>gi|26554123|ref|NP_758057.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454131|dbj|BAC44461.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (388 aa)
Score = 1479, Expect = 5.0e-162, Identities = 374/374 (100%), Positives = 374/374 (100%)
  Q:    15 TGAFGIVATVPIIVSSCSSTSDNNTGGNQDGQQTQKVTPVLKDEVDLKGSLSKIFDTTATDASSRKSTNTLISEDIKANPENYFTNGNETNVKEAIEKATIDVEGNFSNASWTGNAYNTTSNGWDGVTIEDANKLIYTTSSAQLTFKDLDGLKTELEKNGTDNKTVLQNALEAAGATIEADTTLTIKNRVGFTSGDLIHINVEADKSGTQTQYDLQIPTSNLNLSVTGLTIKVSGDNINTNEKTTTNFKYNIGIDSTLGFEQAKGAAPEETANNLSDAATAAKNILVKLGYVTTTGGSDLSNDKISAALGIYNCNFTPKSATEKQGATPDAGVTDANKVYTVTVTATPFNDTYVWDDGSSGEKDFSFDVSLKVN 388
           TGAFGIVATVPIIVSSCSSTSDNNTGGNQDGQQTQKVTPVLKDEVDLKGSLSKIFDTTATDASSRKSTNTLISEDIKANPENYFTNGNETNVKEAIEKATIDVEGNFSNASWTGNAYNTTSNGWDGVTIEDANKLIYTTSSAQLTFKDLDGLKTELEKNGTDNKTVLQNALEAAGATIEADTTLTIKNRVGFTSGDLIHINVEADKSGTQTQYDLQIPTSNLNLSVTGLTIKVSGDNINTNEKTTTNFKYNIGIDSTLGFEQAKGAAPEETANNLSDAATAAKNILVKLGYVTTTGGSDLSNDKISAALGIYNCNFTPKSATEKQGATPDAGVTDANKVYTVTVTATPFNDTYVWDDGSSGEKDFSFDVSLKVN
  S:    15 TGAFGIVATVPIIVSSCSSTSDNNTGGNQDGQQTQKVTPVLKDEVDLKGSLSKIFDTTATDASSRKSTNTLISEDIKANPENYFTNGNETNVKEAIEKATIDVEGNFSNASWTGNAYNTTSNGWDGVTIEDANKLIYTTSSAQLTFKDLDGLKTELEKNGTDNKTVLQNALEAAGATIEADTTLTIKNRVGFTSGDLIHINVEADKSGTQTQYDLQIPTSNLNLSVTGLTIKVSGDNINTNEKTTTNFKYNIGIDSTLGFEQAKGAAPEETANNLSDAATAAKNILVKLGYVTTTGGSDLSNDKISAALGIYNCNFTPKSATEKQGATPDAGVTDANKVYTVTVTATPFNDTYVWDDGSSGEKDFSFDVSLKVN 388
>gi|26554128|ref|NP_758062.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454136|dbj|BAC44466.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (353 aa)
Score = 810, Expect = 1.7e-84, Identities = 230/355 (64%), Positives = 272/355 (76%)
  Q:    14 LTGAFGIVATVPIIVSSCSSTSDNNTGGNQDGQ-QTQKVTPVLKDEVDLKGSLSKIFDTTATDASSRKSTNTLISEDIKANPENYFTNGNETNVKEAIEKATIDVEGNFSNASWTGNAYNTTSNGWDGVTIEDANKLIYTTSSAQLTFKDLDGLKTELEK-NGTDNKTVLQNALEAAGATIEADTTLTIKNRVGFTSGDLIHINVE-ADKSGTQTQYDLQIPTSNLNLSVTGLTIKVSGDNINTNEKTTTNFKYNIGIDSTLGFEQAKGAAPEETANNLSDAATAAKNILVKLGYVTTTGGSDLSNDKISAALGIYNCNFTPKSATEKQGATPDAGVTDANKVYTVTVTATPFNDTYV 368
           +TGAFGIVATVP+IVSSCSSTSDNN  GN +G  +TQKVTPVLKD VDLKGSLSKIFDTTATDA+SRKSTNTLISEDIKANPE+YFTNG+++NV+ AI+ ATIDVEGNFSNASWTGNAY+T +N W GVTIEDANKL+YT++SAQLTFKDLDGLK ELEK  GTD+KTV Q ALEAAGAT  + TT+TI+NR+GFT+ DLIH+NV+ A  SG    YDLQIPTS+LNLSVTGL+IKV+G+NI   EKTTTNF YNIGI   +         P +  N  +        ++  LGY T T G  L ++KIS  LG+YNC FT  SATE          T+    +T+ ++ATP N+ YV
  S:    14 MTGAFGIVATVPVIVSSCSSTSDNNGNGNTNGNTETQKVTPVLKDSVDLKGSLSKIFDTTATDAASRKSTNTLISEDIKANPEDYFTNGSDSNVQSAIQSATIDVEGNFSNASWTGNAYDTNTNTWSGVTIEDANKLVYTSNSAQLTFKDLDGLKAELEKTTGTDSKTVAQVALEAAGATFASGTTITIENRLGFTNDDLIHVNVKAAPSSGNPVNYDLQIPTSDLNLSVTGLSIKVTGENITEGEKTTTNFTYNIGIKEGV-------IVPTDKPNLATADKGTQMKVMEALGY-TNTAGDALDDNKISVKLGLYNCKFTLVSATED---------TNNAGTFTIKISATP-NEGYV 353
>gi|26554110|ref|NP_758044.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454118|dbj|BAC44448.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (391 aa)
Score = 689, Expect = 1.8e-70, Identities = 217/374 (58%), Positives = 269/374 (71%)
  Q:    14 LTGAFGIVATVPIIVSSCSSTSDNNTGGNQDGQ--QTQKVTPVLKDEVDLKGSLSKIFDTTATDASSRKSTNTLISEDIKANP--ENYFTNGNETNVKEAIEKATIDVEGNFSNASWTGNAYNTTSNGWDG----VTIEDANKLIYTTSSAQLTFKDLDGLKTELEKNGTDNKTVLQNALEAAGATIEADTTLTIKNRVGFTSGDLIHINVEADKSGTQTQ-YDLQIPTSNLNLSVTGLTIKVSGDNINTNEKTTTNFKYNIGIDSTLGFEQAKGAAPEETANNLSDAATAAKNILVKLGYVTTTGGSDLSNDKISAALGIYNCNFTPKSATEKQGATPDAGVTDANKVYTVTVTATPF-NDTYVW-DDGSSGEKDFSFDVSLKV 387
           +TGAFGIVATVP+IVSSCSSTSDNNTGG  +G   QTQKV+  LKD VDLKGSLSKIFDT AT+ASSRKSTNTLISEDIKANP     FT   E  VKE I+ AT++VEGNFS++SW G AYN  S  W      VTI+ ANK +Y T+  QLTFKDLDGLKTELEK GT+NKTVLQNALE AGATI+A   L+I+NR+G T+ DL+H+NV+  K+ T  + YDLQIP S+LNLSV+ L+IKV+ DNI T EKTTT + YNIGID T  + Q        T  + +D A+   N +++   + T     L N+ +  ALG+YN  F+  +  +K  AT    + D   VYT+T+ ATP  N  YVW D+G+S E+D +FDV+L +
  S:    14 MTGAFGIVATVPVIVSSCSSTSDNNTGGGNNGGDTQTQKVSLQLKDSVDLKGSLSKIFDTEATNASSRKSTNTLISEDIKANPGTYFTFTETTEETVKETIQNATVEVEGNFSSSSWEGQAYNQESGNWGADSSVVTIDPANKYLYPTNLDQLTFKDLDGLKTELEKTGTNNKTVLQNALETAGATIDAGAQLSIENRLGLTNDDLLHVNVKETKANTADKNYDLQIPVSDLNLSVSDLSIKVTSDNIETGEKTTTKYDYNIGIDPTTHYVQGT------TKPSANDEASVDVNKVLEDLSLATDANGTLDNEALIKALGVYNVQFSNPTIAKK--ATTTRAIEDT--VYTITLKATPTANKNYVWSDNGNSEERDITFDVTLAI 388
>gi|26553723|ref|NP_757657.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26453730|dbj|BAC44061.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (383 aa)
Score = 680, Expect = 2.0e-69, Identities = 196/374 (52%), Positives = 251/374 (67%)
  Q:    15 TGAFGIVATVPIIVSSCSSTSDNNTGGNQDGQQT--------QKVTPVLKDEVDLKGSLSKIFDTTATDASSRKSTNTLISEDIKANPENYFTNGNETNVKEAIEKATIDVEGNFSN-ASWTGNAYNTTSNGWDGVTIEDANKLIYTTSSAQLTFKDLDGLKTELEKNGTDNKTVLQNALEAAGATIEADTTLTIKNRVGFTSGDLIHINVEADKSGTQTQYDLQIPTSNLNLSVT-----GLTIKVSGDNINTNEKTTTNFKYNIGIDSTLGFEQAKGAAPEETANNLSDAATAAKNILVKLGYVTTTGGSDLSNDKISAALGIYNCNFTPKSATEKQGATPDAGVTDANKVYTVTVTATPFNDTYVWDDGSSGEKDFSFDVSLKVN 388
           TGAFGIVATVP+IVSSCSST + N      G             V P +K +V L G LS I+D + TD   RK TNTLI+ D+K NPENYFTNG++  +K+AI+ AT+ V+G F   +SW+GN Y+T S G            +Y +++ Q+    L+ LK    K+ T  +T L++A      +    +  +++N+ G T GDL+HIN++A ++      DLQIP SN+NL  T       T   +G+ I   +   T F YNIGID+TL FEQ KG AP  T N +SDAATAAKNILVKLGYV++  G  LS+DKISAALGIYNC FTPKSATE   A P+A VT++NKVYTVTVTATP+N+TYVWDDGS+G KD SFDVSLKV+
  S:    15 TGAFGIVATVPVIVSSCSSTDNGNNNQGGTGGNGQGGDTQQQSTVKPEIKTDVKLSGKLSGIYDASETD---RKDTNTLITNDVKTNPENYFTNGDQ--IKDAIKDATVTVDGGFKKESSWSGNPYSTWSTG--------TTATLYPSAAPQINIASLNDLKDTKLKDSTAIETFLKDA----NISFTGASGFSVQNQPGLTDGDLLHINIKAKQNSQDLNLDLQIPVSNINLETTLKISIDATTNTTGNKIEAVKDLETKFSYNIGIDATLKFEQQKGEAPAATTNEVSDAATAAKNILVKLGYVSS--GDTLSDDKISAALGIYNCKFTPKSATENTNAKPNAEVTNSNKVYTVTVTATPYNETYVWDDGSTGPKDISFDVSLKVS 383
>gi|26554119|ref|NP_758053.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454127|dbj|BAC44457.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (386 aa)
Score = 653, Expect = 3.0e-66, Identities = 198/374 (52%), Positives = 250/374 (66%)
  Q:    14 LTGAFGIVATVPIIVSSCSSTSDNNTGGNQDGQQTQKVTPVLKDEVDLKGSLSKIFDTTATDASSRKSTNTLISEDIKANPENYFTNGNETNVKEAIEKATIDVEGNFSNAS----WTGNAYNTTSNGWDGVTIEDANK-------LIYTTSSAQLTFKDLDGLKTELEKNGTDNKTVLQNALEAAGATIEADTTLTIKNRVGFTSGDLIHINVEADKSGTQTQYDLQIPTSNLNLSVTGLTIKVSGDNINTNEKTTTNFKYNIGIDSTLGFEQAKGAAPEETANNLSDAATAAKNILVKLGYVTTTGGSDLSNDKISAALGIYNCNFTPKSATEKQGATPDAGVTDANKVYTVTVTATPFNDTYVWDDGSSGE--KDFSFDVSLKV 387
           +TGAFGIVATVP+IVSSCSSTSDNNTGG  + QQTQKVTPVLKD V L GSLSKI+DTT     +RK+TN LI+EDIK NPENYFTNG+E+ VKEA++ AT+ VEGNF+ A     W    Y  +S   +  T   + K       + Y T+S Q+  K LD L T+L    T     L++A++ AG      TT TIKNR GFT+GDLIH+NVE DKSGT+TQYDLQIPTS++NLSVT LTIKV G NI T++KTTTN+ +NIGI+    ++Q        T    +DAA     +L  L   T   G+ L+N+ +  ALG+YN NF+  +   K+GAT     T A K YT+T+ A P ++ YVW DGS     K  +FDV + V
  S:    14 MTGAFGIVATVPVIVSSCSSTSDNNTGGENNNQQTQKVTPVLKDSVSLSGSLSKIYDTTT--GENRKTTNDLITEDIKENPENYFTNGSESAVKEAVKNATVTVEGNFTTAGSESPWKELPYLDSSETSENATAAKSWKATTGLQEVTYATNSDQIEIKSLDDLHTKLSVEQT-----LKDAMKGAGVADTDTTTFTIKNRAGFTNGDLIHVNVEGDKSGTKTQYDLQIPTSDINLSVTDLTIKVEGTNIETSQKTTTNYDFNIGIEPETHYDQG-----STTVTAANDAAVTVNKVLQDLSLATDANGT-LNNEALIKALGVYNVNFSNPTIAPKEGAT-----TRAEKTYTITLDAKPQSEKYVWSDGSDSNTTKKVTFDVKVDV 382
>gi|26554126|ref|NP_758060.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454134|dbj|BAC44464.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (388 aa)
Score = 645, Expect = 2.3e-65, Identities = 200/374 (53%), Positives = 251/374 (67%)
  Q:    14 LTGAFGIVATVPIIVSSCSSTSDNNTGGNQDGQ--QTQKVTPVLKDEVDLKGSLSKIFDTTATDASSRKSTNTLISEDIKANP-ENYFTNGNETNVKEAIEKATIDVEGNFSNASWTGNAYNTTSNGWDG----VTIEDANKLIYTTSSAQLTFKDLDGLKTELEKNGTDNKTVLQNALEAAGATIEADTT-LTIKNRVGFTSGDLIHINVEAD------KSGTQTQYDLQIPTSNLNLSVTGLTIKVSGDNINTNEKTTTNFKYNIGIDSTLGFEQAKGAAPEETANNLSDAATAAKNILVKLGYVTTTGGSDLSNDKISAALGIYNCNFTPKSATEKQGATPDAGVTDANKVYTVTVTATPFNDTYVWDDGSSGEKDFSFDVSLKV 387
           +TGAFGIVATVP+IVSSCSSTSDNNTGG+ +G   QTQ +TP LKD V L G LS IFD+T T  ++ K     I+ DIK N   + F NG+     + +    + V G+F   SW+G  Y+  S GW      VTI  ANKL+Y + S QL    L+ LKT+L    T     L+ ALE AG +  ADTT L + N +G T  DL+HINV +       ++ T T YDLQIP SN+NL V  LTI V+G N+    KTTTNFK+N+GID+TL F+Q   A       + ++ AT A  IL KLGYV++  G+ LS+DKISAALGIYNC FTPKSATE     PD+G+T +NKVY VTVTATP++  YVWDDG++G KD SFDV+LKV
  S:    14 MTGAFGIVATVPVIVSSCSSTSDNNTGGDGNGGGTQTQTITPQLKDSVSLSGPLSDIFDSTGTQNANEK-----IAADIKDNHLSDVFDNGDAL---KQVSDLKVTVAGDFKRDSWSGGTYDAASGGWKSDSGDVTISAANKLVYASESPQLNISSLNDLKTQLSVKAT-----LKEALEKAGVSTIADTTTLAVNNNIGLTD-DLLHINVSSTPQVASGQTATTTNYDLQIPVSNINLVVNNLTITVAGTNVGEATKTTTNFKFNVGIDATLSFKQTGTAPDVSKTESEAEQATLASTILQKLGYVSS--GNTLSDDKISAALGIYNCKFTPKSATENTEVQPDSGITGSNKVYKVTVTATPYDTNYVWDDGTTGPKDISFDVNLKV 385
>gi|26554196|ref|NP_758130.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454205|dbj|BAC44534.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (382 aa)
Score = 637, Expect = 2.3e-64, Identities = 206/373 (55%), Positives = 259/373 (69%)
  Q:    15 TGAFGIVATVPIIVSSCSSTSD-NNTGGNQDGQQTQKVTPVLKDEVDLKGSLSKIFDTTATDASSRKSTNTLISEDIKANPENYFTNGNETNVKEAIEKATIDVEGNFSNASW-TGNAYNTTSNGWDG----VTIEDANKLIYTTSSAQLTFKDLDGLKTELEKNGTDNKTVLQNALEAAGA-TIEADTTLTIKNRVGFTSGDLIHINVEAD-KSGTQTQYDLQIPTSNLNLSVTGLTIKVSGDNINTNEKTTTNFKYNIGIDSTLGFEQAKGAAPEETANNLSDAATAAKNILVKLGYVTTTGGS-DLSNDKISAALGIYNCNFTPKSATEKQGATPDAGVTDANKVYTVTVTATPFNDTYVWDDGS--SGEKDFSFDVSLKV 387
           TGAFGIVATVP+IVSSCSSTS+ NN  GN    QTQKVTPVLKD+V L+G+L+KI+DT+ TD   RK+TNTLI++DIKANPENYFTNG E  +K  I  AT+ V+G FSNASW +G +Y+ T+  W      VTI+D+NKL+Y +SS Q+    LDGLKTELEK       VL+NALEAAGA TI + TTLT++N++GFT+ DLIHINV+A   SG +T YDLQIPTS++NLSVT L++ V+G+NI    KTTTNF YNIGIDS + F Q              D A     +L +L Y +TTG +  L N+ I   LGIYN NF+  S  EK  ++       + K YT+T+ A P +  YVW DGS  +  K  SFDV + V
  S:    15 TGAFGIVATVPVIVSSCSSTSENNNGNGNGGADQTQKVTPVLKDDVSLEGALNKIYDTSTTD---RKNTNTLIADDIKANPENYFTNGAE--LKNVISDATVTVDGKFSNASWASGLSYDATTGNWKDDTTTVTIQDSNKLVYASSSKQINITSLDGLKTELEKT-----DVLKNALEAAGATTIASGTTLTVENKLGFTNDDLIHINVKATPTSGAETNYDLQIPTSDINLSVTDLSVTVTGNNIEAATKTTTNFTYNIGIDSEVHFNQGANLTAAS-----EDDAKDVNKVLEQLKYGSTTGSTFSLDNNAIIKGLGIYNVNFSNPSIQEKTVSSR----ATSEKTYTITLDAKPQSSEYVWADGSDVNTAKKISFDVKIDV 379
