762.1| YwkE [Bacillus licheniformis DSM 13] (288 aa)
Score = 247, Expect = 2.2e-19, Identities = 73/251 (29%), Positives = 129/251 (51%)
  Q:    36 ELILFNSKIIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLI----DKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNV--DPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQ----KEEIEKFLIKNNITVFKFLKDLDDKDRVL 286
           +L +  SK++ +  D+  E D      +KK ++    + ++ +PVQYIT   SFYG  F + +   +PR ETE +++  + + + +    D+   +D+ +GSG +A T++   ++    V   + +         N   L  K  F+  D+ +   +  +K D I+ NPPYI + D     D     EP  AL    +G  FY RF+ EI  ++A+   ++FEIG+ Q    K+   +F    ++ V    KDL+ KDR++
  S:    32 QLNIDRSKLLASFHDVISESDFA---RFKKSVE----LHHQGVPVQYITGKESFYGREFSVNEHVLIPRPETEEVVEAVLSEAERVFHGTDRLKAVDVGTGSGAIAVTLAL--ESPRFSVTATDISEQALSTARHNADRLGAKVDFLCGDLLEPLIARQKKADVIVSNPPYISEEDMRTLSDVVRLHEPAGALTDGADGLQFYKRFMKEIPSVIADQALVVFEIGWTQGNAVKDMFHRFFPDADVRV---KKDLNGKDRIV 280
>gi|148378144|ref|YP_001252685.1| protein methyltransferase [Clostridium botulinum A str. ATCC 3502] >gi|153933674|ref|YP_001382545.1| HemK family modification methylase [Clostridium botulinum A str. ATCC 19397] >gi|153935975|ref|YP_001386097.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Clostridium botulinum A str. Hall] >gi|148287628|emb|CAL81693.1| protein methyltransferase [Clostridium botulinum A str. ATCC 3502] >gi|152929718|gb|ABS35218.1| modification methylase, HemK family [Clostridium botulinum A str. ATCC 19397] >gi|152931889|gb|ABS37388.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Clostridium botulinum A str. Hall] (283 aa)
Score = 247, Expect = 2.3e-19, Identities = 78/240 (32%), Positives = 128/240 (53%)
  Q:    51 IFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKN--QRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKN--DPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYIKK 290
           I    D  I  E K+   QL  +    +P++YI  +  F GL+F IKKG  +PR +TE +++  +++ K  + K I D+C GSG++  TI Y   N + I   +E    PY    +N  + NL+ + + +KSD+         + D I+ NPPYI ++  +  +D   K EP +AL   ++G +FY   + +   +L +G  I FEIG++QK ++   L +        +KDL  KDRV+  +K
  S:    41 ILTNPDYHIKEEEKEKYFQLIDLRKNKMPIKYILGTTEFMGLNFNIKKGVLIPRPDTEILVETVLEEIKNKNYKQICDVCCGSGIIGITIGYTLNNTEIICYDIED--IPYNTTKENILKHNLQDRVKALKSDLLTEAIKEKRRFDLIVSNPPYIREDVIETLMDDVKKYEPFEALCGGKDGLFFYEGIIKQSLEVLNDGGTIAFEIGYDQKIQVSHILNEYGFKDVLCIKDLAGKDRVIKARK 282
>gi|112943598|gb|ABI26315.1| modification methylase HemK [Lactobacillus reuteri] (288 aa)
Score = 247, Expect = 2.3e-19, Identities = 65/208 (31%), Positives = 107/208 (51%)
  Q:    58 EIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFK-IDRSHYEKCDFIICNPPYIDKNDP-NVDPST-KCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFL 265
           E+D+    I + LN     + P QYI     FYG +F + K   +P  ET  ++DW +++      + +LDL +GSGV+  T++  + N    +  +        +  +N     L+   IKSD+F+ ID+ +    D I+ NPPYID +D   +D +  + EP  ALFA ++G  FY R   +    L    +I  E G++Q+E I++ L
  S:    57 EVDWWKDAITRLLN-----HEPAQYIVGQAPFYGRTFKVNKNVLIPEAETAELIDWVLQEMPSRPLR-VLDLGTGSGVIGITLALERPNWHVSLSDISP--AALAIAQENMAKFNLELPLIKSDLFENIDQQY----DLIVTNPPYIDPDDTGEIDQAVLENEPALALFASEHGLGFYHRLFKQAGQYLTTTGQIFGETGYDQEESIQELL 255
>gi|170756524|ref|YP_001779765.1| HemK family modification methylase [Clostridium botulinum B1 str. Okra] >gi|169121736|gb|ACA45572.1| modification methylase, HemK family [Clostridium botulinum B1 str. Okra] (283 aa)
Score = 246, Expect = 2.9e-19, Identities = 78/240 (32%), Positives = 127/240 (52%)
  Q:    51 IFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKN--QRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKN--DPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYIKK 290
           I    D  I  E K+   QL  +    +P++YI  +  F GL F IKKG  +PR +TE +++  +++ K  + K I D+C GSG++  TI Y   N + I   +E    PY    +N  + NL+ + + +KSD+         + D I+ NPPYI ++  +  +D   K EP +AL   ++G +FY   + +   +L +G  I FEIG++QK ++   L +        +KDL  KDRV+  +K
  S:    41 ILTNPDYHIKEEEKEKYFQLIDLRKDKMPIKYILGTTEFMGLDFNIKKGVLIPRPDTEILVETVLEEIKNKNYKQICDVCCGSGIIGITIGYTLNNTEIICYDIED--IPYNTTKENILKHNLEDRVKVLKSDLLTEAIKEKRRFDLIVSNPPYIREDVIETLMDDVKKYEPFEALCGGKDGLFFYEGIIKQSLEVLNDGGTIAFEIGYDQKIQVSHILNEYGFKDVLCIKDLAGKDRVIKARK 282
>gi|187604003|ref|ZP_02990214.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Exiguobacterium sp. AT1b] >gi|187484065|gb|EDU22058.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Exiguobacterium sp. AT1b] (286 aa)
Score = 245, Expect = 3.8e-19, Identities = 64/209 (30%), Positives = 108/209 (51%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPIL-ANGTEIIFEIGFNQKEEIEKFLIKNNITV-FKFLKDLDDKDRVLY 287
           PVQ++     FYG SF + +   +PR ETE ++DW + Q + +    I+D+ +GSG +A T+S         V  V+ +R   +V  +N   L    QF + D       H  +   ++ NPPYI+ ++   +     EP  ALF  ++G   Y + ++E   +L A+   I FEIG+NQ ++++  L +         LKD++ KDR++Y
  S:    68 PVQHVIGHAPFYGRSFEVNRDVLIPRPETEELIDWVLGQLRHVKDDEIVDVGTGSGAIAITLSL---ELGVRVQTVDISREAIEVAKRNAAALGATVQFYEGDGLAPIADHSIRV--LVSNPPYIEADELLDETVVGYEPHLALFGGKDGLDMYRQLIAESVRVLRADWHLIAFEIGYNQGQDVKSLLSERYPEAETGILKDINGKDRIVY 273
>gi|75762681|ref|ZP_00742520.1| Peptide release factor-glutamine N5-methyltransferase [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|74489827|gb|EAO53204.1| Peptide release factor-glutamine N5-methyltransferase [Bacillus thuringiensis serovar israelensis ATCC 35646] (283 aa)
Score = 244, Expect = 4.4e-19, Identities = 68/241 (28%), Positives = 127/241 (52%)
  Q:    47 NSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVK--QKKLIDKK-YILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKND-PNVDPSTK-CEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITV-FKFLKDLDDKDRVLY 287
           N + +      EI+ E +    +      + IP+QY+     FYG SFF+ +   +PR ETE ++   ++  ++   DK+ ++ D+ +GSG ++ T++   +NK+  V  V+  +   +V  +N + L  +  F   D+        +K D ++ NPPYI + D   + P  K  EPK+AL   ++G  FY RF+ E+  +L     + FEIG  Q E++++ L +       + + D++ KDR+++
  S:    35 NRTGLLMNMREEINEEQEASFTEFIHKHVEGIPIQYMIGYEMFYGRSFFVNEEVLIPRPETEELIVGVLERIERHFGDKELHVADIGTGSGAISITLAL--ENKNLHVYTVDIAQESIEVAKENAKALGAEVTFYHGDLLSPFDKTGQKLDVVVSNPPYIPEEDWRGLSPVVKEHEPKRALVGGEDGLDFYRRFMEELPNVLQEKAIVAFEIGVGQGEDVKRLLQQAFPHAHVEVVFDINGKDRMVF 279
>gi|153937927|ref|YP_001389501.1| HemK family modification methylase [Clostridium botulinum F str. Langeland] >gi|152933823|gb|ABS39321.1| modification methylase, HemK family [Clostridium botulinum F str. Langeland] (283 aa)
Score = 244, Expect = 4.4e-19, Identities = 78/240 (32%), Positives = 127/240 (52%)
  Q:    51 IFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKN--QRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKN--DPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYIKK 290
           I    D  I  E K+   QL  +    +P++YI  +  F GL F IKKG  +PR +TE +++  +++ K  + K I D+C GSG++  TI Y   N + I   +E    PY    +N  + NL+ + + +KSD+         + D I+ NPPYI ++  +  +D   K EP +AL   ++G +FY   + +   +L +G  I FEIG++QK ++   L +        +KDL  KDRV+  +K
  S:    41 ILTNPDYHIKEEEKEKYFQLIDLRKNKMPIKYILGTTEFMGLDFNIKKGVLIPRPDTEILVETVLEEIKNKNYKQICDVCCGSGIIGITIGYTLNNTEIICYDIED--IPYNTTKENILKHNLQDRVKALKSDLLTEAIKEKRRFDLIVSNPPYIREDVIETLMDDVKKYEPFEALCGGKDGLFFYEGIIKQSLEVLNDGGTIAFEIGYDQKIQVSHILNEYGFKDVLCIKDLAGKDRVIKARK 282
>gi|118480363|ref|YP_897514.1| HemK family modification methylase [Bacillus thuringiensis str. Al Hakam] >gi|118419588|gb|ABK88007.1| modification methylase, HemK family [Bacillus thuringiensis str. Al Hakam] (283 aa)
Score = 243, Expect = 5.6e-19, Identities = 64/212 (30%), Positives = 117/212 (55%)
  Q:    76 KNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVK--QKKLIDKK-YILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKND-PNVDPSTK-CEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITV-FKFLKDLDDKDRVLY 287
           + IP+QY+     FYG SFF+ +   +PR ETE ++   ++  ++   D+K ++ D+ +GSG ++ T++   +NK+  V  V+  +   +V  +N + L  +  F   D+        +K D ++ NPPYI + D   + P  K  EPK+AL   ++G  FY RF+ E+  +L     + FEIG  Q E+++  L +       + + D++ KDR+++
  S:    64 EGIPIQYMIGHEMFYGRSFFVNEEVLIPRPETEELIVGVLERIERHFGDEKLHVADIGTGSGAISITLAL--ENKNLHVYTVDIAQESIEVAKENAKTLGAEVTFYHGDLLSPFYETGQKLDVVVSNPPYIPEEDWRGLSPVVKEHEPKRALVGGEDGLDFYRRFMEELPNVLQKKAIVAFEIGVGQGEDVKGLLQQAFPHAHVEVVFDINGKDRMVF 279
>gi|30265351|ref|NP_847728.1| HemK family modification methylase [Bacillus anthracis str. Ames] >gi|47530890|ref|YP_022239.1| HemK family modification methylase [Bacillus anthracis str. 'Ames Ancestor'] >gi|49188163|ref|YP_031416.1| HemK family modification methylase [Bacillus anthracis str. Sterne] >gi|165871296|ref|ZP_02215945.1| modification methylase, HemK family [Bacillus anthracis str. A0488] >gi|167636691|ref|ZP_02394979.1| modification methylase, HemK family [Bacillus anthracis str. A0442] >gi|170688140|ref|ZP_02879351.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Bacillus anthracis str. A0465] >gi|170709377|ref|ZP_02899790.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Bacillus anthracis str. A0389] >gi|177651883|ref|ZP_02934466.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Bacillus anthracis str. A0174] >gi|196042385|ref|ZP_03109650.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Bacillus cereus NVH0597-99] >gi|30260029|gb|AAP29214.1| modification methylase, HemK family [Bacillus anthracis str. Ames] >gi|47506038|gb|AAT34714.1| modification methylase, HemK family [Bacillus anthracis str. 'Ames Ancestor'] >gi|49182090|gb|AAT57466.1| modification methylase, HemK family [Bacillus anthracis str. Sterne] >gi|164712963|gb|EDR18491.1| modification methylase, HemK family [Bacillus anthracis str. A0488] >gi|167527891|gb|EDR90713.1| modification methylase, HemK family [Bacillus anthracis str. A0442] >gi|170125725|gb|EDS94639.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Bacillus anthracis str. A0389] >gi|170667833|gb|EDT18585.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Bacillus anthracis str. A0465] >gi|172082587|gb|EDT67651.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Bacillus anthracis str. A0174] >gi|196026777|gb|EDX65419.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Bacillus cereus NVH0597-99] (283 aa)
Score = 243, Expect = 5.6e-19, Identities = 64/212 (30%), Positives = 117/212 (55%)
  Q:    76 KNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVK--QKKLIDKK-YILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKND-PNVDPSTK-CEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITV-FKFLKDLDDKDRVLY 287
           + IP+QY+     FYG SFF+ +   +PR ETE ++   ++  ++   D+K ++ D+ +GSG ++ T++   +NK+  V  V+  +   +V  +N + L  +  F   D+        +K D ++ NPPYI + D   + P  K  EPK+AL   ++G  FY RF+ E+  +L     + FEIG  Q E+++  L +       + + D++ KDR+++
  S:    64 EGIPIQYMIGHEMFYGRSFFVNEEVLIPRPETEELIVGVLERIERHFGDEKLHVADIGTGSGAISITLAL--ENKNLHVYTVDIAQESIEVAKENAKTLGAEVTFYHGDLLSPFYETGQKLDVVVSNPPYIPEEDWRGLSPVVKEHEPKRALVGGEDGLDFYRRFMEELPNVLQKKAIVAFEIGVGQGEDVKGLLQQAFPHAHVEVVFDINGKDRMVF 279
>gi|170759851|ref|YP_001785467.1| HemK family modification methylase [Clostridium botulinum A3 str. Loch Maree] >gi|169406840|gb|ACA55251.1| modification methylase, HemK family [Clostridium botulinum A3 str. Loch Maree] (283 aa)
Score = 243, Expect = 5.7e-19, Identities = 77/240 (32%), Positives = 128/240 (53%)
  Q:    51 IFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKN--QRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKN--DPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYIKK 290
           I    D  I  E K+   QL ++    +P++YI  +  F GL F I+KG  +PR +TE +++  +++ K  + K I D+C GSG++  TI Y   N + I   +E    PY    +N  + NL+ + + +KSD+         K D I+ NPPYI ++  +  +D   K EP +AL   ++G +FY   + +   +L +G  I FEIG++QK ++   L +        +KDL  +DRV+  +K
  S:    41 ILTNPDYHIKDEEKEKYFQLIELRKNKMPIKYILGTTEFMGLDFNIEKGVLIPRPDTEILVETVLEEIKNKNYKQICDVCCGSGIIGITIGYTLNNTEIICYDIED--IPYNTTKENILKHNLQDRIKVLKSDLLTEAIKEKRKFDLIVSNPPYIKEDVIETLMDDVKKYEPLEALCGGKDGLFFYEGIIKQSLEVLNDGGTIAFEIGYDQKIQVSHILNEYGFKDVLCIKDLAGRDRVIKARK 282
>gi|146296535|ref|YP_001180306.1| HemK family modification methylase [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145410111|gb|ABP67115.1| modification methylase, HemK family [Caldicellulosiruptor saccharolyticus DSM 8903] (289 aa)
Score = 243, Expect = 6.3e-19, Identities = 79/250 (31%), Positives = 131/250 (52%)
  Q:    38 ILFNSKIIE-NSSDIFFEKDTEIDFE-YKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQR--NLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPN-VDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLY 287
           IL  S+I+  + S    EK+  I+ E Y++I+    K    + P+QY T    F GL F++ +   +PR +TE +++ A++     +    LD+ +GSG +A  +    K  D  VI V+ +    +V  KN +   +  K  F+KS++F+ +     K D I  NPPYI +N+ + +D     EPKQALF+ +NG Y++          L  G  IIFE+G+ Q + ++K L        K   DL++ +R +Y
  S:    36 ILLVSQILNIDKSQAILEKNLTIEEEDYQRIISAAKK-YTMDFPLQYCTNKAYFMGLEFYVDEDVLIPRFDTETLIEVAIELFNRKENLNFLDVGTGSGCIAIALC---KFLDCKVIAVDISENALRVAEKNAKLNGVFDKIHFVKSNLFE-NIPPSLKFDAIFSNPPYISENEISMLDKRVLKEPKQALFSKENGLYYFQEIAKNARQYLKKGGYIIFEVGYRQSQHVKKILKDLGYVDIKSKNDLNNIERCVY 285
>gi|166986802|ref|ZP_02258036.1| modification methylase, HemK family protein [Bacillus cereus AH187] (232 aa)
Score = 242, Expect = 7.4e-19, Identities = 64/212 (30%), Positives = 117/212 (55%)
  Q:    76 KNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVK--QKKLIDKK-YILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKND-PNVDPSTK-CEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITV-FKFLKDLDDKDRVLY 287
           + IP+QY+     FYG SFF+ +   +PR ETE ++   ++  ++   D+K ++ D+ +GSG ++ T++   +NK+  V  V+  +   +V  +N + L  +  F   D+        +K D ++ NPPYI + D   + P  K  EPK+AL   ++G  FY RF+ E+  +L     + FEIG  Q E+++  L +       + + D++ KDR+++
  S:    13 EGIPIQYMIGHEMFYGRSFFVNEEVLIPRPETEELIVGVLERIERHFSDEKIHVADIGTGSGAISITLAL--ENKNLHVYTVDIAQGSIEVAKENAKTLGAEVTFYHGDLLSPFYETGQKLDVVVSNPPYIPEEDWRGLSPVVKEHEPKRALVGGEDGLDFYRRFMEELPNVLQKKAIVAFEIGIGQGEDVKGLLQQAFPHAHVEVVFDINGKDRMVF 228
>gi|167940505|ref|ZP_02527580.1| Methyltransferase [Bacillus cereus AH1134] (283 aa)
Score = 242, Expect = 8.4e-19, Identities = 67/241 (27%), Positives = 127/241 (52%)
  Q:    47 NSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVK--QKKLIDKK-YILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKND-PNVDPSTK-CEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITV-FKFLKDLDDKDRVLY 287
           N + +      EI  + +K   +      + IP+QY+     FYG SFF+ +   +PR ETE ++   ++  ++   D+K ++ D+ +GSG ++ T++   +N++  V  V+  +   +V  +N + L  +  F   D+        +K D ++ NPPYI + D   + P  K  EPK+AL   ++G  FY RF+ E+  +L     + FEIG  Q E++++ L +       + + D++ KDR+++
  S:    35 NRTGLLMNMREEITEDQEKSFTEFIHKYVEGIPIQYMIGYEMFYGRSFFVNEEVLIPRPETEELIVGVLERIERHFGDEKLHVADIGTGSGAISITLAL--ENENLHVYTVDIAQESIEVAKENAKALGAEVTFYHGDLLSPFHKTGQKLDVVVSNPPYIPEEDWRGLSPVVKEHEPKRALVGGEDGLDFYRRFMEELPNVLQKKAIVAFEIGVGQGEDVKRLLQQAFPHAHVEVVFDINGKDRMVF 279
>gi|49476827|ref|YP_039321.1| HemK family modification methylase [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|49328383|gb|AAT59029.1| modification methylase, HemK family [Bacillus thuringiensis serovar konkukian str. 97-27] (283 aa)
Score = 242, Expect = 8.8e-19, Identities = 64/212 (30%), Positives = 116/212 (54%)
  Q:    76 KNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVK--QKKLIDKK-YILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKND-PNVDPSTK-CEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITV-FKFLKDLDDKDRVLY 287
           + IP+QY+     FYG SF + +   +PR ETE ++   ++  ++   D+K ++ D+ +GSG ++ T++   +NKD  V  V+  +   +V  +N + L  +  F   D+        +K D ++ NPPYI + D   + P  K  EPK+AL   ++G  FY RF+ E+  +L     + FEIG  Q E+++  L +       + + D++ KDR+++
  S:    64 EGIPIQYMIGHEMFYGRSFIVNEEVLIPRPETEELIVGVLERIERHFGDEKLHVADIGTGSGAISITLAL--ENKDLHVYTVDIAQESIEVAKENAKTLGAEVTFYHGDLLSPFYETGQKLDVVVSNPPYIPEEDWRGLSPVVKEHEPKRALVGGEDGLDFYRRFMEELPNVLQKKAIVAFEIGVGQGEDVKGLLQQAFPHAHVEVVFDINGKDRMVF 279
>gi|70725919|ref|YP_252833.1| hypothetical protein SH0918 [Staphylococcus haemolyticus JCSC1435] >gi|68446643|dbj|BAE04227.1| unnamed protein product [Staphylococcus haemolyticus JCSC1435] (277 aa)
Score = 241, Expect = 9.5e-19, Identities = 68/211 (32%), Positives = 112/211 (53%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPST--KCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITV-FKFLKDLDDKDRVLYIK 289
           P+QYI    SFYG  F + + C +PR ETE ++   ++  K      I D+ +GSGVLA T+   K NKD  V   +  +   +V   N    ++   F+K +  K    +  K D I+ NPPYID ++  +  +T  K EP +ALFA   G+  Y   L+++  +L     + FEIG+NQ E ++  +++    +  K +KD++  +R++  K
  S:    67 PIQYIVGFQSFYGYQFQVNEHCLIPRPETEEVMLHFLENCK--SSATIADIGTGSGVLAITLK--KLNKDFTVYATDIVQETLEVASDNAHYHEVAVTFLKGNALKPFIQNNIKLDGIVSNPPYIDVDEMEMMENTVVKYEPHKALFAENKGFAIYELILNDLPKVLNKDAYVTFEIGYNQGERLKNIILEKYPKLDVKVIKDINGNERIVSFK 276
>gi|153956300|ref|YP_001397065.1| methyltransferase [Clostridium kluyveri DSM 555] >gi|146349158|gb|EDK35694.1| Predicted methyltransferase [Clostridium kluyveri DSM 555] (288 aa)
Score = 241, Expect = 1.1e-18, Identities = 75/262 (28%), Positives = 135/262 (51%)
  Q:    25 LDDSQIK-WILKELILFNSKIIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQR---NLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKN--DPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVL 286
           L D +I  +IL   +L    I ++   I    D ++  E  +      K+  + +PV+YI     F G+ F +K G  +PR +TE +++ A+++    +   I DLC G+G +   IS  K  +   V+  + + T  +V  +N R   +L  +   +KSD+ +    +  K + I+CNPPYI ++  D  ++     EP +AL   ++G  FY + + +   +L     ++FEIG++QK+++   L+K        +KDL  KDRV+
  S:    18 LKDKKISSYILDSQLLLGKAINKDRLFIVINADHKVTREEAEKYYYYLKLREEKMPVKYILGQCEFMGMDFIVKPGVLIPRPDTETLVENALEEIDNNEFYNICDLCCGTGAIG--ISLAKFVEHINVVCCDISDTACEVAEQNVRRYYSLNKRISIVKSDLMEYFILNKIKFNMIVCNPPYIKESVIDTLMEDVKNYEPHEALSGGEDGLEFYRKIVKQSLKVLTKNGMLMFEIGYDQKKDVTSILMKYGFKNTTCIKDLAGKDRVI 283
>gi|23100452|ref|NP_693919.1| protoporphyrinogen oxidase [Oceanobacillus iheyensis HTE831] >gi|22778685|dbj|BAC14953.1| protoporphyrinogen oxidase [Oceanobacillus iheyensis HTE831] (287 aa)
Score = 240, Expect = 1.2e-18, Identities = 71/253 (28%), Positives = 134/253 (52%)
  Q:    34 LKELILFNSKIIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKY-ILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYI--DKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPI-LANGTEIIFEIGFNQKEEIEKFLIKN--NITVFKFLKDLDDKDRVL 286
           + E++L +   I     +   +D+  +   + I K +   +   +PVQ++TK   FYG  F + +   +PR ETE ++   ++Q K +++   I+D+ +GSGV+A T++   +   + V   + +     V  +N + +K    F++ +  +      +  D I+ NPPYI   +++   D     +P+ ALFA  NG   Y   L ++  + L++ + + FEIGF+Q E I   + +N  +  VF  +KD++DKDR+L
  S:    25 VAEILLLHHLQISKEQLLMKWRDSIQESSVEAIEKDILTHVETGVPVQHLTKEEHFYGRVFEVNQHVLIPRPETEELVQQVIQQAKTMEQPITIVDVGTGSGVIAITLAL--ELPGSRVFATDISEKALAVAKRNAQAMKADVTFLEGNFLEPFLDINQTADIIVSNPPYIPWSQSEELQDTVKNFDPELALFAENNGLAAYHAILRQMKTMKLSDQSILAFEIGFDQSEAITNMIRQNLPSREVFT-VKDINDKDRIL 280
>gi|160878571|ref|YP_001557539.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Clostridium phytofermentans ISDg] >gi|160427237|gb|ABX40800.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Clostridium phytofermentans ISDg] (279 aa)
Score = 240, Expect = 1.4e-18, Identities = 71/237 (29%), Positives = 117/237 (49%)
  Q:    50 DIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKN-DPNVDPSTK-CEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVL 286
           D       ++  E  +  +QL K    +IP+QY+T S  F GLSF + +   +PRQ+TE +++  +K  K    K +L+LC+GSG +  +++ +   K+A+ + +  +    KV  +N ++ ++   ++ SD+F      Y   D I+ NPPYI+      + P  K  EP+ AL    +G  FY     E    L     +  EIG NQ   I + L +N     K +KD    DRV+
  S:    43 DYMIRAKEDMSIEVYERYQQLLKKRALHIPLQYLTGSQEFMGLSFRVNESVLIPRQDTERLVEEVLKVSK---DKDVLELCTGSGCIIISLAKLGNIKNAVAVDISSDAI--KVAKENAKDNEVLVTYLLSDMFSNVSGTY---DVIVSNPPYIESEVIEGLMPEVKDHEPRIALDGDADGLKFYRILAKESGRFLNKNGRLYLEIGCNQAAFIGELLSQNGFAQIKVVKDYAGLDRVV 273
>gi|194016564|ref|ZP_03055178.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Bacillus pumilus ATCC 7061] >gi|194012037|gb|EDW21605.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Bacillus pumilus ATCC 7061] (294 aa)
Score = 240, Expect = 1.5e-18, Identities = 65/225 (28%), Positives = 118/225 (52%)
  Q:    62 EYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLI---DKKY-ILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYI--DKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITV-FKFLKDLDDKDRVL 286
           E  ++  +  K   K +PVQ++T    FYG  F + K   +PR ETE ++  A+     I   D+    +D+ +GSG +A T++  K+     V   + +     V  +NQ+ L     F++ D+ +  +    K D  I NPPYI  ++ D   +  TK EP  AL   ++G +FY R + +++ +L     ++FEIG  Q ++++  L+++      + +KD++ KDR +
  S:    55 EQDRLFSEFVKQHKKGVPVQHLTGIEFFYGRPFEVNKHVLIPRPETEEVVLAALNLMSDIFPHDQPLQAVDVGTGSGAIAITLALEKETLS--VTATDISHEALAVAKRNQQALGADVHFLQGDLLEPIKDQGIKVDLFISNPPYISAEEMDSLSEVVTKHEPVNALTDGRDGLWFYKRLIRDLHHVLHKQAVVVFEIGHTQGQDVKALLLQSFPAADVRIVKDINGKDRAV 284
>gi|167455008|ref|ZP_02321231.1| modification methylase, HemK family protein [Listeria monocytogenes FSL J2-064] (225 aa)
Score = 238, Expect = 2.3e-18, Identities = 64/220 (29%), Positives = 112/220 (50%)
  Q:    49 SDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPN--VDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKN 268
           S+++ E   E++  ++K  ++         PVQYI K+  FYG  F + +   +PR ETE ++  A    K    K +LD+C+GSG++A  I+  K   +  +   + +     V  KN   L    +F+++D+ +  + + E+ D I+ NPPYI + +     D   K EP  ALFA  +G   Y RF+  +  +L +   +  EIG+ Q E +++   K+
  S:     6 SELWMEISRELEPNHEKQFEEDFARYLAGEPVQYILKTAPFYGYDFLVTEDVLIPRPETEELVACAEDFLKKHSVKNVLDVCTGSGIIA--IALKKAFPEISMTASDISAPALAVAKKNALLLNADVRFVETDLLEAFKQNEERFDMIVANPPYISEAEKAEMSDYVLKNEPSLALFAENDGLAIYERFVDNLQYVLNSSFWVGVEIGYTQGERVKQLFEKS 225
>gi|172058703|ref|YP_001815163.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Exiguobacterium sibiricum 255-15] >gi|171991224|gb|ACB62146.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Exiguobacterium sibiricum 255-15] (282 aa)
Score = 238, Expect = 2.5e-18, Identities = 77/263 (29%), Positives = 133/263 (50%)
  Q:    28 SQIKWILKELILFNSK--IIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVK--QKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEII-FEIGFNQKEEIEKFLIKNNITV-FKFLKDLDDKDRVLYIKK 290
           S  +W+L  ++  +    +I  S ++  E+D     EY  +L  LN V     PVQ++     FYG +F +     +PR ETE ++++     Q +      I+D+ +GSG +  T++         V  V+ +     V  +NQ+ L  +  F++ D+      H  +   ++ NPPYI++++   D     EP  ALF  ++G  FY R L +   +L +   +I FEIG NQ +E++  L K   TV    LKD++ KDR++Y ++
  S:    22 SSAEWLLMHVLQIDRTGLLIRLSDELEPEQDLLFS-EY--LLAHLNGV-----PVQHLIGYQPFYGRNFRVSPAVLIPRPETEELIEFVTGRLQGETFQPGEIVDIGTGSGAICLTLAL---ELGQPVTTVDISPEAIAVAKENQQTLGGEVTFLEGDLLAPLADHSVRV--LVSNPPYIEEDELLSDVVFDHEPHLALFGGKDGLVFYRRLLEDSARVLRDDFRLIAFEIGHNQGQEVQMMLKKRYPTVETGILKDINGKDRIVYAER 277
>gi|109648006|ref|ZP_01371909.1| modification methylase, HemK family [Desulfitobacterium hafniense DCB-2] >gi|109641096|gb|EAT50651.1| modification methylase, HemK family [Desulfitobacterium hafniense DCB-2] (285 aa)
Score = 237, Expect = 3.2e-18, Identities = 63/239 (26%), Positives = 118/239 (49%)
  Q:    51 IFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLI----------DKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKND-PNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYIK 289
           ++ E++  +  E +   +Q+     +  P+QYI K   F GL F++ +   +PR +TE +++  ++ KK            +  +I DLC+GSG LA +I++     +  V+G + +R    V   N   L ++ Q+ + D  +  R   +  D I+ NPPY+ + +   + P    EP+ A     +G  FY     E   +L     I+ EIG+ Q   + +   +      + L+DL  +DRV++ +
  S:    41 LYLEREQTLGPEQEAAYQQMISRRARREPLQYIVKHQEFMGLDFYVDERVLIPRADTEILVEKVLELKKEWQHSADRGGSEESPHIADLCTGSGALAISIAHFWPQAE--VVGTDLSRDALDVARFNGERLGVRIQWRQGDFLEPLRG--DSWDLIVSNPPYVTQAEYGELAPELAKEPRMAFLGGADGLDFYRELAREGRSLLREKGIILMEIGWQQGNSVAELFQQQGFQT-QILQDLGGRDRVVFAR 285
>gi|150003436|ref|YP_001298180.1| putative protoporphyrinogen oxidase [Bacteroides vulgatus ATCC 8482] >gi|149931860|gb|ABR38558.1| putative protoporphyrinogen oxidase [Bacteroides vulgatus ATCC 8482] (278 aa)
Score = 236, Expect = 4.1e-18, Identities = 77/264 (29%), Positives = 132/264 (50%)
  Q:    27 DSQIKWILKELI--LFNSKIIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPSTKC---EPKQALFAPQNGYYFYFRFLSEI-YPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYIKK 290
           DS++  + K L+  +F   ++E    ++  KDT      +K L  +   L K  P+QYI  +  FYGL+F + K   +PR ET  ++DW +++ K   +  ILD+ +GSG +A  +S  K  ++A V+  + +    +V  +N R   ++    + D+  +     E+ D I+ NPPYI + +   D S      EP+ ALF P +    ++R ++E+   +L +G  + FEI      E    L        K  KDL   DR++  +K
  S:    18 DSELVPMAKLLLTQVFGMSVVE----LYAGKDTTFSVNERKQLDDILVRLQKLEPIQYIIGTEEFYGLTFEVNKHVLIPRPETGELVDWIIREHKY-GRVRILDIGTGSGCIA--VSLAKNLEEAEVVSWDVSEKALQVAERNCRRNGVRVILEQRDVL-LASPAGERFDVIVSNPPYITEKE-RADMSANVLEWEPELALFVPDDSPLLFYRKIAELGRDMLVSGGRLYFEINQEYGRETVDMLAGLEYKNIKLRKDLFQNDRMIKAEK 278
>gi|163815256|ref|ZP_02206633.1| hypothetical protein COPEUT_01416 [Coprococcus eutactus ATCC 27759] >gi|158449451|gb|EDP26446.1| hypothetical protein COPEUT_01416 [Coprococcus eutactus ATCC 27759] (284 aa)
Score = 236, Expect = 4.6e-18, Identities = 74/241 (30%), Positives = 121/241 (50%)
  Q:    47 NSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKY-ILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNL---KLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKND------PNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLY 287
           N +D+FFE+D +I  E +    +L +      P+QYIT   +F G  F   +   +PRQ+TE +++ A+   K   K   +LD+C G+G +   ISY     D+ V   + +    +V  KN   L     +   I +D+F      +   D I+ NPPYI K+D      P V  +   EP+ AL    +G YFY   +S+    + +   ++FEIG +Q E+++   +         ++DL   DRV+Y
  S:    37 NRTDMFFERDRDISTELETGYLELIRRRCTREPLQYITGVQNFMGYDFCTSENVLIPRQDTEILVETALNLTKSSQKTLDVLDMCCGTGCIG--ISYGLLRPDSKVTLADISGDAIRVTRKNVTKLCDEPERFDVINTDLFGDVDGQF---DLILSNPPYI-KSDVIEALMPEVRDN---EPRLALDGKADGLYFYRIIVSQAIKYIKDEGYVVFEIGNDQAEDVQHLFVDTGYDDVHVVQDLCRNDRVVY 278
>gi|89897679|ref|YP_521166.1| hypothetical protein DSY4933 [Desulfitobacterium hafniense Y51] >gi|89337127|dbj|BAE86722.1| hypothetical protein [Desulfitobacterium hafniense Y51] (285 aa)
Score = 235, Expect = 4.9e-18, Identities = 62/239 (25%), Positives = 118/239 (49%)
  Q:    51 IFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLI----------DKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKND-PNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYIK 289
           ++ E++  +  E +   +Q+     +  P+QYI K   F GL F++ +   +PR +TE +++  ++ KK            +  +I DLC+GSG LA +I++     +  V+G + +R    V   N   L ++ Q+ + D  +  R   +  D I+ NPPY+ + +   + P    EP+ A     +G  FY     E   +L     I+ EIG+ Q   + +   +      + ++DL  +DRV++ +
  S:    41 LYLEREQTLGPEQEAAYQQMISRRARREPLQYIVKHQEFMGLDFYVDERVLIPRADTEILVEKVLELKKEWQHSADRAGGGESPHIADLCTGSGALAISIAHFWPQAE--VVGTDLSRDALDVARFNGERLGVRIQWRQGDFLEPLRG--DSWDLIVSNPPYVTQAEYGELAPELAKEPRMAFLGGADGLDFYRELAREARSLLREKGIILVEIGWQQGNSVAELFQQQGFQT-QIVQDLGGRDRVVFAR 285
>gi|29349137|ref|NP_812640.1| putative protoporphyrinogen oxidase [Bacteroides thetaiotaomicron VPI-5482] >gi|29341045|gb|AAO78834.1| putative protoporphyrinogen oxidase [Bacteroides thetaiotaomicron VPI-5482] (278 aa)
Score = 235, Expect = 5.6e-18, Identities = 69/237 (29%), Positives = 116/237 (48%)
  Q:    50 DIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPST--KCEPKQALFAPQNGYYFYFRFLSEI-YPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVL 286
           DI+  KD  +    ++ L+ +   L KN P+QYI     F G +F +  G  +PR ET  ++D  VK+    D + +LD+ +GSG +A  IS  K   DA V   + +     +  KN   L  +  F + D+F  D       D I+ NPPY+ + +     +     EP+ ALF P      ++R ++E+   +L  G ++ FEI     +++ + +  N     + +KD+  KDR+L
  S:    39 DIYMGKDIILSACKQRELENIIFRLQKNEPIQYIRGYAEFCGRNFRVAPGVLIPRPETAELVDLIVKENP--DARRLLDIGTGSGCIA--ISLDKNLPDAKVDAWDISEEALAIARKNNEELDAQVTFRRQDVFSADGIQGTSYDIIVSNPPYVTETEKTEMEANVLDWEPELALFVPDEDPLRFYRRIAELGRELLRPGGKLYFEINQAYGQDMIRMIEMNQYRDVRVIKDIFGKDRIL 274
>gi|118726298|ref|ZP_01574926.1| modification methylase, HemK family [Clostridium cellulolyticum H10] >gi|118664297|gb|EAV70931.1| modification methylase, HemK family [Clostridium cellulolyticum H10] (285 aa)
Score = 235, Expect = 6.1e-18, Identities = 65/236 (27%), Positives = 109/236 (46%)
  Q:    51 IFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAV---KQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKN-DPNVDPSTKC-EPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVL 286
           ++   D E+  + K +L  +      NIP+QYI     F  L F +     +PRQ+TE +++  +    Q K    K +LD+C+GSG +A +I+Y       +   V +              ++ + +    D+F   +   +K D I+ NPPYI+ +    +    +  EP  AL    +G  FY R +S     L     + FEIG+NQ E++   L+K +    +  KD    DRV+
  S:    41 LYSHGDRELSIDEKAVLDHMLVQRTGNIPLQYIVGDTEFMSLRFLVTPAVLIPRQDTELLVEKTIDLLNQGKTGTNKKVLDMCTGSGCIAVSIAYFCPECSIVACDVSQKALDVAKANSELNGVQNRVELCCGDLFDAIKGG-QKFDIIVSNPPYIETDIIAGLQKEVRSYEPGLALDGGADGLVFYRRIISSAPERLNRNGWLAFEIGYNQGEKVSA-LMKESFVDIQIFKDYGGNDRVV 279
>gi|168185913|ref|ZP_02620548.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Clostridium botulinum C str. Eklund] >gi|169296020|gb|EDS78153.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Clostridium botulinum C str. Eklund] (292 aa)
Score = 234, Expect = 6.8e-18, Identities = 80/253 (31%), Positives = 133/253 (52%)
  Q:    33 ILKELILFNSKIIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKL--KTQFIKSDIFKIDRSHYEKCDFIICNPPYI-DKNDPNV-DPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           +LK+  LF   II N S+     D E   E+ K++     +    +PV+YI     F GL+F IK+G  +PR +TE +++  +K+ K      I D+C GSG +  +I   K  +++IV   + +    +V  KN     L  + +  KSD+  + +   +K + I+ NPPYI +K  P + D   K EP  AL    +G  FY + +++   +L     + FEIG++Q EE+++ LIKN  +  + + DL   +RV
  S:    33 VLKKDKLF---IILNRSETISNNDKE---EFIKLIN----LRKDKMPVKYILGECEFMGLNFTIKEGVLIPRADTEILVEEVIKEIKNNGYTKICDVCCGSGAIGVSIG--KYIENSIVDCYDISDIAIEVTNKNINRFLLEDRVKVRKSDLLTVAKEENKKFNIIVSNPPYIKEKVIPTLMDDVKKFEPYIALCGGADGLDFYKKIINQSLQLLEEDGLLAFEIGYDQGEEVKELLIKNGFSCVRVINDLAGLNRV 277
>gi|167855821|ref|ZP_02478573.1| HemK-like protein [Haemophilus parasuis 29755] >gi|167853034|gb|EDS24296.1| HemK-like protein [Haemophilus parasuis 29755] (416 aa)
Score = 233, Expect = 8.1e-18, Identities = 77/279 (27%), Positives = 130/279 (46%)
  Q:     7 KRQKSSMTFSELTKRLNPLDDSQIKWILKELILFNSKIIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYM----LDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLK-TQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDP-STKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           K  +  +TF+E T   N   D  +       IL  +    + S IF   +TE++    + L +L     K  P+ YI     F+ L   +     +PR +TE +    L+WA K+        ILDL +G+G +A  ++     K A +IG++K     ++  KN++ L  +  +F++SD F+  ++  ++ D I+ NPPYIDK+D N+     + EP  AL A QNG     + +      L     ++ E G+ Q   ++    +N        +D    DRV
  S:   128 KTYQQWLTFAEQTLLENGSQDPFLNAKADANILLQAVTKRSKSAIFAFAETELNESELRQLAELLARRAKGEPMAYILGEKEFWSLPLAVSTATLIPRPDTERLVEVALEWAYKRLDSSKNLQILDLGTGTGAIALALASELGTK-AEIIGIDKQPDAVQLAEKNRQKLGFENVRFLQSDWFEALKN--QRFDLIVSNPPYIDKDDENLTQGDVRFEPLTALVAEQNGLSDLQKIIQNAPLYLTPNGALMLEHGWQQAASVQDIFQQNQWNAVTTFQDYGGNDRV 409
>gi|163943016|ref|YP_001647900.1| HemK family modification methylase [Bacillus weihenstephanensis KBAB4] >gi|163865213|gb|ABY46272.1| modification methylase, HemK family [Bacillus weihenstephanensis KBAB4] (283 aa)
Score = 232, Expect = 1.3e-17, Identities = 66/241 (27%), Positives = 123/241 (51%)
  Q:    47 NSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLI---DKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPST--KCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITV-FKFLKDLDDKDRVLY 287
           N + +      EI  E +K   +      + IP+QY+     FYG SFF+ +   +PR ETE ++   +++ +     ++ +I D+ +GSG ++ T++   +NK+  V  V+  +   +V  +N + L     F   D+        +K D ++ NPPYI + D     +   + EPK+AL   ++G  FY RF+ E+  +L     + FEIG  Q E+++  L +       + + D++ KDR+++
  S:    35 NRTGMLMNMREEITAEQEKSFAEFIHNHVEGIPIQYMLGYEMFYGRSFFVNEEVLIPRPETEELIVGVLERIERHFGNEELHIADIGTGSGAISITLAL--ENKNLHVYTVDIAQESIEVAKENAKTLGADVTFYHGDLLSPFYETGQKLDVVVSNPPYIPEEDWRGLSTVVKEHEPKRALVGGEDGLDFYRRFMEELPNVLQKKAIVAFEIGVGQGEDVKALLQQTFPRAQVEVVFDINGKDRMVF 279
>gi|167762047|ref|ZP_02434174.1| hypothetical protein BACSTE_00395 [Bacteroides stercoris ATCC 43183] >gi|167700139|gb|EDS16718.1| hypothetical protein BACSTE_00395 [Bacteroides stercoris ATCC 43183] (303 aa)
Score = 232, Expect = 1.4e-17, Identities = 68/245 (27%), Positives = 119/245 (48%)
  Q:    46 ENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDP-----NVDPSTKCEPKQALFAPQNGYYFYFRFLSEI-YPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYIKK 290
           + + D +  KD  +  +  + L  +   L    P+QY+  +  F   S+++  G  +PR ETE +++  V  K++     ILD+ +GSG +A  IS  K   DA V   + + T  ++  +N   L+    F++ D+        E+ D I+ NPPY+ +++      NV      EP  ALF P N    ++R ++E+   +LA+G  + FEI     E     L     T  + LKD+   DR++  ++
  S:    60 QTAVDYYLGKDMILSPKEMQDLDTILARLRNFEPIQYVQGTARFLERSYYVAPGVLIPRPETEELVE--VMLKEVPSGARILDIGTGSGCIA--ISLSKMLPDAKVTAWDISDTALRIARRNNEALQASVCFVQRDVLAYVPGSGERYDVIVSNPPYVTESEKQEMERNV---LDWEPFSALFVPDNDPLLFYRRIAELGKGMLASGGRLYFEINRAFGEATATMLRAQGYTNLRVLKDISGNDRIVIAER 303
>gi|152977514|ref|YP_001377031.1| HemK family modification methylase [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|152026266|gb|ABS24036.1| modification methylase, HemK family [Bacillus cereus subsp. cytotoxis NVH 391-98] (283 aa)
Score = 231, Expect = 1.4e-17, Identities = 68/241 (28%), Positives = 126/241 (52%)
  Q:    47 NSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVK--QKKLIDKK-YILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPST--KCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNI--TVFKFLKDLDDKDRVLY 287
           N + +      EI  E +K  K+L       +PVQY+     FYG SFF+ +   +PR ETE ++   ++  Q+   +++ ++ D+ +GSG ++ T++   +N++  V  V+  +   +V  +N  +L     F   D+        +K D ++ NPPYI + D     S   + EPK+AL    +G  FY RF+ E+  +L     + FE+G  Q E++ K L+++       + + D++ KDR+++
  S:    35 NRTGLMMNMREEISNEQEKRFKELIHKHIDGMPVQYLMGYEMFYGRSFFVNEEVLIPRPETEELIVGVLERIQRNFGNQELHVADIGTGSGAISITLAL--ENQNLHVYTVDIAQESIEVAKQNATSLGANVTFYHGDLLSPFYETGKKLDVVVSNPPYIPEEDWKGLSSVVKEHEPKRALVGGADGLDFYRRFMEELPRVLQKKALVAFEVGVGQGEDV-KGLLEDTFPHAHVEVVFDINGKDRMVF 279
>gi|154482490|ref|ZP_02024938.1| hypothetical protein EUBVEN_00157 [Eubacterium ventriosum ATCC 27560] >gi|149736691|gb|EDM52577.1| hypothetical protein EUBVEN_00157 [Eubacterium ventriosum ATCC 27560] (237 aa)
Score = 231, Expect = 1.4e-17, Identities = 70/213 (32%), Positives = 106/213 (49%)
  Q:    78 IPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKY-ILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPN--VDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYIKK 290
           IP+Q+IT S  F GL F + +   +PRQ+TE +++ A+   K +     +LD+C+GSG +A +I  + +N  A V  V+ +     V  +N    K    F +SD+F+     Y   D I+ NPPYI   +    +D     EP  AL    +G  FY +   E    L +   I FEIG++Q + +   L +N     K  KDL   DRV+   K
  S:    26 IPLQHITGSQEFMGLDFKVNEDVLIPRQDTELLVENAITYIKSVKGDVDVLDMCTGSGCIAISIDRLCEN--AKVTAVDFSEKALVVAKENNALNKADVTFFQSDLFENVEKQY---DVIVSNPPYIKTEEIESLMDEVRIHEPMMALDGDCDGLKFYKKIAKEGRQYLRSNGIIFFEIGYDQGQTVPAILEENGYKDIKVYKDLSGNDRVVTAGK 236
>gi|118445015|ref|YP_879015.1| methyltransferase [Clostridium novyi NT] >gi|118135471|gb|ABK62515.1| Methyltransferase [Clostridium novyi NT] (284 aa)
Score = 231, Expect = 1.5e-17, Identities = 82/254 (32%), Positives = 135/254 (53%)
  Q:    33 ILKELILFNSKIIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFI--KSDIFKIDRSHYEKCDFIICNPPYIDKN-DPNVDPSTK-CEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVL 286
           +LK+  LF   II N ++I   KD E +F     LK +N   +K +PV+YI     F GL+F++K+G  +PR +TE +++  +K+ K  +   I D+C GSG +  +I   K  +++ V   + +    +V  KN     LK +    KSD+  +     +K D I+ NPPYI +   P +    K  EP  AL    +G  FY +   +   IL N   + FEIG++Q E +++ L+++  T  K + DL+  +RV+
  S:    33 VLKKDKLF---IILNRNEIL-SKDEEEEF-----LKLINLRKDK-MPVKYILGECEFMGLNFYVKEGVLIPRADTEILVEEVIKEIKENNYNRICDVCCGSGAIGVSIG--KYMENSTVDCYDISDIAIEVTGKNIERFLLKDRLTVEKSDLLTVAIKQNKKFDVIVSNPPYIKEEVIPTLMEDVKDYEPYIALCGGIDGLDFYRKITVQSLEILENNGLLAFEIGYDQAEAVKELLMESGFTDVKVINDLEGLNRVV 278
>gi|81096268|ref|ZP_00874615.1| Modification methylase HemK [Streptococcus suis 89/1591] >gi|80977612|gb|EAP41148.1| Modification methylase HemK [Streptococcus suis 89/1591] (277 aa)
Score = 231, Expect = 1.6e-17, Identities = 68/211 (32%), Positives = 110/211 (52%)
  Q:    74 LNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDP-----NVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLI----KNNITVFKFLKDLDDKDR 284
           L+++ P QYI     F+GL F + +   +PR ETE +++  +++      + ILD+ +GSG +A  IS  K   D  V+ V+ ++    V  +N R  ++   F++SD+F+     +   D I+ NPPYI  +D      NV  S   EP  ALFA ++G   Y +   +    L    ++ FEIG+ Q +++   L     K  I V   LKD   +DR
  S:    62 LSQHRPAQYIIGKADFHGLEFAVDERVLIPRPETEELVNLILQENSGAGLR-ILDIGTGSGAIA--ISLAKARSDWEVVAVDISKDALAVAQENARTNQVSVHFLESDVFQAVTGQF---DLIVSNPPYISPDDTDEVGLNVLAS---EPHLALFAEEDGMAIYRQIAEQAGAFLKEKGKLYFEIGYKQGQDLTDLLALHFPKKRIRV---LKDQFGQDR 269
>gi|169824786|ref|YP_001692397.1| putative rRNA or tRNA methytransferase [Finegoldia magna ATCC 29328] >gi|167831591|dbj|BAG08507.1| putative rRNA or tRNA methytransferase [Finegoldia magna ATCC 29328] (263 aa)
Score = 231, Expect = 1.6e-17, Identities = 88/268 (32%), Positives = 147/268 (54%)
  Q:    23 NPLDDSQIKWILKELILFN-SKIIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKY--ILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLK-LKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPN-VDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYIKK 290
           N  D S    IL++L  +N S  I +S+D   E D +   EYKK+        +++IP++YI     FY   F+      +PR +TE ++D  +K    I++K+  IL++  GSG+++ T++    +K   V+GV+ N+   ++  KN  +L     +FI SD++  +  +Y K D I+ NPPYIDK D N ++     EP+ ALF   +G YFY + +++    L     + FEIG+NQ+E I + L +N       +KD +  DRV+  ++
  S:     8 NLFDKSDCLMILEKLYNYNFSDSIIHSNDKINENDEKTILEYKKLY-------DEDIPIEYILGFKYFYNRKFYTDSSVLIPRFDTEILVDEIIK----INRKFENILEIGIGSGIISITLNLELNSK---VLGVDINKKAIELSKKNAESLNATNVEFIYSDLY--ENVNY-KFDLIVSNPPYIDKKDFNSLETKILKEPRSALFGGDDGLYFYRKIINQASDYLNEDGMLAFEIGYNQRESIFEILDENGFENHYCIKDFNGFDRVIIARR 263
>gi|15896139|ref|NP_349488.1| S-adenosylmethionine-dependent methyltransferase, HEMK ortholog [Clostridium acetobutylicum ATCC 824] >gi|15025933|gb|AAK80828.1|AE007786_1 S-adenosylmethionine-dependent methyltransferase, HEMK ortholog [Clostridium acetobutylicum ATCC 824] (285 aa)
Score = 229, Expect = 2.9e-17, Identities = 74/253 (29%), Positives = 135/253 (53%)
  Q:    34 LKELILFNSKIIENSSDIFFEKDTEIDFEY------------------KKILKQLNKVLN---KNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKL--KTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKND-PNV-DPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVL 286
           +K+ ++    +++ ++D F+ +D++I   Y                  +  LKQ    +N   K +P++YIT+   F GL F ++KG  +PR +TE +++  ++  +L + K + D+C+GSG +  +I+  K  KD  V+  + +    +V   N++ L L  + +    D+ +      EK D ++ NPPYI +++ P + D     EP  AL   ++G  FY R  S    +L  G  I +EIG ++  E+   L        +  KD    DRV+
  S:     3 IKDALIKAYSVLKETNDEFYMEDSQILLSYVLKKDRIFLITNREYEIEENSLKQYFDYINMRKKKMPIRYITEKCEFMGLDFHVEKGVLIPRPDTEILVEAVLEYIELNNYKKVCDVCTGSGAIGLSIA--KYAKDVEVLCSDISPDAIRVSKINRQGLNLEDRVKIENGDLLEKPIERGEKFDIVVSNPPYIREDEIPKLMDDVKDYEPIIALVGGEDGLDFYRRITSMSKKVLKPGGLIAYEIGSDEANEVSNILENEGFVSIETRKDFARMDRVV 278
>gi|167751821|ref|ZP_02423948.1| hypothetical protein ALIPUT_00063 [Alistipes putredinis DSM 17216] >gi|167660062|gb|EDS04192.1| hypothetical protein ALIPUT_00063 [Alistipes putredinis DSM 17216] (282 aa)
Score = 228, Expect = 3.7e-17, Identities = 68/237 (28%), Positives = 118/237 (49%)
  Q:    49 SDIFFEKDTEIDF-EYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIF-KIDRSHYEKCDFIICNPPYIDKNDP-----NVDPSTKCEPKQALFAPQNGYYFYFRFLSE-IYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           +D+  E D E+   E  +I+ +L        P+QY+     FYGL F +++G  +PR ETE ++ W + +    D   +LD+ +GSG +A T++ +     A V  V+ +     +  +N R L  +  F + D   ++     E+ D I+ NPPYI + +      NV   T  EP +ALF   +    ++R ++     +L  G  + FEI  N  +E  + L +         +DL+DK+R+
  S:    41 TDLVAEPDKELGINELDRIIGELAA----GRPLQYVLGHTEFYGLDFQVREGVLIPRPETEELVRW-IAESPAPDNPAVLDVGTGSGCIAVTLARLIPG--ARVTAVDISEKALSIARENARRLDAEVDFRQGDALGELFPGQREQFDLIVSNPPYIPRREKASMRVNV---TGYEPAEALFVEDDDPLIFYRAIARNARRLLRPGGRLYFEIHENFADETLRMLTREGFPDTAVRRDLNDKNRM 275
>gi|188996114|ref|YP_001930365.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Sulfurihydrogenibium sp. YO3AOP1] >gi|188931181|gb|ACD65811.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Sulfurihydrogenibium sp. YO3AOP1] (291 aa)
Score = 227, Expect = 4.3e-17, Identities = 79/278 (28%), Positives = 146/278 (52%)
  Q:    13 MTFSELTKRLNPL-DDSQIKWILKELILFNSKIIE-NSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYI-LDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKL--KTQFIKSDIF--KIDRSHYEKCDFIICNPPYIDKND-PNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYIKK 290
           M   EL  ++  +  +S+I+    E ++  SKI+      I    D EI  E  K L  L++      P+ Y+TK+  F+GL F+I++G  +PR ETE +++  +++ +    + I L++  GSG +  ++S +K  K+  +IG++ +    ++  K+ +  ++  + +  K +I   K++  +  K DF++ NPPYI + D   +    K EPK+AL + + G  FY + ++ +   L       FE+G  Q E+++  L  N     +  KDL   DRV+   K
  S:     1 MNLKELFSKITEIFKESKIENPANEALILISKILNLPKHHIISYPDLEISEEDAKKLVVLSEKRASGYPMAYLTKNKEFFGLDFYIEEGVLIPRPETEILVEKVIEKLQNAKGELIGLEVGVGSGCI--SVSLLKNIKNLKIIGIDISEKALEITEKSAKIHEVLDRLKLFKFNIMNGKMNSLNLPKLDFVVSNPPYIKEEDYQKLQKEVKKEPKEALISGKEGTEFYEKIVNSLKDFLKEDGFFAFEVGIGQAEKVKLILEDNGYKNIEIYKDLAGIDRVIIASK 284
>gi|149183884|ref|ZP_01862275.1| modification methylase, HemK family protein [Bacillus sp. SG-1] >gi|148848403|gb|EDL62662.1| modification methylase, HemK family protein [Bacillus sp. SG-1] (289 aa)
Score = 227, Expect = 4.4e-17, Identities = 74/286 (25%), Positives = 135/286 (47%)
  Q:     5 KCKRQKSSMTFSELTKRLNPLDDSQIKWILKELILFNSKIIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETE----YMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYI--DKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVF-KFLKDLDDKDRVLYIKK 290
           KC     ++ ++    R N  D++  + ++K L+  +   +  +  +  E   +++F  + I   +     +  P+Q+I     FYG  F + +   +PR ETE    Y L+   K      +    D+ +GSG +A T+   K   +  V+ V+ +     V  KN  NL +  +F++ D+ +   S  EK D ++ NPPYI   + D   +     EP  ALF  ++G  FY RF+ E+  ++ +   I FEIG  Q E +   L         + + D++ KDR+++  +
  S:     3 KCNTVFEALKWASSFLRENKRDENAGELLMKHLLEMDRSQLLANQRLVLEDKVKLEFA-RGITAHI-----QGTPIQHIIGFEEFYGRKFSVNEHVLIPRPETEELVYYTLEKIRKHFSADGELRFADIGTGSGAIAVTMKLEKP--ELFVMAVDISANALHVARKNADNLGVSVEFLEGDLLEPLISRDEKLDVLVSNPPYIPLGELDSLSEVVKDHEPHSALFGGESGLEFYQRFMEELPLVMKDRCLIGFEIGAGQGEAVAGMLRGAFPEAHTEIIHDINGKDRMVFCTR 287
>gi|154687815|ref|YP_001422976.1| YwkE [Bacillus amyloliquefaciens FZB42] >gi|154353666|gb|ABS75745.1| YwkE [Bacillus amyloliquefaciens FZB42] (286 aa)
Score = 227, Expect = 4.6e-17, Identities = 69/241 (28%), Positives = 128/241 (53%)
  Q:    46 ENSSDIFFEKDTEIDFEYKKILKQLNKVLNKN---------------IPVQYITKSFSFYGLSFFIKKGCFVPRQETE----YMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPN--VDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKN--NITVFKFLKDLDDKDRVL 286
           +N++++    DT +D    K+L  L + + ++               IP+QYI     FYG  FF+     +PR ETE    ++LD   +     ++  ++D+ +GSG +A T++   +     V   + ++   +V  +N +NL     F++ D+     S  +K D I+ NPPYI + +     D     EP  AL    +G  FY RF+ E+  ++ +   ++FEIG+NQ + ++     +  N  V + ++D++ KDR +
  S:    22 KNAAELLLLNDTGMD--RSKLLASLQEAVGEDELYRFRRHVEMHKEGIPIQYIIGKEQFYGREFFVNDDVLIPRPETEEVVFHLLDRQKRAFSEAERLNVIDIGTGSGAIAVTLAL--ECGHFSVSASDISKEALQVAERNAQNLGADVCFLQGDLLTPFISSGKKADIIVSNPPYISEEEMADLSDIVRFHEPLHALTDGGDGLKFYKRFMEELPLVMKDKALVVFEIGYNQGKAVKDLFRHSFPNAEV-EVVQDINGKDRTV 280
>gi|89095601|ref|ZP_01168495.1| modification methylase, HemK family protein [Bacillus sp. NRRL B-14911] >gi|89089347|gb|EAR68454.1| modification methylase, HemK family protein [Bacillus sp. NRRL B-14911] (292 aa)
Score = 227, Expect = 5.1e-17, Identities = 73/250 (29%), Positives = 124/250 (49%)
  Q:    38 ILFNSKIIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQK-KLIDKK---YILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPN--VDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFL----IKNNITVFKFLKDLDDKDRVLY 287
           IL    +  + S +  E   E+D   +   K+  ++     PVQYI     FYG +F + +   +PR ETE ++  A+K+K KL  ++      D+ +GSG +A T+    ++ D  V   +          +N      + +FI  D+ +       K D II NPPYI  +D     +  T+ EP +ALFA Q+G   Y RF+ E+  +L   + + FE+G  Q + + + L       NI +   + D++ KDR+++
  S:    31 ILLGHFLNMSRSRLLAEMREELDTRMQGAFKEAVQLHADGRPVQYIIGKEEFYGRTFLVNENVLIPRPETEELVLEALKRKEKLFGREAASAAADIGTGSGAIAVTLKL--ESPDLQVTATDVYGPSLDTAKENADKNGAEIEFILGDLLQPFIEESRKFDIIISNPPYIPLSDMEGMSEVVTENEPHRALFAGQDGLDLYRRFMEELPLVLKEKSLVGFEVGAGQSKAVSELLRTAFPDANIDI---VYDINGKDRMVF 285
>gi|157694095|ref|YP_001488557.1| polypeptide chain release factor methyltransferase [Bacillus pumilus SAFR-032] >gi|157682853|gb|ABV63997.1| polypeptide chain release factor methyltransferase [Bacillus pumilus SAFR-032] (295 aa)
Score = 226, Expect = 5.4e-17, Identities = 63/225 (28%), Positives = 116/225 (51%)
  Q:    62 EYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLI---DKKY-ILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYI--DKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITV-FKFLKDLDDKDRVL 286
           E  ++ ++      K +PVQ++     FYG  F + K   +PR ETE ++  A+     I   D+    +D+ +GSG +A T++  K+     V   + +     V  +NQ+ L     F++ D+ +  +    K D  I NPPYI  D+     +  TK EP  AL   ++G +FY R + +++ +L     ++FEIG  Q ++++  L+++      + +KD++ KDR +
  S:    55 EQDRLFREFVTQHKKGVPVQHLIGIEFFYGRPFEVNKHVLIPRPETEEVVLAALNLMSDIFPHDQPLKAVDVGTGSGAIAITLALEKETLS--VTATDISHEALAVAKRNQQALGADVHFLQGDLLEPIKDQGIKVDLFISNPPYIAADEMGGLSEVVTKHEPVNALTDGRDGLWFYKRLVRDLHHVLHEQAVVVFEIGHKQAQDVKTLLLQSFPAADVRIVKDINGKDRAV 284
>gi|104773786|ref|YP_618766.1| methylase of polypeptide chain release factors [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|103422867|emb|CAI97529.1| Methylase of polypeptide chain release factors [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] (273 aa)
Score = 226, Expect = 5.9e-17, Identities = 76/239 (31%), Positives = 123/239 (51%)
  Q:    49 SDIFFEKDTEI-DFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKN-----KDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNV-DPSTKC-EPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFK--FLKDLDDKDRVLY 287
           S    ++D E+ D E K+  K + ++   + P QYI     F G    + KG  +PR ETE +++WA+    L D   +LDL +GSG +  T++  K+      KD      +   TP ++  +N  +  L     K+++         K D II NPPYI  ++ NV D      EP++ALF  Q+G  FY +F  E+   L +G     E GF++++E+ K +    +  FK  F +D+  K R+L+
  S:    30 SQFQLKQDMELSDAEVKQARKDMKRLAKGDSP-QYILGYAWFLGYRLRVAKGVLIPRFETEELVEWALAH--LQDGDTVLDLGTGSGNI--TVALAKEAESKGIKDLHFYASDVKDTPLRISEENFLDYGLDVTTRKANVLL----GLGKFDLIISNPPYIKPSEKNVMDKGVLANEPEEALFGGQDGLAFYRKFAEEVRDHLNSGGRFFMEFGFSEEDEL-KAMFAEKLPDFKVEFRRDMAGKPRMLF 268
>gi|154148971|ref|YP_001406204.1| bifunctional methyltransferase [Campylobacter hominis ATCC BAA-381] >gi|153804980|gb|ABS51987.1| bifunctional methyltransferase [Campylobacter hominis ATCC BAA-381] (262 aa)
Score = 226, Expect = 5.9e-17, Identities = 79/256 (30%), Positives = 136/256 (53%)
  Q:    35 KELILFNSKIIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIF-EIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYIKK 290
           +E++ F+ K   + +D+    D E+D E  K  + + K  N   P+ YIT    F+G  FF+ +   +PR ETE +++ +++  K      IL++ +GSG++  +I   K  KDA ++ V+ ++   K  +KN +   ++  F  SD+F+    ++   D ++ NPPYI ++ P  D   K EP+ AL   +NG       +++     AN T+ +  EIG++QKE ++K L+KN     +F KDL   DR    KK
  S:    21 REILKFDRKF--SDTDLILNLDKELD-ENSKFWEFIEKFQNGK-PLAYITNEVEFFGEIFFVDESVLIPRFETEILVNKSLEILKNFKAPKILEIGTGSGII--SIMLKKNIKDAEILAVDISKKALKTAIKNAKFHGVEIDFKISDLFENVEGNF---DLVVSNPPYIAQDYPLDDYVLK-EPETALIGGKNGSEILINLINQS----ANRTKFLACEIGYDQKEILKKELVKNGFKA-QFYKDLAGFDRGFTAKK 262
>gi|160885547|ref|ZP_02066550.1| hypothetical protein BACOVA_03547 [Bacteroides ovatus ATCC 8483] >gi|156109169|gb|EDO10914.1| hypothetical protein BACOVA_03547 [Bacteroides ovatus ATCC 8483] (278 aa)
Score = 226, Expect = 6.6e-17, Identities = 70/237 (29%), Positives = 116/237 (48%)
  Q:    50 DIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPN-VDPST-KCEPKQALFAP-QNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVL 286
           DI+  KD  +    ++ L+ +   L KN P+QYI     F G +F +  G  +PR ET  +++  VK+    + +++LD+ +GSG +A  IS  KK  D  V   + +     +  KN  +L+   +F++ D+   D       D I+ NPPY+ + + N +D +    EP  ALF P ++   FY R       +L  G ++ FEI      E    L  N     + +KD+  KDR++
  S:    39 DIYMGKDIILSECKQRELENIIFRLQKNEPIQYIRGFAEFSGRNFKVASGVLIPRPETAELVELIVKENP--NARHLLDIGTGSGCIA--ISLDKKLPDVDVEAWDISEEALAIARKNNEDLEAGVRFLQRDVLSDDWEKVPSFDVIVSNPPYVTETEKNEMDANVLDWEPGLALFVPDEDPLRFYNRIACLGSELLLPGGKLYFEINQAYGRETAHILEMNQYRDVRVIKDIFGKDRIV 274
>gi|167759399|ref|ZP_02431526.1| hypothetical protein CLOSCI_01746 [Clostridium scindens ATCC 35704] >gi|167662956|gb|EDS07086.1| hypothetical protein CLOSCI_01746 [Clostridium scindens ATCC 35704] (283 aa)
Score = 225, Expect = 8.2e-17, Identities = 80/278 (28%), Positives = 134/278 (48%)
  Q:     9 QKSSMTFSELTKR-LNPLDDSQIK------WILKELILFNSKIIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKN--DPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVL 286
           +K ++TF ++ +   + L ++ I+      W L E     SK     +  + + D EI  E         ++    IP+Q+ITK  +F G  F++ +   +PRQ+TE +++ A+K  K      +LDLC+GSG +   IS +K  K     G + +    +V  KN   L++   FI+S +F+     Y   D I+ NPPYI  +  +   +     +P  AL   ++G YFY   +      L     ++FEIG++Q  E+   + K         KDL   DRV+
  S:     2 KKRTLTFQQIYREGTSMLKEAGIREAALDAWYLLEFATGISK-----ASYYGDPDKEIKEEEAARYLGYIEIRKSRIPLQHITKEQAFMGYPFYVDEHVLIPRQDTETLVEEALKVLK--PGMQVLDLCTGSGCI--LISLMKMCKGLYGTGSDISEDALEVARKNACRLEVNAAFIRSSLFEHISGRY---DLIVSNPPYIPTSVIEGLQEEVRLYDPFIALDGKEDGLYFYREIIKAGIRYLRPEGYLMFEIGYDQGNEVACLMEKQGYRNILVKKDLAGLDRVV 276
>gi|146318503|ref|YP_001198215.1| methylase of polypeptide chain release factors [Streptococcus suis 05ZYH33] >gi|146320694|ref|YP_001200405.1| methylase of polypeptide chain release factors [Streptococcus suis 98HAH33] >gi|145689309|gb|ABP89815.1| Methylase of polypeptide chain release factors [Streptococcus suis 05ZYH33] >gi|145691500|gb|ABP92005.1| Methylase of polypeptide chain release factors [Streptococcus suis 98HAH33] (277 aa)
Score = 224, Expect = 9.3e-17, Identities = 61/192 (31%), Positives = 100/192 (52%)
  Q:    74 LNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDP-----NVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFL 265
           L+++ P QYI     F+GL F + +   +PR ETE ++D  +++      + ILD+ +GSG +A  IS  K   D  V+ V+ +     V  +N R  ++   F++SD+ +   +   K D I+ NPPYI  +D      NV  S   EP  ALFA ++G   Y +   +    L    ++ FEIG+ Q +++   L
  S:    62 LSQHRPAQYIIGKADFHGLEFAVDERVLIPRPETEELVDLILQENSGASLR-ILDIGTGSGAIA--ISLAKARPDWEVVAVDISNDALAVAQENARTNQVSVHFLESDVLQ---AVTGKFDIIVSNPPYISPDDTDEVGLNVLTS---EPHLALFAEEDGMAIYRQIAEQAGAFLKENGKLYFEIGYKQGQDLTDLL 249
>gi|116333898|ref|YP_795425.1| methylase of polypeptide chain release factor [Lactobacillus brevis ATCC 367] >gi|116099245|gb|ABJ64394.1| Methylase of polypeptide chain release factor [Lactobacillus brevis ATCC 367] (283 aa)
Score = 224, Expect = 9.6e-17, Identities = 62/210 (29%), Positives = 108/210 (51%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKND-PNVDPSTK-CEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQ----KEEIEKFLIKNNITVFKFLKDLDDKDRVLYI 288
           P QY+     FYG  F +     +PR ETE +++W ++  +    K ++D+ +GSG +A T+   K+    +V   + +     V  KN + L  +  +   D+        ++ D I+ NPPYID+ + P +D S K  EP+QAL+A  +G  FY RF   +   L    +   EIG++Q    K+  ++ L    +TV     D++  DR++++
  S:    70 PAQYVLGYAPFYGREFQVTPATLIPRPETEELVEWVLQVVRQPAAK-VIDVGTGSGAIAVTLK--KERPMWLVTATDISDAAIAVAQKNAQRLTAQLMWATGDLLAPVTG--QRFDVIVSNPPYIDRTEMPEMDTSVKRYEPEQALYAADHGLAFYQRFAQVLTTYLVPTGDFFAEIGYHQGAAVKQIFKQALPDAQVTV---KSDINGHDRMIHV 277
>gi|195978152|ref|YP_002123396.1| methylase of polypeptide chain release factors [Streptococcus equi subsp. zooepidemicus str. MGCS10565] >gi|195974857|gb|ACG62383.1| methylase of polypeptide chain release factors [Streptococcus equi subsp. zooepidemicus str. MGCS10565] (282 aa)
Score = 224, Expect = 9.8e-17, Identities = 70/263 (26%), Positives = 131/263 (49%)
  Q:    26 DDSQIKWILKELILFNSKIIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYI---DKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKN-NITVFKFLKDLDDKDRVLYI 288
           D   + ++ KEL  + S       D    ++ E+  E + +L+++   L++++  QYIT    F  L   +     +PR ETE +++  +K+     +K +LD+ +GSG +A  I+  K   +  V   + +     +   N  +  ++  F +SD+F      +   D I+ NPPYI   DK++  ++   + EP  ALFA +NG+  Y R + +    L    ++ FEIG+ Q E +++ L K       + LKD+  K+R++ +
  S:    20 DRENLAYVFKELKQWTSL------DFLLHQNQEVTSEDQALLERIFLALSQHVSPQYITGRAYFRDLVLAVDSRVLIPRPETEELVELILKENDAT-RKSVLDIGTGSGAIA--IALKKARPNWQVTASDISADALSLAYSNALDHHVEIAFEESDLFSKLSGQF---DIIVSNPPYIAYEDKDEVGLN-VYQSEPHLALFAAENGFAIYRRIIEQASAYLTTSGKLYFEIGYKQGEGLKRLLSKRFPQKRIRVLKDMLGKERMVVV 273
>gi|27468633|ref|NP_765270.1| protoporphyrinogen oxidase [Staphylococcus epidermidis ATCC 12228] >gi|57867592|ref|YP_189288.1| HemK family modification methylase [Staphylococcus epidermidis RP62A] >gi|27316180|gb|AAO05314.1|AE016749_260 protoporphyrinogen oxidase [Staphylococcus epidermidis ATCC 12228] >gi|57638250|gb|AAW55038.1| modification methylase, HemK family [Staphylococcus epidermidis RP62A] (278 aa)
Score = 224, Expect = 9.9e-17, Identities = 70/242 (28%), Positives = 123/242 (50%)
  Q:    47 NSSDIFFEKDTEIDFEYKKILKQLNKVLNKNI---PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPST--KCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQ----KEEIEKFLIKNNITVFKFLKDLDDKDRVLYI 288
           + +D    KD ++       + +L+K L++ I   P+QYI    SFYG  + + + C +PR ETE ++   ++  K  D   I D+ +GSG +A T+  ++   +  VI  +       V  +N  +     QF++ +  K    +  K D +I NPPYI  ++     ST    EP  ALFA +NG+  Y   L ++  ++  G  ++FEIG++Q    K  I+    +  + +F   KD++   R++ I
  S:    36 SKTDYLIHKDEQMSLTS---INKLDKALDRMITGEPIQYIVGFQSFYGYQYKVNQHCLIPRPETEEVMLHFLELCKKTDT--IADIGTGSGAIAITLKLLQPELN--VIATDLYEDALNVAKQNASHYHQNIQFLRGNALKPLIENDIKLDGLISNPPYIGHSEIIDMESTVLNYEPHHALFAEKNGFAIYESILEDLPFVMKQGGHVVFEIGYSQGDILKRMIQDLYPEKEVEIF---KDINGNQRIISI 276
>gi|160888033|ref|ZP_02069036.1| hypothetical protein BACUNI_00441 [Bacteroides uniformis ATCC 8492] >gi|156862532|gb|EDO55963.1| hypothetical protein BACUNI_00441 [Bacteroides uniformis ATCC 8492] (247 aa)
Score = 221, Expect = 2.2e-16, Identities = 65/235 (27%), Positives = 116/235 (49%)
  Q:    50 DIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKND-PNVDPST-KCEPKQALFAPQNGYYFYFRFLSEI-YPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDR 284
           D +  KD  +  + +K L+ +   L    P+QY+  +  F G +F +  G  +PR ETE +++  +++  +     ILD+ +GSG +A T+S  K+  +A V   + +     +   N R L+   QF++ D+     +  E  D I+ NPPY+ + +  +++P+    EP  ALF P +    ++R + E+   +L  G  + FEI     E +   L K   T  +  KD+   DR
  S:     8 DYYLGKDMILSPKDEKELESILFRLCNFEPIQYVQGTARFLGRTFRVAPGVLIPRPETEELVERMLEE--VAPASRILDIGTGSGCIAVTLS--KELPEAEVTAWDISGEALAIAGDNNRLLQTSVQFVQRDVLTYQPAEDEYFDVIVSNPPYVTETEKKDMEPNVLNWEPSGALFVPDSDPLRFYRRIGELGRSMLTVGGRLYFEINRAFGEAVASMLRKQGYTNVRIRKDISGNDR 241
>gi|77405502|ref|ZP_00782594.1| modification methylase, HemK family [Streptococcus agalactiae H36B] >gi|77175899|gb|EAO78676.1| modification methylase, HemK family [Streptococcus agalactiae H36B] (276 aa)
Score = 221, Expect = 2.3e-16, Identities = 72/242 (29%), Positives = 127/242 (52%)
  Q:    47 NSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKND-----PNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIK---NNITVFKFLKDLDDKDRVLYI 288
           +++D    +++ +    +++++ + + L K+   QYIT    F  L FF+ +   +PR ETE ++D  + + K+ D   +LD+ +GSG +A  IS  K+     V+  + + +   +  +N  N   +  FI+SD+F    +  +K D I+ NPPYI  ND      NV  S   EP  ALFA + G   Y + +      L    ++ FEIG+ Q +++   L +   NN    + LKD+  KDR++ +
  S:    35 STTDCLLNQNSSVSDTDQQLMENIFQQLKKHRSPQYITGKAYFRDLIFFVDERVLIPRPETEELVDLILSENKVEDCS-VLDIGTGSGAIA--ISLKKERPSWDVLASDISVSALDLAKENANNCDAEVTFIESDVFS---NISDKFDIIVSNPPYISYNDKDEVGKNVLAS---EPHSALFADEEGLAIYRKIIENSREYLQPRGKLYFEIGYKQGDDLRSLLKRYFPNNRC--RVLKDIFGKDRMVVL 273
>gi|116513792|ref|YP_812698.1| methylase of polypeptide chain release factor [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|116093107|gb|ABJ58260.1| Methylase of polypeptide chain release factor [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (273 aa)
Score = 221, Expect = 2.3e-16, Identities = 73/239 (30%), Positives = 122/239 (51%)
  Q:    49 SDIFFEKDTEI-DFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKN---KDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNV-DPSTKC-EPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFK--FLKDLDDKDRVLY 287
           S    ++D E+ D E K+  K + ++   + P QYI     F G    + KG  +PR ETE +++WA+    L +   +LDL +GSG +   ++   ++   KD      +   TP ++  +N  +  L     K+++         K D II NPPYI  ++ NV D      EP++ALF  Q+G  FY +F  E+   L +G     E GF++++E+ K +    +  FK  F +D+  K R+L+
  S:    30 SQFQLKQDMELSDAEVKQARKDMKRLAKGDSP-QYILGYAWFLGYRLRVAKGVLIPRFETEELVEWALAH--LQNGDTVLDLGTGSGNIMVALAKEAESRGIKDLHFYASDVKDTPLRISEENFLDYGLDVTTRKANVL----LGLGKFDLIISNPPYIKPSEKNVMDKGVLANEPEEALFGGQDGLAFYRKFAEEVRDHLNSGGRFFMEFGFSEEDEL-KAMFAEKLPDFKVEFRRDMAGKPRMLF 268
>gi|76786890|ref|YP_329783.1| HemK family modification methylase [Streptococcus agalactiae A909] >gi|77408686|ref|ZP_00785419.1| modification methylase, HemK family [Streptococcus agalactiae COH1] >gi|76561947|gb|ABA44531.1| modification methylase, HemK family [Streptococcus agalactiae A909] >gi|77172734|gb|EAO75870.1| modification methylase, HemK family [Streptococcus agalactiae COH1] (276 aa)
