>gi|26553519|ref|NP_757453.1| translation factor [Mycoplasma penetrans HF-2] >gi|26453525|dbj|BAC43857.1| predicted translation factor [Mycoplasma penetrans HF-2] (213 aa)
Score = 867, Expect = 1.7e-91, Identities = 213/213 (100%), Positives = 213/213 (100%)
  Q:     1 MGKLKDRKDNKKDSFKKNLNNKEIKNYPKKEFVTYEKDSSNLNGIVFEIKNLKAAIVSTDTVSGLLSLNKPLIYKIKKRDKNKKLIRFVSNLDQIPEVNETFKKLASKFWPGKLTLIYKKESYRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKREGEIKYEWIKKTIEEN 213
           MGKLKDRKDNKKDSFKKNLNNKEIKNYPKKEFVTYEKDSSNLNGIVFEIKNLKAAIVSTDTVSGLLSLNKPLIYKIKKRDKNKKLIRFVSNLDQIPEVNETFKKLASKFWPGKLTLIYKKESYRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKREGEIKYEWIKKTIEEN
  S:     1 MGKLKDRKDNKKDSFKKNLNNKEIKNYPKKEFVTYEKDSSNLNGIVFEIKNLKAAIVSTDTVSGLLSLNKPLIYKIKKRDKNKKLIRFVSNLDQIPEVNETFKKLASKFWPGKLTLIYKKESYRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKREGEIKYEWIKKTIEEN 213
>gi|13358171|ref|NP_078455.1| hypothetical protein UU005m [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|170762116|ref|YP_001752085.1| hypothetical protein UPA3_0005 [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171920287|ref|ZP_02931643.1| conserved hypothetical protein [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|183508513|ref|ZP_02958040.1| conserved hypothetical protein [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186701710|ref|ZP_02971402.1| conserved hypothetical protein [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|168827693|gb|ACA32955.1| conserved hypothetical protein [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171902700|gb|EDT48989.1| conserved hypothetical protein [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|182675949|gb|EDT87854.1| conserved hypothetical protein [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186700976|gb|EDU19258.1| conserved hypothetical protein [Ureaplasma parvum serovar 6 str. ATCC 27818] (184 aa)
Score = 283, Expect = 8.6e-24, Identities = 70/160 (43%), Positives = 97/160 (60%)
  Q:    40 SNLNGIVFEIKNLKAAIVSTDTVSGLLSLNKPLIYKIKKRDKNKKLIRFVSNLDQIPEVNETFKKLASKFWPGKLTLIYKKESYRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKREG 199
           +NLN I   +   K  ++ TDT+ GLL+ N+ +IY+IK+RD+NKK+IRFV++   + ++    K+    FWPG +T+I    SYRMP+  +IL LI K GPLY SSAN+SG  PI N  +A   F    S +I++E    Q   PSTI DID     R G
  S:     7 TNLNVIYDALMANKCVLIPTDTIIGLLAKNQDVIYEIKQRDRNKKIIRFVADYKLLGDLTVEQKQFLDLFWPGSVTIIKNGISYRMPNSPYILKLIQKLGPLYCSSANISGEEPIKNHNEAIFKFGA-NSKLIYVEAQ-QQIGVPSTIVDIDKWEYIRRG 164