>gi|26554129|ref|NP_758063.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454137|dbj|BAC44467.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (384 aa)
Score = 634, Expect = 4.8e-64, Identities = 199/375 (53%), Positives = 248/375 (66%)
  Q:    14 LTGAFGIVATVPIIVSSCSSTSD--NNTGGNQDGQQTQKVTPVLKDEVDLKGSLSKIFDTTATDASSRKSTNTLISEDIKANP-ENYFTNGNETNVKEAIEKATIDVEGNFSNASWTGNAYNTTSNGWD-------GVTIEDANKLIYTTSSAQLTFKDLDGLKTELEKNGTDNKTVLQNALEAAG-ATIEADTTLTIKNRVGFTSGDLIHINVEADKSG---TQTQYDLQIPTSNLNLSVTGLTIKVSGDNINTNEKTTTNFKYNIGIDSTLGFEQAKGAAPEETANNLSDAATAAKNILVKLGYVTTTGGSDLSNDKISAALGIYNCNFTPKSATEKQGATPDAGVTDANKVYTVTVTATPFNDTYVWDDGSSGEKDFSFDVSLKVN 388
           +TGAFGIVATVP+IVSSCSSTSD   N  G    QQTQ +TP L + V+L GSLS I+D+T T  +++K     I+ DIK N   + F NG   +    +   ++ V G FS A WTG  +N  +  W+        +TI DANKL+YT+ S Q+  + LD L  +L    T     L+ ALE AG A+I   TTL + N +GFT+GDL+H+NV A  +G   T T YDLQIP SNLNL V  LTI V+G N+    +TTTNF +N+GID TL F Q  G AP  T + ++    AA  IL KLGY T TG +DLSNDKISAALGIYNC FTP +ATE   AT      + NKVYTVTVTA P++ +YVWDDGSSG K+F+FDVSL VN
  S:    14 MTGAFGIVATVPVIVSSCSSTSDNNGNNNGGNGNQQTQTITPELNETVNLSGSLSDIYDSTGTLNANQK-----IAADIKDNHLSDVFANGQALS---EVSDLSVTVSGEFSRALWTGLTFNGETGNWEDSEDNSNNITIADANKLVYTSESDQINIESLDDLHNKLSVRET-----LKTALENAGVASIPETTTLAVSNNLGFTNGDLLHVNVTATPTGASATATNYDLQIPVSNLNLVVPNLTITVAGTNVGEANRTTTNFNFNVGIDPTLNFSQT-GNAPSATTDEVT-GDDAASTILQKLGYTTATGSTDLSNDKISAALGIYNCKFTPTNATENTSAT---ATNNGNKVYTVTVTAEPYDTSYVWDDGSSGSKEFTFDVSLTVN 384
>gi|26554104|ref|NP_758038.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454112|dbj|BAC44442.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (394 aa)
Score = 605, Expect = 9.6e-61, Identities = 198/374 (52%), Positives = 261/374 (69%)
  Q:    14 LTGAFGIVATVPIIVSSCSSTSDNNTGGNQD------GQQTQKVTPVLKDEVDLKGSLSKIFDTTATDASSRKSTNTLISEDIKANPENYFTNGNETNVKEAIEKATIDVEGNFSNASWT----------GNAYNTTSNGWDGVTIEDANKLIYTTSSAQLTFKDLDGLKTELEKNGTDNKTVLQNALEAAGA-TIEADTTLTIKNRVGFTSGDLIHINVEAD-KSGTQTQYDLQIPTSNLNLSVTGLTIKVSGDNINTNEKTTTNFKYNIGIDSTLGFEQAKGAAPEETANNLSDAATAAKNILVKLGYVTTTGGS--DLSNDKISAALGIYNCNFTPKSATEKQGATPDAGVTDANKVYTVTVTATPF-NDTYVW-DDGSSGEKDFSFDVSLKV 387
           +TGAFGIVATVP+IVS+CSSTSDNNTGGN          QT+KVTP LKDEVDL GSLSKIFDTT ++AS+RK+T TLIS+DIK NPENYFTNGN+  VKEA++ A + V GNFSN+ WT          GN  ++T+     VTIE ANKL+Y TS  Q+    L+ LKT+L K+       L+N LE +GA TI   TTL+I+NR+GFT GDL+H+NV+A   +G +T YDLQIP S++NLSV  L+I+V+GDNI  + KTTT + +NIGID  +     +G+ P  TA   SD         +K G + T   +  +L N+ +  ALGIYN  F+ + A+  + +T        + V+TVT+ ATP  N  YVW D+G+S E+D +FDV+L +
  S:    14 MTGAFGIVATVPVIVSACSSTSDNNTGGNGGTDQGGGSTQTEKVTPTLKDEVDLSGSLSKIFDTT-SEASNRKTTATLISDDIKENPENYFTNGNDEKVKEAVKNANVTVNGNFSNSEWTKEGLLPFGEDGNWKDSTTT----VTIEAANKLVYATSLDQINISSLNDLKTQLTKDNG-----LKNILEKSGASTIAEGTTLSIENRLGFTGGDLLHVNVKAKPTTGNETNYDLQIPVSDINLSVPSLSIEVTGDNIEASNKTTTKYDFNIGIDPVVN-NYNQGSKP--TAATDSDVKVNQVLQDLKFGTIDTQDNTKINLDNEALIKALGIYNVTFSAEGASINKKSTTTRA---TDTVFTVTLKATPTANKNYVWADNGNSEERDITFDVTLSI 393
>gi|26554121|ref|NP_758055.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454129|dbj|BAC44459.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (378 aa)
Score = 599, Expect = 5.7e-60, Identities = 193/373 (51%), Positives = 250/373 (67%)
  Q:    15 TGAFGIVATVPIIVSSCSSTSDNNTGGNQDG----QQTQKVTPVLKDEVDLKGSLSKIFDTTATDASSRKSTNTLISEDIKANPENYFTNGNETNVKEAIEKATIDVEGNFSN-ASWTGNAYNTTSNGWDGVTIEDANKLIYTTSSAQLTFKDLDGLKTELEKNGTDNKTVLQNALEAAGATIEADTTLTIKNRVGFTSGDLIHINVEADKSG-TQTQYDLQIPTSNLNLSVTGLTIKVSGDNINTNEKTTTNFKYNIGIDSTLGFEQAKGAAPEETANNLSDAATAAKNILVKLGYVTTTGGSD-LSNDKISAALGIYNCNFTPKSATEKQGATPDAGVTDANKVYTVTVTATPFNDTYVWDDGSSGEKDFSFDVSLKV 387
           TGAFGIVATVP+IVSSCSSTSDNN G N +G    QQ  ++TP LK  V+L+G L+ I+DT  TD   RK+T+TLI  D+KANP+NYFTNGNE  +KE I+ + I V+G FS  +SW G+AY+T   G        A +++Y T++ Q+    L+ LK    K+ T       +A  +   +++  T L + N++   +GDL+H+NV+  K+  ++ + DLQIP SNLNL  T       G NI       T+F YNIGID+TL F Q KG APE T++++SD A AAK IL KLGY  TTG  D + NDKISAALGIYNC FT K+A      TP+A VT +NKVYTVTVTATP++ TYVWDDG+ G KD SFDVSL +
  S:    15 TGAFGIVATVPVIVSSCSSTSDNNGGSNNNGNGDNQQQTELTPALKSNVNLQGKLTGIYDTNTTD---RKNTSTLIVADMKANPDNYFTNGNE--IKEGIQSSEITVDGGFSTTSSWDGDAYDTWKTG--------ATQVMYPTAAPQINIASLNDLKETTFKDETAINKFFTDA--SLSESVKDVTGLNVANKLHLENGDLLHVNVKGTKTDKSEVKIDLQIPVSNLNLKTTLKVSIKGGTNIKEVTDLETSFSYNIGIDATLNFTQTKGTAPEVTSSDVSDEAAAAKAILKKLGY--TTGSDDAIDNDKISAALGIYNCKFTAKTAKVNDKETPNAEVTGSNKVYTVTVTATPYDSTYVWDDGAEGGKDISFDVSLNL 377
>gi|26554132|ref|NP_758066.1| P35 lipoprotein homolog reported as gene for P38 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454140|dbj|BAC44470.1| P35 lipoprotein homolog reported as gene for P38 lipoprotein [Mycoplasma penetrans HF-2] (383 aa)
Score = 570, Expect = 1.2e-56, Identities = 186/374 (49%), Positives = 234/374 (62%)
  Q:    15 TGAFGIVATVPIIVSSCSST---------------SDNNTGGNQDGQQTQKVTPVLKDEVDLKGSLSKIFDTTATDASSRKSTNTLISEDIKANPENYFTNGNETNVKEAIEKATIDVEGNFSNASWTGNAYNTTSNGWDGVTIEDANKLIYTTSSAQLTFKDLDGLKTELEKNGTDNKTVLQNALEAAGATIEADTTLTIKNRVGFTSGDLIHINVEADKS---GTQTQYDLQIPTSNLNLSV-----TGLTIKVSGDNINTNEKTTTNFKYNIGIDSTLGFEQAKGAAPEETANNLSDAATAAKNILVKLGYVTTTGGSDLSNDKISAALGIYNCNFTPKSATEKQGATPDAGVTDANKVYTVTVTATPFNDTYVWDDGSSGEKDFSFDVSLKVN 388
           TGAFGIVATVPIIVSSCSST                D    GN D Q+ + V P LKD V+L G LS I+ T +      K+TN LISEDIKANPENYFTNG+E  +K+ I ++T+ V+G FS + WT  +  TT +   GV      K+ Y  ++ Q+    L+ LK E  K    + T +Q  L AA  +    ++ T++N++G T+GDL+H+N++A+++   G     DLQIP SN+NL          T   +G NI      TTNF YNIGIDSTL F Q             +  A  A  +L KLGY T   G++L NDKISAALGIYNC FTPKSATEKQGAT   G    NKVYTV V A P++  YVWDDGS+  K+FSFDVSL VN
  S:    15 TGAFGIVATVPIIVSSCSSTDNGGSGNNTGGNGNQGDGGGSGNTDQQENKTVKPELKDNVELNGKLSTIYGTDS------KTTNELISEDIKANPENYFTNGSE--LKDVINQSTVTVDGGFSASQWTEGSDYTTWSAVTGVV-----KVTYPAAAPQIDIASLNALKQETFK----DDTTIQAFLTAANLSFSNTSSFTVENKLGLTNGDLLHVNIKANRTAANGGNLNLDLQIPVSNINLKTILKVSVSATNNSTGTNIEAVSDLTTNFSYNIGIDSTLNFTQTG-----TAPTATTAEANNATEVLKKLGYQT---GNNLDNDKISAALGIYNCKFTPKSATEKQGATAGLG---GNKVYTVVVDAAPYDSNYVWDDGSTDTKEFSFDVSLTVN 383
>gi|26554101|ref|NP_758035.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454109|dbj|BAC44439.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (394 aa)
Score = 560, Expect = 1.6e-55, Identities = 180/373 (48%), Positives = 234/373 (62%)
  Q:    15 TGAFGIVATVPIIVSSCSSTSDNNTGGNQDGQQ---------TQKVTPVLKDEVDLKGSLSKIFDTTATDASSRKSTNTLISEDIKANPENYFTNGNETNVKEAIEKATIDVEGNFSN----ASWTGNAY-------NTTSNGWDGVTIEDANKLIYTTSSAQLTFKDLDGLKTELEKNGTDNKTVLQNALEAAGATIEADTTLTIKNRVGFTSGDLIHINVEADKSGTQTQYDLQIPTSNLNLSVTGLTIKVSGDNINTNEKTTTNFKYNIGIDSTLGFEQAKGAAPEETANNLSDAATAAKNILVKLGYVTTTGGS-DLSNDKISAALGIYNCNFTPKSATEKQGATPDAGVTDANKVYTVTVTATPFNDTYVW-DDGSSGEKDFSFDVSLKV 387
           TGAFGIVATVPIIVSSCSST DNN G   +            T+KVTP LK EV L GSL KI+D++  D   RK+TN LI++D+KA+PENYFTNG++T VKE I+ AT+ V+G F+     + W   AY       N T         +D   +++ T+S Q+  K LD L ++L      N+  L+     A       TT T+KN++GFT+ DLIH+NVE D SGT+TQYDLQIPTS++NLSV+ L+IKV G NI   EKT+T F +NIGIDS   F Q       E A N  D       +L KLG+    G S +L ND I   LGIYN NF+ +   EK   T +      +  YTV++ A P ++ YVW DD +S EK  SFDV++K+
  S:    15 TGAFGIVATVPIIVSSCSSTGDNNGGSGDNNNGNQGGQDGQQTEKVTPELKSEVSLSGSLDKIYDSSTKD---RKTTNQLIADDVKAHPENYFTNGDKTEVKETIKNATVTVDGKFTTEETESPWKDVAYLDESSDANKTDANKSWSATKDLKPVLFPTTSDQIDIKSLDDLHSKL------NEAKLKEVFTNAKIANADKTTFTVKNKLGFTNSDLIHVNVEGDNSGTKTQYDLQIPTSDINLSVSDLSIKVEGTNIEAQEKTSTKFDFNIGIDSKENFNQGS----TEIAYNTKD-LVKVDEVLEKLGFAKKNGSSTELDNDAIIKGLGIYNVNFSGQEIKEKTVTTRE----QKDTTYTVSLKAKPTSNKYVWADDSTSDEKTISFDVTIKI 391
>gi|7839543|gb|AAF70318.1|AF260642_1 P38 [Mycoplasma penetrans] (352 aa)
Score = 514, Expect = 4.3e-50, Identities = 163/345 (47%), Positives = 211/345 (61%)
  Q:    44 DGQQTQKVTPVLKDEVDLKGSLSKIFDTTATDASSRKSTNTLISEDIKANPENYFTNGNETNVKEAIEKATIDVEGNFSNASWTGNAYNTTSNGWDGVTIEDANKLIYTTSSAQLTFKDLDGLKTELEKNGTDNKTVLQNALEAAGATIEADTTLTIKNRVGFTSGDLIHINVEADKS---GTQTQYDLQIPTSNLNLSV-----TGLTIKVSGDNINTNEKTTTNFKYNIGIDSTLGFEQAKGAAPEETANNLSDAATAAKNILVKLGYVTTTGGSDLSNDKISAALGIYNCNFTPKSATEKQGATPDAGVTDANKVYTVTVTATPFNDTYVWDDGSSGEKDFSFDVSLKVN 388
           D Q+ + V P LKD V+L G LS I+ T +      K+TN LISEDIKANPENYFTNG+E  +K+ I ++T+ V+G FS + WT  +  TT +   GV      K+ Y  ++ Q+    L+ LK E  K+     T +Q  L AA  +    ++ T++N++G T+GDL+H+N++A+++   G     DLQIP SN+NL          T   +G NI      TTNF YNIGIDSTL F Q             +  A  A  +L KLGY T   G++L NDKISAALGIYNC FTPKSATEKQGAT   G    NKVYTV V A P++  YVWDDGS+  K+FSFDVSL VN
  S:    28 DQQENKTVKPELKDNVELNGKLSTIYGTDS------KTTNELISEDIKANPENYFTNGSE--LKDVINQSTVTVDGGFSASQWTEGSDYTTWSAVTGVV-----KVTYPAAAPQIDIASLNALKQETFKD----DTTIQAFLTAANLSFSNTSSFTVENKLGLTNGDLLHVNIKANRTAANGGNLNLDLQIPVSNINLKTILKVSVSATNNSTGTNIEAVSDLTTNFSYNIGIDSTLNFTQTG-----TAPTATTAEANNATEVLKKLGYQT---GNNLDNDKISAALGIYNCKFTPKSATEKQGATAGLG---GNKVYTVVVDAAPYDSNYVWDDGSTDTKEFSFDVSLTVN 352
>gi|26554111|ref|NP_758045.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454119|dbj|BAC44449.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (374 aa)
Score = 506, Expect = 3.2e-49, Identities = 170/374 (45%), Positives = 217/374 (58%)
  Q:    15 TGAFGIVATVPIIVSSCSST---------------SDNNTGGNQDGQQTQKVTPVLKDEVDLKGSLSKIFDTTATDASSRKSTNTLISEDIKANPENYFTNGNETNVKEAIEKATIDVEGNFSNASW-TGNAYNT--TSNGWDGVTIEDANKLIYTTSSAQLTFKDLDGLKTELEKNGTDNKTVLQNALEAAGATIEADTTLTIKNRVGFTSGDLIHINVEADKSGTQTQYDLQIPTSNLNLSVT-----GLTIKVSGDNINTNEKTTTNFKYNIGIDSTLGFEQAKGAAPEETANNLSDAATAAKNILVKLGYVTTTGGSDLSNDKISAALGIYNCNFTPKSATEKQGATPDAGVTDANKVYTVTVTATPFNDTYVWDDGSSGEKDFSFDVSLKVN 388
           TGAFGIVATVP+IVSSCSST                D    G    Q+ + V P L  +V L GSLS I+    +  S  K+TN LISED+K NPE YFTNG E  +K+ I++  + V+G FS + W  G+ Y+T  TSNG   VT        Y  ++ Q+    L+ LK +  K    +   +Q  L AA  T    T  T++N++  +SGDL+H+N++  KSG     DLQIP SN+NL  T       T   SG NI      TTNF YNIGIDST+ F Q  GA P  T     D    A+ +L KLGYV++     L NDKISAALG+YNC F  KS+   +G             Y VT+TATPF+  Y+WDDG+SG KD  F VSL V+
  S:    15 TGAFGIVATVPVIVSSCSSTDNGGSGNNTGGNGNQGDGGGSGGTGQQENKTVKPELLKDVSLGGSLSTIY----SSGSDSKTTNELISEDVKTNPEKYFTNGTE--LKDVIKQTKVTVDGGFSASEWQNGDPYSTWSTSNGIVKVT--------YPAAAPQIDIASLNDLKQKTFK----DDAAIQTFLTAANLTFTGVTNYTVENQLSLSSGDLLHVNLKGTKSGGNLNVDLQIPVSNINLKATLKISVDATNNESGTNIEAVTDLTTNFSYNIGIDSTVNFTQT-GATPTATEAEAKD----AQKVLEKLGYVSSGA---LDNDKISAALGVYNCKFVAKSSEPGEGGK-----------YNVTLTATPFDSNYIWDDGTSGPKDLQFPVSLTVS 374