Score = 221, Expect = 2.4e-16, Identities = 72/242 (29%), Positives = 127/242 (52%)
  Q:    47 NSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKND-----PNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIK---NNITVFKFLKDLDDKDRVLYI 288
           +++D    +++ +    +++++ + + L K+   QYIT    F  L FF+ +   +PR ETE ++D  + + K+ D   +LD+ +GSG +A  IS  K+     V+  + + +   +  +N  N   +  FI+SD+F    +  +K D I+ NPPYI  ND      NV  S   EP  ALFA + G   Y + +      L    ++ FEIG+ Q +++   L +   NN    + LKD+  KDR++ +
  S:    35 STTDYLLNQNSSVSDTDQQLMENIFQQLKKHRSPQYITGKAYFRDLIFFVDERVLIPRPETEELVDLILSENKVEDCS-VLDIGTGSGAIA--ISLKKERPSWDVLASDISVSALDLAKENANNCDAEVTFIESDVFS---NISDKFDIIVSNPPYISYNDKDEVGKNVLAS---EPHSALFADEEGLAIYRKIIENSREYLQPRGKLYFEIGYKQGDDLRSLLKRYFPNNRC--RVLKDIFGKDRMVVL 273
>gi|21910336|ref|NP_664604.1| putative protoporphyrinogen oxidase [Streptococcus pyogenes MGAS315] >gi|28895911|ref|NP_802261.1| putative protoporphyrinogen oxidase [Streptococcus pyogenes SSI-1] >gi|21904532|gb|AAM79407.1| putative protoporphyrinogen oxidase [Streptococcus pyogenes MGAS315] >gi|28811161|dbj|BAC64094.1| putative protoporphyrinogen oxidase [Streptococcus pyogenes SSI-1] (279 aa)
Score = 220, Expect = 2.8e-16, Identities = 66/219 (30%), Positives = 113/219 (51%)
  Q:    47 NSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYI---DKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFL 265
           +S D+   ++  +  E   +L+ +   L++++  QYIT +  F  L   + K   +PR ETE ++D  + +  L     +LD+ +GSG +A  IS  K+  +  V   + +R    +   N    +L   FI+SD+F +    +   D I+ NPPYI   DK + +++   + EP  ALFA +NGY  Y + + +    LA   ++ FEIG+ Q E I+  L
  S:    35 SSLDMLIHQNQAVTPEDAVLLEHIFCSLSQHLSPQYITGNAYFRDLKLAVDKRVLIPRPETEELVDMILAEN-LDAPLNVLDIGTGSGAIA--ISLKKERSNWQVTASDISRAALDLAKANADAYQLDITFIESDVFSLISGTF---DIIVSNPPYISYEDKEEVSLN-VLQSEPHLALFAKENGYAIYRKIIEQADNYLAKEGKLYFEIGYKQAEGIKDML 249
>gi|171323818|ref|ZP_02912336.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Geobacillus sp. WCH70] >gi|171090129|gb|EDT36441.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Geobacillus sp. WCH70] (288 aa)
Score = 220, Expect = 2.8e-16, Identities = 63/218 (28%), Positives = 113/218 (51%)
  Q:    70 LNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQ-------KKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKND-PNVDPSTK-CEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITV-FKFLKDLDDKDRVLY 287
           + K + +++PVQ++     FYG  F + +   +PR ETE +++  + +        K ID   ++D+ +GSG +A T++   +NK   V  ++      +V  +N   L     FI  D+ +       K D ++ NPPYI +N+  ++ P  K  EP +AL   ++G  FY RF  E+  +L     + FE+G  Q E +   L +       + + D++ KDR++Y
  S:    61 VRKHVYEHVPVQHLIGLEQFYGRPFLVNRNVLIPRPETEELVEGVLTRITQLFPGNKTID---VVDVGTGSGAIAITLAL--ENKSLRVAAIDIAPEALEVAKRNAERLGADVAFICGDLLQPLVEASRKVDVVVSNPPYIPENEIASLSPVVKDYEPLRALSGGKDGLDFYRRFARELPFVLKERALVAFEVGAGQGEAVAAILRQTFPQAEVEVVFDINGKDRMVY 283
>gi|139473767|ref|YP_001128483.1| putative methyltransferase [Streptococcus pyogenes str. Manfredo] >gi|134272014|emb|CAM30253.1| putative methyltransferase [Streptococcus pyogenes str. Manfredo] (279 aa)
Score = 220, Expect = 2.9e-16, Identities = 66/219 (30%), Positives = 113/219 (51%)
  Q:    47 NSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYI---DKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFL 265
           +S D+   ++  +  E   +L+ +   L++++  QYIT +  F  L   + K   +PR ETE ++D  + +  L     +LD+ +GSG +A  IS  K+  +  V   + +RT   +   N    +L   FI+SD+F +    +   D I+ NPPYI   DK + +++   + EP  ALFA +NGY  Y + + +    L    ++ FEIG+ Q E I+  L
  S:    35 SSLDMLIHQNQAVTPEDAVLLEHIFCSLSQHLSPQYITGNAYFRDLKLAVDKRVLIPRPETEELVDMILAEN-LDAPLNVLDIGTGSGAIA--ISLKKERPNWQVTASDISRTALDLAKANADAYQLDITFIESDVFSLISGTF---DIIVSNPPYISYEDKEEVSLN-VLQSEPHLALFAKENGYAIYRKIIEQADNYLTKEGKLYFEIGYKQAEGIKDML 249
>gi|160893850|ref|ZP_02074633.1| hypothetical protein CLOL250_01404 [Clostridium sp. L2-50] >gi|156864502|gb|EDO57933.1| hypothetical protein CLOL250_01404 [Clostridium sp. L2-50] (292 aa)
Score = 220, Expect = 3.2e-16, Identities = 67/216 (31%), Positives = 114/216 (52%)
  Q:    75 NKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLI--DKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKT-QFIKSDIF-KIDRSHYEKCDFIICNPPYIDKN--DPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYIKK 290
           +K IP+QYIT    F G  F       +PR +TE +++ A +  + I  DK  +LD+C GSG +  +++ +  N+D  +   + + +   +  KN + L++     IKSD+F KID+ +    D I+ NPPYI+    D  +      EP+ AL    +G  FY   +      L     I+FEIG +Q  ++++ L+  +    + +KDL + DRV+  +K
  S:    76 SKRIPLQYITGIQCFMGYDFETAPDVLIPRFDTEVLVEQANRLIQDIHSDKMSVLDMCCGSGCIGLSVALM--NQDIHIDLCDISDSAIALTTKNAKRLEVSDYTVIKSDLFDKIDKRY----DMILSNPPYIESKVIDGLMPEVRDYEPRLALDGDADGLKFYRAIIENAESYLNEKGYILFEIGNHQAHDVQQLLVDKHFEDVRVVKDLAENDRVVIGRK 291
>gi|31544342|ref|NP_852920.1| hypothetical protein MGA_0864 [Mycoplasma gallisepticum R] >gi|31541186|gb|AAP56488.1| HemK [Mycoplasma gallisepticum R] (290 aa)
Score = 219, Expect = 3.9e-16, Identities = 75/227 (33%), Positives = 118/227 (51%)
  Q:    11 SSMTFSELTKRL-NPLDDSQIK--WILKELILFNSKIIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQET----EYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKN-DPNVDPSTKCEPKQALFAPQNGYYFY---FRFLS 237
           S MTF EL   L N     Q K  W    LI   S+ IEN +D+   ++ EIDF + + +K  N++     PV+YI       GL  F+ +   +PR +T    E  L+    +K +++   +LD+C+G+G++A TI   K+     V G + +++  K+   N  N  L  +F  +D  ++     E+ D +I NPPY+D+    N       EP  ALFA   G +FY   FR+L+
  S:     5 SFMTFHELINYLTNNYSKYQEKYSWSFFLLIKRYSEKIENKTDLITLRNEEIDFNFDQFIKDCNRIYKDEYPVEYIINQIEINGLKLFVDETVLIPRIDTNAVIEKFLEVINSRKDIVN---VLDICTGTGLIALTIK--KQFPKYQVFGSDISKSAVKIANFNAVNNLLDARFYVADYLEVFEQVSEEIDALIINPPYLDEELKSNYIKEINYEPFNALFAKNGGTFFYEEIFRYLT 237
>gi|22537234|ref|NP_688085.1| HemK family modification methylase [Streptococcus agalactiae 2603V/R] >gi|25011159|ref|NP_735554.1| modification methylase, HemK family [Streptococcus agalactiae NEM316] >gi|76798428|ref|ZP_00780668.1| HemK protein [Streptococcus agalactiae 18RS21] >gi|77410474|ref|ZP_00786835.1| modification methylase, HemK family [Streptococcus agalactiae CJB111] >gi|77413281|ref|ZP_00789477.1| modification methylase, HemK family [Streptococcus agalactiae 515] >gi|22534101|gb|AAM99957.1|AE014241_8 modification methylase, HemK family [Streptococcus agalactiae 2603V/R] >gi|23095558|emb|CAD46767.1| Unknown [Streptococcus agalactiae NEM316] >gi|76586223|gb|EAO62741.1| HemK protein [Streptococcus agalactiae 18RS21] >gi|77160668|gb|EAO71783.1| modification methylase, HemK family [Streptococcus agalactiae 515] >gi|77163422|gb|EAO74372.1| modification methylase, HemK family [Streptococcus agalactiae CJB111] (276 aa)
Score = 219, Expect = 3.9e-16, Identities = 72/242 (29%), Positives = 126/242 (52%)
  Q:    47 NSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKND-----PNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIK---NNITVFKFLKDLDDKDRVLYI 288
           +++D    +++ +    +++++ + + L K+   QYIT    F  L FF+ +   +PR ETE ++D  + + K+ D   +LD+ +GSG +A  IS  K+     V+  + + +   +  +N  N   +  FI+SD+F    +   K D I+ NPPYI  ND      NV  S   EP  ALFA + G   Y + +      L    ++ FEIG+ Q +++   L +   NN    + LKD+  KDR++ +
  S:    35 STTDYLLNQNSSVSDTDQQLMENIFQQLKKHRSPQYITGKAYFRDLIFFVDERVLIPRPETEELVDLILSENKVEDCS-VLDIGTGSGAIA--ISLKKERPSWDVLASDISVSALDLAKENANNCDAEVTFIESDVFS---NISGKFDIIVSNPPYISYNDKDEVGKNVLAS---EPHSALFADEEGLAIYRKIIENSREYLQPRGKLYFEIGYKQGDDLRSLLKRYFPNNRC--RVLKDIFGKDRMVVL 273
>gi|149192360|ref|ZP_01870563.1| HemK protein [Vibrio shilonii AK1] >gi|148833799|gb|EDL50833.1| HemK protein [Vibrio shilonii AK1] (284 aa)
Score = 219, Expect = 3.9e-16, Identities = 66/218 (30%), Positives = 107/218 (49%)
  Q:    68 KQLNKVLNKNI---PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKT-QFIKSDIFK-IDRSHYEKCDFIICNPPYIDKNDPNVDP-STKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           +Q   +LN+ I   PV YI     F+ L   +     +PR +TE +++ A+  K L++   ILDL +G+G +A  ++   K +   V+GV+      ++   N   L +   QF +   F+ +D  H  K   I+ NPPYID+NDP++     + EP  AL A  NG        ++    L  G  ++FE GF Q + + + L+ N        +D    DRV
  S:    59 EQFEALLNRRIAGEPVAYILGEREFWSLPLNVAPSTLIPRPDTERLVELAL-DKALVNDGDILDLGTGTGAIALALASELKTRS--VMGVDFQTEAVELARSNATKLNITNCQFAQGSWFEPVDLVH--KFSVIVSNPPYIDENDPHLSQGDVRFEPSTALVAENNGLADIETITAKAPTHLLEGGWLLFEHGFEQGQAVREILVNNGFCHVVTEQDYAGNDRV 277
>gi|30249864|ref|NP_841934.1| hemK_fam: modification methylase [Nitrosomonas europaea ATCC 19718] >gi|30180901|emb|CAD85823.1| hemK_fam: modification methylase [Nitrosomonas europaea ATCC 19718] (289 aa)
Score = 219, Expect = 4.4e-16, Identities = 76/275 (27%), Positives = 128/275 (46%)
  Q:    11 SSMTFSELTKRL-NPLDDSQIKWILKELILFNSKIIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNI---PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLK-TQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPST-KCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           +S+T  EL +R  N +D    +WIL+ ++  ++  +   ++     D    F          ++L + I   PV Y+T    FY L F +     +PR ETE +++ A+ +     K  +LDL +GSG +A T++  +      V  V+ +     V  +N R   +K   FI++D F    S  EK D I+ NPPY+   DP+++    + EP  AL A  NG       +++    L     ++ E G++Q +   + L K   T      D+   DRV
  S:    16 ASVTIGELLQRAANVVDRVDARWILQSVLNTDAAFLIAHAEQLLSTDQVAHFR---------QMLARRIAGEPVAYLTGERGFYDLVFEVTPDVLIPRPETELLVEMALSKIPSDRKCNVLDLGTGSGAIAITLA--RHRASTCVTAVDFSPGAMAVARRNARMHAVKNVVFIEADWFSSFTS--EKFDVIVANPPYVAAGDPHLEEGDLRFEPLTALVAQDNGLDCIRTIIAQAPGYLEPSGWLMLEHGYDQADVCRELLAKAGFTHLFTRPDIAGTDRV 283
>gi|157363844|ref|YP_001470611.1| HemK family modification methylase [Thermotoga lettingae TMO] >gi|157314448|gb|ABV33547.1| modification methylase, HemK family [Thermotoga lettingae TMO] (272 aa)
Score = 218, Expect = 4.6e-16, Identities = 76/266 (28%), Positives = 122/266 (45%)
  Q:    13 MTFSELTKRLNPLDDSQIKWILKELILFNSKIIENSSD-IFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKD 278
           MTF +L   +  + +S       E +L  SK+   + + I    + E+ +   +   +L +     IP+QYIT    FYGL   +++G F+PR ETE ++D A+          +LD+ +GSG +A  I+    N +  V   + ++      +KN  +   K +F +       +    +   I+ NPPYI  +   +      EP +ALFA  +G  FY +  SE  P L     +I E   +QKEEI+K  I N      F KD
  S:     1 MTFRQLYILMKNMLESASDSPATEALLLLSKVGNMTKEQILLLFEDEVPYSISEKAFKLAESRASGIPLQYITGKCYFYGLELSVEEGVFIPRVETEVLVDIALDIIGKNKLSTVLDIGTGSGAIALAIAL---NTNCKVYASDISKKALLTAMKNAADYAAKIEFFRGAFLTPVKHIINEIQLIVSNPPYIPVSS-KLPKDVMHEPHEALFAGNDGLDFYRQIFSE--PDLLKNKILIMEFSPDQKEEIQK--ICNYFGKISFFKD 259
>gi|138896953|ref|YP_001127406.1| HemK family modification methylase [Geobacillus thermodenitrificans NG80-2] >gi|196249771|ref|ZP_03148467.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Geobacillus sp. G11MC16] >gi|134268466|gb|ABO68661.1| Modification methylase, HemK family [Geobacillus thermodenitrificans NG80-2] >gi|196210647|gb|EDY05410.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Geobacillus sp. G11MC16] (288 aa)
Score = 218, Expect = 5.6e-16, Identities = 60/228 (26%), Positives = 113/228 (49%)
  Q:    63 YKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQ-------KKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKND-PNVDPSTK-CEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITV-FKFLKDLDDKDRVLYIKK 290
           Y++    + +    ++P+QY+     FYG  F + +   +PR ETE ++   +++       ++ ID   ++D+ +GSG +A T++   +N+   V   + +     V  +N   L  +  F++ D+ +      +  D ++ NPPYI + D   + P  K  EP  ALF  ++G  FY RF  ++  +L       FE+G  Q E +   L         +   DL+ KDR++Y+ +
  S:    54 YERFAADVRRHAVDHVPIQYLIGHEWFYGRRFLVNRHVLIPRPETEELVLGVLERLPRLFEGRERID---VVDVGTGSGAIAVTLAL--ENRTLSVTATDISEEALTVARENAERLGARISFLRGDLLQPLIEQGQTVDVVVSNPPYIPETDAATLSPVVKDYEPHTALFGGRDGLDFYRRFARDLPLVLGTPALAAFEVGAGQGEAVASLLAAAFPEAEIEVAFDLNGKDRMVYMTR 286
>gi|50914206|ref|YP_060178.1| peptide release factor-glutamine N5-methyltransferase [Streptococcus pyogenes MGAS10394] >gi|50903280|gb|AAT86995.1| Peptide release factor-glutamine N5-methyltransferase [Streptococcus pyogenes MGAS10394] (279 aa)
Score = 217, Expect = 7.1e-16, Identities = 69/224 (30%), Positives = 116/224 (51%)
  Q:    42 SKIIENSS-DIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYI---DKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFL 265
           S+I E SS D+   ++  +  E   +L+ +   L++++  QYIT +  F  L   + K   +PR ETE ++D  + +  L     +LD+ +GSG +A  IS  K+  +  V   + +R    +   N    +L   FI+SD+F +    +   D I+ NPPYI   DK + +++   + EP  ALFA +NGY  Y + + +    L    ++ FEIG+ Q E I+  L
  S:    29 SEIKEWSSLDMLIHQNQAVTPEDAVLLEHIFCSLSQHLSPQYITGNAYFRDLKLAVDKRVLIPRPETEELVDMILAEN-LDAPLNVLDIGTGSGAIA--ISLKKERPNWQVTASDISRAALDLAKANADAYQLDITFIESDVFSLISGTF---DIIVSNPPYISYEDKEEVSLN-VLQSEPHLALFAKENGYAIYRKIIEQADNYLTKEGKLYFEIGYKQAEGIKDML 249
>gi|157962942|ref|YP_001502976.1| HemK family modification methylase [Shewanella pealeana ATCC 700345] >gi|157847942|gb|ABV88441.1| modification methylase, HemK family [Shewanella pealeana ATCC 700345] (280 aa)
Score = 217, Expect = 7.2e-16, Identities = 66/224 (29%), Positives = 114/224 (50%)
  Q:    61 FEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKC-DF--IICNPPYIDKNDPNVDP-STKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDR 284
           FE+K++L    K L  N P+ +I     F+ L F +     +PR +TE +++ A+    L +   +LDL +G+G +A ++++  +  +  V  ++K      +  +N+ NLKL+    + D+F+ D     +C DF  I+ NPPYID+ D ++     + EP  AL APQ G+   F         LA G  ++ E G+ Q  E+ + LI+        ++D    DR
  S:    56 FEFKQMLA---KRLRGN-PIAHIVGEREFWSLPFRVNPTTLIPRPDTEILVETALNLP-LAESAKVLDLGTGTGAIALSLAH--ERSEWQVCAIDKVDDAVALAKENRTNLKLE----QVDVFQSDWFDAVECYDFNLIVSNPPYIDEEDEHLSQGDVRFEPASALTAPQRGFADLFYIAESARDYLAPGGYLLLEHGYQQAIELREKLIELGYENVATVRDFGSNDR 272
>gi|50365448|ref|YP_053873.1| polypeptide chain release factor methylase [Mesoplasma florum L1] >gi|50364004|gb|AAT75989.1| polypeptide chain release factor methylase [Mesoplasma florum L1] (300 aa)
Score = 216, Expect = 8.1e-16, Identities = 85/255 (33%), Positives = 137/255 (53%)
  Q:    36 ELILFNSKIIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKY-ILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLK--TQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPST-KCEPKQALFAPQNGYYFYFRFLSEI--YPILANGTEIIFEIGFNQKEEIEKFLIKNNITV---FKFLKDLDDKDRVLYIKK 290
           E+I F +KI    S++ F ++  ++ +  K + +++K L K  P+ YI     F      + K   +PR ETE ++D+  +     ++K  +LDLC GSG +  +I+   K+K   V   + ++    +  KN  N  L   T+ +KSD          K + ++CNPPYID ND +VD  T K EPK ALFA  NG +FY   +  I  +  +     I+FEIG+ Q++E++ FL K  + +   +KF KD  +  R L + K
  S:    40 EIISFITKI--EYSEVLFSQEKVLNKKQFKKIIKISKKLAKGKPLAYILGYKIFRTHKILVNKNTLIPRMETELIVDYVNEFINSQNEKISVLDLCCGSGCIGISIAIENKDKMENVTFSDISKKALNITSKNIENNNLVNWTKVVKSDFLNSIIKQQNKFNILVCNPPYIDFNDVDVDKMTKKYEPKLALFAKDNGLFFYKEAIKNIDKFMDITKNILIVFEIGWKQEKELDVFL-KQELGLKYKWKFEKDYFNNLRYLILTK 300
>gi|163867490|ref|YP_001608689.1| methylase [Bartonella tribocorum CIP 105476] >gi|161017136|emb|CAK00694.1| Methylase [Bartonella tribocorum CIP 105476] (288 aa)
Score = 216, Expect = 8.2e-16, Identities = 68/220 (30%), Positives = 112/220 (50%)
  Q:    67 LKQLNKVLNKNI---PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAV----KQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQF--IKSDIFKIDRSHYEKCDFIICNPPYIDKNDPN--VDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVL 286
           ++Q+ + + + I   PV  I  +  FYG+SF + +    PR +TE ++D  +    KQ K   K   LD+ +GSG +A  I+ +K+   +  + V+ +    K   KN +N  +  +F  + SD F    S  ++ DFI+ NPPYI + D N         +P +AL   ++G  FY +   E    L     I  EIG++Q++E+     KN     +  KDL+   R L
  S:    57 IRQIEQAIKRRIAGEPVYRIIGAREFYGISFALSQETLEPRPDTETLIDLVLPFLKKQVKNSKKTTFLDMGTGSGAIA--IAILKQIPQSYAVAVDISEDALKTATKNAKNADVIHRFTPLLSDWFD---SVTDRFDFIVSNPPYIPEKDINKLAKEVRLHDPLRALIGGKDGLDFYRKLAHEAANYLKENGTIAVEIGYSQEKEVCDLFKKNGFQCLEMRKDLNGIPRAL 282
>gi|15675119|ref|NP_269293.1| putative protoporphyrinogen oxidase [Streptococcus pyogenes M1 GAS] >gi|71910677|ref|YP_282227.1| peptide release factor-glutamine N5-methyltransferase [Streptococcus pyogenes MGAS5005] >gi|13622278|gb|AAK34014.1| putative protoporphyrinogen oxidase [Streptococcus pyogenes M1 GAS] >gi|71853459|gb|AAZ51482.1| peptide release factor-glutamine N5-methyltransferase [Streptococcus pyogenes MGAS5005] (279 aa)
Score = 215, Expect = 9.8e-16, Identities = 66/219 (30%), Positives = 112/219 (51%)
  Q:    47 NSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYI---DKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFL 265
           +S D+   ++  +  E   +L+ +   L++++  QYIT +  F  L   + K   +PR ETE ++D  + +  L     +LD+ +GSG +A  IS  K+  +  V   + +R    +   N    +L   FI+SD+F +     E  D I+ NPPYI   DK + +++   + EP  ALFA +NGY  Y + + +    L    ++ FEIG+ Q E I+  L
  S:    35 SSLDMLIHQNQAVTPEDAVLLEHIFCSLSQHLSPQYITGNAYFRDLKLAVDKRVLIPRPETEELVDMILAEN-LDAPLNVLDIGTGSGAIA--ISLKKERPNWQVTASDISRAALDLAKANADAYQLDITFIESDVFSLIS---ETFDIIVSNPPYISYEDKEEVSLN-VLQSEPHLALFAKENGYAIYRKIIEQADNYLTKEGKLYFEIGYKQAEGIKDML 249
>gi|160940108|ref|ZP_02087453.1| hypothetical protein CLOBOL_04997 [Clostridium bolteae ATCC BAA-613] >gi|158436688|gb|EDP14455.1| hypothetical protein CLOBOL_04997 [Clostridium bolteae ATCC BAA-613] (285 aa)
Score = 215, Expect = 1.0e-15, Identities = 62/236 (26%), Positives = 121/236 (51%)
  Q:    55 KDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNL----KLKTQFIKSDIF---KIDRSHYEKCDFIICNPPYI-DKNDPNVDPSTK-CEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYIKK 290
           KD E + + ++ ++ +     +  P+Q++T +  F G  F + +   +PRQ+TE +++  ++++   +K+ +LD+C+GSG +A +++ + + +    + V       KV   N+  L    +   +  +S++F   + DR+     D I+ NPPYI  +    + P  +  EP+ AL    +G  FY     E    LA G  I  EIG++Q E +E           +  +DL  +DRV+  ++
  S:    49 KDEETEGKCREFMRLIEARAGRT-PLQHLTGTQEFMGFEFLVNEHVLIPRQDTETLVELVLEEQNDREKR-VLDMCTGSGCIAISLALMGRYRHVAALDVSAE--ALKVAAGNRDRLLGGYEGGFELFESNMFSALETDRTF----DVIVSNPPYIPSRVIEGLAPEVRDHEPRIALDGSDDGLTFYRILAEEARNHLAEGGSIYMEIGYDQSEAVEGLFRSGGYRDVRTFQDLAGQDRVVRARR 285
>gi|15616336|ref|NP_244641.1| protoporphyrinogen oxidase [Bacillus halodurans C-125] >gi|10176398|dbj|BAB07493.1| protoporphyrinogen oxidase [Bacillus halodurans C-125] (289 aa)
Score = 215, Expect = 1.0e-15, Identities = 72/229 (31%), Positives = 115/229 (50%)
  Q:    58 EIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKK----YILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPSTKC------EPKQALFAPQNGYYFYFRFLSEIYPILANGTE--IIFEIGFNQKEEIEKFL-IKNNITVFKFLKDLDDKDRVL 286
           E+D E  + L++        +PVQ++    SFYG  F + +   +PR ETE ++   +K+ +   KK     ILD+ +GSG +A T++  ++  +  V  V+ +R   +V   N R L    Q I  D+ +      E+ D I+ NPPYI    P V+  T        EP  ALF   +G   Y R +S++ P L    +  +  EIG  Q  ++EK +           L DL+ KDR++
  S:    46 ELDGELFQRLEEDLAAHASGVPVQHLIGVESFYGRQFQVDQHVLIPRPETEELVLAVLKEIRRQFKKEEEITILDIGTGSGAIAVTLALEEERTN--VTAVDISRDALQVAADNARRLGANVQLIHGDLGEPFLKTGERFDVIVSNPPYI----PTVEKDTLAVHVRDHEPALALFGGVDGLDVYRRLMSQL-PALTKEEKGMVALEIGAGQGMDVEKLMQTAYPKAAVDVLYDLNGKDRIV 280
>gi|149197696|ref|ZP_01874746.1| Methyltransferase [Lentisphaera araneosa HTCC2155] >gi|149139266|gb|EDM27669.1| Methyltransferase [Lentisphaera araneosa HTCC2155] (282 aa)
Score = 215, Expect = 1.0e-15, Identities = 74/241 (30%), Positives = 120/241 (49%)
  Q:    50 DIFFEKDTEI-DFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIV-IGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIF-KIDRSHYEKCDFIICNPPYIDKND-PNVDPST-KCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYIKK 290
           D++ + D  + + E   I ++L +   ++ PVQYI  S +FYGL   +  G  +PR ETE ++D A K  K  + + +LDLC+GSG +   I   KK   +IV   +E+    Y      Q N     + ++ D+F KI  ++  K D I  NPPY+ +++ P +     K EP  ALFA  +G     R   E    +     I+ EIG +Q     +    +N    + +KD   +DR+L  ++
  S:    41 DLYLQHDRPLSESELSSIREKLQRCA-RHEPVQYICGSTNFYGLEISVGPGVLIPRPETECLVDLATKHIK--EGQKLLDLCTGSGCIPIAIQEQKKQSLSIVACDIEEKALNYAQENITQ-NKTQNIELLQCDLFAKI--ANDIKFDLITSNPPYVSESERPEMGKDVLKHEPPSALFADHDGMAIIERIAQEAPQYMEPKAYILIEIGASQGSRCLELFEASNYRNVEVVKDYSSRDRILKAQR 280
>gi|119945324|ref|YP_943004.1| modification methylase, HemK family protein [Psychromonas ingrahamii 37] >gi|119863928|gb|ABM03405.1| modification methylase, HemK family protein [Psychromonas ingrahamii 37] (279 aa)
Score = 215, Expect = 1.0e-15, Identities = 60/210 (28%), Positives = 104/210 (49%)
  Q:    76 KNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKT-QFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVD-PSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           K +PV ++T +  F+ L   +     +PR +TE +++ A+       +  ILDL +GSG +   ++   +  DA  +GV+ N +  ++ ++N +NLKL    F +S+ F      +   D ++ NPPYI+KND ++     + EP  AL A +NG     +   +    L  G  ++ E GFNQ   + +       +    +KD  D DRV
  S:    64 KGVPVAHLTGAREFWSLPLKVNNSTLIPRPDTELLVEAALDYCSADAR--ILDLGTGSGAI--ILALASELPDAYCLGVDVNESAVQLAIENGKNLKLNNVHFQQSNWFDNINGLF---DVVVSNPPYIEKNDHHLKLGDVRFEPLSALVADENGLADIRKIAQKTPEYLKKGGYLLVEHGFNQGSTVRELFTDLGYSEVITIKDYGDNDRV 268
>gi|169351466|ref|ZP_02868404.1| hypothetical protein CLOSPI_02246 [Clostridium spiroforme DSM 1552] >gi|169291688|gb|EDS73821.1| hypothetical protein CLOSPI_02246 [Clostridium spiroforme DSM 1552] (285 aa)
Score = 215, Expect = 1.0e-15, Identities = 76/277 (27%), Positives = 130/277 (46%)
  Q:    14 TFSELTKRLNPLDDSQIKWILKELILFNSKIIENSSDIFFEKDTEIDFEY-KKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKY----ILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNIT-VFKFLKDLDDKDRVLYIKK 290
           T  EL K+     D   K +    +LF     +   +++   D E+D E  K+ L  + +  N   P+QYI    +F+G  F + +   +PR ETE +++  + +       Y    + D+ +GSG +A  IS   +     V   + +     V  +N  NLK   +F+  D+ +       K D  + NPPYI +           EP  ALF   +G YFY +    +  +L     + FE+GF+Q+E +E+ L K      ++ +KD++ KDR+L+I +
  S:     3 TVKELIKQAESRLDDSNKDVNAAKVLFYHLANKEPHELYLMYDEEVDKELEKQFLMGMEEYYNGR-PIQYIKGVETFFGRDFKVNENVLIPRYETEELVENILYRIDDYFSGYKNITLCDVGTGSGAIA--ISLALEEPKLKVYATDISDLALTVAKENANNLKADVEFLVGDMLQPLIEKNLKVDIFVSNPPYIPQEQEIEAVVKDNEPHVALFGGNDGLYFYRKIFERVNELLNERALLAFEMGFDQRELMEEALQKYFPNDPYEIIKDINGKDRMLFIYR 282
>gi|94988611|ref|YP_596712.1| peptide release factor-glutamine N5-methyltransferase [Streptococcus pyogenes MGAS9429] >gi|94990487|ref|YP_598587.1| peptide release factor-glutamine N5-methyltransferase [Streptococcus pyogenes MGAS10270] >gi|94992435|ref|YP_600534.1| peptide release factor-glutamine N5-methyltransferase [Streptococcus pyogenes MGAS2096] >gi|94994409|ref|YP_602507.1| Peptide release factor-glutamine N5-methyltransferase [Streptococcus pyogenes MGAS10750] >gi|94542119|gb|ABF32168.1| peptide release factor-glutamine N5-methyltransferase [Streptococcus pyogenes MGAS9429] >gi|94543995|gb|ABF34043.1| Peptide release factor-glutamine N5-methyltransferase [Streptococcus pyogenes MGAS10270] >gi|94545943|gb|ABF35990.1| Peptide release factor-glutamine N5-methyltransferase [Streptococcus pyogenes MGAS2096] >gi|94547917|gb|ABF37963.1| Peptide release factor-glutamine N5-methyltransferase [Streptococcus pyogenes MGAS10750] (279 aa)
Score = 215, Expect = 1.0e-15, Identities = 65/219 (29%), Positives = 112/219 (51%)
  Q:    47 NSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYI---DKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFL 265
           +S D+   ++  +  E   +L+ +   L++++  QYIT +  F  L   + K   +PR ETE ++D  + +  L     +LD+ +GSG +A  IS  K+  +  V   + +R    +   N    +L   FI+SD+F +    +   D I+ NPPYI   DK + +++   + EP  ALFA +NGY  Y + + +    L    ++ FEIG+ Q E I+  L
  S:    35 SSLDMLIHQNQAVTPEDAVLLEHIFCSLSQHLSPQYITGNAYFRDLKLAVDKRVLIPRPETEELVDMILAEN-LDAPLNVLDIGTGSGAIA--ISLKKERPNWQVTASDISRAALDLAKANADAYQLDITFIESDVFSLISGTF---DIIVSNPPYISYEDKEEVSLN-VLQSEPHLALFAKENGYAIYRKIIEQADNYLTKEGKLYFEIGYKQAEGIKDML 249
>gi|71903503|ref|YP_280306.1| peptide release factor-glutamine N5-methyltransferase [Streptococcus pyogenes MGAS6180] >gi|71802598|gb|AAX71951.1| peptide release factor-glutamine N5-methyltransferase [Streptococcus pyogenes MGAS6180] (279 aa)
Score = 215, Expect = 1.1e-15, Identities = 65/219 (29%), Positives = 112/219 (51%)
  Q:    47 NSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYI---DKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFL 265
           +S D+   ++  +  E   +L+ +   L++++  QYIT +  F  L   + K   +PR ETE ++D  + +  L     +LD+ +GSG +A  IS  K+  +  V   + +R    +   N    +L   FI+SD+F +    +   D I+ NPPYI   DK + +++   + EP  ALFA +NGY  Y + + +    L    ++ FEIG+ Q E I+  L
  S:    35 SSLDMLIHQNQAVTPEDAVLLEHIFCSLSQHLSPQYITGNAYFRDLKLAVDKRVLIPRPETEELVDMILAEN-LDAPLNVLDIGTGSGAIA--ISLKKERPNWQVTASDISRAALDLAKANADAYQLDITFIESDVFSLISGTF---DIIVSNPPYISYEDKEEVSLN-VLQSEPHLALFAKENGYAIYRKIIEQADNYLTKEGKLYFEIGYKQAEGIKDML 249
>gi|114773557|ref|ZP_01450655.1| peptide release factor-glutamine N5-methyltransferase [alpha proteobacterium HTCC2255] (286 aa)
Score = 215, Expect = 1.1e-15, Identities = 64/207 (30%), Positives = 102/207 (49%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQ--FIKSDIFKIDRSHYE-KCDFIICNPPYIDKNDPNVDP-STKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           P+ YI    +FYG  F +     +PR ETE  +D  + +  +   K +LDL +G+G +A  +S I +  +  V+GV+       +  +N +NL  K+   F +SD F    SH + + D I+ NPPY++ + P +     + EP  AL A +NG     R +SE    L     +I E G  Q  EI + + +N  T    L D   + R+
  S:    73 PIAYILGYQNFYGYDFAVSPVTLIPRPETEQCVDLVIAKPYI---KRVLDLGTGTGAIA--LSIILQRPELEVLGVDFVPEAVMLAQQNAQNLAPKSNISFKQSDWF----SHVDGRFDVIVSNPPYVEPDSPYLAKGDIRFEPNSALTAAENGLADIIRIVSEAKHYLNENGLVILEHGHTQGTEIRQLMTQNGFTNVTTLCDYAGQHRI 274
>gi|56808655|ref|ZP_00366380.1| COG2890: Methylase of polypeptide chain release factors [Streptococcus pyogenes M49 591] (279 aa)
Score = 215, Expect = 1.2e-15, Identities = 65/219 (29%), Positives = 112/219 (51%)
  Q:    47 NSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYI---DKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFL 265
           +S D+   ++  +  E   +L+ +   L++++  QYIT +  F  L   + K   +PR ETE ++D  + +  L     +LD+ +GSG +A  IS  K+  +  V   + +R    +   N    +L   FI+SD+F +    +   D I+ NPPYI   DK + +++   + EP  ALFA +NGY  Y + + +    L    ++ FEIG+ Q E I+  L
  S:    35 SSLDMLIHQNQAVTPEDAVLLEHIFCSLSQHLSPQYITGNAYFRDLKLAVDKRVLIPRPETEELVDMILAEN-LDAPLNVLDIGTGSGAIA--ISLKKERPNWQVTASDISRAALDLAKANADAYQLDITFIESDVFSLISGTF---DIIVSNPPYISYEDKEEVSLN-VLQSEPHLALFAKENGYAIYRKIIEQADNYLTKEGKLYFEIGYKQPEGIKDML 249
>gi|167575387|ref|ZP_02368261.1| HemK family methylase, putative [Borrelia valaisiana VS116] (273 aa)
Score = 215, Expect = 1.2e-15, Identities = 72/227 (31%), Positives = 116/227 (51%)
  Q:    62 EYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLK--TQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPSTKCEPKQALFA-PQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYI 288
           E K    Q++++  K  P+ YI +   F G+ F + K   +PR +TE +++ A+ Q +  D K ILDLC GSG +  +I+Y  K K   VI  + +    ++  KN + LKL+   + I S++ K  +    K D II NPPY++K +  +    K EP +AL    ++G     + LS+    L     II E    Q + ++ F IK   T  K + DL+ + R L +
  S:    47 EKKLFFDQIDRI-EKGTPIHYILQKKEFMGIEFSLNKHVLIPRFDTECLVEEALIQIQQNDFKKILDLCCGSGCIGLSIAYCTKKK---VILSDISIKALQIASKNTKKLKLEKFVEIIHSNLLKCIKV---KLDIIITNPPYLNKEELEIKNKIKKEPTKALLGFGKDGLNISRKILSQAKEKLNPNGLIIIESAPWQMKSLKNFAIKKGFTHLKTIYDLEKRARALVL 269
>gi|152979100|ref|YP_001344729.1| HemK family modification methylase [Actinobacillus succinogenes 130Z] >gi|150840823|gb|ABR74794.1| modification methylase, HemK family [Actinobacillus succinogenes 130Z] (286 aa)
Score = 215, Expect = 1.2e-15, Identities = 71/252 (28%), Positives = 123/252 (48%)
  Q:    38 ILFNSKIIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNI---PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTIS--YIKKNKDAIVIGVEKNRTPYKVGVKN-QRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDP-STKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYIK 289
           +L  S   +  S I    DT +D   +K L+ L  +LN+     PV YI     F+ LS  +     +PR +TE +++ A+++  L D   +LDL +G+G +A +++    K+ +   V+GV+       +  +N +RN     +F +S  F    + +E  D ++ NPPYID +D ++     + EP  AL A + GY      + +    L     ++ E G+ Q E++  F  +N       +KD  D +RV   K
  S:    32 LLLQSVTQKTKSQIIAFSDTVLD---EKTLQNLTALLNRRATGEPVAYILGETEFWTLSLKVSPHTLIPRPDTEILVERALERIPLKDGVSVLDLGTGTGAIALSLAKELKKRGQKYWVLGVDLMPEAVVLAQRNAERNQLDDVEFRRSSWFN---NIHETFDLVVSNPPYIDADDAHLTQGDVRFEPLSALIAEEQGYADLRHIIEQTPRYLNPQGWLLLEHGWRQGEKVRSFFDENLWEKVATVKDYGDNERVTLAK 284
>gi|184154904|ref|YP_001843244.1| protoporphyrinogen oxidase [Lactobacillus fermentum IFO 3956] >gi|183226248|dbj|BAG26764.1| protoporphyrinogen oxidase [Lactobacillus fermentum IFO 3956] (283 aa)
Score = 215, Expect = 1.2e-15, Identities = 56/187 (29%), Positives = 95/187 (50%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPY-----IDKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFL 265
           P QY+     F+G  F + +   +P  ETE +++W +       +  +LDL +GSGV+  T++ +++ K  + +  + +    K+ + NQR        ++SD+F   R   ++ + I+ NPPY     ID+ DP V    + EP  ALFA +NG  FY R  +     L     +  E G  Q+E I++ L
  S:    71 PAQYVVGKAPFFGRKFVVNRDVLIPETETEELVEWVLDSMPADKELKVLDLGTGSGVIGITLA-LERPKWQVTLS-DISAAALKIALTNQRLHGTNLNQVESDLFA--RLGDQRFNLIVTNPPYVALSEIDEMDPEV---LEYEPPLALFASENGLAFYRRLFAAAGEHLTPRGVLFGETGHRQEERIQRLL 255
>gi|33241450|ref|NP_876391.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Chlamydophila pneumoniae TW-183] >gi|33235958|gb|AAP98048.1| protoporphyrinogen oxidase [Chlamydophila pneumoniae TW-183] (296 aa)
Score = 214, Expect = 1.3e-15, Identities = 74/266 (27%), Positives = 128/266 (48%)
  Q:    24 PLDDSQIKWILKELILFNSKIIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETE----YMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDP-NVDPSTKC-EPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYIK 289
           PL D +  +IL +L+  +S+      D+    +T +  EY+K L     +  +  P  Y+  + SF GL   +     +PR ETE    Y++++ +   ++   +   D+C GSG L   I   KK+   + + V  +  P  V V N+ N K     +K  +  +   +    D  +CNPPY+  N+  ++DP  +C EP +AL     G  FY R   E+  I+ +      EIG +Q E I+    K+ I   +  +DL  +DR+ +++
  S:    28 PLSDCEALYILMDLLEVSSR--AKLFDLVGISETML-MEYRKRLA----LRGQRCPTAYLNGAVSFLGLRLRVDSRVLIPRTETELLAEYIINYLLSHSEI---QTFYDICCGSGCLGLAI---KKSCPHVEV-VLSDVCPQAVAVANE-NAKSNGLDVKILLGDLSAPYTRPADAFVCNPPYLSFNEIIHIDPEVRCYEPWKALVGGSTGLEFYQRIAQELPKIVTSTGVGWLEIGSSQGESIKNIFSKHGI-YGRLHQDLSGRDRIFFLE 283
>gi|15618038|ref|NP_224322.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Chlamydophila pneumoniae CWL029] >gi|15835650|ref|NP_300174.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Chlamydophila pneumoniae J138] >gi|16752930|ref|NP_445201.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Chlamydophila pneumoniae AR39] >gi|4376377|gb|AAD18267.1| A/G specific methylase [Chlamydophila pneumoniae CWL029] >gi|8163474|gb|AAF73693.1| modification methylase, HemK family [Chlamydophila pneumoniae AR39] >gi|8978488|dbj|BAA98325.1| A/G specific methylase [Chlamydophila pneumoniae J138] (288 aa)
Score = 214, Expect = 1.3e-15, Identities = 74/266 (27%), Positives = 128/266 (48%)
  Q:    24 PLDDSQIKWILKELILFNSKIIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETE----YMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDP-NVDPSTKC-EPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYIK 289
           PL D +  +IL +L+  +S+      D+    +T +  EY+K L     +  +  P  Y+  + SF GL   +     +PR ETE    Y++++ +   ++   +   D+C GSG L   I   KK+   + + V  +  P  V V N+ N K     +K  +  +   +    D  +CNPPY+  N+  ++DP  +C EP +AL     G  FY R   E+  I+ +      EIG +Q E I+    K+ I   +  +DL  +DR+ +++
  S:    20 PLSDCEALYILMDLLEVSSR--AKLFDLVGISETML-MEYRKRLA----LRGQRCPTAYLNGAVSFLGLRLRVDSRVLIPRTETELLAEYIINYLLSHSEI---QTFYDICCGSGCLGLAI---KKSCPHVEV-VLSDVCPQAVAVANE-NAKSNGLDVKILLGDLSAPYTRPADAFVCNPPYLSFNEIIHIDPEVRCYEPWKALVGGSTGLEFYQRIAQELPKIVTSTGVGWLEIGSSQGESIKNIFSKHGI-YGRLHQDLSGRDRIFFLE 275
>gi|56421912|ref|YP_149230.1| protoporphyrinogen oxidase [Geobacillus kaustophilus HTA426] >gi|56381754|dbj|BAD77662.1| protoporphyrinogen oxidase [Geobacillus kaustophilus HTA426] (293 aa)
Score = 214, Expect = 1.4e-15, Identities = 68/228 (29%), Positives = 116/228 (50%)
  Q:    63 YKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQ-------KKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPN-VDPSTK-CEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLI----KNNITVFKFLKDLDDKDRVLYIKK 290
           Y++    + +    ++P+QY+    SFYG  F + +   +PR ETE ++   +K+       +K ID   ++D+ +GSG +A T++   +NK   V   + +     V  +N R L     F+  D+ +   +     D ++ NPPYI + D   + P  K  EP  ALF  ++G  FY RF  E+  +L       FE+G  Q E +   L     +  + V  F  DL+ KDR++Y+ +
  S:    54 YERFAADVRRHAVDHVPIQYLIGYESFYGRLFLVNRHVLIPRPETEELVLGVLKRVPRLFAGRKRID---VVDVGTGSGAIAVTLAL--ENKALSVTATDISEAALAVARENARRLGANVSFLCGDLLQPIMAMGWTVDVVVSNPPYIPETDAAMLSPVVKNYEPHTALFGGRDGLDFYRRFARELPLVLGAPALAAFEVGAGQGEAVAALLAAAFPEAEVEV-DF--DLNGKDRMVYMTR 286
>gi|53804791|ref|YP_113525.1| protein methyltransferase HemK [Methylococcus capsulatus str. Bath] >gi|53758552|gb|AAU92843.1| protein methyltransferase HemK [Methylococcus capsulatus str. Bath] (284 aa)
Score = 214, Expect = 1.6e-15, Identities = 62/210 (29%), Positives = 107/210 (50%)
  Q:    76 KNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKT-QFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPN-VDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           + +PV Y+T    F+  SF +     +PR ETE +++ AV+     ++  ILDL +GSGV+A T++   +  DA V  V+ + +   V   N   L  KT +F++ D F    +   + D I+ NPPY+  +DP+ +    + EP+QAL + ++G +          P L     ++ E GF+Q + + + L K      +  +DL   +RV
  S:    67 RGVPVAYLTGVREFWSRSFKVCPDVLIPRPETELLVELAVEAACRRNRPRILDLGTGSGVIAVTLAL--ECPDAEVWAVDVSESALAVARHNAAALGAKTVRFLRGDWFAPLPADI-RFDLIVSNPPYVSPSDPHLLRGDLRYEPRQALVSVKDGLHDIALIADNAGPRLLPDGGLMIEHGFDQADAVARILGKAGYRDVRHHRDLQGHERV 275
>gi|19746089|ref|NP_607225.1| putative protoporphyrinogen oxidase [Streptococcus pyogenes MGAS8232] >gi|19748261|gb|AAL97724.1| putative protoporphyrinogen oxidase [Streptococcus pyogenes MGAS8232] (279 aa)
Score = 214, Expect = 1.6e-15, Identities = 65/219 (29%), Positives = 112/219 (51%)
  Q:    47 NSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYI---DKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFL 265
           +S D+   ++  +  E   +L+ +   L++++  QYIT +  F  L   + K   +PR ETE ++D  + +  L     +LD+ +GSG +A  IS  K+  +  V   + +R    +   N    +L   FI+SD+F +    +   D I+ NPPYI   DK + +++   + EP  ALFA +NGY  Y + + +    L    ++ FEIG+ Q E I+  L
  S:    35 SSLDMLIHQNQAVTPEDAVLLEHIFCSLSQHLSPQYITGNAYFRDLKLAVDKRVLIPRPETEELVDMILAEN-LDAPLNVLDIGTGSGAIA--ISLKKERPNWQVTASDISRAALDLAKVNADAYQLDITFIESDVFSLISGTF---DIIVSNPPYISYEDKEEVSLN-VLQSEPHLALFAKENGYAIYRKIIEQADNYLTKEGKLYFEIGYKQAEGIKDML 249
>gi|29377041|ref|NP_816195.1| hemK protein [Enterococcus faecalis V583] >gi|29344507|gb|AAO82265.1| hemK protein [Enterococcus faecalis V583] (277 aa)
Score = 213, Expect = 1.9e-15, Identities = 63/207 (30%), Positives = 101/207 (48%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNV-DPSTKC-EPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFL-IKNNITVFKFLKDLDDKDRV 285
           P QY+     FYG SF + +   +PR ETE +++  +K         ++D+ +G+G +A ++   + N    VI ++ +     V  +N + L    +F   +  +   S  EK D +I NPPYI + +  + D S +  EPK ALFA  NG   Y + + E   +L    +I FEIGF Q   +++ L         K  KDL   DR+
  S:    69 PAQYLLGQAEFYGHSFIVNEHTLIPRPETEELVERCLKANPDTPLT-VVDVGTGTGAIAVSLKLARPNWR--VIAIDLSEEALTVAKQNAQALGAGIEFYHGNGLQPVAS--EKIDLLISNPPYISEQEWYLMDASVRTYEPKTALFAENNGLALYQQLIHESQTMLKADGKIYFEIGFQQGAALQELLSAAYPQKTIKIEKDLSGNDRL 273
>gi|167730542|emb|CAO81454.1| modification methylase, HemK family [Candidatus Cloacamonas acidaminovorans] (273 aa)
Score = 213, Expect = 2.1e-15, Identities = 72/217 (33%), Positives = 106/217 (48%)
  Q:    74 LNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAI-VIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKND-PNVDPSTK-CEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYIKK 290
           L K  P QYIT +  FYGL   +     +PR ETE +++  +++ K  ++  ILD+ +GSG +A  +   K N  ++ V   E + +  +   KN    +    F  SD F   +  YE    +I NPPYI K +   ++   K  EP  AL   ++G  FY + LSE    L+    +  E    QKE I     K   T  + LKDL DKDR L+I +
  S:    62 LEKGEPPQYITGTAYFYGLDLKVNPAVLIPRPETERLVELTMERLKGTER--ILDIGTGSGAIAIAL---KHNLPSLNVSATEISFSALETAKKNAEIYRADIHFYLSDCFPPVKQSYE---VLISNPPYISKAEIATLNSRIKDKEPVIALQGGEDGLDFYRKLLSESSEYLSENGFLALEHSDTQKEAIMNIARKEGWTKIEPLKDLTDKDRYLFIYR 273
>gi|168704925|ref|ZP_02737202.1| modification methylase, HemK family protein [Gemmata obscuriglobus UQM 2246] (291 aa)
Score = 212, Expect = 2.3e-15, Identities = 59/212 (27%), Positives = 110/212 (51%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKN--QRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKND-PNVDPSTK-CEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKN-NITVFKFLKDLDDKDRVLYIKK 290
           PV Y+  S  FY L+F +     +PR +TE ++  A+K+ K +    +LD+ +GSG +A ++++ K  KD+ V   + +     V  +N  + N+  +  F++ D+F    +     D ++ NPPYI +++   + P  +  EP+ AL    +G  FY R  + + P L  G  ++ EIG+ Q   +   + +   + +   +KD+    RV+  KK
  S:    77 PVAYLVGSRGFYLLNFDVDPAVLIPRSDTETLVGEALKRLKPLTAPAVLDIGTGSGCIAVSLAHQK--KDSHVTATDVSPDALAVAKRNAIKNNVADRMTFLQGDLFAPLPAGV-TFDLVVSNPPYIAQSEFAELAPDVRDHEPRVALDGGPDGLAFYRRIAAAVGPFLKPGGSLLLEIGWKQDAAVRALIAEQPELELGPTIKDMGKNPRVVTAKK 290
>gi|16080753|ref|NP_391581.1| hypothetical protein BSU37000 [Bacillus subtilis subsp. subtilis str. 168] >gi|1170229|sp|P45873|HEMK_BACSU Protein hemK homolog >gi|853777|emb|CAA89885.1| ywkE [Bacillus subtilis] >gi|2636225|emb|CAB15717.1| ywkE [Bacillus subtilis subsp. subtilis str. 168] (288 aa)
Score = 212, Expect = 2.5e-15, Identities = 71/241 (29%), Positives = 128/241 (53%)
  Q:    46 ENSSDIFFEKDTEIDFEYKKILKQLNKVLNKN---------------IPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLI----DKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPSTKC---EPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFK-----FLKDLDDKDRVL 286
           EN++++    DT +  E  K+L  L + + ++               +PVQYI     FYG  F +     +PR ETE ++   +++ + +     K  ++D+ +GSG +A T++   +N+   V  V+ ++   +V   N   L    +F + D+ +      +K D I+ NPPYI + +   D S      EP  AL    +G  FY RF+ +I  ++ +   ++FEIG+ Q   ++  ++K     FK      LKD++ KDR +
  S:    22 ENAAELLLLYDTGM--ERSKLLASLQEPIGEDELYRFKRHVEMHKEGVPVQYIIGKEFFYGREFMVNDDVLIPRPETEEVVFHLLEKYRSVFSEDGKLEVVDVGTGSGAIAVTLAL--ENQSFSVSAVDISKEALQVASANAEKLGANVRFYQGDLLEPFIKAGKKADIIVSNPPYISEEE-MADLSEIVRFHEPLHALTDGGDGLKFYKRFMEDIPLVMKDKVFVVFEIGWKQGAAVKDLILK----AFKGAEVEVLKDINGKDRTI 280
>gi|152980147|ref|YP_001351901.1| methylase of polypeptide chain release factors [Janthinobacterium sp. Marseille] >gi|151280224|gb|ABR88634.1| methylase of polypeptide chain release factors [Janthinobacterium sp. Marseille] (280 aa)
Score = 211, Expect = 2.9e-15, Identities = 58/218 (26%), Positives = 109/218 (50%)
  Q:    68 KQLNKVLNKNI---PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNV-DPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           +QL+++  + +   P+ Y+T    F+GLSF +     +PR +TE +++ A+    L  +  +LD+ +GSG +A  I++ +   DA V  ++ +     +   N R  +++  F++SD F   +   ++ D I+ NPPYI   DP++ +   + EP  AL    NG         +    LA    ++ E G++Q   +   L  +  T  +  +DL   +RV
  S:    57 QQLSQLFARRLAGEPIAYLTGEREFFGLSFDVSPAVLIPRPDTELLVELALHY--LPPQGRVLDMGTGSGAIAVAIAHAR--PDAFVTALDVSAEALAIAEGNARKNQVQVNFLRSDWFSAVKE--QRFDLIVSNPPYIVAGDPHLSEGDLRFEPVDALTDHANGLSDLQTITRDAARYLAPAAWLLMEHGYDQAAAVRDVLATHGFTEVQSWRDLAGIERV 272
>gi|167625122|ref|YP_001675416.1| HemK family modification methylase [Shewanella halifaxensis HAW-EB4] >gi|167355144|gb|ABZ77757.1| modification methylase, HemK family [Shewanella halifaxensis HAW-EB4] (280 aa)
Score = 211, Expect = 3.6e-15, Identities = 66/224 (29%), Positives = 111/224 (49%)
  Q:    61 FEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKC-DF--IICNPPYIDKNDPNVDP-STKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDR 284
           FE+K++L    K L  N P+ +I     F+ L F +     +PR +TE +++ A+    L +   +LDL +G+G +A  +S   +  +  V  ++K      +   N+ NLKL+    + D+F+ D     +C DF  I+ NPPYID+ D ++     + EP+ AL AP  G+   F         LA G  ++ E G+ Q  E+ + LI+        ++D    DR
  S:    56 FEFKQMLA---KRLRGN-PIAHIVGEREFWSLPFRVNPTTLIPRPDTEILVETALNL-PLAENAKVLDLGTGTGAIA--LSLAHERNEWQVCAIDKVEDAVALAKVNRANLKLE----QVDVFQSDWFDAVECYDFNLIVSNPPYIDEEDEHLSQGDVRFEPQSALTAPLKGFADLFHIAESARDYLAPGGYLLLEHGYQQAIELREKLIELGYENVATVRDFGSNDR 272
>gi|88861345|ref|ZP_01135975.1| N5-glutamine methyltransferase, modifies release factors RF-1 and RF-2 [Pseudoalteromonas tunicata D2] >gi|88816611|gb|EAR26436.1| N5-glutamine methyltransferase, modifies release factors RF-1 and RF-2 [Pseudoalteromonas tunicata D2] (281 aa)
Score = 211, Expect = 3.7e-15, Identities = 56/207 (27%), Positives = 105/207 (50%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKT-QFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDP-STKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           P+ +I     F+ L   +     +PR +TE +++ A+    L +   +LDL +G+G +A  ++  + N    V G ++      +   NQ  L++K  +F++S+ F    +  E+ D I+ NPPYI+++DP++     + EP  AL AP NG       +++    L +G  ++ E G+ Q E++    ++      + +KDL   DRV
  S:    71 PIAHIIGYREFWSLKLKVSPATLIPRPDTETLVEHALSLA-LPEHAKVLDLGTGTGAIALALASEQFNWQ--VTGCDRIEDAVVLAQTNQAALEIKNCRFVQSNWFSAFST--EQFDLIVSNPPYIEQDDPHLSQGDVRFEPLSALVAPDNGLADIRTIVNQARTFLTSGGYLLLEHGYQQAEQVSAIFLQMAYKDIRTIKDLAGNDRV 274
>gi|114330835|ref|YP_747057.1| modification methylase, HemK family protein [Nitrosomonas eutropha C91] >gi|114307849|gb|ABI59092.1| modification methylase, HemK family protein [Nitrosomonas eutropha C91] (293 aa)
Score = 210, Expect = 3.7e-15, Identities = 71/261 (27%), Positives = 121/261 (46%)
  Q:    25 LDDSQIKWILKELILFNSKIIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLK-TQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPS-TKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           +D    +W+L+ ++  ++  +   +++    +  + F+      QL        PV Y+T    FY L F +     +PR ETE +++ A+ +        ILDL +GSG +A TI+  +   D  V  V+ +     V  +N +   ++   FIK+D F    S  EK D I+ NPPYI + DP+++    + EP  AL A  NG     R + +    L +   ++ E G++Q +   + L K   +      DL   DRV
  S:    31 VDRIDARWLLQSVLNVDAAFLITHAELLLGMEQIVHFQ------QLLARRMAGEPVAYLTGERGFYDLVFDVTPDVLIPRPETELLVEMALSKIPPDRCCNILDLGTGSGAIAITIA--RHRPDIYVTAVDLSPLALAVARRNAKRCSVENVVFIKADWFSGFIS--EKFDVIVANPPYIVEGDPHLEADGLRFEPTIALVAQNNGLDCIRRIVDQAPDYLEHSGWLMLEHGYDQADVCRRLLDKTGFSHIFTRSDLAGIDRV 283
>gi|187918070|ref|YP_001883633.1| peptide release factor-glutamine N5-methyltransferase [Borrelia hermsii DAH] >gi|119860918|gb|AAX16713.1| peptide release factor-glutamine N5-methyltransferase [Borrelia hermsii DAH] (277 aa)
Score = 210, Expect = 4.0e-15, Identities = 66/228 (28%), Positives = 116/228 (50%)
  Q:    62 EYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKT--QFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPSTKCEPKQALFA-PQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYIK 289
           E  K+L Q+ K +    P+ YI  +  F G+ F+I K   +PR +TE +++ A+ Q K  +   ILDLC GSG +  TI+Y  K K   V   + +    +V ++N + LKL+   +   SD+ K     +E    II NPPY++K++  +      EP+ AL    ++G     + + +    L     +I E+   Q   ++KF I+      K + D+++++R L ++
  S:    47 EEHKLLSQI-KNIKSGTPINYILGTKEFMGIKFYINKHVLIPRADTECLVEEALIQIKKHNLNRILDLCCGSGCIGLTIAYYLKRK---VTLSDISTKALRVSLRNTQRLKLENYIEIQHSDLLKYIDKEFE---LIITNPPYLNKDELKIKEKLAKEPRIALLGFGRDGLKIPKKIIIQAKHKLTKNGLLIVEMAPWQTNSLKKFAIQEGFEYLKTIYDIENRERALVLR 270
>gi|163783633|ref|ZP_02178622.1| protoporphyrinogen oxidase [Hydrogenivirga sp. 128-5-R1-1] >gi|159881126|gb|EDP74641.1| protoporphyrinogen oxidase [Hydrogenivirga sp. 128-5-R1-1] (270 aa)
Score = 210, Expect = 4.0e-15, Identities = 61/229 (26%), Positives = 112/229 (48%)
  Q:    58 EIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEK-NRTPYKVGVKNQR--NLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKND-PNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVL 286
           E+  E  K  K+L K+  +  P  Y+   + FYG +F +K+G  +PR ETE +++  ++      +    ++  G+G ++ T+      +  + + V+  N T  ++  +N +   +  + +  + D+F   +    + DFI+ NPPYI +N    + P  + E ++AL   + GY FY RF  E+   L  G  +  EIG +Q   +E+ L           KD   +DRV+
  S:    39 EVPEEVVKKFKRLMKLRERGFPTAYLIGEWDFYGRTFKVKEGVLIPRPETELLVEKTLELIPADKEMEGFEVGGGTGCISITLLL---ERGLLRMAVDDVNPTAVELMKENAKIHGVDYRLEVFEGDMFSPVKG--RRFDFIVSNPPYIPENFWERLPPEVRREGREALIGGEKGYEFYERFAKEVPRHLKGGGFVALEIGHDQGRVVEELLKGAGFERVIIYKDYSGQDRVV 266
>gi|46446287|ref|YP_007652.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Candidatus Protochlamydia amoebophila UWE25] >gi|46399928|emb|CAF23377.1| putative HemK protein [Candidatus Protochlamydia amoebophila UWE25] (279 aa)
Score = 210, Expect = 4.2e-15, Identities = 81/248 (32%), Positives = 126/248 (50%)
  Q:    18 LTKRLNPLDDSQIKWILKELILFNSKIIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLD----WAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDI---FKIDRSHYEKCDFIICNPPYIDKND-PNVDPSTK-CEPKQALFAPQNGYYFYFRFLSEIYP-ILANGTEIIFEIGFNQKEEIEKFL 265
           LT  L   D S  K   ++L+   S +  + S ++     ++  E  +  +   K   K  P+ YI  S  FYG S  +     +PRQETE ++D    +   QKKL   K + DLCSGSG +   I+  KK     VI  + +     +   N ++ +++ +F++ D+   F+  R+H     FIICNPPYI + +  ++D   K  EPK AL   + G   Y R L+EI P  L    +I FEIG+ Q + ++K  
  S:     7 LTHELAKKDKSLAKREAQDLL--GSILKCDRSTLYTRHSQDLSLEEWQTCQNYLKRRMKGEPLAYIQGSIDFYGCSIQVNPFVLIPRQETEILVDKISTYLSHQKKL-SGKILWDLCSGSGCIG--IALKKKFPQLHVISSDLSSAALSLARSNAQDNQVEVEFLQGDLLEPFEGRRAH-----FIICNPPYISEAEFKDLDLEVKEFEPKMALVGGETGLEIYQR-LAEILPNYLYPHAKIWFEIGYKQGDSLKKIF 253
>gi|149019617|ref|ZP_01834936.1| HemK protein [Streptococcus pneumoniae SP23-BS72] >gi|147930992|gb|EDK81972.1| HemK protein [Streptococcus pneumoniae SP23-BS72] (279 aa)
Score = 210, Expect = 4.2e-15, Identities = 66/220 (30%), Positives = 108/220 (49%)
  Q:    49 SDIFFEKDTEIDFEY-KKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDP-----NVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKN 268
           +D  F    E+  E  K+ ++ + + L  + P QYI     FYG+   + +   +PR ETE +++  + +  L     +LD+ +GSG +A  ++  K   D  V   + ++    +  +N +N  L+  F KSD F       EK D I+ NPPYI + D      NV  S   EP  ALFA ++G   Y R   +    L +G +I  EIG+ Q + + +   K+
  S:    37 TDFIFALQQEVTTEEEKQFVEDIYQQLAAHKPAQYIIGQADFYGMHLKVDERVLIPRPETEELVELILTEN-LETNLSVLDIGTGSGAIA--LALAKNRPDWSVTAADVSQEALDLASENAKNQNLQIFFKKSDCFT---EISEKYDIIVSNPPYISREDESEVGLNVLYS---EPHLALFADEDGLAIYCRIAEDAKDYLKDGGKIYLEIGYKQGQSVPELFRKH 253
>gi|145634874|ref|ZP_01790581.1| HemK [Haemophilus influenzae PittAA] >gi|145267740|gb|EDK07737.1| HemK [Haemophilus influenzae PittAA] (292 aa)
Score = 210, Expect = 4.2e-15, Identities = 77/263 (29%), Positives = 133/263 (50%)
  Q:    23 NPLDDSQIKWILKELILFNSKIIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNI---PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWA-----VKQKKLIDKKYILDLCSGSG----VLANTISYI--KKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNV-DPSTKCEPKQALFAPQNGYYFYFRFLSEIYP-ILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           NP ++S+I      L+L      +  + I    DTEID   +K+  +L  +L++ +   P+ YI     F+ L   + KG  +PR +TE +++ A     VK ++      ILDL +G+G     LA+ +S I  K+     +IGV+       +   N    +L  +F++S  F+     +   D I  NPPYID  D ++     + EP  AL A   GY    R++ E  P  L +   ++ E G+ Q E++    ++N+  + + ++D  D +RV
  S:    18 NPSENSKID----ALVLLQYATGKPRTQILAFDDTEID---EKVRLKLTALLDRRLNGEPIAYILGEKEFWSLPLNVSKGTLIPRPDTEILVEKALQIALVKLEENPPHFRILDLGTGTGAIALALASELSSICQKRQISLEIIGVDLMPDVVALAQSNAERNQLNVEFLQSRWFENITGQF---DLIASNPPYIDAQDEHLRQGDVRFEPLSALVANDAGYA-DLRYIIESAPNYLNSNGALLLEHGWQQGEKVRSIFLENHWEIVETVRDYGDNERV 285
>gi|91792281|ref|YP_561932.1| HemK family modification methylase [Shewanella denitrificans OS217] >gi|91714283|gb|ABE54209.1| modification methylase, HemK family [Shewanella denitrificans OS217] (284 aa)
Score = 210, Expect = 4.2e-15, Identities = 62/214 (28%), Positives = 107/214 (50%)
  Q:    71 NKVLNKN--IPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKL-KTQFIKSDIFKI--DRSHYEKCDFIICNPPYIDKNDPNVD-PSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDR 284
           N VL +   +PV +I     F+ L F + +   +PR +TE +++ A+    L     +LDL +G+G +A  +S   +  D  V  ++K     ++   N++NL L + + ++SD F    DR      D I+ NPPYID  D +++    + EP+ AL A ++GY   F         L +G  ++ E GF Q  ++ + LI+        ++D    DR
  S:    64 NMVLKRQQGVPVAHIIGEREFWSLPFIVNESTLIPRPDTEILVETALNLT-LSPHAKVLDLGTGTGAIA--LSLASERPDWKVTAIDKVDEAVELAKANRQNLNLPQVEILQSDWFSAVKDRDF----DLIVSNPPYIDAEDEHLNLGDVRFEPQSALTAGEHGYADLFHIAEHAREHLVHGGYLLLEHGFEQAIKVREKLIELGYQQVATVRDFGSNDR 276
>gi|168576250|ref|ZP_02722144.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Streptococcus pneumoniae MLV-016] >gi|183577963|gb|EDT98491.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Streptococcus pneumoniae MLV-016] (279 aa)
Score = 210, Expect = 4.3e-15, Identities = 71/240 (29%), Positives = 118/240 (49%)
  Q:    49 SDIFFEKDTEIDFEY-KKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDP-----NVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKN-NITVFKFLKDLDDKDRVLYI 288
           +D  F    E+  E  K+ ++ + + L  + P QYI     FYG+   + +   +PR ETE +++  + +  L     +LD+ +GSG +A  ++  K   D  V   + ++    +  +N +N  L+  F KSD F       EK D I+ NPPYI + D      NV  S   EP  ALFA ++G   Y R   +    L +G +I  EIG+ Q + + +   K+      + LKD   +DR++ +
  S:    37 TDFIFALQQEVTTEEEKQFVEDIYQQLAAHKPAQYIIGQADFYGMHLKVDERVLIPRPETEELVELILTEN-LETNLSVLDIGTGSGTIA--LALAKNRPDWSVTAADVSQEALDLASENAKNQNLQIFFKKSDCFT---EISEKYDIIVSNPPYISREDESEVGLNVLYS---EPHLALFADEDGLAIYRRIAEDAKDYLKDGGKIYLEIGYKQGQSVPELFRKHLPEKKVRTLKDQFGQDRMVVV 274
>gi|15900892|ref|NP_345496.1| HemK protein [Streptococcus pneumoniae TIGR4] >gi|111658250|ref|ZP_01408942.1| hypothetical protein SpneT_02000564 [Streptococcus pneumoniae TIGR4] >gi|14972494|gb|AAK75136.1| HemK protein [Streptococcus pneumoniae TIGR4] (279 aa)
Score = 210, Expect = 4.3e-15, Identities = 70/240 (29%), Positives = 117/240 (48%)
  Q:    49 SDIFFEKDTEIDFEY-KKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDP-----NVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKN-NITVFKFLKDLDDKDRVLYI 288
           +D  F    E+  E  K+ ++ + + L  + P QYI     FYG+   + +   +PR ETE +++  + +   +    +LD+ +GSG +A  ++  K   D  V   + ++    V  +N +N  L+    KSD F       EK D I+ NPPYI + D      NV  S   EP  ALFA ++G   Y R   +    L +G +I  EIG+ Q + + +   K+      + LKD   +DR++ +
  S:    37 TDFIFALQQEVTTEEEKQFVEDIYQQLAAHKPAQYIIGQADFYGMHLKVDERVLIPRPETEELVELILAENP-VKNLMVLDIGTGSGAIA--LALAKNRPDWSVTAADISQDALDVASENAKNQNLQIFLKKSDCFT---EISEKYDIIVSNPPYISREDESEVGLNVLYS---EPHLALFADEDGLAIYRRIAEDAKDYLKDGGKIYLEIGYKQGQSVPELFRKHLPEKRVRTLKDQFGQDRMVVV 274
>gi|49473851|ref|YP_031893.1| protoporphyrinogen oxidase protein [Bartonella quintana str. Toulouse] >gi|49239354|emb|CAF25687.1| Protoporphyrinogen oxidase protein [Bartonella quintana str. Toulouse] (288 aa)
Score = 210, Expect = 4.4e-15, Identities = 72/240 (30%), Positives = 121/240 (50%)
  Q:    47 NSSDIFFEKDTEIDFEYKKILKQLNKVLNKNI---PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQ-KKLIDK---KYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQF--IKSDIFKIDRSHYEKCDFIICNPPYIDKND-PNVDPSTKC-EPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVL 286
           N+S      D  + FE    + QL + + + I   PV  I     FYG+SF + +    PR +TE ++D  +   KK +DK     +LD+ +GSG +A  I+ +K+   +    V+ ++   K  +KN +N K+  +F  + S+ F    S  ++ D II NPPYI + D  N+    +  +P +AL   ++G +FY +   E    L     +  EIG +Q++E+     KN     +  +DL    R L
  S:    40 NASVRILHPDLCLSFEQ---ITQLEQAIQRRINGEPVYRIIGKREFYGISFALSQETLEPRPDTETLVDLVLPLLKKYVDKLGKTTLLDMGTGSGAIA--IAILKQIPQSYATAVDISKDALKTAIKNAKNAKVIHRFTPLLSNWFD---SVTDRFDLIISNPPYIPETDIKNLAKEVRLHDPLRALIGGKDGLHFYRKLAHEATNYLKTKGSLAVEIGHSQEKEVCDLFEKNGFQFLEMRRDLSGIPRAL 282
>gi|33152003|ref|NP_873356.1| protein-glutamine N-methyl transferase [Haemophilus ducreyi 35000HP] >gi|33148225|gb|AAP95745.1| Protein-glutamine N-methyl transferase [Haemophilus ducreyi 35000HP] (290 aa)
Score = 209, Expect = 4.9e-15, Identities = 65/210 (30%), Positives = 108/210 (51%)
  Q:    76 KNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYM----LDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLK-TQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVD-PSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGT-------EIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           K  P+ YI     F+ L   + K   +PR +TE +    LDWA K+ +     +ILDL +G+G +A  ++    +K A++  V+       +  +N+++L  K   F++SD F   +S  ++ D I+ NPPYIDK D N+     + EP  AL + Q G       LS++Y I+ N          +I E G+ Q   +++F    +    +  +D    DRV
  S:    70 KGEPIAYILGEKEFWSLPLKVSKHTLIPRPDTERVVEIALDWAYKRLEQQTNLHILDLGTGTGAIALALASELGDK-AVITAVDIKAEAVSLAEENRQHLGFKQVTFLQSDWFNALQS--QQFDLIVSNPPYIDKTDENLKLGDVRFEPLSALVSAQQG-------LSDLYKIIENAPLYLTAKGALILEHGWQQATAVQQFFQHYDWDEIQSWQDYAGLDRV 282
>gi|125717978|ref|YP_001035111.1| HemK protein, putative [Streptococcus sanguinis SK36] >gi|125497895|gb|ABN44561.1| HemK protein, putative [Streptococcus sanguinis SK36] (276 aa)
Score = 209, Expect = 5.2e-15, Identities = 67/238 (28%), Positives = 118/238 (49%)
  Q:    49 SDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYI---DKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKN-NITVFKFLKDLDDKDRVL 286
           +D   +   E+  + +  LK + + L  + P QYI  S  F+GL+  + +   +PR ETE +++  + +        +LD+ +GSG +A  ++  + N    +   + +     +  +N ++ +L   F++SD      S   K D I+ NPPYI   DK++  ++  T  EP  ALFA ++GY  Y +   +    L    +I  EIG+ Q + I + L KN      + LKD   KDR++
  S:    37 TDFVLKLRAEVSQKDRDQLKAIQEQLLVHKPAQYIIGSSDFHGLTLKVDERVLIPRPETEELVELILSENPE-SSLSVLDIGTGSGAIALALANSRPNWQ--ITASDLSDDALALAAENAQSCELNLAFVQSDCLD---SIQGKFDIIVSNPPYISEADKDEVGLNVLTS-EPHMALFAEEDGYAVYRKIAEQAGDYLTKKGKIYLEIGYKQGDGIRELLEKNFPQKRIRVLKDQFGKDRMV 271
>gi|168483092|ref|ZP_02708044.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Streptococcus pneumoniae CDC1873-00] >gi|182683969|ref|YP_001835716.1| hemK protein [Streptococcus pneumoniae CGSP14] >gi|172043511|gb|EDT51557.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Streptococcus pneumoniae CDC1873-00] >gi|182629303|gb|ACB90251.1| hemK protein [Streptococcus pneumoniae CGSP14] (279 aa)
Score = 209, Expect = 5.3e-15, Identities = 66/220 (30%), Positives = 107/220 (48%)
  Q:    49 SDIFFEKDTEIDFEY-KKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDP-----NVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKN 268
           +D  F    E+  E  K+ ++ + + L  + P QYI     FYG+   + +   +PR ETE +++  + +  L     +LD+ +GSG +A  ++  K   D  V   + ++   ++  +N  N  L   F KSD F       EK D I+ NPPYI + D      NV  S   EP  ALFA ++G   Y R   +    L +G +I  EIG+ Q + + +   K+
  S:    37 TDFIFALQQEVTTEEEKQFVEDIYQQLAAHKPAQYIIGQADFYGMHLKVDERVLIPRPETEELVELILTEN-LETNLSVLDIGTGSGAIA--LALAKNRPDWSVTAADVSQEALELASENASNQNLNIFFKKSDCFA---EISEKYDIIVSNPPYISREDESEVGLNVLHS---EPHLALFADEDGLAIYCRIAEDAKDYLKDGGKIYLEIGYKQGQSVPELFRKH 253
>gi|69249627|ref|ZP_00605025.1| Modification methylase HemK [Enterococcus faecium DO] >gi|68194106|gb|EAN08646.1| Modification methylase HemK [Enterococcus faecium DO] (290 aa)
Score = 209, Expect = 5.4e-15, Identities = 68/260 (26%), Positives = 122/260 (46%)
  Q:     6 CKRQKSSMTFSELTKRLNPLDDSQIKWILKELILFNSKIIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNV-DPSTKC-EPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFL 265
           CK  K  MT+ E+  R +   +   K       LF  +      D     + EI  E +++++   ++L  + P QY+     FY     + +   +PR ETE +++W + +   +  + ++D+ +G+G +A ++   +KN    +  V+ +    +V  +N +    K  F   D   +     ++ D II NPPYI +N+  + D S +  EPK ALFA  +G   Y +   E   +L +  +I  EIGF Q E ++K  
  S:    10 CKMGK--MTYREVLSRASSFLEDHGKEAYSIQFLFLERKQWKKLDWLLHMNEEISEEEQRLIETDLRLLLADHPPQYLLGYADFYDHRLKVTEATLIPRPETEELVEWCLDETPGVPLE-VIDIGTGTGAIAISLKAARKNWH--ISAVDLSEEALEVAKENAQKEGTKISFYHGD--TLGPVMDQQFDVIISNPPYISRNEWELMDESVRSFEPKMALFAENDGLAIYEKIAVEAPSVLKSNGKIFLEIGFRQGEAVKKIF 264
>gi|149012960|ref|ZP_01833849.1| HemK protein [Streptococcus pneumoniae SP19-BS75] >gi|147763113|gb|EDK70054.1| HemK protein [Streptococcus pneumoniae SP19-BS75] (279 aa)
Score = 209, Expect = 5.5e-15, Identities = 66/220 (30%), Positives = 107/220 (48%)
  Q:    49 SDIFFEKDTEIDFEY-KKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDP-----NVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKN 268
           +D  F    E+  E  K+ ++ + + L  + P QYI     FYG+   + +   +PR ETE +++  + +  L     +LD+ +GSG +A  ++  K   D  V   + ++   ++  +N  N  L   F KSD F       EK D I+ NPPYI + D      NV  S   EP  ALFA ++G   Y R   +    L +G +I  EIG+ Q + + +   K+
  S:    37 TDFIFALQQEVTTEEEKQFVEDIYQQLAAHKPAQYIIGQADFYGMHLKVDERVLIPRPETEELVELILTEN-LETNLSVLDIGTGSGAIA--LALAKNRPDWSVTAADVSQEALELASENASNQNLNIFFKKSDCFA---EISEKYDIIVSNPPYISREDESEVGLNVLHS---EPHLALFADEDGLAIYCRIAEDAKDYLKDGGKIYLEIGYKQGQSVPELFRKH 253
>gi|187251501|ref|YP_001875983.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Elusimicrobium minutum Pei191] >gi|186971661|gb|ACC98646.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Elusimicrobium minutum Pei191] (277 aa)
Score = 209, Expect = 5.6e-15, Identities = 65/213 (30%), Positives = 102/213 (47%)
  Q:    78 IPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLK-TQFIKSDIFKIDRSHYEKCDFIICNPPYIDKND-PNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYIKK 290
           +P+ YIT +  F G +F +     VPR ETE +++  +    L   K ILD+C+GSG +A +++   K + A V GV+ +        KN +   L+  + I  D+F+   + Y   D II NPPYI   D   +    K EP+ AL   +NG     + +      L  G  +  E G N++ EIE    KN     +  KD+    R ++ +K
  S:    69 MPLAYITGTQDFCGHTFIVDSDVLVPRPETEELVE--ISSSMLGKPKRILDMCTGSGCIACSMAM--KYRSAQVTGVDNSMAALLTAEKNVKKFGLQNVELIYGDLFE---NIYGAFDLIITNPPYIPTGDLAGLSREVKEEPQAALDGGENGLDIITQIILYAPDFLETGGLLTMEYGINREREIEGLFDKNIWRSVEVKKDMFGIYRFVFAQK 276
>gi|169833726|ref|YP_001694465.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Streptococcus pneumoniae Hungary19A-6] >gi|168996228|gb|ACA36840.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Streptococcus pneumoniae Hungary19A-6] (279 aa)
Score = 209, Expect = 5.8e-15, Identities = 66/220 (30%), Positives = 107/220 (48%)