>gi|171920600|ref|ZP_02931851.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|188524207|ref|ZP_03004268.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|188530767|ref|ZP_03005091.1| hypothetical protein Uurese_01000002_0200001223 [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gi|188568819|ref|ZP_03005553.1| hypothetical protein Uurealyserovar_01845 [Ureaplasma urealyticum serovar 2] >gi|188592637|ref|ZP_03005940.1| hypothetical protein Uureaserovar_01875 [Ureaplasma urealyticum serovar 10] >gi|195867355|ref|ZP_03079359.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|171903310|gb|EDT49599.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|195659977|gb|EDX53357.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|195660831|gb|EDX54084.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (186 aa)
Score = 280, Expect = 1.8e-23, Identities = 67/160 (41%), Positives = 97/160 (60%)
  Q:    40 SNLNGIVFEIKNLKAAIVSTDTVSGLLSLNKPLIYKIKKRDKNKKLIRFVSNLDQIPEVNETFKKLASKFWPGKLTLIYKKESYRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKREG 199
           +NLN I   +   K  ++ TDT+ GLL+ N+ +IY+IK+RD+NKK++RFV++   + ++    ++    FWPG +T+I    SYRMP+  +IL LI K GPLY SSAN+SG  P+ N  +A   F    S +I++E    Q   PSTI DID     R G
  S:     7 TNLNAIYDALVANKCVLIPTDTIIGLLAKNQDVIYEIKRRDRNKKIVRFVADYKLLGDLTVEQEQFLDLFWPGSVTVIKNGVSYRMPNSPYILKLIQKLGPLYCSSANISGEEPVKNHNEAIFKFGA-NSKLIYVEAQ-QQIGVPSTIVDIDKWEYVRRG 164
>gi|185178792|ref|ZP_02964588.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188024454|ref|ZP_02997105.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188039270|ref|ZP_02998060.1| hypothetical protein Uures_00715 [Ureaplasma urealyticum serovar 8] >gi|188518436|ref|ZP_03003925.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|184209412|gb|EDU06455.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188018748|gb|EDU56788.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188998149|gb|EDU67246.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 11 str. ATCC 33695] (186 aa)
Score = 277, Expect = 3.5e-23, Identities = 67/160 (41%), Positives = 96/160 (60%)
  Q:    40 SNLNGIVFEIKNLKAAIVSTDTVSGLLSLNKPLIYKIKKRDKNKKLIRFVSNLDQIPEVNETFKKLASKFWPGKLTLIYKKESYRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKREG 199
           +NLN I   +   K  ++ TDT+ GLL+ N+ +IY+IK+RD+NKK++RFV++   + ++    ++    FWPG +T+I    SYRMP+   IL LI K GPLY SSAN+SG  P+ N  +A   F    S +I++E    Q   PSTI DID     R G
  S:     7 TNLNAIYDALVANKCVLIPTDTIIGLLAKNQDVIYEIKRRDRNKKIVRFVADYKLLGDLTVEQEQFLDLFWPGSVTVIKNGVSYRMPNSPHILKLIQKLGPLYCSSANISGEEPVKNHNEAIFKFGA-NSKLIYVEAQ-QQIGVPSTIVDIDKWEYVRRG 164
>gi|31544343|ref|NP_852921.1| hypothetical protein MGA_0865 [Mycoplasma gallisepticum R] >gi|31541187|gb|AAP56489.1| conserved hypothetical protein [Mycoplasma gallisepticum R] (182 aa)