>gi|26554107|ref|NP_758041.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454115|dbj|BAC44445.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (386 aa)
Score = 490, Expect = 2.2e-47, Identities = 172/371 (46%), Positives = 224/371 (60%)
  Q:    15 TGAFGIVATVPIIVSSCSSTSD--NNTGGNQDGQQTQKVTPVLKDEVDLKGSLSKIFDTTATDASSRKSTNTLISEDIKANPEN-YFTNGNETNVKEAIEKATIDVEGNFSNASWTGNAYNTTSNGW----------DGVTIEDANKLIYTTSSAQLTFKDLDGLKTELEKNGTDNKTVLQNALEAAGA-TIEADTTLTIKNRVGFTSGDLIHINVEADKSG---TQTQYDLQIPTSNLNLSVTGLTIKVSGDNINTNEKTTTNFKYNIGIDSTLGFEQAKGAAPEETANNLSDAATAAKNILVKLGYV--TTTGGS---DLSNDKISAALGIYNCNFTPKSATEKQGATPDAGVTDANKVYTVTVTATPFNDTYVWDDGSSGEKDFSFDVSL 385
           TGAFGIVATVP+IVS+CSSTSD         DG Q Q + P L++ V+L G+LS IFD+T    +++K     I+ DI+ N  N  F NG E +    +E  T+ V GNFS +SW G  +N  S  W          D V IE+ANKLIYT+ S Q     LD  KT+L          L+ ALEAAGA TI+  TTL + N +GFT  DL+HINV A  +G   T T YDLQIP SNLN+ V  LTI V+G NI    +TTTNF +NIGID T+       +   E+A+  +     AK  LV LG    +T GG+    + ND +SA +G+YNC F   SAT        A V ++N  +T+T+ ATP  + YVWDDGS+G K  + + + 
  S:    15 TGAFGIVATVPVIVSACSSTSDNNTGGNTGGDGTQNQTINPELRESVNLSGALSDIFDSTGAQNANQK-----IAADIQQNHLNDVFVNGQELS---QVEDLTVSVTGNFSRSSWDGLTFNGESGNWGSVGEDGNITDSVNIEEANKLIYTSESEQFDISSLDDFKTKLSTGDK-----LKTALEAAGAGTIDNTTTLAVANNIGFTDDDLLHINVTATPAGDSPTVTNYDLQIPVSNLNIVVPNLTITVAGTNIGEANRTTTNFSFNIGIDDTV-------SESNESASLATANRNDAKQALVALGLASSSTEGGNTTYTIDNDAVSAVVGVYNCRFDIDSAT-------IAPVGESNDNFTITLQATPL-EGYVWDDGSNGSKPVTINATF 379
>gi|26554113|ref|NP_758047.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454121|dbj|BAC44451.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (365 aa)
Score = 480, Expect = 3.2e-46, Identities = 152/387 (39%), Positives = 223/387 (57%)
  Q:     1 MKIKKIKLLKALALTGAFGIVATVPIIVSSCSSTSDNNTGGNQDGQQTQKVTPVLKDEVDLKGSLSKIFDTTATDASSRKSTNTLISEDIKANPENYFTNGNETNVKEAIEKATIDVEGNFSNAS-WTGNAYNTTSNGWDGVTIEDANKLIYTTSSAQLTFKDLDGLKTELEKNGTDNKTVLQNALEAAGATIEADTTLTIKNRVGFTSGDLIHINVEADK---SGTQTQYDLQIPTSNLNLSVT-----GLTIKVSGDNINTNEKTTTNFKYNIGIDSTLGFEQAKGA---APEETANNLSDAATAAKNILVKLGYVTTTGGSDLSNDKISAALGIYNCNFTPKSATEKQGATPDAGVTDANKVYTVTVTATPFNDTYVWDDGSSGEKDFSFDVSLKV 387
           MK KKIKLLK LA  G+F IV+TVP I+S+CSST+D  TG          +TPV+K EV L+G L+ I+DT+    S RK TNTLI+EDIKAN + YF N +E  +K+ I+ +TI V+G FS  S W G  + T S    GVT     K  Y +++ ++    L+ LK E+ K   D+ ++ +   +A        +   + N+ G  +GDL+H+N++A++   + +    DLQIP SN NL  T       +  V G NI  +   TT+F Y+IGID  + ++  K A    P+E+ +        A  IL    Y   +G  +L NDKI++A+G++N  FTP S+ + +G         +  +Y +T+TA PF+D Y WDDGS+G K   F + L V
  S:     1 MKNKKIKLLKTLATVGSFVIVSTVPAIISACSSTADQYTG----------ITPVIKSEVSLQGKLTGIYDTST--GSDRKDTNTLIAEDIKANLDKYFVNVDE--LKDVIQTSTITVDGGFSEKSTWEGENFETWSTDARGVT-----KAPYPSAAPKIDITSLNALKDEILK---DDASIQKFLKDANLPFTSNASNFRLLNKPGLENGDLLHVNIKANRNRNNNSDLNLDLQIPVSNFNLKTTLKVSVSASNNVDGQNIGKDFNLTTHFNYSIGIDPAVNYKALKTALEVTPQESVD--------ATEILKLSDYTDFSG--NLDNDKIASAVGVFNSKFTPVSSVKVEG---------SQDMYNITLTAEPFSDLYFWDDGSTGSKTIQFQIKLNV 358
>gi|26554134|ref|NP_758068.1| P35 lipoprotein homolog reported as gene for P33 lipoprotein [Mycoplasma penetrans HF-2] >gi|27805657|sp|Q50368|P33_MYCPE Lipoprotein p33 precursor >gi|26454142|dbj|BAC44472.1| P35 lipoprotein homolog reported as gene for P33 lipoprotein [Mycoplasma penetrans HF-2] (376 aa)
Score = 472, Expect = 2.6e-45, Identities = 157/373 (42%), Positives = 220/373 (58%)
  Q:    15 TGAFGIVATVPIIVSSCSSTSDNNTGGNQDGQQTQKV---------TPVLKDEVDLKGSLSKIFDTTATDASSRKSTNTLISEDIKANPENYFTNGNETNVKEAIEKATIDVEGNF-SNASWTGNAYNTTSNGWDGVTIEDANKLIYTTSSAQLTFKDLDGLKTELEKNGTDNKTVLQNALEAAGATIEADTTLTIKNRVGFTSGDLIHINVEADKSGTQTQYDLQIPTSNLNLSVTGLTIKV------SGDNINTNEKTTTNFKYNIGIDSTLGFEQAKGAAPEETANNLSDAATAAKNILVKLGYVTTTGGSDLSNDKISAALGIYNCNFTPKSATEKQGATPDAGVTDANKVYTVTVTATPFNDTYVWDDGSSGEKDFSFDVSLKV 387
           TGAFGIVATVP+IVSSCSST +N   G+ +                TP +K +V L G+LSKI+DTT T   SRK+TNTLI+EDIKANPENYFTNG +    + +E  ++ V+G+F SN+ WTG+AY+  S       + D +K +Y ++S QL    L  LK++L+ +        ++ L    +T +AD +  I+N +GFT GDL+HINV A ++G     DL IP S+LNL +T L + V      +G+N+      TTNF YNIGI   +        AP E  N           +L  LGY  T   + L NDK+S +LG+YNC FT  SAT  +G+            +T+ + A P  D YVW+DG++ EK+ SF+ +  +
  S:    15 TGAFGIVATVPVIVSSCSSTDNNGGTGDNNTGGGGSGTDQQQGTTYTPAIKSDVTLSGALSKIYDTTNT-GDSRKNTNTLIAEDIKANPENYFTNGEDL---KKVEGWSVTVDGSFDSNSVWTGDAYSKWS------AVADTHKGVYKSTSKQLNINSLKDLKSQLDTSAKIKAICDESNL--VFSTADAD-SYKIQNELGFTGGDLLHINVTATQAGKTLNMDLGIPVSDLNLKITDLKVSVTASNNSTGNNVAAVSDLTTNFTYNIGIKEEV-------TAPTEKPNLAKTDKGEVMKVLKALGYTQTGDETKLDNDKVSNSLGLYNCEFTAVSATPVEGSEDK---------FTIKLKAKPLTD-YVWEDGTNTEKEISFEATFTM 373
>gi|26554109|ref|NP_758043.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454117|dbj|BAC44447.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (353 aa)
Score = 460, Expect = 7.8e-44, Identities = 159/350 (45%), Positives = 213/350 (60%)
  Q:    15 TGAFGIVATVPIIVSSCSSTSDNNTGGNQDGQQTQKVTPVLKDEVDLKGSLSKIFDTTATDASSRKSTNTLISEDIKANP-ENYFTNGNETNVKEAIEKATIDVEGNFSNASWTGNAYNTTSNGWD-------GVTIEDANKLIYTTSSAQLTFKDLDGLKTELEKNGTDNKTVLQNALEAAG-ATIEADTTLTIKNRVGFTSGDLIHINVEADKSG---TQTQYDLQIPTSNLNLSVTGLTIKVSGDNINTNEKTTTNFKYNIGIDSTLGFEQAKGAAPEETANNLSDAATAAKNILVKLGYVTTTGGS-----DLSNDKISAALGIYNCNFTPKSATEKQGATPDAGVTDANKVYTVTVTATPFN 364
           TGAFGIVATVP+IVSSCSSTSDNNTGG+ +  QTQ +TP L++ V+L G+L+ I+D+T    +++K     I+ DIK N   + FTNG   +    +   T+ V GNFS  SW G  +N  +  W+        +TI +ANKL+YT+ S Q+  + L+ L  +L    T     L+ ALE AG A I   TTL I N +GFT+GDL+H+NV A  +G   T T YDLQIP SNLNL V  LTI VSG N+    +TTTNF +NIGI+ T+     KG   E  A+N S     A   LV LG  T++  S      + ND +SA +G+YNCNF   +            V ++   YT+T+ ATP +
  S:    15 TGAFGIVATVPVIVSSCSSTSDNNTGGDSN-TQTQTITPELRETVNLSGALTDIYDSTGAQNANQK-----IAADIKENHLGDVFTNGEALS---QVSDLTVTVNGNFSRDSWAGLTFNGETGNWEDSANNQNNITIAEANKLVYTSESEQIDIESLNDLHEKLSVRDT-----LKTALENAGVAQIPETTTLAINNNLGFTNGDLLHVNVSATPTGSNPTITNYDLQIPVSNLNLVVPNLTITVSGTNVGEANRTTTNFNFNIGINDTVSETDEKG---ELAADNRS-----ANEALVALGLATSSTDSGNTTYTIDNDAVSAVVGVYNCNFASPTIQ---------AVDESAGTYTITLQATPLD 350
>gi|26554112|ref|NP_758046.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454120|dbj|BAC44450.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (399 aa)
Score = 452, Expect = 5.5e-43, Identities = 162/373 (43%), Positives = 221/373 (59%)
  Q:    15 TGAFGIVATVPIIVSSCSSTSDNNTGGNQDGQQTQKVTPVLKDEVDLKGSLSKIFDTTATDASSRKSTNTLISEDIKANPENYFTNGNETNVKEAIEKATIDVEGNFSNASWTGNAYNTTSNGW-------DGVTIEDANKLIYTTSSAQLTFKDLDGLKTELEKNGTDNKTVLQNALEAAGATIEADTTLTIKNRVGFTSG-------DLIHINVEADK-------SGTQTQYDLQIPTSNLNLSVTGLTIKVSGDNINTNEKTTTNFKYNIGIDSTLGF--EQAKGAAPEETANNLSDAATAAKNILVKLGYVTTTGG----SDLSNDKISAALGIYNCNFTPKSATEKQGATP--DAGVTDANKVYTVTVTATPFNDTYVWDDGSSGEKDFSFDVSLKV 387
           TGAFGIVATVP+IVS+CSSTSDNNTGG  D  QT+ +TP +K    L G+LS I+     + ++  +TN LI+++IK N    F NG+  N    +E   I V  +F  ++WTG  +N+ +  W       D V I++ANKL+Y T + +L    L  LK +L  +       L+  L+ AGAT++ADT  ++ N +GFT+        DL+H+NV   K       + T T YDLQIP S+L+L ++ L++ V G N+     TT    YNIGI+    +     K  A EE A  L D       +LVKLGY T   G    + L+ND I   LGIYN  F   +    QG  P  DA      K YT+T++ATP N  YVW+DG+S  KD SFDV L +
  S:    15 TGAFGIVATVPVIVSACSSTSDNNTGGG-DNTQTKTITPQIKSTSTLSGALSSIY-----NPANSSNTNALIADEIKKNLTEVFDNGDALNNVNDLE---ITVTHSFPESTWTGLTFNSDTGNWGNSTNAQDNVEIQEANKLLYPTQTTELNISSLSDLKEQLNDDAK-----LEKILDDAGATVDADTVYSVNNGLGFTNKNSGSENRDLLHVNVVGTKTTAGQTPTTTTTNYDLQIPVSDLDLEISNLSVTVKGSNVTETTATTNF-TYNIGINDAENYVDPSTKPTATEEEAGKLDD-------VLVKLGYATAATGGATETTLNNDAIIQGLGIYNVTFARTTTEGVQGIVPKEDASNNGNEKTYTITLSATP-NQGYVWEDGTSNAKDISFDVILDI 393
>gi|26554136|ref|NP_758070.1| P35 lipoprotein homolog reported as IMP14 [Mycoplasma penetrans HF-2] >gi|26454144|dbj|BAC44474.1| P35 lipoprotein homolog reported as IMP14 [Mycoplasma penetrans HF-2] (375 aa)
Score = 451, Expect = 8.5e-43, Identities = 163/374 (43%), Positives = 221/374 (59%)
  Q:    15 TGAFGIVATVPIIVSSCSSTSDNNTGGNQ-----------DGQQTQKVTPVLKDEVDLKGSLSKIFDTTATDASSRKSTNTLISEDIKANPENYFTNGNETNVKEAIEKATIDVEGNF-SNASWTGNAYNTTSNGWDGVTIEDANKLIYTTSSAQLTFKDLDGLKTELEKNGTDNKTVLQNALEAAGATIEADTTLTIKNRVGFTSGDLIHINVEADKSGTQTQYDLQIPTSNLNLSVTGLTIKV------SGDNINTNEKTTTNFKYNIGIDSTLGF--EQAKGAAPEETANNLSDAATAAKNILVKLGYVTTTGGSDLSNDKISAALGIYNCNFTPKSATEKQGATPDAGVTDANKVYTVTVTATPFNDTYVWDDGSSGEKDFSFDVSLKVN 388
           TGAFGIVATVP+IVSSCSSTSDNN  GN            D QQ    TP +K EV L GSLSKI+DTT  D  SRK+TN +I++DI +NPE+YFTNG +    + ++  ++ V+GNF S ++WTG AY+  S              +Y  +S QL    L+ LKT+L  + +     + +A+     +    ++  ++N+VGFT  DL+HINV A         +L IP S+LNL +TGL + V      +G+N+ + E  TT+F YNIGI  T+ F          E   NN+++A  A       LGY  T G   L NDKI+AA+GIYNC F   S  E    TP+         +T+T+ ATP N+ YVW+DG+   KD SFDV+  VN
  S:    15 TGAFGIVATVPVIVSSCSSTSDNNGNGNNNNDNNGGGSGTDQQQGTTYTPAIKTEVSLSGSLSKIYDTTTGD--SRKNTNEMIAQDILSNPEDYFTNGADL---KNVQGWSVTVDGNFDSQSTWTGEAYSAWS-------ANATFSGVYAIASEQLNITSLNDLKTQL--SDSTKLKAICDAIPGLRFSSATASSYQVQNQVGFTGDDLLHINVTAQDGNNTRNMNLGIPVSDLNLKITGLKVSVNGTNNETGNNVESVENLTTDFTYNIGIKDTVDFTQPTTTPTTTEANKNNVNEALKA-------LGYTKTDG--SLDNDKIAAAVGIYNCTFVASSIQEDSN-TPNK--------FTITLKATP-NENYVWEDGTREAKDVSFDVTFTVN 375
>gi|26554122|ref|NP_758056.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454130|dbj|BAC44460.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (383 aa)
Score = 451, Expect = 8.6e-43, Identities = 157/374 (41%), Positives = 210/374 (56%)
  Q:    15 TGAFGIVATVPIIVSSCSSTS----DNNTGGNQDGQQTQKVTPVLKDEVDLKGSLSKIFDTTATDASSRKSTNTLISEDIKANPENYFTNGNETNVKEAIEKATIDVEGNFSNASWTGNAYNTTSNGWDGVTIEDANKLIYTTSSAQLTFKDLDGLKTELEKNGTDNKTVLQNALEAAGATIEADTTLTIKNRVGFTSGDLIHINVEADKSGTQT---QYDLQIPTSNLNLSVTGLTIKV------SGDNINTNEKTTTNFKYNIGIDSTLGFEQAKGAAPEETANNLSDAATAAKNILVKLGYVTTTGGSDLSNDKISAALGIYNCNFTPKSATEKQGATPDAGVTDANKVYTVTVTATPFNDTYVWDDGSSGEKDFSFDVSLKVN 388
           TGAFGIVATVP+IVSSCSSTS    + N G   D Q    V P LK EV+L G L+ ++DT+   A +RK TNTLIS+DIKANP+ YF N    ++K+AI+ A + V GNFS + W        +  W     +    + Y T++ Q+    L+ LKT   K+     T +  +        E +    ++N++  +SGDL+H+N++AD   T       DLQIP SN+NL  T LT+ V      +G+ I       TNF YNIGIDST+ F       P+ + +     A  A  +L KLGY  T G  D  NDK+SAA+G+YNC FT  S+ E    +   G     K Y VT++A PF+  YVWDDG  G K   F V L VN