  Q:    49 SDIFFEKDTEIDFEY-KKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDP-----NVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKN 268
           +D  F    E+  E  K+ ++ + + L  + P QYI     FYG+   + +   +PR ETE +++  + +  L     +LD+ +GSG +A  ++  K   D  V   + ++   ++  +N  N  L   F KSD F       EK D I+ NPPYI + D      NV  S   EP  ALFA ++G   Y R   +    L +G +I  EIG+ Q + + +   K+
  S:    37 TDFIFALQQEVTTEEEKQFVEDIYQQLAAHKPAQYIIGQADFYGMHLKVDERVLIPRPETEELVELILTEN-LETNLSVLDIGTGSGAIA--LALAKNRPDWSVTAADVSQEALELASENASNQNLNIFFKKSDCFA---EISEKYDIIVSNPPYISREDESEVGLNVLHS---EPHLALFADEDGLAIYCRIAEDAKDYLKDGGKIYLEIGYKQGQSVPELFRKH 253
>gi|148984975|ref|ZP_01818218.1| HemK protein [Streptococcus pneumoniae SP3-BS71] >gi|147922673|gb|EDK73790.1| HemK protein [Streptococcus pneumoniae SP3-BS71] (279 aa)
Score = 209, Expect = 6.1e-15, Identities = 71/240 (29%), Positives = 118/240 (49%)
  Q:    49 SDIFFEKDTEIDFEY-KKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDP-----NVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKN-NITVFKFLKDLDDKDRVLYI 288
           +D  F    E+  E  K+ ++ + + L  + P QYI     FYG+   + +   +PR ETE +++  + +  L     +LD+ +GSG +A  ++  K   D  V   + ++    +  +N +N  L+  F KSD F       EK D I+ NPPYI + D      NV  S   EP  ALFA ++G   Y R   +    L +G +I  EIG+ Q + + +   K+      + LKD   +DR++ +
  S:    37 TDFIFALQQEVTTEEEKQFVEDIYQQLAAHKPAQYIIGQADFYGMHLKVDERVLIPRPETEELVELILTEN-LETNLSVLDIGTGSGAIA--LALAKNRPDWSVTAADVSQEALDLANENAKNQNLQIFFKKSDCFT---EISEKYDIIVSNPPYISREDESEVGLNVLYS---EPHLALFADEDGLAIYRRIAEDAKDYLKDGGKIYLEIGYKQGQSVPELFRKHLPEKKVRTLKDQFGQDRMVVV 274
>gi|171779353|ref|ZP_02920317.1| hypothetical protein STRINF_01198 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gi|171281970|gb|EDT47401.1| hypothetical protein STRINF_01198 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] (276 aa)
Score = 208, Expect = 6.5e-15, Identities = 74/271 (27%), Positives = 133/271 (49%)
  Q:    14 TFSELTKRLNPL--DDSQIKWILKELILFNSKIIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYI---DKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKN-NITVFKFLKDLDDKDR 284
           T S+L K L  +  D   + ++ +EL  ++        D    ++ E+    +KIL+ +   L  +   QYIT    F  L   + +   +PR ETE ++D  +K+    D + +LD+ +GSG +A  IS      D  V   + ++   ++  +N +  ++   F++SD+F      +   D II NPPYI   DK++  ++     EP  ALFA ++G+  Y + +      L+   ++ FEIG+ Q + +   L K+      + L+D+  KDR
  S:     6 TISQLEKNLQEIGEDPENLTYVFRELKSWSLL------DFILHQNKEVTESDQKILESIMAQLEDHRSPQYITGKAYFRDLELAVDERVLIPRPETEELVDLVLKENSKADLR-VLDIGTGSGAIA--ISLKSARPDWQVTASDISQGALQLAEENSKLNQVSLDFVESDVFGQITGTF---DVIISNPPYIAYGDKDEVGMN-VLASEPHLALFADEDGFAIYRQIIEGAGEHLSENGKLYFEIGYKQGDGLRALLSKHFPQKRIRVLEDIFGKDR 269
>gi|125974913|ref|YP_001038823.1| HemK family modification methylase [Clostridium thermocellum ATCC 27405] >gi|196251575|ref|ZP_03150243.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Clostridium thermocellum DSM 4150] >gi|125715138|gb|ABN53630.1| modification methylase, HemK family [Clostridium thermocellum ATCC 27405] >gi|196198952|gb|EDX93781.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Clostridium thermocellum DSM 4150] (302 aa)
Score = 208, Expect = 6.5e-15, Identities = 68/225 (30%), Positives = 118/225 (52%)
  Q:    62 EYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKL--IDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKL--KTQFIKSDIFK-----IDRSHYEK---------CDFIICNPPYIDKNDPNV--DPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVL 286
           EYKK    L + + K  P+QYIT    F  L F +     +PRQ+TE +++  +   K   ++   ILD+ +GSG +A ++++    KD+ V+ ++ +    ++   N +   +  +  F+K D  +     I +S + K          D I+ NPPYI   +           EP+ AL    +G  FY     E   +L+  + + FE+G+NQ E + +F+ K + +  K +KDL   DRV+
  S:    53 EYKKFTLFLEERI-KGKPLQYITGHQEFMSLDFIVTPDVLIPRQDTETLVEAVLTHVKSTGLENARILDIGTGSGCIAVSLAHFL--KDSRVLALDISEKALEIAETNAKRCGVWDRMFFLKGDALEGLAGIIAQSPFAKDFERKGEGFFDIIVSNPPYIPSEEIKTLHKQVKDYEPRTALDGGIDGLDFYRAITCEAAKLLSTDSLLAFEVGYNQAENVSEFM-KESFSAIKVVKDLAGIDRVV 293
>gi|56476055|ref|YP_157644.1| protein-glutamine N-methyltransferase [Azoarcus sp. EbN1] >gi|56312098|emb|CAI06743.1| Protein-glutamine N-methyltransferase [Azoarcus sp. EbN1] (280 aa)
Score = 208, Expect = 6.7e-15, Identities = 61/207 (29%), Positives = 94/207 (45%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIF-KIDRSHYEKCDFIICNPPYIDKNDPNVDP-STKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           PV Y+T    F+G  F +     +PR +TE +++ A+          +LDL +GSG LA  IS   +   A V+ V+++R    V + N   L+    F+  D F  +   HY+    I+ NPPYI   DP++D    + EP  AL A  +G        ++    L  G  +  E GF+Q   +   L     +     KDL   +RV
  S:    69 PVAYLTGEREFFGHPFIVTPAVLIPRPDTELLVELALAHFGDKPHTRVLDLGTGSGALA--ISLALELPQADVVAVDRSREALWVAMANAARLRASISFVLGDWFSSLGDDHYQ---LIVANPPYIAAADPHLDEGDVRFEPSTALVAGPDGLDDLAAIAAQAPRHLEPGGWLFMEHGFDQAAAVRGLLTDGGFSSIASWKDLAGIERV 272
>gi|114768931|ref|ZP_01446557.1| HemK [alpha proteobacterium HTCC2255] >gi|114549848|gb|EAU52729.1| HemK [alpha proteobacterium HTCC2255] (277 aa)
Score = 208, Expect = 6.8e-15, Identities = 66/221 (29%), Positives = 110/221 (49%)
  Q:    66 ILKQLNKVLNKNI---PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPST--KCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVL 286
           I      ++NK +   P+  I     F+   F +      PR +TE +++  + Q K  +   ILDL +GSG +   +S + + KDAI +G++K+     V  +N   L L +Q +  ++        EK D II NPPYI +ND  +   +    EP+ AL    +G   Y   L     +L    ++I EIG++Q +++   L  +     K +KD+++KDRVL
  S:    52 IYNYFKTLINKRLEFQPISQIIGERYFWKNKFIVSPNVLDPRPDTETLIEHTLSQGKFYN---ILDLGTGSGCI--ILSLLDEYKDAIGVGIDKSEDALNVAKQNANLLSL-SQRVSFNLGNWCEGIKEKFDLIISNPPYISENDMKILSKSVLNWEPRIALTPEGDGLGAYRHILDGAKNLLIPNGKLILEIGYDQGKKVTHLLKNHGYKDIKLVKDINNKDRVL 271
>gi|119952994|ref|YP_945203.1| peptide release factor-glutamine N5-methyltransferase [Borrelia turicatae 91E135] >gi|119861765|gb|AAX17533.1| peptide release factor-glutamine N5-methyltransferase [Borrelia turicatae 91E135] (277 aa)
Score = 208, Expect = 6.9e-15, Identities = 67/228 (29%), Positives = 118/228 (51%)
  Q:    62 EYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKT--QFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPSTKCEPKQALFA-PQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYIK 289
           E  K+  Q+N++     P+ YI K+  F G+ F+I K   +PR++TE +++ A+ Q K  +   ILDLC GSG +  TI++  K K   V   + +    KV +KN + LKL+   +   SD+ K     +E    II NPPY++K++  +      EP+ AL    ++G     + + +    LA    +I E+   Q + ++ F I+      K + D++ ++R L ++
  S:    47 EEHKLSCQINRI-RSGTPINYILKTKEFMGIEFYINKHVLIPREDTECLVEEALIQIKKHNLNKILDLCCGSGCIGLTIAHYLKCK---VTLSDISNKALKVSLKNTQKLKLENYIEIQYSDLLKYINKEFE---LIITNPPYLNKDELKIKEKLIKEPRIALLGFGKDGLEIPKKIIRQAKHKLAKNGLLIIEMAPWQTKSLKDFAIQEGFDYLKTIYDIESRERALVLR 270
>gi|189485188|ref|YP_001956129.1| methylase of polypeptide chain release factors [uncultured Termite group 1 bacterium phylotype Rs-D17] >gi|170287147|dbj|BAG13668.1| methylase of polypeptide chain release factors [uncultured Termite group 1 bacterium phylotype Rs-D17] (288 aa)
Score = 208, Expect = 7.0e-15, Identities = 63/212 (29%), Positives = 111/212 (52%)
  Q:    75 NKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQR-NLKLKTQFIKSDIFK-IDRSHYEKCDFIICNPPYIDKNDPN-VDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVL 286
           +K  PV YI     F    F + K   +PR ETE +++ A+K  K  +K  +LDLC+GSG +A +++ + K KD  ++  + + +  ++  +N R N  L   F+KS++F  I   ++   D II NPPY+   + + ++P  K EP+ AL A  +G +FY +   +    L +   I+ E+   +  EI++     +    + +KD     R+L
  S:    69 SKREPVAYIMGLAGFMDFEFKVNKNVLIPRPETEILVETALKIAKKENKNSVLDLCTGSGCIAVSLAKLGKFKD--IMASDVSGSALEIARENARSNNVLDINFVKSNVFSGISGKNF---DIIISNPPYVSHEEYDALEPELKYEPEIALAADDSGLFFYKKIAGKAGRYLNDNGFILIELNAYKAGEIKQIFSTCSYKNIEIVKDYAGLPRML 278
>gi|161507267|ref|YP_001577221.1| protoporphyrinogen oxidase [Lactobacillus helveticus DPC 4571] >gi|160348256|gb|ABX26930.1| Protoporphyrinogen oxidase [Lactobacillus helveticus DPC 4571] (280 aa)
Score = 208, Expect = 7.3e-15, Identities = 73/221 (33%), Positives = 117/221 (52%)
  Q:    67 LKQLNK---VLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSH-----YEKCDFIICNPPYIDKN-----DPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITV-FKFLKDLDDKDRVLY 287
           LKQ NK    L K +  QYI     F+G    +++G  +PR ETE +++W +K  K  DK  +LDL +GSG +   ++     K+A   G+ K+ T Y   + +      +  F+  D+  + R        EK D II NPPYI        D NV    + EPK+ALFA  +G  FY +F  ++   L +  E   E GF++++++++   K       +F KD+  K R+++
  S:    52 LKQANKDIKKLAKGVSPQYILGYAWFFGYKIMVQRGVLIPRFETEELVEWTLKSLKSGDK--VLDLGTGSGCITVALA-----KEAEKKGI-KDLTLYASDITDAALRTSEENFLTYDLDVVTRKANVLIGLEKFDKIISNPPYIKTTEKKEMDANV---LQNEPKEALFAGNDGLDFYKKFAKQVRDHLNSHGEFFLEFGFSEEDQLKELFAKELPDFDIEFRKDMAGKPRMVH 275
>gi|163729707|ref|ZP_02137186.1| peptide release factor-glutamine N5-methyltransferase [Vibrio fischeri MJ11] >gi|161397164|gb|EDQ21454.1| peptide release factor-glutamine N5-methyltransferase [Vibrio fischeri MJ11] (284 aa)
Score = 207, Expect = 8.7e-15, Identities = 64/219 (29%), Positives = 107/219 (48%)
  Q:    67 LKQLNKVLNKNI---PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQR-NLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNV-DPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           L   N +L + +   P+ YI     F+ L   +     +PR +TE +++ A+      + + ILDL +G+G +A  I+   +     VIGV+      ++  +N + N     +F +   F+   S  +K D I+ NPPYID NDP++ +   + EP+ AL A QNG+      +      L NG  ++ E GF Q E++  F  ++     K  +D    DRV
  S:    56 LGNFNALLERRLAGEPIAYIVGYREFWSLPLKVSPTTLIPRPDTERLVEVALDHLT-PNAQSILDLGTGTGAIALAIA--SEMPTLNVIGVDYQDDAVELAKENAKINHINNVEFRQGSWFE-PISLSDKFDIIVSNPPYIDGNDPHLSEGDVRFEPQTALVAEQNGFSDLIHIMQHGREYLLNGGWLMMEHGFEQGEQLRHFFEEHGYINVKTEQDYTGNDRV 275
>gi|94500022|ref|ZP_01306557.1| modification methylase, HemK family protein [Oceanobacter sp. RED65] >gi|94427880|gb|EAT12855.1| modification methylase, HemK family protein [Oceanobacter sp. RED65] (281 aa)
Score = 207, Expect = 8.8e-15, Identities = 64/249 (25%), Positives = 120/249 (48%)
  Q:    36 ELILFNSKIIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQR-NLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNV-DPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDR 284
           EL+L +  + +  + +F   DTE+  E      QL +   +  PV YI     F+ L+  +     +PR +TE ++D+ V+     + K +LDL +G+G LA  ++  K+   A V+ V+       +  +N + N     + ++SD F +      + D I+ NPPYID ND ++ +   + EPK AL A ++G     +  ++    L     ++ E G++Q   +     ++  +  +  +DL  +DR
  S:    28 ELLLLHV-LKQTRTFLFTHSDTELSQEQYLQFTQLLERRKQGEPVAYIIGQTGFWDLTIKVSPATLIPRGDTESLMDYIVEH---FNPKNVLDLGTGTGALA--LATAKEYPQASVVAVDVIEEAVALAKENAKLNKVTNVEILQSDWFALVPK--RRFDLIVSNPPYIDANDHHLGEGDVRYEPKSALVAERHGLADIEKICNQALSFLTEDGCLMVEHGYDQGPHVRAIFSQSGFSNIETHQDLAGRDR 270
>gi|16273459|ref|NP_439708.1| hypothetical protein HI1559 [Haemophilus influenzae Rd KW20] >gi|1170230|sp|P45253|HEMK_HAEIN Protein hemK homolog (M.HindHemKP) >gi|1574403|gb|AAC23208.1| hemK protein (hemK) [Haemophilus influenzae Rd KW20] (292 aa)
Score = 207, Expect = 9.3e-15, Identities = 76/274 (27%), Positives = 139/274 (50%)
  Q:    12 SMTFSELTKRLNPLDDSQIKWILKELILFNSKIIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNI---PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVK--QKKLIDKK---YILDLCSGSG----VLANTISYI--KKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDP-STKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           +   ++L K+ NP ++S+I      L+L      ++ + I    DTEID   +K+  +L  +L++ +   P+ YI     F+ L   + KG  +PR +TE +++ A++   +KL +      ILDL +G+G     LA+ ++ I  K++    +IGV+       +   N    +L  +F++S  F    +   K D I+ NPPYID  D ++     + EP  AL A   GY      +      L +   ++ E G+ Q E++     +N+  + + ++D  D +RV
  S:     8 AQAIADLAKK-NPTENSKID----ALVLLQHATGKSRTQILAFDDTEID---EKVRLKLTALLDRRLKGEPIAYILGEKEFWSLPLNVSKGTLIPRPDTEILVEKALQIALEKLEENPPHFRILDLGTGTGAIALALASELAPICQKRHIPLEIIGVDLMSDVVALAQSNAERNQLNVEFLQSRWFD---NITGKFDLIVSNPPYIDAQDEHLHQGDVRFEPLSALVANDEGYADLRHIIELASSYLNSNGVLLLEHGWQQGEKVRSIFQENHWEMVETVRDYSDNERV 285
>gi|110601333|ref|ZP_01389525.1| modification methylase, HemK family [Geobacter sp. FRC-32] >gi|110547966|gb|EAT61200.1| modification methylase, HemK family [Geobacter sp. FRC-32] (284 aa)
Score = 207, Expect = 9.6e-15, Identities = 61/208 (29%), Positives = 101/208 (48%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKND-PNVDPSTK-CEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKF-LKDLDDKDRVL 286
           P+QYI  S  F GL F +     +PR +TE +++ AVK+        ILD+ +GSG +  +IS  K    AI+ GV+ +     V  KN     +  + +   +F+  +   ++   ++ NPPYI  +D   + P  +  EP  AL   ++G  FY + ++     L  G  ++ E+G  Q E++ K    N      F  KD  D +RV+
  S:    75 PLQYILGSQEFMGLDFAVAPAVLIPRHDTEVLVNEAVKRAG--KTSSILDVGTGSGCI--SISLAKALPGAIITGVDTSVDALAVAEKNCNTHGVAVKLLHGSLFEPVQG--QQFHMVVSNPPYIPSDDLKTLQPEVRDYEPAGALDGGKDGLDFYRQIVAAATDYLVCGGWLLLEVGIGQAEQVRKLFFDNGKFAEVFAAKDTADIERVV 279
>gi|24379521|ref|NP_721476.1| putative protoporphyrinogen oxidase [Streptococcus mutans UA159] >gi|24377462|gb|AAN58782.1|AE014946_7 putative protoporphyrinogen oxidase [Streptococcus mutans UA159] (278 aa)
Score = 207, Expect = 9.8e-15, Identities = 71/242 (29%), Positives = 118/242 (48%)
  Q:    47 NSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHY-EKCDFIICNPPYIDKNDPN-VDPSTKC-EPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKN--NITVFKFLKDLDDKDRVLYI 288
           N +D   ++  EI       L+++ + L ++IP QYIT    F  L   + +   +PR ETE ++   +K+ +      +LD+ +GSG +A  ++  K   D  V   + +     +  +N    +    F++SDIF    SH  +K D I+ NPPYI   D + V+ +    EP  ALFA  +G  FY +   E    L    +I  EIG+ Q E + +   +   N  V + L+D   KDR++ +
  S:    36 NQTDFILQQPQEIAEADLTKLEEIMQQLRQHIPAQYITGKAYFADLILSVDERVLIPRPETEELVKLILKENQHRSSAKLLDIGTGSGAIA--LALAKAQPDWQVWASDISEDALNLAQENATVNQAAVTFLQSDIF----SHISDKYDIIVSNPPYISLRDQDEVEQNVLAHEPHLALFADNDGLAFYQKLALEAEHYLKLTGKIYLEIGYKQGEAVSQLFERQFPNKRV-RLLQDSFGKDRMVVV 275
>gi|148988473|ref|ZP_01819920.1| HemK protein [Streptococcus pneumoniae SP6-BS73] >gi|147926154|gb|EDK77228.1| HemK protein [Streptococcus pneumoniae SP6-BS73] (279 aa)
Score = 207, Expect = 1.0e-14, Identities = 65/220 (29%), Positives = 107/220 (48%)
  Q:    49 SDIFFEKDTEIDFEY-KKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDP-----NVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKN 268
           +D  F    E+  E  K+ ++ + + L  + P QYI     FYG+   + +   +PR ETE +++  + +  L     +LD+ +GSG +A  ++  K   D  V   + ++   ++  +N  N  L   F KSD F       EK D I+ NPPYI + D      NV  S   EP  A+FA ++G   Y R   +    L +G +I  EIG+ Q + + +   K+
  S:    37 TDFIFALQQEVTTEEEKQFVEDIYQQLAAHKPAQYIIGQADFYGMHLKVDERVLIPRPETEELVELILTEN-LETNLSVLDIGTGSGAIA--LALAKNRPDWSVTAADVSQEALELASENASNQNLNIFFKKSDCFA---EISEKYDIIVSNPPYISREDESEVGLNVLHS---EPHLAIFADEDGLAIYCRIAEDAKDYLKDGGKIYLEIGYKQGQSVPELFRKH 253
>gi|149006295|ref|ZP_01830007.1| serine hydroxymethyltransferase [Streptococcus pneumoniae SP18-BS74] >gi|147762072|gb|EDK69034.1| serine hydroxymethyltransferase [Streptococcus pneumoniae SP18-BS74] (279 aa)
Score = 207, Expect = 1.1e-14, Identities = 70/240 (29%), Positives = 117/240 (48%)
  Q:    49 SDIFFEKDTEIDFEY-KKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDP-----NVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKN-NITVFKFLKDLDDKDRVLYI 288
           +D  F    E+  E  K+ ++ + + L  + P QYI     FYG+   + +   +PR ETE +++  + +  L     +LD+ +GSG +A  ++  K   D  V   + ++   ++  +N  +  L   F KSD F       EK D I+ NPPYI + D      NV  S   EP  ALFA ++G   Y R   +    L +G +I  EIG+ Q + + +   K+      + LKD   +DR++ +
  S:    37 TDFIFALQQEVTTEEEKQFVEDIYQQLAAHKPAQYIIGQADFYGMHLKVDERVLIPRPETEELVELILTEN-LETNLSVLDIGTGSGAIA--LALAKNRPDWSVTAADVSQEALELASENASDQNLNIFFKKSDCFA---EISEKYDIIVSNPPYISREDESEVGLNVLHS---EPHLALFADEDGLAIYCRIAEDAKDYLKDGGKIYLEIGYKQGQSVPELFRKHLPEKKVRTLKDQFGQDRMVVV 274
>gi|154249579|ref|YP_001410404.1| HemK family modification methylase [Fervidobacterium nodosum Rt17-B1] >gi|154153515|gb|ABS60747.1| modification methylase, HemK family [Fervidobacterium nodosum Rt17-B1] (258 aa)
Score = 207, Expect = 1.1e-14, Identities = 73/254 (28%), Positives = 126/254 (49%)
  Q:    35 KELILFNSKIIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYI 288
           +E ++  SK++E S +     D E++   + I + L K L    P+QYI     F+G  F+I++G  +PR ETE +++ A+   +    K +L++  GSGV+  T++           G + N    +V  KN +   +  +    +  +     +++ + I+ NPPY+ + D  +    + EP  ALFA ++G  FY +F  E Y I   G  ++ EIG +Q E + K      +T  + LKDL  KDR L +
  S:    18 REALILISKVLERSKEFVISHD-ELECPEQAI-ELLEKRLT-GYPLQYILGEVEFFGRKFYIEEGVLIPRWETEGLVEIAIDLIRKNGIKKVLEIGVGSGVILITLAL---ETGVECYGTDINPKAIEVTRKNSQMYDVSCELKLGEYAEPFIEKFDEFELIVSNPPYV-RADAVLPIEVQYEPPDALFAGKDGLDFYKKFF-ERYNI--QGKIVVMEIGEDQGEALRK------LTGGEILKDLAGKDRYLVV 255
>gi|148377996|ref|YP_001256872.1| protoporphirogen oxidase HEMK [Mycoplasma agalactiae PG2] >gi|148292042|emb|CAL59434.1| Protoporphirogen oxidase HEMK [Mycoplasma agalactiae PG2] (240 aa)
Score = 206, Expect = 1.2e-14, Identities = 68/215 (31%), Positives = 109/215 (50%)
  Q:    74 LNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLK----TQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPSTK-CEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYI 288
           LN+  P+QYI     +  +   +     +PR ETE ++ + +  + L     +LDLC+GSG +   +   KKN D+I + +        +       L  K     + ++SD FK  +  +   D I+ NPPY+D +D +VD S K  EP+ ALFA  +G+YFY + L+E    L  G  + FEI     + I+++     I   K +KD+  KDR  +I
  S:    28 LNQGYPIQYIMGYVEYVNVRINLNHKVLIPRYETEELV-YILLNEHLKPGMKVLDLCTGSGFIGIAL---KKNLDSINVTLSDIDNEAIMQANENVALNFKDTEGIKVVQSDCFKDIKGKF---DLIVSNPPYLDYDDKDVDESVKKFEPEIALFAKDSGWYFYEKILNEAKIYLNVGGVLAFEI---NPKHIDRW---KQINGAKIVKDMSSKDRFAFI 234
>gi|126653460|ref|ZP_01725556.1| modification methylase, HemK family protein [Bacillus sp. B14905] >gi|126589816|gb|EAZ83949.1| modification methylase, HemK family protein [Bacillus sp. B14905] (286 aa)
Score = 206, Expect = 1.4e-14, Identities = 67/209 (32%), Positives = 103/209 (49%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAV-KQKKLIDKKY--ILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYI--DKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEII-FEIGFNQKEEIEKFLIKN-NITVFKFLKDLDDKDRVLY 287
           PVQY   S  FYG SF + +   +PR ETE ++   + +  KL   +   + D+ +GSG +A  IS   +     V+  + +        KN + L+    F   D+        EK D I+ NPPYI  D+ +   D   K EP  ALFA ++G   Y R L+E  P+  N   +I  EIG+ Q E++ KF   +         KD++ K R+++
  S:    71 PVQYCVGSEEFYGRSFIVDESVLIPRPETEELILGTINRMTKLFQHQALKVADIGTGSGAIA--ISMKLECPALTVVATDLSEDALATAQKNAQRLEADIDFRLGDLTAPLAG--EKFDIILSNPPYIAFDEAEAMSDVVLKHEPHSALFAEEDGLILY-RQLAEQLPMYMNKPALIGLEIGYTQGEKVAKFFQDSFPQATISIEKDINGKPRMIF 281
>gi|15793377|ref|NP_283199.1| HemK protein [Neisseria meningitidis Z2491] (273 aa)
Score = 206, Expect = 1.4e-14, Identities = 62/207 (29%), Positives = 100/207 (48%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPST-KCEPKQALFAPQNGYYFYFRFLSEIYP-ILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           PV YI  +  FYG  F +     +PR ETE++++  +   +L +   + DL +GSG +A T++   +  DA V   + +    +   KN  +L  + +F     F  D     K D I+ NPPYI+  D ++     + EP+ AL    +G     R L++  P  LA G  ++ E GF+Q   +   L +N  +  + L DL   DRV
  S:    60 PVAYILGAREFYGRRFTVNPSVLIPRPETEHLVEAVLA--RLPENGRVWDLGTGSGAVAVTVAL--ERPDAFVRASDISPPALETARKNAADLGARVEFAYGSWFDTDMPSEGKWDIIVSNPPYIENGDKHLSQGDLRFEPQIALTDFSDGLSC-IRTLAQGAPDRLAEGGFLLLEHGFDQGAAVRGVLAENGFSGVETLPDLAGLDRV 263
>gi|194099711|ref|YP_002002846.1| HemK [Neisseria gonorrhoeae NCCP11945] >gi|193935001|gb|ACF30825.1| HemK [Neisseria gonorrhoeae NCCP11945] (295 aa)
Score = 205, Expect = 1.4e-14, Identities = 61/207 (29%), Positives = 99/207 (47%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPST-KCEPKQALFAPQNGYYFYFRFLSEIYP-ILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           PV YI     FYG  F +     +PR ETE++++  +   +L +   + DL +GSG +A T++   +  DA V   + +    +   KN  +L  + +F     F  D     + D I+ NPPYI+  D ++     + EP+ AL    +G     R L++  P  LA G  ++ E GF+Q   +   L +N  +  + L DL   DRV
  S:    82 PVAYILGVREFYGRRFTVNPNVLIPRPETEHLVEAVLA--RLPENGRVWDLGTGSGAVAVTVAL--ERPDAFVRASDISTPALETARKNAADLGARVEFAHGSWFDTDMPSERQWDIIVSNPPYIENGDKHLSQGDLRFEPQIALTDFSDGLSC-IRTLAQGAPDRLAEGGFLLLEHGFDQGAAVRGVLAENGFSGVEILPDLAGLDRV 285
>gi|59802323|ref|YP_209035.1| hypothetical protein NGO2015 [Neisseria gonorrhoeae FA 1090] >gi|59719218|gb|AAW90623.1| putative protoporphyrinogen oxidase [Neisseria gonorrhoeae FA 1090] (285 aa)
Score = 205, Expect = 1.4e-14, Identities = 61/207 (29%), Positives = 99/207 (47%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPST-KCEPKQALFAPQNGYYFYFRFLSEIYP-ILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           PV YI     FYG  F +     +PR ETE++++  +   +L +   + DL +GSG +A T++   +  DA V   + +    +   KN  +L  + +F     F  D     + D I+ NPPYI+  D ++     + EP+ AL    +G     R L++  P  LA G  ++ E GF+Q   +   L +N  +  + L DL   DRV
  S:    72 PVAYILGVREFYGRRFTVNPNVLIPRPETEHLVEAVLA--RLPENGRVWDLGTGSGAVAVTVAL--ERPDAFVRASDISTPALETARKNAADLGARVEFAHGSWFDTDMPSERQWDIIVSNPPYIENGDKHLSQGDLRFEPQIALTDFSDGLSC-IRTLAQGAPDRLAEGGFLLLEHGFDQGAAVRGVLAENGFSGVEILPDLAGLDRV 275
>gi|169182757|ref|ZP_02843271.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Thauera sp. MZ1T] >gi|169010165|gb|EDS56933.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Thauera sp. MZ1T] (289 aa)
Score = 205, Expect = 1.5e-14, Identities = 58/208 (27%), Positives = 97/208 (46%)
  Q:    78 IPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIF-KIDRSHYEKCDFIICNPPYIDKNDPNVDP-STKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           +PV Y+T +  FYG  F +     +PR ETE +++ A+          +LDL +GSG LA T++   + + A V+ ++++R    V + N   L     F++SD F  +   H+E    I+ NPPY+   DP+++    + EP+ AL A   G       ++     L +G  +  E G++Q       L            DL   +RV
  S:    71 VPVAYLTGTREFYGREFLVTPAVLIPRPETELLVELALAHFPGRRGLRVLDLGTGSGALAVTLAL--ELEAAEVVALDRSREALWVAMANAARLGASVSFVQSDWFGALGDEHFE---LIVSNPPYVAAGDPHLEQGDVRFEPRGALAAGPQGLDDLAEIVAGAPARLVDGGWLFLEHGYDQAASARGLLADAGFAAIASWADLAGIERV 275
>gi|168487486|ref|ZP_02711994.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Streptococcus pneumoniae CDC1087-00] >gi|183569705|gb|EDT90233.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Streptococcus pneumoniae CDC1087-00] (279 aa)
Score = 205, Expect = 1.5e-14, Identities = 65/220 (29%), Positives = 107/220 (48%)
  Q:    49 SDIFFEKDTEIDFEY-KKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDP-----NVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKN 268
           +D  F    E+  E  K+ ++ + + L  + P QYI     FYG+   + +   +PR ETE +++  + +  L     +LD+ +GSG +A  ++  K   D  V   + ++   ++  +N  +  L   F KSD F       EK D I+ NPPYI + D      NV  S   EP  ALFA ++G   Y R   +    L +G +I  EIG+ Q + + +   K+
  S:    37 TDFIFALQQEVTTEEEKQFIEDIYQQLAAHKPAQYIIGQADFYGMHLKVDERVLIPRPETEELVELILTEN-LETNLSVLDIGTGSGAIA--LALAKNRPDWSVTAADVSQEALELASENASDQNLNIFFKKSDCFA---EISEKYDIIVSNPPYISREDESEVGLNVLHS---EPHLALFADEDGLAIYCRIAEDAKDYLKDGGKIYLEIGYKQGQSVPELFRKH 253
>gi|124002114|ref|ZP_01686968.1| protoporphyrinogen oxidase [Microscilla marina ATCC 23134] >gi|123992580|gb|EAY31925.1| protoporphyrinogen oxidase [Microscilla marina ATCC 23134] (288 aa)
Score = 205, Expect = 1.5e-14, Identities = 64/222 (28%), Positives = 108/222 (48%)
  Q:    65 KILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHY--EKCDFIICNPPYIDKNDPNV--DPSTKCEPKQALFAPQNGYYFYFRFLSEI-YPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVL 286
           ++L    + L +  P+QYITK   FYGL F +K G  +PR ETE ++ W + Q        +LD+ +GSG +A T++  K    A V  ++ +     +  +N    K+  Q+I  +I     +H+  +  D I+ NPPY+   +     +   K EP  ALF PQN    ++  ++++    L     + FEI        +K + +      +  KDL  KDR++
  S:    58 QVLDNALRRLQQYEPIQYITKQAEFYGLPFRVKPGVLIPRPETEELVAWII-QDFQSQPLTLLDIGTGSGCIAVTLA--KNMPQAQVNALDVSNEALTIAQQNAALNKVNIQWIAHNILAPSFTHFADQSLDVIVSNPPYVTPAEQAQMHENVLKHEPALALFVPQNEPLLFYEAITQVARQKLKPQGALYFEINEQFGAITKKMIEQQGFQEVEVRKDLFGKDRMV 281
>gi|116511388|ref|YP_808604.1| methylase of polypeptide chain release factor [Lactococcus lactis subsp. cremoris SK11] >gi|116107042|gb|ABJ72182.1| Methylase of polypeptide chain release factor [Lactococcus lactis subsp. cremoris SK11] (271 aa)
Score = 205, Expect = 1.6e-14, Identities = 66/225 (29%), Positives = 113/225 (50%)
  Q:    66 ILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYI--DKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEK-FLIKNNITVFKFLKDLDDKDRVLYIKK 290
           +L +L++ L KN P QYI     FY L F + +   +PR ETE +++  + +    D   ILD+ +GSG +A  IS  K  ++  V   + ++   ++  +N +   +  +FI+SD+        ++ D I+ NPPYI  D+     D   K EP  ALFA   G   Y +   +    L +  +I  EIG+ Q + ++  F  K    +    +D+  KDR++ +K+
  S:    50 LLTELSERLIKNEPPQYIVGWAEFYELKFKVDERVLIPRPETEELVEMILTENN-NDSLKILDIGTGSGAIA--ISLAKARQNWSVKASDISQNALELAAENAKMNHVNLEFIQSDVMD---ELTDRFDIIVSNPPYIAFDETYEMDDSVIKYEPDLALFAQNQGLAIYQKIADQAVNHLTDDGKIYLEIGYKQGKAVQAIFQEKFTDRLVSIHQDIFGKDRMISVKR 271
>gi|126701108|ref|YP_001090005.1| protein methyltransferase [Clostridium difficile 630] >gi|145952639|ref|ZP_01801648.1| hypothetical protein CdifQ_04004015 [Clostridium difficile QCD-32g58] >gi|168697774|ref|ZP_02730051.1| protein methyltransferase [Clostridium difficile QCD-37x79] >gi|168714955|ref|ZP_02747232.1| protein methyltransferase [Clostridium difficile QCD-63q42] >gi|168726409|ref|ZP_02758686.1| protein methyltransferase [Clostridium difficile QCD-76w55] >gi|168730145|ref|ZP_02762422.1| protein methyltransferase [Clostridium difficile QCD-97b34] >gi|196124992|ref|ZP_03116741.1| protein methyltransferase [Clostridium difficile ATCC 43255] >gi|115252545|emb|CAJ70388.1| protein methyltransferase [Clostridium difficile 630] (282 aa)
Score = 205, Expect = 1.6e-14, Identities = 62/208 (29%), Positives = 103/208 (49%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQ--RNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNV--DPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVL 286
           P+ YI ++  F GL FF+K+G  +PR +TE +++  ++  +      ILD+ +GSG +  TIS  K  +++ ++  + + T  ++  KN     +  K ++I SD+F        K D I+ NPPYI K D           EP  AL   ++G  FY R   +    L     + +E+G NQ E++   +  N        KD+   DRV+
  S:    68 PIAYIVENREFMGLDFFVKEGVLIPRPDTETLVEEIIEICREKKDVSILDIGTGSGAI--TISLAKYIENSKIMSFDISETALEIAKKNAIINEVGEKIKYINSDLFTAISDSNIKFDIIVSNPPYIKKQDIETLHKQVKDYEPYNALEGGEDGLDFYRRITEQGKKYLNKCGILAYEVGHNQAEDVINIMKSNGYKKIYTKKDIQGIDRVV 277
>gi|77979776|ref|ZP_00835192.1| COG2890: Methylase of polypeptide chain release factors [Yersinia intermedia ATCC 29909] (276 aa)
Score = 205, Expect = 1.6e-14, Identities = 59/230 (25%), Positives = 105/230 (45%)
  Q:    56 DTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQ-FIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDP-STKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           +TE+  +  ++L+QL     +  P+ Y+     F+ L   +     +PR +TE +++ A+    +   + ILDL +G+G +A  ++   +  D  V+GV+       +   N   L ++   F++S  F      +     I  NPPYID NDP+++    + EP  AL AP  G       +      L  G  ++ E G+ Q + ++K L     +     KD  + DRV
  S:    44 ETELAADQLQVLEQLATRREQGEPIAYLVGEREFWSLPLSVSSATLIPRPDTECLVEQALALLPVTPCR-ILDLGTGTGAIA--LALASERPDCAVVGVDIQADAVALACHNAEKLAIENVCFLQSSWFDTVSGRFA---LIASNPPYIDANDPHLNEGDVRFEPHSALVAPAEGIASLDEIIRRAPAYLEAGGWLLLEHGWQQADAVQKLLNTAGFSAVMTHKDYGNNDRV 269
>gi|53732833|ref|ZP_00349588.1| COG2890: Methylase of polypeptide chain release factors [Haemophilus influenzae R2846] >gi|148826081|ref|YP_001290834.1| hypothetical protein CGSHiEE_05375 [Haemophilus influenzae PittEE] >gi|148716241|gb|ABQ98451.1| HemK [Haemophilus influenzae PittEE] (292 aa)
Score = 205, Expect = 1.6e-14, Identities = 75/263 (28%), Positives = 133/263 (50%)
  Q:    23 NPLDDSQIKWILKELILFNSKIIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNI---PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVK--QKKLIDKK---YILDLCSGSG----VLANTISYI--KKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDP-STKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           NP ++S+I      L+L      ++ + I    DTEID   +K+  +L  +L++ +   P+ YI     F+ L   + KG  +PR +TE +++ A++   +KL +      ILDL +G+G     LA+ ++ I  K++    +IGV+       +   N    +L  QF++S  F    +   K D I+ NPPYID  D ++     + EP  AL A   GY      +      L +   ++ E G+ Q E++    ++N   + + ++D  D +RV
  S:    18 NPTENSKID----ALVLLQHVTGKSRTQILTFDDTEID---EKVRLKLTALLDRRLKGEPIAYILGEKEFWSLPLNVSKGTLIPRPDTESLVEKALQIALEKLEENPPHFRILDLGTGTGAIALALASELAPICQKRHIPLEIIGVDLMPDVVALARSNAERNQLNVQFLQSSWFD---NITGKFDLIVSNPPYIDVQDEHLHQGDVRFEPLSALVANDEGYADLRHIIELASSYLNSNGVLLLEHGWQQGEKVRSIFLENYWEMVETVRDYGDNERV 285
>gi|163750756|ref|ZP_02157991.1| hemK family protein [Shewanella benthica KT99] >gi|161329451|gb|EDQ00445.1| hemK family protein [Shewanella benthica KT99] (278 aa)
Score = 205, Expect = 1.7e-14, Identities = 61/223 (27%), Positives = 112/223 (50%)
  Q:    62 EYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKL-KTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDP-STKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDR 284
           +Y K++++  +VL    P+ +I     F+ L F +     +PR +TE +++ A+    L +   +LDL +G+G +A +++Y KK     +  V+K      +   N+ +LKL + + I+SD F  D       + I+ NPPYID+ D ++D    + EP+ AL A + G+   +   +     LA G  ++ E G+ Q   + K +I+        ++D    DR
  S:    55 DYTKMVQR--RVLGT--PIAHIVGEREFWSLPFMVNPTTLIPRPDTEILVETALNL-PLAENAQVLDLGTGTGAIALSLAYEKKEWQ--ITAVDKIIEAVALAKANREHLKLQQVEIIQSDWF--DSVTCYDFNLIVSNPPYIDETDAHLDQGDVRFEPQSALTAGEAGFADLYYIAASARDYLAPGGYLLLEHGYQQAMPLRKKMIELGYENVATVRDFGSNDR 270
>gi|148994242|ref|ZP_01823535.1| serine hydroxymethyltransferase [Streptococcus pneumoniae SP9-BS68] >gi|148998843|ref|ZP_01826279.1| HemK protein [Streptococcus pneumoniae SP11-BS70] >gi|168488842|ref|ZP_02713041.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Streptococcus pneumoniae SP195] >gi|168494450|ref|ZP_02718593.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Streptococcus pneumoniae CDC3059-06] >gi|147755270|gb|EDK62321.1| HemK protein [Streptococcus pneumoniae SP11-BS70] >gi|147927383|gb|EDK78414.1| serine hydroxymethyltransferase [Streptococcus pneumoniae SP9-BS68] >gi|183572386|gb|EDT92914.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Streptococcus pneumoniae SP195] >gi|183575598|gb|EDT96126.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Streptococcus pneumoniae CDC3059-06] (279 aa)
Score = 205, Expect = 1.8e-14, Identities = 65/220 (29%), Positives = 107/220 (48%)
  Q:    49 SDIFFEKDTEIDFEY-KKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDP-----NVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKN 268
           +D  F    E+  E  K+ ++ + + L  + P QYI     FYG+   + +   +PR ETE +++  + +  L     +LD+ +GSG +A  ++  K   D  V   + ++   ++  +N  +  L   F KSD F       EK D I+ NPPYI + D      NV  S   EP  ALFA ++G   Y R   +    L +G +I  EIG+ Q + + +   K+
  S:    37 TDFIFALQQEVTTEEEKQFVEDIYQQLAAHKPAQYIIGQADFYGMHLKVDERVLIPRPETEELVELILTEN-LETNLSVLDIGTGSGAIA--LALAKNRPDWSVTAADVSQEALELASENASDQNLNIFFKKSDCFA---EISEKYDIIVSNPPYISREDESEVGLNVLHS---EPHLALFADEDGLAIYCRIAEDAKDYLKDGGKIYLEIGYKQGQSVPELFRKH 253
>gi|118052147|ref|ZP_01520694.1| modification methylase, HemK family [Comamonas testosteroni KF-1] >gi|118000275|gb|EAV14432.1| modification methylase, HemK family [Comamonas testosteroni KF-1] (291 aa)
Score = 204, Expect = 1.8e-14, Identities = 56/197 (28%), Positives = 94/197 (47%)
  Q:    69 QLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFL 265
           QL  +  + +PV Y+T S  FYGL   +      PR +TE ++DWA++         ++DL +GSG +A  ++   +   A VI V+ +     V   N   L+L  Q       +      E  D I+ NPPYI  +DP++   T  EP  AL +  +G       + +    L +G  ++FE G++Q E++ + +
  S:    70 QLCALRQQGMPVAYLTGSKEFYGLDLAVDSRVLDPRPDTETLVDWALELIPEGQPVRVVDLGTGSGAIA--LALQSQRPSARVIAVDASADALAVARSNAARLQLPVQLAHGSWLE-PLDGLEPVDLIVSNPPYIRADDPHLAALTH-EPLSALASGADGLEDIRSIIDQAPARLKDGGWLLFEHGWDQAEDVARLM 262
>gi|71894204|ref|YP_278312.1| protoporphirogen oxidase HemK [Mycoplasma synoviae 53] >gi|71850992|gb|AAZ43601.1| Protoporphirogen oxidase HemK [Mycoplasma synoviae 53] (241 aa)
Score = 204, Expect = 2.0e-14, Identities = 71/222 (31%), Positives = 112/222 (50%)
  Q:    68 KQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIG---FNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYIK 289
           K+LN +L+KN P+Q I        +   +     +PR ETE ++  A +  K      +LDL +GSG +A  I   KK   A +   + ++   +   KN +  KL    I S+ F    +  +K + IICNPPYI K +   +   K EPK+AL+A  +G+YFY + +S+    L N   +IFE+     ++  EI+   +K NI    F  D+ +  R+  IK
  S:    21 KELN-LLSKNYPIQKIIGHVEMLNVKIDLSYKVLIPRYETEEVILKAFEYIKNDSSFKVLDLATGSGFIALAIK--KKFSSAKIYASDISKIALRQASKNAQINKLDIGLIHSNWFS---NVNQKFNLIICNPPYIGKYEELSESIKKYEPKKALYAKDDGFYFYKKIISQAPKYLQNEKLLIFELSALHLDKWNEIKNQKVKYNINSITFFNDIANLLRIAIIK 239
>gi|59711376|ref|YP_204152.1| N5-glutamine methyltransferase, modifies release factors RF-1 and RF-2 [Vibrio fischeri ES114] >gi|59479477|gb|AAW85264.1| N5-glutamine methyltransferase, modifies release factors RF-1 and RF-2 [Vibrio fischeri ES114] (284 aa)
Score = 204, Expect = 2.1e-14, Identities = 64/219 (29%), Positives = 106/219 (48%)
  Q:    67 LKQLNKVLNKNI---PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQR-NLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNV-DPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           L   N +L + +   P+ YI     F+ L   +     +PR +TE +++ A+      + + ILDL +G+G +A  I+   +     VIGV+      ++   N + N     +F +   F+   S  +K D I+ NPPYID NDP++ +   + EP+ AL A QNG+      +      L NG  ++ E GF Q E++  F  ++     K  +D    DRV
  S:    56 LGNFNALLERRLAGEPIAYIVGYREFWSLPLKVSPTTLIPRPDTERLVEVALDHLT-PNAQSILDLGTGTGAIALAIA--SEMPTLNVIGVDYQDDAVELAKGNAKINHINNVEFRQGSWFE-PISLSDKFDIIVSNPPYIDGNDPHLSEGDVRFEPQTALVAEQNGFSDLIHIMQHGREYLLNGGWLMMEHGFEQGEQLRHFFEEHGYINVKTEQDYAGNDRV 275
>gi|68536430|ref|YP_251135.1| methylase of peptide chain release factors [Corynebacterium jeikeium K411] >gi|68264029|emb|CAI37517.1| methylase of peptide chain release factors [Corynebacterium jeikeium K411] (308 aa)
Score = 204, Expect = 2.1e-14, Identities = 47/158 (29%), Positives = 82/158 (51%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNL-KLKTQFIKSDIF-----------KIDRSHYEKCDFIICNPPYIDKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFL 236
           P+Q+I  S  F GL  F++ GCFVPR ETE + DWA          +++DLC G G L   +S++     ++  G E +    ++  KN R + ++   F+++D+             +    +   D ++CNPPY+ ++   + P    +P  A+F+  +G     R L
  S:    85 PLQHIVGSAPFCGLDLFVEPGCFVPRPETELLADWAAHFLTGRPTPHVVDLCCGPGTLGLGVSFLYDAPISLT-GFEISPAALRLAEKNARLVPQVNATFVQADLAVDDPLEPPATRDVSPGAFAPADVVVCNPPYVPEST-EISPEVAADPHAAVFSGDDGLDLMPRVL 252
>gi|167750128|ref|ZP_02422255.1| hypothetical protein EUBSIR_01097 [Eubacterium siraeum DSM 15702] >gi|167656871|gb|EDS01001.1| hypothetical protein EUBSIR_01097 [Eubacterium siraeum DSM 15702] (275 aa)
Score = 204, Expect = 2.1e-14, Identities = 63/208 (30%), Positives = 100/208 (48%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKN--QRNLKLKTQFIKSDIFK---IDRSHYEKCDFIICNPPYIDKND-PNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVL 286
           P+QYI  ++ FYG  +F+ +G  +PR ETE + D A    K      + DLCSGSG +A T++ ++ N  A  +G+E +   Y   +KN  Q   +     I  DIF    + R   +    ++ NPPYI   D   +      EP+ ALF  ++G  FY R +      L +G     EIG  Q + + +          + ++D    DR++
  S:    62 PLQYILGNWEFYGRKYFVGEGVLIPRPETELLCDIAKAHLKNTGGTAV-DLCSGSGCIAVTVA-LEANVKA--VGIEISDKAYGYFLKNIEQNKAERSVTAINGDIFDKNILGRFEDDSLYAVLSNPPYISSADMKALQKEVTFEPELALFGGEDGLDFYRRLIPMWAGKLRSGGLFAVEIGEEQGQAVSRIFEGAGFNP-EIIRDYSGHDRIV 270
>gi|148826785|ref|YP_001291538.1| hypothetical protein CGSHiGG_00160 [Haemophilus influenzae PittGG] >gi|148718027|gb|ABQ99154.1| HemK [Haemophilus influenzae PittGG] (292 aa)
Score = 204, Expect = 2.2e-14, Identities = 74/263 (28%), Positives = 133/263 (50%)
  Q:    23 NPLDDSQIKWILKELILFNSKIIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNI---PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVK--QKKLIDKK---YILDLCSGSG----VLANTISYI--KKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDP-STKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           NP ++S+I      L+L      ++ + I    DTEID   +K+  +L  +L++ +   P+ YI     F+ L   + KG  +PR +TE +++ A++   +KL +      ILDL +G+G     LA+ ++ I  K++    +IGV+       +   N    +L  +F++S  F    +   K D I+ NPPYID  D ++     + EP  AL A   GY      +      L +   ++ E G+ Q E++    ++N   + + ++D  D +RV
  S:    18 NPTENSKID----ALVLLQHATGKSRTQILAFDDTEID---EKVRLKLTALLDRRLKGEPIAYILGEKEFWSLPLNVSKGTLIPRPDTESLVEKALQIALEKLEENPPHFRILDLGTGTGAIALALASELAPICQKRHIPLEIIGVDLMPDVVALAQSNAERNQLNVEFLQSRWFD---NITGKFDLIVSNPPYIDAQDEHLHQGDVRFEPLSALVANDEGYADLRHIIELASSYLNSNGVLLLEHGWQQGEKVRSIFLENYWEMVETVRDYGDNERV 285
>gi|188587461|ref|YP_001919006.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Natranaerobius thermophilus JW/NM-WN-LF] >gi|179352148|gb|ACB86418.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Natranaerobius thermophilus JW/NM-WN-LF] (321 aa)
Score = 204, Expect = 2.4e-14, Identities = 69/211 (32%), Positives = 115/211 (54%)
  Q:    62 EYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVK-QKKLIDKK-----------------YILDLCSGSGVLANTISYIKKN---KDAIVIGVEKNRTPYKVGVKNQRNLKLKTQ--FIKSDIFKIDRSHYEKCDFIICNPPYID-KNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITV 272
           +YK+ LK+L    ++  P  Y+T    F GL F + +   +PR +TE ++++A+    K+I K                   ILD+C+GSG +  +I+Y       ++  +   + +    ++   N  NL L +Q  F+KSD+F    +  +    I  NPPYI  K+   +    K EP  AL A ++G Y+Y +   +I   L+    +IFEIG +Q+EE+E  L   N+ V
  S:    67 QYKE-LKELVIKRSEGTPYAYLTGKREFMGLEFTVTENVLIPRPDTEVVVEFALNCLGKIILKDNPNNKKELQFNELNSPIKILDICTGSGNIGLSIAYYFNKMYGQNLELTLSDISDKALEIAHINASNLGLLSQCKFVKSDLFS--NTSDDNYRLITANPPYISSKHYSTLSKEVKLEPAHALLAGEDGLYYYKKISQQIKKYLSQDGVLIFEIGEDQQEEVENMLSTQNLVV 298
>gi|116618872|ref|YP_819243.1| methylase of polypeptide chain release factor [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|116097719|gb|ABJ62870.1| Methylase of polypeptide chain release factor [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (330 aa)
Score = 204, Expect = 2.4e-14, Identities = 66/217 (30%), Positives = 105/217 (48%)
  Q:    74 LNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKY---ILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLK-TQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNV--DPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKF----LIKNNITVFKFLKDLDDKDRVLYIKK 290
           L KN P QYI     FYG  F + +   +PR ETE +++W +K     + K+   +LD+ +GSG +  T+  + +N        + ++    V   N +   L    F++SD+F        K D I+ NPPYI  +D N   D     EP  ALFA  +G   Y +    +   L       FEIG+ Q + +++     L K  IT+    +D    DR++ ++K
  S:   113 LVKNKPPQYILGHAPFYGREFMVDERVLIPRPETEQLVEWILKDAG--NTKHPVSVLDIGTGSGAIIETL--MLENDRVKGFAADISQDALTVAEMNAQRFNLSHLHFVESDVFSALSGL--KFDLIVSNPPYISNSDENEMDDSVLTFEPHTALFAENDGLAIYKKIARGLDAHLTEHGRAYFEIGYKQGKAVQQLLQAALPKAKITL---RQDFSGLDRMIRVEK 330
>gi|195947836|ref|ZP_03089022.1| HemK family methylase [Borrelia garinii PBr] (273 aa)
Score = 203, Expect = 2.6e-14, Identities = 71/227 (31%), Positives = 116/227 (51%)
  Q:    62 EYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKT--QFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPSTKCEPKQALFA-PQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYI 288
           E K    Q++K+  K  P+ YI +   F G+ F + K   +PR +TE +++ A+ Q +    K ILDLC GSG +  +I+Y  K K   V   + +    K+  KN + LKL+   + I+S++ K  +   E+ D II NPPY++K +  +    K EP +AL    ++G     + LS+    L     II E    Q + ++ F IK   +  K + DL+ + R L +
  S:    47 EKKLFFDQIDKI-EKGTPIHYILQKKEFMGIEFSLNKHVLIPRFDTECLVEEALIQIQQNGFKKILDLCCGSGCIGLSIAYYTKKK---VTLSDISIKALKIVEKNTKKLKLEKFIEIIRSNLLKCIK---ERFDIIITNPPYLNKEELEIKNKIKKEPAKALLGFGKDGLNISRKILSQAKEKLNPNGLIIIESAPWQIKSLKDFAIKKGFSHLKTIYDLEKRARALVL 269
>gi|127513839|ref|YP_001095036.1| HemK family modification methylase [Shewanella loihica PV-4] >gi|126639134|gb|ABO24777.1| modification methylase, HemK family [Shewanella loihica PV-4] (280 aa)
Score = 203, Expect = 2.7e-14, Identities = 57/206 (27%), Positives = 102/206 (49%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKL-KTQFIKSDIFK-IDRSHYEKCDFIICNPPYIDKNDPNVDP-STKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDR 284
           P+ +I     F+ L F +     +PR +TE +++ A+    L +   +LDL +G+G +A ++++ + N    +  V+K      +   N+ NLKL + + ++SD F  I+R  +   + I+ NPPYID+ D ++     + EP  AL A ++GY   F         LA G  ++ E GF Q   +   +I+        ++D    DR
  S:    70 PIAHIVGEREFWSLPFMVNPTTLIPRPDTEILVETALNLP-LAENAKVLDLGTGTGAIALSLAFERSNWQ--ITAVDKVLEAVALAKANRDNLKLPQVEVLQSDWFDAINRYDF---NLIVSNPPYIDEEDEHLSQGDVRFEPHSALTAGEHGYADLFYIAEAARDYLAPGGYLLLEHGFGQALTVRDKMIELGYEAVATVRDFGSNDR 272
>gi|146302781|ref|YP_001197372.1| HemK family modification methylase [Flavobacterium johnsoniae UW101] >gi|146157199|gb|ABQ08053.1| modification methylase, HemK family [Flavobacterium johnsoniae UW101] (284 aa)
Score = 203, Expect = 2.8e-14, Identities = 68/215 (31%), Positives = 112/215 (52%)
  Q:    74 LNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKK---YILDLCSGSGVLANTISYIKKNKDAIVIGVEKN--RTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYID--KNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYP--ILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYI 288
           L K +P+QY+    +FYGL F + +   +PR ETE +++W + + K ID+K    ILD+ +GSG +A +++    N D   I V K    T  +  ++N  N+     FI  DI + +     K D I+ NPPYI   + +         EP  ALF   N    ++R ++ +    +LA G ++ FEI     +E+ + L K +       KD+ D DR++ +
  S:    65 LKKEVPIQYLLGKTNFYGLDFEVNENVLIPRPETEELVEWIISENKGIDRKEKIKILDIGTGSGCIAVSLAKNLPNADVYAIDVSKKAIETAKRNAIRNDVNV----TFIFQDILQAEELKC-KYDVIVSNPPYIRNLEKEEIKKNVLDYEPHLALFVDDNDALLFYRKIASLAQNNLLAKG-QLYFEINQYLGKEMIELLGKMDFINIDLRKDIYDNDRMIKV 282
>gi|116627621|ref|YP_820240.1| protoporphyrinogen oxidase [Streptococcus thermophilus LMD-9] >gi|116100898|gb|ABJ66044.1| Methylase of polypeptide chain release factor [Streptococcus thermophilus LMD-9] (277 aa)
Score = 203, Expect = 2.8e-14, Identities = 65/208 (31%), Positives = 106/208 (50%)
  Q:    58 EIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNL-KLKTQFIKSDIFKIDRSHYEKC-DFIICNPPYIDKNDP-----NVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFL 265
           E+  E   +L  +   L  + P QYI     F+GL F + +   +PR ETE ++D  + +    + K +LD+ +GSG +A ++   KK++    +          V  K+   L ++   F+ +D+F+    +   C D I+ NPPYI +ND      NV  S   EPK ALFA ++G   Y + L +    L    ++ FEIG+ Q E++ K L
  S:    46 EVSEEDGNLLAHIFTQLTAHKPAQYILGYEEFHGLRFQVDERVLIPRPETEELVDLILAENPNTELK-VLDIGTGSGAIAVSL---KKSRPMWQVTASDLSADALVLAKDNAKLNRVDISFVLADVFE----NVSGCFDIIVSNPPYISENDKDEVGLNVLTS---EPKMALFADEDGLAIYRQILEDADKYLNPQGKLYFEIGYKQGEDLRKLL 249
>gi|145632950|ref|ZP_01788683.1| HemK [Haemophilus influenzae 3655] >gi|144986606|gb|EDJ93172.1| HemK [Haemophilus influenzae 3655] (292 aa)
Score = 203, Expect = 2.9e-14, Identities = 74/263 (28%), Positives = 131/263 (49%)
  Q:    23 NPLDDSQIKWILKELILFNSKIIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNI---PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVK--QKKLIDKK---YILDLCSGSG----VLANTISYI--KKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDP-STKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           NP ++S+I      L+L      +  + I    DTEID   +K+  +L  +L++ +   P+ YI     F+ L   + KG  +PR +TE +++ A++   +KL +      ILDL +G+G     LA+ ++ I  K++    +IGV+       +   N    +L  QF++S  F      +   D I+ NPPYID  D ++     + EP  AL A   GY      +      L +   ++ E G+ Q E++     +N+  + + ++D  D +RV
  S:    18 NPTENSKID----ALVLLQHATGKLRTQILAFDDTEID---EKVRLKLTALLDRRLKGEPIAYILGEKEFWSLPLNVSKGTLIPRPDTESLVEKALQIALEKLEENPPHFRILDLGTGTGAIALALASELAPICQKRHIPLEIIGVDLMPDVVALAQSNAERNQLNVQFLQSRWFDNITGQF---DLIVSNPPYIDAQDEHLHQGDVRFEPLSALVANDEGYADLRHIIELASSYLNSNGVLLLEHGWQQGEKVRSIFQENHWEMVETVRDYGDNERV 285
>gi|55822720|ref|YP_141161.1| protoporphyrinogen oxidase [Streptococcus thermophilus CNRZ1066] >gi|55738705|gb|AAV62346.1| protoporphyrinogen oxidase [Streptococcus thermophilus CNRZ1066] (277 aa)
Score = 203, Expect = 2.9e-14, Identities = 65/208 (31%), Positives = 106/208 (50%)
  Q:    58 EIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNL-KLKTQFIKSDIFKIDRSHYEKC-DFIICNPPYIDKNDP-----NVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFL 265
           E+  E   +L  +   L  + P QYI     F+GL F + +   +PR ETE ++D  + +    + K +LD+ +GSG +A ++   KK++    +          V  K+   L ++   F+ +D+F+    +   C D I+ NPPYI +ND      NV  S   EPK ALFA ++G   Y + L +    L    ++ FEIG+ Q E++ K L
  S:    46 EVSEEDGNLLAHIFTQLTAHKPAQYILGYEEFHGLRFQVDERVLIPRPETEELVDLILAENPNTELK-VLDIGTGSGAIAVSL---KKSRPMWQVTASDLSADALVLAKDNAKLNRVDISFVLADVFE----NVSGCFDIIVSNPPYISENDKDEVGLNVLTS---EPKMALFADEDGLAIYRQILEDADKYLNPQGKLYFEIGYKQGEDLRKLL 249
>gi|119897273|ref|YP_932486.1| HemK protein [Azoarcus sp. BH72] >gi|119669686|emb|CAL93599.1| HemK protein [Azoarcus sp. BH72] (278 aa)
Score = 203, Expect = 2.9e-14, Identities = 63/207 (30%), Positives = 95/207 (45%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPST-KCEPKQALFAPQNGYYFYFRFLSEIYPI----LANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           PV Y+     FYG SF +     +PR +TE +++ AV       +  +LDL +GSG LA T++      D  V  ++++R    V + N   L     F++SD F  D    E+   I+ NPPYI  +D +++    + EP+ AL A   G       LSEI       L  G  +  E G++Q   +   L           KDL   +RV
  S:    66 PVAYLIGEREFYGRSFAVTPAVLIPRPDTELLVELAVAHFSAQQRVRVLDLGTGSGALAITLALELDAAD--VTALDRSREALWVAMANAARLGASVSFVQSDWF--DALGEERFQLIVANPPYIAADDAHLEEGDLRFEPRSALAAGTAG----LDDLSEIAAAAPAHLEAGGWLFLEHGYDQAMSVRGLLADAGFAAISSWKDLAGIERV 269
>gi|153808976|ref|ZP_01961644.1| hypothetical protein BACCAC_03277 [Bacteroides caccae ATCC 43185] >gi|149128309|gb|EDM19528.1| hypothetical protein BACCAC_03277 [Bacteroides caccae ATCC 43185] (278 aa)
Score = 203, Expect = 3.0e-14, Identities = 66/237 (27%), Positives = 112/237 (47%)
  Q:    50 DIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYI---DKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEI-YPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVL 286
           DI+  KD  +    ++ L+ +   L KN P+QYI     F G  F +  G  +PR ET  +++  VK+      +++LD+ +GSG +A  IS  +   DA V   + +     +  +N + L  +  F + D+   +       D I+ NPPYI   +K D   +     EP  ALF P +    ++R ++ +   +L  G ++ FEI      E    L  N     + +KD+  KDR++
  S:    39 DIYMGKDIILSECKQRELENIIFRLQKNEPIQYIRGFAEFCGRKFKVAPGVLIPRPETAELVELIVKENP--GARHLLDIGTGSGCIA--ISLDQNLPDAEVEAWDVSEEALAIASENNKELDARVMFRRRDVLSDELGATSCYDVIVSNPPYITEAEKQDMEAN-VLDWEPGLALFVPDDDPLRFYRRIARLGCDLLLPGGKLYFEINQAYGRETAHILEMNQYRDVRVIKDIFGKDRIV 274
>gi|116494652|ref|YP_806386.1| methylase of polypeptide chain release factor [Lactobacillus casei ATCC 334] >gi|116104802|gb|ABJ69944.1| Methylase of polypeptide chain release factor [Lactobacillus casei ATCC 334] (276 aa)
Score = 203, Expect = 3.0e-14, Identities = 62/207 (29%), Positives = 103/207 (49%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKND-PNVDPST-KCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQ----KEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           P QYI     F+G  F +     +PR ETE ++ WA ++++       LDL +GSG +  T++  +K     +   + +     V  +N +  ++  QF  SD+F    + Y   DF++ N PYI   + P +D ST + EPK ALFA  +G   + +F++ +   L  G     E G+ Q    +E   K L +  +T   F +D+ D  R+
  S:    69 PAQYIVGVAPFFGELFKVTPAVLIPRFETEELVAWAAEEQRTAQTG--LDLGTGSGAIGLTLA--RKLPQTTMTLSDVSPEALAVAKQNAKEQQVAVQFTVSDLFAALPARY---DFVVTNLPYIAPEETPVMDQSTLRYEPKLALFAGHHGLAVFEQFVAALPQHLTAGGAAYLEFGYRQEPALRELFAKQLPQAQVT---FRRDMADHPRM 271
>gi|31615726|pdb|1NV8|A Chain A, N5-Glutamine Methyltransferase, Hemk >gi|31615727|pdb|1NV8|B Chain B, N5-Glutamine Methyltransferase, Hemk >gi|31615728|pdb|1NV9|A Chain A, Hemk, Apo Structure (284 aa)
Score = 203, Expect = 3.0e-14, Identities = 72/255 (28%), Positives = 131/255 (51%)
  Q:    36 ELILFNSKIIENSSDIFFEKDTEID-FEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFI--KSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYIKK 290
           E++L  S+++    +  F KD  +   E K+IL+ + K  +   P+ YI     F GLSF +++G FVPR ETE +++ A++  +    K + D+ +GSG +  +++   K  DAIV   + +    ++  KN     +  +F   K +  +  +  +   + I+ NPPY+ K+  ++      EP +ALF  ++G  FY  F         +G  ++ EIG +Q EE++K ++ + +    FLKD   K R L + +
  S:    37 EVLLIVSRVLGIRKEDLFLKDLGVSPTEEKRILELVEKRAS-GYPLHYILGEKEFMGLSFLVEEGVFVPRPETEELVELALELIRKYGIKTVADIGTGSGAIGVSVA---KFSDAIVFATDVSSKAVEIARKNAERHGVSDRFFVRKGEFLEPFKEKFASIEMILSNPPYV-KSSAHLPKDVLFEPPEALFGGEDGLDFYREFFGRYD---TSGKIVLMEIGEDQVEELKK-IVSDTV----FLKDSAGKYRFLLLNR 281
>gi|15677887|ref|NP_275055.1| hemK protein [Neisseria meningitidis MC58] >gi|7227327|gb|AAF42384.1| hemK protein [Neisseria meningitidis MC58] (423 aa)
Score = 203, Expect = 3.0e-14, Identities = 62/207 (29%), Positives = 99/207 (47%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPN-VDPSTKCEPKQALFAPQNGYYFYFRFLSEIYP-ILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           PV YI     FYG  F +     +PR ETE++++  +   +L +   + DL +GSG +A T++   +  DA V   + +    +   KN  +L  + +F     F  D     K D I+ NPPYI+  D + +    + EP+ AL    +G     R L++  P  LA G  ++ E GF+Q   +   L +N  +  + L DL   DRV
  S:   210 PVAYILGVREFYGRRFTVNPSVLIPRPETEHLVEAVLA--RLPENGRVWDLGTGSGAVAVTVAL--ERPDAFVRASDISPPALETARKNAADLGARVEFAHGSWFDTDMPSEGKWDIIVSNPPYIENGDKHLLQGDLRFEPQIALTDFSDGLSC-IRTLAQGAPDRLAEGGFLLLEHGFDQGAAVRGVLAENGFSGVETLPDLAGLDRV 413
>gi|194398713|ref|YP_002037656.1| methyltransferase, HemK family protein [Streptococcus pneumoniae G54] >gi|194358380|gb|ACF56828.1| methyltransferase, HemK family protein [Streptococcus pneumoniae G54] (279 aa)
Score = 203, Expect = 3.1e-14, Identities = 69/240 (28%), Positives = 116/240 (48%)
  Q:    49 SDIFFEKDTEIDFEY-KKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDP-----NVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKN-NITVFKFLKDLDDKDRVLYI 288
           +D  F    E+  E  K+ ++ + + L  + P QYI     FYG+   + +   +PR ETE +++  + +  L     +LD+ +GSG +A  ++  K   D  V   + ++   ++  +N  +      F KSD F       EK D I+ NPPYI + D      NV  S   EP  ALFA ++G   Y R   +    L +G +I  EIG+ Q + + +   K+      + LKD   +DR++ +
  S:    37 TDFIFALQQEVTTEEEKQFVEDIYQQLAAHKPAQYIIGQADFYGMHLKVDERVLIPRPETEELVELILTEN-LETNLSVLDIGTGSGAIA--LALAKNRPDWSVTAADVSQEALELASENASDQNFNIFFKKSDCFA---EISEKYDIIVSNPPYISREDESEVGLNVLHS---EPHLALFADEDGLAIYCRIAEDAKDYLKDGGKIYLEIGYKQGQSVPELFRKHLPEKRVRTLKDQFGQDRMVVV 274
>gi|157150169|ref|YP_001450440.1| protoporphyrinogen oxidase [Streptococcus gordonii str. Challis substr. CH1] >gi|157074963|gb|ABV09646.1| possible protoporphyrinogen oxidase [Streptococcus gordonii str. Challis substr. CH1] (276 aa)
Score = 203, Expect = 3.1e-14, Identities = 66/238 (27%), Positives = 115/238 (48%)
  Q:    49 SDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYI---DKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEI----EKFLIKNNITVFKFLKDLDDKDRVL 286
           +D   +   E+  E ++ LK + K L  + P QYI  S  F GL+  + +   +PR ETE +++  + +        +LD+ +GSG +A  ++      D  +   + +R    +  +N ++  L    ++SD     +  +   D I  NPPYI   DK++  ++  T  EP  ALFA ++GY  Y +   +    L    +I  EIG+ Q + +     +F  +  I V   LKD   KDR++
  S:    37 TDFVLKLRIEVSQEEREQLKAIQKQLLAHKPAQYIIGSSDFNGLNLKVDERVLIPRPETEELVELILSENPETPLS-VLDIGTGSGAIA--LALANSRPDWQITASDLSRDALSLAAENAQSCGLNLTLVQSDCLDAIQGKF---DIIASNPPYISEEDKDEVGLNVLTS-EPHMALFAEEDGYAVYRKIAEQAGDYLTEKGKIYLEIGYKQGDGVADLFRQFFPQKRIRV---LKDQFGKDRMV 271
>gi|167754863|ref|ZP_02426990.1| hypothetical protein CLORAM_00367 [Clostridium ramosum DSM 1402] >gi|167704913|gb|EDS19492.1| hypothetical protein CLORAM_00367 [Clostridium ramosum DSM 1402] (285 aa)
Score = 202, Expect = 3.2e-14, Identities = 70/277 (25%), Positives = 127/277 (45%)
  Q:    14 TFSELTKRLNPLDDSQIKWILKELILFNSKIIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKY----ILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFL---IKNNITVFKFLKDLDDKDRVLYIKK 290
           T  EL K      D   K +    +LF     +   +++   D E+  E +       +   +  P+QYI    +F+G  F + +   +PR ETE +++  + +      +Y    + D+ +GSG +A +++   +     V   + +     V   N +NL    +F+  D+ +    +  K D  + NPPYI +           EP  ALF   +G YFY +    + P+L     + FE+GF+Q+E +E  L     N+    + +KD++ KDR+L+I +
  S:     3 TVKELIKLAESRLDDASKDVNVAKVLFYHLADKQPHELYLMYDEEVSSELEAKFLAGMEEYYQGKPIQYIKGVENFFGRDFKVNEDVLIPRYETEELVENILYRIDDYFAEYQSITLCDVGTGSGAIATSLAL--EEPRLKVFATDISLKAVTVAKDNAKNLGANIEFMVGDMLEPLLENEIKVDIFVSNPPYIPQEQEIEAMVKDNEPHVALFGGNDGLYFYRKIFQGVEPLLQERALLAFEMGFDQRELMEAALQEYFPND--PHEIIKDINGKDRMLFIYR 282
>gi|55820817|ref|YP_139259.1| protoporphyrinogen oxidase [Streptococcus thermophilus LMG 18311] >gi|55736802|gb|AAV60444.1| protoporphyrinogen oxidase [Streptococcus thermophilus LMG 18311] (277 aa)
Score = 202, Expect = 3.3e-14, Identities = 65/208 (31%), Positives = 106/208 (50%)
  Q:    58 EIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNL-KLKTQFIKSDIFKIDRSHYEKC-DFIICNPPYIDKNDP-----NVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFL 265
           E+  E   +L  +   L  + P QYI     F+GL F + +   +PR ETE ++D  + +    + K +LD+ +GSG +A ++   KK++    +          V  K+   L ++   F+ +D+F+    +   C D I+ NPPYI +ND      NV  S   EPK ALFA ++G   Y + L +    L    ++ FEIG+ Q E++ K L
  S:    46 EVSEEDGDLLAHIFTQLTAHKPAQYILGYEEFHGLRFQVDERVLIPRPETEELVDLILAENPNTELK-VLDIGTGSGAIAVSL---KKSRPMWQVTASDLSADALVLAKDNAKLNRVDISFVLADVFE----NVSGCFDIIVSNPPYISENDKDEVGLNVLTS---EPKMALFADEDGLAIYRQILEDADKYLNPQGKLYFEIGYKQGEDLRKLL 249
>gi|125623425|ref|YP_001031908.1| putative protoporphyrinogen oxidase [Lactococcus lactis subsp. cremoris MG1363] >gi|124492233|emb|CAL97162.1| putative protoporphyrinogen oxidase [Lactococcus lactis subsp. cremoris MG1363] (270 aa)
Score = 202, Expect = 3.5e-14, Identities = 66/224 (29%), Positives = 112/224 (50%)
  Q:    66 ILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYI--DKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEK-FLIKNNITVFKFLKDLDDKDRVLYIK 289
           +L +L++ L KN P QYI     FY L F + +   +PR ETE +++  + +    D   ILD+ +GSG +A  IS  K  ++  V   + ++   ++  +N +   +  +FI+SD+        ++ D I+ NPPYI  D+     D   K EP  ALFA   G   Y +   +    L +  +I  EIG+ Q + ++  F  K    +    +D+  KDR++ +K
  S:    50 LLTELSERLIKNEPPQYIVGWAEFYELKFKVDERVLIPRPETEELVEMILTENN-NDSLKILDIGTGSGAIA--ISLAKARQNWSVKASDISQNALELAAENAKMNHVNLEFIQSDVMD---ELTDRFDIIVSNPPYIAFDETYEMDDSVIKYEPDLALFAKNQGLAIYQKIADQAVNHLTDDGKIYLEIGYKQGKAVQAIFQEKFTDRLVSIHQDIFGKDRMISVK 270
>gi|167931713|ref|ZP_02518800.1| protoporphyrinogen oxidase, putative [Borrelia burgdorferi 156a] >gi|195941928|ref|ZP_03087310.1| protoporphyrinogen oxidase, putative [Borrelia burgdorferi 80a] >gi|195951596|ref|ZP_03092693.1| protoporphyrinogen oxidase, putative [Borrelia burgdorferi 29805] >gi|195960767|ref|ZP_03096972.1| protoporphyrinogen oxidase, putative [Borrelia burgdorferi 64b] (286 aa)
Score = 202, Expect = 4.0e-14, Identities = 68/220 (30%), Positives = 115/220 (52%)
  Q:    69 QLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLK--TQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPSTKCEPKQALFA-PQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYI 288
           Q++K+  K IP+ YI +   F G+ F + K   +PR +TE + + A+ Q +    K ILDLC GSG +  +I+Y  + K   VI  + +    ++  KN + LKL+   + I S++ K  +    K D II NPPY++K +  +    K EP +AL    ++G     + L++    L+    II E    Q + ++ F IK   +  K + DL+++ R L +
  S:    54 QIDKI-EKGIPIHYILQKKEFMGIEFSLNKHVLIPRFDTECLAEEALIQIQQNGFKKILDLCCGSGCIGLSIAYYIRKK---VILSDISTKALQIVEKNTKKLKLEKFVEIIHSNLLKCIKG---KLDIIITNPPYLNKEELEIKNKIKKEPTKALLGFGKDGLNISRKILNQAKEKLSPNGLIIIESAPWQIKSLKDFAIKKGFSHLKTIYDLENRARALIL 269
>gi|42631607|ref|ZP_00157145.1| COG2890: Methylase of polypeptide chain release factors [Haemophilus influenzae R2866] >gi|145639101|ref|ZP_01794709.1| HemK [Haemophilus influenzae PittII] >gi|145272073|gb|EDK11982.1| HemK [Haemophilus influenzae PittII] (292 aa)
Score = 202, Expect = 4.0e-14, Identities = 81/270 (30%), Positives = 140/270 (51%)
  Q:    16 SELTKRLNPLDDSQIKWILKELILFNSKIIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNI---PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWA--VKQKKLIDKK---YILDLCSGSGVLA-----NTISYIKKNKDAI-VIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDP-STKCEPKQALFAPQNGYYFYFRFLSEIYP--ILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           S+L ++ NP ++S+I      L+L      +  + I    DTEID   +K+  +L  +L++ +   P+ YI     F+ L   + KG  +PR +TE +++ A  +  +KL        ILDL +G+G +A        S  +K + ++ +IGV+       +   N    +L  QF++S  F    +   K D I+ NPPYID  D ++     + EP  AL A   GY    R++ E  P  +  NGT ++ E G+ Q E++     +N+  + + ++D  D +RV
  S:    12 SDLAQK-NPSENSKID----ALVLLQYATGKPRTQILAFDDTEID---EKVRLKLTALLDRRLKGEPIAYILGEKEFWSLPLNVSKGTLIPRPDTEVLVEKALQISLEKLEQNPPHFRILDLGTGTGAIALALASELFSICQKRQISLEIIGVDLMPDVVALAQSNAERNQLNVQFLQSRWFD---NITGKFDLIVSNPPYIDVQDEHLHQGDVRFEPLSALVANDAGYA-DLRYIIESAPNYLNFNGT-LLLEHGWQQGEKVRSIFQENHWEMVETVRDYGDNERV 285
>gi|194368828|pdb|1SG9|A Chain A, Crystal Structure Of Thermotoga Maritima Protein Hemk, An N5-Glutamine Methyltransferase >gi|194368829|pdb|1SG9|B Chain B, Crystal Structure Of Thermotoga Maritima Protein Hemk, An N5-Glutamine Methyltransferase >gi|194368830|pdb|1SG9|C Chain C, Crystal Structure Of Thermotoga Maritima Protein Hemk, An N5-Glutamine Methyltransferase (276 aa)
Score = 201, Expect = 4.2e-14, Identities = 72/255 (28%), Positives = 131/255 (51%)
  Q:    36 ELILFNSKIIENSSDIFFEKDTEID-FEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFI--KSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYIKK 290
           E++L  S+++    +  F KD  +   E K+IL+ + K  +   P+ YI     F GLSF +++G FVPR ETE +++ A++  +    K + D+ +GSG +  +++   K  DAIV   + +    ++  KN     +  +F   K +  +  +  +   + I+ NPPY+ K+  ++      EP +ALF  ++G  FY  F         +G  ++ EIG +Q EE++K ++ + +    FLKD   K R L + +
  S:    28 EVLLIVSRVLGIRKEDLFLKDLGVSPTEEKRILELVEKRAS-GYPLHYILGEKEFMGLSFLVEEGVFVPRPETEELVELALELIRKYGIKTVADIGTGSGAIGVSVA---KFSDAIVFATDVSSKAVEIARKNAERHGVSDRFFVRKGEFLEPFKEKFASIEMILSNPPYV-KSSAHLPKDVLFEPPEALFGGEDGLDFYREFFGRYD---TSGKIVLMEIGEDQVEELKK-IVSDTV----FLKDSAGKYRFLLLNR 272