Score = 264, Expect = 1.1e-21, Identities = 73/167 (43%), Positives = 106/167 (63%)
  Q:    35 YEKDSSNLNGIVFEIKNLKAAIVSTDTVSGLLSLNKPLIYKIKKRDKNKKLIRFVSNLDQIPEVNETFKKLASKFWPGKLTLIYKKESYRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAF-ESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKREGEI 201
           +EKD    + IV  I + K  I+ TDTV G++  +K  IY  KKRD NKKLI F S+++Q    ++ F  LA++FWPGKLTLIY KESYR+P+  +IL +    G +YSSSAN+S   P       + + +    +D++ I+G+   + Q STIYD+D+N + REGE+
  S:     6 FEKD---FDEIVKAINDDKLVILPTDTVFGVICKSKNKIYDFKKRDLNKKLIYFCSDVEQTNINDKLFLDLANRFWPGKLTLIYNKESYRIPNSPYILKIAKICGKIYSSSANISDLNPYKTWEQYYNDPYFNQNNDVVVIKGE-TTSEQGSTIYDLDSNKILREGEL 169
>gi|13508101|ref|NP_110050.1| HemK family methylase [Mycoplasma pneumoniae M129] >gi|2496353|sp|P75419|Y362_MYCPN Uncharacterized protein MG259 homolog >gi|1674165|gb|AAB96122.1| hemk family protein [Mycoplasma pneumoniae M129] (453 aa)
Score = 212, Expect = 1.2e-15, Identities = 57/168 (33%), Positives = 96/168 (57%)
  Q:    30 KEFVTYEKDSSNLNGI-VFEIKNLKA-------AIVSTDTVSGLLSLNKPLIYKIKKRDKNKKLIRFVSNLDQIPEVNETFKKLASKFWPGKLTLIYKKESYRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSD-------IIFIEGDYYQNNQPSTIYDIDTNTLKR 197
           K+F+    D++ L  + + + K +KA       AI+ TDT  GL+S  +  +  IK+RD NK  ++F++   QI ++ +  +KLA  FWPG  T I   +SYR+P+   +L L+   G +Y +SAN +   P       F   + Y++D          ++  +  NN+PS IY++DT  + R
  S:   259 KQFIGLSIDNTKLPVLKIAQTKQIKALLDKGMTAIIPTDTQIGLMSYCQQDLDHIKQRDPNKHYVQFLAP-SQINQLPKQLQKLAKLFWPGAYTFIVDGQSYRLPNSPQLLKLLKTVGLIYCTSANQAKQKP-------FGKLSAYQNDPYWVQQNCFIVQNSFKSNNEPSLIYNLDTKQIVR 433
>gi|12045114|ref|NP_072925.1| HemK family modification methylase [Mycoplasma genitalium G37] >gi|2496352|sp|Q49404|Y259_MYCGE Uncharacterized protein MG259 >gi|1045951|gb|AAC71479.1| modification methylase, HemK family [Mycoplasma genitalium G37] >gi|166078831|gb|ABY79449.1| modification methylase, HemK family [synthetic Mycoplasma genitalium JCVI-1.0] (456 aa)
Score = 197, Expect = 7.9e-14, Identities = 60/169 (35%), Positives = 96/169 (56%)
  Q:    29 KKEFVTYEKDSSNLNGIVFEIKNLK----------AAIVSTDTVSGLLSLNKPLIYKIKKRDKNKKLIRFVSNLDQIPEVNETFKKLASKFWPGKLTLIYKKESYRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFES--FNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKR 197
           +K+F+  + D+  L   V +IKN K          A IV+TDT  GL+S ++  + KIK+R  NK  +     L+++ ++ +  +++AS FWPG  T I   +SYR+P +  +LNL +  G ++ +SAN+S   P T + D      + K    II        NN PS +Y++DT  L R
  S:   259 QKQFIGMKVDNQKLP--VVDIKNTKTIKQLLKMGLAGIVNTDTQMGLISYSESTLDKIKQRALNKHYVSMFG-LEELKKLPKKLQQIASYFWPGSYTFIKNNKSYRVPKNLGLLNLFNAIGRVFCTSANISNQKPYTKLSDYQNDSYWIKQPCFIIRSTSKVQSNNTPSLVYNLDTKQLVR 436