  S:    15 TGAFGIVATVPVIVSSCSSTSDNNVNGNGGQGGDQQTQTSVKPDLKSEVNLSGKLTGVYDTS---ADNRKDTNTLISDDIKANPDKYFNNA--ADIKDAIKDAKVTVNGNFSASEWNTQGAKDYAE-WSKDNSQAIPTVTYPTAAKQIDIASLNELKTVTFKDSDTISTFITESKITIDKFSEME-KFRVENKLHLSSGDLLHVNLKADNKTTGQAGLNLDLQIPVSNINLK-TSLTVSVDATTNTTGNKIEAVSDLKTNFSYNIGIDSTVNFTD-----PKISQSLTKTEADDATEVLKKLGYAGTDGTID--NDKVSAAIGVYNCKFTAVSSKEDTTVSAKTG----KKAYKVTLSAEPFDSNYVWDDGQIGAKQVDFTVQLTVN 382
>gi|986921|gb|AAC16392.1| p35 lipoprotein [Mycoplasma penetrans] >gi|1583185|prf||2120285A lipoprotein (362 aa)
Score = 447, Expect = 2.3e-42, Identities = 156/364 (42%), Positives = 209/364 (57%)
  Q:    15 TGAFGIVATVPIIVSSCSSTSD-----NNTGGNQDGQQTQKVTPVLKDEVDLKGSLSKIFDTTATDASSRKSTNTLISEDIKANPENYFTNGNETNVKEAIEKATIDVEGNFSNASWTGNAYNTTSNGWDGVTIEDANKLIYTTSSAQLTFKDLDGLKTELEKNGTDNKTVLQNALEAAGATIEADTTLTIKNRVGFTSGDLIHINVEADKSGTQTQYDLQIPTSNLNLSVTGLTIKVSGDNINTNEKTTTNFKYNIGIDSTLGFEQAKGAAPEETANNLSDAATAAKNILVKLGYVTTTGGS-DLSNDKISAALGIYNCNFTPKSATEKQGATPDAGVTDANKVYTVTVTATPFNDTYVWDDGSSGEKD 378
           TGAFGIVATVP+IVSSCSSTS+     N  GG     Q  +VTP +K EV L G+LSKI+DT     + R++T+ LI +DIKANPENYFTNG    +K+ I  AT+ V+G F+ +++TG AY+  S         D  K  Y+ +S QL  K ++ L+T L     D+  +           +   T   + N     S DL+HINV A    T    DL IP S+LNL + GL I VSG  I T+E  TTN+K+NIGID+T+     K   P       +D  T A+ +L KLGY T +G +  L  DK++ ALG+YNC F        +    +   T+ NK YTVT+ ATP ND Y W+DG++G K+
  S:    15 TGAFGIVATVPVIVSSCSSTSENNGNGNGNGGTDGNTQQTEVTPAIKSEVSLTGALSKIYDTKT--GTDRETTSQLIVKDIKANPENYFTNGEA--LKDVIASATVTVDGGFTESTFTGEAYSVWS------AKADVKKGTYSQASKQLDIKSINDLQTVL----GDSAAIKGICDLIPNLKLNNGTDYKVTNNGLSLSEDLLHINVTAKDGQTDVSMDLAIPVSDLNLKIDGLKISVSGTGIKTSE-LTTNYKFNIGIDNTV-----KTLTPAAVTLAEAD-RTNAEKVLEKLGYATVSGSTYTLDQDKLADALGLYNCKF--------EAVKSEKDSTNNNK-YTVTLKATP-NDGYFWEDGTNGAKE 353
>gi|26554135|ref|NP_758069.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|27805656|sp|Q50367|P35_MYCPE Lipoprotein p35 precursor >gi|26454143|dbj|BAC44473.1| P35 lipoprotein [Mycoplasma penetrans HF-2] (362 aa)
Score = 445, Expect = 3.3e-42, Identities = 159/367 (43%), Positives = 211/367 (57%)
  Q:    15 TGAFGIVATVPIIVSSCSSTSD-----NNTGGNQDGQQTQKVTPVLKDEVDLKGSLSKIFDTTATDASSRKSTNTLISEDIKANPENYFTNGNETNVKEAIEKATIDVEGNFSNASWTGNAYNTTSNGWDGVTIEDANKLIYTTSSAQLTFKDLDGLKTELEKNGTDNKTVLQNALEAAGATIEADTTLTIKNRVGFTSGDLIHINVEADKSGTQTQYDLQIPTSNLNLSVTGLTIKVSGDNINTNEKTTTNFKYNIGIDSTLGFEQAKGAAPEETANNLSDAATAAKNILVKLGYVTTTGGS-DLSNDKISAALGIYNCNFTPKSATEKQGATPDAGVTDANKVYTVTVTATPFNDTYVWDDGSSGEK-DFSF 381
           TGAFGIVATVP+IVSSCSSTS+     N  GG     Q  +VTP +K EV L G+LSKI+DT     + R++T+ LI +DIKANPENYFTNG    +K+ I  AT+ V+G F+ +++TG AY+  S         D  K  Y+ +S QL  K ++ L+T L     D+  +           +   T   + N     S DL+HINV A    T    DL IP S+LNL + GL I VSG  I T+E  TTN+K+NIGID+T+     K   P       +D  T A+ +L KLGY T +G +  L  DK++ ALG+YNC F        +    +   T+ NK YTVT+ ATP ND Y W+DG++G K D SF
  S:    15 TGAFGIVATVPVIVSSCSSTSENNGNGNGNGGTDGNTQQTEVTPAIKSEVSLTGALSKIYDTKT--GTDRETTSQLIVKDIKANPENYFTNGEA--LKDVIASATVTVDGGFTESTFTGEAYSVWS------AKADVKKGTYSQASKQLDIKSINDLQTVL----GDSAAIKGICDLIPNLKLNNGTDYKVTNNGLSLSEDLLHINVTAKDGQTDVSMDLAIPVSDLNLKIDGLKISVSGTGIKTSE-LTTNYKFNIGIDNTV-----KTLTPAAVTLAEAD-RTNAEKVLEKLGYATVSGSTYTLDQDKLADALGLYNCKF--------EAVKSEKDSTNNNK-YTVTLKATP-NDGYFWEDGTNGAKEDISF 357
>gi|26553715|ref|NP_757649.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26453722|dbj|BAC44053.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (519 aa)
Score = 441, Expect = 1.1e-41, Identities = 153/371 (41%), Positives = 217/371 (58%)
  Q:    15 TGAFGIVATVPIIVSSCSSTSDNNTGGNQDGQ-------QTQKVTPVLKDEVDLKGSLSKIFDTTATDASSRKSTNTLISEDIKANPENYFTNGNETNVKEAIEKATIDVEGNFSNASWTGNAYNTTSNGWDGVTIEDANKLIYTTSSAQLTFKDLDGLKTELEKNGTDNKTVLQNALEAAGATIEADTTLTIKNRVGFTSGDLIHINVEADKSGTQTQYDLQIPTSNLNLSVTGLTIKVSGDNINTNEKTTTNFKYNIGIDSTLGF-------EQAKGAAPEETANNLSDAATAAKNILVKLGYV-------TTTGGSDLSNDKISAALGIYNCNFTPKSATEKQGATPDAGVTDANK--VYTVTVTATPFNDTYVWDDGSSGEKDFSFDVSL 385
           TGAFGI+ATVP+IVSSCS+TSDNN G N  G        QT+KVTP  K  ++L G+L+ I++      S  K+TNTL+ E+IK N ++ F N NE   K       + V+GNFSN+SW G  Y  T+  W+GVTI D NKL Y + S Q+    L+ LK +L      ++T L+ AL  AG      +T TIKNR+G T  +LIH+NVE   S   TQYDLQIP S++NL ++ + I +SGD++N  E+ + N  +NIGI+S   +       +  K A  +     L   AT+    +V+           +TT    L  DKI+ +LGI+N  F   + T      P   V +      Y + +T +P    Y +DDG + +K FSF+V++
  S:    15 TGAFGIIATVPVIVSSCSTTSDNNGGNNNTGGGSGGGTTQTEKVTPKFKSSINLIGALTDIYN-----PSEGKNTNTLLGEEIKNNLDSAFENSNELENK----NFAVTVKGNFSNSSWGGEQY--TNGNWNGVTITDDNKLYYDSESPQIDISSLNDLKNKLS-----DETTLKEALSKAGVADTEGSTYTIKNRLGLTDNNLIHVNVEGKSSTATTQYDLQIPVSDINLDLSNVDISISGDDVNPVEE-SVNLNFNIGINSKTTYTAPTETQKLTKKATVDSVMEQLGFKATSTTKNVVRTSITLTQDNGASTTSLVGLDTDKIAESLGIFNTEFKNITLTRVSEWNPYDEVQENQNYLTYRIDITGSP-KQGYYFDDGKTEDKTFSFNVNI 390
>gi|26553722|ref|NP_757656.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26453729|dbj|BAC44060.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (368 aa)
Score = 439, Expect = 2.0e-41, Identities = 157/371 (42%), Positives = 211/371 (56%)
  Q:    15 TGAFGIVATVPIIVSSCSS----------TSDNNTGGNQDGQQTQKVTPVLKDEVDLKGSLSKIFDTTATDASSRKSTNTLISEDIKANPENYFTNGNETNVKEAIEKATIDVEGNF-SNASWTGNAYNTTSNGWDGVTIEDANKLIYTTSSAQLTFKDLDGLKTELEKNGTDNKTVLQNALEAAGATIEADTTLTIKNRVGFTSGDLIHINVEADKSGTQTQYDLQIPTSNLNLSVTGLTIKVS------GDNINTNEKTTTNFKYNIGIDSTLGFEQAKGAAPEETANNLSDAATAAKNILVKLGYVTTTGGS-DLSNDKISAALGIYNCNFTPKSATEKQGATPDAGVTDANKVYTVTVTATPFNDTYVWDDGSSGEKDFSFDVSL 385
           TGAFGIVATVP+IVSSCSS           +     G     Q Q +TP LK +V  +G+LSKI+DTTA     ++ TNTLI++DIKANPE YF NG +    ++IE  T+ V+GNF S ASW G  Y+  S         +  K +Y  +SAQL    L  LK++L  +       ++   E +  T    T   ++N++GFT GDL+H+NV A ++ T    D+ IP S+LNL +TGL + VS      G+N+   +  TTNF YNIGI+ T+     K   P      L+   T A  +L  LGY T       L NDK+S ALG+YNC F          A       +ANK YTVT+ ATP ND YVW++G+   K+ SF  +L
  S:    15 TGAFGIVATVPVIVSSCSSTDNNGGTGNNNNQGGGNGGNTDTQQQTITPKLKADVTTQGALSKIYDTTA-----KEDTNTLIAKDIKANPETYFENGADL---KSIEGWTVTVDGNFDSAASWEGQTYDEWSK------TANIKKGVYEQTSAQLNIASLKDLKSQLSTSEQ-----IKKLCEDSNLTFSDATEYKVQNQLGFTDGDLLHVNVTAKQNTTNLVMDVAIPVSDLNLKITGLKVSVSKTENQTGNNVAEVKDLTTNFTYNIGINDTV-----KEITPTAV---LAQDKTDANKVLKALGYATEAANVYTLDNDKLSDALGLYNCKFE---------AVSSKATNEANK-YTVTLKATP-NDGYVWENGTKDAKEVSFVATL 365
>gi|3850057|emb|CAA07195.1| putative lipoprotein [Mycoplasma penetrans] (360 aa)
Score = 437, Expect = 3.5e-41, Identities = 158/366 (43%), Positives = 214/366 (58%)
  Q:    14 LTGAFGIVATVPIIVSSCSSTSDNNTGGNQ-----------DGQQTQKVTPVLKDEVDLKGSLSKIFDTTATDASSRKSTNTLISEDIKANPENYFTNGNETNVKEAIEKATIDVEGNF-SNASWTGNAYNTTSNGWDGVTIEDANKLIYTTSSAQLTFKDLDGLKTELEKNGTDNKTVLQNALEAAGATIEADTTLTIKNRVGFTSGDLIHINVEADKSGTQTQYDLQIPTSNLNLSVTGLTIKV------SGDNINTNEKTTTNFKYNIGIDSTLGF--EQAKGAAPEETANNLSDAATAAKNILVKLGYVTTTGGSDLSNDKISAALGIYNCNFTPKSATEKQGATPDAGVTDANKVYTVTVTATPFNDTYVWDDGSSGEKDF 379
           LTGAFGIVATVP+IVSSCSSTSDNN  GN            D QQ    TP +K EV L GSLSKI+DTT  D  SRK+TN +I++DI +NPE+YFTNG +    + ++  ++ V GNF S ++WTG AY+  S              +Y  +S QL    L+ LKT+L  + +     + +A+     +    ++  ++N+VGFT  DL+HINV A         +L IP S+LNL +TGL + V      +G+N+ + E  TT+F YNIGI  T+ F          E   NN+++A  A       LGY  T G   L NDKI+AA+GIYNC F   S  E    TP+         +T+T+ ATP N+ YVW+DG+   K F
  S:     1 LTGAFGIVATVPVIVSSCSSTSDNNGNGNNNNDNNGGGSGTDQQQGTTYTPAIKTEVSLSGSLSKIYDTTTGD--SRKNTNEMIAQDILSNPEDYFTNGADL---KNVQGWSVTVNGNFDSQSTWTGEAYSAWS-------ANATFSGVYAMASEQLNITSLNDLKTQL--SDSTKLKAICDAIPGLRFSSATASSYQVQNQVGFTGDDLLHINVTAQDGNNTRNMNLGIPVSDLNLKITGLKVSVNGTNNETGNNVESVENLTTDFTYNIGIKDTVDFTQPTTTPTTTEANKNNVNEALKA-------LGYTKTDG--SLDNDKIAAAVGIYNCTFVASSIQEDSN-TPNK--------FTITLKATP-NENYVWEDGTREAKMF 353
>gi|26554118|ref|NP_758052.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454126|dbj|BAC44456.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (388 aa)
Score = 423, Expect = 1.5e-39, Identities = 159/373 (42%), Positives = 219/373 (58%)
  Q:    15 TGAFGIVATVPIIVSSCS---STSDNNTGGNQDGQQTQKVTPVLKDEVDLKGSLSKIFDTTATDASSRKSTNTLISEDIKANPENYFTNGNETNVKEAIEKATIDVEGNFSN--ASWTGNAYNTTSNGWDGVTIEDA-------NKLIYTTSSAQLTFKDLDGLKTELEKNGTDNKTVLQNALEAAGATIEADTTLTIKNRVGFTSGDLIHINVEADKS-GTQTQYDLQIPTSNLNLSVTGLTIKVSGDNI--NTNEKTTTNFKYNIGIDSTLGFEQAKGAAPEETANNLSDAATAAKNILVKLGYVTTTG-GSDLSNDKISAALGIYNCNFTPKSATEKQGATPDAGVTDANKVYTVTVTATP---FNDTYVWDDGSSGEKDFSFDVSLKV 387
           TGAFGIVATVP+IVS+CS   +  +N  GG+    QT+K+TP L ++V L GSL  I+D+T T     K TN LI+E+IKAN  + F NG +   +  ++   I V GNF    ++W    Y  +S   D  T + +       NK++Y T+S Q+  K LD L T+L     D  T+     E    T E   + TIKNR G T+ DLIH+NVE  KS  T+ Q+DLQIPTS++NL V+ LT+KV G NI    N KTTT F +NIGID+T  + Q       ET+   ++ A   + +L  L   T  G  + L N+ +  ALG+Y   F+   A   + +       D    YTVT+ ATP    N+TYVWDDG+S  KD +F V++K+
  S:    15 TGAFGIVATVPVIVSACSSTNNGGNNQGGGSGGTTQTEKITPELNEKVSLGGSLKDIYDSTGT-----KKTNELIAEEIKANINSVFKNGEKLAAESDLK---ITVNGNFPETLSNWKDLPYLDSSETADNATADKSWSATASLNKVLYPTTSKQIDIKSLDDLYTKL-----DEATIKAALKEGGVTTTETSKSFTIKNRPGLTNDDLIHVNVEETKSDDTKVQHDLQIPTSDINLVVSDLTVKVEGQNIETTENTKTTTEFDFNIGIDTTTHYNQG-----SETSTAQTEDAVKVEQVLKDLKLATADGNNTKLDNEALIKALGVYTVTFSLDDAKVTKDSVQSRAPVDTK--YTVTLKATPNKDSNNTYVWDDGTSDAKDITFPVTIKI 386
>gi|26554117|ref|NP_758051.1| P35 lipoprotein homolog reported as putative lipoprotein IMP13 [Mycoplasma penetrans HF-2] >gi|26454125|dbj|BAC44455.1| P35 lipoprotein homolog reported as putative lipoprotein IMP13 [Mycoplasma penetrans HF-2] >gi|27260911|dbj|BAC45034.1| lipoprotein P42 [Mycoplasma penetrans] (390 aa)
Score = 421, Expect = 2.6e-39, Identities = 156/373 (41%), Positives = 223/373 (59%)
  Q:    15 TGAFGIVATVPIIVSSCSSTSDNNTGGNQDGQ--------QTQKVTPVLKDEVDLKGSLSKIFDTTATDASSRKSTNTLISEDIKANPENYFTNGN----ETNVKEAIEKATIDVEGNFSNASWTGNAYNTT----SNGWDGVTIEDANKLIYTTSSAQLTFKDLDGLKTELEKNGTDNKTVLQNALEAAG-ATIEADTTLTIKNRVGFTSGDLIHINVEADKSGTQT-QYDLQIPTSNLNLSVTGLTIKVSGDNINT--NEKTTTNFKYNIGIDSTLGFEQAKGAAPEETANNLSDAATAAKNILVKLGYVTTTGGSDLSNDKISAALGIYNCNFTPKSATEKQGATPDAGVTDANKVYTVTVTATPF---NDTYVWDDGSSGEKDFSFDVSLKV 387
           TGAFGIVATVP+IVSSCSSTSDNN G   +          Q++K+TP L D+V L GSL  I+D+T T     K +N LI+E+IK N ++ F NG     ET++K  ++    +   N+++  +  N  + +    +  W  +T  D N ++Y+T S Q+  K LD LKTEL+K       VL+NAL+ AG +T E  T   IKN+   T+ DL+H+NV   KS   T Q+DLQIPTS++NL V+ L++KV G NI +    KTTT F +NIGIDST  ++Q    +   T  ++         +L  L   T   G+ L+N+ +  ALGIYN  F+  S  +                Y +T+ ATP    N+TYVWDDG++  KD +F V++ +