>gi|116629882|ref|YP_815054.1| methylase of polypeptide chain release factor [Lactobacillus gasseri ATCC 33323] >gi|116095464|gb|ABJ60616.1| Methylase of polypeptide chain release factor [Lactobacillus gasseri ATCC 33323] (280 aa)
Score = 201, Expect = 4.2e-14, Identities = 73/239 (30%), Positives = 125/239 (52%)
  Q:    49 SDIFFEKDTEIDF-EYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSH-----YEKCDFIICNPPYIDKNDPNVDPST--KCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVF--KFLKDLDDKDRVLY 287
           S+     D E+   + K+ LK + K L + I  QYI     FYG    + +G  +PR ETE ++ WA++  K  +K  ILDL +GSG +   ++ +K+ +D  +    +N   Y   + +    + +  F+K D+    R        EK D II NPPYI  ++ ++  +   K EP  AL+  ++G  FY +F  +I   L +  +   E GF++K+++ K L +  +  F  +F  DL  K R+++
  S:    37 SEFLLHIDDELSLAQEKQALKDMKK-LCRGISPQYILGYAWFYGYKILVNRGVLIPRFETEELVKWALENIKSGEK--ILDLGTGSGAI--MVALVKQAQDRKI----ENLILYASDITDAALRESEENFLKYDLDVRTRKANVLVGLEKFDTIISNPPYIKTSEKDLMDANVIKNEPDTALYGGEDGLDFYRKFAKQIRSHLYSHGQFFLEFGFSEKDQL-KDLFEAELPDFEIEFKNDLAGKPRMVH 275
>gi|49475008|ref|YP_033049.1| protoporphyrinogen oxidase protein [Bartonella henselae str. Houston-1] >gi|49237813|emb|CAF27008.1| Protoporphyrinogen oxidase protein [Bartonella henselae str. Houston-1] (288 aa)
Score = 201, Expect = 4.3e-14, Identities = 73/240 (30%), Positives = 118/240 (49%)
  Q:    47 NSSDIFFEKDTEIDFEYKKILKQLNKVLNKNI---PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAV----KQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQF--IKSDIFKIDRSHYEKCDFIICNPPYIDKNDPN--VDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVL 286
           N SD   + D  + FE  +IL QL K + + I   PV  I     FYG+SF + +    PR +TE ++D  +    K  +  +K  +LD+ +GSG +A  I+ +K+   +  + V+ +    K   KN ++ K+  +F  + SD F      +   D II NPPYI + D           +P +AL   ++G  FY +   +    L     I  EIG++Q++E+     KN     +  KDL+   R L
  S:    40 NISDRVLQPDLCLSFE--QIL-QLEKAIQRRIAGEPVYRIIGKREFYGISFALSQETLEPRSDTETLVDLVLPPLKKYGEKSEKITLLDMGTGSGAIA--IAILKQIPQSYAVAVDISENALKTATKNAKSAKVINRFTPLLSDWFDSVTGQF---DLIISNPPYIPETDITKLAKEVHLHDPLRALIGGKDGLDFYRKLSDKAANYLKEKGSIAVEIGYSQEKEVCDLFEKNGFKCLEMRKDLNGIPRAL 282
>gi|145642041|ref|ZP_01797612.1| HemK [Haemophilus influenzae R3021] >gi|145273221|gb|EDK13096.1| HemK [Haemophilus influenzae 22.4-21] (292 aa)
Score = 201, Expect = 4.5e-14, Identities = 72/263 (27%), Positives = 131/263 (49%)
  Q:    23 NPLDDSQIKWILKELILFNSKIIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNI---PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVK--QKKLIDKK---YILDLCSGSGVLANTISY------IKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDP-STKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           NP ++S+I      L+L      ++ + I    DTEID   +K+  +L  +L++ +   P+ YI     F+ L   + KG  +PR +TE +++ A++   +KL +      ILDL +G+G +A  ++        K++    +IGV+       +   N    +L  +F++S  F    +   K D I+ NPPYID  D ++     + EP  AL A   GY      +      L +   ++ E G+ Q E++    ++N   + + ++D  D +RV
  S:    18 NPTENSKID----ALVLLQHVTGKSRTQILAFDDTEID---EKVRLKLTALLDRRLKGEPIAYILGEKEFWSLPLNVSKGTLIPRPDTEILVEKALQIALEKLEENPPHFRILDLGTGTGAIALALASELEPICQKRHIPLEIIGVDLMPDVVALAQSNAERNQLNVEFLQSRWFD---NITGKFDLIVSNPPYIDAQDEHLHQGDVRFEPLSALVANDEGYADLRHIIELASSYLNSNGVLLLEHGWQQGEKVRSIFLENYWEMVETVRDYGDNERV 285
>gi|118594304|ref|ZP_01551651.1| modification methylase, HemK family protein [Methylophilales bacterium HTCC2181] >gi|118440082|gb|EAV46709.1| modification methylase, HemK family protein [Methylophilales bacterium HTCC2181] (283 aa)
Score = 201, Expect = 4.6e-14, Identities = 63/240 (26%), Positives = 114/240 (47%)
  Q:    46 ENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKT-QFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVD-PSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           E S+ +   ++ +I      +++ + K      P+ Y+ K + FYG +++I +   +PRQ+TE M+D  ++  K      ILDL +GSGV+  T+++   N    +  +       KV   N  N  LK  QF++S+ F  ++    K D I+ NPPYI KND ++  P    +P+ AL +   G       +      L     ++ E GF+Q   ++     N     +  +D++ + R+
  S:    40 ETSTQLIIGRNKKISENDAGLIESIVKQRLLGTPLAYLFKEWDFYGRTYYINQQTLIPRQDTELMIDILIQNNKEDSSLKILDLGTGSGVIGLTLAHHFFNAQITLSDISSEAI--KVAKINGGNSGLKNIQFVESNWF--EKIPPGKFDVIVSNPPYIPKNDKHLKHPELLEQPQIALMSELGGLQAITDIVKNAKQYLNKAGLLMIEHGFDQAPTVKNIFTANTFNNVRQYQDINSRIRI 277
>gi|196164014|ref|ZP_03124545.1| protein methyltransferase [Clostridium difficile QCD-23m63] (282 aa)
Score = 201, Expect = 5.1e-14, Identities = 61/208 (29%), Positives = 103/208 (49%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKN--QRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNV--DPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVL 286
           P+ YI ++  F GL FF+K+G  +PR +TE +++  ++  +      ILD+ +GSG +  TIS  K  +++ ++  + +    ++  KN     +  K ++I SD+F    +   K D I+ NPPYI K D           EP  AL   ++G  FY R   +    L     + +E+G NQ E++   +  N        KD+   DRV+
  S:    68 PIAYIVENREFMGLDFFVKEGVLIPRPDTETLVEEIIEICREKKDVSILDIGTGSGAI--TISLAKYIENSKIMSFDISEIALEIAKKNAITNEVDEKIKYINSDLFTAISNSNIKFDIIVSNPPYIKKQDIETLHTQVKDYEPYNALEGGEDGLDFYRRITEQGKKYLNKFGILAYEVGHNQAEDVINIMKSNGYKKIYTKKDIQGIDRVV 277
>gi|94271211|ref|ZP_01291906.1| Modification methylase HemK [delta proteobacterium MLMS-1] >gi|93450531|gb|EAT01681.1| Modification methylase HemK [delta proteobacterium MLMS-1] (325 aa)
Score = 201, Expect = 5.2e-14, Identities = 60/212 (28%), Positives = 109/212 (51%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKK-----YILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKN--QRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYI-DKNDPNVDPSTK-CEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNI-TVFKFLKDLDDKDRVLYIKK 290
           P+ YI   + F+ L F +  G  +PR ETE +++ A++    +         ILDL +GSG+LA  ++  ++   A VI V+++     V  +N  +  ++ +   + +D      +     D ++ NPPY+ D   P ++P  +  EP+QAL     G     R  +E+ P L  G  ++ EIG++Q+  +E+ L  +N     + L DL    R+L  ++
  S:    94 PLAYIIGEWEFWSLPFAVDPGVLIPRPETELLVEEALRLAPQLRGGAGRPLTILDLGTGSGILAVVLA--RELAPARVIAVDRSPAALAVARRNVCRHRVESRVSLLAADWLSALAAGKALFDLVVANPPYVEDVALPGLEPEVRDYEPRQALDGGAAGMAQIRRLAAELPPFLRPGGGLLMEIGWDQQGVVEQLLAPDNAWREVRILPDLAGLPRLLRCRR 313
>gi|15643254|ref|NP_228298.1| hemK protein [Thermotoga maritima MSB8] >gi|4980999|gb|AAD35573.1|AE001726_7 hemK protein [Thermotoga maritima MSB8] (282 aa)
Score = 201, Expect = 5.2e-14, Identities = 72/255 (28%), Positives = 131/255 (51%)
  Q:    36 ELILFNSKIIENSSDIFFEKDTEID-FEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFI--KSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYIKK 290
           E++L  S+++    +  F KD  +   E K+IL+ + K  +   P+ YI     F GLSF +++G FVPR ETE +++ A++  +    K + D+ +GSG +  +++   K  DAIV   + +    ++  KN     +  +F   K +  +  +  +   + I+ NPPY+ K+  ++      EP +ALF  ++G  FY  F         +G  ++ EIG +Q EE++K ++ + +    FLKD   K R L + +
  S:    35 EVLLIVSRVLGIRKEDLFLKDLGVSPTEEKRILELVEKRAS-GYPLHYILGEKEFMGLSFLVEEGVFVPRPETEELVELALELIRKYGIKTVADIGTGSGAIGVSVA---KFSDAIVFATDVSSKAVEIARKNAERHGVSDRFFVRKGEFLEPFKEKFASIEMILSNPPYV-KSSAHLPKDVLFEPPEALFGGEDGLDFYREFFGRYD---TSGKIVLMEIGEDQVEELKK-IVSDTV----FLKDSAGKYRFLLLNR 279
>gi|110003949|emb|CAK98289.1| putative s-adenosyl-methionine-dependent methyltransferase protein [Spiroplasma citri] (291 aa)
Score = 200, Expect = 5.5e-14, Identities = 79/276 (28%), Positives = 143/276 (51%)
  Q:    13 MTFSELTKRL-NPLDDSQIKWILKELILFNSKIIENS-SDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYI--------------LDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKT-QFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFK--FLKDLDDKDRVLYI 288
           MT +EL ++  + L DS     L ++ +  +  ++ S + ++  ++ +I+F+     +QL    N   P+Q+IT   +FYG  F++     +PR ETE ++D       +ID+ ++              +D+ +GSG +A  IS   +N +  +   + +    KV  +N + L  K  + ++ D+ +    +  K D ++CNPPYI  N          EP  ALF   +G YFY         ++     + FE G++QK+++EK L+K      K  F KD++ K R+L+I
  S:     1 MTVNELIQKSEDYLKDSNNANYLADIKILIAFFMKTSLAKLYAIQNDKINFKIDDYWQQLIAYRNGK-PIQHITNLQNFYGYDFYVDYNVLIPRYETEELVD---NINIIIDEMFLNNCNKRNCNKRLTLIDIGTGSGAIA--ISLGLENPNLTIYASDISIEALKVAKRNIKQLNCKNVKLLEGDMLEPFIKNKIKADLLVCNPPYIPNNQKISHHVKNYEPHVALFGDADGLYFYREIFQNWQKVVKKNGILCFEHGYDQKKDLEK-LVKEYFPNHKYYFQKDINKKWRMLFI 288
>gi|51598457|ref|YP_072645.1| HemK family methylase [Borrelia garinii PBi] >gi|51573028|gb|AAU07053.1| HemK family methylase, putative [Borrelia garinii PBi] (273 aa)
Score = 200, Expect = 5.5e-14, Identities = 71/227 (31%), Positives = 115/227 (50%)
  Q:    62 EYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKT--QFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPSTKCEPKQALFA-PQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYI 288
           E K    Q++K + K  P+ YI +   F G+ F + K   +PR +TE +++ A+ Q +    K ILDLC GSG +  +I+Y  K K   V   + +    K+  KN + LKL+   + I S++ K  +   E+ D II NPPY++K +  +    K EP +AL    ++G     + LS+    L     II E    Q + ++ F IK   +  K + DL+ + R L +
  S:    47 EKKLFFDQIDK-MKKGTPIHYILQKKEFMGIEFSLNKHVLIPRFDTECLVEEALIQIQQNGFKKILDLCCGSGCIGLSIAYYTKKK---VTLSDISIKALKIVEKNTKKLKLEKFIEIIHSNLLKFIK---ERFDIIITNPPYLNKEELEIKNKIKKEPAKALLGFGKDGLNISRKILSQAKEKLNPNGLIIIESAPWQIKSLKDFAIKKGFSHLKTIYDLEKRARALVL 269
>gi|118586289|ref|ZP_01543744.1| protoporphyrinogen oxidase [Oenococcus oeni ATCC BAA-1163] >gi|118433284|gb|EAV39995.1| protoporphyrinogen oxidase [Oenococcus oeni ATCC BAA-1163] (275 aa)
Score = 200, Expect = 5.5e-14, Identities = 66/202 (32%), Positives = 106/202 (52%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLI---DKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLK-LKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPST-KCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKN----NITVFKFLKDLD 280
           PVQY+    +FYG  F +     +P  ET  ++D  VK   L+   D   ILD+ +GSG LA T++   K K+  V+ V+ ++    +  KN +NL   + +FI+SD+ +     +   D I+ NPPY+   +  +D      EP QAL+A  +G   + + + E    L      IFE+ + Q +EI+  + KN     I +FK +  LD
  S:    64 PVQYVLGFANFYGRDFSVGPQVLIPEVETAELID-HVKNAVLLPLEDDFSILDIGTGSGNLAITLALELKAKN--VLAVDISQDALDLAKKNSQNLSATEVKFIRSDLLENVNGMF---DLIVSNPPYVKTGEKEIDKQVVDFEPHQALYAGADGMDVFRKMIPETVKHLKPDGYAIFEMDYRQGDEIKSLIKKNFPKAQIEIFKDISGLD 268
>gi|183598964|ref|ZP_02960457.1| hypothetical protein PROSTU_02408 [Providencia stuartii ATCC 25827] >gi|188021180|gb|EDU59220.1| hypothetical protein PROSTU_02408 [Providencia stuartii ATCC 25827] (281 aa)
Score = 200, Expect = 5.8e-14, Identities = 63/235 (26%), Positives = 112/235 (47%)
  Q:    51 IFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKL-KTQFIKSDIF-KIDRSHYEKCDFIICNPPYIDKNDPNVDP-STKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           IF   +TE+     + L+ L     +  P+ YI     F+ L  F+     +PR +TE +++ A+ +     +  ILDL +G+G +A  I+   +  D+++IG++ N     +  +NQ+ L L   QF++SD F  +   H+   D I+ NPPYID ND ++     + EP  AL A  +G       +S     L     ++ E G+ Q   + +   +   +  +   D   +DR+
  S:    39 IFAFAETELTQPEYEALESLLCRREQGEPIAYIIGEREFWSLPLFVSPATLIPRPDTECLVEQALARLP-AQRCQILDLGTGTGAIALAIA--SERPDSVIIGIDFNLDAVSLAQRNQQRLALNNVQFLQSDWFTSLSCQHF---DMIVSNPPYIDGNDDHLQQGDVRFEPLTALVADNHGLSDLDHIVSTSRSYLNPQGWLLVEHGWQQGAAVRELFKQYGYSNIETCLDYGGRDRI 270
>gi|149114991|ref|ZP_01841739.1| modification methylase, HemK family [Shewanella baltica OS223] >gi|160876840|ref|YP_001556156.1| modification methylase, HemK family [Shewanella baltica OS195] >gi|146865221|gb|EDK50559.1| modification methylase, HemK family [Shewanella baltica OS223] >gi|160862362|gb|ABX50896.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Shewanella baltica OS195] (282 aa)
Score = 200, Expect = 5.8e-14, Identities = 59/229 (25%), Positives = 106/229 (46%)
  Q:    56 DTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKL-KTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDP-STKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDR 284
           +  +  E  K  +Q+ +   K +PV +I     F+ L F +     +PR +TE +++ A+    L     +LDL +G+G +A  ++   + +   +  V+K      + + N+ NLKL +   ++SD F   +S     D I+ NPPYID+ D ++     + EP+ AL A + G+   +   +     L     I+ E GF Q   +   LI+        ++D    DR
  S:    49 EKSLTVEQWKRFQQMVQKRQKGVPVAHIVGEREFWSLPFIVNDTTLIPRPDTEILVETALNM-PLSTYAKVLDLGTGTGAIA--LALASERESWQITAVDKVDDAVALAIANRENLKLPQVDILQSDWFSAVKS--RDFDLIVSNPPYIDETDEHLHQGDVRFEPQSALTAAEEGFADLYYIANTARDYLKPNGYILLEHGFEQAVRLRAKLIELGYENVATVRDFGSNDR 274
>gi|73748900|ref|YP_308139.1| SAM-dependent methyltransferase HemK family protein [Dehalococcoides sp. CBDB1] >gi|73660616|emb|CAI83223.1| SAM-dependent methyltransferase HemK family [Dehalococcoides sp. CBDB1] (277 aa)
Score = 200, Expect = 6.1e-14, Identities = 55/187 (29%), Positives = 95/187 (50%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQ--FIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFL 265
           P  YIT    FYG +F + K   +PR ETE++++ A++  +  +  YI D+ +GSGV+A T++   + KDA V   + +    +V  +N    +L+ +  F + D+     S  E  D +  N PY+ K +  +      EP+ AL   ++G   Y R +  +   L  G   + EIG +Q E + K++
  S:    69 PSAYITGEKEFYGRTFLVDKRVLIPRPETEHLIEKALQIARHYECPYIADIGTGSGVIAITLAL--ELKDAYVYATDISEDALEVARQNAEEYRLEKRLSFYQGDLLS---SLPEMVDILAANLPYVPKAEAGL---LNGEPRLALDGGKDGLDLYRRLIPILPARLRPGGTALLEIGIHQSELLAKYI 249
>gi|148269572|ref|YP_001244032.1| HemK family modification methylase [Thermotoga petrophila RKU-1] >gi|147735116|gb|ABQ46456.1| modification methylase, HemK family [Thermotoga petrophila RKU-1] (282 aa)
Score = 200, Expect = 6.1e-14, Identities = 71/255 (27%), Positives = 129/255 (50%)
  Q:    36 ELILFNSKIIENSSDIFFEKDTEID-FEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFI--KSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYIKK 290
           E++L  S+++    +  F KD  +   E K+ILK + K  +   P+ YI     F GLS  +++G FVPR ETE +++ A++  +    K + D+ +GSG +  +++   K  D +V   + +    +V  KN     +  +F   K ++ +  +  +   + I+ NPPY+ K+  ++      EP +ALF  ++G  FY  F         +G  ++ EIG +Q EE++K      ++   FLKD   K R L++ +
  S:    35 EVLLIVSRVLGIRKEDLFLKDLVVSPTEEKRILKLVEKRAS-GYPLHYILGEKEFMGLSLLVEEGVFVPRPETEELVELALELIRKYGIKAVADIGTGSGAIGVSVA---KFSDVVVFATDVSSKAVEVARKNAERHGVSDRFFVRKGELLEPFKEKFASIEMILSNPPYV-KSSAHLPKDVLFEPAEALFGGEDGLDFYREFFGRYN---TSGKIVLMEIGEDQVEELKKI-----VSDAVFLKDSAGKYRFLFLNR 279
>gi|163762329|ref|ZP_02169394.1| acyl-CoA dehydrogenase domain protein [Bacillus selenitireducens MLS10] >gi|160357068|gb|EDP83716.1| acyl-CoA dehydrogenase domain protein [Bacillus selenitireducens MLS10] (307 aa)
Score = 200, Expect = 6.3e-14, Identities = 61/211 (28%), Positives = 116/211 (54%)
  Q:    78 IPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLI-----------DKKYILDLCSGSGVLANTIS-----YIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNV--DPSTKCEPKQALFAPQNGYYFYFRFLSEIYPIL-ANGTEIIFEIGFNQKEEIEKFLIKNNI--TVFKFLKDLDDKDRVLYI 288
           IPVQ++T    FYG  F + +   +PR ETE +++ AVK++              ++  I+D+ +GSG+LA T++     ++K N+   VI  + +R   ++   N    +    F+             +   I+ NPPYI ++D  +  D     EP  ALFA +NG   Y   + +++ +L   GT + FEIG+NQ + + + +I +    +  + ++D++  +R++ +
  S:    74 IPVQHLTGEEVFYGRRFRVNRDVLIPRPETEELVE-AVKERLSTGLSTSWDADSQEELGIVDIGTGSGILAITLALEIPGWLKGNQATRVIATDISRAALEMARINAEAHEAPVTFLAGSYLDPIIESGIRPRLIVSNPPYIPESDQAMMKDNVKNHEPHTALFAEENGLAAYRTMIEDLHRVLHPEGTWLFFEIGWNQGDAV-RTMITDRFPESSPEVIRDINGNERIVAV 303
>gi|32491093|ref|NP_871347.1| hypothetical protein WGLp344 [Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis] >gi|25166300|dbj|BAC24490.1| hemK [Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis] (281 aa)
Score = 200, Expect = 6.3e-14, Identities = 74/255 (29%), Positives = 120/255 (47%)
  Q:    33 ILKELILFNSKIIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKI--DRSHYEKCDFIICNPPYIDKNDPN-VDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLY 287
           +LK ++  +SK I    + +  K+     +   I ++L +      P+ Y+ KS  F+ +   I  G F+PR +TE +++ A+    L  +  IL+L SGSGV+  ++S  K+N   I+ G++KN+    +  KN + L +     K   +K   D+  Y     II NPPYI KNDP  +    K EPK AL + ++G              L     ++ E GF Q E++    + N         D   K+RV Y
  S:    32 LLKHVLRVDSKKIILHGENYLTKNQYYKLKNLLIRRKLGE------PISYLIKSHEFWSIKIKISCGIFIPRHDTECLIETALSL-PLKKESRILELGSGSGVI--SLSLGKENPKWIITGIDKNKKSIFLSRKNAKMLNINNVKFKKINWKYLKDKKIYS---MIITNPPYIKKNDPCLLKGDLKFEPKSALISGRDGLKDIKIICKISKKFLKRKGYLLVEHGFQQGEDVRNLFLSNGYKSVCTCFDYTRKERVTY 277
>gi|126172945|ref|YP_001049094.1| HemK family modification methylase [Shewanella baltica OS155] >gi|125996150|gb|ABN60225.1| modification methylase, HemK family [Shewanella baltica OS155] (282 aa)
Score = 200, Expect = 6.3e-14, Identities = 59/229 (25%), Positives = 106/229 (46%)
  Q:    56 DTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKL-KTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDP-STKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDR 284
           +  +  E  K  +Q+ +   K +PV +I     F+ L F +     +PR +TE +++ A+    L     +LDL +G+G +A  ++   + +   +  V+K      + + N+ NLKL +   ++SD F   +S     D I+ NPPYID+ D ++     + EP+ AL A + G+   +   +     L     I+ E GF Q   +   LI+        ++D    DR
  S:    49 EKSLTVEQWKRFQQMVQKRQKGVPVAHIVGEREFWSLPFIVNDTTLIPRPDTEILVETALNM-PLSTYANVLDLGTGTGAIA--LALASERESWQITAVDKVDDAVALAIANRENLKLPQVDILQSDWFSAVKS--RDFDLIVSNPPYIDETDEHLHQGDVRFEPQSALTAAEEGFADLYYIANTARDYLKPNGYILLEHGFEQAVRLRAKLIELGYENVATVRDFGSNDR 274
>gi|147669661|ref|YP_001214479.1| HemK family modification methylase [Dehalococcoides sp. BAV1] >gi|146270609|gb|ABQ17601.1| modification methylase, HemK family [Dehalococcoides sp. BAV1] (277 aa)
Score = 200, Expect = 6.4e-14, Identities = 55/187 (29%), Positives = 95/187 (50%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQ--FIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFL 265
           P  YIT    FYG +F + K   +PR ETE++++ A++  +  +  YI D+ +GSGV+A T++   + KDA V   + +    +V  +N    +L+ +  F + D+     S  E  D +  N PY+ K +  +      EP+ AL   ++G   Y R +  +   L  G   + EIG +Q E + K++
  S:    69 PSAYITGEKEFYGRTFLVDKRVLIPRPETEHLIEKALQIARHYECPYIADIGTGSGVIAITLAL--ELKDAYVYAADISEDALEVARQNAEEYRLEKRLSFYQGDLLS---SLPEMVDILAANLPYVPKAEAGL---LNGEPRLALDGGKDGLDLYRRLIPILPARLRPGGTALLEIGIHQSELLAKYI 249
>gi|94264415|ref|ZP_01288205.1| Modification methylase HemK [delta proteobacterium MLMS-1] >gi|93455172|gb|EAT05390.1| Modification methylase HemK [delta proteobacterium MLMS-1] (319 aa)
Score = 200, Expect = 6.4e-14, Identities = 60/212 (28%), Positives = 109/212 (51%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKK-----YILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKN--QRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYI-DKNDPNVDPSTK-CEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNI-TVFKFLKDLDDKDRVLYIKK 290
           P+ YI   + F+ L F +  G  +PR ETE +++ A++    +         ILDL +GSG+LA  ++  ++   A VI V+++     V  +N  +  ++ +   + +D      +     D ++ NPPY+ D   P ++P  +  EP+QAL     G     R  +E+ P L  G  ++ EIG++Q+  +E+ L  +N     + L DL    R+L  ++
  S:    94 PLAYIIGEWEFWSLPFAVDPGVLIPRPETELLVEEALRLAPQLRGGAGRPLTILDLGTGSGILAVVLA--RELAPARVIAVDRSPAALAVARRNVCRHRVESRVSLLAADWLSALAAGKALFDLVVANPPYVEDVALPGLEPEVRDYEPRQALDGGAAGMAQIRRLAAELPPFLRPGGGLLMEIGWDQQGVVEQLLAPDNAWREVRILPDLAGLPRLLCCRR 313
>gi|196157373|ref|YP_002126862.1| peptide release factor-glutamine N5-methyltransferase(HemK) [Alteromonas macleodii 'Deep ecotype'] >gi|88772579|gb|EAR03860.1| peptide release factor-glutamine N5-methyltransferase [Alteromonas macleodii 'Deep ecotype'] >gi|196113152|gb|ACG66868.1| peptide release factor-glutamine N5-methyltransferase(HemK) [Alteromonas macleodii 'Deep ecotype'] (285 aa)
Score = 200, Expect = 6.8e-14, Identities = 62/207 (29%), Positives = 99/207 (47%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETE----YMLDWAVKQKKL-IDKKYILDLCS-GSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKT-QFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDP-STKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           PV YI     F+ LS F      +PR +TE    ++++WA          K  L +C  G+G  A  ++   +   A VIGV+       +  +N  + K+   +F++SD F   R H    D I+ NPPYID+  P ++    + EPK AL +  +G       +S     L +   + FE GF+Q + ++  L  +     K +KD  + DRV
  S:    67 PVAYIIGKRDFWTLSLFTSSHTLIPRPDTEVLVEHVINWATGNVSANTPNKPPLSICDLGTGTGAIALALASELPQASVIGVDFLSDAVALAKRNANSNKINNARFMQSDWFSALRGH--TFDIIVSNPPYIDETSPYLNEGDVRFEPKSALTSGDSGLSDIKHIISHASTYLNSNGLLAFEHGFDQGDAVKALLQTSGFVNVKTIKDYGNNDRV 279
>gi|121635723|ref|YP_975968.1| hemk protein [Neisseria meningitidis FAM18] >gi|120867429|emb|CAM11201.1| hemk protein [Neisseria meningitidis FAM18] (423 aa)
Score = 200, Expect = 6.9e-14, Identities = 61/207 (29%), Positives = 99/207 (47%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPST-KCEPKQALFAPQNGYYFYFRFLSEIYP-ILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           PV Y+     FYG  F +     +PR ETE++++  +   +L +   + DL +GSG +A T++   +  DA V   + +    +   KN  +L  + +F     F  D     K D I+ NPPYI+  D ++     + EP+ AL    +G     R L++  P  LA G  ++ E GF+Q   +   L +N  +  + L DL   DRV
  S:   210 PVAYLLGWREFYGRRFAVNPNVLIPRPETEHLVEAVLA--RLPENGRVWDLGTGSGAVAVTVAL--ERPDAFVRASDISPPSLETARKNAADLGARVEFAHGSWFDTDMPSEGKWDIIVSNPPYIENGDKHLSQGDLRFEPQIALTDFSDGLSC-IRTLAQGAPDRLAEGGFLLLEHGFDQGAAVRGVLAENGFSGVETLPDLAGLDRV 413
>gi|15594542|ref|NP_212331.1| protoporphyrinogen oxidase, putative [Borrelia burgdorferi B31] >gi|2688095|gb|AAC66591.1| protoporphyrinogen oxidase, putative [Borrelia burgdorferi B31] (286 aa)
Score = 199, Expect = 7.6e-14, Identities = 68/220 (30%), Positives = 114/220 (51%)
  Q:    69 QLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLK--TQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPSTKCEPKQALFA-PQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYI 288
           Q++K+  K IP+ YI +   F G+ F + K   +PR +TE + + A+ Q +    K ILDLC GSG +  +I+Y  + K   VI  + +    ++  KN + LKL+   + I S++ K  +    K D II NPPY++K +  +    K EP +AL    ++G     + L++    L+    II E    Q + ++ F IK   +  K + DL+ + R L +
  S:    54 QIDKI-EKGIPIHYILQKKEFMGIEFSLNKHVLIPRFDTECLAEEALIQIQQNGFKKILDLCCGSGCIGLSIAYYIRKK---VILSDISTKALQIVEKNTKKLKLEKFVEIIHSNLLKCIKG---KLDIIITNPPYLNKEELEIKNKIKKEPTKALLGFGKDGLNISRKILNQAKEKLSPNGLIIIESAPWQIKSLKDFAIKKGFSHLKTIYDLEKRARALIL 269
>gi|116491554|ref|YP_811098.1| methylase of polypeptide chain release factor [Oenococcus oeni PSU-1] >gi|116092279|gb|ABJ57433.1| Methylase of polypeptide chain release factor [Oenococcus oeni PSU-1] (275 aa)
Score = 199, Expect = 7.8e-14, Identities = 66/202 (32%), Positives = 106/202 (52%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLI---DKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLK-LKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPST-KCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKN----NITVFKFLKDLD 280
           PVQY+    +FYG  F +     +P  ET  ++D  VK   L+   D   ILD+ +GSG LA T++   K K+  V+ V+ ++    +  KN +NL   + +FI+SD+ +     +   D I+ NPPY+   +  +D      EP QAL+A  +G   + + + E    L      IFE+ + Q +EI+  + KN     I +FK +  LD
  S:    64 PVQYVLGFANFYGRDFSVGPQVLIPEVETAELID-HVKNAVLLPLEDDFSILDIGTGSGNLAITLALELKAKN--VLAVDISQDALDLAKKNSQNLSATEVKFIRSDLLENVNGLF---DLIVSNPPYVKTGEKEIDKQVVDFEPHQALYAGADGMDVFRKMIPETVKHLKPDGYAIFEMDYRQGDEIKSLIKKNFPKAQIEIFKDISGLD 268
>gi|167944076|ref|ZP_02531150.1| protoporphyrinogen oxidase, putative [Borrelia burgdorferi Bol26] (286 aa)
Score = 199, Expect = 8.0e-14, Identities = 68/220 (30%), Positives = 114/220 (51%)
  Q:    69 QLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLK--TQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPSTKCEPKQALFA-PQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYI 288
           Q++K+  K IP+ YI +   F G+ F + K   +PR +TE + + A+ Q +    K ILDLC GSG +  +I+Y  + K   VI  + +    ++  KN + LKL+   + I S++ K  +    K D II NPPY++K +  +    K EP +AL    ++G     + L++    L+    II E    Q + ++ F IK   +  K + DL+ + R L +
  S:    54 QIDKI-EKGIPIHYILQKKEFMGIEFSLNKHVLIPRFDTECLAEEALIQIQQNGFKKILDLCCGSGCIGLSIAYYIRKK---VILSDISTKALQIVEKNTKKLKLEKFVEIIHSNLLKCIKG---KLDIIITNPPYLNKEELEIKNKIKKEPTKALLGFGKDGLNISRKILNQAKEKLSPNGLIIIESAPWQIKSLKDFAIKKGFSHLKTIYDLEKRARALIL 269
>gi|195949112|ref|ZP_03090212.1| protoporphyrinogen oxidase, putative [Borrelia burgdorferi WI91-23] (286 aa)
Score = 199, Expect = 8.2e-14, Identities = 67/220 (30%), Positives = 115/220 (52%)
  Q:    69 QLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLK--TQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPSTKCEPKQALFA-PQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYI 288
           Q++K+  K IP+ YI +   F G+ F + +   +PR +TE +++ A+ Q +    K ILDLC GSG +  +I+Y  + K   VI  + +    ++  KN + LKL+   + I S++ K  +    K D II NPPY++K +  +    K EP +AL    ++G     + L++    L+    II E    Q + ++ F IK   +  K + DL+ + R L +
  S:    54 QIDKI-EKGIPIHYILQKKEFMGIEFSLNRHVLIPRFDTECLVEEALIQIQQNGFKKILDLCCGSGCIGLSIAYYIRKK---VILSDISTKALQIVEKNTKKLKLEKFVEIIHSNLLKCIKG---KLDIIITNPPYLNKEELEIKNKIKKEPTKALLGFGKDGLNISRKILNQAKEKLSPNGLIIIESAPWQIKSLKDFAIKKGFSHLKTIYDLEKRARALIL 269
>gi|169826580|ref|YP_001696738.1| HemK-like protein [Lysinibacillus sphaericus C3-41] >gi|168991068|gb|ACA38608.1| HemK-like protein [Lysinibacillus sphaericus C3-41] (285 aa)
Score = 199, Expect = 8.4e-14, Identities = 65/209 (31%), Positives = 101/209 (48%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAV-KQKKLIDKKY--ILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYI--DKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEII-FEIGFNQKEEIEKFLIKN-NITVFKFLKDLDDKDRVLY 287
           PVQY   S  FYG SF + +   +PR ETE ++   + +  KL   +   + D+ +GSG +A  IS   +     V+  + +        KN + L+    F   D+        EK D ++ NPPYI  ++     D   K EP  ALFA ++G   Y R L+E  P   N   +I  EIG+ Q E++ KF   +         KD++ K R+++
  S:    70 PVQYCVGSEEFYGRSFIVDESVLIPRPETEELILGTINRMTKLFQHQALKVADIGTGSGAIA--ISMKLECPTLTVVATDLSEAALATAQKNAQRLEANIDFRLGDLTAPLAG--EKFDIVLSNPPYIAFEEAQAMSDVVLKHEPHSALFAEEDGLILY-RQLAEQLPAYMNRPALIGLEIGYTQGEKVAKFFQDSFPQATISIEKDINGKPRMIF 280
>gi|195962101|ref|ZP_03098306.1| HemK family methylase [Borrelia spielmanii A14S] (277 aa)
Score = 199, Expect = 8.6e-14, Identities = 74/254 (29%), Positives = 124/254 (48%)
  Q:    35 KELILFNSK--IIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLK--TQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPSTKCEPKQALFA-PQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYI 288
           KELI+ N K  + +   ++FF+    I+               K  P+ YI +   F G+ F + K   +PR +TE +++ A+ Q +    K ILDLC GSG +  +I+Y  K K   ++  + +    ++  KN + LKL+   + I S++ K  +    K D II NPPY++K +  +    K EP +AL    ++G     + LS+    L     II E    Q + ++ F IK   +  K + DL+ + R L +
  S:    32 KELIIANIKKSLTKKEKNLFFDHIDNIE---------------KGTPIHYILRKKEFMGIEFTLNKHVLIPRFDTECLVEEALIQIQQNGFKKILDLCCGSGCIGLSIAYYMKKK---IMLSDISIKALQIVTKNTKKLKLERFVEIIHSNLLKCIKG---KLDIIITNPPYLNKEELEIKNKIKKEPSRALLGFGKDGLNISRKILSQAKEKLNPNGLIIIESAPWQIKSLKDFAIKKGFSHLKTIYDLEKRARALVL 269
>gi|170728013|ref|YP_001762039.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Shewanella woodyi ATCC 51908] >gi|169813360|gb|ACA87944.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Shewanella woodyi ATCC 51908] (280 aa)
Score = 199, Expect = 8.7e-14, Identities = 56/206 (27%), Positives = 102/206 (49%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKL-KTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDP-STKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDR 284
           P+ +I     F+ L F +     +PR +TE +++ A+    L +   +LDL +G+G +A +++Y K +    +  V+K      +   N+ +LKL +   I+SD F  D  +    + I+ NPPYID+ D +++    + EP  AL AP++G+   +         LA G  ++ E GF Q  ++   +I+        ++D    DR
  S:    70 PIAHIVGEREFWSLPFMVNPTTLIPRPDTEILVETALNLP-LAEAAKVLDLGTGTGAIALSLAYEKPSWQ--ITAVDKIIEAVALAKANRSHLKLPQVDIIQSDWF--DSVNCYDFNLIVSNPPYIDEEDSHLEEGDVRFEPHSALTAPEHGFADLYHIADCARDYLAPGGYLLLEHGFGQALQLRDKMIELGYENVATVRDFGSNDR 272
>gi|161869127|ref|YP_001598293.1| HemK protein [Neisseria meningitidis 053442] >gi|161594680|gb|ABX72340.1| HemK protein [Neisseria meningitidis 053442] (234 aa)
Score = 199, Expect = 8.9e-14, Identities = 61/207 (29%), Positives = 99/207 (47%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPN-VDPSTKCEPKQALFAPQNGYYFYFRFLSEIYP-ILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           PV YI     FYG  F +     +PR ETE++++  +   +L +   + DL +GSG +A T++   +  DA V   + +    +   +N  +L  + +F     F  D     K D I+ NPPYI+  D + +    + EP+ AL    +G     R L++  P  LA G  ++ E GF+Q   +   L +N  +  + L DL   DRV
  S:    21 PVAYILGVREFYGRRFTVNPSVLIPRPETEHLVEAVLA--RLPENGRVWDLGTGSGAVAVTVAL--ERPDAFVRASDISPPALETARENAADLGARVEFAHGSWFDTDMPSEGKWDIIVSNPPYIENGDKHLLQGDLRFEPQIALTDFSDGLSC-IRTLAQGAPDRLAEGGFLLLEHGFDQGAAVRGVLAENGFSGVETLPDLAGLDRV 224
>gi|118602770|ref|YP_903985.1| HemK family modification methylase [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)] >gi|118567709|gb|ABL02514.1| modification methylase, HemK family [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)] (261 aa)
Score = 198, Expect = 9.2e-14, Identities = 75/241 (31%), Positives = 119/241 (49%)
  Q:    46 ENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKY---ILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTE-------IIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVL 286
           +N   +    D + + E K  L QL K     IP  Y++ +  FY L F +     +PR ETE ++D A+    L DK     +LDL +GSG++  T+    KN    +   + +     +    Q+N K    F     FK   +  +  D II NPPYI ++DP+++     EP+ AL + ++G       L +I  I+ N  +       I+ E GF+Q++EI + L  N   + KF KD + +DR L
  S:    25 KNHVQLITHYDYQPNNEEKTQLNQLIKQRQFGIPFAYLSGTKGFYHLDFKVTPSTLIPRPETELLIDIAL---GLFDKNQTCKVLDLGTGSGIIIITLG--DKNPQWHLTATDSSINALDIA---QQNAKTNINFQLGSWFKATPN--QIFDLIISNPPYIKQSDPHLN-DLSFEPQSALVSGKDG-------LDDIRTIINNAPQHLNKKGYILLEHGFDQQQEIIQLLSNNFFNIQKF-KDYNQQDRAL 256
>gi|153002120|ref|YP_001367801.1| HemK family modification methylase [Shewanella baltica OS185] >gi|151366738|gb|ABS09738.1| modification methylase, HemK family [Shewanella baltica OS185] (282 aa)
Score = 198, Expect = 9.5e-14, Identities = 59/229 (25%), Positives = 106/229 (46%)
  Q:    56 DTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKL-KTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDP-STKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDR 284
           +  +  E  K  +Q+ +   K +PV +I     F+ L F +     +PR +TE +++ A+    L     +LDL +G+G +A  ++   + +   +  V+K      + + N+ NLKL +   ++SD F   +S     D I+ NPPYID+ D ++     + EP+ AL A + G+   +   +     L     I+ E GF Q   +   LI+        ++D    DR
  S:    49 EKSLTVEQWKRFQQMVQKRQKGVPVAHIVGEREFWSLPFIVNDTTLIPRPDTEILVETALNL-PLSTYAKVLDLGTGTGAIA--LALASERESWQITAVDKVDDAVALAIANRENLKLPQVDILQSDWFSAVKS--RDFDLIVSNPPYIDETDEHLHQGDVRFEPQSALTAAEEGFADLYYIANTARDYLKPNGYILLEHGFEQAVRLRAKLIELGYENVATVRDFGSNDR 274
>gi|187931104|ref|YP_001891088.1| modification methylase, HemK family [Francisella tularensis subsp. mediasiatica FSC147] >gi|187712013|gb|ACD30310.1| modification methylase, HemK family [Francisella tularensis subsp. mediasiatica FSC147] (284 aa)
Score = 198, Expect = 9.6e-14, Identities = 72/234 (30%), Positives = 116/234 (49%)
  Q:    51 IFFEKDTEIDFEYKKILKQLNKVLNKNI---PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKY-ILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKN-QRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPSTK-CEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDR 284
           ++   D ++D   K  LK++++ + + +   P+ YI     F+    ++ K   +PR +TE ++   +   +  D +  ILDL +G+G +A  ++    N    V+ V+  +    V  KN Q N     +FI+S  +       +K D I+ NPPYID  D N+D S K  EP +ALFA  NG       +S+    L  G  I  E GF Q + I     + N T  K +KDL++ DR
  S:    43 LYINSDKQLD---KNTLKKIDEKILRLLAGEPLAYILGYKYFWNQKLYVTKDTLIPRADTETIVATVLDDIQNKDAQLKILDLGTGTGAIALALAAELANSQ--VVAVDLYQQSLDVAKKNAQANNITNVKFIQSSWYT--NLDTDKFDIIVSNPPYIDLADTNIDQSVKDYEPARALFAADNGLADIRIIISQAKDFLNLGGFIYIEHGFTQADAITALFSQCNFTDIKIVKDLNNNDR 275
>gi|168692670|ref|ZP_02725462.1| protoporphyrinogen oxidase, putative [Borrelia burgdorferi 94a] (286 aa)
Score = 198, Expect = 9.6e-14, Identities = 67/220 (30%), Positives = 115/220 (52%)
  Q:    69 QLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLK--TQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPSTKCEPKQALFA-PQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYI 288
           Q++K+  K IP+ YI +   F G+ F + +   +PR +TE +++ A+ Q +    K ILDLC GSG +  +I+Y  + K   VI  + +    ++  KN + LKL+   + I S++ K  +    K D II NPPY++K +  +    K EP +AL    ++G     + L++    L+    II E    Q + ++ F IK   +  K + DL+ + R L +
  S:    54 QIDKI-EKGIPIHYILQKKEFMGIEFNLNRHVLIPRFDTECLVEEALIQIQQNGFKKILDLCCGSGCIGLSIAYYIRKK---VILSDISTKALQIVEKNTKKLKLEKFVEIIHSNLLKCIKG---KLDIIITNPPYLNKEELEIKNKIKKEPTKALLGFGKDGLNISRKILNQAKEKLSPNGLIIIESAPWQIKSLKDFAIKKGFSHLKTIYDLEKRARALIL 269
>gi|168526514|ref|ZP_02720153.1| protoporphyrinogen oxidase, putative [Borrelia burgdorferi 118a] >gi|168580110|ref|ZP_02724082.1| protoporphyrinogen oxidase, putative [Borrelia burgdorferi 72a] (286 aa)
Score = 198, Expect = 9.8e-14, Identities = 67/220 (30%), Positives = 115/220 (52%)
  Q:    69 QLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLK--TQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPSTKCEPKQALFA-PQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYI 288
           Q++K+  K IP+ YI +   F G+ F + +   +PR +TE +++ A+ Q +    K ILDLC GSG +  +I+Y  + K   VI  + +    ++  KN + LKL+   + I S++ K  +    K D II NPPY++K +  +    K EP +AL    ++G     + L++    L+    II E    Q + ++ F IK   +  K + DL+ + R L +
  S:    54 QIDKI-EKGIPIHYILQKKEFMGIEFNLNRHVLIPRFDTECLVEEALIQIQQNGFKKILDLCCGSGCIGLSIAYYIRKK---VILSDISTKALQIVEKNTKKLKLEKFVEIIHSNLLKCIKG---KLDIIITNPPYLNKEELEIKNKIKKEPTKALLGFGKDGLNISRKILNQAKEKLSPNGLIIIESAPWQIKSLKDFAIKKGFSHLKTIYDLEKRARALIL 269
>gi|191638151|ref|YP_001987317.1| Protoporphyrinogen oxidase (Putative) [Lactobacillus casei] >gi|190712453|emb|CAQ66459.1| Protoporphyrinogen oxidase (Putative) [Lactobacillus casei BL23] (276 aa)
Score = 198, Expect = 9.9e-14, Identities = 61/207 (29%), Positives = 102/207 (49%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKND-PNVDPST-KCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQ----KEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           P QYI     F+G  F +     +PR ETE ++ W  ++++       LDL +GSG +  T++  +K     +   + +     V  +N +  ++  QF  SD+F    + Y   DF++ N PYI   + P +D ST + EPK ALFA  +G   + +F++ +   L  G     E G+ Q    +E   K L +  +T   F +D+ D  R+
  S:    69 PAQYIVGVAPFFGELFKVTPAVLIPRFETEELVAWVAEEQRTAQTG--LDLGTGSGAIGLTLA--RKLPQTTMTLSDVSPEALAVAKQNAKEQQVAVQFTVSDLFAALPARY---DFVVTNLPYIAPEETPVMDQSTLRYEPKLALFAGHHGLAVFEQFVAALPQHLTAGGAAYLEFGYRQEPALRELFAKQLPQAQVT---FRRDMADHPRM 271
>gi|115315349|ref|YP_764072.1| hemK methylase [Francisella tularensis subsp. holarctica OSU18] >gi|115130248|gb|ABI83435.1| hemK methylase [Francisella tularensis subsp. holarctica OSU18] >gi|157122798|gb|EDO66927.1| hypothetical protein FTAG_01187 [Francisella tularensis subsp. holarctica FSC022] (284 aa)
Score = 198, Expect = 9.9e-14, Identities = 72/234 (30%), Positives = 116/234 (49%)
  Q:    51 IFFEKDTEIDFEYKKILKQLNKVLNKNI---PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKY-ILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKN-QRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPSTK-CEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDR 284
           ++   D ++D   K  LK++++ + + +   P+ YI     F+    ++ K   +PR +TE ++   +   +  D +  ILDL +G+G +A  ++    N    V+ V+  +    V  KN Q N     +FI+S  +       +K D I+ NPPYID  D N+D S K  EP +ALFA  NG       +S+    L  G  I  E GF Q + I     + N T  K +KDL++ DR
  S:    43 LYINSDKQLD---KNTLKKIDEKILRLLAGEPLAYILGYKYFWNQKLYVTKDTLIPRADTETVVATVLDDIQNKDAQLKILDLGTGTGAIALALAAELANSQ--VVAVDLYQQSLDVAKKNAQANNITNVKFIQSSWYT--NLDTDKFDIIVSNPPYIDLADTNIDQSVKDYEPARALFAADNGLADIRIIISQAKDFLNLGGFIYIEHGFTQADAITALFSQCNFTDIKIVKDLNNNDR 275
>gi|126728794|ref|ZP_01744609.1| modification methylase, HemK family protein [Sagittula stellata E-37] >gi|126710724|gb|EBA09775.1| modification methylase, HemK family protein [Sagittula stellata E-37] (281 aa)
Score = 198, Expect = 1.0e-13, Identities = 62/229 (27%), Positives = 109/229 (47%)
  Q:    58 EIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVG--VKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKND-PNVDPSTK-CEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVL 286
           E+D E + +   L +     +PV ++    +FYG  F +      PR ETE +++ A+ +        +LDL +GSG +  T+  + +  DA+  G + + +   V    +N  NL+ + +F +   +       E  D I+ NPPYI  N+ P + P  +  EP+ AL    +G   Y   L+     LA G  ++ EIG  Q   + K   +  +   + + D+D +DRV+
  S:    48 EVDPELEVVYLTLIERRADRVPVSHLVGRRAFYGRDFLVTPEVLDPRPETETLIEVALSEPF----GTVLDLGTGSGCILLTL--LAERDDAVGYGTDVSASALNVAHWNRNALNLEGRAEFCEGSWYGALGQMDELFDLIVSNPPYIAVNEMPFLSPEVRDHEPRLALTDEADGQTAYHAILAGHARWLAPGGRLVAEIGATQGMAVSKLFARAGLRGVRVIPDIDGRDRVV 274
>gi|162447072|ref|YP_001620204.1| SAM-dependent methyltransferase [Acholeplasma laidlawii PG-8A] >gi|161985179|gb|ABX80828.1| SAM-dependent methyltransferase, HemK family [Acholeplasma laidlawii PG-8A] (283 aa)
Score = 198, Expect = 1.2e-13, Identities = 78/259 (30%), Positives = 120/259 (46%)
  Q:    30 IKWILKELILFNSKIIENSSDIFFEKDTEIDFEY-KKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKY-------ILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKN-NITVFKFLKDLDDKDRVLYI 288
           + W++ EL  ++       ++ + + ++++  E   KI     +   +  PVQ+I     FYG  F +     +PR+ETE +    V++  LI   Y       +LDL +GSG +A T+S  + N    V   + + T   V  +NQ NL  K  FI SD F      Y   D I+ NPPYI  ND  V+     EP  AL+   +G   Y   L      L     I FE    Q E ++  ++K       + LKDL  KDR+ ++
  S:    24 MSWLITELSGYSP------TEFYLKMNSKVSEELINKIEDGFKRYAIEGTPVQHIVGYSYFYGYKFKVSDQVLIPRRETEQL----VEETLLIYDTYFEDQKVDVLDLGTGSGAIAITLSIEEPNMQ--VEASDISVTALMVARENQLNLSSKVNFIASDWFSNINKKY---DIIVANPPYI-PNDEAVEDVVTKEPSLALYGGVDGLEPYEIILKNAKNYLKEKALIAFEHSMYQSENLKTLILKYFKDAKVRQLKDLQGKDRMTFV 275
>gi|168491916|ref|ZP_02716059.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Streptococcus pneumoniae CDC0288-04] >gi|183573762|gb|EDT94290.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Streptococcus pneumoniae CDC0288-04] (279 aa)
Score = 198, Expect = 1.2e-13, Identities = 70/240 (29%), Positives = 118/240 (49%)
  Q:    49 SDIFFEKDTEIDFEY-KKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDA-IVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDP-----NVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKN-NITVFKFLKDLDDKDRVLYI 288
           +D  F    E+  E  K+ ++ + + L  + P QYI     FYG+   + +   +PR ETE +++  + +  L     +LD+ +GSG +A  ++   KN+ A  V   + ++   ++  +N  +  L   F KSD F       EK D I+ NPPYI + D      NV  S   EP  ALFA ++G   Y R   +    L +  +I  EIG+ Q + + +   K+      + LKD   +DR++ +
  S:    37 TDFIFALQQEVTTEEEKQFVEDIYQQLAAHKPAQYIIGQADFYGMHLKVDERVLIPRPETEELVELILTE-NLETNLSVLDIGTGSGAIALALA---KNRPAWSVTAADVSQEALELASENASDQNLNIFFKKSDCFA---EISEKYDIIVSNPPYISREDESEVGLNVLHS---EPHLALFADEDGLAIYCRIAEDATDYLKDSGKIYLEIGYKQGQSVPELFRKHLPEKRVRTLKDQFGQDRMVVV 274
>gi|170288248|ref|YP_001738486.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Thermotoga sp. RQ2] >gi|170175751|gb|ACB08803.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Thermotoga sp. RQ2] (282 aa)
Score = 197, Expect = 1.2e-13, Identities = 71/255 (27%), Positives = 128/255 (50%)
  Q:    36 ELILFNSKIIENSSDIFFEKDTEID-FEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFI--KSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYIKK 290
           E++L  S+++    +  F KD  +   E K+ILK + K  +   P+ YI     F GLS  +++G FVPR ETE +++ A++  +    K + D+ +GSG +  +++   K  D +V   + +    +V  KN     +  +F   K +  +  +  +   + I+ NPPY+ K+  ++      EP +ALF  ++G  FY  F         +G  ++ EIG +Q EE++K      ++   FLKD   K R L++ +
  S:    35 EVLLIVSRVLGIRKEDLFLKDLVVSPTEEKRILKLVEKRAS-GYPLHYILGEKEFMGLSLLVEEGVFVPRPETEELVELALELIRKYGIKAVADIGTGSGAIGVSVA---KFSDVVVFATDVSSKAVEVARKNAERHGVSDRFFVRKGEFLEPFKEKFASIEMILSNPPYV-KSSAHLPKDVLFEPAEALFGGEDGLDFYREFFGRYN---TSGKIVLMEIGEDQVEELKKI-----VSDAVFLKDSAGKYRFLFLNR 279
>gi|86131745|ref|ZP_01050342.1| putative protoporphyrinogen oxidase [Cellulophaga sp. MED134] >gi|85817567|gb|EAQ38741.1| putative protoporphyrinogen oxidase [Dokdonia donghaensis MED134] (291 aa)
Score = 197, Expect = 1.3e-13, Identities = 67/240 (27%), Positives = 115/240 (47%)
  Q:    47 NSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVK-------QKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNV--DPSTKCEPKQALFAPQNGYYFYFRFLSEI-YPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVL 286
           N  +I   +   I    +K L+++   L+K+ P+QYIT S SFYGL F +     +PR ETE ++ W +        +++  D   +LD+ +GSG +A T++  K    A V  V+ ++       +N +   +K  F   +I +  ++  E  + I+ NPPY+ + +  +  +     EP  ALF        ++R + E+    LA    + FEI      E    L     T     KD+  KDR++
  S:    38 NRVEISLSRKQNIHPSQRKELEEITARLSKSEPMQYITGSSSFYGLDFQVNPATLIPRPETEELVAWIIDDVAQGLLKEEAQDMLRLLDIGTGSGCIAITLA--KNINKATVEAVDISQNALATAYQNAKANGVKVDFYNQNILET-QALDEVYNVIVSNPPYVREQEKAMMRENVLSNEPDSALFVSDQDPLIFYRKIGELARKSLAPSGALYFEINEYLGRETVALLKNIGFTDVVLRKDMFGKDRMI 284
>gi|42518856|ref|NP_964786.1| hypothetical protein LJ0931 [Lactobacillus johnsonii NCC 533] >gi|41583142|gb|AAS08752.1| hypothetical protein LJ_0931 [Lactobacillus johnsonii NCC 533] (280 aa)
Score = 197, Expect = 1.3e-13, Identities = 68/224 (30%), Positives = 116/224 (51%)
  Q:    64 KKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSH-----YEKCDFIICNPPYIDKNDPNVDPST--KCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVF--KFLKDLDDKDRVLY 287
           K+ LK + K L + I  QYI     FYG    + +G  +PR ETE ++ WA++   +   K ILDL +GSG +   ++ +K+ +   +    +N   Y   + +    + +  F+K D+    R        EK D II NPPYI  ++ N+      K EP  AL+  ++G  FY +F  ++   L    +   E GF++KE++++ L +  +  F  +F  DL  K R+++
  S:    53 KQALKDMKK-LRRGISPQYILGYAWFYGYKILVNRGVLIPRFETEELVKWALEN--IESGKKILDLGTGSGAI--MVALVKQAQKQGI----QNLNLYASDITDSALRESEENFLKYDLDVKTRKANVLVGLEKFDMIISNPPYIKTSEKNLMDKNVIKNEPDTALYGGEDGLDFYRKFAKQVQSHLNPQGQFFLEFGFSEKEQLKE-LFETELPDFEIEFKDDLAGKPRMVH 275
>gi|126646374|ref|ZP_01718891.1| putative protoporphyrinogen oxidase [Algoriphagus sp. PR1] >gi|126578006|gb|EAZ82226.1| putative protoporphyrinogen oxidase [Algoriphagus sp. PR1] (277 aa)
Score = 197, Expect = 1.5e-13, Identities = 62/208 (29%), Positives = 103/208 (49%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYI-----DKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSE-IYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVL 286
           PVQYI     FYG  FF+ +   +PR ETE ++   +KQ      K +LD+ +GSG +  +++ ++ NK  I    + +    +V  +N  +L  +  F   DI K D     + D ++ NPPY+     D+   NV      EP  ALF P +    ++R ++E    +L  G ++ +EI  N   +  K L          ++DL+ KDR++
  S:    67 PVQYIIGKAPFYGRDFFVDESVLIPRNETEELVHMIIKQNPSAGLK-VLDIGTGSGCIPISLA-LELNKPEIYTA-DVSEEALEVAEENAEHLGAQVTFFHLDILK-DTPALSELDIVVSNPPYVPEAEWDELHSNV---RDFEPGLALFVPDHDPLLFYRVIAEKALKLLKPGGKLYYEIHNNFGPQTVKLLESLGYKNIDLVQDLNGKDRMV 273
>gi|15834913|ref|NP_296672.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Chlamydia muridarum Nigg] >gi|8163189|gb|AAF73543.1| modification methylase, HemK family [Chlamydia muridarum Nigg] (290 aa)
Score = 197, Expect = 1.5e-13, Identities = 64/211 (30%), Positives = 93/211 (44%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQ-KKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYID-KNDPNVDPSTKC-EPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYIK 289
           P  YI     F G+   +     +PRQETE  ++  +   +   +KK   D+C GSG +   +S  K      V+  +       V   N +   L   F+  D+F+  R      D  +CNPPY+  K    VDP  +C EP +AL    +G  FY R    I+ IL  G     EIG NQ E ++K      I+   F KD    DR  +++
  S:    65 PTAYIHGKVHFLGIELQVSPEVLIPRQETEIFVEKIIGYLQTHKEKKIFYDVCCGSGCIG--LSVKKHCPHVHVVLSDICSQALAVAKSNAKRNDLIVDFLCGDLFEPFRI---PADAFVCNPPYLSYKEFFKVDPEVRCHEPWKALVGGVSGLEFYHRIAEHIHKILVPGGVGWLEIGSNQGESVKKIFRDKGISGCVF-KDYAQLDRFFFLE 272
>gi|118498112|ref|YP_899162.1| HemK family modification methylase [Francisella tularensis subsp. novicida U112] >gi|194323338|ref|ZP_03057122.1| methyltransferase, HemK family [Francisella tularensis subsp. novicida FTE] >gi|118424018|gb|ABK90408.1| modification methylase, HemK family [Francisella tularensis subsp. novicida U112] >gi|194322702|gb|EDX20182.1| methyltransferase, HemK family [Francisella tularensis subsp. novicida FTE] (284 aa)
Score = 197, Expect = 1.6e-13, Identities = 72/234 (30%), Positives = 116/234 (49%)
  Q:    51 IFFEKDTEIDFEYKKILKQLNKVLNKNI---PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKY-ILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKN-QRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPSTK-CEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDR 284
           ++   D ++D   K  LK++++ + + +   P+ YI     F+    ++ K   +PR +TE ++   +   +  D +  ILDL +G+G +A  ++    N    V+ V+  +    V  KN Q N     +FI+S  +       +K D I+ NPPYID  D N+D S K  EP +ALFA  NG       +S+    L  G  I  E GF Q + I     + N T  K +KDL++ DR
  S:    43 LYINSDKQLD---KNTLKKIDEKILRLLAGEPLAYILGYKYFWNQKLYVTKDTLIPRADTETVVATVLDDIQNKDAQLKILDLGTGTGAIALALAAELANSQ--VVAVDLYQQSLDVAKKNAQANNITNVKFIQSSWYT--NLDTDKFDIIVSNPPYIDLADTNIDQSVKDYEPARALFAADNGLADIRIIISQAKDFLNLGGFIYIEHGFTQADAITALFSQYNFTDIKTVKDLNNNDR 275
>gi|120612309|ref|YP_971987.1| HemK family modification methylase [Acidovorax avenae subsp. citrulli AAC00-1] >gi|120590773|gb|ABM34213.1| modification methylase, HemK family [Acidovorax avenae subsp. citrulli AAC00-1] (311 aa)
Score = 196, Expect = 1.6e-13, Identities = 52/187 (27%), Positives = 92/187 (49%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFL 265
           PV Y+T    FYGL   +      PR +TE ++DWA++  + +    + DL +GSG +A  + +       +V+ V+ +     V   N R L L   F++++        +   D I+ NPPYI+++DP++      EP+QAL +  +G       + +    LA G  ++ E G+NQ + ++  L
  S:    77 PVAYLTGRKEFYGLPLQVDARVLDPRPDTETLVDWALEVLRPLPLPRVADLGTGSGAIALALRHGLPGAQ-VVLAVDASADALAVARANARRLHLSVDFVRTNWLDGISGPF---DAIVSNPPYIEEDDPHLAALVH-EPRQALASGPDGLDDIRTIVVQSSSRLAPGGWLLLEHGWNQAQAVQALL 258
>gi|157376590|ref|YP_001475190.1| HemK family modification methylase [Shewanella sediminis HAW-EB3] >gi|157318964|gb|ABV38062.1| modification methylase, HemK family [Shewanella sediminis HAW-EB3] (280 aa)
Score = 196, Expect = 1.6e-13, Identities = 56/206 (27%), Positives = 101/206 (49%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKL-KTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDP-STKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDR 284
           P+ +I     F+ L F +     +PR +TE +++ A+    L D   +LDL +G+G +A +++Y K      +  V+K      +   N+ +LKL + + ++SD F  D       + I+ NPPYID+ D ++     + EP+ AL A + G+   +   S     LA G  ++ E G+ Q  ++ K +I+        ++D    DR
  S:    70 PIAHIVGEREFWSLPFMVNPTTLIPRPDTEILVETALNL-PLADSARVLDLGTGTGAIALSLAYEKPEWQ--ITAVDKIIEAVALAKANRAHLKLPQVEIVQSDWF--DSVACYDFNLIVSNPPYIDETDEHLSQGDVRFEPQSALTAGEEGFADLYHIASCARDYLAPGGYLLLEHGYQQAIQLRKKMIELGYENVATVRDFGSNDR 272
>gi|60593723|pdb|1VQ1|A Chain A, Crystal Structure Of N5-Glutamine Methyltransferase, Hemk(Ec 2.1.1.-) (Tm0488) From Thermotoga Maritima At 2.80 A Resolution >gi|60593724|pdb|1VQ1|B Chain B, Crystal Structure Of N5-Glutamine Methyltransferase, Hemk(Ec 2.1.1.-) (Tm0488) From Thermotoga Maritima At 2.80 A Resolution (294 aa)
Score = 196, Expect = 1.6e-13, Identities = 72/255 (28%), Positives = 131/255 (51%)
  Q:    36 ELILFNSKIIENSSDIFFEKDTEID-FEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFI--KSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYIKK 290
           E++L  S+++    +  F KD  +   E K+IL+ + K  +   P+ YI     F GLSF +++G FVPR ETE +++ A++  +    K + D+ +GSG +  +++   K  DAIV   + +    ++  KN     +  +F   K +  +  +  +   + I+ NPPY+ K+  ++      EP +ALF  ++G  FY  F         +G  ++ EIG +Q EE++K ++ + +    FLKD   K R L + +
  S:    47 EVLLIVSRVLGIRKEDLFLKDLGVSPTEEKRILELVEKRAS-GYPLHYILGEKEFXGLSFLVEEGVFVPRPETEELVELALELIRKYGIKTVADIGTGSGAIGVSVA---KFSDAIVFATDVSSKAVEIARKNAERHGVSDRFFVRKGEFLEPFKEKFASIEXILSNPPYV-KSSAHLPKDVLFEPPEALFGGEDGLDFYREFFGRYD---TSGKIVLXEIGEDQVEELKK-IVSDTV----FLKDSAGKYRFLLLNR 291
>gi|56707339|ref|YP_169235.1| hemK protein [Francisella tularensis subsp. tularensis SCHU S4] >gi|110669809|ref|YP_666366.1| hemK protein [Francisella tularensis subsp. tularensis FSC198] >gi|134301376|ref|YP_001121344.1| HemK family methyltransferase [Francisella tularensis subsp. tularensis WY96-3418] >gi|56603831|emb|CAG44802.1| hemK protein homolog [Francisella tularensis subsp. tularensis SCHU S4] >gi|110320142|emb|CAL08185.1| hemK protein homolog [Francisella tularensis subsp. tularensis FSC 198] >gi|134049153|gb|ABO46224.1| methyltransferase, hemK family [Francisella tularensis subsp. tularensis WY96-3418] >gi|151568261|gb|EDN33915.1| modification methylase [Francisella tularensis subsp. tularensis FSC033] (284 aa)
Score = 196, Expect = 1.6e-13, Identities = 71/221 (32%), Positives = 109/221 (49%)
  Q:    64 KKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKY-ILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKN-QRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPSTK-CEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDR 284
           KKI +++ ++L    P+ YI     F+    ++ K   +PR +TE ++   +   +  D +  ILDL +G+G +A  ++    N    V+ V+  +    V  KN Q N     +FI+S  +       +K D I+ NPPYID  D N+D S K  EP +ALFA  NG       +S+    L  G  I  E GF Q + I     + N T  K +KDL++ DR
  S:    57 KKIDEKILRLLAGE-PLAYILGYKYFWNQKLYVTKDTLIPRADTETVVATVLDDIQNKDAQLKILDLGTGTGAIALALAAELANSQ--VVAVDLYQQSLDVAKKNAQANNITNVKFIQSSWYT--NLDTDKFDIIVSNPPYIDLADTNIDQSVKDYEPARALFAADNGLADIRIIISQAKDFLNLGGFIYIEHGFTQADAITALFSQCNFTDIKIVKDLNNNDR 275
>gi|195955461|ref|ZP_03094154.1| protoporphyrinogen oxidase, putative [Borrelia burgdorferi CA-11.2a] (286 aa)
Score = 196, Expect = 1.7e-13, Identities = 67/220 (30%), Positives = 114/220 (51%)
  Q:    69 QLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLK--TQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPSTKCEPKQALFA-PQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYI 288
           Q++K+  K IP+ YI +   F G+ F + +   +PR +TE +++ A+ Q +    K ILDLC GSG +  +I+Y  + K   VI  + +    ++  KN + LKL+   + I S++ K  +    K D II NPPY++K +  +    K EP +AL    ++G     + L++    L     II E    Q + ++ F IK   +  K + DL+ + R L +
  S:    54 QIDKI-EKGIPIHYILQKKEFMGIEFSLNRHVLIPRFDTECLVEEALIQIQQNGFKKILDLCCGSGCIGLSIAYYIRKK---VILSDISTKALQIVEKNTKKLKLEKFVEIIHSNLLKCIKG---KLDIIITNPPYLNKEELEIKNKIKKEPTKALLGFGKDGLNISRKILNQAKEKLNPNGLIIIESAPWQIKSLKDFAIKKGFSHLKTIYDLEKRARALIL 269
>gi|167942531|ref|ZP_02529605.1| HemK family methylase, putative [Borrelia afzelii ACA-1] (273 aa)
Score = 196, Expect = 1.7e-13, Identities = 75/254 (29%), Positives = 125/254 (49%)
  Q:    35 KELILFNSK--IIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLK--TQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPSTKCEPKQALFA-PQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYI 288
           KELI+ N K  + +   ++FF+   +I+               K  P+ YI K   F G+ F + K   +PR +TE +++ A+ Q +    K ILDLC GSG +  +I+Y  K K   V+  + +    ++  KN + LKL+   + I S++ K  +    + D II NPPY++K +  +    K EP +AL    ++G     + LS+    L     II E    Q + ++ F IK   +  K + DL+ + R L +
  S:    32 KELIIANIKKSLTKKEKNLFFDHIDKIE---------------KGTPIHYILKKKEFMGIEFTLNKHVLIPRFDTECLVEEALIQIQQNGFKKILDLCCGSGCIGISIAYYMKKK---VMLSDISIKALQIVEKNTKKLKLEKFVEIIHSNLLKCIKG---RIDIIITNPPYLNKEELEIKNKIKKEPAKALLGFGKDGLNISRKILSQAKEKLNPNGLIIIESAPWQIKSLKDFAIKKGFSHLKTIYDLEKRARALVL 269
>gi|152990781|ref|YP_001356503.1| protoporphyrinogen oxidase [Nitratiruptor sp. SB155-2] >gi|151422642|dbj|BAF70146.1| protoporphyrinogen oxidase [Nitratiruptor sp. SB155-2] (274 aa)
Score = 196, Expect = 1.7e-13, Identities = 63/212 (29%), Positives = 102/212 (48%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKN---DPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIF--EIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYIKK 290
           P++YI +  SFYG  FFI+ G  +PR ETE ++D     K+L   + + ++  GSGV++  +    K     +   + +        KN +   L  + +++D+        +K D I+ NPPYI K    +PNV    K EP +ALF  + G       L +I  +    +  I   E+GF+QK  I  ++        +F KDL   DR   I++
  S:    65 PIEYIIQRVSFYGEEFFIQNGVLIPRPETEILIDEV--SKELRGDESLAEIGVGSGVISAILKM--KFPSLQITATDISDKAIACARKNFQKFGLDIELVQTDLLD---GVEKKIDVIVSNPPYIAKGFELEPNV---AKYEPHEALFGGREGD----EILKKIIDLFLQSSAKILACEMGFDQKNAIRDYVKSRKDIDVRFFKDLAGLDRGFIIQR 267
>gi|120600165|ref|YP_964739.1| HemK family modification methylase [Shewanella sp. W3-18-1] >gi|124545636|ref|ZP_01704811.1| modification methylase, HemK family [Shewanella putrefaciens 200] >gi|146291907|ref|YP_001182331.1| HemK family modification methylase [Shewanella putrefaciens CN-32] >gi|120560258|gb|ABM26185.1| modification methylase, HemK family [Shewanella sp. W3-18-1] >gi|124510612|gb|EAY54680.1| modification methylase, HemK family [Shewanella putrefaciens 200] >gi|145563597|gb|ABP74532.1| modification methylase, HemK family [Shewanella putrefaciens CN-32] (282 aa)
Score = 196, Expect = 1.8e-13, Identities = 62/231 (26%), Positives = 112/231 (48%)
  Q:    54 EKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKL-KTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDP-STKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDR 284
           EK   ID ++K+  +Q+     K +PV +I     F+ L F +     +PR +TE +++ A+    L     +LDL +G+G +A  ++  +++ +  +  V+K      + + N+ NLKL + + ++SD F   +S     D I+ NPPYID+ D ++     + EP+ AL A + G+   +         L     I+ E GF Q  ++   LI+        ++D    DR
  S:    49 EKALTID-QWKR-FQQMVLKRQKGVPVAHIVGEREFWSLPFIVNDTTLIPRPDTEILVETALNL-PLSTYAKVLDLGTGTGAIALALASERESWE--ITAVDKVDDAVALAIANRENLKLPQVEILQSDWFSAVKS--RDFDLIVSNPPYIDEADEHLHQGDVRFEPQSALTAAEEGFADLYYIAKTARDYLKPNGYILLEHGFEQAVKLRGKLIELGYENVATVRDFGSNDR 274
>gi|56965631|ref|YP_177365.1| methylase, polypeptide chain release factor [Bacillus clausii KSM-K16] >gi|56911877|dbj|BAD66404.1| methylase [Bacillus clausii KSM-K16] (288 aa)
Score = 196, Expect = 1.9e-13, Identities = 60/222 (27%), Positives = 104/222 (46%)
  Q:    67 LKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFK-IDRSHYEKCDFIICNPPYIDKNDPN--VDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITV-FKFLKDLDDKDRVLYI 288
            KQ   V+   +PVQ++     FYG +F +     +PR ETE ++   + + K    + ILD+ +GSG +A T+    +  D  V   + +     V  +N + L     F K D+   +  + +   D I+ NPPYI   D +       + EP+ ALFA ++G  FY R   E+   +   + +  EIG  Q E ++              + D++ KDR++++
  S:    57 FKQDVAVMVSGVPVQHVLGYEQFYGRTFLVNGDVLIPRPETEELVALVLNKLK-PGPQAILDVGTGSGAIALTLKL--ERPDCHVTATDISEKALDVARENAQRLGADITFAKGDLLAPVAGAVF---DVIVSNPPYIPYRDRDSLAVHVREFEPEMALFAEEDGLMFYRRLAEEVPACIHPRSLVAVEIGAGQGEAVQALFAAAFPFADINIVYDINGKDRIVFV 276
>gi|151571189|gb|EDN36843.1| hypothetical protein FTCG_01058 [Francisella tularensis subsp. novicida GA99-3549] (284 aa)
Score = 196, Expect = 1.9e-13, Identities = 71/234 (30%), Positives = 116/234 (49%)
  Q:    51 IFFEKDTEIDFEYKKILKQLNKVLNKNI---PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKY-ILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKN-QRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPSTK-CEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDR 284
           ++   D ++D   K  LK++++ + + +   P+ YI     F+    ++ K   +PR +TE ++   +   +  D +  ILDL +G+G +A  ++    N    V+ V+  +    V  KN Q N     +FI+S  +       +K D I+ NPPYID  D N+D S K  EP +ALFA  NG       +S+    L  G  I  E GF Q + +     + N T  K +KDL++ DR
  S:    43 LYINSDKQLD---KNTLKKIDEKILRLLAGEPLAYILGYKYFWNQKLYVTKDTLIPRADTETVVATVLDDIQNKDAQLKILDLGTGTGAIALALAAELANSQ--VVAVDLYQQSLDVAKKNAQANNITNVKFIQSSWYT--NLDTDKFDIIVSNPPYIDLADTNIDQSVKDYEPARALFAADNGLADIRIIISQAKDFLNLGGFIYIEHGFTQADAVTALFSQYNFTHIKTVKDLNNNDR 275
>gi|146328946|ref|YP_001209003.1| HemK family modification methylase [Dichelobacter nodosus VCS1703A] >gi|146232416|gb|ABQ13394.1| modification methylase, HemK family [Dichelobacter nodosus VCS1703A] (276 aa)
Score = 196, Expect = 1.9e-13, Identities = 57/198 (28%), Positives = 98/198 (49%)
  Q:    67 LKQLNKVLNKNI---PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKL-KTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKF 264
           + QLN +L +     P  YI  +  FY L   +     +PR ETE ++D A+ +    D   ++DL +GSG +A  I+   +     V+ V+K+    +V  +N R+L+L    F+ SD          + D I+ NPPYID +D ++  +   EP+ AL +P++GY      ++     L     ++ E G  Q +++  F
  S:    51 IAQLNALLLRRARGEPFAYILGNQPFYHLDLKVSPAVLIPRPETEQLVDAALAKIPPQDCYRVIDLGTGSGAIALAIA--AERPHCRVLAVDKSWDALRVAQENARHLQLANVHFVLSDWLTAIAD--ARADMIVSNPPYIDAHDEHL-AALAYEPQMALVSPEHGYADLLHLIAHAGRCLRPNGWLLLEHGNQQAQKLRAF 247
>gi|111115019|ref|YP_709637.1| HemK family methylase [Borrelia afzelii PKo] >gi|110890293|gb|ABH01461.1| HemK family methylase, putative [Borrelia afzelii PKo] (273 aa)
Score = 196, Expect = 2.0e-13, Identities = 75/254 (29%), Positives = 125/254 (49%)
  Q:    35 KELILFNSK--IIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLK--TQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPSTKCEPKQALFA-PQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYI 288
           KELI+ N K  + +   ++FF+   +I+               K  P+ YI K   F G+ F + K   +PR +TE +++ A+ Q +    K ILDLC GSG +  +I+Y  K K   V+  + +    ++  KN + LKL+   + I S++ K  +    + D II NPPY++K +  +    K EP +AL    ++G     + LS+    L     II E    Q + ++ F IK   +  K + DL+ + R L +
  S:    32 KELIIANIKKSLTKKEKNLFFDHIYKIE---------------KGTPIHYILKKKEFMGIEFTLNKHVLIPRFDTECLVEEALIQIQQNGFKKILDLCCGSGCIGISIAYYMKKK---VMLSDISIKALQIVEKNTKKLKLEKFVEIIHSNLLKCIKG---RIDIIITNPPYLNKEELEIKNKIKKEPAKALLGFGKDGLNISRKILSQAKEKLNPNGLIIIESAPWQIKSLKDFAIKKGFSHLKTIYDLEKRARALVL 269
>gi|58337081|ref|YP_193666.1| protoporphyrinogen oxidase [Lactobacillus acidophilus NCFM] >gi|58254398|gb|AAV42635.1| protoporphyrinogen oxidase [Lactobacillus acidophilus NCFM] (280 aa)
Score = 196, Expect = 2.0e-13, Identities = 68/221 (30%), Positives = 117/221 (52%)
  Q:    67 LKQLNK---VLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKN-----KDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPN-VDPST-KCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVF--KFLKDLDDKDRVLY 287
           +KQ NK    L K +  QYI     F G    +++G  +PR ETE ++ WA++  K  D   +LDL +GSG +  T++ +K+      KD  +   +      ++  +N  N  L     K+++         K D II NPPYI   + N +D +  + EP++ALF  ++G  FY RF  ++   L +  E   E GF++++++ + L    +  F  +F KD+  K R+++