>gi|162447073|ref|YP_001620205.1| dsRNA-binding domain-containing protein [Acholeplasma laidlawii PG-8A] >gi|161985180|gb|ABX80829.1| dsRNA binding, YrdC domain protein [Acholeplasma laidlawii PG-8A] (182 aa)
Score = 189, Expect = 6.0e-13, Identities = 66/160 (41%), Positives = 94/160 (58%)
  Q:    53 KAAIVSTDTVSGLLS--LNK---PLIYKIKKRDKNKKLIRFVSNLDQIPEV---NETFKKLASKFWPGKLTLIY------------KKESYRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTI-YDIDTNTLKREGEIKYEWIKKTIEE 212
           K  I  TDTV GL +  L+K     IY+IK RD NK +   +SNL+Q+ E+   ++   K+ASKFWPG LTLI+            K    RMP+ K  L LID+ GPL ++S N S  PP+ N  DA       K D ++   +       + I +  D  +L R+G+I  + I K +E+
  S:     3 KLLIFPTDTVYGLGTPYLDKEGLKQIYEIKGRDFNKPIAILISNLEQVKEIAKASDNALKVASKFWPGGLTLIFESSDAYYQQSGEKTIGLRMPNHKLALKLIDELGPLKTTSVNYSNQPPL-NDYDAIMKVFGDKVDKVYPNEESLSEVSSTVIDFTHDLPSLIRQGDITLDEIMKVLEK 182
>gi|167755050|ref|ZP_02427177.1| hypothetical protein CLORAM_00554 [Clostridium ramosum DSM 1402] >gi|167705100|gb|EDS19679.1| hypothetical protein CLORAM_00554 [Clostridium ramosum DSM 1402] (201 aa)
Score = 179, Expect = 8.8e-12, Identities = 53/139 (38%), Positives = 82/139 (58%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQIPE---VNETFKKLASKFWPGKLTLIYKKESY--------------RMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLK--REGEIKYEWIKKTIE 211
           +Y++K RDK K +   +S  + I +   V+ET KKL + F PG +T+I KK  +              R+PDD F+L+L+DKTGP+  +SANLSG     +++D       +   I  I      + + STI D+    ++  R G+I  E I + IE
  S:    47 LYELKHRDKGKAISMMISKAEDIEKYAYVDETAKKLIAAFMPGMITIILKKRPHIDDYFTASLDTIGIRIPDDPFVLSLLDKTGPMLVTSANLSGE---NSLVDDKAVMKVFHGKIPLIVKGESISKEASTIVDLSKGKVEILRLGDISKEQIAEVIE 201
>gi|118406895|gb|ABK81654.1| conserved hypothetical protein [Mycoplasma hominis] (155 aa)
Score = 177, Expect = 1.7e-11, Identities = 48/115 (41%), Positives = 68/115 (59%)
  Q:    50 KNLKAAIVSTDTVSGL----LSLNKPLIYKIKKRDKNKKLIRFVSNLDQ---IPEVNETFKKLASKFWPGKLTLIYKKESYRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESF 164
           K  K  I +TDTV G+        + LIY+IK RD+NKKLI  VS++ Q     E N    + A K+WPG  T++   + +RMP+ K +L  I+  GP+Y +S NLS  P    I +A + F
  S:     4 KYQKLIISTTDTVLGIGGPVSKEVEDLIYEIKGRDRNKKLIILVSSIKQARQFKEWNSQADEFAKKYWPGATTIVVNNQGFRMPNQKKLLEYIEVNGPIYMTSCNLSNAPVCKTIENAKQLF 125
>gi|163840180|ref|YP_001624585.1| Sua5/YciO/YrdC/YwlC family protein [Renibacterium salmoninarum ATCC 33209] >gi|162953656|gb|ABY23171.1| Sua5/YciO/YrdC/YwlC family protein [Renibacterium salmoninarum ATCC 33209] (265 aa)
Score = 173, Expect = 4.7e-11, Identities = 56/162 (34%), Positives = 91/162 (56%)
  Q:    49 IKNLKAAIVSTDTVSGLLS-----LNKPLIYKIKKRDKNKK---LIRFVSNLDQIP-EVNETFKKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNN---QPSTIYDIDTNTLK--REGEIKYEWIKKTI 210