  S:    15 TGAFGIVATVPVIVSSCSSTSDNNNGNGNNNNGGGSDGNTQSEKITPELNDKVSLAGSLKDIYDSTGT-----KKSNELIAEEIKNNIKDVFKNGEKLAAETDLKITVDGGFPEKLTNWTDLPYVDNTDDASKKDPNKSWSAIT--DLNPVLYSTKSNQINIKSLDDLKTELQKT-----DVLKNALKDAGVSTAETSTAFEIKNQPALTNDDLVHVNVIETKSDKSTVQHDLQIPTSDINLVVSNLSVKVEGKNIESTDTTKTTTEFNFNIGIDSTQHYDQGSAKSAATTEGDVD-----VNKVLKDLNLATDDKGA-LNNEALIKALGIYNVTFSSPSIKKATVTA----RAATATSYEITLKATPNKEGNNTYVWDDGTTEAKDITFPVTIDI 388
>gi|3850052|emb|CAA07192.1| putative lipoprotein [Mycoplasma penetrans] (353 aa)
Score = 413, Expect = 1.7e-38, Identities = 151/321 (47%), Positives = 202/321 (62%)
  Q:    14 LTGAFGIVATVPIIVSSCSSTSDNNTGGNQ-----------DGQQTQKVTPVLKDEVDLKGSLSKIFDTTATDASSRKSTNTLISEDIKANPENYFTNGNETNVKEAIEKATIDVEGNFSN--ASWTGNAYNTTSN---------GWDGVTIEDANKLIYTTSSAQLTFKDLDGLKTELEKNGTDNKTVLQNALEAAG-ATIEADTTLTIKNRVGFTSGDLIHINVEADKSGTQT-QYDLQIPTSNLNLSVTGLTIKVSGDNINT--NEKTTTNFKYNIGIDSTLGFEQAKGAAPEETANNLSDAATAAKNILVKLGYVTTTGGSDLSNDKISAALGIYNCNFTPKS 334
           LTGAFGIVATVP+IVSSCSSTSDNN  GN            D QQ    TP +K EV L GSLSKI+DTT  D  SRK+TN +I++DI +NPE+YFTNG +    + ++  ++ V+G F     +WT   Y   ++          W  +T  D N ++Y+T S Q+  K LD LKTEL+K       VL+NAL+ AG +T E  T   IKN+   T+ DL+H+NV   KS   T Q+DLQIPTS++NL V+ L++KV G NI +    KTTT F +NIGIDST  ++Q    +   T  ++         +L  L   T   G+ L+N+ +  ALGIYN  F+  S
  S:     1 LTGAFGIVATVPVIVSSCSSTSDNNGNGNNNNDNNGGGSGTDQQQGTTYTPAIKTEVSLSGSLSKIYDTTTGD--SRKNTNEMIAQDILSNPEDYFTNGADL---KNVQGWSVTVDGGFPEKLTNWTDLPYVDNTDDASKKDPNKSWSAIT--DLNPVLYSTKSNQINIKSLDDLKTELQKT-----DVLKNALKDAGVSTAETSTAFEIKNQPALTNDDLVHVNVIETKSDKSTVQHDLQIPTSDINLVVSNLSVKVEGKNIESTDTTKTTTEFNFNIGIDSTQHYDQGSAKSAATTEGDVD-----VNKVLKDLNLATDDKGA-LNNEALIKALGIYNVTFSSPS 329
>gi|26554138|ref|NP_758072.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454146|dbj|BAC44476.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (362 aa)
Score = 410, Expect = 4.5e-38, Identities = 154/371 (41%), Positives = 218/371 (58%)
  Q:    15 TGAFGIVATVPIIVSSCSSTS---------DNNTGGNQDGQQTQKVTPVLKDEVDLKGSLSKIFDTTATDASSRKSTNTLISEDIKANPENYFTNGNETNVKEAIEKATIDVEGNFSNASWTGNAYNTTSNGWDGVTIEDANKLIYTTSSAQLTFKDLDGLKTELEKNGTDNKTVLQNALEAAGATIEADTTLTIKNRVGFTSGDLIHINVEADKSGTQT-QYDLQIPTSNLNLSVTGLTIKVSGDNINTNEKTTTNFKYNIGIDSTLGFEQAKGAAPEETANNLSDAATAAKNILVKLGYVTTTGGSDLSNDKISAALGIYNCNFTPKSATEKQGATPDAGVTDANKVYTVTVTATPFNDTYVWDDGSSGEK-DFSFDVSL 385
           TGAFGIVATVP+IVSSCSSTS         +NN   + +GQQ  ++TP +K EV L G+LSKI+D       + KST+ LI+EDIKANP NYF NG    +K+ I+ AT+ V G F+ +++ G+ Y T S       + D  K  Y  +S QL  K ++ L+T+L    ++N  ++ +A+     T  +D  +  KN +    GDL+H+N+ A ++GT     DL IP S+LNL +  L I VSG  I  +   TTN+K+N+GID+T+  +    A    TA +     T  K     LGY  +     L NDK+S ALG+YNCNF   S+    G         ANK YT+T+ ATP N+ YVW+DG++  K D +F+ +L
  S:    15 TGAFGIVATVPVIVSSCSSTSDNNGGNGNNNNNGNQDGNGQQQTEITPTIKKEVSLSGALSKIYD-------ANKSTSDLIAEDIKANPTNYFDNGEA--LKDLIKDATVSVNGGFTESTFKGDTYETWS-----AKVGD-KKGTYAQASKQLDIKSINDLETQL--GDSNNIKIICDAIPTLKLTNGSDYKVE-KNALKL-DGDLLHVNISAKENGTTAVSMDLAIPVSDLNLKIDALKISVSGTGIKESTDLTTNYKFNVGIDNTV--KPITNATGTVTAGDREKVMTVMK----ALGYTVSGQDDKLDNDKLSDALGLYNCNFEAVSSKPVSG--------QANK-YTITLKATP-NEGYVWEDGTNNPKTDITFEATL 361
>gi|26554137|ref|NP_758071.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454145|dbj|BAC44475.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (361 aa)
Score = 409, Expect = 5.8e-38, Identities = 151/371 (40%), Positives = 208/371 (56%)
  Q:    15 TGAFGIVATVPIIVSSCSST-------SDNNTGGNQDGQQTQKVTPVLKDEVDLKGSLSKIFDTTATDASSRKSTNTLISEDIKANPENYFTNGNETNVKEAIEKATIDVEGNFSNASWTGNAYNTTSNGWDGVTIEDANKLIYTTSSAQLTFKDLDGLKTELEKNGTDNKTVLQNALEAAGATIEADTTLTIKNRVGFTSGDLIHINVEADKSGT--QTQYDLQIPTSNLNLSVTGLTIKVSGDNINTNEKTTTNFKYNIGIDSTLG-FEQAKGAAPEETANNLSDAATAAKNILVKLGYVTTTGGSDLSNDKISAALGIYNCNFTPKSATEKQGATPDAGVTDANKVYTVTVTATPFNDTYVWDDGSSGEK-DFSFDVSL 385
           TGAFGIVATVP+IVSSCSST        +N  G    GQQ  +VTP +K EV L G+LSKI+D        +K+T+ LI+EDIKANP NYF NG+   +KE I+ AT+ V G F+ +++ G  Y+  S        +DA K  Y  S+AQL  K ++ L+T+L     D+K +       +   I   +   ++       GDL+H+N+ A + G   + + DL IP S+LNL +  L I V+G  I T+   TT + +N+GID+T+     AKG   E           A       LGY T T G++L NDK+S ALG+YNC+F      E  G  P  G T     YT+ + ATP N  YVW+DG++  K D SF  +L
  S:    15 TGAFGIVATVPVIVSSCSSTSDNNGNSDNNPGGQGDGGQQQTEVTPTIKTEVSLSGALSKIYD-------GKKTTSDLIAEDIKANPTNYFDNGDA--LKELIKDATVSVNGGFTESTFKGETYDVWS--------KDAKKGTYPQSAAQLNIKSINDLETQL----GDSKAIQTLCESISSLKITNGSDYKVEKNALKLDGDLLHVNITAKEDGKTDRVKMDLAIPVSDLNLKIDDLKISVNGTGIKTSTDLTTKYTFNVGIDNTVKTITGAKGVLAENERKEFLKVMKA-------LGY-TDTAGTNLDNDKLSDALGLYNCSF------EVTGVDPVTGSTSGE--YTIKLKATP-NKDYVWEDGTNTPKTDVSFVATL 358
>gi|26554157|ref|NP_758091.1| signal-peptide-less P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454166|dbj|BAC44495.1| signal-peptide-less P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (448 aa)
Score = 405, Expect = 1.5e-37, Identities = 130/335 (38%), Positives = 189/335 (56%)
  Q:    51 VTPVLKDEVDLKGSLSKIFDTTATDASSRKSTNTLISEDIKANPENYFTNGNETNVKEAIEKATIDVEGNF-SNASWTGNAYNTTSNGWDGVTIEDANKLIYTTSSAQLTFKDLDGLKTELEKNGTDNKTVLQNALEAAGATIEADTTLTIKNRVGFTSGDLIHINVEADKS-GTQTQYDLQIPTSNLNLSVTGLTIKVSGDNINTNEKTTTNFKYNIGIDSTLGFEQAKGAAPEETANNLSDAATAAKNILVKLGYVTTTGGS-DLSNDKISAALGIYNCNFTPKSATEKQGATPDAGVTDANKVYTVTVTATPFNDTYVWDDGSSGEKDFSFDVSL 385
           +TP +   ++L GSL++IFD   T AS RKST+ +I++DI AN E YF+NGN+    + +   TID  G+F S +SWTG AY   S+     T+       Y +S  Q+    L+ LKT+ +  G      LQN L  +G    +++T TI+N +GFT GDL+H+N+  +   G     DLQIP S++NL++ GL +  +G+N+      TTNF YNIGID T+ F + K      ++ N +    A    LV LG+ T   GS  L+++KISAALG++NC F   S TE Q    +         +T+ + ATP N  Y W++GS   K+ SF V L
  S:   140 ITPAINKTINLTGSLTRIFDVN-TPASYRKSTDIMIAQDIHANLEKYFSNGNDI---KTVNNLTIDASGSFPSVSSWTGLAYANWSSNVKHSTV-------YASSLPQINITSLNDLKTKWDSQG------LQNILLESGLKF-SNSTFTIQNLLGFTDGDLVHMNIFVESGYGEDFTVDLQIPVSDINLTIPGLRVTANGENVQYLLIDTTNFTYNIGIDDTVNFVKPKTGVTSLSSANKNKVNEA----LVSLGFATRNSGSYTLNSNKISAALGVFNCTFEGVSITEDQSKPNN---------FTIVLRATP-NVNYYWENGSRDYKELSFKVDL 445
Score = 139, Expect = 1.1e-06, Identities = 51/145 (35%), Positives = 69/145 (47%)
  Q:   243 LTIKVSGDNINTNEKTTTNFKYNIGIDSTLGFEQAKGAAPEETANNLSDAATAAKNILVKLGYVTTTGGSD--LSNDKISAALGIYNCNFTPKSATEKQGATPDAGVTDANKVYTVTVTATPF-NDTYVWDDGSSGEKDFSFDVSLKV 387
           + I VSG ++ T   TT NF YNIGI+S     Q        T    S  A     ILVKLGY       +  L+ + +    GIYN  F+  S +  +           + VYT+T+  TP  N  +VW+DGSS  K  SFD ++ V
  S:     1 MQISVSGTDVRTT-NTTINFNYNIGINSQSSLPQLT-----STPRGSSSEAKDPNKILVKLGYAEIASNKEITLNQEVLQEEFGIYNVEFSNASISPSKNTQ-----NGYSGVYTITLDVTPITNKGFVWEDGSSNTKKISFDTNVDV 137
>gi|26554127|ref|NP_758061.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454135|dbj|BAC44465.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (384 aa)
Score = 404, Expect = 2.2e-37, Identities = 155/375 (41%), Positives = 208/375 (55%)
  Q:    14 LTGAFGIVATVPIIVSSC---SSTSDNNTGGNQDGQQTQKVTPVLKDEVDLKGSLSKIFDTTATDASSRKSTNTLISEDIKANPENYFTNGNETNVKEAIEKATIDVEGNFSNASWTGNAYNTTSNGW-------DGVTIEDANKLIYTTSSAQLTFKDLDGLKTELEKNGTDNKTVLQNALEAAGATIEADTTLTIKNRVGFTSG--------DLIHINVEADKSGTQ---TQYDLQIPTSNLNLSVTGLTIKVSGDNI-NTNEKTTTNFKYNIGIDSTLGFEQAKGAAPEETANNLSDAATAAKNILVKLGYVTTTGGSD-LSNDKISAALGIYNCNFTPKSATEKQGATPDAGVTDANKVYTVTVTATPFNDTYVWDDGSSGEKDFSFDVSLKVN 388
           +TGAFGIVATVP+IVS+C   S  + NN  G    QQTQ +TP +K E  L G+LS I+DT  T       TN LI+ +IK N    F NG + +    +    + V   F  ++WTG +++  S  W         VTI DANKL+Y + +  L    L  LKT+L+       T L+  L   G T  ADTT ++ N +GFT+         DL+H+NV   K+G+    T YDLQIP S+LNL +T L++ V G N+  T EKTT    YNIGI+  + F     A P   A+  ++  T   N L  LGY  T  G D + NDK++AALGIYNC FT         A     + DA   +T  + ATP N  YVW+DG++  K   F     V+
  S:    14 MTGAFGIVATVPVIVSACSSTSDNNGNNNNGGDTNQQTQSITPKIKTESKLSGALSNIYDTANTG-----KTNELIANEIKKNLSEVFENGEDLS---KVNDLQVSVTHTFPASTWTGLSFDAASGNWKHSTDSNQDVTITDANKLLYASKTQALDISSLSDLKTQLD------DTKLKAILTDTGVTPAADTTYSVANALGFTNKKKDDTNNRDLLHVNVVGTKTGSNPGTTNYDLQIPVSDLNLKLTDLSVTVKGTNVAETTEKTT--LTYNIGINDVVEFVDPS-AKPTVAASVKTNKETM--NALKALGYTATVSGQDQIDNDKVAAALGIYNCTFT-------LAAENPLVIDDATNKFTFNLVATP-NSGYVWEDGTNTAKPVQFATDFTVS 384
>gi|26554161|ref|NP_758095.1| signal-peptide-less P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454170|dbj|BAC44499.1| signal-peptide-less P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (494 aa)
Score = 400, Expect = 5.6e-37, Identities = 137/385 (35%), Positives = 212/385 (55%)
  Q:     1 MKIKKIKLLKALALTGAFGIVATVPIIVSSCSSTSDN---NTGG------NQDGQQTQKVTPVLKDEVDLKGSLSKIFDTTATDASSRKSTNTLISEDIKANPENYFTNGNETNVKEAIEKATIDV--EGNFSNASWTGNAYNTTSNGWDGVTIEDANKLIYTTSSAQLTFKDLDGLKTELEKNGTDNKTVLQNALEAAGATIEADTTLTIKNRVGFTSGDLIHINVEADKSGTQTQYDLQIPTSNLNLSVTGLTIKVSGDNINTNEKTTTNFKYNIGIDSTLGFEQAKGAAPEETANNLSDAATAAKNILVKLGYVTTTGGSD----LSNDKISAALGIYNCNFTPKSATEKQGATPDAGVTDANKVYTVTVTATPFNDTYVWDDGSSGEKDFSFDVSL 385
           MK ++ K+ K +AL+G F + A VP  V S ++ + N   N  G      N  G +  KVTP LK  + + GS   +FD       S K+TN L+++ IK NP  +F N       E +     DV  E N S+++WTG +Y+ +   W G TIE++NKL+Y++SS   T   LD  K +L        + L+++L AAG  ++++TT +IKN++G + G L HINVEA  S  +  YDLQIPTSN+N S   L IKV+G+++    K    FKY+IGI S     +  G++        S++A     ++  LG+++++        L N+K+S ALG++N  F+         A  +         + VT+T    N  Y ++DG++  K+FSF V L
  S:     1 MKTQRSKIGKVIALSGIFTVTAAVPAAVLSSAALNGNFANNQSGDALIPSNPSGHENTKVTPKLKSSIQMMGS-EDLFDL-----GSNKTTNELLAQKIKDNPSLFFEN------PEVLAGKNFDVVVEDNLSSSAWTGQSYDVSKGNW-GNTIEESNKLLYSSSSPNFTISSLDDFKAKLNAG-----SRLKDSLTAAGLNVDSNTTPSIKNKIGLSDG-LFHINVEASVSNKKADYDLQIPTSNINFSFENLNIKVTGNDV-VETKQRVAFKYSIGIKS---ISKYNGSSEIMKMWYASESA-----VMSGLGFLSSSKNESSELILDNNKVSKALGVFNTTFSNTKLELDNSAVNEGNYL----TFKVTITGNA-NADYCFEDGTT-SKEFSFPVKL 366
>gi|26554156|ref|NP_758090.1| signal-peptide-less P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454165|dbj|BAC44494.1| signal-peptide-less P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (697 aa)
Score = 396, Expect = 1.6e-36, Identities = 132/355 (37%), Positives = 195/355 (54%)
  Q:    34 TSDNNTGGNQDGQQTQKVTPVLKDEVDLKGSLSKIFDTTATDASSRKSTNTLISEDIKANPENYFTNGNETNVKEAIEKATIDVEGNFSNASWTGNAYNTTSNGWDGVTIEDANKLIYTTSSAQLTFKDLDGLKTELEKNGTDNKTVLQNALEAAGATIEADTTLTIKNRVGFTSGDLIHINVEADKSGTQTQY--DLQIPTSNLNLSVTGLTIKVSGDNINTNEKTTTNFKYNIGIDSTLGFEQAKGAAPEETANNLSDAATAAKNILVKLGYVTTTGGS-DLSNDKISAALGIYNCNFTPKSATEKQGATPDAGVTDANKVYTVTVTATPFNDTYVWDDGSSGEKDFSFDVSLKVN 388