  S:    52 IKQANKDIKKLAKGVSPQYILGYAWFLGYKIMVQRGVLIPRFETEELVTWALESLKNGDT--VLDLGTGSGCI--TVALLKEAEKKGIKDISMYASDVTDNALRISEENFLNYNLDVTTRKANVL----IGLGKFDLIISNPPYIKTGEKNEMDKNVLQNEPEEALFGGKDGLDFYRRFAKQVRAHLNSHGEFFLEFGFSEEDQLRE-LFAEELPDFDIEFRKDMAGKPRMVH 275
>gi|145637545|ref|ZP_01793202.1| HemK [Haemophilus influenzae PittHH] >gi|145269231|gb|EDK09177.1| HemK [Haemophilus influenzae PittHH] (292 aa)
Score = 195, Expect = 2.3e-13, Identities = 74/263 (28%), Positives = 131/263 (49%)
  Q:    23 NPLDDSQIKWILKELILFNSKIIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNI---PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVK--QKKLIDKK---YILDLCSGSG----VLANTISYI--KKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDP-STKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           NP ++S+I      L+L      ++ + I    DTEID   +K+  +L  +L++ +   P+ YI     F+ L   + K   +PR +TE +++ A++   +KL +     +ILDL +G+G     LA+ ++ I  K++    +IGV+       +   N    +L  QF++S  F    +   K D I+ NPPYID  D ++       EP  AL A   GY      +      L +   ++ E G+ Q E++    ++N   + + + D  D +RV
  S:    18 NPTENSKID----VLVLLQHVTGKSRTQILAFDDTEID---EKVRLKLTALLDRRLKGEPIAYILGEKEFWSLPLNVSKSTLIPRPDTESLVEKALQIALEKLEENPPHFHILDLGTGTGAIALALASELAPICQKRHIPLEIIGVDLMPDVVALAQSNAERNQLNVQFLQSSWFD---NITGKFDLIVSNPPYIDAQDEHLHQGDVSFEPLSALVANDAGYADLRHIIELASSYLNSNGVLLLEHGWQQGEKVRSIFLENYWEMVETVCDYGDNERV 285
>gi|163788596|ref|ZP_02183041.1| putative protoporphyrinogen oxidase [Flavobacteriales bacterium ALC-1] >gi|159875833|gb|EDP69892.1| putative protoporphyrinogen oxidase [Flavobacteriales bacterium ALC-1] (492 aa)
Score = 195, Expect = 2.5e-13, Identities = 73/217 (33%), Positives = 110/217 (50%)
  Q:    74 LNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVK---QKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHY--------EK---CDFIICNPPYI---DKND--PNVDPSTKCEPKQALFAP-QNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYIKK 290
           LN+  P+QYI     FYGL F + +   +PR ETE ++D  +K   ++    +  ILD+ +GSG +A  IS  K    A V  ++ +    K+  +N     +   FI++DI KI    +        +K    D I+ NPPY+   +K +  PNV  +   EP  ALF    N   FY    +     L    E+ FEI      E +  L+  N    + LKDL+  DR+L  +K
  S:    65 LNQQKPIQYILGETEFYGLPFKVNENVLIPRPETEELVDLIIKYHSEQSEESQLRILDIGTGSGCIA--ISLAKNLPSAEVYALDVSEDALKIAKQNADLNNVSINFIETDILKISNDSFFWKDITLQQKRLVFDIIVSNPPYVRNLEKQEIKPNVLDN---EPHLALFVEDDNPLLFYKEITNFAIDNLKPKGELYFEINQYLGHETKALLVNANFENMELLKDLNGNDRMLKGRK 296
>gi|195958883|ref|ZP_03095092.1| protoporphyrinogen oxidase, putative [Borrelia sp. SV1] (286 aa)
Score = 195, Expect = 2.5e-13, Identities = 68/220 (30%), Positives = 112/220 (50%)
  Q:    69 QLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLK--TQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPSTKCEPKQALFA-PQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYI 288
           Q++K+  K  P+ YI +   F G+ F + K   +PR +TE + + A+ Q +    K ILDLC GSG +  +I+Y  + K   VI  + +    ++  KN + LKL+   + I S++ K  +    K D II NPPY++K +  +    K EP +AL    ++G     + LS+    L     II E    Q + ++ F IK   +  K + DL+ + R L +
  S:    54 QIDKI-EKGTPIHYILQKKEFMGIEFSLNKHVLIPRFDTECLAEEALIQIQQNGFKKILDLCCGSGCIGLSIAYYIRKK---VILSDISTKALQIVEKNTKKLKLEKFVEIIHSNLLKCIKG---KLDIIITNPPYLNKEELEIKNKIKKEPTKALLGFGKDGLNISRKILSQAKEKLNPNGLIIIESAPWQIKSLKDFAIKKGFSHLKTIYDLEKRARALIL 269
>gi|123442666|ref|YP_001006643.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Yersinia enterocolitica subsp. enterocolitica 8081] >gi|122089627|emb|CAL12477.1| putative protoporphyrinogen oxidase [Yersinia enterocolitica subsp. enterocolitica 8081] (284 aa)
Score = 194, Expect = 2.8e-13, Identities = 58/230 (25%), Positives = 105/230 (45%)
  Q:    56 DTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKL-KTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDP-STKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           +T++  E   +L+ L     +  P+ Y+     F+ L   +     +PR +TE +++ A+    +   + ILDL +G+G +A  ++   +  D  V+GV+       +   N + L +    F++S  F    S   +   I+ NPPYID NDP+++    + EP  AL A   G       + +    L  G  ++ E G+ Q   ++K L  +  +     KD  + DRV
  S:    44 ETQLTAEQLAVLEPLAARREQGEPIAYLVGEREFWSLPLSVSSATLIPRPDTECLVEQALAHLPVTPCR-ILDLGTGTGAIA--LALASERPDCAVMGVDIKADAVALARHNAKKLAINNVDFLQSSWFD---SVSGRFTLIVSNPPYIDANDPHLNEGDVRYEPHSALVAEAEGIADLAEIIRQSPAYLEVGGWLMLEHGWQQATAVQKLLNNSGFSAVMTYKDYGNNDRV 269
>gi|194682446|emb|CAR42348.1| protein methyltransferase (protein-glutamine N-methyltransferase) [Proteus mirabilis HI4320] (282 aa)
Score = 194, Expect = 2.8e-13, Identities = 61/217 (28%), Positives = 105/217 (48%)
  Q:    69 QLNKVLNKNI---PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKL-KTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNV-DPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           QL+ +L + I   P+ Y+     F+ L   +     +PR +TE +++ A+ +K       ILDL +G+G +A  I+   +  D  V+GV+       + ++N ++L L   +F +S  F    S Y+  D II NPPYID+ D ++     + EP  AL A  +G+      ++     LAN   ++ E G+ Q E +    I       +  +D    +RV
  S:    54 QLSSLLARRIKGEPIAYLVGEREFWSLPLKVSPATLIPRPDTECLVEKAL-EKLSAQASRILDLGTGTGAIALAIA--SERSDCRVLGVDFQPEAVALAIENAQHLALSNVEFTESCWFS-SLSGYQ-FDMIISNPPYIDEEDEHLYQGDVRFEPLTALVAADHGFADIELIITNARQFLANNGWVLIEHGWQQGERVRNIFIDKGYCCVETFRDYGGNERV 270
>gi|28378949|ref|NP_785841.1| protoporphyrinogen oxidase (putative) [Lactobacillus plantarum WCFS1] >gi|28271786|emb|CAD64692.1| protoporphyrinogen oxidase (putative) [Lactobacillus plantarum WCFS1] (288 aa)
Score = 194, Expect = 2.8e-13, Identities = 55/210 (26%), Positives = 101/210 (48%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNV-DPSTKC-EPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKN--NITVFKFLKDLDDKDRVLYI 288
           PVQY+     FYGL+  +     +PR ETE ++DW +          +LD+ +GSG +A  I + +   +  +   + +    +V   N   L L  + + SD+  +     +  D I+ NPPYI  ++ +V D S    EP+ ALFA  +G   Y +  + +   L +   +  E G++Q   ++    ++  + TV    +D+   +R+L +
  S:    73 PVQYVLGDAPFYGLTLQVDPAVLIPRVETEELVDWILTDVPATAPVRLLDVGTGSGAIALAIKHERPAWE--ITASDISTAALQVAKANADRLHLDVKLVHSDL--LTSVSAQPFDIIVSNPPYIAASEKDVMDASVLAHEPQTALFADHDGLALYEQLATTVADHLTSTGRLYLEFGYHQGPALQTLFAQSMPDATV-TLRQDMAGHNRMLRV 281
>gi|68249926|ref|YP_249038.1| hypothetical protein NTHI1574 [Haemophilus influenzae 86-028NP] >gi|145631801|ref|ZP_01787561.1| HemK [Haemophilus influenzae 22.4-21] >gi|68058125|gb|AAX88378.1| HemK [Haemophilus influenzae 86-028NP] >gi|144982591|gb|EDJ90141.1| HemK [Haemophilus influenzae R3021] (292 aa)
Score = 194, Expect = 2.8e-13, Identities = 71/263 (26%), Positives = 130/263 (49%)
  Q:    23 NPLDDSQIKWILKELILFNSKIIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNI---PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVK--QKKLIDKK---YILDLCSGSGVLANTISY------IKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDP-STKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           NP ++S+I      L+L      ++ + I    DTEID   +K+  +L  +L++ +   P+ YI     F+ L   + K   +PR +TE +++ A++   +KL +      ILDL +G+G +A  ++        K++    +IGV+       +   N    +L  +F++S  F    +   K D I+ NPPYID  D ++     + EP  AL A   GY      +      L +   ++ E G+ Q E++     +N+  + + ++D  D +RV
  S:    18 NPTENSKID----ALVLLQHATGKSRTQILAFDDTEID---EKVRLKLTALLDRRLKGEPIAYILGEKEFWSLPLNVSKSTLIPRPDTESLVEKALQIALEKLEENPPHFRILDLGTGTGAIALALASELEPICQKRHIPLEIIGVDLMPDVVALAQSNAERNQLNVEFLQSRWFD---NITGKFDLIVSNPPYIDAQDEHLHQGDVRFEPLSALVANDAGYADLRHIIELASSYLNSNGVLLLEHGWQQGEKVRSIFQENHWEMVETVRDYSDNERV 285
>gi|145629733|ref|ZP_01785529.1| HemK [Haemophilus influenzae 22.1-21] >gi|144978070|gb|EDJ87849.1| HemK [Haemophilus influenzae 22.1-21] (264 aa)
Score = 194, Expect = 3.0e-13, Identities = 72/230 (31%), Positives = 122/230 (53%)
  Q:    56 DTEIDFEYKKILKQLNKVLNKNI---PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWA--VKQKKLIDKK---YILDLCSGSGVLA-----NTISYIKKNKDAI-VIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDP-STKCEPKQALFAPQNGYYFYFRFLSEIYP--ILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           DTEID   +K+  +L  +L++ +   P+ YI     F+ L   + KG  +PR +TE +++ A  +  +KL        ILDL +G+G +A        S  +K + ++ +IGV+       +   N    +L  QF++S  F    +   K D I+ NPPYID  D ++     + EP  AL A   GY    R++ E  P  +  NGT ++ E G+ Q E++     +N+  + + ++D  D +RV
  S:    19 DTEID---EKVRLKLTALLDRRLKGEPIAYILGEKEFWSLPLNVSKGTLIPRPDTEVLVEKALQISLEKLEQNPPHFRILDLGTGTGAIALALASELFSICQKRQISLEIIGVDLMPDVVALAQSNAERNQLNVQFLQSRWFD---NITGKFDLIVSNPPYIDVQDEHLHQGDVRFEPLSALVANDAGYA-DLRYIIESAPNYLNFNGT-LLLEHGWQQGEKVRSIFQENHWEMVETVRDYGDNERV 257
>gi|24375322|ref|NP_719365.1| hemK family protein [Shewanella oneidensis MR-1] >gi|24350135|gb|AAN56809.1|AE015816_6 hemK family protein [Shewanella oneidensis MR-1] (286 aa)
Score = 194, Expect = 3.1e-13, Identities = 60/239 (25%), Positives = 109/239 (45%)
  Q:    46 ENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKL-KTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDP-STKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDR 284
           +N + ++   +  +  E  K  +Q+ +   + +PV +I     F+ L F +     +PR +TE +++ A+    L     +LDL +G+G +A  ++   +     +  V+K      +   N+ NLKL + + ++SD F    SH    D I+ NPPYID+ D ++     + EP+ AL A   G+   +         L     I+ E GF Q  ++   LI+        ++D    DR
  S:    39 KNRAYLYTWPEKALSVEQWKRFQQMVQRRQQGVPVAHIVGEREFWSLPFIVNDTTLIPRPDTEILVESALNL-PLESNAKVLDLGTGTGAIA--LALASERAAWQITAVDKVEDAVALAKANRTNLKLEQVEILQSDWFSAVTSH--DFDLIVSNPPYIDEADEHLHQGDVRFEPQSALTAADEGFADLYYIAKTARDYLKPNGYILLEHGFEQAVKLRAKLIELGYQNVATVRDFGSNDR 274
>gi|168224602|ref|ZP_02649833.1| hypothetical protein Sententeric_02400 [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433] (277 aa)
Score = 194, Expect = 3.2e-13, Identities = 52/207 (25%), Positives = 102/207 (49%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKT-QFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNV-DPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           P+ Y+T    F+ L  F+     +PR +TE +++ A+ +   +    ILDL +G+G +A  ++   +  D  V  V++      + ++N  +L ++  + ++S  F       ++ D I+ NPPYID  DP++ +   + EP+ AL A +NG       +     +L  G  ++ E G+ Q E +  F  ++  +  +  +D    +RV
  S:    67 PIAYLTGLREFWSLPLFVSPATLIPRPDTECLVEQALARLP-VKTCRILDLGTGTGAIA--LALACERPDCEVTAVDRMPDAVALAIRNAEHLAIRNVRILQSCWFSALSG--QQFDMIVSNPPYIDAQDPHLSEGDVRFEPRSALVADENGMADLTHIIDNARQMLTPGGFLLLEHGWQQGEAVRAFFRRSGYSDVETCRDYGGNERV 270
>gi|167627297|ref|YP_001677797.1| HemK family modification methylase [Francisella philomiragia subsp. philomiragia ATCC 25017] >gi|167597298|gb|ABZ87296.1| modification methylase, HemK family [Francisella philomiragia subsp. philomiragia ATCC 25017] (285 aa)
Score = 194, Expect = 3.4e-13, Identities = 77/261 (29%), Positives = 128/261 (49%)
  Q:    24 PLDDSQIKWILKELILFNSKIIENSSDIFFEKDTEIDFEYKKILKQLN-KVLN--KNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKY---ILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQ-RNLKLKTQFIKSDIFK-IDRSHYEKCDFIICNPPYIDKNDPNVDPSTK-CEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDR 284
           P  DS IK  L+ +I     +  + + ++   D  +D     IL ++N K+L      P+ YI     F+    ++ K   +PR +TE ++  A     + DK     ILDL +GSG +A  ++  ++   + V+ V+       V  KN   N  +  +F++S  ++ +D + +   D I+ NPPYID +D N+D S +  EP +ALFA  NG       +S+    L  G  +  E GF Q  +I       +    + +KDL+ KDR
  S:    18 PQSDSSIKHDLQMIIC--DVLGVDKTYLYLNSDKHLD---NAILTKINGKILRLLAGEPLAYILGYKYFWNQKLYVTKDTLIPRADTEAVV--AAVLDDIQDKNAQLKILDLGTGSGAIA--LALAEELPKSQVVAVDLYSKTLDVAKKNALANKIVNVEFMQSSWYENLDATKF---DIIVSNPPYIDVDDANIDDSVREHEPSKALFAADNGLADIRIIISQASGFLKQGGYLYIEHGFTQANDIANIFSHYSFGDIQTIKDLNHKDR 275
>gi|25027861|ref|NP_737915.1| putative protoporphyrinogen oxidase HemK [Corynebacterium efficiens YS-314] >gi|23493144|dbj|BAC18115.1| putative protoporphyrinogen oxidase HemK [Corynebacterium efficiens YS-314] (280 aa)
Score = 193, Expect = 3.7e-13, Identities = 58/212 (27%), Positives = 97/212 (45%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIF--KIDRSHYEKCDFIICNPPYIDKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITV-FKFLKDLDDKDRVLYIKK 290
           P+Q+I        L   +  G FVPR ETE + DWAV++ + +DK  ++DLC+GSG LA  I++  +  DA V  VE +        +N          +  D+    +    + + D ++ NPPY+ +   ++DP    +P  A+F+   G       +  I+ +LA G  +  E        +   +  +   V    LKDL  +DR +   K
  S:    66 PLQHILGRAPMGPLDLHVGPGVFVPRPETEVLADWAVRRGRGVDKPVVVDLCTGSGALAAYIAH--ELVDASVTAVELDPGAATWAQRNFDEFTPGVDLVIGDVTDPTLLPDLHGRVDIVVSNPPYVPETG-DLDPEVYRDPHMAVFSGPTGMDVITEMIHLIHALLAPGGVVGIEHDDTTSAAVRDVVTGHGGFVDVAVLKDLTGRDRFITASK 277
>gi|15902969|ref|NP_358519.1| HemK protein [Streptococcus pneumoniae R6] >gi|116517180|ref|YP_816385.1| HemK protein [Streptococcus pneumoniae D39] >gi|15458533|gb|AAK99729.1| HemK protein homolog; possible protoporphyrinogen oxidase [Streptococcus pneumoniae R6] >gi|116077756|gb|ABJ55476.1| HemK protein [Streptococcus pneumoniae D39] (279 aa)
Score = 193, Expect = 3.7e-13, Identities = 64/220 (29%), Positives = 106/220 (48%)
  Q:    49 SDIFFEKDTEIDFEY-KKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDP-----NVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKN 268
           +D  F    E+  E  K+ ++ + + L  + P QYI     FYG+   + +   +PR ETE +++  + +  L     +LD+ +GSG +A  ++  K   D  V   + ++    +  +N +N  L+    KSD F       EK D I+ NPPYI + D      NV  S   EP  ALFA ++G   Y R   +    L +  +I  EIG+ Q + + +   K+
  S:    37 TDFIFALQQEVTTEEEKQFVEDIYQQLAAHKPAQYIIGQADFYGMHLKVDERVLIPRPETEELVELILTE-NLETNLSVLDIGTGSGAIA--LALAKNRPDWSVTAADISQEALDLARENAKNQNLQIFLKKSDCFT---EISEKYDIIVSNPPYISREDESEVGLNVLYS---EPHLALFADEDGLAIYRRIAEDATDYLKDSGKIYLEIGYKQGQCVPELFRKH 253
>gi|89256989|ref|YP_514351.1| modification methylase [Francisella tularensis subsp. holarctica] >gi|156503188|ref|YP_001429254.1| methyltransferase, HemK family protein [Francisella tularensis subsp. holarctica FTNF002-00] >gi|167009370|ref|ZP_02274301.1| modification methylase [Francisella tularensis subsp. holarctica FSC200] >gi|89144820|emb|CAJ80159.1| modification methylase [Francisella tularensis subsp. holarctica LVS] >gi|134254054|gb|EBA53148.1| modification methylase hemK [Francisella tularensis subsp. holarctica 257] >gi|156253791|gb|ABU62297.1| methyltransferase, HemK family protein [Francisella tularensis subsp. holarctica FTNF002-00] (284 aa)
Score = 193, Expect = 3.8e-13, Identities = 71/234 (30%), Positives = 115/234 (49%)
  Q:    51 IFFEKDTEIDFEYKKILKQLNKVLNKNI---PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKY-ILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKN-QRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPSTK-CEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDR 284
           ++   D ++D   K  LK++++ + + +   P+ YI     F+    ++ K   +PR +TE ++   +   +  D +  ILDL +G+G +A  ++    N    V+ V+  +    V  KN Q N     +FI+S  +       +K D I+ NPPYID  D N+D S K  EP +ALFA  NG       +S+    L  G  I  E GF Q + I     + N    K +KDL++ DR
  S:    43 LYINSDKQLD---KNTLKKIDEKILRLLAGEPLAYILGYKYFWNQKLYVTKDTLIPRADTETVVATVLDDIQNKDAQLKILDLGTGTGAIALALAAELANSQ--VVAVDLYQQSLDVAKKNAQANNITNVKFIQSSWYT--NLDTDKFDIIVSNPPYIDLADTNIDQSVKDYEPARALFAADNGLADIRIIISQAKDFLNLGGFIYIEHGFTQADAITALFSQCNFNDIKIVKDLNNNDR 275
>gi|42521716|ref|NP_967096.1| HemK protein [Bdellovibrio bacteriovorus HD100] >gi|39574246|emb|CAE77750.1| HemK protein [Bdellovibrio bacteriovorus HD100] (293 aa)
Score = 193, Expect = 3.8e-13, Identities = 67/236 (28%), Positives = 118/236 (50%)
  Q:    51 IFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLD----WAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKL--KTQFIKSDIFKI--------DRSHYEKCDFIICNPPYIDKNDPNVDPST-KCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQ----KEEIEKFLIKNNITVFKFLKDLDDKDRVL 286
           ++   D  +  E   +L++L +      PV YI     F+   F +     +PR ETE++++    WA  ++  +    ++DL  GSG +   +S +K+  +A +I V+      +V  +N ++L +  + QF+  D   +        D +     D ++ NPPYI  +DP V+ +  K EP  AL+A  +G      +     P L     ++ E+G +Q    K+  E   I N I+V   +KDL   DRV+
  S:    41 LYLRFDQPMKDEELAVLRELVRRRASGEPVAYIMGYRDFFNHRFEVNNQVLIPRPETEHIVEDVLAWASDKEASLG---LIDLGCGSGCIG--LSLLKEYPNAKLIAVDLLPGAIEVAQRNAQSLDVADRVQFLNLDAGNVEAIMSAYKDFTGQSSIDVLVSNPPYIASDDPQVEENVKKFEPNSALYAEDSGLALLKGWSKAFAPYLKTPGLMLMEMGMSQGPAMKQAYESLKIFNEISV---IKDLSGHDRVI 287
>gi|59712413|ref|YP_205189.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Vibrio fischeri ES114] >gi|163728501|ref|ZP_02135984.1| ribosomal protein L3P methyltransferase [Vibrio fischeri MJ11] >gi|59480514|gb|AAW86301.1| N5-glutamine methyltransferase [Vibrio fischeri ES114] >gi|161397980|gb|EDQ22266.1| ribosomal protein L3P methyltransferase [Vibrio fischeri MJ11] (310 aa)
Score = 193, Expect = 4.4e-13, Identities = 55/203 (27%), Positives = 103/203 (50%)
  Q:    62 EYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQF--IKSDIFK-IDRSHYEKCDFIICNPPYIDKNDPNVDPST-KCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKF 264
           E  +I++++ + +N+ IP  Y+T    F GL FF+ +   VPR     +++   +     +   I+DLC+GSG +A   ++   N +   I +  +     V  +N ++  ++ Q   I+SD+ + I +  Y   +FI+ NPPY+D+ D N  P   + EP+  L A  +G     R L+     L +   +I E+G +    +E++
  S:    72 ERLRIVERVVRRINERIPTAYLTNKAWFCGLEFFVDERVLVPRSPIAELIETQFEPWLTEEPTRIMDLCTGSGCIAIACAHAFPNAEVDAIDISTD--ALMVAEQNVQDHGMEQQVFPIRSDLLRDIPKDQY---NFIVSNPPYVDEEDMNSLPEEFEHEPELGLAAGTDGLKLVRRILANAPDYLMDNGFLICEVGNSMVHMMEQY 273
>gi|194535598|ref|YP_002070770.1| putative adenine-specific methylase [Vibrio cholerae RC385] >gi|150420392|gb|EDN12688.1| putative adenine-specific methylase [Vibrio cholerae RC385] (314 aa)
Score = 192, Expect = 4.7e-13, Identities = 59/203 (29%), Positives = 105/203 (51%)
  Q:    62 EYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTI--SYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQF--IKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPST-KCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKF 264
           E  ++++++ K +N   PV Y+T    F GL FF+ +   VPR     ++    +   + +   I+DLC+GSG +A     ++ +   DAI I V+      +V  +N ++  L+ Q   I+SD+F+ D    E+ D I+ NPPY+D+ D +  PS  + EP+  L A  +G     R L+     L     ++ E+G +    +E++
  S:    76 ERLRVVERVIKRINDRTPVAYLTNKAWFCGLEFFVDQRVLVPRSPIGELIQNRFEPWLIEEPTRIMDLCTGSGCIAIACANAFPEAEVDAIDISVDA----LQVAEQNIQDHGLEQQVFPIRSDLFR-DLPQ-EQYDLIVTNPPYVDQEDMDSLPSEFRHEPELGLAAGSDGLKLARRILANASLYLKENGVLVCEVGNSMVHMMEQY 277
>gi|19552425|ref|NP_600427.1| rRNA or tRNA methylase [Corynebacterium glutamicum ATCC 13032] >gi|62390089|ref|YP_225491.1| rRNA or tRNA methylase [Corynebacterium glutamicum ATCC 13032] >gi|145295340|ref|YP_001138161.1| hypothetical protein cgR_1280 [Corynebacterium glutamicum R] >gi|21323968|dbj|BAB98594.1| Predicted rRNA or tRNA methylase [Corynebacterium glutamicum ATCC 13032] >gi|25246523|gb|AAN72320.1| protoporphyrinogen oxidase [Corynebacterium glutamicum] >gi|41325425|emb|CAF19905.1| Predicted rRNA or tRNA methylase [Corynebacterium glutamicum ATCC 13032] >gi|140845260|dbj|BAF54259.1| hypothetical protein [Corynebacterium glutamicum R] (279 aa)
Score = 192, Expect = 4.9e-13, Identities = 56/212 (26%), Positives = 101/212 (47%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQ-KKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIF--KIDRSHYEKCDFIICNPPYIDKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEK-FLIKNNITVFKFLKDLDDKDRVLYIKK 290
           P+Q+I  +     L   +  G F+PR ETE + DWAV+Q    ++K+ I+DLC+GSG LA  I +     DA +  VE +        +N      + + I  D+    +    +   D ++ NPPY+ ++D ++DP    +P  A+F+  +G     + +  I+ +L +G  +  E      + + + F         + L DL  + R +  +K
  S:    66 PLQHILGTAPMGPLDLHVGPGVFIPRPETEVLADWAVRQVAGDVEKRKIVDLCTGSGALAAYIGHAL--IDATLYAVELDPGAATWAQRNFDEFAPQVKLIHGDVTDPTLLAEVHGTIDLVVSNPPYVPESD-DLDPEVYQDPHMAVFSGADGMDVINKMVHLIFNLLKSGGAVGIEHDDTTSDAVRQVFSQHGGFGTIEVLHDLTGRARFVTARK 278
>gi|168203425|gb|ACA21560.1| HemK [Candidatus Pelagibacter ubique] (280 aa)
Score = 192, Expect = 4.9e-13, Identities = 71/257 (27%), Positives = 113/257 (43%)
  Q:    34 LKELILFNSKIIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNV--DPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYIKK 290
           L   IL    I +N   I   ++  ++ E     K L +  +K  PV Y+     F+   F I +   +PR +TE +++  +K  K      ILD+  GSG +  ++   KKN   I I + K              L  + +  K+D   +D  ++ K D II NPPYI+K D           EP  AL     G     + +++   ++    ++I EI FNQ+E+++K LI     + K LKD    DR +   K
  S:    24 LDSEILLAEVINKNREYIILNQNHTVNKESYYQFKTLVEQRSKGKPVAYLVGKKDFWNYQFQINEHVLIPRPDTEIIVEQVLKITKFKSNLMILDIGVGSGCILLSVLKEKKNSRGIGIDLSKKSVEISKLNALNLGLLNRLKIFKTD---VDNFNFGKYDLIISNPPYINKLDLKYLDKDVINFEPNIALDGGLEGISVISKVINKSSELIKKKGKLILEISFNQREKVKKLLINKGFYINKILKDYAKNDRCIISTK 279
>gi|32033820|ref|ZP_00134105.1| COG2890: Methylase of polypeptide chain release factors [Actinobacillus pleuropneumoniae serovar 1 str. 4074] >gi|126209496|ref|YP_001054721.1| HemK-like protein [Actinobacillus pleuropneumoniae L20] >gi|126098288|gb|ABN75116.1| HemK-like protein [Actinobacillus pleuropneumoniae L20] (290 aa)
Score = 192, Expect = 5.0e-13, Identities = 70/264 (26%), Positives = 124/264 (46%)
  Q:    22 LNPLDDSQIKWILKELILFNSKIIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNI---PVQYITKSFSFYGLSFFIKKGCFVPRQETEYM----LDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKT-QFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVD-PSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           LNP  D+ +        L  +      S IF   +T +   ++  L +L ++L + +   P+ YI     F+ L   +     +PR +TE +    LDW  K+ +      ILDL +G+G +A  ++    +K A +IGV+       +   N++NL  +  +F++SD F    +   + D I+ NPPYIDK D N+     + EP  AL A QNG     + +      L +   ++ E G+ Q + +++   +      +  +D    DR+
  S:    24 LNPKTDANL--------LLQAVTKRTKSAIFAFGETAL---HQTELAELAQLLARRLQGEPMAYILGEKEFWSLPLKVSPHTLIPRPDTERLVEVALDWVYKRLESQQTLQILDLGTGTGAIALALASELGDK-AQIIGVDFKPEAVTLAETNRQNLGFENVRFLQSDWFSALEN--RQFDLIVSNPPYIDKQDKNLQYGDVRFEPLSALVAEQNGLSDLQKIIENAPLYLLDNGALMLEHGWQQAQAVQQIFKQYQWDEIESFQDYGGNDRL 282
>gi|148244860|ref|YP_001219554.1| protein methyltransferase HemK [Candidatus Vesicomyosocius okutanii HA] >gi|146326687|dbj|BAF61830.1| protein methyltransferase HemK [Candidatus Vesicomyosocius okutanii HA] (270 aa)
Score = 192, Expect = 5.1e-13, Identities = 68/254 (26%), Positives = 120/254 (47%)
  Q:    33 ILKELILFNSKIIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPY-KVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVL 286
           I+  ++L +  + ++ + +    + ++    K  L Q  K     +P  Y++ +  FY L F +     +PR ETE ++D A+          +LDL +GSGV+A TIS    N +        N     K   K   N +L + F        + +  +  D II NPPYI +ND +++   + EP+ AL + ++G       ++ I   L     ++ E GFNQ+++I + L+K+N    K  KD + K+R +
  S:    20 IIDIVLLLSLTLDKSHAQLISHNNYQLSSNEKNQLNQFIKHRQSGVPFAYLSGTKGFYHLDFKVTPDTLIPRPETELLIDIALGLFNQNQTYEVLDLGTGSGVIAITISDKNPNWNLTATDFSINALAVAKQNTKTNINFQLGSWF--------EATPNQTFDLIISNPPYIKQNDIHLN-ELRFEPQSALISGKDGLDDIQIIINNIPKFLNEKGYLLLEHGFNQQQKIIQ-LLKDNFFNIKKFKDYNQKNRAI 264
>gi|83857004|ref|ZP_00950532.1| putative protoporphyrinogen oxidase [Croceibacter atlanticus HTCC2559] >gi|83848371|gb|EAP86240.1| putative protoporphyrinogen oxidase [Croceibacter atlanticus HTCC2559] (282 aa)
Score = 192, Expect = 5.4e-13, Identities = 70/237 (29%), Positives = 107/237 (45%)
  Q:    50 DIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDR--SHYEKCDFIICNPPYID--KNDPNVDPSTKCEPKQALFAP-QNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVL 286
           DI    DT +         +  K L    P+QYI     F+ L+F +     +PR ETE ++ W ++ +   +   +LDLC+GSG +A  IS  K  KDA V  ++ + +   +  +N  N      F+  DI   D    HY   D I+ NPPY+   + D   +   + EP  ALF    N   FY + +S     L     +  EI     E  +  L  ++ T  +  KD+  KDR+L
  S:    41 DIVMNPDTVVSAAILANFTEAFKRLKVFEPIQYIIGETEFFDLNFKVTPDVLIPRPETEDLVRWIIQDQHKTNLD-VLDLCTGSGCIA--ISLSKYLKDATVSALDISTSALAIAKENAENNNTNIHFLLKDILASDSLPQHY---DVIVSNPPYVRNLEKDLMSNNVLEHEPHLALFVEDDNPLIFYNKIISLSKTHLKPNGTLYLEINEFLGEATQALLDSDSFTNIELKKDIFGKDRML 276
>gi|56460001|ref|YP_155282.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Idiomarina loihiensis L2TR] >gi|56179011|gb|AAV81733.1| Modification methylase, HemK family [Idiomarina loihiensis L2TR] (309 aa)
Score = 192, Expect = 5.8e-13, Identities = 57/206 (27%), Positives = 101/206 (49%)
  Q:    59 IDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYI--KKNKDAIVIGVEKNRTPYKVGVKN--QRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKND-PNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKF 264
           ++ E ++ ++ L + + ++IP  Y+T    F GL F++ +   VPR     +++   +   +     +LDLC+G G +A   +Y   +   DA+ I  E      +V   N  Q  L  +   I+SD+F  D    EK D I+ NPPY+D  D  ++ P    EP+  L A ++G     + L +   +L +G   + E+G +     EK+
  S:    69 LNSEKQEFVELLKQRVEQHIPAAYLTHQAWFAGLPFYVDERVLVPRSPIAELIENGFQTWLVEAPHRVLDLCTGGGCIAIACAYAFPEAEVDALDISTEA----LEVAEFNIEQHGLTHRVTPIQSDLF--DAVKAEKYDLIVTNPPYVDAEDMTDLPPEYHHEPELGLAAGEDGLILVDKMLMQASDLLNDGGLFVCEVGNSMPALAEKY 273
>gi|88803654|ref|ZP_01119178.1| putative protoporphyrinogen oxidase [Polaribacter irgensii 23-P] >gi|88780387|gb|EAR11568.1| putative protoporphyrinogen oxidase [Polaribacter irgensii 23-P] (301 aa)
Score = 192, Expect = 5.9e-13, Identities = 69/220 (31%), Positives = 108/220 (49%)
  Q:    67 LKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKY-------------ILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYI---DKNDPNVDPSTKCEPKQALF-APQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVL 286
           LK++   L K  P+QYI  +  FYGL F + K   +PR ETE ++ W + + K I  ++             ILD+ +G+G +  ++S  K +  + +  ++ + T   +  KN     +   FI+ DI K      +K D II NPPY+   +K + N +     EP  ALF + +N   FY +        L     + FEI     +E  K L K      +  KDL   DR+L
  S:    64 LKKIIDRLQKEEPIQYILGNTEFYGLPFLVNKNTLIPRPETEELVSWVLHEIKEIHGEHKNKATNAIETPLTILDIGTGTGCI--SVSLAKNSPQSEITAIDNSATALHIAKKNALLNNVAVNFIQLDILKTTELP-QKFDIIISNPPYVRELEKVEINKNVLAN-EPHLALFVSDENPLLFYDKIADLAIQGLTKNGLLFFEINQYLAKETIKMLTKKGFHSIQLKKDLFGNDRML 296
>gi|126736398|ref|ZP_01752140.1| modification methylase, HemK family protein [Roseobacter sp. CCS2] >gi|126714219|gb|EBA11088.1| modification methylase, HemK family protein [Roseobacter sp. CCS2] (288 aa)
Score = 191, Expect = 5.9e-13, Identities = 58/208 (27%), Positives = 104/208 (50%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKN-QRN-LKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYI--DKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVL 286
           PV ++T + +FYG  F + K    PR ETE +++ A++         +LDL +GSG +  T+  + +N  A+ +G + +     V ++N QR+ +  +  F++SD     +  +   D I+ NPPYI  D+         + EP+ AL    +G   Y   + +    L  G  ++ EIG  Q   + + +I+  +     + DLD +DRV+
  S:    73 PVSHLTGTRAFYGRDFEVTKDVLDPRPETETLIEAALRDPF----ARVLDLGTGSGCILVTL--LAENPKAVGVGGDASAVALTVALRNAQRHGVDDRATFVQSDWMAAIKRRF---DLIVANPPYIAADEMAGLSRDVREWEPRMALTDEADGLSAYRTIIKQAGDALIPGGRLMCEIGSTQGHAVAELMIRAGLRHVGVIPDLDGRDRVV 275
>gi|124515208|gb|EAY56719.1| Methylase of polypeptide chain release factors [Leptospirillum sp. Group II UBA] (293 aa)
Score = 191, Expect = 6.3e-13, Identities = 58/179 (32%), Positives = 91/179 (50%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKL--KTQFIKSD---IFKIDRSHYEKCDFIICNPPYIDKND-PNVDPSTKC-EPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQ 257
           P   IT S  F    F +  G  +PR ETE +++  ++       + ILDL  GSG+L   IS +KK   A  + V+++  P +V  KN   L +  +  F++ D   + ++D+      D I+ NPPYI   D   +DP     EP++AL    +G  FY R ++ +  +L+ G     EIG  Q
  S:    79 PFHLITGSVPFLEERFAVAPGTLIPRPETESLVENVLRILDSRSPERILDLGCGSGILG--ISLLKKFPKAHCLAVDRSVVPLEVSRKNALALGVLSRIHFVQGDWTEMLRLDQGF----DLIVSNPPYIASGDLSGLDPEILFYEPREALDGGPDGLVFYRRLMAVLPGLLSTGGVAAVEIGSCQ 258
>gi|190151398|ref|YP_001969923.1| HemK-like protein [Actinobacillus pleuropneumoniae serovar 7 str. AP76] >gi|189916529|gb|ACE62781.1| HemK-like protein [Actinobacillus pleuropneumoniae serovar 7 str. AP76] (314 aa)
Score = 191, Expect = 6.9e-13, Identities = 70/264 (26%), Positives = 124/264 (46%)
  Q:    22 LNPLDDSQIKWILKELILFNSKIIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNI---PVQYITKSFSFYGLSFFIKKGCFVPRQETEYM----LDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKT-QFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVD-PSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           LNP  D+ +        L  +      S IF   +T +   ++  L +L ++L + +   P+ YI     F+ L   +     +PR +TE +    LDW  K+ +      ILDL +G+G +A  ++    +K A +IGV+       +   N++NL  +  +F++SD F    +   + D I+ NPPYIDK D N+     + EP  AL A QNG     + +      L +   ++ E G+ Q + +++   +      +  +D    DR+
  S:    48 LNPKTDANL--------LLQAVTKRTKSAIFAFGETAL---HQTELAELAQLLARRLQGEPMAYILGEKDFWSLPLKVSPHTLIPRPDTERLVEVALDWVYKRLESQQTLQILDLGTGTGAIALALASELGDK-AQIIGVDFKPEAVTLAETNRQNLGFENVRFLQSDWFSALEN--RQFDLIVSNPPYIDKQDENLQYGDVRFEPLSALVAEQNGLSDLQKIIENAPLYLLDNGALMLEHGWQQAQAVQQIFQQYQWDEIESFQDYGGNDRL 306
>gi|15604742|ref|NP_219526.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Chlamydia trachomatis D/UW-3/CX] >gi|3328414|gb|AAC67614.1| N6-adenine-specific DNA methylase [Chlamydia trachomatis D/UW-3/CX] (290 aa)
Score = 191, Expect = 7.1e-13, Identities = 60/211 (28%), Positives = 96/211 (45%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKL-IDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYID-KNDPNVDPSTKC-EPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYIK 289
           P  YI     F G+   +     +PRQETE  ++  +   ++  +K    D+C GSG +   ++  K      V   + +     +   N R+  L   F+  D+F  D   +   D ++CNPPY+  K     DP  +C EP +AL    +G  FY R  + I+ IL +G     EIG  Q E+I++      I   + LKD    DR  +++
  S:    65 PTAYIHGKVHFLGVELQVTPQVLIPRQETEIFVEQIIGYLQMHKEKTTFYDVCCGSGCIG--LAVRKHCPHVRVTLSDISPEALAIAESNARSNALAVDFLLGDLF--DPFSF-PADVLVCNPPYLSYKEFFESDPEVRCHEPWKALVGGVSGLEFYHRIATHIHKILVSGGVGWLEIGSTQGEDIKQIFHAKGIR-GRVLKDYAQLDRFFFLE 272
>gi|121601994|ref|YP_988677.1| HemK family methyltransferase [Bartonella bacilliformis KC583] >gi|120614171|gb|ABM44772.1| methyltransferase, HemK family [Bartonella bacilliformis KC583] (288 aa)
Score = 191, Expect = 7.1e-13, Identities = 65/220 (29%), Positives = 107/220 (48%)
  Q:    67 LKQLNKVLNKNI---PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAV----KQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQF--IKSDIFKIDRSHYEKCDFIICNPPYIDKND-PNVDPSTK-CEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVL 286
           + QL + + + I   P   I  +  FYG+SF + K    PR +TE ++D  +    K+ K   K  +LD+ +G+G +A  I+ +K+      + V+      K   +N +N  +  +F  + S+ F      +   D II NPPYI + D PN+    +  +P +AL   ++G  FY +   E    L     I  EIG++QK+E+     KN     K   DL    R +
  S:    57 IAQLEEAIKRRISGEPTHRIIGTREFYGISFALSKETLEPRPDTEILIDLVLPILKKKVKKSGKATLLDMGTGTGAIA--IAILKQVVQTCAVAVDIAEDALKTATQNAKNADVLHRFTPLLSNWFNTVTGQF---DLIISNPPYIPEKDIPNLAKEVRQYDPLRALIGGKDGLDFYRKLADESATYLKEEGYIAVEIGYSQKKEVCNLFEKNGFKCLKIRDDLSGIPRAI 282
>gi|189464286|ref|ZP_03013071.1| hypothetical protein BACINT_00627 [Bacteroides intestinalis DSM 17393] >gi|189438076|gb|EDV07061.1| hypothetical protein BACINT_00627 [Bacteroides intestinalis DSM 17393] (278 aa)
Score = 191, Expect = 7.2e-13, Identities = 63/241 (26%), Positives = 112/241 (46%)
  Q:    50 DIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYI---DKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEI-YPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYIKK 290
           D +  KD  +  + ++ L+ L + L    P+QYI     F G +F +  G  +PR ETE +++  +  K++     +LD+ +GSG +A T++  K+   A V   + +     +   N   L++   F + D+        E+ D I+ NPPY+   +K D   +     EP  ALF P      ++R +S +   IL    ++ FEI     E+I   + +      +  KD+   DR +  +K
  S:    39 DYYLGKDITLSAKAEQELQSLLRRLRNFEPIQYILGEARFLGRTFQVASGVLIPRPETEELVE--IMLKEISSTSRVLDIGTGSGCIAATLA--KELPGAQVTAWDVSEEALAIAAANSLALQVPVCFEQRDVLTYIPGVTERYDVIVSNPPYVTEAEKQDMERN-VLDWEPSLALFVPDADPLRFYRRISVLGLEILEPDGKLYFEINRTFGEDIVLMMRELGYRFVRLQKDISHNDRFVIAQK 278
>gi|117919222|ref|YP_868414.1| HemK family modification methylase [Shewanella sp. ANA-3] >gi|117611554|gb|ABK47008.1| modification methylase, HemK family [Shewanella sp. ANA-3] (286 aa)
Score = 191, Expect = 7.4e-13, Identities = 58/239 (24%), Positives = 110/239 (46%)
  Q:    46 ENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKL-KTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDP-STKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDR 284
           +N + ++   +  +  E  K  +Q+ +   + +PV +I     F+ L F +     +PR +TE +++ A+    L     +LDL +G+G +A  ++   +     +  V+K      +   N+ NLKL + + ++SD F   ++H    D I+ NPPYID+ D ++     + EP+ AL A   G+   +         L     I+ E GF Q  ++ + L +        ++D    DR
  S:    39 KNRAFLYTWPEKALTVEQWKRFQQMVQRRQQGVPVAHIVGEREFWSLPFIVNDTTLIPRPDTEILVETALNL-PLESNAKVLDLGTGTGAIA--LALASERATWQITAVDKVEDAVALAKANRTNLKLEQVEILQSDWFSAIKAH--DFDLIVSNPPYIDEADEHLHQGDVRFEPQSALTAADEGFADLYYIAKTARDYLKPNGYILLEHGFEQAVKLREKLTELGYQNVATVRDFGSNDR 274
>gi|193213221|ref|YP_001999174.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Chlorobaculum parvum NCIB 8327] >gi|193086698|gb|ACF11974.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Chlorobaculum parvum NCIB 8327] (294 aa)
Score = 191, Expect = 7.6e-13, Identities = 61/208 (29%), Positives = 112/208 (53%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKL-----IDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKN--QRNLKLKTQFIKSDIFKIDRSHYEKC----DFIICNPPYIDKND-PNVDPSTK-CEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVL 286
           PVQYI     FYG  FF+ +   +PR ETE +L+ A+++        +D   ILD+ +GSG +A T++   +   A V  ++ +    +V  +N  +  +  + +F+++D   +D +  +K     D +I NPPYI +++   +    K  EP+ AL +P  G+ FY   ++    +L  G  + FE+  +  E ++K L+ +     + ++D    DR L
  S:    75 PVQYIAGESFFYGYRFFVDERVLIPRPETELVLEHAIERLAASGLDSVDTPSILDIGTGSGCIAITLAL--RLPGAQVTALDVSADALEVARRNAEEHGVSDRIRFVQAD--ALDLAFAQKAGGPFDLVISNPPYIPESEWATLQKEVKGYEPRLALVSP-TGFEFYRSIVATAPALLRKGGVLCFELHADGAEGVKK-LLGHEFRDVQVMQDYSRLDRAL 289
>gi|13508101|ref|NP_110050.1| HemK family methylase [Mycoplasma pneumoniae M129] >gi|2496353|sp|P75419|Y362_MYCPN Uncharacterized protein MG259 homolog >gi|1674165|gb|AAB96122.1| hemk family protein [Mycoplasma pneumoniae M129] (453 aa)
Score = 191, Expect = 7.7e-13, Identities = 63/204 (30%), Positives = 98/204 (48%)
  Q:    57 TEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANG---TEIIFEIGFNQKEE 260
           T  DF+ + I+  L       +P+ YIT S     L+F  + G F+PR ++  +L   VK + L   K  +DLC GSG LA  I+  K+     V G + N    ++  +N R   ++ Q+I++D            D II NPPY+  N+  +D +   EP+ +L A  NG  FY     ++Y  L       ++I E    QK+E
  S:    47 TITDFDEQGIVNALKAYFVDQLPLPYITGSVKLGSLTFKTQPGVFIPRADSLALLK-VVKAQNL---KTAVDLCCGSGTLA--IALKKRFPHLNVYGSDLNPQALQLAAQNARLNMVEVQWIEADFLAALAQVNTPIDLIITNPPYL--NESQLDQTLNHEPRNSLVADGNGILFY----QKLYNFLLGNRQVKQVILECSPTQKKE 241
>gi|149188130|ref|ZP_01866425.1| N5-glutamine methyltransferase [Vibrio shilonii AK1] >gi|148838118|gb|EDL55060.1| N5-glutamine methyltransferase [Vibrio shilonii AK1] (310 aa)
Score = 190, Expect = 8.0e-13, Identities = 59/203 (29%), Positives = 102/203 (50%)
  Q:    62 EYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQF--IKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPST-KCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKF 264
           E  ++++++ K +N   P  Y+T    F GL FF+ +   VPR     +++   +     +   I+DLC+GSG +A  I+      DA V  ++ +    +V  +N ++  L+ Q   I+SD+F+ D    EK + I+ NPPY+D+ D N  P     EP+  L A  +G     R LS     L +   +I E+G +    +E++
  S:    72 ERLRVVERVIKRINDRTPTAYLTNKAWFCGLEFFVDERVLVPRSPIGELIEAQFQPWLSEEPVRIMDLCTGSGCIA--IACAHAFPDAEVDAIDISTDALEVAEQNVQDHGLEQQVFPIRSDLFR-DLPK-EKYNLIVSNPPYVDEEDMNSLPEEFTHEPELGLAAGTDGLKLVRRILSNAPDYLTDNGILICEVGNSMVHMMEQY 273
>gi|78777517|ref|YP_393832.1| modification methylase HemK [Sulfurimonas denitrificans DSM 1251] >gi|78498057|gb|ABB44597.1| Modification methylase HemK [Sulfurimonas denitrificans DSM 1251] (276 aa)
Score = 190, Expect = 8.4e-13, Identities = 68/220 (30%), Positives = 113/220 (51%)
  Q:    65 KILKQLNKVLN------KNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKY---ILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDR 284
           K +K++ K+L       KN P++YI  S SFY   F+I  G  +PR ETE ++D  +K   + DK     I+++  GSG++  +I   K   +A  I V+ ++    V  KN     L+ + I+     +     EK D+++ NPPYI  +D +++ +   EP+ ALF    G       L  +  + A       E+G++QK++I+ +L    +    F KD  D DR
  S:    50 KEVKEIEKLLEWAQRRAKNEPLEYIVGSVSFYSEEFYIDSGALIPRPETELLIDEVLKN--IEDKNSPLNIVEVGVGSGII--SIILAKSLPNAKFIAVDISQAALGVARKNIEKFSLEDR-IELRHGSLLEPIKEKIDYLVSNPPYI-ADDVSLESNLSYEPQNALFGGSVGDEIIKELLDGV--LKAEINLFSCEMGYDQKDKIQNYLNNKPLKSLVFYKDYSDFDR 270
>gi|15672580|ref|NP_266754.1| protoporphyrinogen oxidase [Lactococcus lactis subsp. lactis Il1403] >gi|12723493|gb|AAK04696.1|AE006293_2 protoporphyrinogen oxidase (EC 1.3.3.4) [Lactococcus lactis subsp. lactis Il1403] (270 aa)
Score = 190, Expect = 8.7e-13, Identities = 69/225 (30%), Positives = 115/225 (51%)
  Q:    65 KILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKN---------KDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIF-KIDRSHYEKCDFIICNPPYI--DKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEK-FLIKNNITVFKFLKDLDDKDRVLYIK 289
           K+L +++K L++N P QYI     F  L   + +   +PR ETE +++  + + +  D   ILD+ +GSG +A +++  ++N         K+A+ +  E           NQ NL    +FI+SD+  KI  S     D I+ NPPYI  D+     +   K EP  ALFA   G   Y +   +    L +  +I  EIG+ Q + ++  F  K    +    +D+  KDR++ +K
  S:    49 KLLTEVSKRLHQNEPPQYIVGWAEFRDLKLKVDERVLIPRPETEELVEMILAENEK-DSLKILDIGTGSGAIAISLAQARENWSVKASDISKEALTLAAENAEI-------NQANL----EFIQSDVLDKITDSF----DIIVSNPPYIAFDETYEMDNSVIKYEPDLALFAENQGLAIYQKIADQAVNHLTDNGKIYLEIGYKQGQAVQAIFQEKFTDKLVSIHQDIFGKDRMISVK 270
>gi|121534883|ref|ZP_01666702.1| modification methylase, HemK family [Thermosinus carboxydivorans Nor1] >gi|121306482|gb|EAX47405.1| modification methylase, HemK family [Thermosinus carboxydivorans Nor1] (289 aa)
Score = 190, Expect = 8.8e-13, Identities = 56/213 (26%), Positives = 101/213 (47%)
  Q:    78 IPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKN--QRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKND-PNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYIKK 290
           +PV YIT    F GL F +     VPR +TE +++ A+ +   +    +LDL +GSG +   +S + + + A  IGV+ +     V   N  +  +  +    + D+F       +  D I+ NPPYI   D   ++P  + EP+ AL    +G  FY R ++     L +G  +  E+G  Q   +      + + V   ++D    +RV+ +++
  S:    76 VPVAYITGHKEFMGLDFIVTSDVLVPRPDTEVLVEAALARLAGVSTPVVLDLGTGSGAI--IVSLLHRLQAATGIGVDISPGALAVARANAQKHGVAARLALKQGDLFAPVAG--QAFDAIVANPPYIPDGDIAGLEPEVRHEPRTALAGGADGLDFYRRIVAMAPGHLKDGAFLAVEVGCGQAAAVAGLAAVSGLGVEAVIRDYAGIERVVVMRR 287
>gi|163789459|ref|ZP_02183898.1| hemK protein [Carnobacterium sp. AT7] >gi|159875313|gb|EDP69378.1| hemK protein [Carnobacterium sp. AT7] (282 aa)
Score = 190, Expect = 8.9e-13, Identities = 78/280 (27%), Positives = 125/280 (44%)
  Q:    10 KSSMTFSELTKRLNPLDDSQIKWILKELILFNSKIIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAI-VIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPN-VDPST-KCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKF----LIKNNITVFKFLKDLDDKDRVLYIK 289
           KS  T+ E+ K  +   ++  +      +L   +   + +D+    + EI  E K  L +        IPVQ I     FY   F + K   +PR ETE ++D  +K+     K  +LD+             IKK +    V   + +    KV  +N  +L  + + ++ D+ +  +   E  D II NPPYI  ++   +D S    EP  ALFA  NG   Y R   E   IL  G EI+ EIGF Q + +++       K  + +    KD+   DR++ +K
  S:     2 KSKTTYREVLKWASSFLETCKREPFAAELLLRERQDWSKTDVMLHLNEEIPSEVKHQLLKDVSDHGSGIPVQQIVGYGWFYDRKFKVTKDTLIPRPETEEIVDIFLKETSTNQKLTVLDI---GTGTGIIGITIKKERPLFDVTATDLSSKALKVAKENAESLSAEVRLLEGDLTEPVKK--ETFDVIISNPPYISTDEVGYMDESVLHYEPHLALFAENNGLAIYQRLAKETPAILNPGGEILLEIGFKQGKSVQEIFQQAFPKAEVAIG---KDMSGNDRLIRVK 280
>gi|89891629|ref|ZP_01203133.1| putative protoporphyrinogen oxidase [Flavobacteria bacterium BBFL7] >gi|89516176|gb|EAS18839.1| putative protoporphyrinogen oxidase [Flavobacteria bacterium BBFL7] (281 aa)
Score = 190, Expect = 8.9e-13, Identities = 60/214 (28%), Positives = 101/214 (47%)
  Q:    49 SDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNV--DPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEII-FEIGFNQKEEIE 262
           SD   +   E+    ++IL++  + L  + P+QYIT    FYG    + +   +PRQETE ++D  +K  K      I+D+ +G+G +  ++   K   D IV  ++ +         N  +LK   + I  D+  +D    EK D I+ NPPY+   +     D   + EP  ALF   +    ++R + E+  I      I+ FEI     EE++
  S:    40 SDFMIKDREELSHLQEEILQKSLRELRTSKPIQYITGKAHFYGHEIVVNEHTLIPRQETEELVDMIIKDHKTESYLNIIDIGTGTGCIGLSLKAAK--PDCIVTLMDVSEEALATAQSNANHLKTPVKTILQDVLALDELP-EKYDIIVSNPPYVRNLEKKEIHDNVLENEPHLALFVEDDNALVFYRKIMELAKIALQPNGILYFEINQYLPEEMK 253
>gi|157826325|ref|YP_001494045.1| bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase [Rickettsia akari str. Hartford] >gi|157800283|gb|ABV75537.1| bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase [Rickettsia akari str. Hartford] (522 aa)
Score = 190, Expect = 8.9e-13, Identities = 74/227 (32%), Positives = 115/227 (50%)
  Q:    62 EYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQ-----------------KKLID-----KKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKN--QRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPN--VDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYI 288
           E K   K L + L K+ P+ YIT    FY   F + K   +PR +TE ++D  +++                 KKL          IL+L +GSG +A  IS + +  +A +I  + +    +V   N  + ++  + Q I SD F  +    +K D I+ NPPYI  ++ +     +   EP  ALFA ++G   Y        P L    +II EIGFNQ E++ K  +     +    KDL   +RV+ I
  S:    55 EIKAFEKLLERRL-KHEPITYITGVKEFYSREFIVNKHVLIPRSDTEILVDVVLQRYSHSTQGHSTESGKPETKKLDSVVNPRNDSILELGTGSGCVA--ISLLCELPNANIIATDISIEAIEVAKSNAIKHHVTDRIQIIHSDWF--ENLGKQKFDVIVSNPPYISHSEKSEMALETLNHEPHFALFAEEDGLQAYRIIAKNAKPFLKPNGKIILEIGFNQAEKVSKIFLNYGYNIDNIYKDLQSHNRVIEI 302
>gi|19115895|ref|NP_594983.1| S-adenosylmethionine-dependentmethyltransferase [Schizosaccharomyces pombe] >gi|2408047|emb|CAB16250.1| S-adenosylmethionine-dependentmethyltransferase [Schizosaccharomyces pombe] (309 aa)
Score = 190, Expect = 9.5e-13, Identities = 77/259 (29%), Positives = 124/259 (47%)
  Q:    32 WILKELILFNSKIIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDK---KYILDLCSGSGVLANTISYIKKNKDA--IVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKID--------RSHYEKCDFIICNPPYIDKND--PNVDPST-KCEPKQALFAPQNGYYFYFRFLSEIYPILANGTE-------IIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYIKK 290
           WI KEL L   +I ++                +K +    ++  +N P+QYI KS  F  +    ++G  +PR ETE  ++  V +   +++     ILDLC+GSG ++   S++  N      +  V+ ++   K+ VKN           K +  +ID         S  +    ++CNPPYI  +D     D S  K EPK AL A   G  FY++F   I  +L    +       I+FEIG   + +I K L  +        +D   +DRV+ I +
  S:    37 WICKELKLLYPEISKHG--------------LRKKIVNACQLRARNYPLQYILKSQPFGNIKIDCQQGVLIPRWETEEWVERVVDKLNRLERLKPLKILDLCTGSGCIS---SFVLANLRVPHTIEAVDVSKKALKLAVKNCDRAIAHGTVGKINFHQIDVLNEHERVESLLQTSHVLLCNPPYISDDDFAAQTDISVRKYEPKLALLAKNGGNEFYYKFSQYIKRMLQRNAKDFVPLSLIVFEIGSTHQAKIVKSLFDDTNWQANIEQDGAHQDRVVIITR 301
>gi|167553920|ref|ZP_02347663.1| hypothetical protein Sentente_25723 [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] >gi|168462749|ref|ZP_02696680.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Salmonella enterica subsp. enterica serovar Newport str. SL317] >gi|195633874|gb|EDX52226.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Salmonella enterica subsp. enterica serovar Newport str. SL317] (277 aa)
Score = 190, Expect = 9.6e-13, Identities = 52/207 (25%), Positives = 101/207 (48%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLK-TQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNV-DPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           P+ Y+T    F+ L  F+     +PR +TE +++ A+ +   +    ILDL +G+G +A  ++   +  D  V  V++      + ++N  +L ++  + ++S  F       ++ D I+ NPPYID  DP++ +   + EP+ AL A +NG       +     +L  G  ++ E G+ Q E +     ++  T  +  +D    +RV
  S:    67 PIAYLTGLREFWSLPLFVSPATLIPRPDTECLVEQALARLP-VKTCRILDLGTGTGAIA--LALACERPDCEVTAVDRMPDAVALAIRNAEHLAIRNVRILQSCWFSALSG--QQFDMIVSNPPYIDAQDPHLSEGDVRFEPRSALVADENGMADLTHIIDNARQMLTPGGFLLLEHGWQQGEAVRAVFRRSGYTDVETCRDYGGNERV 270
>gi|156975384|ref|YP_001446291.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Vibrio harveyi ATCC BAA-1116] >gi|156526978|gb|ABU72064.1| hypothetical protein VIBHAR_03115 [Vibrio harveyi ATCC BAA-1116] (310 aa)
Score = 190, Expect = 9.7e-13, Identities = 57/203 (28%), Positives = 104/203 (51%)
  Q:    62 EYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQF--IKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPST-KCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKF 264
           E  +I++++ K +N+  P  Y+T    F GL FF+ +   VPR     ++    +   + +   I+DLC+GSG +A  I+      +A V  ++ +    +V  +N ++  ++ Q   I+SD+F+ D S  EK + I+ NPPY+D+ D N  P     EP+  L A  +G     R L+     L +   ++ E+G +    +E++
  S:    72 ERLRIVERVVKRINERTPTAYLTNKAWFCGLEFFVDERVLVPRSPIGELIQAEFQPWLVEEPTRIMDLCTGSGCIA--IACAHAFPEAEVDAIDISTDALQVAEQNVQDHGMEQQVFPIRSDLFR-DLSK-EKYNLIVSNPPYVDEEDMNSLPDEFTHEPELGLAAGTDGLKLVRRILANAPDYLTDDGILVCEVGNSMVHMMEQY 273
>gi|149276500|ref|ZP_01882644.1| putative protoporphyrinogen oxidase [Pedobacter sp. BAL39] >gi|149233020|gb|EDM38395.1| putative protoporphyrinogen oxidase [Pedobacter sp. BAL39] (288 aa)
Score = 190, Expect = 9.7e-13, Identities = 60/221 (27%), Positives = 106/221 (47%)
  Q:    69 QLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAV-------KQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPSTKC---EPKQALFAPQNGYYFYFRFLSEIYP-ILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYIK 289
           ++   + K  PVQ++    +FYG S  +     +PR ETE ++DW +       +Q        ++D  +GSG +   I+  K   +A+V  V+ ++T  KV   N      + +FI++D+   +    +K D ++ NPPYI KN   ++        EP  ALF P      ++  L+++    L     + FEI  +  +E    L   +    +  KD+  KDR+L  +
  S:    60 EIATAMTKGRPVQHVLGETTFYGFSIQVSPDVLIPRPETEELVDWILTTLRSDFQQAPETGPLRVIDFGTGSGCIP--IAIKKHIAEAVVEAVDISQTALKVAKHNALMNNAEIRFIQADM--CNYKTEQKYDLMVSNPPYI-KNLERIEMHKNVLEHEPHLALFVPDERPLLFYEALADLAAKSLNEQGYLFFEINEHLAQETIDMLASKSFKTIELRKDMQGKDRMLMTR 286
>gi|163801892|ref|ZP_02195789.1| N5-glutamine methyltransferase [Vibrio campbellii AND4] >gi|159174400|gb|EDP59204.1| N5-glutamine methyltransferase [Vibrio campbellii AND4] (310 aa)
Score = 190, Expect = 1.0e-12, Identities = 56/203 (27%), Positives = 104/203 (51%)
  Q:    62 EYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQF--IKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPST-KCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKF 264
           E  +I++++ K +N+  P  Y+T    F GL FF+ +   VPR     ++    +   + +   I+DLC+GSG +A  I+      DA V  ++ +    +V  +N ++  ++ Q   I+SD+F+ D +  E+ + I+ NPPY+D+ D N  P     EP+  L A  +G     R L+     L +   ++ E+G +    +E++
  S:    72 ERLRIVERVVKRINERTPTAYLTNKAWFCGLEFFVDERVLVPRSPIGELIQAEFQPWLVEEPTRIMDLCTGSGCIA--IACAHAFPDAEVDAIDISTDALQVAEQNVQDHGMEQQVFPIRSDLFR-DLAK-EQYNLIVSNPPYVDEEDMNSLPDEFTHEPELGLAAGTDGLKLVRRILANAPDYLTDNGILVCEVGNSMVHMMEQY 273
>gi|90416953|ref|ZP_01224882.1| hemK protein [marine gamma proteobacterium HTCC2207] >gi|90331300|gb|EAS46544.1| hemK protein [marine gamma proteobacterium HTCC2207] (277 aa)
Score = 189, Expect = 1.0e-12, Identities = 56/217 (25%), Positives = 108/217 (49%)
  Q:    69 QLNKVLNKNI---PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKT-QFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDP-STKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           Q + +L + I   PV Y+  S  F+ L   +     +PR ETE +++ A+    L ++  +LDL +G+G +A  ++   +     +  V+  ++   +  +N++  +L   +   SD F       ++ D I+ NPPYI+ NDP++     + EP  AL +  +G        S+    LA+G  ++ E GF+Q   + + L +   T+ +   DL+  +R+
  S:    54 QFDALLQRRIAGEPVAYLIGSQGFWSLDLEVSPATLIPRPETELLVEVAL-DLALPEQAAVLDLGTGTGAIA--LALASERNGWQICAVDLQQSAVDLAERNRQRYQLNNVRLFASDWFAA--IPVQRFDLIVSNPPYIEANDPHLTQGDVRFEPASALVSGDDGLDDLRLVCSQSVDYLADGGWLLLEHGFDQGAAVRELLERAGFTLVETRSDLNGCERI 270
>gi|114046305|ref|YP_736855.1| HemK family modification methylase [Shewanella sp. MR-7] >gi|113887747|gb|ABI41798.1| modification methylase, HemK family [Shewanella sp. MR-7] (286 aa)
Score = 189, Expect = 1.0e-12, Identities = 57/223 (25%), Positives = 103/223 (46%)
  Q:    62 EYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKL-KTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDP-STKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDR 284
           E  K  +Q+ +   + +PV +I     F+ L F +     +PR +TE +++ A+    L     +LDL +G+G +A  ++   +     +  V+K      +   N+ NLKL + + ++SD F   ++H    D I+ NPPYID+ D ++     + EP+ AL A   G+   +         L     I+ E GF Q  ++ + L +        ++D    DR
  S:    55 EQWKRFQQMVQRRQQGVPVAHIVGEREFWSLPFIVNDTTLIPRPDTEILVETALNL-PLESNAKVLDLGTGTGAIA--LALASERATWQITAVDKVEEAVALAKANRTNLKLEQVEILQSDWFSAIKAH--DFDLIVSNPPYIDEADEHLHQGDVRFEPQSALTAADEGFADLYYIAKTARDYLKPNGYILLEHGFEQAVKLREKLTELGYQNVATVRDFGSNDR 274
>gi|121603685|ref|YP_981014.1| HemK family modification methylase [Polaromonas naphthalenivorans CJ2] >gi|120592654|gb|ABM36093.1| modification methylase, HemK family [Polaromonas naphthalenivorans CJ2] (283 aa)
Score = 189, Expect = 1.0e-12, Identities = 58/206 (28%), Positives = 99/206 (48%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWA---VKQKKLIDKKYILDLCSGSGVLANTISYIKK--NKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDR 284
           P+ YI     F+GL+  +     VPR +TE +++W+   +K   L+    +LDL +GSG +A  I++  K   ++A V  V+ +     V  +N R L L   FI+S   +     +     I  NPPYI   DP++  +   EP QAL A  +G       + +    L  G  ++ E G++Q   + + L++      +  +DL   +R
  S:    69 PLAYIVGGKEFFGLALQVDARVLVPRPDTETLVEWSLAVLKAPGLMPPLKVLDLGTGSGAIALAIAHSLKATGREAQVTAVDASADALDVARENARRLGLAVAFIESSWLQGVNGRFH---LIASNPPYIASADPHL-AALAHEPLQALTAGMDGLDDIRDIIQQAPDHLLPGGWLLLEHGYDQAGRVRELLVQRGFLQVQGRQDLAGIER 275
>gi|168233806|ref|ZP_02658864.1| hypothetical protein Sententerica_22699 [Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191] >gi|194470184|ref|ZP_03076168.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|194456548|gb|EDX45387.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] (277 aa)
Score = 189, Expect = 1.1e-12, Identities = 52/207 (25%), Positives = 102/207 (49%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLK-TQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNV-DPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           P+ Y+T    F+ L  F+     +PR +TE +++ A+ +  L   + ILDL +G+G +A  ++   +  D  V  V++      + ++N  +L ++  + ++S  F       ++ D I+ NPPYID  DP++ +   + EP+ AL A +NG       +     +L  G  ++ E G+ Q E +     ++  +  +  +D    +RV
  S:    67 PIAYLTGLREFWSLPLFVSPATLIPRPDTECLVEQALARLPLKTCR-ILDLGTGTGAIA--LALACERPDCEVTAVDRMPDAVALAIRNAEHLAIRNVRILQSCWFSALSG--QQFDMIVSNPPYIDAQDPHLSEGDVRFEPRSALVADENGMADLTHIIDNARQMLTPGGFLLLEHGWQQGEAVRAVFRRSGYSDVETCRDYGGNERV 270
>gi|76788736|ref|YP_327822.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Chlamydia trachomatis A/HAR-13] >gi|166154245|ref|YP_001654363.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Chlamydia trachomatis 434/Bu] >gi|166155120|ref|YP_001653375.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Chlamydia trachomatis L2b/UCH-1/proctitis] >gi|47558932|gb|AAT35566.1| class 1 release factor N5-glutamine S-adenosyl-L-methionine dependent methyltransferase; PrmC; HemK [Chlamydia trachomatis] >gi|76167266|gb|AAX50274.1| peptide release factor-glutamine N5-methyltransferase [Chlamydia trachomatis A/HAR-13] >gi|165930233|emb|CAP03718.1| peptide release factor-glutamine N5-methyltransferase [Chlamydia trachomatis 434/Bu] >gi|165931108|emb|CAP06672.1| peptide release factor-glutamine N5-methyltransferase [Chlamydia trachomatis L2b/UCH-1/proctitis] (290 aa)
Score = 189, Expect = 1.1e-12, Identities = 59/211 (27%), Positives = 96/211 (45%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKL-IDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYID-KNDPNVDPSTKC-EPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYIK 289
           P  YI     F G+   +     +PRQETE  ++  +   ++  +K    D+C GSG +   ++  K      V   + +     +   N R+  L   F+  D+F  D   +   D ++CNPPY+  K     DP  +C EP +AL    +G  FY R  + I+ IL +G     EIG  Q E++++      I   + LKD    DR  +++
  S:    65 PTAYIHGKVHFLGVELQVTPQVLIPRQETEIFVEQIIGYLQMHKEKTTFYDVCCGSGCIG--LAVRKHCPHVRVTLSDISPEALAIAESNARSNALAVDFLLGDLF--DPFSF-PADVLVCNPPYLSYKEFFESDPEVRCHEPWKALVGGVSGLEFYHRIATHIHKILVSGGVGWLEIGSTQGEDVKQIFHAKGIR-GRVLKDYAQLDRFFFLE 272
>gi|113971502|ref|YP_735295.1| HemK family modification methylase [Shewanella sp. MR-4] >gi|113886186|gb|ABI40238.1| modification methylase, HemK family [Shewanella sp. MR-4] (286 aa)
Score = 189, Expect = 1.1e-12, Identities = 57/223 (25%), Positives = 103/223 (46%)
  Q:    62 EYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKL-KTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDP-STKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDR 284
           E  K  +Q+ +   + +PV +I     F+ L F +     +PR +TE +++ A+    L     +LDL +G+G +A  ++   +     +  V+K      +   N+ NLKL + + ++SD F   ++H    D I+ NPPYID+ D ++     + EP+ AL A   G+   +         L     I+ E GF Q  ++ + L +        ++D    DR
  S:    55 EQWKRFQQMVQRRQQGVPVAHIVGEREFWSLPFIVNDTTLIPRPDTEILVETALNL-PLESNAKVLDLGTGTGAIA--LALASERATWQITAVDKVEDAVALAKANRTNLKLEQVEILQSDWFSAIKAH--DFDLIVSNPPYIDEADEHLHQGDVRFEPQSALTAADEGFADLYYIAKTARDYLKPNGYILLEHGFEQAVKLREKLTELGYQNVATVRDFGSNDR 274
>gi|150385479|ref|ZP_01924098.1| modification methylase, HemK family [Victivallis vadensis ATCC BAA-548] >gi|150258164|gb|EDM95454.1| modification methylase, HemK family [Victivallis vadensis ATCC BAA-548] (282 aa)
Score = 189, Expect = 1.1e-12, Identities = 59/240 (24%), Positives = 112/240 (46%)
  Q:    50 DIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKND-PNVDPSTKC-EPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIK-NNITVFKFLKDLDDKDRVLYIK 289
           ++F      +  E ++ +++L +      P+QY+     F  L   +     +PR ETE + ++AVK   L +   +LDL +GSG +A  ++   +  D  +  V+ +    +V  +N+     + +F++SD+F       E+ D +  N PY+ + + P ++P  +  EP+ AL AP  G+    R   E+   L  G   IFE+   Q   + +  +K         L D   +DR + ++
  S:    41 ELFLCAGEPVPAELERHIRELARRRANREPLQYLLGVAYFMDLELEVTPAVLIPRPETELLAEYAVKH--LPEGGSMLDLGTGSGAIALAVA--AERPDVRITAVDVSSDALEVARRNRVRCGGEVRFLQSDLFS--ELPGERFDLVGANLPYVTQEEYPALEPEVRLFEPQLALTAPDGGFRLIERAARELADHLNPGGRAIFELSPPQAPRLAELFVKLGGFDEIDVLADYTRRDRFVSVR 277
>gi|119505821|ref|ZP_01627887.1| protoporphyrinogen oxidase [marine gamma proteobacterium HTCC2080] >gi|119458319|gb|EAW39428.1| protoporphyrinogen oxidase [marine gamma proteobacterium HTCC2080] (271 aa)
Score = 189, Expect = 1.1e-12, Identities = 50/207 (24%), Positives = 102/207 (49%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPST-KCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           P+ YI   + F+ L   +     +PR +TE ++ WAV       K+  LDL +GSG +A  + +     +  V  V+ ++    V   N + L+L+ ++++   F+   +   + D ++ NPPYI ++D ++       EPK AL +  +G +   + +++    L  G  ++ E G++Q  ++   L+ +     +  +DL  ++RV
  S:    61 PLAYILGQWEFWSLPLKVTPDVLIPRMDTELLVQWAVALLPEQSKQRCLDLGTGSGAVALAVKHEFPTSE--VTAVDLSQPALNVARTNGQQLQLEVEWLEGSWFEPVAA--REFDLVVANPPYIREDDDHLHQGDLPAEPKMALTSGIDGLHALRQLVADGQSALGPGGWMLLEHGWDQGPDVRDLLVTHGWQAVETRRDLAGRERV 264
>gi|163812352|ref|ZP_02204026.1| modification methylase, HemK family [Dehalococcoides sp. VS] >gi|157404006|gb|EDO70052.1| modification methylase, HemK family [Dehalococcoides sp. VS] (277 aa)
Score = 189, Expect = 1.2e-12, Identities = 53/190 (27%), Positives = 93/190 (48%)
  Q:    76 KNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKL--KTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFL 265
           + +P  YIT    FYG +F + K   +PR ETE++++ A++  +  +  YI D+ +GSG +A T++   + KDA V   + +    ++   N    +L  +  F + D+ +   S  E  D +  N PY+   +  +    K EP  AL    +G   Y R +  +   L  G   + EIG +Q E + K++
  S:    66 EGVPSAYITGEKEFYGRTFQVDKRVLIPRPETEHLIEKALRIARSYESPYIADIGTGSGAIAITLAL--ELKDAYVYATDISAEALEIARNNAAEYRLGKRLTFYRGDLLE---SLPEMVDILTANLPYVPTTETKL---LKGEPLLALDGGADGLDIYRRLIPVLPGKLRPGGTALLEIGIHQSEVLAKYI 249
>gi|77973499|ref|ZP_00829046.1| COG2890: Methylase of polypeptide chain release factors [Yersinia frederiksenii ATCC 33641] (282 aa)
Score = 189, Expect = 1.2e-12, Identities = 59/230 (25%), Positives = 102/230 (44%)
  Q:    56 DTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKT-QFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDP-STKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           +T +  E   +L+ L     +  PV Y+     F+ L   +     +PR +TE +++ A+        + ILDL +G+G +A  I+   +  D  V+G +       +   N   L +    F++S  F+     +     I+ NPPYID NDP+++    + EP  AL AP  G       + +    L  G  ++ E G+ Q + ++K L     +     KD  + DRV
  S:    44 ETVLTTEQLAVLEPLAARREQGEPVAYLVGEREFWSLPLSVSCATLIPRPDTECLVEQALAHLPATPCR-ILDLGTGTGAIALAIA--SERPDCSVVGGDIKADAVALARHNAEKLAINNVHFLQSSWFESVSGLFT---LIVSNPPYIDANDPHLNQGDVRYEPHSALVAPAEGLADLAEIIRQSPAYLEAGGWLMLEHGWQQAQAVQKLLKNAGFSAVMTYKDYGNNDRV 269
>gi|56413304|ref|YP_150379.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|56127561|gb|AAV77067.1| HemK protein, putative protoporphyrinogen oxidase [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] (277 aa)
Score = 189, Expect = 1.2e-12, Identities = 52/207 (25%), Positives = 101/207 (48%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLK-TQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNV-DPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           P+ Y+T    F+ L  F+     +PR +TE +++ A+ +   +    ILDL +G+G +A  ++   +  D  V  V++      + ++N  +L ++  + ++S  F       ++ D I+ NPPYID  DP++ +   + EP+ AL A +NG       +     +L  G  ++ E G+ Q E +     ++  T  +  +D    +RV
  S:    67 PIAYLTGLREFWSLPLFVSPATLIPRPDTECLVEQALARLP-VKTCRILDLGTGTGAIA--LALACERPDCEVTAVDRMPDAVALAIRNAEHLAIQNVRILQSCWFSALSG--QQFDMIVSNPPYIDAQDPHLSEGDVRFEPRSALVADENGMADLTHIIDNARQMLTPGGFLLLEHGWQQGEAVRAVFRRSGYTDVETCRDYGGNERV 270
>gi|86146091|ref|ZP_01064417.1| putative adenine-specific methylase [Vibrio sp. MED222] >gi|85836038|gb|EAQ54170.1| putative adenine-specific methylase [Vibrio sp. MED222] (310 aa)
Score = 189, Expect = 1.2e-12, Identities = 56/193 (29%), Positives = 99/193 (51%)
  Q:    62 EYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQF--IKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPST-KCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIG 254