           I   +  ++ TDTV G+ +     +    +   K R ++     LI+ V  +D +  +++E  +KLA  FWPG LTLI+  +              + RMPDDK +L+L+  TGPL  SSAN +G P    +  A E   +   ++   EG+   +    QPSTI D   + L+  R G I  + ++  +
  S:    25 IAQKQTIVMPTDTVYGIAADAFSPVAVATLLAAKGRGRSMPPPVLIQRVQTMDGLAVDISEEARKLAEAFWPGGLTLIFHAQPSLDWDLGDSFGTVALRMPDDKLVLDLLTLTGPLAVSSANRTGQPTARTVAQAREQLGEV-VEVYLGEGERPLDGAEVQPSTIVDATGDRLRVVRPGVITIDQLRGVV 213
>gi|62423949|ref|ZP_00379102.1| COG0009: Putative translation factor (SUA5) [Brevibacterium linens BL2] (216 aa)
Score = 172, Expect = 5.3e-11, Identities = 42/115 (36%), Positives = 71/115 (61%)
  Q:    98 VNETFKKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDI-IFIEGDYYQNNQPSTIYDI--DTNTLKREGEIKYEWIKKTIEE 212
           V+E    L ++FWPG LT+I   +              + RMPDD++ L L+ +TGPL  SSAN+SG+P  T+  +A E       D+ I+++G   ++   STI D+  D   + REG +  + +++ + +
  S:    82 VDEKLLALTARFWPGPLTIIANAQPSLDWDLGDTHGTVAVRMPDDEYALALLGRTGPLAVSSANVSGSPAATSADEAMEMLG---DDVDIYVDGGVRESGISSTIVDLTGDVPKIVREGPVTSDELREIVPD 210
>gi|183603846|ref|ZP_02722143.2| Sua5/YciO/YrdC/YwlC family protein [Streptococcus pneumoniae MLV-016] >gi|183577918|gb|EDT98446.1| Sua5/YciO/YrdC/YwlC family protein [Streptococcus pneumoniae MLV-016] (200 aa)
Score = 171, Expect = 8.3e-11, Identities = 58/165 (35%), Positives = 94/165 (56%)
  Q:    48 EIKNLKAAIVSTDTVSGLLSLNKPL-------IYKIKKRDKNKKLIRFVSNLDQIPEVNET----FKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLK--REGEIKYEWIKKTIEE 212
           E++N  A I+ T+TV GL +  K L       +Y++K+R ++K L   V++L+ I   ++      +KL   F PG LT+I +                 +RMP     L+LI +TGPL   SAN+SG           + F++   +++ +E D +   Q STI D+  + +K  R+G IK E I   + E
  S:     8 ELENGGAVILPTETVYGLFA--KALDEKAVDHVYQLKRRPRDKALNLNVASLEDILHFSKNQPAYLQKLVETFLPGPLTIILEANDRVPYWVNSDLATIGFRMPSHPITLDLIRETGPLIGPSANISGQASGVTFEQILKDFDQ---EVLGLEDDAFLTGQDSTIVDLSGDKVKILRQGAIKREDILARLPE 194
>gi|148984976|ref|ZP_01818219.1| Sua5/YciO/YrdC/YwlC family protein [Streptococcus pneumoniae SP3-BS71] >gi|147922674|gb|EDK73791.1| Sua5/YciO/YrdC/YwlC family protein [Streptococcus pneumoniae SP3-BS71] (199 aa)
Score = 171, Expect = 8.6e-11, Identities = 58/165 (35%), Positives = 94/165 (56%)
  Q:    48 EIKNLKAAIVSTDTVSGLLSLNKPL-------IYKIKKRDKNKKLIRFVSNLDQIPEVNET----FKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLK--REGEIKYEWIKKTIEE 212
           E++N  A I+ T+TV GL +  K L       +Y++K+R ++K L   V++L+ I   ++      +KL   F PG LT+I +                 +RMP     L+LI +TGPL   SAN+SG           + F++   +++ +E D +   Q STI D+  + +K  R+G IK E I   + E