           TSD             ++TP L   +DLKGSLS+IFDT+ +   +RK TNT+I+EDIK+N  NYF+NGN+    + +E   + V GNF  ++WTG AY+T    W   T       IY++ SAQ+    L+ LKT+L   G      L   L AAG      ++  I+N +G + GDL+H+N+      T   +  DL IP S++NL V+ L + VSG N+      + N+ YN+GID T+ F +        ++ N ++   A    LV LG+ T +G +  L+ DKISAALG++NC F        +G +     + AN  +T+T+ ATP N  Y W+DG++  K+ SF V L V+
  S:   373 TSDTKPVSFNVNVSVDEITPSLNSTLDLKGSLSRIFDTSGS--GTRKDTNTVIAEDIKSNLNNYFSNGNDL---KTVEDLDVTVNGNFPTSTWTGVAYDT----WKSSTSYTG---IYSSESAQIDITSLNDLKTKLTTKG------LYGILLAAGLKFSG-SSFAIQNEIGLSGGDLLHVNIRITSEWTTNPFTVDLAIPVSDINLKVSNLGVSVSGSNVKALSNGSVNYTYNVGIDDTVNFVKPTTGVTALSSANKTNVNEA----LVSLGFATKSGTNYTLNKDKISAALGVFNCTF--------EGISIQEDASTANN-FTITLKATP-NTNYYWEDGTNVPKELSFKVDLTVS 697
Score = 343, Expect = 2.7e-30, Identities = 132/388 (34%), Positives = 205/388 (52%)
  Q:     1 MKIKKIKLLKALALTGAFGIVATVPIIVSSCSSTSDNNTGGNQDGQ--------------QTQKVTPVLKDEVDLKGSLSKIFDTTATDASSRKSTNTLISEDIKANPENYFTNGNETNVKEAIEKATIDVEGNFSNASWTGNAYNTTSNGWDGVTIEDANKLIYTTSSAQLTFKDLDGLKTELEKNGTDNKTVLQNALEAAGATIEADTTLTIKNRVGFTSGDLIHINV-EADKSGTQTQYDLQIPTSNLNLSVTGLTIKVSGDNINTNEKTTTNFKYNIGIDSTLGFEQAKGAAPEETANNLSDAATAAKNILVKLGYVTTTGGSD--LSNDKISAALGIYNCNFTPKSATEKQGATPDAGVTDANKVYTVTVTATPFNDTYVWDDGSSGEKDFSFDVSLKVN 388
           MK ++ KLLK L++TG F   A VPI + S    S + T                     Q Q + P LK  ++L GSL KIFD   + +S+   TN+LI+++IK N +  F N ++    E +   +I V+G FS     GN     + GW   T+   N+++Y +S  Q     LD  K++L  N T  K ++  + +A+     A  ++   + +G    +L+H+NV E D S      DLQIP SN+NL+V+ + + VSGDN+ T    TTNF YN+GI      +Q++   P +     +    +A  ILVKLGY      +   L+ D +   LGIYN  F+  +A+     +   G T + K+ ++  T TP N  +VW+DG+S  K  SF+V++ V+
  S:     1 MKSQRKKLLKILSITGIFVATAAVPITLLSKYVISASLTNSKNQNNQDNNNQDGGGDTTPQAQTIVPKLKSSINLSGSLDKIFDAKNSSSSN---TNSLIAQEIKNNLDKSFDNASDL---EKVNNLSISVDGGFSGGVTWGNKQYDQNIGWGKETV--GNEILYGSSLDQFNISSLDDFKSQL-NNDTKLKDIISKS-DASKFDSTATYSIASGSNLGLVGDNLVHVNVIETDASSNTKSIDLQIPISNINLNVSNMIVSVSGDNVETQTNKTTNFSYNVGIS-----DQSQFTNPVDAPVASASEVKSANKILVKLGYAEVAANNQITLNQDLLKEELGIYNVTFSNANASIAPNGSTTDGTTGSYKI-SLDATPTP-NKDFVWEDGTSDTKPVSFNVNVSVD 388
>gi|26554120|ref|NP_758054.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454128|dbj|BAC44458.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (389 aa)
Score = 395, Expect = 2.4e-36, Identities = 158/373 (42%), Positives = 210/373 (56%)
  Q:    15 TGAFGIVATVPIIVSSCSSTSDNN-------TGGNQDGQQTQKVTPVLKDEVDLKGSLSKIFDTTATDASSRKSTNTLISEDIKANPENYFTNGNETNVKEAIEKATIDVEGNFSN--ASWTGNAY--------NTTSNGWDGVTIEDANKLIYTTSSAQLTFKDLDGLKTELEKNGTDNKTVLQNALEAAGATIEADTTLTIKNRVGFTSGDLIHINVEA---DKSGTQTQYDLQIPTSNLNLSVTGLTIKVSGDNIN--TNEKTTTNFKYNIGIDSTLGFEQAKGAAPEETANNLSDAATAAKNILVKLGYVTTTGGSDLSNDKISAALGIYNCNFTPKSATEKQGATPDAGVTDANKVYTVTVTATPF---NDTYVWDDGSSGEKDFSFDVSLKV 387
           TGAFGIVATVP+IVSSCSSTSDNN        GG     Q++K+TP L D+V L GSL  I+D+T         TN L++++IK N    F NG +    EA     I V GNF    ++W    Y         T +  W   T  +   ++Y TSS Q+  K LD L T+L    T     L++ L+AAG T    +T  IKNR G T+ DLIH+NV     D + T+T YDLQIPTS++NL V+ L++KV G NI    + KTTT   +NIGIDST  + Q       +  N           +L  L +V T    D  N+ +   LG+YN  F+   A+  +  T     T     Y VT+ ATP     +TYVWDDG+SG KD +F V++K+
  S:    15 TGAFGIVATVPVIVSSCSSTSDNNTGGDTNQGGGTGGDTQSEKITPELNDKVSLSGSLKDIYDSTGA-----TKTNELLAKEIKDNINTVFKNGEKL---EAETDLKITVNGNFPETLSNWKDLPYIDSTEASNPTPAKSWSATT--NLQTVVYATSSEQINIKSLDDLHTQLSVEKT-----LKDILKAAGVTNTDTSTYEIKNRPGLTNDDLIHVNVGGTANDTNKTKTIYDLQIPTSDINLVVSDLSVKVEGKNIETTDSTKTTTELDFNIGIDSTTHYNQTIDVTEADEKN------VEVNKVLETLKFVKTDKTID--NEALIKELGVYNVTFSLDGASIAKKETTARAATPTE--YVVTLKATPNKNDKNTYVWDDGTSGTKDITFPVTIKI 387
>gi|26554189|ref|NP_758123.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454198|dbj|BAC44527.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (517 aa)
Score = 393, Expect = 3.7e-36, Identities = 138/371 (37%), Positives = 196/371 (52%)
  Q:    15 TGAFGIVATVPIIVSSCSST------SDNNTGGNQD-------------GQQTQKVTPVLKDEVDLKGSLSKIFDTTATDASSRKSTNTLISEDIKANPENYFTNGNETNVKEAIEKATIDVEGNFSNASWTGNAYNTTSNGW-DGVTIEDANKLIYTTSSAQLTFKDLDGLKTELEKNGTDNKTVLQNALEAAGATIEADTTLTIKNRVGFTSGDLIHINVEADKSGTQT---QYDLQIPTSNLNLSVTGLTIKVSGDNINTNEKTTTNFKYNIGIDSTLGFEQAKGAAPEETANNLSDAATAAKNILVKLGYVTTTGGSDLSNDKISAALGIYNCNFTPKSATEKQGATPDAGVTDANKVYTVTVTATPFNDTYVWDDGSSGEKDFSFDVSL 385
           TG FGIV T+P IVS+CSS       S +N G NQD             G   QK+ P +   VDL GSL+ I+D+T       K  N L+ E +  N    FTN +E   K       I V+GNFS  SW+G+ Y+  +N W  G  I+ AN+++Y++ S QL    LD LK++L  +       L+  LE AG T+    T  + N++G T   L+H+NV    SGT +    +DLQIP S++ L +  L + VSG ++   E +  N K+NIGI S   +          T N  S  AT       K   VT+T G  L+++ +  ALG+YN  F+  + T      PD  VT +   YTV V  +P N  Y +DD +   K F F++ +
  S:    15 TGTFGIVITIPAIVSACSSIKEKNDGSQSNNGNNQDNSKDQGSEGSGNGGITNQKIVPKINSSVDLIGSLTDIYDSTGN-----KDINVLLGEKLSNNASKIFTNADELENK----NYAIAVKGNFSRDSWSGDQYDAGNNKWGSGSKIDPANQVVYSSKSKQLNISSLDDLKSQLTND------FLKKELEKAGVTVNQSATYAVANKLGLTDDILLHVNVTETASGTTSVSKNFDLQIPVSDIKLDIKDLKVIVSGSDVEQIE-SDINLKFNIGIKSKTNYSPRDIKKFNVTPNVDSIIATLG----FKDSSVTSTEGVALNSEALGKALGVYNTTFSKPALTLNSDIKPD--VTGSFLTYTVIVDGSP-NQGYYFDDETDYSKKFIFNIKV 385
>gi|26554160|ref|NP_758094.1| signal-peptide-less P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454169|dbj|BAC44498.1| signal-peptide-less P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (692 aa)
Score = 385, Expect = 3.4e-35, Identities = 129/335 (38%), Positives = 186/335 (55%)
  Q:    51 VTPVLKDEVDLKGSLSKIFDTTATDASSRKSTNTLISEDIKANPENYFTNGNETNVKEAIEKATIDVEGNFSNASWTGNAYNTTSNGWDGVTIEDANKLIYTTSSAQLTFKDLDGLKTELEKNGTDNKTVLQNALEAAGATIEADTTLTIKNRVGFTSGDLIHINVEADKSGTQTQYDLQIPTSNLNLSVTGLTIKVSGDNINTNEKTTTNFKYNIGIDSTLGFEQAKGAAP--EETANNLSDAATAAKNILVKLGYVTTTGGSD-----LSNDKISAALGIYNCNFTPKSATEKQGATPDAGVTDANKVYTVTVTATPFNDTYVWDDGSSGEKDFSFDVSL 385
           +TP L   ++L GS+SKIFDTT T + +RK TNT+I+EDIKANPENYF+NG++    + I    + V GNF  ++WTG+ Y T  +     T+   N  IY+ S  QL    L  LKT++ + G  N  +L + L  +GAT         +N +GFT  DL+H+ V    +      DL IP S++NL+V+ L + V+G  + T     TN+ YNIGID T+ F +    +P  EE   N+++A       LV LG+ T    S+     L + KIS ALG+YNC F   +  E           D+   YT+T+ ATP N  Y WD G++  ++ +F V L
  S:   383 ITPDLNQTINLTGSVSKIFDTTTT-SGTRKDTNTVIAEDIKANPENYFSNGSDL---KTISDLAVTVNGNFPTSTWTGSPYETWKS-----TVTSTNVGIYSPSLPQLNISSLSDLKTKINQLGIYN-VLLTSGLTYSGAT------FAFQNELGFTDDDLLHVCVRVTSTYGNVNVDLGIPLSSINLTVSALAVSVNGTGVQTLTNGNTNYTYNIGIDDTVNFTKPTTVSPLTEENKTNVNEA-------LVSLGFATKNTNSNPNTYTLDSTKISKALGVYNCTFEGIAIQE-----------DSANNYTITLKATP-NANYNWDSGTNESRELTFKVDL 689
Score = 306, Expect = 4.4e-26, Identities = 134/378 (35%), Positives = 203/378 (53%)
  Q:    10 KALALTGAFGIVATVPIIVSS----------CSSTSDNNTGGNQDGQQTQKVTPVLKDEVDLKGSLSKIFDTTATDASSRKSTNTLISEDIKANPENYFTNGNETNVKEAIEKATIDVEGNF-SNASWTGNAYNTTSNGWDGVTIEDANKLIYTTSSAQLTFKDLDGLKTELEKNGTDNKTVLQNALEAAGAT-IEADTTLTIKNRVGFTSGDLIHINVEADKSGTQTQYDLQIPTSNLNLSVTGLTIKVSGDNINTNEKTTTNFKYNIGIDSTLGFEQAKGAAPEETANNLSDAATAAKNILVKLGY--VTTTGGSDLSNDKISAALGIYNCNFTPKSATEKQGATPDAGVTDANK-VYTVTVTATPF-NDTYVWDDGSSGEKDFSFDVSLKV 387
           K LA+TG F + A  PI + S           +S ++NN GG     Q Q +TP LK  ++L GS+ KI+ +      +   T TLI+++IK N ++ F N  E    +++    I VEG+F  N+SW G  Y+ T NGW        N+++Y+T    L    L+ LK +L    TD K  ++  L A+ ++ ++ +   T+KN+ GFTS +LIHINV      +    DLQIP S++N +++ + I VSGDN+ T   TTT   YN+ I++     Q   + P  TA+ +SD       +LVKLG+  + +     L+   +   LGIYN  F+  S        P    TD     Y ++  ATP  N  +VW+DG+S  K  SFDV++ V
  S:    16 KILAITGIFTVSAATPIALVSKYVIFKNSSNGNSNNNNNNGGGNTNPQNQTITPKLKSSINLSGSIDKIYSS-----QNSSDTKTLIAQEIKNNLDSAFENSEEL---KSVNNLNISVEGDFGDNSSWAGIEYSGT-NGWSSTV--SGNEVLYSTDLNTLNISSLNDLKYQL----TDAK--IKEILNASDSSKLKTNAEYTVKNKPGFTSNNLIHINVFEILGSSVKNLDLQIPYSSVNFNISNMQISVSGDNVQTTNATTT-LNYNVAINTETNSTQI-ASRPTATASEISD----VNKVLVKLGFAEIGSDNNVTLNQKALQEELGIYNVVFSNAS------IAPSGTTTDGQSGAYKISFDATPIANKGFVWEDGTSTAKSVSFDVNVDV 380
>gi|26554193|ref|NP_758127.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454202|dbj|BAC44531.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (365 aa)
Score = 383, Expect = 5.6e-35, Identities = 142/370 (38%), Positives = 211/370 (57%)
  Q:    15 TGAFGIVATVPIIVSSCSS---------TSDNNTGGNQDGQQTQKVTPVLKDEVDLKGSLSKIFDTTATDASSRKSTNTLISEDIKANPENYFTNGNETNVKEAIEKATIDVEGNF-SNASWTGNAYNTTSNGWDGVTIEDANKLIYTTSSAQLTFKDLDGLKTELEKNGTDNKTVLQNALEAAGATIEADTTLTIKNRVGFTSGDLIHINVEADKSGTQTQY--DLQIPTSNLNLSVTGLTIKVSGDNINTNEKTTTNFKYNIGIDSTLGFEQAKGAAPEETANNLSDAATAAKNILVKLGYVTTTGG-SDLSNDKISAALGIYNCNFTPKSATEKQGATPDAGVTDANKVYTVTVTATPFNDTYVWDDGSSGEKDFSFDVS 384
           TGAFGIV+ VP+IVSSCSS          +  +  GN +  Q QKVTP LK  ++  G L KI+D+++   ++RK+T+TL+ E+   NP+  FTN  E   K+      I+V+G F +N +WTG  Y+ T  GW    +     + Y  S + +    L+ LKT+L+ N T +K +   +L+       ++TT T++N++   +GDL+H+NV      +   +  DLQIP S+LNL +  L+I VSG ++   +K   N  +NIGI+    F Q    A   T +N+ DA  A    LV LGY TT+   + L+N KIS+A+GIYNC F+  +   K         TD N  YT+ + A P N  YVW+DG++  K  S DV+
  S:    15 TGAFGIVSAVPLIVSSCSSTDNDETNNNNNGQDNQGNTENPQNQKVTPKLKSSINFSGDLGKIYDSSS--GTNRKTTDTLLEEEFTKNPDLIFTNAKELEDKD----FKIEVDGGFDTNNAWTGTPYSGTG-GWKTSVLR---SVFYAESLSSIDITSLNDLKTKLD-NATISKIITAASLQF------SNTTYTVQNQLSLENGDLLHVNVLGTIGNSSRSFTLDLQIPISDLNLVIPNLSISVSGTDVELIDKQEVNLDFNIGINENTNFNQ---GATTLTKDNVVDADKA----LVALGYATTSNNVTTLNNTKISSAIGIYNCTFSASTVVLKS--------TDTN-TYTINLVAKP-NTEYVWEDGTNTSKIISLDVT 363
>gi|26554125|ref|NP_758059.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454133|dbj|BAC44463.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (378 aa)
Score = 381, Expect = 1.0e-34, Identities = 156/374 (41%), Positives = 208/374 (55%)
  Q:    15 TGAFGIVATVPIIVSSCSSTSD--NNTGGNQDGQQTQKVTPVLKDEVDLKGSLSKIFDTTATDASSRKSTNTLISEDIKANPENYFTNGNETNVKEAIEKATIDVEGNFSNASWTGNAYNTTSNGWDGVTIEDANKLIYTTSSAQLTFKDLDGLKTELEKNGTDNKTVLQNALEAAGATIEADTTLTIKNRVGFTSG-------DLIHINV------EADKSGTQTQYDLQIPTSNLNLSVTGLTIKVSGDNINTNEKTTTNFKYNIGIDSTLGFEQAKGAAPEETANNLSDAATAAKNILVKLGYVTTTGG-SDLSNDKISAALGIYNCNFTPKSATEKQGATPDAGVTDANKVYTVTVTATPFNDTYVWDDGSSGEKDFSFDVSLKVN 388