           E  +I++++ K +N+  P  Y+T    F GL FF+ +   VPR     +++   +   + +   I+D+C+GSG +A  I+      DA V  ++ +    +V  +N ++  ++ Q   I+SD+F+ D    EK + I+ NPPY+D+ D N  P     EP+  L A  +G     R L+     L +   +I E+G
  S:    72 ERLRIVERVIKRINERTPTAYLTNKAWFCGLEFFVDERVLVPRSPIGELIEAQFQPWLIEEPTRIMDMCTGSGCIA--IACAHAFPDAEVDAIDISTDALQVAEQNVQDHGMEQQVFPIRSDLFR-DLPK-EKYNLIVSNPPYVDEEDMNSLPDEFTHEPELGLAAGTDGLKLVRRILANAPDYLTDDGILICEVG 263
>gi|168223096|ref|ZP_02648328.1| hypothetical protein Senterenterica_22074 [Salmonella enterica subsp. enterica serovar Agona str. SL483] (277 aa)
Score = 189, Expect = 1.2e-12, Identities = 52/207 (25%), Positives = 100/207 (48%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLK-TQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNV-DPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           P+ Y+T    F+ L  F+     +PR +TE +++ A+ Q   +    ILDL +G+G +A  ++   +  D  V  V++      + ++N  +L ++  + ++S  F       ++ D I+ NPPYID  DP++ +   + EP+ AL A +NG       +     +L  G  ++ E G+ Q E +     ++     +  +D    +RV
  S:    67 PIAYLTGLREFWSLPLFVSPATLIPRPDTECLVEQALAQLP-VKTCRILDLGTGTGAIA--LALACERPDCEVTAVDRMPDAVALAIRNAEHLAIRNVRILQSCWFSALSG--QQFDMIVSNPPYIDAQDPHLSEGDVRFEPRSALVADENGMADLTHIIDNARQMLTPGGFLLLEHGWQQGEAVRAVFRRSGYMDVETCRDYGGNERV 270
>gi|84387710|ref|ZP_00990726.1| putative adenine-specific methylase [Vibrio splendidus 12B01] >gi|84377393|gb|EAP94260.1| putative adenine-specific methylase [Vibrio splendidus 12B01] (310 aa)
Score = 189, Expect = 1.2e-12, Identities = 57/193 (29%), Positives = 98/193 (50%)
  Q:    62 EYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQF--IKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPST-KCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIG 254
           E  +I++++ K +N   P  Y+T    F GL FF+ +   VPR     +++   +   + +   I+DLC+GSG +A  I+      DA V  ++ +    +V  +N ++  ++ Q   I+SD+F+ D    EK + I+ NPPY+D+ D N  P     EP+  L A  +G     R L+     L +   +I E+G
  S:    72 ERLRIVERVIKRINDRTPTAYLTNKAWFCGLEFFVDERVLVPRSPIGELIEAQFQPWLIEEPTRIMDLCTGSGCIA--IACAHAFPDAEVDAIDISTDALQVAEQNVQDHGMEQQVFPIRSDLFR-DLPK-EKYNLIVSNPPYVDEEDMNSLPEEFTHEPELGLAAGTDGLKLVRRILANAPNYLTDDGILICEVG 263
>gi|54295178|ref|YP_127593.1| hypothetical protein lpl2258 [Legionella pneumophila str. Lens] >gi|53755010|emb|CAH16498.1| hypothetical protein [Legionella pneumophila str. Lens] (287 aa)
Score = 188, Expect = 1.3e-12, Identities = 64/240 (26%), Positives = 109/240 (45%)
  Q:    46 ENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKT-QFIKSDIF-KIDRSHYEKCDFIICNPPYIDKNDPNVDP-STKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           +N + +F   D  +  E  +   Q+ K   + +P+ YIT    F+ LS  +     +PR ETE++++ A++     +   +LDL +GSG +A  ++  K+     +   + ++   ++   N + L L    F  S  F  +    Y     I+ NPPYI +NDP++     + EP  AL + Q+G       +   Y  L     ++ E GF QK EI   L +         +DL   DRV
  S:    36 KNRAYLFAHPDALVSPEQIETYLQMIKQRAEGLPIAYITGQREFWSLSLKVTPNVLIPRHETEHLVELALELIPDKENVSVLDLGTGSGAIA--LALAKERPLWRIDACDFSKEALELACYNAKTLGLNNINFCHSYWFNNLPLKQYHA---IVSNPPYIAENDPHLKQGDVRFEPTSALVSSQDGLADLQYIIQHSYEYLLPDGLLLVEHGFEQKNEISTILNQLGYKNIHCWQDLQGHDRV 273
>gi|149003881|ref|ZP_01828704.1| HemK protein [Streptococcus pneumoniae SP14-BS69] >gi|147758111|gb|EDK65115.1| HemK protein [Streptococcus pneumoniae SP14-BS69] (279 aa)
Score = 188, Expect = 1.4e-12, Identities = 65/220 (29%), Positives = 108/220 (49%)
  Q:    49 SDIFFEKDTEIDFEY-KKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDA-IVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDP-----NVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKN 268
           +D  F    E+  E  K+ ++ + + L  + P QYI     FYG+   + +   +PR ETE +++  + +  L     +LD+ +GSG +A  ++   KN+ A  V   + ++    +  +N +N  L+    KSD F       EK D I+ NPPYI + D      NV  S   EP  ALFA ++G   Y R   +    L +  +I  EIG+ Q + + +   K+
  S:    37 TDFIFALQQEVTTEEEKQFVEDIYQQLATHKPAQYIIGQADFYGMHLKVDERVLIPRPETEELVELILTE-NLETNLSVLDIGTGSGAIALALA---KNRPAWSVTAADISQEALDLARENAKNQNLQIFLKKSDCFT---EISEKYDIIVSNPPYISREDESEVGLNVLYS---EPHLALFADEDGLAIYRRIAEDATDYLKDSGKIYLEIGYKQGQCVPELFRKH 253
>gi|86142851|ref|ZP_01061290.1| putative protoporphyrinogen oxidase [Flavobacterium sp. MED217] >gi|85830883|gb|EAQ49341.1| putative protoporphyrinogen oxidase [Leeuwenhoekiella blandensis MED217] (280 aa)
Score = 188, Expect = 1.4e-12, Identities = 67/213 (31%), Positives = 103/213 (48%)
  Q:    58 EIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFK---IDRSHYEKCDFIICNPPYI-DKNDPNVDPST-KCEPKQALFAPQNGYYFYFRFLSE--IYPILANGTEIIFEIGFNQKEEIEKFLIKNNI 270
           E+D   + +  +    L +N P+QYI  S  FYG  F +     +PR ETE ++DW     K      ILD+ +GSG +A  +S  K   +A V  ++ +    K+   N  +  +  QFIK DI     +DRS+    D I+ NPPY+ D     +  +    EP  ALF        +++ ++E  I  +  NG  + FEI  NQ   +E   +  NI
  S:    49 ELDEAQRNLFDKALSRLQQNEPLQYIVASTEFYGFPFQLSPAVLIPRPETEELVDWIYTDFKNTSCT-ILDIGTGSGAIA--VSLAKLLPEAKVTAIDVSEDALKIAEANASSNAVNVQFIKQDILDCQALDRSY----DVIVSNPPYVRDLEKVEIKANVLNYEPHLALFVEDQNALIFYKKIAELAIQALQPNGI-LYFEI--NQYLSVETVGLLKNI 258
>gi|83951818|ref|ZP_00960550.1| modification methylase, HemK family protein [Roseovarius nubinhibens ISM] >gi|83836824|gb|EAP76121.1| modification methylase, HemK family protein [Roseovarius nubinhibens ISM] (275 aa)
Score = 188, Expect = 1.5e-12, Identities = 58/208 (27%), Positives = 100/208 (48%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQ--FIKSDIFKIDRSHYEKCDFIICNPPYIDKND-PNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVL 286
           P+ +I     FYG +F +      PR ETE ++  A+++      + +LDL +GSG +   +S + + + A  +G + +     V  +N   L L ++  F ++D FK     Y   D I+ NPPYI   + P + P    EP+ AL    +G   Y    + +   L  G  I+ EIG  Q  ++ +   +  +   +  +DLD +DRV+
  S:    69 PMSHILGQRQFYGRAFKVTGDVLDPRPETECLVAAALEE----GFERVLDLGTGSGCI--LLSLLAEREGAQGLGADVSAAALDVARENAARLGLASRAAFQEADWFKGVAGQY---DLIVSNPPYIGIAEMPELAPELAHEPRAALTDEGDGLSAYRAIAAGVLAHLVPGGRILVEIGRTQGADVARIFAEAGLQAVELRQDLDGRDRVV 270
>gi|167471071|ref|ZP_02335775.1| methyltransferase, HemK family protein [Yersinia pestis FV-1] (267 aa)
Score = 188, Expect = 1.5e-12, Identities = 59/230 (25%), Positives = 104/230 (45%)
  Q:    56 DTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQ-FIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDP-STKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           +TEI  E    L+ L     +  P+ Y+     F+ L   +     +PR +TE +++ A+ +   +  + ILDL +G+G +A  ++   + +D  VI V+ N     +   N   L +    F++   F+     +     I  NPPYID NDP+++    + EP  AL A   G       +S+    L  G  ++ E G+ Q   +++ L  +  +     KD  + DRV
  S:    35 ETEITAEQLLWLETLANRREQGEPIAYLVGEREFWSLPLSVSSATLIPRPDTECLVEQALARLPAMPCR-ILDLGTGTGAIA--LALATERRDCAVIAVDINADAVALARHNAEKLTIDNVCFLQGSWFEPVSGRFA---LIASNPPYIDANDPHLNEGDVRYEPHSALVAAAEGMADLAAIVSQAPGYLDPGGWLMLEHGWQQANAVQELLKNSGFSAVMTCKDYGNNDRV 260
>gi|16122261|ref|NP_405574.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Yersinia pestis CO92] >gi|22126174|ref|NP_669597.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Yersinia pestis KIM] >gi|45441670|ref|NP_993209.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Yersinia pestis biovar Microtus str. 91001] >gi|108807398|ref|YP_651314.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Yersinia pestis Antiqua] >gi|108811663|ref|YP_647430.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Yersinia pestis Nepal516] >gi|145598395|ref|YP_001162471.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Yersinia pestis Pestoides F] >gi|149366050|ref|ZP_01888085.1| release factors RF-1 and RF-2 N5-glutamine methyltransferase [Yersinia pestis CA88-4125] >gi|162418925|ref|YP_001606877.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Yersinia pestis Angola] >gi|165926407|ref|ZP_02222239.1| methyltransferase, HemK family [Yersinia pestis biovar Orientalis str. F1991016] >gi|165938832|ref|ZP_02227386.1| methyltransferase, HemK family [Yersinia pestis biovar Orientalis str. IP275] >gi|166009186|ref|ZP_02230084.1| methyltransferase, HemK family [Yersinia pestis biovar Antiqua str. E1979001] >gi|166211074|ref|ZP_02237109.1| methyltransferase, HemK family [Yersinia pestis biovar Antiqua str. B42003004] >gi|167401386|ref|ZP_02306883.1| methyltransferase, HemK family [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167419945|ref|ZP_02311698.1| methyltransferase, HemK family [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167424706|ref|ZP_02316459.1| methyltransferase, HemK family [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|21959138|gb|AAM85848.1|AE013831_11 possible protoporphyrinogen oxidase [Yersinia pestis KIM] >gi|45436532|gb|AAS62086.1| putative protoporphyrinogen oxidase [Yersinia pestis biovar Microtus str. 91001] >gi|108775311|gb|ABG17830.1| protoporphyrinogen oxidase [Yersinia pestis Nepal516] >gi|108779311|gb|ABG13369.1| putative protoporphyrinogen oxidase [Yersinia pestis Antiqua] >gi|115347740|emb|CAL20655.1| putative protoporphyrinogen oxidase [Yersinia pestis CO92] >gi|145210091|gb|ABP39498.1| protoporphyrinogen oxidase [Yersinia pestis Pestoides F] >gi|149292463|gb|EDM42537.1| release factors RF-1 and RF-2 N5-glutamine methyltransferase [Yersinia pestis CA88-4125] >gi|162351740|gb|ABX85688.1| methyltransferase, HemK family [Yersinia pestis Angola] >gi|165913195|gb|EDR31818.1| methyltransferase, HemK family [Yersinia pestis biovar Orientalis str. IP275] >gi|165921628|gb|EDR38825.1| methyltransferase, HemK family [Yersinia pestis biovar Orientalis str. F1991016] >gi|165991741|gb|EDR44042.1| methyltransferase, HemK family [Yersinia pestis biovar Antiqua str. E1979001] >gi|166208254|gb|EDR52734.1| methyltransferase, HemK family [Yersinia pestis biovar Antiqua str. B42003004] >gi|166961640|gb|EDR57661.1| methyltransferase, HemK family [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167049082|gb|EDR60490.1| methyltransferase, HemK family [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167056588|gb|EDR66357.1| methyltransferase, HemK family [Yersinia pestis biovar Mediaevalis str. K1973002] (276 aa)
Score = 188, Expect = 1.5e-12, Identities = 59/230 (25%), Positives = 104/230 (45%)
  Q:    56 DTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQ-FIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDP-STKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           +TEI  E    L+ L     +  P+ Y+     F+ L   +     +PR +TE +++ A+ +   +  + ILDL +G+G +A  ++   + +D  VI V+ N     +   N   L +    F++   F+     +     I  NPPYID NDP+++    + EP  AL A   G       +S+    L  G  ++ E G+ Q   +++ L  +  +     KD  + DRV
  S:    44 ETEITAEQLLWLETLANRREQGEPIAYLVGEREFWSLPLSVSSATLIPRPDTECLVEQALARLPAMPCR-ILDLGTGTGAIA--LALATERRDCAVIAVDINADAVALARHNAEKLTIDNVCFLQGSWFEPVSGRFA---LIASNPPYIDANDPHLNEGDVRYEPHSALVAAAEGMADLAAIVSQAPGYLDPGGWLMLEHGWQQANAVQELLKNSGFSAVMTCKDYGNNDRV 269
>gi|126336076|ref|XP_001378754.1| PREDICTED: similar to HemK methyltransferase family member 1 [Monodelphis domestica] (358 aa)
Score = 188, Expect = 1.6e-12, Identities = 65/231 (28%), Positives = 119/231 (51%)
  Q:    60 DFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAV-----------KQKKLIDKKY----ILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKL--KTQFIKSDIFKIDRSH---YEKCDFIICNPPYIDKND-PNVDPST-KCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKN---NITVFKFLKDLDDKDRVLYIKK 290
           D + ++I +   + L + +PVQY+   + F GL+  +    F+PR ETE +++  +           +++ L  + +    ILD+C GSG +A  +S + K   + V+ V+K     ++  +N + L L  + Q ++ DI  ++R     +   DF++ NPPYI   D   + P     E   +L   +NG       LS+   +L +   I  E+     E +EK+L  +    +++     D   K R L+I K
  S:    94 DLQQEQIGELCTRRLQR-MPVQYVIGEWDFQGLTLKMTPPVFIPRPETEELVNLVLHEQSQRCQEFRRKRTLAHQSHSWPLILDVCCGSGAIA--LSLLSKLTQSRVVAVDKGEEAVQLTRENAQRLHLEDRIQIVRHDITSVNREQLLPWGPVDFVVSNPPYIFHCDMAQLAPEILSYEDTDSLDGGENGMSVIREILSQAPMLLKDSGSIFLEVDPRHPELVEKWLQSHPDLGLSLLATHVDFCGKPRFLHIHK 346
>gi|71278012|ref|YP_270225.1| HemK family modification methylase [Colwellia psychrerythraea 34H] >gi|71143752|gb|AAZ24225.1| modification methylase, HemK family [Colwellia psychrerythraea 34H] (285 aa)
Score = 188, Expect = 1.6e-12, Identities = 54/209 (25%), Positives = 98/209 (46%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKN--KDAIVIGVEKNRTPYKVGVKNQRNLKLK-TQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDP-STKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLY 287
           P+ YI     F+ L F +     +PR +TE +++  ++    +D  + LDL +G+G +A  ++  + N   DAI   ++      K+  +N ++L L      +SD F  +  +  K D I+ NPPYID  D ++     +CEP+ AL A + G         +    L     + FE GF Q + +   L        + ++D +  +R+ +
  S:    71 PIAYIVGVQEFWSLPFRVSPATLIPRPDTEVLVELVLEHFGELDTLHCLDLGTGTGAIALALASEQPNWQIDAIDFSLDA----VKLAKQNAQDLHLSHVNIFQSDWF--NAVNERKFDVIVSNPPYIDALDKHLSQGDVRCEPESALVADEQGLGDIKHIAQQALKFLNTHGSLFFEHGFEQGQAVRNILTALGYDNVQTVRDFNGHERITW 277
>gi|16760668|ref|NP_456285.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Salmonella enterica subsp. enterica serovar Typhi str. CT18] >gi|29141573|ref|NP_804915.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] >gi|25513362|pir||AI0719 HemK protein, probable protoporphyrinogen oxidase hemK [imported] - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) >gi|16502964|emb|CAD02130.1| HemK protein, putative protoporphyrinogen oxidase [Salmonella enterica subsp. enterica serovar Typhi] >gi|29137200|gb|AAO68764.1| HemK protein [Salmonella enterica subsp. enterica serovar Typhi Ty2] (277 aa)
Score = 188, Expect = 1.6e-12, Identities = 52/207 (25%), Positives = 101/207 (48%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLK-TQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNV-DPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           P+ Y+T    F+ L  F+     +PR +TE +++ A+ +   +    ILDL +G+G +A  ++   +  D  V  V++      + ++N  +L ++  + ++S  F       ++ D I+ NPPYID  DP++ +   + EP+ AL A +NG       +     +L  G  ++ E G+ Q E +     ++  T  +  +D    +RV
  S:    67 PIAYLTGLREFWSLPLFVSPATLIPRPDTECLVEQALARLP-VKTCRILDLGTGTGAIA--LALACERPDCEVTAVDRMPDAVALAIRNAEHLAIRNVRILQSCWFSALSG--QQFDMIVSNPPYIDAQDPHLSEGDVRFEPRSALVADENGMADLTHIIDNARQMLTPGGFLLLEHGWRQGEAVRAAFRRSGYTDVETCRDYGGNERV 270
>gi|118474800|ref|YP_891733.1| bifunctional methyltransferase [Campylobacter fetus subsp. fetus 82-40] >gi|118414026|gb|ABK82446.1| bifunctional methyltransferase [Campylobacter fetus subsp. fetus 82-40] (261 aa)
Score = 188, Expect = 1.7e-12, Identities = 69/234 (29%), Positives = 112/234 (47%)
  Q:    51 IFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTE-IIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDR 284
           IF  K+ ++DF   + L  L++  N   P+QYIT+S  F    F + +G  VPR ETE ++   V   K ++   I ++  GSGV++ +++ I KN       + ++   Y    KN     ++ +   +         +   D I+ NPPYI K D  +D     EP QALF  + G       L +I  +  + T+ ++ E+G++QK  +   L K     F+F KDL   DR
  S:    34 IFLHKEDKLDF-VDEFLILLDRYKNGE-PLQYITRSCDFLDYEFEVGRGVLVPRYETEILVQKVVSIAKNLENISICEIGIGSGVISISLAKILKNCKFTATDISEDALKY--ARKNISKFGVQIELFNTSFLDGVEGDF---DIIVSNPPYIAK-DYKLDKWVMSEPSQALFGGEKGD----EILKKIVNLAKDRTKFLVCEMGYDQKASLSNELEKAGFK-FEFYKDLAGFDR 255
>gi|88810846|ref|ZP_01126103.1| HemK protein [Nitrococcus mobilis Nb-231] >gi|88792476|gb|EAR23586.1| HemK protein [Nitrococcus mobilis Nb-231] (283 aa)
Score = 187, Expect = 1.8e-12, Identities = 54/179 (30%), Positives = 86/179 (48%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKL-KTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVD-PSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQ 257
           PV Y+T    F+ L   +     +PR ETE +++ A+     I +  +LDL +GSG +   I+   +  DA V+ V+       V   N R L L + QF+  D   ++ +   +   I+ NPPY+D  +P +   S + EP  AL AP+ G     R +S     L +G  +  E G+ Q
  S:    72 PVAYLTGIREFWSLELRVTPATLIPRPETEGLVEVALASLTGITQPMVLDLGTGSGAVGLAIA--TERPDATVVAVDTCPRALAVARCNARRLGLQRVQFLLGDW--LEPAGERRFHLIVANPPYVDPAEPELRCASLRFEPPTALLAPEQGLAELRRIVSGALTNLHHGGVLAVEHGYRQ 248
>gi|51246577|ref|YP_066461.1| HemK methylase [Desulfotalea psychrophila LSv54] >gi|50877614|emb|CAG37454.1| related to HemK methylase [Desulfotalea psychrophila LSv54] (291 aa)
Score = 187, Expect = 1.8e-12, Identities = 61/211 (28%), Positives = 102/211 (48%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKY--ILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIF-KIDRSHYEKCDFIICNPPYIDKNDPNVDPSTKCEPKQALFAPQ--------NGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIK-----NNITVFKFLKDLDDKDRVLYIK 289
           P+ YI     F+ L F +     +PR ETE+ML+  +       +    +LDLC+GSGV+A  ++   K     V+ V+ +    +V   N     +   FI+SD+F  I+  H  +   I+ NPPY+ +       + + EP+ A + P         +G  F  R   ++   L+ G E+  E G +Q   I     +     ++ T    L+D   +DRVLY +
  S:    69 PLAYILGEQEFWSLDFKVNSHVLIPRPETEFMLEKVLASAGAWRESVTPVLDLCTGSGVIAVVLA---KELGRPVVAVDISEEALQVARFNAHRHHVAINFIRSDLFANIEPLH--QFGLIVSNPPYVSRG----AIAHELEPEVASYEPHLALDGGAGDGLDFIRRMRDDLPKYLSLGGEVFIEFGADQGAAIADLFAEPGSDGSSFTDVHVLQDYARRDRVLYAR 286
>gi|51596332|ref|YP_070523.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Yersinia pseudotuberculosis IP 32953] >gi|170024409|ref|YP_001720914.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Yersinia pseudotuberculosis YPIII] >gi|186895375|ref|YP_001872487.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Yersinia pseudotuberculosis PB1/+] >gi|51589614|emb|CAH21244.1| putative protoporphyrinogen oxidase [Yersinia pseudotuberculosis IP 32953] >gi|169750943|gb|ACA68461.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Yersinia pseudotuberculosis YPIII] >gi|186698401|gb|ACC89030.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Yersinia pseudotuberculosis PB1/+] (276 aa)
Score = 187, Expect = 1.8e-12, Identities = 59/230 (25%), Positives = 105/230 (45%)
  Q:    56 DTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQ-FIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDP-STKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           +TEI  E    L+ L     +  P+ Y+     F+ L   +     +PR +TE +++ A+ +   +  + ILDL +G+G +A  ++   + +D  VI V+ N     +   N + L +    F++   F+     +     I  NPPYID NDP+++    + EP  AL A   G       +S+    L  G  ++ E G+ Q   +++ L  +  +     KD  + DRV
  S:    44 ETEITAEQLLWLETLANRREQGEPIAYLVGEREFWSLPLSVSSATLIPRPDTECLVEQALARLPSMPCR-ILDLGTGTGAIA--LALASERRDCAVIAVDINADAVALARHNAKKLAIDNVCFLQGSWFEPVSGRFA---LIASNPPYIDANDPHLNEGDVRYEPHSALVAAAEGMADLAAIVSQAPGYLEPGGWLMLEHGWQQANAVQERLKNSGFSAVMTCKDYGNNDRV 269
>gi|85709576|ref|ZP_01040641.1| protein chain release factors methylase subunit [Erythrobacter sp. NAP1] >gi|85688286|gb|EAQ28290.1| protein chain release factors methylase subunit [Erythrobacter sp. NAP1] (274 aa)
Score = 187, Expect = 1.9e-12, Identities = 61/206 (29%), Positives = 107/206 (51%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKL---KTQFIKSDIFKIDRSHYE-------KCDFIICNPPYIDKNDPNVDPSTK-CEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDR 284
           PV +IT +  FYG  F +     +PR ++E ++D  ++     + K +LDL +GSG  A  I+ + + + A  +G++ +    ++   N + L L   + +F++ D       H E         D I+CNPPY+++ D  +D   +  EP  ALFA   G   Y   + ++  +L+     + EIG +Q E + K   ++   V K LKDL ++ R
  S:    65 PVAHITGTQEFYGREFAVSPHVLIPRGDSETLIDTVLESAP--NAKRVLDLGTGSG--ALLITTLLELEGASGLGIDASEPALELARSNAQALGLIGSRARFLRRDW------HEEGWDDDLGTFDLIVCNPPYVEE-DAELDADVRDYEPASALFAGPEGLDDYRVIIPQLRKLLSAEGMAVLEIGASQGEAVSKIATEHGFCV-KILKDLANRPR 269
>gi|167564256|ref|ZP_02357172.1| protein hemK [Burkholderia oklahomensis EO147] (288 aa)
Score = 187, Expect = 1.9e-12, Identities = 59/206 (28%), Positives = 99/206 (48%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKT------QFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNV-DPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDR 284
           PV  +T +  F+GL F I     +PR ETE +++ A+     I    +LDL +GSG +A  +S   +  DA V  ++++     V  +N R L          QF++SD +    S   +   I+ NPPYI ++DP++ +   + EP+ AL    +G       ++  +  LA G  +  E G++Q   +   L        + L DL   +R
  S:    71 PVAQLTGAREFFGLEFEITPDVLIPRPETELLVETALDAIDGIASPCVLDLGTGSGAIA--VSIASERPDARVWALDRSAAALDVARRNARKLLAPARPGGPLQFLESDWYAALDSG-RRFHVIVSNPPYIARHDPHLAEGDLRFEPRGALTDDDDGLAAIRAIVAGAHAFLAPGGALWIEHGYDQAAAVRARLEAAGFADVESLADLASIER 280
>gi|194540498|ref|YP_002075537.1| methyltransferase, HemK family [Vibrio sp. Ex25] >gi|151939053|gb|EDN57885.1| methyltransferase, HemK family [Vibrio sp. Ex25] (292 aa)
Score = 187, Expect = 2.0e-12, Identities = 56/203 (27%), Positives = 102/203 (50%)
  Q:    62 EYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQF--IKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPST-KCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKF 264
           E  +I++++ K +N+  P  Y+T    F GL FF+ +   VPR     ++    +   + +   I+DLC+GSG +A  I+      +A V  ++ +    +V  +N ++  ++ Q   I+SD+F+      EK + I+ NPPY+D+ D N  P     EP+  L A  +G     R L+     L +   +I E+G +    +E++
  S:    54 ERLRIVERVVKRINERTPTAYLTNKAWFCGLEFFVDERVLVPRSPIGELIQAEFQPWLVEEPTRIMDLCTGSGCIA--IACAHAFPEAEVDAIDISTDALQVAEQNVQDHGMEQQVFPIRSDLFR--DLPKEKYNLIVSNPPYVDEEDMNSLPDEFTHEPELGLAAGTDGLKLVRRILANAPDYLTDNGILICEVGNSMIHMMEQY 255
>gi|57234022|ref|YP_181924.1| HemK family modification methylase [Dehalococcoides ethenogenes 195] >gi|57224470|gb|AAW39527.1| modification methylase, HemK family [Dehalococcoides ethenogenes 195] (277 aa)
Score = 187, Expect = 2.0e-12, Identities = 53/187 (28%), Positives = 93/187 (49%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQ--FIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFL 265
           P  YIT +  FYG +F + K   +PR ETE++++ A++  +  +  YI D+ +GSG +A T++   + KDA V   + +    +V   N    +L+ +  F + D+ +   S  E  D ++ N PY+   +  +    K EP  AL    +G   Y R +  +   L  G   + EIG +Q E +  ++
  S:    69 PSAYITGAKEFYGRAFQVDKRVLIPRPETEHLIEKALRIARSYESPYIADIGTGSGAIAITLAL--ELKDAYVYATDISAEALEVARNNAAEYRLEKRLMFYRGDLLE---SLPEMVDILMANLPYVPTAEAGL---LKGEPVSALDGGADGLDIYRRLIPVLPGKLRPGGTALLEIGIHQSEVLANYI 249
>gi|157737442|ref|YP_001490125.1| modification methylase [Arcobacter butzleri RM4018] >gi|157699296|gb|ABV67456.1| modification methylase [Arcobacter butzleri RM4018] (277 aa)
Score = 187, Expect = 2.1e-12, Identities = 69/230 (30%), Positives = 124/230 (53%)
  Q:    60 DFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKK---YILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKN--QRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIF---EIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYIK 289
           +F   K L+ L K    N P++YI    SFYG  F +K+G  +PR ETE +++ AV+  K  DKK    +L++ +GSG+++  ++ + +N    +I V+ N    ++  +N  + N+  K  F  S+++  +  + +  +  I NPPYI  ND  +  + K EP  ALF    G       + +      N  +I +   E+G++QK+ +E++  + N+  + F KD ++ DR   +K
  S:    47 EFSKIKELETLVKKRATNYPLEYIIGKASFYGEQFLVKEGVLIPRPETEILVENAVEILK--DKKEPIKVLEIGTGSGIISVMLAMLIENIK--IIAVDINPKAIELAKENAIKHNVLEKIDFRLSNLY--ENVNEDDINLTISNPPYI-ANDYKLPLNVKFEPSNALFGGNLGDELLKDIIKQ-----TNDKKIPYLLCEMGYDQKKSLEEYFKQFNVESYNFYKDYENFDRGFTLK 272
>gi|88608405|ref|YP_506028.1| HemK family modification methylase [Neorickettsia sennetsu str. Miyayama] >gi|88600574|gb|ABD46042.1| modification methylase, HemK family [Neorickettsia sennetsu str. Miyayama] (289 aa)
Score = 187, Expect = 2.2e-12, Identities = 66/216 (30%), Positives = 108/216 (50%)
  Q:    74 LNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQ-KKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYE--------KCDFIICNPPYIDKND-PNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNN--ITVFKFLKDLDDKDRVLYIK 289
           L K+  V  I     F+  SF + K   +PR +TE ML   + + KKL     I++L +GSG +   IS +K+ ++A+  G EK+R  + + + N     L+ +       K+ R  +E        K D I+ NPPY+ + + P +    + EP+ AL    NG   YF  L     IL  G EI  EIG + ++ +    +  N    + +  +DL   +R+L +K
  S:    74 LRKSHSVAAIVGEKEFWKHSFAVNKDVLIPRPDTETMLVALLSRYKKLTQPLKIVELGTGSGCV--IISILKEFRNALGFGFEKSRAAFYLTMHNMLKYGLRARL------KLYRLGFESAMRVLSCKVDVIVSNPPYVRRGEIPYLQLEVQNEPRIALDGGFNGILPYFSILKLASKILRPGGEIFLEIGSSWRDSV----VSANYPFKIVERYRDLSGIERILVLK 289
>gi|29840417|ref|NP_829523.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Chlamydophila caviae GPIC] >gi|29834766|gb|AAP05401.1| modification methylase, HemK family [Chlamydophila caviae GPIC] (283 aa)
Score = 186, Expect = 2.3e-12, Identities = 61/211 (28%), Positives = 94/211 (44%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYI---LDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDP-NVDPSTKC-EPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYIK 289
           P  YI  S  F GL   +     +PR ETE + +  VK   L D  +I    D+C GSG L  +I     N   I+  +        V   N     L  + +  D+F     +    D  +CNPPY+  ++  +VDP  +C EP +AL    +G  FY R  +E+  IL        EIG+ Q   +++      I+     +DL   DR+ +++
  S:    67 PTAYIHGSVHFLGLHLEVDSRVLIPRMETELLAEQIVKY--LSDHPHIQTFYDVCCGSGCLGLSIKKYCPNIQVILSDICSKAV--AVAKTNAFKNNLNVEILNGDLFA---PYSCPGDAFVCNPPYLSFDEILHVDPEVRCHEPWKALVGGSSGLEFYERIANELNTILLPRGVGWLEIGYKQGSSVKRIFANRGIS-GNIYQDLSGCDRIFFLE 274
>gi|16765116|ref|NP_460731.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Salmonella typhimurium LT2] >gi|62180339|ref|YP_216756.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|161613729|ref|YP_001587694.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|167546378|ref|ZP_02341943.1| hypothetical protein Sentent_24011 [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23] >gi|167559147|ref|ZP_02352155.1| hypothetical protein Sententeri_20169 [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853] >gi|167993218|ref|ZP_02574313.1| hypothetical protein Sententer_01000022_0100017315 [Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701] >gi|168237829|ref|ZP_02662887.1| hypothetical protein Senteenterica_16701 [Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480] >gi|168820513|ref|ZP_02832513.1| hypothetical protein Salentericaenterica_14096 [Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537] >gi|194443667|ref|YP_002041025.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194735200|ref|YP_002114805.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|17865746|sp|P40816|HEMK_SALTY Protein methyltransferase hemK (Protein-glutamine N-methyltransferase hemK) (Protein-(glutamine-N(5)) MTase hemK) (M.StyLTHemKP) >gi|16420305|gb|AAL20690.1| putative protoporphyrinogen oxidase [Salmonella typhimurium LT2] >gi|62127972|gb|AAX65675.1| putative protoporphyrinogen oxidase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|161363093|gb|ABX66861.1| hypothetical protein SPAB_01454 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|194402330|gb|ACF62552.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194710702|gb|ACF89923.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] (277 aa)
Score = 186, Expect = 2.4e-12, Identities = 51/207 (24%), Positives = 101/207 (48%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLK-TQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNV-DPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           P+ Y+T    F+ L  F+     +PR +TE +++ A+ +   +    ILDL +G+G +A  ++   +  D  V  V++      + ++N  +L ++  + ++S  F       ++ D I+ NPPYID  DP++ +   + EP+ AL A +NG       +     +L  G  ++ E G+ Q E +     ++  +  +  +D    +RV
  S:    67 PIAYLTGLREFWSLPLFVSPATLIPRPDTECLVEQALARLP-VKTCRILDLGTGTGAIA--LALACERPDCEVTAVDRMPDAVALAIRNAEHLAIRNVRILQSCWFSALSG--QQFDMIVSNPPYIDAQDPHLSEGDVRFEPRSALVADENGMADLTHIIDNARQMLTPGGFLLLEHGWQQGEAVRAVFRRSGYSDVETCRDYGGNERV 270
>gi|169838091|ref|ZP_02871279.1| Methyltransferase [candidate division TM7 single-cell isolate TM7a] (268 aa)
Score = 186, Expect = 2.4e-12, Identities = 62/182 (34%), Positives = 106/182 (58%)
  Q:    55 KDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAV---KQKKLIDKKY--ILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKT-QFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNV--DPSTKCEPKQALFAPQNGYYFYFRFL 236
           +D   D E +KI   + K+  +  PVQY+     FYG  F++ KG  +PRQ+TE +++  +   K K L ++ +  ILD+  GSG++  T +   + + + V+GV+ +    +   KN+  LK+   +F+KSD+F  +   + + D I+ NPPYI  N+  +  D +   EP +ALFA  +G YF  +F+
  S:    44 RDDIEDEEIEKIRYFIQKIGREKFPVQYLLNEQEFYGRKFYVDKGVLIPRQDTEILVEKMIDILKDKVLKNEIHPKILDIGVGSGIIGITAAL--EIESSYVLGVDISDKALETAQKNKEILKVSNIKFLKSDLF--ENVEFREFDMIVSNPPYISLNEVGIMSDDTLLHEPSEALFAENDGLYFIMKFV 229
>gi|149914650|ref|ZP_01903180.1| modification methylase, HemK family, putative [Roseobacter sp. AzwK-3b] >gi|149811443|gb|EDM71278.1| modification methylase, HemK family, putative [Roseobacter sp. AzwK-3b] (278 aa)
Score = 186, Expect = 2.5e-12, Identities = 58/208 (27%), Positives = 97/208 (46%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKL--KTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKND-PNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVL 286
           P+ ++     FYG  F +      PR ETE +++ A+     +    +LDL +GSG +   +S + +  DA  +GV+ +    +V  +N   L L  + +F+ SD F   R  +   D I+ NPPYI  ++   +    + EP+ AL     G   Y   ++E    L  G  +I EIG+ Q  ++   +            DLD +DRV+
  S:    71 PMAHLLGYREFYGRRFAVDARVLDPRPETETLVERALA----VAFSRVLDLGTGSGCI--LLSLLAERPDATGVGVDLSEDALEVARRNAARLDLSARCEFLVSDWFAAVRGTF---DLIVSNPPYIAADEMAGLARELQYEPRMALTDEGCGLSAYRAIVAEAGACLVEGGRLIVEIGWRQGADVADLMRAGGFAEVCVRPDLDGRDRVV 272
>gi|91223592|ref|ZP_01258857.1| putative adenine-specific methylase [Vibrio alginolyticus 12G01] >gi|91191678|gb|EAS77942.1| putative adenine-specific methylase [Vibrio alginolyticus 12G01] (310 aa)
Score = 186, Expect = 2.5e-12, Identities = 56/203 (27%), Positives = 102/203 (50%)
  Q:    62 EYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQF--IKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPST-KCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKF 264
           E  +I++++ K +N+  P  Y+T    F GL FF+ +   VPR     ++    +   + +   I+DLC+GSG +A  I+      +A V  ++ +    +V  +N ++  ++ Q   I+SD+F+      EK + I+ NPPY+D+ D N  P     EP+  L A  +G     R L+     L +   +I E+G +    +E++
  S:    72 ERLRIVERVVKRINERTPTAYLTNKAWFCGLEFFVDERVLVPRSPIGELIQAEFQPWLVEEPTRIMDLCTGSGCIA--IACAHAFPEAEVDAIDISTDALQVAEQNVQDHGMEQQVFPIRSDLFR--DLPKEKYNLIVSNPPYVDEEDMNSLPDEFTHEPELGLAAGTDGLKLVRRILANAPDYLTDNGILICEVGNSMIHMMEQY 273
>gi|27904664|ref|NP_777790.1| hypothetical protein bbp162 [Buchnera aphidicola str. Bp (Baizongia pistaciae)] >gi|32129595|sp|Q89AT0|HEMK_BUCBP Protein hemK homolog >gi|27904061|gb|AAO26895.1| HemK [Buchnera aphidicola str. Bp (Baizongia pistaciae)] (277 aa)
Score = 186, Expect = 2.6e-12, Identities = 63/219 (28%), Positives = 108/219 (49%)
  Q:    67 LKQLNKVLNKNI---PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKT-QFIKSDIF-KIDRSHYEKCDFIICNPPYIDKND-PNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           L  LN +L + +   P+ Y+     F+ L F +     +PR +TE +++ A+   K +    +LDL +G G +A  ++   +  D  +IG++  +    +  KN + LKLK   F+ S  F K+D       D I+ NPPY+  ++  NVD     EP  ALF+ +NG       +      L +   ++ E G+ QK++++ F  K +       +D  D DRV
  S:    53 LIDLNVLLQRRMNSEPISYLIHVKEFWSLPFLVSNSTLIPRPDTEILVEKALIYLKNLSNAKVLDLGTGCGSIA--LALASERLDCKIIGIDCVKESISIASKNAKILKLKNVSFLHSIWFSKVDNMF----DMIVSNPPYLSFSEMKNVDKEVLFEPFIALFSSENGLGAIRHIIKYSKKYLYSKAWLLVEHGWKQKDKVQSFFYKYSFININTYRDYCDSDRV 271
>gi|152992202|ref|YP_001357923.1| protoporphyrinogen oxidase [Sulfurovum sp. NBC37-1] >gi|151424063|dbj|BAF71566.1| protoporphyrinogen oxidase [Sulfurovum sp. NBC37-1] (282 aa)
Score = 186, Expect = 2.7e-12, Identities = 65/213 (30%), Positives = 102/213 (47%)
  Q:    77 NIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWA---VKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTE-IIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYIK 289
           N P +YI  S SFY L   ++KG  VPR ETE ++D     ++++K+     I ++  GSG +  +I   +K  +  ++  + +  P KV  KN     L+ Q        ID    E+ + ++ NPPYI +           EPK+ALF  + G     +    I  +   G   +  E+G++QKE I  F+ +  +   KF KDL   DR   IK
  S:    73 NEPYEYIVGSASFYDLHLEVEKGVLVPRPETEILIDLVAGIIEEEKI---SRIAEIGVGSGAI--SIVLARKFPELNIVATDISEIPIKVARKNIETFGLEKQIELRRSNLIDEVD-ERVELVVSNPPYIAEGFLLESNVVDYEPKEALFGGRVGDELLKQI---ILDVKEKGIRWLACEMGYDQKEPIASFVKEIGVQSIKFYKDLVGFDRGFIIK 280
>gi|167856506|ref|ZP_02479219.1| hypothetical adenine-specific methylase [Haemophilus parasuis 29755] >gi|167852370|gb|EDS23671.1| hypothetical adenine-specific methylase [Haemophilus parasuis 29755] (314 aa)
Score = 186, Expect = 2.7e-12, Identities = 57/203 (28%), Positives = 101/203 (49%)
  Q:    62 EYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKN--QRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPST-KCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKF 264
           E ++I++ + + L    PV Y+T S  F GL F++ +   VPR     ++          + K ILD+C+GSG +A  I+   K  +A +  V+ +     V   N  + N+  +    +SD+F  D    ++ D I+ NPPY+D+ D +  P     EP+ AL +  +G     R L++    L++   ++ E+G +    IE+F
  S:    80 EKERIIEMVEQRLGLRKPVAYLTNSAWFSGLEFYVDERVIVPRSPIGELIQQGFTGILRAEPKRILDMCTGSGCIA--IACADKFPNAEIDAVDLSVDALNVAEINIERHNMAHRVFPFQSDLF--DDLPQDRYDLIVTNPPYVDQEDLDDMPEEFHHEPEMALGSGVDGLDITKRILAQAADFLSDNGVLVCEVGNSMVHLIEQF 281
>gi|168478291|ref|ZP_02707314.1| hypothetical protein Salmoentericaenterica_26896 [Salmonella enterica subsp. enterica serovar Virchow str. SL491] (277 aa)
Score = 186, Expect = 2.7e-12, Identities = 51/207 (24%), Positives = 101/207 (48%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLK-TQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNV-DPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           P+ Y+T    F+ L  F+     +PR +TE +++ A+ +   +    ILDL +G+G +A  ++   +  D  V  V++      + ++N  +L ++  + ++S  F       ++ D I+ NPPYID  DP++ +   + EP+ AL A +NG       +     +L  G  ++ E G+ Q E +     ++  +  +  +D    +RV
  S:    67 PIAYLTGLREFWSLPLFVSPATLIPRPDTECLVEQALARLP-VKTCRILDLGTGTGAIA--LALACERPDCEVTAVDRMPDAVALAIRNAEHLAIRNVRILQSCWFSALSG--QQFDMIVSNPPYIDAQDPHLSEGDVRFEPRSALVADENGMADLTHIIDNARQMLTPGGFLLLEHGWRQGEAVRAVFRRSGYSDVETCRDYGGNERV 270
>gi|168260000|ref|ZP_02681973.1| hypothetical protein Salmentericaenterica_02810 [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] (277 aa)
Score = 186, Expect = 2.7e-12, Identities = 52/207 (25%), Positives = 100/207 (48%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLK-TQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNV-DPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           P+ Y+T    F+ L  F+     +PR +TE +++ A+ +   +    ILDL +G+G +A  ++   +  D  V  V++      + ++N  +L ++  + ++S  F       ++ D I+ NPPYID  DP++ +   + EP+ AL A +NG       +     +L  G  ++ E G+ Q E +     +   T  +  +D    +RV
  S:    67 PIAYLTGLREFWSLPLFVSPATLIPRPDTECLVEQALARLP-VKTCRILDLGTGTGAIA--LALACERPDCEVTAVDRMPDAVALAIRNAEHLAIRNVRILQSCWFSALSG--QQFDMIVSNPPYIDAQDPHLSEGDVRFEPRSALVADENGMADLTHIIDNARQMLTPGGFLLLEHGWQQGEAVRAVFRRFGYTDVETCRDYGGNERV 270
>gi|50121993|ref|YP_051160.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Pectobacterium atrosepticum SCRI1043] >gi|49612519|emb|CAG75969.1| conserved hypothetical protein [Erwinia carotovora subsp. atroseptica SCRI1043] (310 aa)
Score = 186, Expect = 2.7e-12, Identities = 67/242 (27%), Positives = 124/242 (51%)
  Q:    23 NPLDDSQIKWILKELILFNSKIIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKN--QRNLKLKTQFIKSDIFK-IDRSHYEKCDFIICNPPYIDKNDPNVDPST-KCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKF 264
           NP D++ I+ +L  L L     ++   D++  +   I  E ++I++++ + +N+ IPV Y+T    F GL F++ +   VPR     +++    ++       ILDLC+GSG +A  I+  +   +A V  V+ +     V  +N  Q  L+ +   I+SD+F+ +    Y   D I+ NPPY+D+ D +  P   + EP+  L A  +G     R L+     L++   +I E+G +    I+++
  S:    40 NPWDEA-IQLVLPSLYL----PLDIPEDMYTSR--LITSERQRIVERVIRRVNERIPVAYLTNKAWFCGLEFYVDERVLVPRSPIGELINNYFDEQLPKVPNLILDLCTGSGCIA--IACAQAFPEAEVDAVDISSDALAVTEQNIQQHELEYRVTPIRSDLFRDLPAIRY---DLIVTNPPYVDEEDMSDLPQEFRFEPELGLAAGNDGLDLVRRILACAPDYLSDDGVLICEVGNSMVHLIDQY 273
>gi|189462017|ref|ZP_03010802.1| hypothetical protein BACCOP_02689 [Bacteroides coprocola DSM 17136] >gi|189431231|gb|EDV00216.1| hypothetical protein BACCOP_02689 [Bacteroides coprocola DSM 17136] (280 aa)
Score = 186, Expect = 2.8e-12, Identities = 66/256 (25%), Positives = 118/256 (46%)
  Q:    31 KWILKELILFNSKIIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYI-DKNDPNVDPST-KCEPKQALFAPQNGYYFYFRFLSEI-YPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVL 286
           KWIL ++   ++  +    D+ F K+ E D   + IL +L +      P+QYI     F GL F +  G  +PR ET  ++DW +          ILD+ +GSG +   +   KK K + +   + +     +  +N+   ++     + DIF          D ++ NPPYI +K    ++ +    EP+ ALF P +    ++R ++E+   IL +G  + +EI     +E  + L        +  KD+   DR++
  S:    26 KWILTDVFCLSTTELYAGKDMNFSKN-ECD-RLEDILSRLKRYE----PLQYILGKVDFCGLPFEVAPGALIPRPETAELIDWIISDYTDKAGVRILDVGTGSGCIPIVLG--KKLKQSKITSWDVSEKALDIARRNKLLNQVDITLAQVDIFDTALPDIH-VDVLVSNPPYITEKERSGMERNVLDWEPELALFVPDSDPLLFYRRIAEVGCDILVSGGTLYYEINRAYGKETVQLLEGMGYQSVELRKDMFGNDRMI 275
>gi|152997600|ref|YP_001342435.1| HemK family modification methylase [Marinomonas sp. MWYL1] >gi|150838524|gb|ABR72500.1| modification methylase, HemK family [Marinomonas sp. MWYL1] (282 aa)
Score = 186, Expect = 2.9e-12, Identities = 57/207 (27%), Positives = 97/207 (46%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQ-RNLKLKTQFIKSDIFKIDRSHYEKC---DFIICNPPYIDKNDPNVDP-STKCEPKQALFAPQNGYYFYFRFLSEIYP-ILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           PV Y+    +F+ L   +     +PR +TE +++ A+    +     ILDL +G+G +A  +S   +   + V+GV+       +  +N  RN      F++S  F       E C   D I+ NPPYID +D ++     + EPK AL A  +G       + E+ P  +     ++FE G++Q   + K  I+      +  +D    DRV
  S:    68 PVAYLLGQQAFWNLDLEVAPCTLIPRADTERLVEVALSVLDISKVNRILDLGTGTGAIA--LSLASEQPKSTVMGVDLVEDAVALAKRNALRNKLSNVDFLQSSWF----DALEGCEPFDLIVSNPPYIDPDDEHLSQGDVRFEPKSALVADNHGMA-DIEHIIEVAPKFMQQNAYLMFEHGYDQAASVRKCFIEAGFAAVESFQDFGGNDRV 273
>gi|88704042|ref|ZP_01101757.1| protoporphyrinogen oxidase [gamma proteobacterium KT 71] >gi|88701869|gb|EAQ98973.1| protoporphyrinogen oxidase [Congregibacter litoralis KT71] (280 aa)
Score = 185, Expect = 3.1e-12, Identities = 60/230 (26%), Positives = 104/230 (45%)
  Q:    56 DTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLK-TQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPST-KCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           D E++    +  + L       IPV Y+     F+ L+  +     +PR +TE +++ A+K   L     +LDL +GSG +A  ++   +     + GVE +    ++   N + L LK   F +SD F   R   ++ D I+ NPPYI ++D ++     + EP+ AL +  +G       ++E    L     ++ E GF Q   +   L     T     +DL   +RV
  S:    43 DAEVEASAAEHYRHLLAQRASGIPVAYLLGEREFWSLTLRVNDATLIPRPDTELLVEQALKL-DLSPGASVLDLGTGSGAIA--LALASERPRWQITGVEHSPEALEIARTNGKRLGLKDVAFHRSDWFTAVRG--QRFDLIVSNPPYIAESDGHLSSGDLRFEPRSALVSGADGLDDIRHIIAEAPTWLEPRGRLLLEHGFEQGSTVRALLSTRGFTAVASAEDLAGHERV 269
>gi|170017815|ref|YP_001728734.1| methylase of polypeptide chain release factor [Leuconostoc citreum KM20] >gi|169804672|gb|ACA83290.1| Methylase of polypeptide chain release factor [Leuconostoc citreum KM20] (332 aa)
Score = 185, Expect = 3.1e-12, Identities = 62/208 (29%), Positives = 100/208 (48%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLI--DKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKT-QFIKSDIFK--IDRSHYEKCDFIICNPPYIDKNDPN-VDPST-KCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEI----EKFLIKNNITVFKFLKDLDDKDRVL 286
           P QYI     FYG  F + +   +PR ETE ++ W +        +   +LD+ +GSG +  T+  + +N        + +     V   N + L +K  +F++SD+F    D     + D I+ NPPYI  +D + +D S    EP  ALFA   G   Y +    +   L       FEIG+ Q +++    +K L K  +T+ +    LD   RV+
  S:   118 PPQYILGHAPFYGREFIVDERVLIPRPETEQLVAWILADASGTTGESVSVLDIGTGSGAIIETL--MLENPRVRGFAADISSDALTVAALNAQQLNIKQLRFVESDVFSGLADL----RFDLIVSNPPYIASSDEDEMDASVLTYEPHDALFADNQGLAIYQKIAEGLAAHLTPQGRAYFEIGYKQGQQVVDIMQKALPKATVTLKQDFAGLDRMVRVV 330
>gi|168241357|ref|ZP_02666289.1| hypothetical protein Senterienterica_06991 [Salmonella enterica subsp. enterica serovar Heidelberg str. SL486] >gi|194447419|ref|YP_002045818.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194405723|gb|ACF65942.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] (277 aa)
Score = 185, Expect = 3.1e-12, Identities = 52/207 (25%), Positives = 100/207 (48%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLK-TQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNV-DPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           P+ Y+T    F+ L  F+     +PR +TE +++ A+ +   +    ILDL +G+G +A  ++   +  D  V  V++      + ++N  +L ++  + ++S  F       ++ D I+ NPPYID  DP++ +   + EP+ AL A +NG       +     +L  G  ++ E G+ Q E +     +   T  +  +D    +RV
  S:    67 PIAYLTGLREFWSLPLFVSPATLIPRPDTECLVEQALARLP-VKTCRILDLGTGTGAIA--LALACERPDCEVTAVDRMPDAVALAIRNAEHLAIRNVRILQSCWFSALSG--QQFDMIVSNPPYIDAQDPHLSEGDVRFEPRSALVADENGMADLTHIIDNARQMLTPGGFLLLEHGWRQGEAVRAVFRRFGYTDVETCRDYGGNERV 270
>gi|15828577|ref|NP_325937.1| protoporphirogen oxidase HEMK [Mycoplasma pulmonis UAB CTIP] >gi|14089519|emb|CAC13279.1| PROTOPORPHIROGEN OXIDASE HEMK [Mycoplasma pulmonis] (230 aa)
Score = 185, Expect = 3.1e-12, Identities = 75/225 (33%), Positives = 119/225 (52%)
  Q:    65 KILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIV-IGVEKNRTPYK-VGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPSTKC-EPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYIK 289
           KI ++  ++L KN+PVQ I        +   I     +PR ETE ++   + +  L D   +LDLC+GSG +   +S +KK    +  I +E  +   K V + N +N K+    I+SD+F+  +  +   D I+ NPPY+   +  +D S K  EP +AL+AP+NG+YFY + + +    L     + FEI    K   E FL KN    FK +KD++ K+R  + K
  S:    19 KISQKEKRLLKKNMPVQKIIGYIEMANVKIDICHKVLIPRYETEELI--FLVKDFLKDDMKVLDLCAGSGFIGIALSKMKKIDLTLSDISLEAIKQIEKNVKINNVKNYKI----IQSDLFENIQGDF---DIIVSNPPYLSY-EQKIDKSVKFFEPLKALYAPKNGWYFYEKIIEKASSFLKKDGMLFFEINPLHK---ELFLEKN----FKVIKDINGKNRFAFKK 229
>gi|149372324|ref|ZP_01891512.1| putative protoporphyrinogen oxidase [unidentified eubacterium SCB49] >gi|149354714|gb|EDM43277.1| putative protoporphyrinogen oxidase [unidentified eubacterium SCB49] (282 aa)
Score = 185, Expect = 3.1e-12, Identities = 73/278 (26%), Positives = 136/278 (48%)
  Q:     9 QKSSMTFSELTKRLNPLDD-SQIKWILKELIL-FNS-KIIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWA-VKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPST--KCEPKQALFAPQNGYYFYFRFLSEI-YPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVL 286
           ++  + F+E+ K   PL++ +   ++L E    FN  +  +  +D+F         E+++ + +  + L  + P+QYI    +FYGL F + +   +PR ETE +++W  V+     D K ILD+ +GSG +A  +S  K+   A V   + +    KV  +N    K++ +F   DI  +D    +  D I+ NPPY+   +  +  +   + EP  ALF        ++R ++ + +  L     + FEI     EE++  + +         KD+  KDR++
  S:     4 KEQRLAFAEILKSHYPLEEINSFFYLLTEHYFGFNKFETHQKGADVF-------PVEHEQHISEAIQRLLLHEPIQYIIGETAFYGLPFKVDRHTLIPRPETEELVEWILVEAANNEDDKEILDIGTGSGCIA--VSLAKEFDKAQVSAYDISEGALKVAQENALTNKVEVRFKNVDILALDELE-QSFDVIVSNPPYVRDLEKKMMQANVLEHEPATALFVSDTDPLIFYRKIAALAFKSLKKNGLLYFEINEYLGEEMKVLMKEMGFNNCIIKKDIYGKDRMM 278
>gi|150026062|ref|YP_001296888.1| methylase of polypeptide chain release factors [Flavobacterium psychrophilum JIP02/86] >gi|149772603|emb|CAL44086.1| Methylase of polypeptide chain release factors [Flavobacterium psychrophilum JIP02/86] (285 aa)
Score = 185, Expect = 3.3e-12, Identities = 68/239 (28%), Positives = 122/239 (51%)
  Q:    50 DIFFEKDTEID----FEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLID---KKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYI---DKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPI-LANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYI 288
           D+    D ++D     +++ +L QL +      P+QYI     F+GL F++ +   +PR ETE +++W +K+   I       ILD+ +GSG +A  IS  K   +A V  ++ +        KN    ++   FI+ +I + +  + E  D I+ NPPY+   +K + + +   + EP  ALF   N    ++R ++E+    L+N  ++ FEI     +E  + L K N       KD+   DR++ +
  S:    41 DLVLSPDLKLDNIQLLQWETVLLQLKE----QKPIQYILGETQFFGLPFYVNENTLIPRPETEELVEWIIKENLKISSLKNLKILDIGTGSGCIA--ISLAKNLPNASVFAIDVSDKALATAQKNAVLNEVDITFIEKNILQTEDLNQE-FDIIVSNPPYVRNLEKKEIHKN-VLEYEPHLALFVEDNDSLLFYRKITELATRNLSNNGQLYFEINQYLGKETVELLEKYNFKNTTLKKDIYGNDRMIKV 282
>gi|15642117|ref|NP_231749.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Vibrio cholerae O1 biovar eltor str. N16961] >gi|121586816|ref|ZP_01676598.1| adenine-specific methylase, putative [Vibrio cholerae 2740-80] >gi|121727216|ref|ZP_01680383.1| adenine-specific methylase, putative [Vibrio cholerae V52] >gi|147673603|ref|YP_001217639.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Vibrio cholerae O395] >gi|153213246|ref|ZP_01948658.1| adenine-specific methylase, putative [Vibrio cholerae 1587] >gi|153223620|ref|ZP_01953974.1| adenine-specific methylase, putative [Vibrio cholerae MAK 757] >gi|153803027|ref|ZP_01957613.1| adenine-specific methylase, putative [Vibrio cholerae MZO-3] >gi|153818977|ref|ZP_01971644.1| adenine-specific methylase, putative [Vibrio cholerae NCTC 8457] >gi|153822882|ref|ZP_01975549.1| adenine-specific methylase, putative [Vibrio cholerae B33] >gi|153825591|ref|ZP_01978258.1| adenine-specific methylase, putative [Vibrio cholerae MZO-2] >gi|153828601|ref|ZP_01981268.1| putative adenine-specific methylase [Vibrio cholerae 623-39] >gi|194532057|ref|YP_002067491.1| adenine-specific methylase, putative [Vibrio cholerae MO10] >gi|18203198|sp|Q9KQ83|Y2118_VIBCH Uncharacterized adenine-specific methylase VC_2118 >gi|9656668|gb|AAF95263.1| adenine-specific methylase, putative [Vibrio cholerae O1 biovar El Tor str. N16961] >gi|121548983|gb|EAX59022.1| adenine-specific methylase, putative [Vibrio cholerae 2740-80] >gi|121630461|gb|EAX62854.1| adenine-specific methylase, putative [Vibrio cholerae V52] >gi|124116046|gb|EAY34866.1| adenine-specific methylase, putative [Vibrio cholerae 1587] >gi|124118086|gb|EAY36829.1| adenine-specific methylase, putative [Vibrio cholerae MAK 757] >gi|124121425|gb|EAY40168.1| adenine-specific methylase, putative [Vibrio cholerae MZO-3] >gi|125618011|gb|EAZ46558.1| adenine-specific methylase, putative [Vibrio cholerae MO10] >gi|125621105|gb|EAZ49450.1| adenine-specific methylase, putative [Vibrio cholerae V51] >gi|126510472|gb|EAZ73066.1| adenine-specific methylase, putative [Vibrio cholerae NCTC 8457] >gi|126519578|gb|EAZ76801.1| adenine-specific methylase, putative [Vibrio cholerae B33] >gi|146315486|gb|ABQ20025.1| putative adenine-specific methylase [Vibrio cholerae O395] >gi|148875872|gb|EDL74007.1| putative adenine-specific methylase [Vibrio cholerae 623-39] >gi|149740742|gb|EDM54841.1| adenine-specific methylase, putative [Vibrio cholerae MZO-2] >gi|150422684|gb|EDN14638.1| adenine-specific methylase, putative [Vibrio cholerae AM-19226] (314 aa)
Score = 185, Expect = 3.6e-12, Identities = 59/203 (29%), Positives = 102/203 (50%)
  Q:    62 EYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTI--SYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQF--IKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPST-KCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKF 264
           E  ++++++ K +N   PV Y+T    F GL FF+     VPR     ++    +     +   I+DLC+GSG +A     ++ +   DAI I V+       V  +N ++  L+ Q   I+SD+F+ D    E+ D I+ NPPY+D+ D +  PS  + EP+  L A  +G     R L+     L     ++ E+G +    +E++
  S:    76 ERLRVVERVIKRINDRTPVAYLTNKAWFCGLEFFVDSRVLVPRSPIGELIQNRFEPWLTEEPTRIMDLCTGSGCIAIACANAFPEAEVDAIDISVDA----LNVAEQNIQDHGLEQQVFPIRSDLFR-DLPQ-EQYDLIVTNPPYVDQEDMDSLPSEFRHEPELGLAAGSDGLKLARRILANAPLYLKENGILVCEVGNSMVHMMEQY 277
>gi|15602421|ref|NP_245493.1| hypothetical protein PM0556 [Pasteurella multocida subsp. multocida str. Pm70] >gi|18202825|sp|Q9CN82|HEMK_PASMU Protein hemK homolog (M.PmuHemKP) >gi|12720822|gb|AAK02640.1| HemK [Pasteurella multocida subsp. multocida str. Pm70] (298 aa)
Score = 185, Expect = 3.7e-12, Identities = 68/219 (31%), Positives = 112/219 (51%)
  Q:    67 LKQLNKVL---NKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYM----LDWA---VKQKKLIDKKYILDLCSGSGVLANTISYI------KKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYE-KCDFIICNPPYIDKNDPNVDP-STKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           L+QL ++L    K  P+ YI    +F+ LS  + +   +PR +TE +    LD+A   V    +  +  ILDL +G+G +A  ++        K   +  ++GV++      +   N +  +LK  F++S  F  D  + E + D I+ NPPYIDKNDP++     + EP  AL A + GY      + +    L     ++ E G+ Q E++     KN       LKD    +RV
  S:    58 LQQLAQLLMRRAKGEPIAYILGEKAFWSLSLKVSEHTLIPRPDTEVLVEHALDFAKQRVTSAHVSGELSILDLGTGTGAIALALAAELTPLTQKCGINLNILGVDRIAEAVALAKDNAKQNELKVNFLQSVWF--DALNPEIRFDLIVSNPPYIDKNDPHLTQGDVRFEPLSALVAAEEGYADIRHIIEQAPLFLKPQGALLLEHGWQQAEKVRSIFQKNLWHNVATLKDYSGNERV 292
>gi|153834410|ref|ZP_01987077.1| hypothetical adenine-specific methylase YfcB [Vibrio harveyi HY01] >gi|148869181|gb|EDL68209.1| hypothetical adenine-specific methylase YfcB [Vibrio harveyi HY01] (310 aa)
Score = 185, Expect = 3.8e-12, Identities = 55/203 (27%), Positives = 102/203 (50%)
  Q:    62 EYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQF--IKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPST-KCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKF 264
           E  +I++++ K +N+  P  Y+T    F GL FF+ +   VPR     ++    +   + +   I+DLC+GSG +A  I+      +A V  ++ +    +V  +N ++  ++ Q   I+SD+F+      EK + I+ NPPY+D+ D N  P     EP+  L A  +G     R L+     L +   ++ E+G +    +E++
  S:    72 ERLRIVERVVKRINERTPTAYLTNKAWFCGLEFFVDERVLVPRSPIGELIQAEFQPWLVEEPTRIMDLCTGSGCIA--IACAHAFPEAEVDAIDISTDALQVAEQNVQDHGMEQQVFPIRSDLFR--DLPKEKYNLIVSNPPYVDEEDMNSLPDEFTHEPELGLAAGTDGLKLVRRILANAPDYLTDDGILVCEVGNSMVHMMEQY 273
>gi|149174662|ref|ZP_01853287.1| hemK protein [Planctomyces maris DSM 8797] >gi|148846356|gb|EDL60694.1| hemK protein [Planctomyces maris DSM 8797] (309 aa)
Score = 185, Expect = 3.8e-12, Identities = 65/248 (26%), Positives = 118/248 (47%)
  Q:    43 KIIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKL--KTQFIKSDIFKIDRSHYEKCDFIICNPPYI-DKNDPNVDPSTKC-EPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEE-IEKFLIKNNITVFKFLKDLDDKDRVLYIKK 290
           ++  N  D+  E++       + +++QL +    + PV Y+  +  F+GL F++ K   VPR +TE ++   V + + +   +ILDLC+GSG +A  IS      +A     + +     +  KN  + +L  + QF+ SD F+         D I+ NPPYI D     ++   +  EP+ AL   ++G  FY + + E    L +   ++ E    Q+ + +  F      T  +   DL  + RV+  +K
  S:    62 RLYTNYEDVVTEQE-------RALMRQLVQRRANSEPVAYLVGNREFFGLDFYVDKNVLVPRPDTETLVIELVDEAQKLTNPFILDLCTGSGCIA--ISAAANCHNAKFQATDISEPALAIAQKNAASNELSNQIQFLLSDCFE-QIPPGTLFDIIVSNPPYIPDAEIEQLEKDVRQHEPRLALSGGKDGLDFYRKIIQEAGRYLKDQGLLMLEFSPEQEADLLALFKATGEYTNVRVKADLAGRARVIIGQK 304
>gi|165977489|ref|YP_001653082.1| protein-glutamine N-methyl transferase [Actinobacillus pleuropneumoniae serovar 3 str. JL03] >gi|165877590|gb|ABY70638.1| protein-glutamine N-methyl transferase [Actinobacillus pleuropneumoniae serovar 3 str. JL03] (320 aa)
Score = 184, Expect = 4.2e-12, Identities = 72/264 (27%), Positives = 126/264 (47%)
  Q:    22 LNPLDDSQIKWILKELILFNSKIIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNI---PVQYITKSFSFYGLSFFIKKGCFVPRQETEYM----LDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKT-QFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVD-PSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGT-------EIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           LNP  D+ +        L  +      S IF   +T +   ++  L +L ++L + +   P+ YI     F+ L   +     +PR +TE +    LDW  K+ +      ILDL +G+G +A  ++    +K A +IGV+       +   N++NL  +  +F++SD F    +   + D I+ NPPYID+ D N+     + EP  AL A Q+G       LS++  I+ N          +I E G+ Q + +++   +         +D    DR+
  S:    48 LNPKTDANL--------LLQAVTKRTKSAIFAFGETAL---HQTELAELAQLLARRLQGEPMAYILGEKEFWSLPLKVSPHTLIPRPDTERLVEVALDWVYKRLESQQTLQILDLGTGTGAIALALASELGDK-AQIIGVDFKLEAVTLAETNRQNLGFENVRFLQSDWFSALEN--RQFDLIVSNPPYIDQQDENLQYGDVRFEPLSALVAEQDG-------LSDLQKIIQNAPLHLNDNGALILEHGWQQAQAVQQIFQQYQWDEIASFQDYGGNDRL 306
>gi|90407673|ref|ZP_01215853.1| Methylase of polypeptide chain release factor [Psychromonas sp. CNPT3] >gi|90311264|gb|EAS39369.1| Methylase of polypeptide chain release factor [Psychromonas sp. CNPT3] (277 aa)
Score = 184, Expect = 4.2e-12, Identities = 55/200 (27%), Positives = 97/200 (48%)
  Q:    76 KNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKL-KTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNV-DPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKF 275
           K +PV Y+T +  F+ L F +     +PR +TE ++++A++        +ILDL +G+G +   ++   +   A    V+ N    ++ ++N++ LKL      +SD F      +   D I+ NPPYIDK D ++ +   + EP  AL A   G       +S+    L     ++ E GF Q E      ++N   +F+F
  S:    64 KGVPVAYLTGTREFWSLPFKVNASTLIPRADTETLVEYALQVCS--PNSHILDLGTGTGAI--ILALASELPHAQCSAVDFNADAVQLAIENRQALKLDNVNIYQSDWFSQVHGRF---DLIVSNPPYIDKEDHHLAEGDVRFEPLSALVADDKGLADIHLIVSQARLYLKTNGTLMIEHGFEQGEA-----VRNIFRLFEF 253
>gi|151572643|gb|EDN38297.1| modification methylase [Francisella tularensis subsp. novicida GA99-3548] (284 aa)
Score = 184, Expect = 4.2e-12, Identities = 71/234 (30%), Positives = 115/234 (49%)
  Q:    51 IFFEKDTEIDFEYKKILKQLNKVLNKNI---PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKY-ILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKN-QRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPSTK-CEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDR 284
           ++   D ++D   K  LK++++ + + +   P+ YI     F+    ++ K   +PR +TE ++   +   +  D +  ILDL +G+G +A  ++    N    V+ V+  +    V  KN Q N     +FI+S  +       +K D I+ NPPYID  D N+D S K  EP +ALFA  NG       +S+    L     I  E GF Q + I     + N T  K +KDL++ DR
  S:    43 LYINSDKQLD---KNTLKKIDEKILRLLAGEPLAYILGYKYFWNQKLYVTKDTLIPRADTETVVATVLDDIQNKDAQLKILDLGTGTGAIALALAAELANSQ--VVAVDLYQQSLDVAKKNAQANNITNVKFIQSSWYT--NLDTDKFDIIVSNPPYIDLADTNIDQSVKDYEPARALFAADNGLADIKIIISQSKYFLNPRGFIYIEHGFTQADAITVLFSQYNFTDIKTVKDLNNNDR 275
>gi|150422739|gb|EDN14693.1| hemK protein [Vibrio cholerae AM-19226] (286 aa)
Score = 184, Expect = 4.4e-12, Identities = 55/187 (29%), Positives = 96/187 (51%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKL-KTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVD-PSTKCEPKQALFAPQNGYYFYFRFLSEIYP-ILANGTEIIFEIGFNQKEEIEKFL 265
           P+ YI     F+ LS  +     +PR +TE +++ A+ +  LID + +LDL +G+G +A  ++     +   V G++      ++  +N   L +   QF++   F    +   K   I+ NPPYI++NDP++     + EPK AL A +NG     R +S   P  L +G  ++FE G++Q   +   L
  S:    71 PMAYILGEREFWSLSLKVSPSTLIPRPDTERLVELALDKAALIDGE-LLDLGTGTGAIALALASELPTRQ--VTGIDLRPEAAELARENATRLAIHNAQFLQGSWFS-PLADGTKFALIVSNPPYIEENDPHLSLGDVRFEPKSALVAAENGLA-DIRHISTHAPHFLLDGGWLLFEHGYDQGVAVRTIL 255
>gi|87122381|ref|ZP_01078262.1| probable DNA methylase [Marinomonas sp. MED121] >gi|86162356|gb|EAQ63640.1| probable DNA methylase [Marinomonas sp. MED121] (301 aa)
Score = 184, Expect = 4.4e-12, Identities = 65/193 (33%), Positives = 101/193 (52%)
  Q:    62 EYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLD-----WAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQR--NLKLKTQFIKSDIF-KIDRSHYEKCDFIICNPPYIDKNDPNVDP-STKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIG 254
           E K IL  LN+ ++K  P+ Y+     F GL F + K   +PR     +L      W +KQ  L     ILD+C+GSG L  T + I   +DA V   + ++    V  +N     ++   + I+SD+F K+ +  Y   D IICNPPY+D +D    P     EP+ AL +  +G  F  +FL++    L +   I++E+G
  S:    70 EKKSILTMLNERISKRTPLPYLLGEAWFMGLPFKVTKDTLIPRSPIMALLKDEFQPW-LKQYPL----NILDMCTGSGCLGITAALI--FEDAKVDISDISQAALDVARQNIEIHQVEESVEAIQSDMFEKLLQRQY---DLIICNPPYVDADDYQSAPLEFHREPELALTSGFDGLDFTRKFLNQAAEHLHDDGIIVYEVG 261
>gi|94971497|ref|YP_593545.1| HemK family modification methylase [Acidobacteria bacterium Ellin345] >gi|94553547|gb|ABF43471.1| modification methylase, HemK family [Acidobacteria bacterium Ellin345] (280 aa)
Score = 184, Expect = 4.5e-12, Identities = 57/212 (26%), Positives = 102/212 (48%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPN-VDPSTK-CEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYIKK 290
           P QYIT    FYG  F +     +PR ETE++++  ++      +  +LD+ +GSG +A T++  K+     V  V+ +    ++   N   L+ + +F  SD+         + D I+ NPPY+ + + + V    K  EP  A+F  + G     R   +++  L  G   + EIG++  + + +  I  + T FK + DL    RV+  +K
  S:    69 PAQYITGHQEFYGRDFLVSPAVLIPRPETEHLIEAVLELAPREVRWEVLDVGTGSGCIAATLA--KEFPRMKVTAVDISPEALQIAQANAARLEAQVEFRVSDLLSAIEPG-RQFDMIVSNPPYVGECEADKVQRQVKDFEPHCAVFGGERGMDIIKRLAPQVWEHLKPGGWFLMEIGYSIADPVHE--IMRDWTNFKVVPDLRGIPRVVVGRK 277
>gi|154491829|ref|ZP_02031455.1| hypothetical protein PARMER_01450 [Parabacteroides merdae ATCC 43184] >gi|154088070|gb|EDN87115.1| hypothetical protein PARMER_01450 [Parabacteroides merdae ATCC 43184] (291 aa)
Score = 184, Expect = 4.8e-12, Identities = 67/239 (28%), Positives = 110/239 (46%)
  Q:    52 FFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKY-ILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYE---KCDFIICNPPYIDKNDPNVDPSTKC---EPKQALFAPQNGYYFYFRFLSEI-YPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYIKK 290
            F KD E+    K  +  + + L +  P+QYI  +  FY L F +     +PR ETE +++  +      D+K  ILD+ +GSG +A T+   K  K A VI  + +        +N +       FI++DI   +++  +     D I+ NPPYI K +   D        EP  ALF P N    Y+  ++      L     + FEI       + + L +      + ++DL  KDR++  +K
  S:    50 LFCKDKELPESEKSRIHDIVERLKQMEPIQYILGTADFYSLQFEVDPSVLIPRPETEELVEQVILDNA--DQKIKILDIGTGSGCIAVTLR--KHLKKASVIATDISAEALATARRNAKRNNTTVTFIQTDILDPEKAEMDIPFILDVIVSNPPYI-KEEEKKDMERNVLDYEPHLALFVPDNDPLLYYWHIAHFGKKKLRRNGHLYFEINAACGNMVVEMLEEEGYKNIELIQDLSGKDRIIKARK 291
>gi|194434244|ref|ZP_03066510.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Shigella dysenteriae 1012] >gi|194417475|gb|EDX33578.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Shigella dysenteriae 1012] (277 aa)
Score = 184, Expect = 4.8e-12, Identities = 57/219 (26%), Positives = 110/219 (50%)
  Q:    67 LKQLNKVLNKNI---PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKK-YILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKT-QFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDP-STKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           L+QL+ +L +     PV ++T    F+ L  F+     +PR +TE +++ A+  ++L ++   ILDL +G+G +A  ++   +  D  +  V++      +  +N ++L +K    ++SD F       ++   I+ NPPYID+ DP++     + EP  AL A  +G       + +    L +G  ++ E G+ Q E + +  I       +  +D  D +RV