           TGAFGIVATVP+IVSSCSSTSD       N  G QTQ +TP ++  V L G+LS I+DT     SS ++TN  I+E+IK N E  FTNG   +    +E   I V  NF  ++W G AY+  S GW    ++    ++Y  +   LT   L  LKT+L    +D+K  +Q    AAG T   + T  ++N +GFT+        DL+H+NV      ++    T   YDLQIP S+LNL +  L++ V G N+      TT   YNIGI+    F Q       + ++  +D A AA   LV L Y T   G + L N+KISA LGIYN  FT  S     G          N  YT+T++ATP  D YVW+DGS+  K  SF+V+  VN
  S:    15 TGAFGIVATVPVIVSSCSSTSDNNTGGDNNGGGTQTQTITPQIQSAVTLNGALSDIYDTA---NSSSENTNAKIAEEIKNNLETVFTNGAALSDVSDLE---ITVSHNFPESTWIGTAYSGDS-GWYSAQMD---TVLYDYTLNPLTISSLSDLKTQL----SDSK--IQEIFTAAGTTTTTNATYAVQNALGFTNKNNGAENRDLLHVNVLETVPGQSGGDPTTKNYDLQIPVSDLNLELKDLSVTVKGTNV-AETTLTTTLTYNIGINEAQNFTQPTTNPTVQGSDIQNDDANAANKALVALTYATEADGQTTLDNEKISAELGIYNSVFTAVSIKPVDG---------GNNQYTITLSATP-KDGYVWEDGSNTAKQVSFNVTFTVN 377
>gi|986922|gb|AAC16393.1| p33 lipoprotein [Mycoplasma penetrans] >gi|1583186|prf||2120285B lipoprotein (318 aa)
Score = 374, Expect = 6.3e-34, Identities = 118/254 (46%), Positives = 163/254 (64%)
  Q:    15 TGAFGIVATVPIIVSSCSSTSDNNTGGNQDGQQTQKV---------TPVLKDEVDLKGSLSKIFDTTATDASSRKSTNTLISEDIKANPENYFTNGNETNVKEAIEKATIDVEGNF-SNASWTGNAYNTTSNGWDGVTIEDANKLIYTTSSAQLTFKDLDGLKTELEKNGTDNKTVLQNALEAAGATIEADTTLTIKNRVGFTSGDLIHINVEADKSGTQTQYDLQIPTSNLNLSVTGLTIKV------SGDNINTNEKTTTNFKYNIGI 268
           TGAFGIVATVP+IV SCSST +N   G+ +                TP +K +V L G+LSKI+DTT T   SRK+TNTLI+EDIKANPENYFTNG +    + +E  ++ V+G+F SN+ WTG+AY+  S       + D +K +Y ++S QL    L  LK++L+ +        ++ L    +T +AD +  I+N +GFT GDL+HINV A ++G     DL IP S+LNL +T L + V      +G+N+      TTNF YNIGI
  S:    15 TGAFGIVATVPVIVYSCSSTDNNGGTGDNNTGGGGSGTDQQQGTTYTPAIKSDVTLSGALSKIYDTTNT-GDSRKNTNTLIAEDIKANPENYFTNGEDL---KKVEGWSVTVDGSFDSNSVWTGDAYSKWS------AVADTHKGVYKSTSKQLNINSLKDLKSQLDTSAKIKAICDESNL--VFSTADAD-SYKIQNELGFTGGDLLHINVTATQAGKTLNMDLGIPVSDLNLKITDLKVSVTASNNSTGNNVAAVSDLTTNFTYNIGI 271
>gi|3850055|emb|CAA07194.1| putative lipoprotein [Mycoplasma penetrans] (336 aa)
Score = 373, Expect = 9.4e-34, Identities = 140/321 (43%), Positives = 197/321 (61%)
  Q:    14 LTGAFGIVATVPIIVSSCSSTSDNNTGGNQDGQ--------QTQKVTPVLKDEVDLKGSLSKIFDTTATDASSRKSTNTLISEDIKANPENYFTNGN----ETNVKEAIEKATIDVEGNFSNASWTGNAYNTT----SNGWDGVTIEDANKLIYTTSSAQLTFKDLDGLKTELEKNGTDNKTVLQNALEAAG-ATIEADTTLTIKNRVGFTSGDLIHINVEADKSGTQT-QYDLQIPTSNLNLSVTGLTIKVSGDNINT--NEKTTTNFKYNIGIDSTLGFEQAKGAAPEETANNLSDAATAAKNILVKLGYVTTTGGSDLSNDKISAALGIYNCNFTPKS 334
           LTGAFGIVATVP+IVSSCSSTSDNN G   +          Q++K+TP L D+V L GSL  I+D+T T     K +N LI+E+IK N ++ F NG     ET++K  ++    +   N+++  +  N  + +    +  W  +T  D N ++Y+T S Q+  K LD LKTEL+K       VL+NAL+ AG +T E  T   IKN+   T+ DL+H+NV   KS   T Q+DLQIPTS++NL V+ L++KV G NI +    KTTT F +NIGIDST  ++Q    +   T  ++         +L  L   T   G+ L+N+ +  ALGIYN  F+  S
  S:     1 LTGAFGIVATVPVIVSSCSSTSDNNNGNGNNNNGGGSDGNTQSEKITPELNDKVSLAGSLKDIYDSTGT-----KKSNELIAEEIKNNIKDVFKNGEKLAAETDLKITVDGGFPEKLTNWTDLPYVDNTDDASKKDPNKSWSAIT--DLNPVLYSTKSNQINIKSLDDLKTELQKT-----DVLKNALKDAGVSTAETSTAFEIKNQPALTNDDLVHVNVIETKSDKSTVQHDLQIPTSDINLVVSNLSVKVEGKNIESTDTTKTTTEFNFNIGIDSTQHYDQGSAKSAATTEGDVD-----VNKVLKDLNLATDDKGA-LNNEALIKALGIYNVTFSSPS 323
>gi|26554103|ref|NP_758037.1| putative P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|22901855|gb|AAN10106.1| putative lipoprotein mp8 [Mycoplasma penetrans] >gi|26454111|dbj|BAC44441.1| P35 lipoprotein homolog fragment [Mycoplasma penetrans HF-2] (329 aa)
Score = 371, Expect = 1.6e-33, Identities = 135/311 (43%), Positives = 187/311 (60%)
  Q:    14 LTGAFGIVATVPIIVSSCSSTS------DNNTGGNQDGQQTQKVTPVLKDEVDLKGSLSKIFDTTATDASSRKSTNTLISEDIKANPENYFTNGNETNVKEAIEKATIDVEGNFSNASWTGNAYNTTSNGWDGVTIEDANKLIYTTSSAQLTFKDLDGLKTELEKNG-TDNKTVLQNALEAAGATIEADTTLTIKNRVGFTSGDLIHINVEAD-KSGTQT--QYDLQIPTSNLNLSVT-----GLTIKVSGDNINTNEKTTTNFKYNIGIDSTLGFEQAKGAAPEETANNLSDAATAAKNILVKLGYVTTTGGS-DLSNDKISAALG 324
           +TGAFGIVATVP+IVSSCSSTS      +NN G   D Q    + P +K +V L G L+ I+D + TD   RK TNTLIS+DIKANP+ YFTNG   ++K+AI+ A + V GNFS + W        S  W      + +K++Y T +AQ+    L+ LKT+  K+  T NK +  + +    A +       ++N++  +  DL+H+N++AD K+  Q+    DL+IP SN+NL  T       T   +G+ I      TTNF YNIGIDST+ F       P+      +D A  A+ +L KLGY T T G+  L NDKISAA+G
  S:    14 MTGAFGIVATVPVIVSSCSSTSDNNGNGNNNGGQGGDQQTQTTIKPAIKSDVQLSGKLNNIYDASTTD---RKDTNTLISDDIKANPDKYFTNG--ADIKDAIKDAKVTVNGNFSASEWNDQGAKEYSE-WSKDGNNNISKILYPTEAAQIDIASLNELKTKTFKDSETINKFITDSKITI--ANLANMQNFRVENKLYLSDEDLLHVNLKADNKTANQSGLNLDLEIPVSNINLKTTLTVSVDATTNTTGNKIEAVSGLTTNFSYNIGIDSTVKFTD-----PKTYPTVTTDEAKKAETVLEKLGYATNTSGNITLDNDKISAAIG 327
>gi|26554159|ref|NP_758093.1| signal-peptide-less P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454168|dbj|BAC44497.1| signal-peptide-less P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (713 aa)
Score = 360, Expect = 2.8e-32, Identities = 125/336 (37%), Positives = 183/336 (54%)
  Q:    50 KVTPVLKDEVDLKGSLSKIFDTTATDASSRKSTNTLISEDIKANPENYFTNGNETNVKEAIEKATIDVEGNF-SNASWTGNAYNTTSNGWDGVTIEDANKLIYTTSSAQLTFKDLDGLKTELEKNGTDNKTVLQNALEAAGATIEADTTLTIKNRVGFTSGDLIHINVEADKSGTQT-QYDLQIPTSNLNLSVTGLTIKVSGDNINTNEKTTTNFKYNIGIDSTLGFEQAKGAAPEETANNLSDAATAAKNILVKLGYVTTTGGSD-----LSNDKISAALGIYNCNFTPKSATEKQGATPDAGVTDANKVYTVTVTATPFNDTYVWDDGSSGEKDFSFDVSL 385
           +++P L   ++L G LSKI+D   T + SRKSTNTLI+EDIKAN + YF+NGN+    + +E  ++   G+F + +SWTG  Y+T S              +Y  S  Q+    L+ LKT+    G      + N L  +G    +D+T T++N +GFT GDL+H+N+  +   T     DLQIP SN+NL+V  L +  +G N+ + +  TTNF YNIGI  T+ F +           N ++   A    LV LG+ T    S+     L ++KISAALG++NC F   S TE +    +         YT+ + A+P N  Y W+ GSS  K+ SF V L
  S:   400 EISPALNTTLNLTGPLSKIYDVEGT-SGSRKSTNTLIAEDIKANLDTYFSNGNDL---KTVENLSVSASGSFPTTSSWTGTEYSTWSTSVQ-------YSAVYGQSLGQINISSLNDLKTKWNSQG------IYNVLLGSGLRF-SDSTFTVQNLLGFTGGDLLHMNIFVNSGYTANFTVDLQIPASNINLTVPTLRVTANGSNVASLQVDTTNFTYNIGIKDTVDFVKPTTGVTALAPANKTNVNEA----LVSLGFATRNTSSNPYTYTLDSEKISAALGVFNCTFEGISITEDESNPNN---------YTIVLKASP-NANYNWESGSSDPKELSFKVDL 710
Score = 335, Expect = 2.0e-29, Identities = 134/387 (34%), Positives = 206/387 (53%)
  Q:     1 MKIKKIKLLKALALTGAFGIVATVPI------IVSSCSSTSDNNTGGNQDGQ----------------------------QTQKVTPVLKDEVDLKGSLSKIFDTTATDASSRKSTNTLISEDIKANPENYFTNGNETNVKEAIEKATIDVEGNFSN-ASWTGNAYNTTSNGWDGVTIEDANKLIYTTSSAQLTFKDLDGLKTELEKNGTDNKTVLQNALEAAGATIEADTTLTIKNRVGFTSGDLIHINVEADKSGTQTQYDLQIPTSNLNLSVTGLTIKVSGDNINTNEKTTTNFKYNIGIDSTLGFEQAKGAAPEETANNLSDAATAAKNILVKLGY--VTTTGGSDLSNDKISAALGIYNCNFTPKSATEKQGATPDAGVTDANKVYTVTVTATPF-NDTYVWDDGSSGEKDFSFDVSLKV 387
           MK K+ KLLK L++ G F + A VPI      ++ + +S+S+ N   N                                Q   + P LK  ++L G++ KI+++      +   TN LI+E+IK N E  F N  E    E +    I V GNF++ +SW GN Y+ T NGW G T    N+++Y+TS  QL    L+ LK +L    TD K + +    +  + +      T+KN++GFT+ +L+H+N+          +DLQIP S++N +V+ ++I VSG ++ T    TTNF YNI I++T    ++    P  T    S   T A  ILVKLGY  V T     L+ + +    GIYN  F+           P+         Y +T+ ATP  N  ++W DG++  K  SFDV++ +
  S:     1 MKSKRSKLLKILSVIGIFAVSAAVPITLVSKYVIFTKTSSSNGNVDDNSGNNNGNDNSNPNDNNGNNDGGNDSNNNNTTPQDGSIVPRLKSSINLSGTVDKIYNS-----QNASETNNLIAEEIKTNLEQAFDNSTEL---ENVNDLNITVNGNFADTSSWGGNPYDGT-NGWSGSTT--GNEILYSTSLNQLNISSLNDLKHQL----TDAK-IKEILRSSDSSKLNESAEYTVKNKLGFTNNNLVHVNIMEILGSGVRNFDLQIPISSINFNVSNMSISVSGTDVQTT-NATTNFNYNIAINNT----ESNTPQPTSTPKASSSEVTNADKILVKLGYADVGTNNSIVLNQELLQEEFGIYNVEFS------NAKIAPNTSTNRQVGSYKITLDATPIANKGFIWQDGTTSTKSVSFDVNVDI 398
>gi|26554108|ref|NP_758042.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454116|dbj|BAC44446.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (378 aa)
Score = 359, Expect = 3.6e-32, Identities = 140/374 (37%), Positives = 201/374 (53%)
  Q:    14 LTGAFGIVATVPIIVSSCSSTSD---NNTGGNQDGQQTQKVTPVLKDEVDLKGSLSKIFDTTATDASSRKSTNTLISEDIKANPENYFTNGNETNVKEAIEKATIDVEGNFSNAS-WTGNAYNTTSNGWDGVTIEDANKLIYTTSSAQLTFKDLDGLKTELEKNGTDNKTVLQNALEAAGA--TIEADTTLTIKNRV----GFTSGDLIHINVEADKSGTQTQYDLQIPTSNLNLSVTGLTIKVSGDNINTNEKTTTNFKYNIGIDSTLGFEQAKGAAPEETANNLSDAATAAKNILVKLGYVTTTGGS-DLSNDKISAALGIYNCNFTPKSATEKQGATPDAGVTDANKVYTVTVTATPFNDTYVWDDGSSGEKDFSFDVSLKV 387
           +TGAFGIVATVP+IVSSCSSTSD             Q Q ++  L+  V L G+LS I++ T     S  +TNTL++  IK+N  + F NG      + +E   I V GNF   S WTG      +NGW+    +    ++Y  ++A L    L+ LKT+L      +     ++  A+G   T+  ++ L + N         S DL+HI+V   +    T YDLQIP S+LNL V+ LT+ V+G N+     TTTNF YNIGI+ T  F Q   A    +A+   D   A    LV LGY   + G+  L+N+ ISA +G+YN  F+  +    QG + +         +T+T++ATP  + YVW+DG+   K  SF V+  V
  S:    14 MTGAFGIVATVPVIVSSCSSTSDNNTGGDNNGGGNTQNQTISTQLRSSVTLSGALSNIYNPT-----SGSNTNTLLAAQIKSNLNSVFENGEALANVDDLE---ITVNGNFPTTSEWTGTTAFAGNNGWNAT--QGLTDVLYDWNTAALNISSLNDLKTQLTSEKITSIITEASSAPASGTVFTVVENSALGLTNNADSIDANASRDLLHIHVTGTEGSNTTNYDLQIPVSDLNLVVSDLTVTVTGTNVEQTGSTTTNFTYNIGINETANFVQPTQAPSINSADTNGDGNKA----LVALGYANESDGNYTLNNEAISAGIGVYNSEFSNPTIAATQGGSSNQ--------FTITLSATP-KEGYVWEDGTRDAKSISFPVTFTV 375
>gi|26554162|ref|NP_758096.1| signal-peptide-less P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454171|dbj|BAC44500.1| signal-peptide-less P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (685 aa)
Score = 356, Expect = 7.6e-32, Identities = 122/336 (36%), Positives = 182/336 (54%)
  Q:    50 KVTPVLKDEVDLKGSLSKIFDTTATDASSRKSTNTLISEDIKANPENYFTNGNETNVKEAIEKATIDVEGNFSNAS-WTGNAYNTTSNGWDGVTIEDANKLIYTTSSAQLTFKDLDGLKTELEKNGTDNKTVLQNALEAAGATIEADTTLTIKNRVGFTSGDLIHINVEADKSGTQTQY--DLQIPTSNLNLSVTGLTIKVSGDNINTNEKTTTNFKYNIGIDSTLGFEQAKGAAPEETANNLSDAATAAKN-ILVKLGYVT-----TTGGSDLSNDKISAALGIYNCNFTPKSATEKQGATPDAGVTDANKVYTVTVTATPFNDTYVWDDGSSGEKDFSFDVSL 385
           ++TP +   +++ G  SKIF       ++R  TN +I++DIK+N   YF+NGN+    + +E   I VEGNF   S WTG  Y      W   T     K IY++SS ++    L+ LKT+L   G     +  N L         D + TI N++GFT GDLIH+N+  +   TQ  +  D+ IPTS++NL ++ L I   GDN+ T +    NF YNIGI+ ++ F +     P      LSDA     N  LV LG+ T       G   L+ DKISAALG++NC F        +G +       +++ +T+++ ATP N+ Y W+DG++  K+ SF V+L
  S:   370 EITPTVNSTLNITGPFSKIFAANTGTGNNRVRTNDVIADDIKSNLSKYFSNGNDL---KTVENLNIRVEGNFPETSVWTGEPYEV----WSKTT---RFKGIYSSSSQKINITSLNDLKTKLNSIGLGKFLLDSNLL-------FRDASFTILNQLGFTGGDLIHVNILVNSPYTQGTFTVDVGIPTSDINLIISNLKIASFGDNV-TLQSVPVNFTYNIGINDSVDFIK-----PTTGVTPLSDANKNNVNEALVSLGFATRNIDSNPGTYTLNPDKISAALGVFNCTF--------EGISIKDVSNGSSRSFTISLIATP-NNNYYWEDGTNTSKELSFTVNL 682
Score = 324, Expect = 4.0e-28, Identities = 116/381 (30%), Positives = 190/381 (49%)
  Q:     7 KLLKALALTGAFGIVATVPIIVSS---CSSTSDNNTGGNQDGQQTQKVTPVLKDEVDLKGSLSKIFDTTATDASSRKSTNTLISEDIKANPENYFTNGNETNVKEAIEKATIDVEGNFSNAS-WTGNAYNTTSNGWDGVTIEDANKLIYTTSSAQLTFKDLDGLKTELEKNGTDNKTVLQNALEAAGATIEADTTLTIKNRVGFTSGDLIHINVEADKSGTQTQYDLQIPTSNLNLSVTGLTIKVSGDNINTNEKTTTNFKYNIGIDSTLGFEQAKGAAPEETANNLSDAATAAKNILVKLGY--VTTTGGSDLSNDKISAALGIYNCNFTPKSATEKQGATPDAGVTDANKVYTVTVTATPF-NDTYVWDDGSSGEKDFSFDVSLKV 387
           K +K   LTG F   A +P+++ S       S +    N +   +Q +TP LK  + L G++ KI+D+          TNTL++++I  N +  F N  +    + +    I VEG+F+N+S W+G  Y    NGW G+T    N ++Y++   QL    L+ LKT+L+ +    + +     E   + +  +   +I+N+   T+ +L+H+NV A        +DLQIPTS++NL+++ ++I VSG+N+        +F YN+ +     F       P  T    +   T A  ILVKLG   VTT     L+   I   LGIYN  F+  S       T        + +Y +++ ATP  N  +VWDDG +  +  +F+V + V
  S:     6 KKIKTWGLTGIFAASAAIPVVLISRYVLFRNSSSINNQNSESDNSQFITPKLKSSISLSGTIDKIYDSQKATV-----TNTLVAQEIHNNLDQVFENSQDL---QKVNNLKIAVEGDFTNSSSWSGVDYEG-DNGWKGLT--KGNVILYSSKFGQLNISSLNDLKTQLDNDAKIKEIIR----EFDSSKLNQNAIYSIQNKPAVTNDNLLHVNVIAILGSNTKYFDLQIPTSSINLNISNMSISVSGNNVKPLTSAVASFNYNVSLAPKSYFMN-----PASTPVASASEVTNANKILVKLGLAEVTTRNQIVLTQKAIQEQLGIYNVEFSNASIAPSGTTT-----NGKSGLYQISLQATPIANGDFVWDDGQNTVRTITFEVWVNV 368
>gi|26553716|ref|NP_757650.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26453723|dbj|BAC44054.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (518 aa)
Score = 330, Expect = 8.5e-29, Identities = 130/383 (33%), Positives = 203/383 (53%)
  Q:     1 MKIKKIKLLKALALTGAFGIVATVPIIV---------SSCSSTSDNNTGGNQDGQQTQKVTPVLKDEVDLKGSLSKIFDTTATDASSRKSTNTLISEDIKANPENYFTNGNETNVKEAIEKATIDVEGNFSNASWTGNAYNTTSNGWDGVTIEDANKLIYTTSSAQLTFKDLDGLKTELEKNGTDNKTVLQNALEAAGATIEADTTLTIKNRVGFTSGDLIHINVEADKSGTQTQYDLQIPTSNLNLSVTGLTIKVSGDNINT-NEKTTTNFKYNIGIDSTLGFEQAKGAAPEETANNLSDAATAAKNILVKLGYV---------------------TTTGGSDLSNDKISAALGIYNCNFTPKSATEKQGATP-DAGVTDANKV-YTVTVTATPFNDTYVWDDGSSGEKDFSFDV 383
           MK  K K+LK LA+TGAFGI+ATVP+I+         S+ +  ++         +  QKVTP LK  ++L GS++ I++    + S     + L+ + IK+N    F N +E   K+      I +E +FSN+ W G  YN T+  W   T     KL Y  S AQ+ F  L+ LK +L      ++  ++  L+ +G       T  I+N+ G T  +++HINV      +   YDLQIP S+L L +  + + VS ++IN+ N+    NF  NIGI+S   +       P ET   + D   +A +IL KLG++                     + T   DL +DK+   LG++N  F+    T      P D   T+ N + Y + +   P N  Y ++DG++  K+FSF+V
  S:     1 MKTAKKKVLKTLAITGAFGIIATVPVIISACSSASNNSNTNGGNNTGDNSGNGTRDPQKVTPKLKSSINLVGSITDIYNHEVNNTS-----HDLLIKKIKSNLGLVFENESELVNKD----INIKLESDFSNSEWIGETYNVTNKNWGSDT---TTKLTYAHSLAQINFSSLNDLKMQLS-----DQIKIKEILKESGVPDTYLNTYKIENKTGLTENNILHINVIEVGKSSPKNYDLQIPVSDLKLVLPQVNVLVSENDINSINQPIDINF--NIGIESHSNY-----VGPVET--QIIDERASANSILEKLGFIKMTNTKNSNKTNMTFTEINGASVTTNIDLDSDKVGETLGVFNTTFSDVKLTRISEWNPYDVVSTEDNYLTYKIDLNGRP-NKGYYFEDGTTESKEFSFNV 389
>gi|26554133|ref|NP_758067.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454141|dbj|BAC44471.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (439 aa)
Score = 328, Expect = 1.4e-28, Identities = 131/340 (38%), Positives = 192/340 (56%)
  Q:    48 TQKVTPVLKDEVDLKGSLSKIFDTTATDASSRKSTNTLISEDIKANPENYFTNGNETNVKEAIEKATIDVEGNFSNASWTGNAYNTTSNGWD-----------GVTIEDANKLIYTTSSAQLTFKDLDGLKTELEKNGTDNKTVLQNALEAAGATIEADTTLTIKNRVGFTSG-------DLIHINVEAD-----KSGTQTQYDLQIPTSNLNLSVTGLTIKVSGDNINTNEKTTTNFKYNIGIDSTLGFEQAKGAAPEETANNLSDAATAAKNILVKLGYV---TTTGGSDLSNDKISAALGIYNCNFTPKSATEKQGATPDAGVTDANKVYTVTVTATPFNDTYVWDDGSSGEKDFSFDVSLKV 387
           T+ +TP +K  V L G+LS I+DT  T      +TN LI+++IK N    F NG      + I    I V   F +++WTG  +N +S+G              + IE  NKL+Y + +  LT   L  LKT+L      N + L+  L+      EA+TT ++ N +GFT+        DL+H+NV           T T YDLQIP S+LNL +T L + V GDN+ T+   TT   YNIGI+ +   +  +GA P+ T ++    A     ILVK GY    T    + L+N+ +   LGIYN  F+  S ++ +  T ++G  +  K YT+T++A P ND YVW+DG+S  K+ SFDV L +
  S:    90 TETITPKIKSTVTLGGALSNIYDTANT-----SNTNNLIADEIKKNLSEVFDNGEAL---KDISSLDISVNHKFPDSTWTGLPFNHSSDGSSVFWGNDQADQTSILIEPENKLLYPSKTQPLTISSLSDLKTQL------NDSKLKEILKDTETKPEANTTYSVDNALGFTNKALGSDNKDLLHVNVVGTTKVEGSEDTTTNYDLQIPVSDLNLKLTDLEVTVKGDNVTTSTLRTTL-TYNIGINDSTN-QDNEGAKPQATESD----AGKLDTILVKFGYANEGTQGQEATLNNENLIEGLGIYNVTFSKDSNSKIEPKT-NSGNEENEKTYTITLSAKP-NDGYVWEDGTSTAKNISFDVILDI 433
>gi|26554194|ref|NP_758128.1| putative P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454203|dbj|BAC44532.1| P35 lipoprotein homolog fragment [Mycoplasma penetrans HF-2] (381 aa)
Score = 257, Expect = 2.4e-20, Identities = 93/248 (37%), Positives = 139/248 (56%)
  Q:   138 WDGVTIEDANKLIYTTSSAQLTFKDLDGLKTELEKNGTDNKTVLQNALEAAGATIEADTTLTIKNRVGFTSGDLIHINVEADK-SGTQTQYDLQIPTSNLNLSVTGLTIKVSGDNINTNEKTTTNFKYNIGIDSTLGFEQAKGAAPEETANNLSDAATAAKNILVKLGYVTTT-----------GGSDLSNDKISAALGIYNCNFTPKSATEKQGATPDAGVTDANKVYTVTVTATPFNDTYVWDDGSSGEKDFSFDVSL 385
           WDGV+I++ NKL Y+ +S Q+  K LD LKT+L      ++T L++AL+ AGAT++   T TIKN+ G T  DLIH+NVE+ K S T T YDLQIP S++NL ++ L +KVSG ++ T      N  YNI I     +    G A  +  N    A     +++ +LG+  TT               L+++KI   LG++N  F+  +   +  +T +   T+    Y +TVT TP    +   +G    K FSF V +
  S:     8 WDGVSIDETNKLHYSYNSPQIDIKSLDDLKTQLS-----DQTKLKDALKEAGATVDETATYTIKNQPGLTDDDLIHVNVESSKASATATNYDLQIPASDINLVISDLNVKVSGADV-TEVNEKVNLNYNIAIKDETSY---TGPADIKKMN----ATPTEDSVMQELGFKATTRTKRSTDATPAATVALNSEKIGETLGVFNTEFS--NPVLELDSTNNPSSTNNFFTYKITVTGTPKEGYHF--EGGETSKQFSFLVKI 250
>gi|26554106|ref|NP_758040.1| putative P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454114|dbj|BAC44444.1| P35 lipoprotein homolog fragment [Mycoplasma penetrans HF-2] (179 aa)
Score = 227, Expect = 7.0e-17, Identities = 71/158 (44%), Positives = 105/158 (66%)
  Q:    14 LTGAFGIVATVPIIVSSCSSTSDNNTGG---NQDGQQTQKVTPVLKDEVDLKGSLSKIFDTTATDASSRKSTNTLISEDIKANPENYFTNGNETNVKEAIEKATIDVEGNFSNASWTGNAYNTTSNGW-------DGVTIEDANKLIYTTSSAQLTFKDLDGLKTELE 171
           +TGAFGI+ATVP+IVSSCSSTSDNN G    NQ G+Q+Q + P +K  V L G+L+ I++ T         TN+LI+++IK N  + F NG++      +E   + V   F  ++WTG ++++TS  W       + VTI++ANKL+Y++ S QL    L  LKT+L+
  S:    14 MTGAFGIIATVPVIVSSCSSTSDNNGGNGDTNQGGEQSQTIIPQIKSSVTLSGALTDIYNPTDI-----SKTNSLIADEIKNNLADVFDNGSDLTNVSDLE---VSVTHTFPASTWTGLSFDSTSGNWKAEGSSGNDVTIDNANKLVYSSES-QLNISSLSDLKTQLD 172
>gi|26554195|ref|NP_758129.1| putative P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454204|dbj|BAC44533.1| P35 lipoprotein homolog fragment [Mycoplasma penetrans HF-2] (144 aa)
Score = 181, Expect = 1.7e-11, Identities = 60/125 (48%), Positives = 80/125 (64%)
  Q:     9 LKALALTGAFGIVATVPIIVSSCSSTSDNNTGGNQDGQ--------------QTQKVTPVLKDEVDLKGSLSKIFDTTATDASSRKSTNTLISEDIKANPENYFTNGNETNVKEAIEKATIDVEGNFSNASWTGNAYNT 133
           +KALALTGAFGI+ATVP+IVSSCSSTS+NN G    G                TQKVTP LK  ++L G+L  I+     + +S K+T  L++++IK NP   F +  + N K       + VE  FS +SWT   Y+T
  S:     1 MKALALTGAFGIIATVPVIVSSCSSTSENNGGSGNGGTGDNQGGGGSGGGTTDTQKVTPKLKSSINLVGALKDIY-----NPASGKTTKDLLAQEIKNNPSLAFEDSEKLNGK----NFDVSVEATFSRSSWTDKTYDT 130
>gi|3850053|emb|CAA07193.1| putative lipoprotein [Mycoplasma penetrans] (120 aa)
Score = 177, Expect = 4.5e-11, Identities = 53/86 (61%), Positives = 66/86 (76%)
  Q:     8 LLKALALTGAFGIVATVPIIVSSCSST--------SDNNTGGNQDGQQTQKVTPVLKDEVDLKGSLSKIFDTTATDASSRKSTNTLISEDIKAN 93
           LLKALALTGAFGIVATVP+IVSSCSST        ++NN GG+    Q++K+TP L D+V L GSL  I+D+T T     K +N LI+E+IK N
  S:     1 LLKALALTGAFGIVATVPVIVSSCSSTSDNNNGNGNNNNGGGSDGNTQSEKITPELNDKVSLAGSLKDIYDSTGT-----KKSNELIAEEIKNN 89
>gi|26554105|ref|NP_758039.1| putative P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454113|dbj|BAC44443.1| P35 lipoprotein homolog fragment [Mycoplasma penetrans HF-2] (159 aa)
Score = 168, Expect = 5.3e-10, Identities = 63/159 (39%), Positives = 89/159 (55%)
  Q:   229 LQIPTSNLNLSVTGLTIKVSGDNINTNEKTTTNFKYNIGIDSTLGFEQAKGAAPEETANNLSDAATAAKNILVKLGYVTTTGGS----DLSNDKISAALGIYNCNFTPKSATEKQGATPDAGVTDANKVYTVTVTATPFNDTYVWDDGSSGEKDFSFDVSLKV 387
           +QIP S+LNL ++ L++ V G N+ T     TNF YNIGI+S   +E+         A + +  A     IL KLGYVT + G+     ++ND I  ALG+YN  FT   AT  +    DA      K YT+T+ ATP ND +VW+D ++  K  +FD  L +
  S:     1 MQIPVSDLNLVISNLSVTVKGTNV-TETTLETNFTYNIGINSASNYEEPTNKPSITQAQSQTLDANV---ILEKLGYVTASSGTPTTYTVNNDTIVKALGVYNVTFTNTGATVTEKT--DANNAANQKTYTITLNATP-NDGHVWEDATNTSKPITFDAILGI 156
>gi|26554158|ref|NP_758092.1| signal-peptide-less P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454167|dbj|BAC44496.1| signal-peptide-less P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (204 aa)
Score = 141, Expect = 6.9e-07, Identities = 63/207 (30%), Positives = 102/207 (49%)
  Q:     1 MKIKKIKLLKALALTGAFGIVATVPI-----IVSSCSSTSDNNTGGNQDGQQTQKVTPVLKDEVDLKGSLSKIFDTTATDASSRKSTNTLISEDIKANPENYFTNGNETNVKEAIEKATIDVEGNF-SNASWTGNAYNTTSNGWDGVTIEDANKLIYTTSSAQLTFKDLDGLKTELEKNGTDNKTVLQNALEAAGATIEADTTLTIKNRVGFT 207
           MK    KLLK  ++ G F      PI      V S  S SD+N   +    +   + P LK  ++L G L KI+++      +    N  I+++IK N +  F N  E    +++    I + G+F  ++SW GN Y+  +NGW  +T E  N+++Y+ S  QL    L  LK +L    TD+K + +   E   + +      ++KN+ GFT
  S:     1 MKSNVAKLLKISSVVGIFAASTAAPISLVSMYVFSNKSLSDSNGNDSNTNPEDGSIIPKLKSSINLSGPLDKIYNS-----QNASEANDWIAQEIKTNLDLAFENSEEL---KSVTDLNILINGDFLDSSSWDGNPYD-GNNGWSSLTKE--NQILYSASLEQLNVSSLTDLKNQL----TDSK-IKEILNEYDSSKLNWTAEYSVKNKPGFT 197
>gi|26554102|ref|NP_758036.1| putative P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454110|dbj|BAC44440.1| P35 lipoprotein homolog fragment [Mycoplasma penetrans HF-2] (69 aa)
Score = 124, Expect = 6.1e-05, Identities = 29/66 (43%), Positives = 38/66 (57%)
  Q:   323 LGIYNCNFTPKSATEKQGATPDAGVTDANKVYTVTVTATPFNDTYVWDDGSSGEKDFSFDVSLKVN 388
           LG+YNC FT  S+      T DAG T     Y V ++A P++  YVWDDG++  K  SF V L V+
  S:     8 LGVYNCKFTAVSSDPDTSVTADAGKT----AYKVVLSAEPYDSNYVWDDGTTDAKQVSFTVQLTVS 69
>gi|124516503|gb|EAY58011.1| conserved hypothetical protein [Leptospirillum sp. Group II UBA] (508 aa)
Score = 97, Expect = 9.4e-02, Identities = 33/133 (24%), Positives = 60/133 (45%)
  Q:    40 GGNQDGQQTQKVTPVLKDEVDLKGSLSKIFDTTATDASSRKSTNTLISEDIKANPE-NYFTNGNETNVKEAIEKATIDVEGNFSNASWTGNAYNTTSNGWDGVTIEDANKLIYT----TSSAQLTFKDLDGLKTELEK 172
           G N    + +++  + +D  +   S S+ +         RK   + IS  +K  P  +++ +  E+   E ++  TID + +     W  N  N   N W+G     +N  ++T      S +L FK L+ L  E+EK
  S:   363 GRNDVRTEIRELLNIAEDAHESLRSASRSYARNILSHGDRKPRGSDISNVVKQMPSISWYWSRLESVFHEVLQSYTIDRDPDDIRCQWLRNVRNILGNAWEGQRTMVSNGDVWTIRAIVKSEELIFKKLNELDKEIEK 500