  S:    52 LQQLDALLARRRTGEPVAHLTGQREFWSLPLFVSPATLIPRPDTECLVEQAL--ERLPEQPCRILDLGTGTGAIA--LALASERPDCEITAVDRMPDAVALAQRNAQHLAIKNIHILQSDWFSALAG--QQFAMIVSNPPYIDEQDPHLQQGDVRFEPLTALVAADSGMADIVHIIEQSRNALVSGGFLLLEHGWQQGEAVRQAFILAGYHDVETCRDYGDNERV 270
>gi|82544334|ref|YP_408281.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Shigella boydii Sb227] >gi|157156593|ref|YP_001462465.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Escherichia coli E24377A] >gi|81245745|gb|ABB66453.1| possible protoporphyrinogen oxidase [Shigella boydii Sb227] >gi|157078623|gb|ABV18331.1| protein methyltransferase HemK [Escherichia coli E24377A] (277 aa)
Score = 184, Expect = 4.9e-12, Identities = 56/218 (25%), Positives = 109/218 (50%)
  Q:    68 KQLNKVLNKNI---PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKK-YILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKT-QFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDP-STKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           +QL+ +L +     P+ ++T    F+ L  F+     +PR +TE +++ A+   +L ++   ILDL +G+G +A  ++   +  D  +I V++      +  +N ++L +K    ++SD F       ++   I+ NPPYID+ DP++     + EP  AL A  +G       + +    L +G  ++ E G+ Q E + +  I       +  +D  D +RV
  S:    53 QQLDALLTRRRDGEPIAHLTGGREFWSLPLFVSPATLIPRPDTECLVEQAL--ARLPEQPCRILDLGTGTGAIA--LALASERPDCEIIAVDRMPDAVSLAQRNAQHLAIKNIHILQSDWFSALAG--QQFAMIVSNPPYIDEQDPHLQQGDVRFEPLTALVAADSGMADIVHIIEQSRNALVSGGFLLLEHGWQQGEAVRQAFILAGYHDVETCRDYGDNERV 270
>gi|157145533|ref|YP_001452852.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Citrobacter koseri ATCC BAA-895] >gi|157082738|gb|ABV12416.1| hypothetical protein CKO_01276 [Citrobacter koseri ATCC BAA-895] (277 aa)
Score = 184, Expect = 5.0e-12, Identities = 58/222 (26%), Positives = 107/222 (48%)
  Q:    64 KKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKK-YILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKL-KTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNV-DPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           ++ L QL     +  PV ++T    F+ L  F+     +PR +TE +++ A+   +L D    ILDL +G+G +A  ++   +  D  V  V++      +  +N ++L +   + ++SD F       ++ D I+ NPPYID +DP++     + EP  AL A  NG       +++    LA G  ++ E G+ Q   +   L +      +  +D  D +R+
  S:    52 REQLAQLLARRQRGEPVAHLTGIREFWSLPLFVSPATLIPRPDTECLVEQAL--ARLPDSPCRILDLGTGTGAIA--LALATERPDCEVTAVDRMPDAVALAGRNAQHLAIHNVRILQSDWFAALPG--QQFDMIVSNPPYIDAHDPHLAQGDVRFEPLSALVADDNGMADITHIIAQARHALAPGGYLLLEHGWQQGVAVRTALAQAGYVQVETCRDYGDNERI 270
>gi|52425320|ref|YP_088457.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Mannheimia succiniciproducens MBEL55E] >gi|52307372|gb|AAU37872.1| HemK protein [Mannheimia succiniciproducens MBEL55E] (344 aa)
Score = 183, Expect = 5.3e-12, Identities = 61/211 (28%), Positives = 108/211 (51%)
  Q:    54 EKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKN--QRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKND-PNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKF 264
           EK+T I+   K++ K+L        PV Y+T S  F GL F++ +   +PR     +++   +   + + K ILD+C+GSG +A  I+  ++ K+A V  V+ +     V   N  + NL  +   I+SD+F  D    +K D I+ NPPY+D+ D  ++      EP+ AL +  +G     + L+     L +   ++ E+G +    IE++
  S:   109 EKETVINLVIKRLAKRL--------PVAYLTNSAWFCGLEFYVDERVIIPRSPISALIENRFQGIIVKEPKRILDMCTGSGCIA--IACAEQFKEAEVDAVDLSIDALNVAEINIDRYNLSERVFPIQSDLF--DNVPADKYDLIVSNPPYVDREDLADMPEEFHYEPEMALGSGVDGLTITKQILANAANYLNDDGVLVCEVGNSMIHLIEQY 310
>gi|114561907|ref|YP_749420.1| modification methylase, HemK family protein [Shewanella frigidimarina NCIMB 400] >gi|114333200|gb|ABI70582.1| modification methylase, HemK family protein [Shewanella frigidimarina NCIMB 400] (284 aa)
Score = 183, Expect = 5.4e-12, Identities = 61/239 (25%), Positives = 113/239 (47%)
  Q:    46 ENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKL-KTQFIKSDIFKIDRSHYEKCDF--IICNPPYIDKNDPNVD-PSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDR 284
           +N S ++   + ++  E  K   Q+        PV +I     F+ L F + +   +PR +TE +++ A+      + K +LDL +G+G +A  ++   +     +  ++K     ++   N+ NL L + + I+SD F    S  E+ DF  I+ NPPYID+ D ++     + EP+ AL A   GY   +    +    L  G  ++ E G+ Q  ++ + LI+        ++D    DR
  S:    41 KNRSFLYTWPERQLTSEQFKAYSQMIAKRQSGTPVAHIIGEREFWSLPFIVNESTLIPRPDTEILVETALNLSVRHNAK-VLDLGTGTGAIA--LALASERPKWRITAIDKVPEAVELAKANRGNLNLTEVEIIQSDWF----SAVEQRDFDLIVSNPPYIDEADEHLHLGDVRFEPQSALTAGNEGYADLYYIAEQARAHLLPGGYLLLEHGYEQAIKVREKLIELGYQNVATVRDFGSNDR 276
>gi|91216496|ref|ZP_01253462.1| putative protoporphyrinogen oxidase [Psychroflexus torquis ATCC 700755] >gi|91185290|gb|EAS71667.1| putative protoporphyrinogen oxidase [Psychroflexus torquis ATCC 700755] (281 aa)
Score = 183, Expect = 5.6e-12, Identities = 61/256 (23%), Positives = 114/256 (44%)
  Q:    31 KWILKELILFNSKIIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKY-ILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPN--VDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVL 286
           KW+ ++L+   +       D+  E +  +D +     K+    L    P+ YI     F+GL F +     +PR ETE +++W ++ +K    +  ILDL +GSG +   I+  K    A +  ++ +    K+   N  +   K ++ ++D+  + +   E+ D ++ NPPY+  N+     D   K EP  ALF   +    ++R ++E+   +     +  EI  N  EE  +          +  KD     R+L
  S:    29 KWLAEDLLDLKTH------DLLLESEANLDSKKLVEFKKAQSRLEAQEPIHYILGYTEFFGLRFRVNTSVLIPRPETEELVEWILEDQKFSKSQLSILDLGTGSGCIP--IALAKHLPQAKLKALDISSEALKLAELNSEDNNTKIEYTQADLLTL-KHLPEEIDIVVSNPPYVKFNEQAQMQDNVLKNEPHLALFVKDSDPLIFYRRIAELTSKMRKRPLVYVEINQNLAEETRQLFKSFGFQSLELRKDFRGNYRML 278
>gi|83816659|ref|YP_446173.1| hemK protein [Salinibacter ruber DSM 13855] >gi|83758053|gb|ABC46166.1| hemK protein [Salinibacter ruber DSM 13855] (303 aa)
Score = 183, Expect = 5.9e-12, Identities = 54/220 (24%), Positives = 109/220 (49%)
  Q:    68 KQLNKVLNKNI---PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDI-FKIDRSHYEKCDFIICNPPYI-DKNDPNVDPSTK-CEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEK-FLIKNNITVFKFLKDLDDKDRVLY 287
           +Q ++++ + +   P+Q+I    SFYGL   +     VPR ETE ++D A+   + + +  +LD  +GSG +A  + +  +  DA V   + +     V   N ++L L  +F + D+  ++  +     D ++ NPPYI D    ++ P  +  +P ++LFA ++   FY   +  +      G   + E+      E+E+ F  +  +      +DL  + R+++
  S:    70 EQFHRMVGRRVQGEPLQHILGYASFYGLRLRVSPDVMVPRPETETVVDRALTCIEEVSRPRVLDAGTGSGCIALALKH--ERPDAEVHACDVSTDALAVARANAQDLGLDVRFFEGDLCAEVPAATPRDVDLLVSNPPYIPDAEAESLPPVVREYDPDRSLFAGRDPLRFYRALVRWVSACCVPGGSFVLEVHAEHAAEVERLFRGEEGVGAVHTEEDLSGRPRIVW 294
>gi|56412718|ref|YP_149793.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|56126975|gb|AAV76481.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] (310 aa)
Score = 183, Expect = 5.9e-12, Identities = 58/204 (28%), Positives = 101/204 (49%)
  Q:    62 EYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKN--QRNLKLKTQFIKSDIFK-IDRSHYEKCDFIICNPPYIDKNDPNVDPST-KCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFL 265
           E  +I++++ + +N+ IPV Y+T    F G  F++ +   VPR     +++           KYILD+C+GSG +A   +Y     DA V  V+ +     V   N  +  L      I+SD+F+ + +  Y   D I+ NPPY+D  D +  P+  + EP+  L +  +G     R L      L++   +I E+G +    +E++L
  S:    72 EKHRIVERVIRRINERIPVAYLTNKAWFCGHEFYVDERVLVPRSPIGELINNHFAGLISQQPKYILDMCTGSGCIAIACAY--AFPDAEVDAVDISPDALAVAEHNIEEHGLIHHVTPIRSDLFRDLPKVQY---DLIVTNPPYVDAEDMSDLPNEYRHEPELGLASGTDGLKLTRRILGNAPDYLSDDGVLICEVGNSMVHLMEQYL 274
>gi|71065791|ref|YP_264518.1| HemK family modification methylase [Psychrobacter arcticus 273-4] >gi|71038776|gb|AAZ19084.1| probable modification methylase, HemK family [Psychrobacter arcticus 273-4] (305 aa)
Score = 183, Expect = 6.0e-12, Identities = 56/212 (26%), Positives = 104/212 (49%)
  Q:    74 LNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYM----LDWAVKQ----KKLIDKKYILDLCSGSGVLANTISYIKKNKDAI------VIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKC-DFIICNPPYIDKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           + +  P+ Y+T + +F+ L F + +   +PR +TE +    LDW   Q       +    +LDL +GSG +A ++++  K  D +      V+ V+ +    K+   N  +  ++  F+ S  +    +  E+  D I+ NPPYID+ D ++      EP  AL AP +G       +      L  G  +  E G++Q + + +    N+    + +KD    DR+
  S:    70 MQQGTPLAYLTGTQAFWSLDFTVNEHTLIPRPDTEVLVETVLDWIKSQPFSTTPTLKSMRLLDLGTGSGCIAISLAHELKLADTLKQVSWQVVAVDFSLEALKIAQHNAVSNAVEVTFVHSSWYDELPTQDEQLFDVIVSNPPYIDEADEHL-AGLLAEPISALSAPNHGLADIEHIVYYAPQYLKVGGLLAIEHGYDQGQAVRQLFADNHFDNIRTIKDFGGNDRM 295
>gi|157415009|ref|YP_001482265.1| modification methylase, HemK family [Campylobacter jejuni subsp. jejuni 81116] >gi|157385973|gb|ABV52288.1| putative DNA methylase [Campylobacter jejuni subsp. jejuni 81116] (271 aa)
Score = 183, Expect = 6.1e-12, Identities = 76/239 (31%), Positives = 119/239 (49%)
  Q:    51 IFFEKDTEIDFE-YKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQF-IKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEI--YPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYIK 289
           +F  +D +ID E Y +++K+         P +YI +   F+GL F IKKG  +PR ++E +L   +   K      IL++  GSG+L+  ++   K     +   + N    ++ ++N +  K+      K   FK  + +Y   DFI  NPPYI KN   +D   + EPK+ALF  + GY      L EI  + +      +  E G++QKE +EK L +NN  V  F KD  D +R    K
  S:    36 LFLNQDIQIDHEPYFELIKRFKS----GEPFEYIFEKVDFWGLEFKIKKGVLIPRYDSEILLFQILNLCKKNTFNGILEIGFGSGILSIVLA---KELGLKITACDINPKALELALENAKLHKVDHLIDFKLCNFKQIKENY---DFIFSNPPYI-KNSYPIDIWVQKEPKEALFGGEKGY----EILEEIIHFSLDKKVKFLACEFGYDQKEILEKILYQNNFIV-DFFKDEQDYNRAFIAK 262
>gi|153948102|ref|YP_001401038.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Yersinia pseudotuberculosis IP 31758] >gi|152959597|gb|ABS47058.1| methyltransferase, HemK family [Yersinia pseudotuberculosis IP 31758] (276 aa)
Score = 183, Expect = 6.1e-12, Identities = 58/230 (25%), Positives = 104/230 (45%)
  Q:    56 DTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQ-FIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDP-STKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           +TEI  E    L+ L     +  P+ Y+     F+ L   +     +PR +TE +++ A+ +   +  + ILDL +G+G +A  ++   + +D  VI V+ N     +   N + L +    F++   F+     +     I  NPPYID NDP+++    + EP   L A   G       +S+    L  G  ++ E G+ Q   +++ L  +  +     KD  + DRV
  S:    44 ETEITAEQLLWLETLANRREQGEPIAYLVGEREFWSLPLSVSSATLIPRPDTECLVEQALARLPSMPCR-ILDLGTGTGAIA--LALASERRDCAVIAVDINADAVALARHNAKKLAIDNVCFLQGSWFEPVSGRFA---LIASNPPYIDANDPHLNEGDVRYEPHSVLVAAAEGMADLAAIVSQAPGYLEPGGWLMLEHGWQQANAVQERLKNSGFSAVMTCKDYGNNDRV 269
>gi|56460032|ref|YP_155313.1| hypothetical protein IL0924 [Idiomarina loihiensis L2TR] >gi|56179042|gb|AAV81764.1| Protoporphyrinogen oxidase; HemK [Idiomarina loihiensis L2TR] (281 aa)
Score = 182, Expect = 6.6e-12, Identities = 59/215 (27%), Positives = 104/215 (48%)
  Q:    76 KNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFK-IDRSHYEKCDFIICNPPYIDKNDPNVD-PSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYIKK 290
           K  PV +IT    F+ L   +     +PR +TE +++ A+  + L +   +LDL +G+G +A  ++   +     V   +K+    ++  +N + L L  + + S+ F+ + +S   K D I+ NPPYID  DP++     + EP+ AL A  NG       + E    LA+   ++ E G+ Q + + + L K+        +D    DRV   KK
  S:    64 KGKPVAHITGRREFWSLMLEVNASTLIPRPDTETLVEAALSLE-LPENARVLDLGTGTGAVA--LALKSERPGWQVWACDKSGDAVELARRNSQALGLNVEILCSNWFQSVPKSL--KFDLILSNPPYIDAGDPHLSMGDVRFEPQTALIAENNGLADIETIIKEANNHLADQGWLLLEQGWQQADSVAELLFKSGYKKVNRWQDYARVDRVTGGKK 275
>gi|170768219|ref|ZP_02902672.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Escherichia albertii TW07627] >gi|170122985|gb|EDS91916.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Escherichia albertii TW07627] (277 aa)
Score = 182, Expect = 6.6e-12, Identities = 53/207 (25%), Positives = 102/207 (49%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKK-YILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKT-QFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDP-STKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           PV ++T    F+ L  F+     +PR +TE +++ A+   +L ++   ILDL +G+G +A  ++   +  D  +  V++     ++  +N R+L +K    ++SD F       ++   I+ NPPYID+ DP++     + EP  AL A  +G       + +    L +G  ++ E G+ Q E + +  I+      +  +D    +RV
  S:    67 PVAHLTGVREFWSLRLFVSSATLIPRPDTECLVEQAL--ARLPEQPCRILDLGTGTGAIA--LALASERTDCDITAVDRMPDAVELAKRNARHLAIKNIHILQSDWFSALVG--QQFAMIVSNPPYIDEQDPHLQQGDVRFEPLSALVAADSGMADIVHIIEQSRNALVSGGFLLLEHGWQQGEAVRQAFIRAGYCEVETCRDYGGNERV 270
>gi|89898159|ref|YP_515269.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Chlamydophila felis Fe/C-56] >gi|89331531|dbj|BAE81124.1| tRNA/rRNA methyltransferase [Chlamydophila felis Fe/C-56] (283 aa)
Score = 182, Expect = 6.9e-12, Identities = 59/212 (27%), Positives = 97/212 (45%)
  Q:    78 IPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVK---QKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKND-PNVDPSTKC-EPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYIK 289
           +P  YI  S SF GL   +     +PR ETE + +  +K   Q   I   Y  D+C GSG L  ++         ++  +            +  NLK+  + +  D+F     +    D  +CNPPY+  ++   VDP  +C EP +AL    +G  FY R   ++  +L  G     EIG+ Q E I+K      ++   + +DL   DR+ +++
  S:    66 VPTSYIHGSVSFLGLHLDVDSRVLIPRMETELLAERIIKYLTQHPHIRTFY--DVCCGSGCLGLSVKKYCPEIQVVLSDICPKAVAVAKANASINNLKV--EILLGDLFS---PYSYPADAFVCNPPYLSFSEIMYVDPEVRCHEPWKALVGGSSGVEFYERIAQDLDLVLCPGGVGWLEIGYRQGELIKKIFAGRGVSGTIY-QDLSGCDRIFFLE 274
>gi|110805217|ref|YP_688737.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Shigella flexneri 5 str. 8401] >gi|110614765|gb|ABF03432.1| possible protoporphyrinogen oxidase [Shigella flexneri 5 str. 8401] (277 aa)
Score = 182, Expect = 7.1e-12, Identities = 56/218 (25%), Positives = 109/218 (50%)
  Q:    68 KQLNKVLNKNI---PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKK-YILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKT-QFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDP-STKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           +QL+ +L +     P+ ++T    F+ L  F+     +PR +TE +++ A+   +L ++   ILDL +G+G +A  ++   +  D  +I V++      +  +N ++L +K    ++SD F       ++   I+ NPPYID+ DP++     + EP  AL A  +G       + +    L +G  ++ E G+ Q E + +  I       +  +D  D +RV
  S:    53 QQLDALLTRRRDGEPIAHLTGVREFWSLPLFVSPATLIPRPDTECLVEQAL--ARLPEQPCRILDLGTGTGAIA--LALASERPDCEIIAVDRMPDAVSLAQRNAQHLAIKNIHILQSDWFSALAG--QQFAMIVSNPPYIDEQDPHLQQGDVRFEPLTALVAADSGMADIVHIIQQSRNALVSGGFLLLEHGWQQGEAVRQAFILAGYHDVETCRDYGDNERV 270
>gi|28898977|ref|NP_798582.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Vibrio parahaemolyticus RIMD 2210633] >gi|153836932|ref|ZP_01989599.1| hypothetical adenine-specific methylase YfcB [Vibrio parahaemolyticus AQ3810] >gi|28807196|dbj|BAC60466.1| putative adenine-specific methylase [Vibrio parahaemolyticus RIMD 2210633] >gi|149749705|gb|EDM60450.1| hypothetical adenine-specific methylase YfcB [Vibrio parahaemolyticus AQ3810] (310 aa)
Score = 182, Expect = 7.1e-12, Identities = 55/193 (28%), Positives = 97/193 (50%)
  Q:    62 EYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQF--IKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPST-KCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIG 254
           E  +I++++ K +N+  P  Y+T    F GL FF+ +   VPR     ++    +   + +   I+DLC+GSG +A  I+      +A V  ++ +    +V  +N ++  ++ Q   I+SD+F+      EK + I+ NPPY+D+ D N  P     EP+  L A  +G     R L+     L +   +I E+G
  S:    72 ERLRIVERVVKRINERTPTAYLTNKAWFCGLEFFVDERVLVPRSPIGELIQAEFQPWLVEEPTRIMDLCTGSGCIA--IACAHAFPEAEVDAIDISADALQVAEQNIQDHGMEQQVFPIRSDLFR--DLPKEKYNLIVSNPPYVDEEDMNSLPQEFTHEPELGLAAGTDGLKLVRRILANAPDYLTDDGILICEVG 263
>gi|88192213|pdb|2B3T|A Chain A, Molecular Basis For Bacterial Class 1 Release Factor Methylation By Prmc (276 aa)
Score = 182, Expect = 7.2e-12, Identities = 56/218 (25%), Positives = 109/218 (50%)
  Q:    68 KQLNKVLNKNI---PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKK-YILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKT-QFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDP-STKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           +QL+ +L +     P+ ++T    F+ L  F+     +PR +TE +++ A+   +L ++   ILDL +G+G +A  ++   +  D  +I V++      +  +N ++L +K    ++SD F       ++   I+ NPPYID+ DP++     + EP  AL A  +G       + +    L +G  ++ E G+ Q E + +  I       +  +D  D +RV
  S:    53 QQLDALLTRRRDGEPIAHLTGVREFWSLPLFVSPATLIPRPDTECLVEQAL--ARLPEQPCRILDLGTGTGAIA--LALASERPDCEIIAVDRMPDAVSLAQRNAQHLAIKNIHILQSDWFSALAG--QQFAMIVSNPPYIDEQDPHLQQGDVRFEPLTALVAADSGMADIVHIIEQSRNALVSGGFLLLEHGWQQGEAVRQAFILAGYHDVETCRDYGDNERV 270
>gi|193064883|ref|ZP_03045960.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Escherichia coli E22] >gi|194425825|ref|ZP_03058381.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Escherichia coli B171] >gi|192927568|gb|EDV82185.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Escherichia coli E22] >gi|194415880|gb|EDX32146.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Escherichia coli B171] (277 aa)
Score = 182, Expect = 7.2e-12, Identities = 56/218 (25%), Positives = 109/218 (50%)
  Q:    68 KQLNKVLNKNI---PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKK-YILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKT-QFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDP-STKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           +QL+ +L +     P+ ++T    F+ L  F+     +PR +TE +++ A+   +L ++   ILDL +G+G +A  ++   +  D  +I V++      +  +N ++L +K    ++SD F       ++   I+ NPPYID+ DP++     + EP  AL A  +G       + +    L +G  ++ E G+ Q E + +  I       +  +D  D +RV
  S:    53 QQLDALLTRRRDGEPIAHLTGVREFWSLPLFVSPATLIPRPDTECLVEQAL--ARLPEQPCRILDLGTGTGAIA--LALASERPDCEIIAVDRMPDAVSLAQRNAQHLAIKNIHILQSDWFSALAG--QQFAMIVSNPPYIDEQDPHLQQGDVRFEPLTALVAADSGMADIVHIIEQSRNALVSGGFLLLEHGWQQGEAVRQAFILAGYHDVETCRDYGDNERV 270
>gi|74312448|ref|YP_310867.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Shigella sonnei Ss046] >gi|191166624|ref|ZP_03028452.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Escherichia coli B7A] >gi|73855925|gb|AAZ88632.1| possible protoporphyrinogen oxidase [Shigella sonnei Ss046] >gi|190903273|gb|EDV62994.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Escherichia coli B7A] (277 aa)
Score = 182, Expect = 7.2e-12, Identities = 56/218 (25%), Positives = 109/218 (50%)
  Q:    68 KQLNKVLNKNI---PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKK-YILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKT-QFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDP-STKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           +QL+ +L +     P+ ++T    F+ L  F+     +PR +TE +++ A+   +L ++   ILDL +G+G +A  ++   +  D  +I V++      +  +N ++L +K    ++SD F       ++   I+ NPPYID+ DP++     + EP  AL A  +G       + +    L +G  ++ E G+ Q E + +  I       +  +D  D +RV
  S:    53 QQLDALLTRRRDGEPIAHLTGVREFWSLPLFVSPATLIPRPDTECLVEQAL--ARLPEQPCRILDLGTGTGAIA--LALASERPDCEIIAVDRMPDAVSLAQRNAQHLAIKNIHILQSDWFSALAG--QQFAMIVSNPPYIDEQDPHLQQGDVRFEPLTALVAADSGMADIVHIIEQSRNALVSGGFLLLEHGWQQGEAVRQAFILAGYHDVETCRDYGDNERV 270
>gi|16129175|ref|NP_415730.1| N5-glutamine methyltransferase, modifies release factors RF-1 and RF-2 [Escherichia coli str. K-12 substr. MG1655] >gi|24112611|ref|NP_707121.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Shigella flexneri 2a str. 301] >gi|30062736|ref|NP_836907.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Shigella flexneri 2a str. 2457T] >gi|89108057|ref|AP_001837.1| N5-glutamine methyltransferase, modifies release factors RF-1 and RF-2 [Escherichia coli W3110] >gi|157160717|ref|YP_001458035.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Escherichia coli HS] >gi|170020421|ref|YP_001725375.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Escherichia coli ATCC 8739] >gi|170080840|ref|YP_001730160.1| release factors RF-1 and RF-2 N5-glutamine methyltransferase [Escherichia coli str. K12 substr. DH10B] >gi|187731012|ref|YP_001879995.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Shigella boydii CDC 3083-94] >gi|188492205|ref|ZP_02999475.1| protein methyltransferase HemK [Escherichia coli 53638] >gi|81170789|sp|P0ACC1|HEMK_ECOLI Protein methyltransferase hemK (Protein-glutamine N-methyltransferase hemK) (Protein-(glutamine-N(5)) MTase hemK) (M.EcoKHemKP) >gi|81170790|sp|P0ACC2|HEMK_SHIFL Protein methyltransferase hemK (Protein-glutamine N-methyltransferase hemK) (Protein-(glutamine-N(5)) MTase hemK) >gi|50513699|pdb|1T43|A Chain A, Crystal Structure Analysis Of E.Coli Protein (N5)-Glutamine Methyltransferase (Hemk) >gi|968931|gb|AAC43438.1| possible protoporphyrinogen oxidase >gi|1651602|dbj|BAA36070.1| N5-glutamine methyltransferase, modifies release factors RF-1 and RF-2 [Escherichia coli W3110] >gi|1787463|gb|AAC74296.1| N5-glutamine methyltransferase, modifies release factors RF-1 and RF-2 [Escherichia coli str. K-12 substr. MG1655] >gi|18376673|dbj|BAB84109.1| protein-(glutamine-N5) methyl transferase [Escherichia coli] >gi|24051516|gb|AAN42828.1| possible protoporphyrinogen oxidase [Shigella flexneri 2a str. 301] >gi|30040984|gb|AAP16714.1| possible protoporphyrinogen oxidase [Shigella flexneri 2a str. 2457T] >gi|157066397|gb|ABV05652.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Escherichia coli HS] >gi|169755349|gb|ACA78048.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Escherichia coli ATCC 8739] >gi|169888675|gb|ACB02382.1| release factors RF-1 and RF-2 N5-glutamine methyltransferase [Escherichia coli str. K12 substr. DH10B] >gi|187428004|gb|ACD07278.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Shigella boydii CDC 3083-94] >gi|188487404|gb|EDU62507.1| protein methyltransferase HemK [Escherichia coli 53638] (277 aa)
Score = 182, Expect = 7.2e-12, Identities = 56/218 (25%), Positives = 109/218 (50%)
  Q:    68 KQLNKVLNKNI---PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKK-YILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKT-QFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDP-STKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           +QL+ +L +     P+ ++T    F+ L  F+     +PR +TE +++ A+   +L ++   ILDL +G+G +A  ++   +  D  +I V++      +  +N ++L +K    ++SD F       ++   I+ NPPYID+ DP++     + EP  AL A  +G       + +    L +G  ++ E G+ Q E + +  I       +  +D  D +RV
  S:    53 QQLDALLTRRRDGEPIAHLTGVREFWSLPLFVSPATLIPRPDTECLVEQAL--ARLPEQPCRILDLGTGTGAIA--LALASERPDCEIIAVDRMPDAVSLAQRNAQHLAIKNIHILQSDWFSALAG--QQFAMIVSNPPYIDEQDPHLQQGDVRFEPLTALVAADSGMADIVHIIEQSRNALVSGGFLLLEHGWQQGEAVRQAFILAGYHDVETCRDYGDNERV 270
>gi|193213806|ref|YP_001995005.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Chloroherpeton thalassium ATCC 35110] >gi|193087283|gb|ACF12558.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Chloroherpeton thalassium ATCC 35110] (294 aa)
Score = 182, Expect = 7.3e-12, Identities = 62/236 (26%), Positives = 118/236 (50%)
  Q:    50 DIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLID----KKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKC----DFIICNPPYI---DKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           D++ + D  +  + ++  ++L K   +  PVQYI  +  F+GL+  +     +PR ETE +++ A+     +D    K  ILD+ +GSG +A  +++  +  +A ++ V+ +     +  +N    KLK++    +I  +    Y++       II NPPYI   +++   V+     EP  ALF  Q G+ FY +   E   +L     + FE+  +   ++   L KN     +F++D     R+
  S:    46 DLYLKFDMPVTEQERQTFRELCKRRLEGEPVQYIIGNQDFFGLTLDVDSRVLIPRPETELLVEEALNSLSQLDFGDEKIKILDIGTGSGCIA--LAFASQLSNAEILAVDVSSEALALAKQNSEKNKLKSEVRFLNIDMLSAHFYDEVPGSYHLIISNPPYIPIAERDSLQVE-VRNFEPAIALFV-QQGFEFYEKIAQEAARLLKPNGLLCFELHADGATKVNIILKKNGFEQIRFVQDYAGFSRI 288
>gi|157964997|ref|YP_001499821.1| bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase [Rickettsia massiliae MTU5] >gi|157844773|gb|ABV85274.1| Methylase of polypeptide chain release factors [Rickettsia massiliae MTU5] (511 aa)
Score = 182, Expect = 7.4e-12, Identities = 77/272 (28%), Positives = 133/272 (48%)
  Q:    15 FSELTKRLNPLDDSQIKWILKELILFNSKIIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVK----------QKKLIDKKY-ILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKL--KTQFIKSDIFKIDRSHYEKCDFIICNPPYI---DKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVL 286
            S+ T +LN +  S  +  L+  IL    I +    +    D +++    +  ++L +   K+ P+ YIT    FY   F + K   +PR +TE ++D   +           +   DK   IL+L +GSG +A  IS + +  +A VI  + +    ++   N     +  + Q I S+ F  +    +K DFI+ NPPYI   +K++  ++ +   EP  ALFA ++G + YF         L    +II EIGF Q+E + +  + +   +    KDL    RV+
  S:     9 LSDATDKLNKIGISSPQ--LEARILLQHVINKPIEYLLINLDEQLNEAEIEAFEKLLERRLKHEPIVYITGVKEFYSREFIVNKHVLIPRSDTEVLVDVVFQCHPRFRGDDISENCNDKFLNILELGTGSGCIA--ISLLCELPNANVIATDISLDAIEIIKSNAAKYSVTDRIQIIHSNWF--ENIETQKFDFIVSNPPYIAHSEKSEMAIE-TINYEPSIALFAEKDGLHAYFLIAENAKQFLKPNGKIILEIGFKQEEAVTQIFLDHGYNIESVYKDLQGHSRVI 289
>gi|54298227|ref|YP_124596.1| hypothetical protein lpp2285 [Legionella pneumophila str. Paris] >gi|53752012|emb|CAH13438.1| hypothetical protein [Legionella pneumophila str. Paris] (287 aa)
Score = 182, Expect = 7.4e-12, Identities = 63/240 (26%), Positives = 109/240 (45%)
  Q:    46 ENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKT-QFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDP-STKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           +N + +F   D  +  E  +   Q+ K   + +P+ YIT    F+ LS  +     +PR ETE +++ A++     +   +LDL +GSG +A  ++  K+     +   + ++   ++   N + L L    F  S  F  +    ++   I+ NPPYI +NDP++     + EP  AL + Q+G       +   Y  L     ++ E GF QK EI   L +         +DL   DRV
  S:    36 KNRAYLFAHPDALVSPEQIETYLQMIKQRAEGLPIAYITGQREFWSLSLKVTPNVLIPRHETERLVELALELIPDKENVSVLDLGTGSGAIA--LALAKERPLWHIDACDFSKEALELARYNAKTLGLNNINFYHSCWF--NNLPLKQYHAIVSNPPYIAENDPHLKQGDVRFEPTSALVSSQDGLADLQYIIQHSYEYLLPDGLLLVEHGFEQKNEISAILNQLGYKNIHCWQDLQGHDRV 273
>gi|38233636|ref|NP_939403.1| HemK family methytransferase [Corynebacterium diphtheriae NCTC 13129] >gi|38199896|emb|CAE49562.1| HemK-family methytransferase [Corynebacterium diphtheriae] (272 aa)
Score = 182, Expect = 7.4e-12, Identities = 59/212 (27%), Positives = 104/212 (49%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIF--KIDRSHYEKCDFIICNPPYIDKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKN-NITVFKFLKDLDDKDRVLYIKK 290
           P+Q+I +   F  L   +  G F+PR ETE + DWAV+     D   ++DLC+GSG LA  I++  ++ +  V  VE +          +RNL  +   ++ D+   +I        D ++ NPPY+  ++ +++P    +P  A+F+  +G       +  IY +LA G  +  E      E  ++ LI +   +  + LKDL  ++R +   K
  S:    64 PLQHILQVTWFGPLELHVGPGVFIPRPETEVLADWAVRHTDSED--IVVDLCTGSGALAAYIAH--EHPECSVWAVELSDAAMAFA---RRNLPDRVHLVQGDVTDPEILDHLSGAVDLLVSNPPYVPLSN-DLEPEVYQDPSMAVFSGDSGMDTINAMIPVIYRLLAPGGLVGIEHDDLTSELTQQALIDHGGFSNIEPLKDLTGRNRFVVASK 270
>gi|83953607|ref|ZP_00962328.1| modification methylase, HemK family protein [Sulfitobacter sp. NAS-14.1] >gi|83841552|gb|EAP80721.1| modification methylase, HemK family protein [Sulfitobacter sp. NAS-14.1] (280 aa)
Score = 182, Expect = 7.5e-12, Identities = 54/210 (25%), Positives = 103/210 (49%)
  Q:    78 IPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQ--RNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKND-PNVDPSTKC-EPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLY 287
           +PV ++    +FYG  F + +    PR ETE +++ A+ +      + +LDL +GSG +  T+  + + +DA  +G++ +         N     ++ + +  +SD F      +   D I+ NPPY+ +++  +V P  +  EP+ AL   Q+G   Y    ++    LA    ++ EIG+ Q  +++           + L DL  +DRVL+
  S:    71 VPVSHLVGQRAFYGRDFKVSRDVLDPRPETESLIELALSEP----FERVLDLGTGSGCILVTL--LAEQQDARGVGLDLSEAACLQASANAVLHGVQARAEITQSDWFSAAEGRF---DLIVSNPPYLAQSEMADVSPELRLHEPEMALTDGQDGLSVYRIIAAQAQGYLAPTGRVLAEIGWQQGADVKAIFEAAGWGRVRILPDLGGRDRVLW 275
>gi|153213281|ref|ZP_01948693.1| hemK protein [Vibrio cholerae 1587] >gi|124116081|gb|EAY34901.1| hemK protein [Vibrio cholerae 1587] (286 aa)
Score = 182, Expect = 8.0e-12, Identities = 55/187 (29%), Positives = 96/187 (51%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKL-KTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVD-PSTKCEPKQALFAPQNGYYFYFRFLSEIYP-ILANGTEIIFEIGFNQKEEIEKFL 265
           P+ YI     F+ LS  +     +PR +TE +++ A+ +  LID + +LDL +G+G +A  ++     +   V G++      ++  +N   L +   QF++   F    +   K   I+ NPPYI++NDP++     + EPK AL A +NG     R +S   P  L +G  ++FE G++Q   +   L
  S:    71 PMAYILGEREFWSLSLKVSPSTLIPRPDTERLVELALDKAALIDGE-LLDLGTGTGAIALALASELPMRQ--VTGIDLRPEAAELARENATRLAIHNAQFLQGSWFS-PLADGTKFALIVSNPPYIEENDPHLSLGDVRFEPKSALVAAENGLA-DIRHISTHAPRFLLDGGWLLFEHGYDQGVAVRTIL 255
>gi|153951215|ref|YP_001398334.1| HemK family modification methylase [Campylobacter jejuni subsp. doylei 269.97] >gi|152938661|gb|ABS43402.1| modification methylase, HemK family [Campylobacter jejuni subsp. doylei 269.97] (271 aa)
Score = 182, Expect = 8.3e-12, Identities = 75/239 (31%), Positives = 119/239 (49%)
  Q:    51 IFFEKDTEIDFE-YKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLK--TQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEI--YPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYIK 289
           +F  +D EID E Y +++++         P +YI +   F+GL F IKKG  +PR ++E +L   +   K      IL++  GSG+L+  ++   K     +   + N    ++ ++N +  K+     F   +  +I+    E  DFI  NPPYI KN   +D   + EPK+ALF  + GY      L EI  + +      +  E G++QKE +EK L +NN  V  F KD  D +R    K
  S:    36 LFLNQDIEIDHEPYFELVRRFKS----GEPFEYIFEKVDFWGLEFKIKKGVLIPRYDSEILLFQILNLCKKNTFNGILEIGFGSGILSIILA---KELGLKITACDINPKALELALENAKLHKVDHLIDFKLCNFKQIE----ENYDFIFSNPPYI-KNSYPIDIWVQKEPKEALFGGEKGY----EILEEIIHFSLDKKVKFLACEFGYDQKEILEKILYQNNFIV-DFFKDEQDYNRAFIAK 262
>gi|52842547|ref|YP_096346.1| protein methyltransferase HemK [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] >gi|52629658|gb|AAU28399.1| protein methyltransferase HemK [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] (287 aa)
Score = 182, Expect = 8.4e-12, Identities = 64/240 (26%), Positives = 108/240 (45%)
  Q:    46 ENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKT-QFIKSDIF-KIDRSHYEKCDFIICNPPYIDKNDPNVD-PSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           +N + +F   D  +  E  +   Q+ K   + +P+ YIT    F+ LS  +     +PR ETE +++ A++     +   +LDL +GSG +A  ++  K+     +   + ++   ++   N + L L    F  S  F  +    Y     I+ NPPYI +NDP++     + EP  AL + Q+G       +   Y  L     ++ E GF QK EI   L +         +DL   DRV
  S:    36 KNRAYLFAHPDALVSPEQIETYLQMIKQRAEGLPIAYITGQREFWSLSLKVTPNVLIPRHETERLVELALELIPDKENVSVLDLGTGSGAIA--LALAKERPLWHIDACDFSKEALELARYNAKTLGLNNINFCHSYWFNNLPLKQYHA---IVSNPPYIAENDPHLKHGDVRFEPTSALVSSQDGLADLQYIIQHSYEYLLPDGLLLVEHGFEQKNEISAILNQLGYKNIHCWQDLQGHDRV 273
>gi|86151737|ref|ZP_01069951.1| modification methylase, HemK family [Campylobacter jejuni subsp. jejuni 260.94] >gi|86153286|ref|ZP_01071490.1| methylase of polypeptide chain release factor [Campylobacter jejuni subsp. jejuni HB93-13] >gi|121613646|ref|YP_001000418.1| HemK family modification methylase [Campylobacter jejuni subsp. jejuni 81-176] >gi|167005360|ref|ZP_02271118.1| modification methylase, HemK family protein [Campylobacter jejuni subsp. jejuni 81-176] >gi|85841366|gb|EAQ58614.1| modification methylase, HemK family [Campylobacter jejuni subsp. jejuni 260.94] >gi|85843012|gb|EAQ60223.1| methylase of polypeptide chain release factor [Campylobacter jejuni subsp. jejuni HB93-13] >gi|87249539|gb|EAQ72499.1| modification methylase, HemK family [Campylobacter jejuni subsp. jejuni 81-176] (271 aa)
Score = 182, Expect = 8.4e-12, Identities = 75/239 (31%), Positives = 119/239 (49%)
  Q:    51 IFFEKDTEIDFE-YKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQF-IKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEI--YPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYIK 289
           +F  +D +ID E Y +++++         P +YI +   F+GL F IKKG  +PR ++E +L   +   K      IL++  GSG+L+  ++   K     +   + N    ++ ++N +  K+      K   FK  + +Y   DFI  NPPYI KN   +D   + EPK+ALF  + GY      L EI  + +      +  E G++QKE +EK L +NN  V  F KD  D +R    K
  S:    36 LFLNQDIQIDHEPYFELIRRFKS----GEPFEYIFEKVDFWGLEFKIKKGVLIPRYDSEILLFQILNLCKKNTFNGILEIGFGSGILSIVLA---KELGLKITACDINPKALELALENAKLHKVDHLIDFKLCNFKQIKENY---DFIFSNPPYI-KNSYPIDIWVQKEPKEALFGGEKGY----EILEEIIHFSLDKKVKFLACEFGYDQKEILEKILYQNNFIV-DFFKDEQDYNRAFIAK 262
>gi|148976458|ref|ZP_01813164.1| N5-glutamine methyltransferase [Vibrionales bacterium SWAT-3] >gi|145964281|gb|EDK29537.1| N5-glutamine methyltransferase [Vibrionales bacterium SWAT-3] (310 aa)
Score = 182, Expect = 8.5e-12, Identities = 56/193 (29%), Positives = 97/193 (50%)
  Q:    62 EYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQF--IKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPST-KCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIG 254
           E  +I++++ K +N   P  Y+T    F GL FF+ +   VPR     +++   +     +   I+DLC+GSG +A  I+      +A V  ++ +    +V  +N ++  ++ Q   I+SD+F+ D    EK + I+ NPPY+D+ D N  P     EP+  L A  +G     R L+     L +   +I E+G
  S:    72 ERLRIVERVIKRINDRTPTAYLTNKAWFCGLEFFVDERVLVPRSPIGELIEAQFQPWLTEEPTRIMDLCTGSGCIA--IACAHAFPEAEVDAIDISTDALQVAEQNVQDHGMEQQVFPIRSDLFR-DLPK-EKYNLIVSNPPYVDEEDMNSLPDEFTHEPELGLAAGTDGLKLVRRILANAPDYLTDDGILICEVG 263
>gi|91786751|ref|YP_547703.1| HemK family modification methylase [Polaromonas sp. JS666] >gi|91695976|gb|ABE42805.1| modification methylase, HemK family [Polaromonas sp. JS666] (287 aa)
Score = 181, Expect = 8.7e-12, Identities = 53/187 (28%), Positives = 95/187 (50%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWA---VKQKKLIDKKYILDLCSGSGVLANTISYIKK--NKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFL 265
           P+ YI  S  F+GL   +     VPR +TE ++ W+   ++   + ++  ILDL +GSG +A  I++  +   + A V+ V+ +     V  +N R L+L+ +F +S+       H+     I  NPPYI   DP++  +   EP  +L A  +G     + +++    LA G  ++ E G++Q   +   L
  S:    73 PLAYIVGSKEFFGLELQVDARVLVPRPDTETLVHWSLEVLQAPAMTERPQILDLGTGSGAIALAIAHSLQAAGRPARVVAVDASAGALAVARENARRLQLELEFSQSNWLDEVGGHFH---LIASNPPYIASADPHL-VALAHEPLGSLAAGPDGLGDIRQIVAKAPEHLAPGGWLLLEHGYDQAAAVRGLL 260
>gi|34556665|ref|NP_906480.1| protoporphyrinogen oxidase [Wolinella succinogenes DSM 1740] >gi|34482379|emb|CAE09380.1| PROTOPORPHYRINOGEN OXIDASE [Wolinella succinogenes] (283 aa)
Score = 181, Expect = 9.0e-12, Identities = 58/211 (27%), Positives = 102/211 (48%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCS---GSGVLANTISYIKKN-----KDAIVIGVEKNRTPYK-VGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYIK 289
           P++YI +  SFY   F++  G  +PR ETE ++DWA     LI    I  +     GSG++++T++ +  +      D     +E  R   K +G +++  L L +     +          + D ++ NPPYI +N P   P    EP +ALF  + G       + E      +   +I E+G++Q+  IE+F+ +      +F +DL   DR   ++
  S:    69 PIEYILERASFYSRDFYVASGVLIPRPETEILIDWA---SSLIASHPICRVAEVGIGSGIISSTLALLHPHLTFEASDISPRALEVARENLKRMGAESRITLHLGSLLEPLE---------GEFDLLLSNPPYIAQNTPLPKP-LNFEPSEALFGGERGSELLEELIKEAQK--RSIPYMIAEMGYDQRGAIERFMERIPHQELRFYQDLAGLDRGFIVR 273
>gi|165924032|ref|ZP_02219864.1| protein methyltransferase HemK [Coxiella burnetii RSA 334] >gi|165916517|gb|EDR35121.1| protein methyltransferase HemK [Coxiella burnetii RSA 334] (277 aa)
Score = 181, Expect = 9.3e-12, Identities = 60/253 (23%), Positives = 117/253 (46%)
  Q:    38 ILFNSKIIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKT-QFIKSDIFK-IDRSHYEKCDFIICNPPYIDKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYIKK 290
           +L    + ++ +D+F   + +++   +K L    K   K  P+ YI     F+ L+  +     +PR ETE +++W +K     +K  I DL +GSG +A  I+  + +    +   + ++   K+   N +  ++K   F + +  + + R  Y     I+ NPPYI   D ++    K EP++AL A  +G       + E    L NG  ++ E G++Q E+I   +  +        +DL    R++  ++
  S:    28 LLLECVLKKSRADLFAYPEIQLNSSQQKTLSAYVKRRLKGEPIAYILGQKEFWSLNLKVTPDVLIPRPETEMLVEWILKNLPKDEKLRIADLGTGSGAVALAIAVERPH--WTIDATDNSQAALKIAEINAKQHEIKNCNFYQGEWCQALPRRDYHA---IVGNPPYIPDKDQHLQ-QLKHEPREALAAGSDGLSAIKIIIHEAKSYLVNGGWLLLEHGYDQAEKIMTLMQADGYREITDRRDLAGLSRMMVARR 276
>gi|161503113|ref|YP_001570225.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] >gi|160864460|gb|ABX21083.1| hypothetical protein SARI_01178 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] (277 aa)
Score = 181, Expect = 9.6e-12, Identities = 53/219 (24%), Positives = 105/219 (47%)
  Q:    67 LKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKT-QFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNV-DPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           L +L +   +  P+ ++T    F+ L  F+     +PR +TE +++ A+ +   +    ILDL +G+G +A  ++   +  D  V  V++      + ++N  +L ++  + ++S  F       ++ D I+ NPPYID  DP++ +   + EP  AL A +NG       +     +L  G  ++ E G+ Q E +     + + T  +  +D    +RV
  S:    55 LAELLRRRKQGEPIAHLTGIREFWSLPLFVSPATLIPRPDTECLVEQALARLP-VKTCRILDLGTGTGAIA--LALASERPDCDVTAVDRMPDAVALAIRNAEHLAIRNVRILQSCWFSALPG--QQFDMIVSNPPYIDARDPHLSEGDVRFEPLSALVADENGMADITHIIDHARQVLTPGGWLLLEHGWQQGEAVRATFRRADYTDVETCRDYGGNERV 270
>gi|71909296|ref|YP_286883.1| modification methylase HemK [Dechloromonas aromatica RCB] >gi|71848917|gb|AAZ48413.1| Modification methylase HemK [Dechloromonas aromatica RCB] (270 aa)
Score = 181, Expect = 1.0e-11, Identities = 56/207 (27%), Positives = 93/207 (44%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPS-TKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           P+ Y+     F G  F +     +PR ETE +++ A+ +   +    ++DL +GSG++A  IS   ++  A V+ V+ +     V   N   L  +  F + D F       E+ D I+ NPPY+   DP++  +    EP+ AL    +G       +++    LA G  ++FE G++Q E     L            DL   DRV
  S:    62 PLAYLVGEAEFRGRVFQVSPAVLIPRPETEVLIELALAKLPGLAAPKVVDLGTGSGIVA--ISLALESPAATVVAVDLSAEAISVARNNAGRLGARIDFRQGDWFSPLAG--ERFDLIVSNPPYVADGDPHLALNGLPFEPQMALTDGADGLSCIRHIVADAADHLAPGGWLLFEHGYDQGEASRNLLTAAGFKAAFTFPDLAGIDRV 265
>gi|32475816|ref|NP_868810.1| hemK protein [Rhodopirellula baltica SH 1] >gi|32446359|emb|CAD76187.1| hemK protein [Rhodopirellula baltica SH 1] (296 aa)
Score = 180, Expect = 1.2e-11, Identities = 67/229 (29%), Positives = 118/229 (51%)
  Q:    62 EYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKK--LIDK--KYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKL--KTQFIKSDIFKIDRSHYEKCDFIIC-NPPYIDKNDPNVDPST--KCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNN--ITVFKFLKDLDDKDRVLYIKK 290
           E +   ++L +   +  PV  +     FY +S  + +   VPR ETE+++  A+ Q K  L D+    +LD+ +GSG +A  I+  K      V  V+ + T   +   N  NLKL  +   ++SD+F  D    ++   +IC NPPYI +++ +  P+T  + EP+ AL +  +G     R L++    L +G ++I E+       + K L + N        +KDL   +R+L ++K
  S:    61 EQRVAFRELVRRRGEGAPVAQLVGYREFYSISIRVDENVLVPRPETEHLVIEAIDQIKGRLSDRPSPTVLDIGTGSGAIAVAIA--KSLPKTQVTAVDISLTALDIAKWNVENLKLSDRVTLLQSDLF--DGLEPDQTFDVICSNPPYISQSEYDELPTTVREFEPRGALLSGPDGTEIIARLLNDSVQRLNDGGQLIIELS-PMIAGVSKTLAEQNGGYKEIHLIKDLAGHERILSMQK 295
>gi|149195280|ref|ZP_01872368.1| modification methylase, HemK family protein [Caminibacter mediatlanticus TB-2] >gi|149134544|gb|EDM23032.1| modification methylase, HemK family protein [Caminibacter mediatlanticus TB-2] (273 aa)
Score = 180, Expect = 1.3e-11, Identities = 73/239 (30%), Positives = 125/239 (52%)
  Q:    51 IFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVK----QKKLIDKKY---------------------ILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEI-----IFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYIK 289
           +F   + E+  E+ KI +++ +      P++YI     FYG  +++K+G  +PR +TE +++ A+K    + K+  KK+                     I+D CSGSGV+A TI   +   D  V+  + +    +V  KN +   +  +F K ++F       EK D +I NPPY++ +           PK   + P   +Y     L  +  I+     +     I EIG+NQKE + KFL ++ +  ++F KDL    R + IK
  S:    27 LFLNDELEVPSEFFKIYEKVKR----GYPIEYIFNEIEFYGKKYYVKEGVLIPRDDTEVIVERALKLLDEELKVKSKKFKINDKLNVKNEKLEINNEKLKIVDCCSGSGVIAITIK--QYFPDIEVVATDISDKAIEVAKKNAKLHNVDIKFKKCNLFD------EKGDILISNPPYVENS----------YPKPNDYEPDIAFYGGVDGLDIVREIILRAKNLEYKYAIIEIGYNQKENLSKFL-EDKVKEYEFFKDLARNIRGVEIK 272
>gi|71892128|ref|YP_277860.1| N5-glutamine methyltransferase [Candidatus Blochmannia pennsylvanicus str. BPEN] >gi|71796234|gb|AAZ40985.1| N5-glutamine methyltransferase [Candidatus Blochmannia pennsylvanicus str. BPEN] (278 aa)
Score = 180, Expect = 1.3e-11, Identities = 77/273 (28%), Positives = 126/273 (46%)
  Q:    17 ELTKRLNPLDDSQIKWILKELILFNSKIIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLK-TQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPSTKC-EPKQALFAPQNGYYFYFRFLSEIYPILANGTE-------IIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYIK 289
           +L K ++P  D++I  IL ++   +   +    +   E DT I       LK L     K  P+ Y+  S  F+ L   +  G F+PR +TE ++       K +    +LDL +G G +A  ++  + N +  + G++  +    +  KN+  L  K  +FI  D FK  R+  +K + I+ NPPYIDKND  +       EPK AL + Q G       L ++  I    T+       ++ E G+NQ   +     K   T    ++D    +RV Y K
  S:    13 KLKKSISPKRDAEI--ILGQVTKKSRAQLLAFGESLLEYDTIIQ------LKSLIYRRKKGEPIAYLVGSKEFWSLDLKVSPGTFIPRPDTECLVKHVFDLLK-VSHLNVLDLGTGVGTIALALASERPNWN--ITGIDCQKKALFLAHKNKLLLNFKNVKFIYGDWFKYLRN--KKFNLIVSNPPYIDKNDSCLQFRDMIFEPKNALVSKQKG-------LEDLTVICKYSTQHLRQNGWLVLEHGWNQGNYMRALFFKFGFTHIHTIRDYHHYERVTYGK 274
>gi|148266071|ref|YP_001232777.1| HemK family modification methylase [Geobacter uraniireducens Rf4] >gi|146399571|gb|ABQ28204.1| modification methylase, HemK family [Geobacter uraniireducens Rf4] (284 aa)
Score = 180, Expect = 1.3e-11, Identities = 58/212 (27%), Positives = 97/212 (45%)
  Q:    75 NKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKND-PNVDPSTK-CEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVL 286
           +K  P+QYI  S  F GL F +     +PR +TE ++  A    +  +   ILD+  GSG +  +++  K    A ++GV+ +     +  KN     +     +  +F+  +   ++ D I+ NPPYI  +D   + P  +  EP QAL    +G  FY   +      L  G  ++FE+G  Q E +   L K         KD +  +RV+
  S:    72 SKREPLQYILGSQEFMGLEFEVSPAVLIPRHDTEVLV--AEAAARCGEHCRILDIGVGSGCV--SVALAKALPTATILGVDSSPQALVLAQKNADKQGVTVSLFEGSLFEPFQD--QRFDLIVSNPPYIPTDDLKTLQPEVRDYEPIQALDGGADGLDFYRLIVPAASDYLNPGGWLLFEVGVGQAEAVLGLLDKTGFGELFTAKDPNGIERVV 279
>gi|160916054|ref|ZP_02078261.1| hypothetical protein EUBDOL_02081 [Eubacterium dolichum DSM 3991] >gi|158431778|gb|EDP10067.1| hypothetical protein EUBDOL_02081 [Eubacterium dolichum DSM 3991] (284 aa)
Score = 180, Expect = 1.4e-11, Identities = 53/200 (26%), Positives = 99/200 (49%)
  Q:    89 FYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYI----LDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKE----EIEKFLIKNNITVFKFLKDLDDKDRVLYI 288
           FYG  F + +   +PR ETE ++ + +       K  +    +D+ +GSG +A  ++  K+  +  ++  + +    ++  +N ++  +  + +  D+ +       K D +I NPPYI  ++   D     EP  ALF  ++G  FY         +L +   + FE+G+NQKE    E  K+     I V   +KD+  K+R+L+I
  S:    78 FYGYRFKVNEDVLIPRPETEELVAYILAAYDEYFKDTLNVTAVDVGTGSGAIA--VALKKEEPNIHILASDISEKACRIAKQNAQDNDVVVEVLCGDMLEPLIERNIKVDILISNPPYIPSDEAMEDSVVNYEPHVALFGGEDGLKFYRIIFEHAKKVLKDKAMMAFEMGYNQKEALSAEARKYFPDAKIEV---IKDMSGKNRMLFI 280
>gi|33519809|ref|NP_878641.1| putative protoporphyrinogen oxidase [Candidatus Blochmannia floridanus] >gi|33504154|emb|CAD83416.1| methylase of polypeptide chain release factors [Candidatus Blochmannia floridanus] (281 aa)
Score = 180, Expect = 1.4e-11, Identities = 68/251 (27%), Positives = 128/251 (50%)
  Q:    15 FSELTKRLNPLDDSQIKWILKELILFNSKIIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLK-TQFIKSDIF-KIDRSHYEKCDFIICNPPYIDKNDPN-VDPSTKCEPKQALFAPQNGYYFYF----RFLSEIYPILANGTEIIFEIGFNQKEEIEKFL 265
           F +L   L+P  DS+I   + E++   S+       +   ++T +  E  K L+ L     K+ P+ Y+  S  F+ LSF I  G F+PR +TE +++  +      +   +LDL SG G +A  ++  +   +  + G+++ +    + +KNQ++ K +  +F +S+ F KI ++ +     I+ NPPYI+++D + +      EPK AL +P  G         + ++ +YP+      +  E G+NQ + I   L
  S:    12 FLQLKNSLSPRRDSEI---ILEIVTKKSR-----EQLLTFEETTLTPEQIKKLQSLIDRRKKSEPIAYLVGSKEFWSLSFKISPGVFIPRTDTECLIEEVLNLIPDCNHLKVLDLGSGVGSIALALASERPTWN--ITGIDQQQQAVILAIKNQKSYKFRNVEFKQSNWFTKIKKNKFH---LIVSNPPYINEHDLHFLSQDIHFEPKSALVSPYYGLKDLIIICKQSINHLYPM----GWLCLEHGWNQGKYIRTLL 252
>gi|161502470|ref|YP_001569583.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] >gi|160863817|gb|ABX20440.1| hypothetical protein SARI_00514 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] (310 aa)
Score = 180, Expect = 1.5e-11, Identities = 57/203 (28%), Positives = 100/203 (49%)
  Q:    62 EYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKN--QRNLKLKTQFIKSDIFK-IDRSHYEKCDFIICNPPYIDKNDPNVDPST-KCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKF 264
           E  +I++++ + +N+ IPV Y+T    F G  F++ +   VPR     +++           KYILD+C+GSG +A   +Y     DA V  V+ +     V   N  +  L      I+SD+F+ + +  Y   D I+ NPPY+D  D +  P+  + EP+  L +  +G     R L      L++   +I E+G +    +E++
  S:    72 EKHRIVERVIRRVNERIPVAYLTNKAWFCGHEFYVDERVLVPRSPIGELINNHFAGLISQQPKYILDMCTGSGCIAIACAY--AFPDAEVDAVDISPDALAVAEHNIEEHGLIHHVTPIRSDLFRDLPKVQY---DLIVTNPPYVDAEDMSDLPNEYRHEPELGLASGTDGLKLTRRILGNAPDYLSDAGVLICEVGNSMVHLMEQY 273
>gi|29655247|ref|NP_820939.1| protein methyltransferase HemK [Coxiella burnetii RSA 493] >gi|161830961|ref|YP_001596009.1| protein methyltransferase HemK [Coxiella burnetii RSA 331] >gi|29542519|gb|AAO91453.1| protein methyltransferase HemK [Coxiella burnetii RSA 493] >gi|161762828|gb|ABX78470.1| protein methyltransferase HemK [Coxiella burnetii RSA 331] (277 aa)
Score = 179, Expect = 1.5e-11, Identities = 65/253 (25%), Positives = 114/253 (45%)
  Q:    38 ILFNSKIIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKS-DIFKIDRSHYEKC------DF--IICNPPYIDKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYIKK 290
           +L    + ++ +D+F   + +++   +K L    K   K  P+ YI     F+ L+  +     +PR ETE +++W +K     +K  I DL +GSG +            A+ I VE+          +Q  LK+     K  +I   +  H E C      D+  I+ NPPYI   D ++    K EP++AL A  +G       + E    L NG  ++ E G++Q E+I   +  +        +DL    R++  ++
  S:    28 LLLECVLKKSRADLFAYPEIQLNSSQQKTLSAYVKRRLKGEPIAYILGQKEFWSLNLKVTPDVLIPRPETEMLVEWILKNLPKDEKLRIADLGTGSGAV------------ALAIAVERPHWTIDATDNSQAALKIAEINAKQHEIKNCNFYHGEWCQALPRRDYHAIVGNPPYIPDKDQHLQ-QLKHEPREALAAGSDGLSAIKIIIHEAKSYLVNGGWLLLEHGYDQAEKIMTLMQADGYREITDRRDLAGLSRMMVARR 276
>gi|154173807|ref|YP_001408445.1| modification methylase HemK [Campylobacter curvus 525.92] >gi|112802935|gb|EAU00279.1| modification methylase HemK [Campylobacter curvus 525.92] (278 aa)
Score = 179, Expect = 1.6e-11, Identities = 61/206 (29%), Positives = 98/206 (47%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKC----------DFIICNPPYIDKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANG--TEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDR 284
           P+ YIT    FYGL+F ++KG  +PR ETE ++D +++    +    + ++ +GSG+++  I+    N  A +   + N T   +  +N     +           +DR  + KC          D ++ NPPYI + D  +D     EP  ALF    G       L  I  +  N     +  E+G++QK  +EK L  N     KF +DL   DR
  S:    66 PLGYITSKADFYGLNFSVRKGVLIPRPETEILVDKSLEILVNLPAARVAEIGTGSGIISICIAL---NSPAKITATDINETALDLARENAAKFGV-----------VDRIEFIKCAYLDDVSGEFDLLVSNPPYIAQ-DYKLDKFVLNEPHNALFGGLTGD----EILKNIILLARNRRVKNLACEMGYDQKSSLEKALKFNGFEA-KFYQDLAGFDR 263
>gi|170681331|ref|YP_001744531.1| ribosomal large subunit L3 protein glutamine methyltransferase [Escherichia coli SMS-3-5] >gi|170519049|gb|ACB17227.1| ribosomal large subunit L3 protein glutamine methyltransferase [Escherichia coli SMS-3-5] (310 aa)
Score = 179, Expect = 1.6e-11, Identities = 60/203 (29%), Positives = 105/203 (51%)
  Q:    62 EYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDK--KYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKN--QRNLKLKTQFIKSDIFK-IDRSHYEKCDFIICNPPYIDKNDPNVDPST-KCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKF 264
           E  +I++++ + +N+ IPV Y+T    F G  F++ +   VPR     +++   K   LI K  ++ILD+C+GSG +A   +Y     DA V  V+ +     V  +N  +  L      I+SD+F+ + +  Y   D I+ NPPY+D  D +  P+  + EP+  L +  +G     R L      LA+   +I E+G +    +E++
  S:    72 EKHRIVERVIRRVNERIPVAYLTNKAWFCGHEFYVDERVLVPRSPIGELIN--NKFAGLISKQPQHILDMCTGSGCIAIACAY--AFPDAEVDAVDISPDALAVAEQNIEEHGLIHNVIPIRSDLFRDLPKVQY---DLIVTNPPYVDAEDMSDLPNEYRHEPELGLASGTDGLKLTRRILGNAADYLADDGVLICEVGNSMVHLMEQY 273
>gi|187731589|ref|YP_001881152.1| ribosomal large subunit L3 protein glutamine methyltransferase [Shigella boydii CDC 3083-94] >gi|194432949|ref|ZP_03065233.1| ribosomal large subunit L3 protein glutamine methyltransferase [Shigella dysenteriae 1012] >gi|187428581|gb|ACD07855.1| ribosomal large subunit L3 protein glutamine methyltransferase [Shigella boydii CDC 3083-94] >gi|194418937|gb|EDX35022.1| ribosomal large subunit L3 protein glutamine methyltransferase [Shigella dysenteriae 1012] (310 aa)
Score = 179, Expect = 1.6e-11, Identities = 60/203 (29%), Positives = 105/203 (51%)
  Q:    62 EYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDK--KYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKN--QRNLKLKTQFIKSDIFK-IDRSHYEKCDFIICNPPYIDKNDPNVDPST-KCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKF 264
           E  +I++++ + +N+ IPV Y+T    F G  F++ +   VPR     +++   K   LI K  ++ILD+C+GSG +A   +Y     DA V  V+ +     V  +N  +  L      I+SD+F+ + +  Y   D I+ NPPY+D  D +  P+  + EP+  L +  +G     R L      LA+   +I E+G +    +E++
  S:    72 EKHRIVERVIRRVNERIPVAYLTNKAWFCGHEFYVDERVLVPRSPIGELIN--NKFAGLISKQPQHILDMCTGSGCIAIACAY--AFPDAEVDAVDISPDALAVAEQNIEEHGLIHNVIPIRSDLFRDLPKVQY---DLIVTNPPYVDAEDMSDLPNEYRHEPELGLASGTDGLKLTRRILGNAADYLADDGVLICEVGNSMVHLMEQY 273
>gi|89109150|ref|AP_002930.1| N5-glutamine methyltransferase [Escherichia coli W3110] >gi|90111419|ref|NP_416833.4| N5-glutamine methyltransferase [Escherichia coli str. K-12 substr. MG1655] >gi|157161819|ref|YP_001459137.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Escherichia coli HS] >gi|170081946|ref|YP_001731266.1| ribosomal protein L3 N5-glutamine methyltransferase [Escherichia coli str. K12 substr. DH10B] >gi|188493483|ref|ZP_03000753.1| methyltransferase, HemK family [Escherichia coli 53638] >gi|19859177|sp|P39199|YFCB_ECOLI Uncharacterized adenine-specific methylase yfcB >gi|85675359|dbj|BAA16188.2| N5-glutamine methyltransferase [Escherichia coli W3110] >gi|87082085|gb|AAC75390.2| N5-glutamine methyltransferase [Escherichia coli str. K-12 substr. MG1655] >gi|157067499|gb|ABV06754.1| ribosomal large subunit L3 protein glutamine methyltransferase [Escherichia coli HS] >gi|169889781|gb|ACB03488.1| ribosomal protein L3 N5-glutamine methyltransferase [Escherichia coli str. K12 substr. DH10B] >gi|188488682|gb|EDU63785.1| methyltransferase, HemK family [Escherichia coli 53638] (310 aa)
Score = 179, Expect = 1.6e-11, Identities = 60/203 (29%), Positives = 105/203 (51%)
  Q:    62 EYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDK--KYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKN--QRNLKLKTQFIKSDIFK-IDRSHYEKCDFIICNPPYIDKNDPNVDPST-KCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKF 264
           E  +I++++ + +N+ IPV Y+T    F G  F++ +   VPR     +++   K   LI K  ++ILD+C+GSG +A   +Y     DA V  V+ +     V  +N  +  L      I+SD+F+ + +  Y   D I+ NPPY+D  D +  P+  + EP+  L +  +G     R L      LA+   +I E+G +    +E++
  S:    72 EKHRIVERVIRRVNERIPVAYLTNKAWFCGHEFYVDERVLVPRSPIGELIN--NKFAGLISKQPQHILDMCTGSGCIAIACAY--AFPDAEVDAVDISPDALAVAEQNIEEHGLIHNVIPIRSDLFRDLPKVQY---DLIVTNPPYVDAEDMSDLPNEYRHEPELGLASGTDGLKLTRRILGNAADYLADDGVLICEVGNSMVHLMEQY 273
>gi|15801441|ref|NP_287458.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Escherichia coli O157:H7 EDL933] >gi|15830971|ref|NP_309744.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Escherichia coli O157:H7 str. Sakai] >gi|168711514|ref|ZP_02743791.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Escherichia coli O157:H7 str. EC4045] >gi|168721717|ref|ZP_02753994.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Escherichia coli O157:H7 str. EC4206] >gi|168738435|ref|ZP_02770712.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Escherichia coli O157:H7 str. EC4115] >gi|168750772|ref|ZP_02775794.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Escherichia coli O157:H7 str. EC4113] >gi|168758137|ref|ZP_02783144.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Escherichia coli O157:H7 str. EC4401] >gi|168764381|ref|ZP_02789388.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Escherichia coli O157:H7 str. EC4501] >gi|168771101|ref|ZP_02796108.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Escherichia coli O157:H7 str. EC4486] >gi|168776895|ref|ZP_02801902.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Escherichia coli O157:H7 str. EC4196] >gi|168782568|ref|ZP_02807575.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Escherichia coli O157:H7 str. EC4076] >gi|168787716|ref|ZP_02812723.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Escherichia coli O157:H7 str. EC869] >gi|168795959|ref|ZP_02820966.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Escherichia coli O157:H7 str. EC4042] >gi|168801525|ref|ZP_02826532.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Escherichia coli O157:H7 str. EC508] >gi|195939100|ref|ZP_03084482.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Escherichia coli O157:H7 str. EC4024] >gi|12514925|gb|AAG56070.1|AE005338_10 possible protoporphyrinogen oxidase [Escherichia coli O157:H7 EDL933] >gi|13361182|dbj|BAB35140.1| possible protoporphyrinogen oxidase [Escherichia coli O157:H7 str. Sakai] >gi|187767812|gb|EDU31656.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Escherichia coli O157:H7 str. EC4196] >gi|188015064|gb|EDU53186.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Escherichia coli O157:H7 str. EC4113] >gi|189000050|gb|EDU69036.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Escherichia coli O157:H7 str. EC4076] >gi|189354975|gb|EDU73394.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Escherichia coli O157:H7 str. EC4401] >gi|189360088|gb|EDU78507.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Escherichia coli O157:H7 str. EC4486] >gi|189365629|gb|EDU84045.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Escherichia coli O157:H7 str. EC4501] >gi|189372472|gb|EDU90888.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Escherichia coli O157:H7 str. EC869] >gi|189376321|gb|EDU94737.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Escherichia coli O157:H7 str. EC508] (277 aa)
Score = 179, Expect = 1.7e-11, Identities = 55/218 (25%), Positives = 109/218 (50%)
  Q:    68 KQLNKVLNKNI---PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKK-YILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKT-QFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDP-STKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           +QL+ +L +     P+ ++T    F+ L  F+     +PR +TE +++ A+   +L ++   ILDL +G+G +A  ++  ++  D  +  V++      +  +N ++L +K    ++SD F       ++   I+ NPPYID+ DP++     + EP  AL A  +G       + +    L +G  ++ E G+ Q E + +  I       +  +D  D +RV
  S:    53 QQLDALLTRRRDGEPIAHLTGVREFWSLPLFVSPATLIPRPDTECLVEQAL--ARLPEQPCRILDLGTGTGAIA--LALARERPDCEITAVDRMPDAVALAQRNAQHLAIKNIHILQSDWFSALAG--QQFAMIVSNPPYIDEQDPHLQQGDVRFEPLTALVAADSGMADIVHIIEQSRNALVSGGFLLLEHGWQQGEAVRQAFILAGYHDVETCRDYGDNERV 270
>gi|83942387|ref|ZP_00954848.1| modification methylase, HemK family protein [Sulfitobacter sp. EE-36] >gi|83846480|gb|EAP84356.1| modification methylase, HemK family protein [Sulfitobacter sp. EE-36] (280 aa)
Score = 179, Expect = 1.7e-11, Identities = 53/210 (25%), Positives = 103/210 (49%)
  Q:    78 IPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQ--RNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKND-PNVDPSTKC-EPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLY 287
           +PV ++    +FYG  F + +    PR ETE +++ A+ ++     + +LDL +GSG +  T+  + + +DA  +G++ +         N     ++ + +  +SD F      +   D I+ NPPY+ +++  +V P  +  EP+ AL   Q+G   Y    ++    L     ++ EIG+ Q  +++           + L DL  +DRVL+
  S:    71 VPVSHLVGQRAFYGRDFKVSRDVLDPRPETESLIELALSER----FERVLDLGTGSGCILVTL--LAEQQDARGVGLDLSEAACLQASANAVLHGVQARAEIKQSDWFSAAEGRF---DLIVSNPPYLAQSEMADVSPELRLHEPEMALTDGQDGLSVYRIIAAQAQGYLTPTGRVLAEIGWQQGADVKAIFEAAGWGRVRILPDLGGRDRVLW 275
>gi|153828622|ref|ZP_01981289.1| hemK protein [Vibrio cholerae 623-39] >gi|148875893|gb|EDL74028.1| hemK protein [Vibrio cholerae 623-39] (286 aa)
Score = 179, Expect = 1.7e-11, Identities = 54/187 (28%), Positives = 95/187 (50%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKL-KTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVD-PSTKCEPKQALFAPQNGYYFYFRFLSEIYP-ILANGTEIIFEIGFNQKEEIEKFL 265
           P+ YI     F+ L   +     +PR +TE +++ A+ +  LID + +LDL +G+G +A  ++     +   V G++      ++  +N   L +   QF++   F    +   K   I+ NPPYI++NDP++     + EPK AL A +NG     R +S   P  L +G  ++FE G++Q   +   L
  S:    71 PMAYILGEREFWSLPLKVSPSTLIPRPDTERLVELALDKAALIDGE-LLDLGTGTGAIALALASELPTRQ--VTGIDLRPEAAELARENATRLAIHNAQFLQGSWFS-PLADGTKFALIVSNPPYIEENDPHLSLGDVRFEPKSALVAAENGLA-DIRHISTHAPRFLLDGGWLLFEHGYDQGVAVRTIL 255
>gi|125620573|gb|EAZ48939.1| hemK protein [Vibrio cholerae V51] (286 aa)
Score = 179, Expect = 1.7e-11, Identities = 54/187 (28%), Positives = 95/187 (50%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKL-KTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVD-PSTKCEPKQALFAPQNGYYFYFRFLSEIYP-ILANGTEIIFEIGFNQKEEIEKFL 265
           P+ YI     F+ L   +     +PR +TE +++ A+ +  LID + +LDL +G+G +A  ++     +   V G++      ++  +N   L +   QF++   F    +   K   I+ NPPYI++NDP++     + EPK AL A +NG     R +S   P  L +G  ++FE G++Q   +   L
  S:    71 PMAYILGEREFWSLPLKVSPSTLIPRPDTERLVELALDKAALIDGE-LLDLGTGTGAIALALASELPTRQ--VTGIDLRPEAAELARENATRLAIHNAQFLQGSWFS-PLADGTKFALIVSNPPYIEENDPHLSLGDVRFEPKSALVAAENGLA-DIRHISTHAPHFLLDGGWLLFEHGYDQGVAVRTIL 255
>gi|193069963|ref|ZP_03050911.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Escherichia coli E110019] >gi|192956716|gb|EDV87171.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Escherichia coli E110019] (277 aa)
Score = 179, Expect = 1.7e-11, Identities = 56/218 (25%), Positives = 108/218 (49%)
  Q:    68 KQLNKVLNKNI---PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKK-YILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKT-QFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDP-STKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           +QL+ +L +     P+ ++T    F+ L  F+     +PR +TE +++ A+   +L ++   ILDL +G+G +A  ++   +  D  +I V++         +N ++L +K    ++SD F       ++   I+ NPPYID+ DP++     + EP  AL A  +G       + +    L +G  ++ E G+ Q E + +  I       +  +D  D +RV
  S:    53 QQLDALLTRRRDGEPIAHLTGVREFWSLPLFVSPATLIPRPDTECLVEQAL--ARLPEQPCRILDLGTGTGAIA--LALASERPDCEIIAVDRMPDAVSQAQRNAQHLAIKNIHILQSDWFSALAG--QQFAMIVSNPPYIDEQDPHLQQGDVRFEPLTALVAADSGMADIVHIIEQSRNALVSGGFLLLEHGWQQGEAVRQAFILAGYHDVETCRDYGDNERV 270
>gi|168474357|ref|ZP_02703380.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Salmonella enterica subsp. enterica serovar Virchow str. SL491] (310 aa)
Score = 179, Expect = 1.8e-11, Identities = 57/203 (28%), Positives = 100/203 (49%)
  Q:    62 EYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKN--QRNLKLKTQFIKSDIFK-IDRSHYEKCDFIICNPPYIDKNDPNVDPST-KCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKF 264
           E  +I++++ + +N+ IPV Y+T    F G  F++ +   VPR     +++           KYILD+C+GSG +A   +Y     DA V  V+ +     V   N  +  L      I+SD+F+ + +  Y   D I+ NPPY+D  D +  P+  + EP+  L +  +G     R L      L++   +I E+G +    +E++
  S:    72 EKHRIVERVIRRINERIPVAYLTNKAWFCGHEFYVDERVLVPRSPIGELINNHFAGLISQQPKYILDMCTGSGCIAIACAY--AFPDAEVDAVDISPDALAVAEHNIEEHGLIHHVTPIRSDLFRDLPKVQY---DLIVTNPPYVDAEDMSDLPNEYRHEPELGLASGTDGLKLTRRILGSAPDYLSDDGVLICEVGNSMVHLMEQY 273
>gi|149907916|ref|ZP_01896584.1| putative adenine-specific methylase [Moritella sp. PE36] >gi|149808922|gb|EDM68853.1| putative adenine-specific methylase [Moritella sp. PE36] (309 aa)
Score = 179, Expect = 1.8e-11, Identities = 54/203 (26%), Positives = 99/203 (48%)
  Q:    62 EYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYE--KCDFIICNPPYIDKND-PNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKF 264
           E + +++ + + +N+ IP  Y+T    F GL FFI +   VPR     ++    +     +   ILD+C+GSG +A  +S+   + +   + +E            +  ++ +   I+SD+F    S+ E  + D I+ NPPY+D+ D  N+    K EP+  L +  +G     + L++   +L +G  +  EIG +     EKF
  S:    72 ERQTLVELIVRRVNERIPAAYLTNKAWFAGLEFFIDERVLVPRSPFAELIMNGFQPWLTNEPMRILDMCTGSGCIAIALSHAFPDSEIDAVDIEHGAIEVAEINIQEHGVENQVTPIQSDLF----SNLEGLRYDMIVSNPPYVDQEDIDNLPDEFKHEPEIGLQSGFDGLELTLKMLAQAPDMLNDGGLLFVEIGNSMVHMQEKF 273
>gi|170683182|ref|YP_001743982.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Escherichia coli SMS-3-5] >gi|170520900|gb|ACB19078.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Escherichia coli SMS-3-5] (277 aa)
Score = 179, Expect = 1.8e-11, Identities = 56/218 (25%), Positives = 107/218 (49%)
  Q:    68 KQLNKVLNKNI---PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKK-YILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKT-QFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDP-STKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           +QL+ +L +     P+ ++T    F+ L  F+     +PR +TE +++ A+   +L ++   ILDL +G+G +A  ++   +  D  +  V+       +  +N +NL +K    ++SD F       ++   I+ NPPYID+ DP++     + EP  AL A  +G       + +    L +G  ++ E G+ Q E + +  I       +  +D  D +RV
  S:    53 QQLDALLTRRRDGEPIAHLTGVREFWSLPLFVSPATLIPRPDTECLVEQAL--ARLPEQPCRILDLGTGTGAIA--LALASERPDCEITAVDCMPDAVSLAQRNAQNLAIKNIHILQSDWFSALAG--QQFAMIVSNPPYIDEQDPHLQQGDVRFEPLTALVAADSGMADIVHIIEQSRNALVSGGFLLLEHGWQQGEAVRQAFIHAGYHDVETCRDYGDNERV 270
>gi|91228928|ref|ZP_01262826.1| HemK protein [Vibrio alginolyticus 12G01] >gi|91187511|gb|EAS73845.1| HemK protein [Vibrio alginolyticus 12G01] (284 aa)
Score = 179, Expect = 1.8e-11, Identities = 64/217 (29%), Positives = 105/217 (48%)
  Q:    69 QLNKVLNKNI---PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKY-----ILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLK-TQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDP-STKCEPKQALFAPQNGYYFYFRFLSEI-YPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           Q + +L + +   PV YI     F+ L F +     +PR +TE +++ A      +DK Y     +LDL +G+G +A  I+   +     V+GV+  +    +   N   L +K   F +   F+   +   K   I+ NPPYID+ DP++     + EPK AL A +NG     R +S++    L  G  + FE G++Q E + + +           KD    DRV
  S:    60 QFDALLERRLTGEPVAYIIGEREFWSLPFKVSPSTLIPRPDTERLVEVA------LDKTYEQTGPVLDLGTGTGAIA--IALASEMPKRQVMGVDLKQEAKALAEYNAEQLNIKNVTFAQGSWFE-PITEGTKFALIVSNPPYIDEKDPHLSQGDVRFEPKSALVAKENGLA-DIRHISDLARQYLEVGGWLAFEHGYDQGEAVREIMRGFGYQQVATEKDYGGNDRV 277
>gi|82544812|ref|YP_408758.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Shigella boydii Sb227] >gi|81246223|gb|ABB66931.1| putative adenine-specific methylase [Shigella boydii Sb227] (421 aa)
Score = 179, Expect = 1.8e-11, Identities = 60/203 (29%), Positives = 105/203 (51%)
  Q:    62 EYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDK--KYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKN--QRNLKLKTQFIKSDIFK-IDRSHYEKCDFIICNPPYIDKNDPNVDPST-KCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKF 264
           E  +I++++ + +N+ IPV Y+T    F G  F++ +   VPR     +++   K   LI K  ++ILD+C+GSG +A   +Y     DA V  V+ +     V  +N  +  L      I+SD+F+ + +  Y   D I+ NPPY+D  D +  P+  + EP+  L +  +G     R L      LA+   +I E+G +    +E++
  S:   183 EKHRIVERVIRRVNERIPVAYLTNKAWFCGHEFYVDERVLVPRSPIGELIN--NKFAGLISKQPQHILDMCTGSGCIAIACAY--AFPDAEVDAVDISPDALAVAEQNIEEHGLIHNVIPIRSDLFRDLPKVQY---DLIVTNPPYVDAEDMSDLPNEYRHEPELGLASGTDGLKLTRRILGNAADYLADDGVLICEVGNSMVHLMEQY 384
>gi|161612878|ref|YP_001586844.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|167549608|ref|ZP_02343367.1| hypothetical protein Sentente_03814 [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] >gi|168220527|ref|ZP_02645759.1| hypothetical protein Senterenterica_09047 [Salmonella enterica subsp. enterica serovar Agona str. SL483] >gi|161362242|gb|ABX66010.1| hypothetical protein SPAB_00584 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] (310 aa)
Score = 179, Expect = 1.8e-11, Identities = 57/203 (28%), Positives = 100/203 (49%)
  Q:    62 EYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKN--QRNLKLKTQFIKSDIFK-IDRSHYEKCDFIICNPPYIDKNDPNVDPST-KCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKF 264
           E  +I++++ + +N+ IPV Y+T    F G  F++ +   VPR     +++           KYILD+C+GSG +A   +Y     DA V  V+ +     V   N  +  L      I+SD+F+ + +  Y   D I+ NPPY+D  D +  P+  + EP+  L +  +G     R L      L++   +I E+G +    +E++
  S:    72 EKHRIVERVIRRINERIPVAYLTNKAWFCGHEFYVDERVLVPRSPIGELINNHFAGLISQQPKYILDMCTGSGCIAIACAY--AFPDAEVDAVDISPDALAVAEHNIEEHGLIHHVTPIRSDLFRDLPKVQY---DLIVTNPPYVDAEDMSDLPNEYRHEPELGLASGTDGLKLTRRILGNAPDYLSDDGVLICEVGNSMVHLMEQY 273
>gi|16761309|ref|NP_456926.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Salmonella enterica subsp. enterica serovar Typhi str. CT18] >gi|16765712|ref|NP_461327.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Salmonella typhimurium LT2] >gi|29140995|ref|NP_804337.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] >gi|167544528|ref|ZP_02340099.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23] >gi|167556228|ref|ZP_02349244.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853] >gi|167993074|ref|ZP_02574169.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701] >gi|168228060|ref|ZP_02653291.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433] >gi|168229760|ref|ZP_02654818.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191] >gi|168242511|ref|ZP_02667443.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Salmonella enterica subsp. enterica serovar Heidelberg str. SL486] >gi|168261591|ref|ZP_02683564.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] >gi|168817877|ref|ZP_02829877.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537] >gi|61250532|sp|P0A293|YFCB_SALTY Uncharacterized adenine-specific methylase yfcB >gi|61250534|sp|P0A294|YFCB_SALTI Uncharacterized adenine-specific methylase yfcB >gi|25512989|pir||AG0804 conserved hypothetical protein STY2617 [imported] - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) >gi|16420929|gb|AAL21286.1| putative methylase [Salmonella typhimurium LT2] >gi|16503608|emb|CAD07617.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Typhi] >gi|29136620|gb|AAO68186.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Typhi Ty2] (310 aa)
Score = 179, Expect = 1.8e-11, Identities = 57/203 (28%), Positives = 100/203 (49%)
  Q:    62 EYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKN--QRNLKLKTQFIKSDIFK-IDRSHYEKCDFIICNPPYIDKNDPNVDPST-KCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKF 264
           E  +I++++ + +N+ IPV Y+T    F G  F++ +   VPR     +++           KYILD+C+GSG +A   +Y     DA V  V+ +     V   N  +  L      I+SD+F+ + +  Y   D I+ NPPY+D  D +  P+  + EP+  L +  +G     R L      L++   +I E+G +    +E++
  S:    72 EKHRIVERVIRRINERIPVAYLTNKAWFCGHEFYVDERVLVPRSPIGELINNHFAGLISQQPKYILDMCTGSGCIAIACAY--AFPDAEVDAVDISPDALAVAEHNIEEHGLIHHVTPIRSDLFRDLPKVQY---DLIVTNPPYVDAEDMSDLPNEYRHEPELGLASGTDGLKLTRRILGNAPDYLSDDGVLICEVGNSMVHLMEQY 273
>gi|27365325|ref|NP_760853.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Vibrio vulnificus CMCP6] >gi|27361472|gb|AAO10380.1|AE016803_167 Adenine-specific methylase [Vibrio vulnificus CMCP6] (292 aa)
Score = 178, Expect = 2.0e-11, Identities = 56/203 (27%), Positives = 102/203 (50%)
  Q:    62 EYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYI--KKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQF--IKSDIFK-IDRSHYEKCDFIICNPPYIDKNDPNVDPST-KCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKF 264
           E  +I++++ K +N+  P  Y+T    F GL FF+ +   VPR     ++    +   + +   I+DLC+GSG +A   ++   +   DAI I V+       V  +N ++  ++ Q   I+SD+F+ + +  Y   + I+ NPPY+D+ D N  P+    EP   L A  +G     R L+     L     ++ E+G +    +E++
  S:    54 ERLRIVERVVKRINERTPTAYLTNKAWFCGLEFFVDERVLVPRSPIGELIQAQFEPWLIEEPVRIMDLCTGSGCIAIACAHAFPEAEVDAIDISVDA----LAVAEQNIQDHGMEQQVFPIRSDLFRDLPKEQY---NIIVTNPPYVDEEDMNSLPTEFTHEPALGLAAGTDGLKLVRRILANAPDYLTEKGILVCEVGNSMVHMMEQY 255
>gi|37680619|ref|NP_935228.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Vibrio vulnificus YJ016] >gi|37199367|dbj|BAC95199.1| putative adenine-specific methylase [Vibrio vulnificus YJ016] (310 aa)
Score = 178, Expect = 2.0e-11, Identities = 56/203 (27%), Positives = 102/203 (50%)
  Q:    62 EYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYI--KKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQF--IKSDIFK-IDRSHYEKCDFIICNPPYIDKNDPNVDPST-KCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKF 264
           E  +I++++ K +N+  P  Y+T    F GL FF+ +   VPR     ++    +   + +   I+DLC+GSG +A   ++   +   DAI I V+       V  +N ++  ++ Q   I+SD+F+ + +  Y   + I+ NPPY+D+ D N  P+    EP   L A  +G     R L+     L     ++ E+G +    +E++
  S:    72 ERLRIVERVVKRINERTPTAYLTNKAWFCGLEFFVDERVLVPRSPIGELIQAQFEPWLIEEPVRIMDLCTGSGCIAIACAHAFPEAEVDAIDISVDA----LAVAEQNIQDHGMEQQVFPIRSDLFRDLPKEQY---NIIVTNPPYVDEEDMNSLPTEFTHEPALGLAAGTDGLKLVRRILANAPDYLTEKGILVCEVGNSMVHMMEQY 273
>gi|183599681|ref|ZP_02961174.1| hypothetical protein PROSTU_03170 [Providencia stuartii ATCC 25827] >gi|188021935|gb|EDU59975.1| hypothetical protein PROSTU_03170 [Providencia stuartii ATCC 25827] (310 aa)
Score = 178, Expect = 2.0e-11, Identities = 57/203 (28%), Positives = 103/203 (50%)
  Q:    62 EYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQF--IKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPST-KCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKF 264
           E  +I++++ + +N+ +PV Y+T    F G  F++ +   +PR     +++         + + ILD+C+GSG +A   +Y  +  +A V  V+ +     V   N  N  L+ +   I+SD+F+ D     K D I+ NPPY+D  D +  P   + EP+ AL A  +G     R L+     L++   +I E+G +    IE++
  S:    72 ERHRIIERVLRRINERVPVAYLTNCSWFCGHEFYVDERVLIPRSPIGELINNHFVGLLADEPRTILDMCTGSGCIAIACAY--EFPEAEVDAVDISTDVLAVTEHNIANHGLEHRVIPIRSDLFR-DMPDV-KYDLIVTNPPYVDAEDMDDLPEEFRVEPELALAAGSDGLKLVRRILANAPRFLSDEGVLICEVGNSMVHLIEQY 273
>gi|82776552|ref|YP_402901.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Shigella dysenteriae Sd197] >gi|81240700|gb|ABB61410.1| possible protoporphyrinogen oxidase [Shigella dysenteriae Sd197] (277 aa)
Score = 178, Expect = 2.0e-11, Identities = 55/218 (25%), Positives = 109/218 (50%)
  Q:    68 KQLNKVLNKNI---PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKK-YILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKT-QFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDP-STKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           +QL+ +L +     P+ ++T    F+ L  F+     +PR +TE +++ A+   +L ++   ILDL +G+G +A  ++  ++  D  +  V++      +  +N ++L +K    ++SD F       ++   I+ NPPYID+ DP++     + EP  AL A  +G       + +    L +G  ++ E G+ Q E + +  I       +  +D  D +RV
  S:    53 QQLDALLTRRRDGEPIAHLTGVREFWSLPLFVSPATLIPRPDTECLVEQAL--ARLPEQPCRILDLGTGTGAIA--LALARERPDCEITAVDRMPDAVALAQRNAQHLAIKNIHILQSDWFS--ELAGQQFAMIVSNPPYIDEQDPHLQQGDVRFEPLTALVAADSGMADIVHIIEQSRNALVSGGFLLLEHGWQQGEAVRQAFILAGYHDVETCRDYGDNERV 270
>gi|150388170|ref|YP_001318219.1| HemK family modification methylase [Alkaliphilus metalliredigens QYMF] >gi|149948032|gb|ABR46560.1| modification methylase, HemK family [Alkaliphilus metalliredigens QYMF] (293 aa)
Score = 178, Expect = 2.1e-11, Identities = 57/211 (27%), Positives = 111/211 (52%)
  Q:    76 KNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKY------ILDLCSGSGVLANTIS-YIKKNKDAIVIGVEKNRTPYKVGVKNQRN--LKLKTQFIKSDIFKIDRSH--YEKCDFIICNPPYIDKN-DPNVDPSTK-CEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVL 286
           K +PVQYI  +  F GL F ++ G  +PR +TE +++  +    L +  Y      ++D+ +GSG +A +++ +I+++K   +  ++ +    ++   N R   ++ K  F    +F+  + +       F+I NPPYI  +    + P  K  EP+ AL    +G  FY   + +    L     + FEIG++Q E+++  +     +  + ++DL   DRV+
  S:    67 KRMPVQYIVGTQEFMGLDFRVESGVLIPRADTEILVESVL---GLYEVHYNNEAVALMDIGTGSGAIAISLARFIERSK---IYAIDLSEKALEIAENNGRTNEVQHKISFFYGSLFEPLKGYDLEGTFQFVISNPPYIPPDVVEELSPQVKDYEPRMALEGGADGLDFYREIVEKAPQYLQMKGWLCFEIGYDQGEQVKGLMETRGFSRVEVIRDLAGLDRVV 284
>gi|148359877|ref|YP_001251084.1| protein methyltransferase HemK [Legionella pneumophila str. Corby] >gi|148281650|gb|ABQ55738.1| protein methyltransferase HemK [Legionella pneumophila str. Corby] (287 aa)
Score = 178, Expect = 2.2e-11, Identities = 63/240 (26%), Positives = 108/240 (45%)
  Q:    46 ENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKT-QFIKSDIF-KIDRSHYEKCDFIICNPPYIDKNDPNVDP-STKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           +N + +F   D  +  E  +   Q+ K   + +P+ YIT    F+ LS  +     +PR ETE +++ A++     +   +L+L +GSG +A  ++  K+     +   + ++   ++   N + L L    F  S  F  +    Y     I+ NPPYI +NDP++     + EP  AL + Q+G       +   Y  L     ++ E GF QK EI   L +         +DL   DRV
  S:    36 KNRAYLFAHPDALVSPEQIETYLQMIKQRAEGLPIAYITGQREFWSLSLKVTPNVLIPRHETERLVELALELIPDKENVSVLELGTGSGAIA--LALAKERPLWHIDACDFSKEALELARYNAKTLGLNNINFCHSYWFNNLPLKQYHA---IVSNPPYIAENDPHLKKGDVRFEPTSALVSSQDGLADLQYIIQHSYEYLLPDGLLLVEHGFEQKNEISAILNQLGYKNIHCWQDLQGHDRV 273
>gi|62180957|ref|YP_217374.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|62128590|gb|AAX66293.1| putative methylase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] (310 aa)
Score = 178, Expect = 2.2e-11, Identities = 57/203 (28%), Positives = 100/203 (49%)
  Q:    62 EYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKN--QRNLKLKTQFIKSDIFK-IDRSHYEKCDFIICNPPYIDKNDPNVDPST-KCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKF 264
           E  +I++++ + +N+ IPV Y+T    F G  F++ +   VPR     +++           KYILD+C+GSG +A   +Y     DA V  V+ +     V   N  +  L      I+SD+F+ + +  Y   D I+ NPPY+D  D +  P+  + EP+  L +  +G     R L      L++   +I E+G +    +E++
  S:    72 EKHRIVERVIRRINERIPVAYLTNRAWFCGHEFYVDERVLVPRSPIGELINNHFAGLISQQPKYILDMCTGSGCIAIACAY--AFPDAEVDAVDISPDALAVAEHNIEEHGLIHHVTPIRSDLFRDLPKVQY---DLIVTNPPYVDAEDMSDLPNEYRHEPELGLASGTDGLKLTRRILGNAPDYLSDDGVLICEVGNSMVHLMEQY 273
>gi|168237410|ref|ZP_02662468.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480] (310 aa)
Score = 178, Expect = 2.2e-11, Identities = 51/203 (25%), Positives = 97/203 (47%)
  Q:    62 EYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFK-IDRSHYEKCDFIICNPPYIDKNDPNVDPST-KCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKF 264
           E  +I++++ + +N+ IPV Y+T    F G  F++ +   VPR     +++           KYILD+C+GSG +A   +Y   + +   + +  +          +  L      I+SD+F+ + +  Y   D I+ NPPY+D  D +  P+  + EP+  L +  +G     R L      L++   +I E+G +    +E++
  S:    72 EKHRIVERVIRRINERIPVAYLTNKAWFCGHEFYVDERVLVPRSPIGELINNHFAGLISQQPKYILDMCTGSGCIAIACAYAFPDSEVDAVDISPDALAVAEHNIEEHGLIHHVTPIRSDLFRDLPKVQY---DLIVTNPPYVDAEDMSDLPNEYRHEPELGLASGTDGLKLTRRILGNAPDYLSDDGVLICEVGNSMVHLMEQY 273
>gi|57239542|ref|YP_180678.1| bifunctional methyltransferase HemK/tRNA (guanine-N(7)-)-methyltransferase protoporphyrinogen oxidase [Ehrlichia ruminantium str. Welgevonden] >gi|58579527|ref|YP_197739.1| bifunctional methyltransferase HemK/tRNA (guanine-N(7)-)-methyltransferase protoporphyrinogen oxidase [Ehrlichia ruminantium str. Welgevonden] >gi|57161621|emb|CAH58549.1| putative methyltransferase [Ehrlichia ruminantium str. Welgevonden] >gi|58418153|emb|CAI27357.1| Bifunctional methyltransferase-hemK proteinhomolog and tRNA (guanine-N(7)-)-methyltransferase protoporphyrinogen oxidase (hemK) [Ehrlichia ruminantium str. Welgevonden] (280 aa)
Score = 178, Expect = 2.3e-11, Identities = 80/268 (29%), Positives = 125/268 (46%)
  Q:    23 NPLDDSQIKWILKELILFNSKIIENSSDIFFEK-DTEI--DFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLD-----WAVKQKKLIDKKYILDLCSGSGVLANTI-SYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKND-PNVDPSTKC-EPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYIKK 290
           NP  D ++  I++ L+  +  I+     I   K DTEI  D   K+ L         N+P+ +I     F+ + F +      PR ++E ++      +  K ++L+    I D  +G+G L   + SY K    A+ I VEKN   Y+V  +N +N K+  + IK  +   + + YE CD I+ NPPYI +N    + P  K  EP  AL     G   YF     I   L      + EIG +Q  +I   + K  +    +  DL  K R + IK+
  S:    22 NPKRDVEV--IIRHLMNVDGLIVVKDPYISLNKTDTEIFWDMVKKRAL---------NVPISHIIGKREFWSMDFIVNSHVLDPRPDSESIISAVFTMYPCKNRRLV----IGDFGTGTGCLLTVLLSYYKL---AVGIAVEKNVKAYRVAYQNFKNHKVYNR-IKMRLSSWN-TCYEMCDLIVSNPPYIRRNKIMTLQPEVKLYEPYVALDGGPVGLENYFSIFVVIKRCLKKNGVAVLEIGEDQL-QIHHIICKYGLKFHSYCYDLSGKKRCIIIKQ 279
>gi|58617581|ref|YP_196780.1| bifunctional methyltransferase HemK/tRNA (guanine-N(7)-)-methyltransferase protoporphyrinogen oxidase [Ehrlichia ruminantium str. Gardel] >gi|58417193|emb|CAI28306.1| Bifunctional methyltransferase-hemK proteinhomolog and tRNA (guanine-N(7)-)-methyltransferase protoporphyrinogen oxidase (hemK) [Ehrlichia ruminantium str. Gardel] (280 aa)
Score = 178, Expect = 2.3e-11, Identities = 80/268 (29%), Positives = 125/268 (46%)
  Q:    23 NPLDDSQIKWILKELILFNSKIIENSSDIFFEK-DTEI--DFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLD-----WAVKQKKLIDKKYILDLCSGSGVLANTI-SYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKND-PNVDPSTKC-EPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYIKK 290
           NP  D ++  I++ L+  +  I+     I   K DTEI  D   K+ L         N+P+ +I     F+ + F +      PR ++E ++      +  K ++L+    I D  +G+G L   + SY K    A+ I VEKN   Y+V  +N +N K+  + IK  +   + + YE CD I+ NPPYI +N    + P  K  EP  AL     G   YF     I   L      + EIG +Q  +I   + K  +    +  DL  K R + IK+
  S:    22 NPKRDVEV--IIRHLMNVDGLIVVKDPYISLNKTDTEIFWDMVKKRAL---------NVPISHIIGKREFWSMDFIVNSHVLDPRPDSESIISAVFTMYPCKNRRLV----IGDFGTGTGCLLTVLLSYYKL---AVGIAVEKNVKAYRVAYQNFKNHKVYNR-IKMRLSSWN-TCYEMCDLIVSNPPYIRRNKIMTLQPEVKLYEPYVALDGGPVGLENYFSIFVVIKRCLKKNGVAVLEIGEDQL-QIHHIVCKYGLKFHSYCYDLSGKKRCIIIKQ 279
>gi|194436964|ref|ZP_03069063.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Escherichia coli 101-1] >gi|194423947|gb|EDX39935.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Escherichia coli 101-1] (277 aa)
Score = 178, Expect = 2.4e-11, Identities = 55/218 (25%), Positives = 109/218 (50%)
  Q:    68 KQLNKVLNKNI---PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKK-YILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKT-QFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDP-STKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           +QL+ +L +     P+ ++T    F+ L  F+     +PR +TE +++ A+   +L ++   ILDL +G+G +A  ++   +  D  +  V++      +  +N ++L +K  + ++SD F       ++   I+ NPPYID+ DP++     + EP  AL A  +G       + +    L +G  ++ E G+ Q E + +  I       +  +D  D +RV
  S:    53 QQLDALLTRRRDGEPIAHLTGVREFWSLPLFVSPATLIPRPDTECLVEQAL--ARLPEQPCRILDLGTGTGAIA--LALASERPDCEITAVDRMPDAVALAQRNAQHLAIKNIRILQSDWFSALAG--QQFTMIVSNPPYIDEQDPHLQQGDVRFEPLTALVAADSGMADIVHIIEQSRNALVSGGFLLLEHGWQQGEAVRQAFILAGYHDVETCRDYGDNERV 270
>gi|153825564|ref|ZP_01978231.1| hemK protein [Vibrio cholerae MZO-2] >gi|149740715|gb|EDM54814.1| hemK protein [Vibrio cholerae MZO-2] (286 aa)
Score = 178, Expect = 2.4e-11, Identities = 54/187 (28%), Positives = 95/187 (50%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKL-KTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVD-PSTKCEPKQALFAPQNGYYFYFRFLSEIYP-ILANGTEIIFEIGFNQKEEIEKFL 265
           P+ YI     F+ L   +     +PR +TE +++ A+ +  LID + +LDL +G+G +A  ++     +   V G++      ++  +N   L +   QF++   F    +   K   I+ NPPYI++NDP++     + EPK AL A +NG     R +S   P  L +G  ++FE G++Q   +   L
  S:    71 PMAYILGEREFWSLPLKVSPSTLIPRPDTERLVELALDKAALIDGE-LLDLGTGTGAIALALASELPTRQ--VTGIDLRPEAAELARENATRLAIHNAQFLQGSWFS-PLADGTKFALIVSNPPYIEENDPHLSLGDLRFEPKSALVAAENGLA-DIRHISTHAPRFLLDGGWLLFEHGYDQGVAVRTIL 255
>gi|154707092|ref|YP_001425369.1| protein methyltransferase HemK [Coxiella burnetii Dugway 5J108-111] >gi|154356378|gb|ABS77840.1| protein methyltransferase HemK [Coxiella burnetii Dugway 5J108-111] (277 aa)
Score = 177, Expect = 2.6e-11, Identities = 65/253 (25%), Positives = 113/253 (44%)
  Q:    38 ILFNSKIIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKS-DIFKIDRSHYEKC------DF--IICNPPYIDKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYIKK 290
           +L    + ++ +D+F   + +++   +K L    K   K  P+ YI     F+ L+  +     +PR ETE ++ W +K     +K  I DL +GSG +            A+ I VE+          +Q  LK+     K  +I   +  H E C      D+  I+ NPPYI   D ++    K EP++AL A  +G       + E    L NG  ++ E G++Q E+I   +  +        +DL    R++  ++
  S:    28 LLLECVLKKSRADLFAYPEIQLNSSQQKTLSAYVKRRLKGEPIAYILGQKEFWSLNLKVTPDVLIPRPETEMLVGWILKNLPKDEKLRIADLGTGSGAV------------ALAIAVERPHWTIDATDNSQAALKIAEINAKQHEIKNCNFYHGEWCQALPRRDYHAIVGNPPYIPDKDQHLQ-QLKHEPREALAAGSDGLSAIKIIIHEAKSYLVNGGWLLLEHGYDQAEKIMTLMQADGYREITDRRDLAGLSRMMVARR 276
>gi|77979081|ref|ZP_00834502.1| COG2890: Methylase of polypeptide chain release factors [Yersinia intermedia ATCC 29909] (315 aa)
Score = 177, Expect = 2.8e-11, Identities = 49/193 (25%), Positives = 94/193 (48%)
  Q:    62 EYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKND-PNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIG 254
           E  +I++++ + +N+ IPV Y+T    F G+ +++ +   VPR     +++ +         K+ILD+C+GSG +A   +Y   + +   + +  +          Q  ++ +   I+SD+F+ D     K D I+ NPPY+D  D  ++    + EP+  L A  +G     R L+     L +   +I E+G
  S:    77 ERHRIVERVIRRVNERIPVAYLTNKAWFCGMEYYVDERVLVPRSPIAELINNSFDGLIRHQPKHILDMCTGSGCIAIACAYAFPDAEVDAVDISNDVLAVTEHNIQQHEMEHQVTPIRSDLFR-DLPPI-KYDLIVTNPPYVDAEDMADLPQEFRFEPELGLAAGSDGLKLARRILACAPDFLQDDGVLICEVG 268
>gi|15642177|ref|NP_231809.1| hemK protein [Vibrio cholerae O1 biovar eltor str. N16961] >gi|121586800|ref|ZP_01676582.1| hemK protein [Vibrio cholerae 2740-80] >gi|153223515|ref|ZP_01953917.1| hemK protein [Vibrio cholerae MAK 757] >gi|153818816|ref|ZP_01971483.1| hemK protein [Vibrio cholerae NCTC 8457] >gi|153823574|ref|ZP_01976241.1| hemK protein [Vibrio cholerae B33] >gi|194532093|ref|YP_002067527.1| hemK protein [Vibrio cholerae MO10] >gi|18203196|sp|Q9KQ26|HEMK_VIBCH Protein hemK homolog (M.VchAHemK2P) >gi|9656732|gb|AAF95323.1| hemK protein [Vibrio cholerae O1 biovar El Tor str. N16961] >gi|121548967|gb|EAX59006.1| hemK protein [Vibrio cholerae 2740-80] >gi|124118153|gb|EAY36896.1| hemK protein [Vibrio cholerae MAK 757] >gi|125618047|gb|EAZ46594.1| hemK protein [Vibrio cholerae MO10] >gi|126510659|gb|EAZ73253.1| hemK protein [Vibrio cholerae NCTC 8457] >gi|126518909|gb|EAZ76132.1| hemK protein [Vibrio cholerae B33] (286 aa)
Score = 177, Expect = 2.8e-11, Identities = 54/187 (28%), Positives = 94/187 (50%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKL-KTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVD-PSTKCEPKQALFAPQNGYYFYFRFLSEIYP-ILANGTEIIFEIGFNQKEEIEKFL 265
           P+ YI     F+ L   +     +PR +TE +++ A+ +  LID + +LDL +G+G +A  ++     +   V G++      ++  +N   L +   QF +   F    +   K   I+ NPPYI++NDP++     + EPK AL A +NG     R +S   P  L +G  ++FE G++Q   +   L
  S:    71 PMAYILGEREFWSLPLKVSPSTLIPRPDTERLVELALDKAALIDGE-LLDLGTGTGAIALALASELPTRQ--VTGIDLRPEAAELARENATRLAIHNAQFFQGSWFS-PLADGTKFALIVSNPPYIEENDPHLSLGDVRFEPKSALVAAENGLA-DIRHISTHAPHFLLDGGWLLFEHGYDQGVAVRTIL 255
>gi|28897518|ref|NP_797123.1| HemK protein [Vibrio parahaemolyticus RIMD 2210633] >gi|28805730|dbj|BAC59007.1| HemK protein [Vibrio parahaemolyticus RIMD 2210633] (285 aa)
Score = 177, Expect = 2.9e-11, Identities = 62/217 (28%), Positives = 103/217 (47%)
  Q:    69 QLNKVLNKNI---PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKY-----ILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDP-STKCEPKQALFAPQNGYYFYFRFLSEI-YPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           Q N +L + +   PV YI     F+ L   +     +PR +TE +++ A      +DK Y     ILDL +G+G +A  ++    N+   V+GV+  +   ++   N   L +K        +    +   K   I+ NPPY+D+ DP++     + EPK AL A +NG     R +S++    L  G  + FE G++Q E + + +           KD    DRV
  S:    60 QFNALLARRLAGEPVAYIIGEREFWSLPLKVSPTTLIPRPDTERLVEVA------LDKTYGQTGSILDLGTGTGAIALALASELPNRQ--VMGVDLKQEAKELAEYNAAQLNIKNVTFDQGSWFEPIAEGTKFALIVSNPPYVDEKDPHLSQGDVRFEPKSALVADENGLA-DIRHISDLARQYLEEGGWLAFEHGYDQGEAVREIMRGFGYQQVVTEKDYGGNDRV 277
>gi|91762345|ref|ZP_01264310.1| HemK [Candidatus Pelagibacter ubique HTCC1002] >gi|91718147|gb|EAS84797.1| HemK [Candidatus Pelagibacter ubique HTCC1002] (280 aa)
Score = 177, Expect = 2.9e-11, Identities = 64/257 (24%), Positives = 112/257 (43%)
  Q:    34 LKELILFNSKIIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNV--DPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYIKK 290
           L   IL ++ I  +   I       ++ E  +  K L +   K  P+ Y+     F+   FF+ K   +PR ++E +++  +K     D   +LD+ +GSG +  +I   + N     I + K           Q NL  + +F  S +   +   Y   D ++ NPPYI++             EPK AL    +G+    + +++   ++    + I EIGFNQK ++ K L +    V K +KD  + DR +   K
  S:    24 LDSEILLSNSIKRDKKHIILNPKEVLNSEQLRKFKSLIERRKKGEPIAYLINKKEFWKDEFFVNKDVLIPRPDSELIIEQVLKIYSKDDHLQLLDIGTGSGCILLSILKERSNFYGTGIDISKKSINVSKFNAKQLNLTNRVKFFHSSVDNFNNGKY---DIVVSNPPYIEQLSLKYLEKDVVNFEPKLALSGGFDGFSKIRKVINKASILIKKNGKFILEIGFNQKNKVIKILKEEGFYVNKAIKDYGNNDRCIISTK 279
>gi|57237024|ref|YP_178826.1| HemK family modification methylase [Campylobacter jejuni RM1221] >gi|57165828|gb|AAW34607.1| modification methylase, HemK family [Campylobacter jejuni RM1221] (271 aa)
Score = 177, Expect = 3.0e-11, Identities = 75/239 (31%), Positives = 118/239 (49%)
  Q:    51 IFFEKDTEIDFE-YKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQF-IKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEI--YPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYIK 289
           +F  +D +ID E Y K++++         P +YI +   F+GL F IKKG  +PR ++E +L   +   K      IL++  GSG+L+  ++   K     +   + N    ++ ++N +  K+      K   FK  + +Y   DFI  NPPYI KN   +D   + EPK+ALF  + GY      L EI  + +      +  E G++QKE +EK L +NN  V  F KD    +R    K
  S:    36 LFLNQDIQIDHEPYFKLIRRFKS----GEPFEYIFEKVDFWGLEFKIKKGILIPRYDSEILLFQILNLCKKNTFNGILEIGFGSGILSIILA---KELGLKITACDINLKALELALENAKLHKVDHLIDFKLCNFKQIKENY---DFIFSNPPYI-KNSYPIDIWVQKEPKEALFGGEKGY----EILEEIIHFSLDKKVKFLACEFGYDQKEILEKILYQNNFIV-DFFKDEQGYNRAFVAK 262
>gi|90022890|ref|YP_528717.1| protein methyltransferase hemK [Saccharophagus degradans 2-40] >gi|89952490|gb|ABD82505.1| modification methylase, HemK family [Saccharophagus degradans 2-40] (288 aa)
Score = 177, Expect = 3.1e-11, Identities = 65/219 (29%), Positives = 109/219 (49%)
  Q:    67 LKQLNKVLNKN---IPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKK------YILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLK-TQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDP-STKCEPKQALFAPQNGYYFYFRFLSEIYPI--------LANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           L+Q N+++++     P+ Y+T    F+ L   +     +PR +TE +++ A++  + + +K       ILDL +G+G +A  ++   +   A +  V+K     ++  KN+  L  K    + SD F       +K   I+ NPPYID+ DP++     + EP  AL AP  G       L++I  I        L NG  +  E G+ Q E +     KN     +  KD    DRV
  S:    57 LQQFNQLVSQRQQGTPIAYLTGEKEFWSLPLQVSPATLIPRGDTEILVEVALELAQTLQQKNPQEHIRILDLGTGTGAIA--LALASELPTANITAVDKMPQAVELAEKNRAALGFKNVTVLHSDWFSA--ITLQKFHVIVSNPPYIDEQDPHLKQGDVRFEPLTALVAPNQG-------LADIQHIAEHAKQHLLPNGF-LCVEHGWQQAEAVRGVFEKNGYVGVRSEKDNGGNDRV 282
>gi|40062726|gb|AAR37631.1| modification methylase, HemK family [uncultured marine bacterium 438] (280 aa)
Score = 177, Expect = 3.1e-11, Identities = 65/257 (25%), Positives = 112/257 (43%)
  Q:    34 LKELILFNSKIIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNV--DPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYIKK 290
           L   IL ++ I  +   +       ++ E     K L +   K  P+ Y+     F+   FF+ K   +PR ++E +++  +K     D+  ILD+ +GSG +  +I   + N     I + K           Q NL  + +F  S +   +   Y   D I+ NPPYI++             EPK AL    +G+    + +++   ++    + I EIGFNQK ++ K L +    V K +KD  + DR +   K
  S:    24 LDSEILLSNSIKRDKKHVILNPKEVLNSEQLGKFKSLIERRKKGEPIAYLINKKEFWKDEFFVNKDVLIPRPDSELIIEQVLKIYSKDDQLQILDIGTGSGCILLSILKERSNFYGTGIDISKKSIDVSKFNAKQLNLTNRVKFFHSSVDNFNNGKY---DIIVSNPPYIEQLCLKYLEKDVVNFEPKLALSGGFDGFSKIRKVINKTSNLIKKNGKFILEIGFNQKNKVIKILKEEGFYVNKAIKDYGNNDRCIISTK 279
>gi|156933075|ref|YP_001436991.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Enterobacter sakazakii ATCC BAA-894] >gi|156531329|gb|ABU76155.1| hypothetical protein ESA_00885 [Enterobacter sakazakii ATCC BAA-894] (338 aa)
Score = 177, Expect = 3.1e-11, Identities = 54/203 (26%), Positives = 102/203 (50%)
  Q:    62 EYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDK--KYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFK-IDRSHYEKCDFIICNPPYIDKNDPNVDPST-KCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKF 264
           E  +I++++ + +N+ IPV Y+T    F G  F++ +   VPR     +++   +   LID   ++ILD+C+GSG +A   +Y   N +   + +  +          +  L      I+SD+F+ + +  Y   D I+ NPPY+D+ D +  P+  + EP+  L A  +G     R L+     L +   +I E+G +    +E++
  S:   100 ERHRIVERVIRRVNERIPVAYLTNKAWFCGHEFYVDERVLVPRSPIGELIN--NRFAGLIDHEPQHILDMCTGSGCIAIACAYAFPNAEVDAVDISADALAVTEHNIEEHGLIHHVTPIRSDLFRDLPKVQY---DIIVTNPPYVDEEDMSDLPNEYRHEPELGLAAGSDGLKLARRILACSPDYLTDNGILICEVGNSMVHLMEQY 301
>gi|149925824|ref|ZP_01914088.1| modification methylase, HemK family protein [Limnobacter sp. MED105] >gi|149825941|gb|EDM85149.1| modification methylase, HemK family protein [Limnobacter sp. MED105] (307 aa)
Score = 177, Expect = 3.2e-11, Identities = 61/234 (26%), Positives = 108/234 (46%)
  Q:    56 DTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVK--QKKLIDK--KYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKT-QFIKSDIFK--IDRSHYEKCDFIICNPPYIDKNDPNVDPST-KCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYIK 289
           + E+  +     K L     +  P+ Y+ +   FY   FF+     +PR ETE +++ A+   Q K  +     +LD+  GSG +A  +S   +N    V   + +     V   N   L  K  +F++SD+F+  ++++     D I  NPPYI+  D ++     + EP+QAL    +G +FY         +L  G  ++ E G  Q+E ++    K      + L DL    R ++ +
  S:    47 NRELPMDQLSAFKSLAAKRQQGEPIAYLVQQKEFYSRPFFVDPRVLIPRPETEELVEHALGFLQSKSTENLLTRVLDIGCGSGAIA--VSLALENPILEVTATDISADALWVAQFNANELGAKNIRFLQSDLFENLLNQTPPLAFDLICSNPPYIELGDEHLSQGDLRFEPQQALTDGGDGLHFYREIAQHSPSLLRAGGGVLVEHGHTQQEAVKALFSKAPYVDVQGLPDLAGTPRFVFAR 286
>gi|194538368|ref|YP_002073465.1| protein methyltransferase HemK (Protein-glutamine N-methyltransferase hemK) (Protein-(glutamine-N5) MTase hemK) [Vibrio sp. Ex25] >gi|151936923|gb|EDN55813.1| protein methyltransferase HemK (Protein-glutamine N-methyltransferase hemK) (Protein-(glutamine-N5) MTase hemK) [Vibrio sp. Ex25] (284 aa)
Score = 177, Expect = 3.2e-11, Identities = 64/217 (29%), Positives = 105/217 (48%)
  Q:    69 QLNKVLNKNI---PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKY-----ILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLK-TQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDP-STKCEPKQALFAPQNGYYFYFRFLSEI-YPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           + N +L + +   PV YI     F+ L F +     +PR +TE +++ A      +DK Y     ILDL +G+G +A  I+   +     V+GV+  +    +   N   L +K   F +   F+   +   K   I+ NPPYID+ DP++     + EPK AL A +NG     R +S++    L  G  + FE G++Q + + + +           KD    DRV
  S:    60 KFNALLERRLAGEPVAYIIGEREFWSLPFKVSPSTLIPRPDTERLVEVA------LDKTYEQTGPILDLGTGTGAIA--IALASEMPTRQVMGVDLKQEAKALAEYNAEQLNIKNVTFAQGSWFE-PITEGTKFALIVSNPPYIDEKDPHLSQGDVRFEPKSALVAKENGLA-DIRHISDLARQYLEVGGWLAFEHGYDQGDAVREIMRGFGYQQVATEKDYGGNDRV 277
>gi|27363733|ref|NP_759261.1| methylase of polypeptide chain release factor [Vibrio vulnificus CMCP6] >gi|27359849|gb|AAO08788.1|AE016797_243 Methylase of polypeptide chain release factor [Vibrio vulnificus CMCP6] (291 aa)
Score = 177, Expect = 3.2e-11, Identities = 57/207 (27%), Positives = 93/207 (44%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDP-STKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           PV YI     F+ L F +     +PR +TE +++ A+ +K       ILDL +G+G +A  I+   +     V+GV+  +    +   N   L +K    K   +    +   K   I+ NPPYID+NDP+++    + EPK AL A ++G         +    L     ++FE G++Q   + + L           KD    DRV
  S:    73 PVAYIIGEREFWSLPFKVAPSTLIPRPDTERLVELAL-EKTATQTGSILDLGTGTGAIA--IALASELPHRTVMGVDLQQEAKLLAESNALALNIKNVTFKQGSWFEPVAQGTKFALIVSNPPYIDENDPHLNQGDVRFEPKSALVAEESGLADIRYIAQQARDYLEPHGWLMFEHGYDQGIAVREILDTLGYQEVATEKDYGGNDRV 277
>gi|167582489|ref|ZP_02375363.1| hemK protein [Burkholderia thailandensis TXDOH] (285 aa)
Score = 177, Expect = 3.2e-11, Identities = 57/206 (27%), Positives = 103/206 (50%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKT------QFIKSDIF-KID---RSHYEKCDFIICNPPYIDKNDPNV-DPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDR 284
           PV  +T +  F+GL F +     +PR ETE +++ A+     I    +LDL +GSG +A +I+ ++   DA V  ++++     V  +N R L          +F++SD +  +D   R H      ++ NPPYI ++DP++ +   + EP+ AL    +G       ++  +  +A G  +  E G++Q   +   L        + L DL   +R
  S:    68 PVAQLTGAREFFGLEFDVTPDVLIPRPETELLVETALDAIDGIASPCVLDLGTGSGAIAVSIASVR--PDARVWALDRSAAALDVARRNARKLLDPARAGGPLRFLESDWYAALDPGLRFH-----VVVSNPPYIARHDPHLAEGDLRFEPRGALTDEDDGLAAIRTIVAGAHAFVAPGGALWIEHGYDQAAAVRALLEAAGFADVESLADLASIER 277
>gi|26247535|ref|NP_753575.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Escherichia coli CFT073] >gi|91210433|ref|YP_540419.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Escherichia coli UTI89] >gi|110641442|ref|YP_669172.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Escherichia coli 536] >gi|117623430|ref|YP_852343.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Escherichia coli APEC O1] >gi|191170952|ref|ZP_03032503.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Escherichia coli F11] >gi|26107936|gb|AAN80135.1|AE016759_409 Protein methyltransferase hemK [Escherichia coli CFT073] >gi|91072007|gb|ABE06888.1| protein methyltransferase HemK [Escherichia coli UTI89] >gi|110343034|gb|ABG69271.1| protein methyltransferase HemK [Escherichia coli 536] >gi|115512554|gb|ABJ00629.1| protein methyltransferase HemK [Escherichia coli APEC O1] >gi|190908684|gb|EDV68272.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Escherichia coli F11] (277 aa)
Score = 176, Expect = 3.5e-11, Identities = 55/218 (25%), Positives = 108/218 (49%)
  Q:    68 KQLNKVLNKNI---PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKK-YILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKT-QFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDP-STKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           +QL+ +L +     P+ ++T    F+ L  F+     +PR +TE +++ A+   +L ++   ILDL +G+G +A  ++   +  D  +  V++      +  +N ++L +K    ++SD F       ++   I+ NPPYID+ DP++     + EP  AL A  +G       + +    L +G  ++ E G+ Q E + +  I       +  +D  D +RV
  S:    53 QQLDALLTRRRDGEPIAHLTGVREFWSLPLFVSPATLIPRPDTECLVEQAL--ARLPEQPCRILDLGTGTGAIA--LALASERPDCEITAVDRMPDAVSLAQRNAQHLAIKNIHILQSDWFSALAG--QQFAMIVSNPPYIDEQDPHLQQGDVRFEPLTALVAADSGMADIVHIIEQSRNALVSGGFLLLEHGWQQGEAVRQAFIFAGYHDVETCRDYGDNERV 270
>gi|152996265|ref|YP_001341100.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Marinomonas sp. MWYL1] >gi|150837189|gb|ABR71165.1| modification methylase, HemK family [Marinomonas sp. MWYL1] (304 aa)
Score = 176, Expect = 3.5e-11, Identities = 60/193 (31%), Positives = 99/193 (51%)
  Q:    62 EYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLD-----WAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKN--QRNLKLKTQFIKSDIFK-IDRSHYEKCDFIICNPPYIDKNDPNVDPST-KCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIG 254
           E K ILK +   + K  P+ Y+     F GL F + K   +PR     +L+     W +K   L     ILD+C+GSG L    + +   +DA V   + +     V  +N  +  ++ +   I SD+FK +    Y   D IICNPPY+D +D +  P+    EP+ AL + ++G  F   FL+++   L +   +++E+G
  S:    70 EKKHILKLVQTRITKREPLPYLLGEAWFMGLPFKVTKDTLIPRSPIISLLESEFTPW-LKNYPL----NILDMCTGSGCLGIAAALV--FEDAEVDISDISEAALDVANENIVRHQVEDRVHAIHSDMFKGLSGKRY---DLIICNPPYVDADDFHNAPAEFHNEPELALTSGEDGLNFTHEFLTQVAHYLQDDGILVYEVG 261
>gi|86149778|ref|ZP_01068007.1| modification methylase, HemK family [Campylobacter jejuni subsp. jejuni CF93-6] >gi|85839596|gb|EAQ56856.1| modification methylase, HemK family [Campylobacter jejuni subsp. jejuni CF93-6] (271 aa)
Score = 176, Expect = 3.5e-11, Identities = 75/239 (31%), Positives = 118/239 (49%)
  Q:    51 IFFEKDTEIDFE-YKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQF-IKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEI--YPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYIK 289
           +F  +D +ID E Y +++K+         P +YI +   F+GL F IKKG  +PR ++E +L   +   K      IL++  GSG+L+  ++   K     +   + N    ++ ++N +  K+      K   FK  + +Y   DFI  NPPYI KN   +D   + EPK+ALF  + GY      L EI  + +      +  E G++QKE +EK L +NN  V  F KD    +R    K
  S:    36 LFLNQDIQIDHEPYFELIKRFKS----GEPFEYIFEKVDFWGLEFKIKKGILIPRYDSEILLFQILNLCKKNTFNGILEIGFGSGILSIVLA---KELGLKITACDINPKALELALENAKLHKVDHLIDFKLCNFKQIKENY---DFIFSNPPYI-KNSYPIDIWVQKEPKEALFGGEKGY----EILEEIIHFSLDKKVKFLACEFGYDQKEILEKILYQNNFIV-DFFKDEQGYNRAFIAK 262
>gi|167620579|ref|ZP_02389210.1| hemK protein [Burkholderia thailandensis Bt4] (246 aa)
Score = 176, Expect = 3.6e-11, Identities = 57/206 (27%), Positives = 103/206 (50%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKT------QFIKSDIF-KID---RSHYEKCDFIICNPPYIDKNDPNV-DPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDR 284
           PV  +T +  F+GL F +     +PR ETE +++ A+     I    +LDL +GSG +A +I+ ++   DA V  ++++     V  +N R L          +F++SD +  +D   R H      ++ NPPYI ++DP++ +   + EP+ AL    +G       ++  +  +A G  +  E G++Q   +   L        + L DL   +R
  S:    29 PVAQLTGAREFFGLDFDVTPDVLIPRPETELLVETALDAIDGIASPCVLDLGAGSGAIAVSIASVR--PDARVWALDRSAAALDVARRNARKLLDPARAGGPLRFLESDWYAALDPGLRFH-----VVVSNPPYIARHDPHLAEGDLRFEPRGALTDEDDGLAAIRTIVAGAHAFVAPGGALWIEHGYDQAAAVRALLEAAGFADVESLADLASIER 238
>gi|83720020|ref|YP_443438.1| hemK protein [Burkholderia thailandensis E264] >gi|83653845|gb|ABC37908.1| hemK protein [Burkholderia thailandensis E264] (285 aa)
Score = 176, Expect = 3.6e-11, Identities = 57/206 (27%), Positives = 103/206 (50%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKT------QFIKSDIF-KID---RSHYEKCDFIICNPPYIDKNDPNV-DPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDR 284
           PV  +T +  F+GL F +     +PR ETE +++ A+     I    +LDL +GSG +A +I+ ++   DA V  ++++     V  +N R L          +F++SD +  +D   R H      ++ NPPYI ++DP++ +   + EP+ AL    +G       ++  +  +A G  +  E G++Q   +   L        + L DL   +R
  S:    68 PVAQLTGAREFFGLDFDVTPDVLIPRPETELLVETALDAIDGIASPCVLDLGAGSGAIAVSIASVR--PDARVWALDRSAAALDVARRNARKLLDPARAGGPLRFLESDWYAALDPGLRFH-----VVVSNPPYIARHDPHLAEGDLRFEPRGALTDEDDGLAAIRTIVAGAHAFVAPGGALWIEHGYDQAAAVRALLEAAGFADVESLADLASIER 277
>gi|115375811|ref|ZP_01463063.1| methyltransferase, HemK family [Stigmatella aurantiaca DW4/3-1] >gi|115367199|gb|EAU66182.1| methyltransferase, HemK family [Stigmatella aurantiaca DW4/3-1] (292 aa)
Score = 176, Expect = 3.8e-11, Identities = 53/209 (25%), Positives = 98/209 (46%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQ--FIKSDIFKIDRSHYEKCDFIICNPPYIDKND-PNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLY 287
           P QY+T +  FY   F +     +PR ETE +++ A++        + LD+C+GSG +A  IS   +     V+  + +     +  +N   L + ++  F++ D+F    +   +   ++ NPPYI   + P +    + EP  AL   ++G     R +      LA G  +  EIG  Q   +++ L     +  +  KDL+ +DR+ +
  S:    73 PTQYLTGAKEFYNRPFKVDARVLIPRPETELLVEAALRALPKDAPSHALDVCAGSGCIA--ISLAAERPQTSVLATDLSPGACALARENAETLGVSSRVTFLQGDLFAPVPAD-ARFALVVSNPPYIASGEIPGLSVEVRREPHLALDGGRDGLDLIRRVIQGARRYLAPGGLLAMEIGETQGAAVKELLHAAGYSDARVEKDLERRDRLAF 281
>gi|119775697|ref|YP_928437.1| hemK family protein [Shewanella amazonensis SB2B] >gi|119768197|gb|ABM00768.1| hemK family protein [Shewanella amazonensis SB2B] (285 aa)
Score = 176, Expect = 3.9e-11, Identities = 60/247 (24%), Positives = 111/247 (44%)
  Q:    38 ILFNSKIIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKL-KTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVD-PSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDR 284
           +L    + +N + ++   +  +  E  K  +QL     K +PV +I     F+ L F + +   +PR +TE +++ A+    L D   +LD+ +G+G +A  ++  + N    +  ++K      +   N+  L L + + ++SD F   R      D I+ NPPYID++D ++     + EP  AL A   GY             L  G  ++ E GF Q  ++ + L+         ++D    DR
  S:    31 VLLQHCLGKNRTFLYTWPERPLTSEQWKHFEQLINRRAKGVPVAHILGEREFWSLKFLVNETTLIPRPDTEMLVETALNL-PLPDNARVLDMGTGTGAIALALASERPNWR--ITALDKVDDAVALAKANREQLGLSQVEILQSDWFSAVRD--ADFDLIVSNPPYIDEHDEHLAMGDVRFEPLSALTAADEGYADLNHIAMHAREHLKVGGYLLLEHGFAQALKLRETLVSLGYDKVATVRDFGSNDR 274
>gi|56708636|ref|YP_170532.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Francisella tularensis subsp. tularensis SCHU S4] >gi|110671108|ref|YP_667665.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Francisella tularensis subsp. tularensis FSC198] >gi|56605128|emb|CAG46250.1| Adenine-specific methylase, HemK family [Francisella tularensis subsp. tularensis SCHU S4] >gi|110321441|emb|CAL09633.1| Adenine-specific methylase, HemK family [Francisella tularensis subsp. tularensis FSC 198] >gi|151569509|gb|EDN35163.1| hypothetical protein FTBG_01043 [Francisella tularensis subsp. tularensis FSC033] (314 aa)
Score = 176, Expect = 4.0e-11, Identities = 59/209 (28%), Positives = 98/209 (46%)
  Q:    54 EKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYML--DWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDP-STKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIE 262
           EK   ID+ Y++        L K +P  YI K   F G+ F I +   +PR     ++  +++     + D   +LDLC+GSG +    S + ++ +  ++ +  +          +  L  + + IKSD+F  D  H +K D I+ NPPY+DK D +  P     EPK AL A  +G     R + E    +     +I E+G +Q   +E
  S:    73 EKKIIIDYVYQR------ACLRKPLP--YILKKAWFAGMEFDIDERVIIPRSPIAELIRNEFSPWINDIDDVTSVLDLCTGSGCIGIACSNVFEDANITLVDISDDALAVANHNIKKHQLSDRVRAIKSDLF--DNLHGQKFDLIVSNPPYVDKQDLDTMPHEYHYEPKLALEAGDDGLDLAKRIILEADKYMTENGVLIVEVGNSQYALME 274
>gi|194505141|ref|YP_002034712.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Burkholderia pseudomallei 1655] >gi|184211028|gb|EDU08071.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Burkholderia pseudomallei 1655] (285 aa)
Score = 176, Expect = 4.1e-11, Identities = 54/187 (28%), Positives = 95/187 (50%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKT------QFIKSDIF-KID---RSHYEKCDFIICNPPYIDKNDPNV-DPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFL 265
           P+  +T +  F+GL F I     +PR ETE +++ A+     I    +LDL +GSG +A  +S   +  DA V  +E++     V  +N R L          +F++SD +  +D   R H      ++ NPPYI ++DP++ +   + EP+ AL    +G       ++  +  +A G  +  E G++Q   +   L
  S:    68 PIAQLTGAREFFGLEFDITPDVLIPRPETELLVETALDAIDGIASPCVLDLGTGSGAIA--VSIASERPDACVWALERSVAALDVARRNARKLLDPARAGGPLRFLESDWYAALDPGLRFH-----VVVSNPPYIARHDPHLAEGDLRFEPRGALTDENDGLAAIRTIVAGAHAFVAPGGALWLEHGYDQAAAVRALL 258
>gi|146329306|ref|YP_001209561.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Dichelobacter nodosus VCS1703A] >gi|146232776|gb|ABQ13754.1| modification methylase, HemK family [Dichelobacter nodosus VCS1703A] (300 aa)
Score = 176, Expect = 4.2e-11, Identities = 52/197 (26%), Positives = 93/197 (47%)
  Q:    60 DFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQK-KLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLK---TQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPSTKC-EPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFN 256
           D E   +     + + + +PV Y+T+   + G  F+I +   +PR     ++D  +    +  D + ILDLC GSG +     Y     DA V+  + +     V   N +   ++    + ++SDIF      +   D+I+CNPPY++  +     +  C EP+QAL +  +G     R LS+    L +   +I E+G +
  S:    61 DKECALLADAFRRRIEERLPVPYLTQRTLYGGYEFYIDERALIPRSPIAELIDRGLAPYWQGDDPERILDLCCGSGCIGILAKY--HYPDAEVVLADIDEQALAVAAINLQRAAMEDDGVEIVQSDIFTAVTGTF---DWILCNPPYVEAEEMATIAAEYCHEPRQALVSGADGLDLTRRILSQAAHYLNDNGVLILEVGMS 257
>gi|148653569|ref|YP_001280662.1| HemK family modification methylase [Psychrobacter sp. PRwf-1] >gi|148572653|gb|ABQ94712.1| modification methylase, HemK family [Psychrobacter sp. PRwf-1] (314 aa)
Score = 176, Expect = 4.2e-11, Identities = 62/212 (29%), Positives = 105/212 (49%)
  Q:    74 LNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLD---------WAVKQKKLIDK-----------KYILDLCSGSGVLANTISY----IKKNKDAI---VIGVEKNRTPYKVGVKNQR-NLKLKTQFIKSDIFKI-----DRSHYEKCDFIICNPPYIDKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           +    P+ Y+T   +F+ L FF+ +   +PR +TE +++         +A  Q    D            K +LDL +GSG +A ++++    +  N  A    V  ++ +    +V  +N   N     +FI+SD F             + D I+ NPPYI  +D ++D   K EP  AL AP NG     +   +    L +G  +  E G++Q   + +       T  K ++D    DRV
  S:    63 MRSGTPLAYLTGKQAFWSLDFFVNEHTLIPRPDTEVLVEQVLAWIDTHYAQVQNDDADDINDFNDANKLPKRLLDLGTGSGCIAISLAHELQMLAPNHTASQWQVTAIDYSNPALEVARRNAALNKVTNIEFIQSDWFSALEAANTNKESPRFDIIVSNPPYIVDDDEHLD-KLKAEPLSALVAPDNGLGDIKQIAGQARGYLVSGGLLAVEHGYDQGAAVRQIFTDFGYTQVKTVQDYGGNDRV 306
>gi|89256954|ref|YP_514316.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Francisella tularensis subsp. holarctica] >gi|115315316|ref|YP_764039.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Francisella tularensis subsp. holarctica OSU18] >gi|118496921|ref|YP_897971.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Francisella tularensis subsp. novicida U112] >gi|134301405|ref|YP_001121373.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Francisella tularensis subsp. tularensis WY96-3418] >gi|156503148|ref|YP_001429213.1| N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase [Francisella tularensis subsp. holarctica FTNF002-00] >gi|167010048|ref|ZP_02274979.1| hypothetical adenine-specific methylase YfcB [Francisella tularensis subsp. holarctica FSC200] >gi|194324148|ref|ZP_03057922.1| hypothetical adenine-specific methylase YfcB [Francisella tularensis subsp. novicida FTE] >gi|89144785|emb|CAJ80123.1| Adenine-specific methylase, HemK family [Francisella tularensis subsp. holarctica LVS] >gi|115130215|gb|ABI83402.1| HemK family, adenine-specific methylase [Francisella tularensis subsp. holarctica OSU18] >gi|118422827|gb|ABK89217.1| modification methylase, HemK family [Francisella tularensis subsp. novicida U112] >gi|134049182|gb|ABO46253.1| methyltransferase, HemK family [Francisella tularensis subsp. tularensis WY96-3418] >gi|134254026|gb|EBA53120.1| adenine-specific methylase, hemK family [Francisella tularensis subsp. holarctica 257] >gi|151570012|gb|EDN35666.1| modification methylase [Francisella tularensis subsp. novicida GA99-3549] >gi|151571483|gb|EDN37137.1| hypothetical protein FTDG_01546 [Francisella tularensis subsp. novicida GA99-3548] >gi|156253751|gb|ABU62257.1| methyltransferase, HemK family protein [Francisella tularensis subsp. holarctica FTNF002-00] >gi|194321595|gb|EDX19079.1| hypothetical adenine-specific methylase YfcB [Francisella tularensis subsp. novicida FTE] (314 aa)
Score = 175, Expect = 4.4e-11, Identities = 59/209 (28%), Positives = 98/209 (46%)
  Q:    54 EKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYML--DWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDP-STKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIE 262
           EK   ID+ Y++        L K +P  YI K   F G+ F I +   +PR     ++  +++     + D   +LDLC+GSG +    S + ++ +  ++ +  +          +  L  + + IKSD+F  D  H +K D I+ NPPY+DK D +  P     EPK AL A  +G     R + E    +     +I E+G +Q   +E
  S:    73 EKKIIIDYVYQR------ACLRKPLP--YILKKAWFAGMEFDIDERVIIPRSPIAELIRNEFSPWINDIDDVTSVLDLCTGSGCIGIACSNVFEDANITLVDISDDALAVANHNIKKHQLSDRVRAIKSDLF--DNLHGQKFDLIVSNPPYVDKQDLDTMPHEYHYEPKLALEAGDDGLDLAKRIILEADKYMTENGVLIVEVGNSQYALME 274
>gi|167838057|ref|ZP_02464916.1| hemK protein [Burkholderia thailandensis MSMB43] (251 aa)
Score = 175, Expect = 4.4e-11, Identities = 57/206 (27%), Positives = 102/206 (49%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKT------QFIKSDIF-KID---RSHYEKCDFIICNPPYIDKNDPNV-DPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDR 284
           P+  +T +  F+GL F +     +PR ETE +++ A+     I    +LDL +GSG +A  +S      DA V  ++++ T   V  +N R L          +F++SD +  +D   R H      ++ NPPYI ++DP++ +   + EP+ AL   ++G       ++  +  +A G  +  E G++Q   +   L        + L DL   +R
  S:    34 PIAQLTGAREFFGLEFDVTPDVLIPRPETELLVETALDAIDGIASPCVLDLGTGSGAIA--VSIASGRPDARVWALDRSATALDVARRNARKLLDPARPGGPLRFLESDWYAALDPGLRFH-----VVVSNPPYIARHDPHLAEGDLRFEPRGALTDERDGLAAIRAIVAGAHAFVAPGGALWIEHGYDQAAAVRALLGAAGFADVESLADLASIER 243
>gi|50085502|ref|YP_047012.1| methyl transferase [Acinetobacter sp. ADP1] >gi|49531478|emb|CAG69190.1| methyl transferase [Acinetobacter sp. ADP1] (274 aa)
Score = 175, Expect = 4.6e-11, Identities = 65/254 (25%), Positives = 122/254 (48%)
  Q:    32 WILKELILFNSKIIENSSDIFFEKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKL-KTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           W+L+ ++  NS  ++        ++ E     ++ L  L + L+K  P+ YIT S  F+ L   +     VPR +TE +++  V    L +   ++DL +G+G +A  +S  K+     ++  +      +V   N +   L + +F+ S  F+   S  +K D I+ NPPYID ND ++  +   EP++AL A ++G     + + +    L     I  E G++Q + + + L+ +N    +  KD    DR+
  S:    23 WLLEHILELNSLELKMRQMQILTQEQE-----QQYLDGLMR-LSKGEPLAYITGSQPFWSLDLNVTPDTLVPRPDTEILIE-TVLSLDLPEHCSMVDLGTGTGAIA--LSLAKERPYWKILATDIYFPTLEVAQSNAKKHALNQVKFLCSAWFEAIPS--QKFDLIVSNPPYIDANDEHM-LNLGTEPRRALVADKHGLADLEQIIGQAVLWLNTHGWIAVEHGYDQGQAVCQLLMDHNFAKVQTCKDYGGNDRI 265
>gi|157122773|gb|EDO66902.1| hypothetical protein FTAG_01155 [Francisella tularensis subsp. holarctica FSC022] (314 aa)
Score = 175, Expect = 4.6e-11, Identities = 59/209 (28%), Positives = 98/209 (46%)
  Q:    54 EKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYML--DWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPST-KCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIE 262
           EK   ID+ Y++        L K +P  YI K   F G+ F I +   +PR     ++  +++     + D   +LDLC+GSG +    S + ++ +  ++ +  +          +  L  + + IKSD+F  D  H +K D I+ NPPY+DK D +  P     EPK AL A  +G     R + E    +     +I E+G +Q   +E
  S:    73 EKKIIIDYVYQR------ACLRKPLP--YILKKAWFAGMEFDIDERVIIPRSPIAELIRNEFSPWINDIDDVTSVLDLCTGSGCIGIACSNVFEDANITLVDISDDALAVANHNIKKHQLSDRVRAIKSDLF--DNLHGQKFDLIVSNPPYVDKQDLDTMPHEYHYEPKLALEAGDDGLDLAKRIILEADKYMTENGVLIVEVGNSQYALME 274
>gi|78221602|ref|YP_383349.1| modification methylase HemK [Geobacter metallireducens GS-15] >gi|78192857|gb|ABB30624.1| Modification methylase HemK [Geobacter metallireducens GS-15] (284 aa)
Score = 175, Expect = 4.6e-11, Identities = 57/211 (27%), Positives = 97/211 (45%)
  Q:    76 KNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKND-PNVDPSTK-CEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVL 286
           K  P+QY+  +  F GL F +     +PR +TE +++ A+++        +LD+  GSG +A  ++  K   DA V GVE++     +  +N     ++       +F+      ++ D I+ NPPYI   D   + P  +  EP+ AL    +G  FY   +      L  G  ++ E+G  Q E +     +   T     KDL+  DRV+
  S:    73 KREPLQYVLGTQEFCGLDFAVTPAVLIPRHDTEVLVEEALRRAP--HAATVLDIGVGSGCIA--VALAKNLPDAQVWGVEQSAGAITLARQNVERHGVRVILCAGSLFEPFAD--QRFDLIVSNPPYIPTADLDTLQPEVREYEPRAALDGGADGLDFYRIIVPAALEHLNAGGWLMVELGIGQAEAVLGMFKQAGFTGCFTAKDLNGIDRVV 279
>gi|51474015|ref|YP_067772.1| bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase [Rickettsia typhi str. Wilmington] >gi|81389917|sp|Q68VR6|HEMK_RICTY Bifunctional methyltransferase [Includes: HemK protein homolog ; tRNA (guanine-N(7)-)-methyltransferase (tRNA(m7G46)-methyltransferase)] >gi|51460327|gb|AAU04290.1| bifunctional methyltransferase [Rickettsia typhi str. Wilmington] (518 aa)
Score = 175, Expect = 4.7e-11, Identities = 64/210 (30%), Positives = 103/210 (49%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAV------------------KQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKN--QRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDP--NVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRVLYI 288
           P+ YIT    FY   F + K   +PR +TE ++D  +                     K I    IL+L +GSG +A  IS + +  +  VI  + +    KV   N  + N+  + Q I S+ F  ++ + +K D I+ NPPYI  ++       +   EP  ALFA ++G   Y          L    +II EIGF+Q E++ +  +     +    +DL   +RV+ I
  S:    71 PIAYITGIKEFYSREFIVNKHVLIPRIDTEILIDVVIGLVVSRNDLNTCSKLKSLDSVKTIQHYNILELGTGSGCIA--ISLLCELPNTSVIATDISVDAIKVAKSNTIKHNVTDRIQIIHSNWF--EKLNKQKFDLIVSNPPYISHSEKLEMAIETINYEPHIALFAEEDGLEAYSIIAKNAKQFLKPNGKIILEIGFSQAEKVCQIFLNYGYNIDHIYQDLQSHNRVIEI 298
>gi|109898877|ref|YP_662132.1| HemK family modification methylase [Pseudoalteromonas atlantica T6c] >gi|109701158|gb|ABG41078.1| modification methylase, HemK family [Pseudoalteromonas atlantica T6c] (298 aa)
Score = 175, Expect = 4.8e-11, Identities = 54/221 (24%), Positives = 110/221 (49%)
  Q:    65 KILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKN-QRNLKLKTQFIKSDIF------KIDRSHYEKCDF--IICNPPYIDKNDPNVDP-STKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFLIKNNITVFKFLKDLDDKDRV 285
           +  +QL        P+ Y+     F+ L   +     +PR ETE +++  V    + +  ++LDL +G+G +A  ++  K N    V+G++K+     +  +N + N   + +F++SD F      ++D+ + +   F  I+ NPPY++ +   +     + EP  AL + ++G       +S+    L +G  + FE G+ Q + ++  L+ N       + DL+D  R+
  S:    63 RTYQQLVAKRKTGYPIAYLLGYRDFWSLRLRVSPATLIPRPETELLVE-TVLNLPIAEDAHVLDLGTGTGAIALALASEKPNWQ--VLGIDKSADAVALAKQNAELNSLPQVRFMQSDWFSALEQTQLDQQNNQHNVFSLIVSNPPYVEDDSVYLQQGDVRFEPASALTSGKDGLDDIRIIISKAITFLPSGGWLAFEHGYQQAQGVQALLVNNGFEQVHSVNDLNDLPRI 290
>gi|62260141|gb|AAX77884.1| unknown protein [synthetic construct] (349 aa)
Score = 175, Expect = 4.9e-11, Identities = 59/209 (28%), Positives = 98/209 (46%)
  Q:    54 EKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYML--DWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPST-KCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIE 262
           EK   ID+ Y++        L K +P  YI K   F G+ F I +   +PR     ++  +++     + D   +LDLC+GSG +    S + ++ +  ++ +  +          +  L  + + IKSD+F  D  H +K D I+ NPPY+DK D +  P     EPK AL A  +G     R + E    +     +I E+G +Q   +E
  S:    99 EKKIIIDYVYQR------ACLRKPLP--YILKKAWFAGMEFDIDERVIIPRSPIAELIRNEFSPWINDIDDVTSVLDLCTGSGCIGIACSNVFEDANITLVDISDDALAVANHNIKKHQLSDRVRAIKSDLF--DNLHGQKFDLIVSNPPYVDKQDLDTMPHEYHYEPKLALEAGDDGLDLAKRIILEADKYMTENGVLIVEVGNSQYALME 300
>gi|187931125|ref|YP_001891109.1| modification methylase, HemK family [Francisella tularensis subsp. mediasiatica FSC147] >gi|187712034|gb|ACD30331.1| modification methylase, HemK family [Francisella tularensis subsp. mediasiatica FSC147] (314 aa)
Score = 175, Expect = 5.0e-11, Identities = 59/209 (28%), Positives = 98/209 (46%)
  Q:    54 EKDTEIDFEYKKILKQLNKVLNKNIPVQYITKSFSFYGLSFFIKKGCFVPRQETEYML--DWAVKQKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPST-KCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIE 262
           EK   ID+ Y++        L K +P  YI K   F G+ F I +   +PR     ++  +++     + D   +LDLC+GSG +    S + ++ +  ++ +  +          +  L  + + IKSD+F  D  H +K D I+ NPPY+DK D +  P     EPK AL A  +G     R + E    +     +I E+G +Q   +E
  S:    73 EKKIIIDYVYQR------ACLRKPLP--YILKKAWFAGMEFDIDERVIIPRSPIAELIRNEFSPWINDIDDVTSVLDLCTGSGCIGIACSNVFEDANITLVDISDDALTVANHNIKKHQLSDRVRAIKSDLF--DNLHGQKFDLIVSNPPYVDKQDLDTMPHEYHYEPKLALEAGDDGLDLAKRIILEADKYMTENGVLIVEVGNSQYALME 274
>gi|171057270|ref|YP_001789619.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Leptothrix cholodnii SP-6] >gi|170774715|gb|ACB32854.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Leptothrix cholodnii SP-6] (280 aa)
Score = 175, Expect = 5.0e-11, Identities = 53/187 (28%), Positives = 91/187 (48%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVK-QKKLIDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKIDRSHYEKCDFIICNPPYIDKNDPNVDPSTKCEPKQALFAPQNGYYFYFRFLSEIYPILANGTEIIFEIGFNQKEEIEKFL 265
           PV Y+T    F+GL+  I      PR +TE ++DW ++   +L     +LDL +GSG +A  I +  +   A V  V+ +     V   N   L L   +   + F  +    ++ D I+ NPPYI ++DP++ P+ + EP+QAL +  +G       + +    L  G  ++ E G +Q   ++  L
  S:    68 PVAYLTGRHEFHGLTLHITSDVLDPRPDTETLVDWGLELLARLGRPARVLDLGTGSGAIALAIKH--RCPSAQVSAVDFSAAALAVARANGARLNLDVDWQPGNWF--ENLAGQRFDLILSNPPYIAEDDPHM-PALRHEPRQALVSGADGLDDIRSLVRQAPQHLVAGGWLLLEHGHDQGVAVQDLL 250
>gi|88805871|ref|ZP_01121390.1| putative protoporphyrinogen oxidase [Robiginitalea biformata HTCC2501] >gi|88784689|gb|EAR15859.1| putative protoporphyrinogen oxidase [Robiginitalea biformata HTCC2501] (304 aa)
Score = 175, Expect = 5.1e-11, Identities = 48/159 (30%), Positives = 82/159 (51%)
  Q:    79 PVQYITKSFSFYGLSFFIKKGCFVPRQETEYMLDWAVKQKKL-IDKKYILDLCSGSGVLANTISYIKKNKDAIVIGVEKNRTPYKVGVKNQRNLKLKTQFIKSDIFKID----------RSHYEKCDFIICNPPYIDKNDPN--VDPSTKCEPKQALFAPQNGYYFYFRFLS 237
           PVQYIT +  F  +   +  G  +PR ETE ++ W +++    + +  ILD+ +GSG +A  +   K    A V  ++ +    +V  +N R+L L  + +++DI   +             +   D II NPPYI +             EP++ALFAP +    Y+R ++
  S:    70 PVQYITGTARFLDMDLRVGPGALIPRPETEELVRWVLERHAADLREGNILDIGTGSGCIA--LGLAKSLPAARVTALDISGEALEVARENARHLGLDVRLVRADIRNPEGEWPESILNPEGEWPGYDLIISNPPYIPRGQEGQLAVHVRDHEPREALFAPDSDPLLYYRHIA 239