  S:     7 ELENGGAVILPTETVYGLFA--KALDEKAVDHVYQLKRRPRDKALNLNVASLEDILHFSKNQPAYLQKLVETFLPGPLTIILEANDRVPYWVNSDLATIGFRMPSHPITLDLIRETGPLIGPSANISGQASGVTFEQILKDFDQ---EVLGLEDDAFLTGQDSTIVDLSGDKVKILRQGAIKREDILARLPE 193
>gi|193216888|ref|YP_002000130.1| conserved hypothetical protein [Mycoplasma arthritidis 158L3-1] >gi|193002211|gb|ACF07426.1| conserved hypothetical protein [Mycoplasma arthritidis 158L3-1] (157 aa)
Score = 170, Expect = 8.9e-11, Identities = 44/109 (40%), Positives = 63/109 (57%)
  Q:    56 IVSTDTVSGL----LSLNKPLIYKIKKRDKNKKLIRFVSNLDQ---IPEVNETFKKLASKFWPGKLTLIYKKESYRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESF 164
           I +TDT+ GL          LIY+IK RD  KKLI  VS++ Q     E     + LA+KFWPG  TL+   + +RMP+   +L  ++  GP+Y +S N+S +P    I +A   F
  S:    10 IATTDTIIGLGGKVSRRISDLIYEIKGRDPRKKLIILVSSIKQARAFKEWTSEAEALANKFWPGATTLVVNDQGFRMPNQPKLLEFLEANGPVYMTSCNISNSPVCQTIEEAKNVF 125
>gi|183603629|ref|ZP_02716060.2| Sua5/YciO/YrdC/YwlC family protein [Streptococcus pneumoniae CDC0288-04] >gi|183573819|gb|EDT94347.1| Sua5/YciO/YrdC/YwlC family protein [Streptococcus pneumoniae CDC0288-04] (200 aa)
Score = 168, Expect = 1.8e-10, Identities = 57/165 (34%), Positives = 93/165 (56%)
  Q:    48 EIKNLKAAIVSTDTVSGLLSLNKPL-------IYKIKKRDKNKKLIRFVSNLDQIPEVNET----FKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLK--REGEIKYEWIKKTIEE 212
           E++N  A I+ T+TV GL S  K L       +Y++K+R ++K L   +++ + I   ++      +KL   F PG LT+I +                 +RMP     L+LI +TGPL   SAN+SG           + F++   +++ +E D +   Q STI D+  + +K  R+G IK E I   + E
  S:     8 ELENGGAVILPTETVYGLFS--KALDEKAVDHVYQLKRRPRDKALNLNIASFEDILHFSKNQPAYLQKLVETFLPGPLTIILEANDRVPYWVNSDLATIGFRMPSHPITLDLIRETGPLIGPSANISGQASGVTFEQILKDFDQ---EVLGLEDDAFLTGQDSTIVDLSGDKVKILRQGAIKREDILARLPE 194
>gi|29840271|ref|NP_829377.1| Sua5/YciO/YrdC family protein [Chlamydophila caviae GPIC] >gi|29834619|gb|AAP05255.1| Sua5/YciO/YrdC family protein [Chlamydophila caviae GPIC] (285 aa)
Score = 168, Expect = 1.8e-10, Identities = 58/160 (36%), Positives = 86/160 (53%)
  Q:    53 KAAIVSTDTVSGL-LSLNKP----LIYKIKKRDKNKKLIRFVSNLDQIPE-----VNETFKKLASKFWPGKLTLIY---------KKESYRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKREGEIKYEWIKKTIEE 212
           K     TDTV GL ++LN P     IY +K R++ K L+ +V+ L+ I +     ++    KLA +F PG LTL+          +K  +R+P    +  LID +GPL  +SAN+S  PP     +  E F     DI  I G        ST+   D   + REG I  + I++ + E
  S:    21 KVIAFPTDTVYGLAVALNSPNAQEKIYSLKHRERGKPLVIYVNTLEDIEKFSGCPLSSQAMKLAQEFLPGPLTLLVDHRNSRFSQEKLGFRIPSLPVVERLIDLSGPLLGTSANISNFPPAVVSEEVVEDFP--NEDIFIIPGQ-CSFGLESTVISTDPLKIYREGIISRQAIEEIMGE 196
>gi|47459206|ref|YP_016068.1| putative translation factor [Mycoplasma mobile 163K] >gi|47458535|gb|AAT27857.1| putative translation factor [Mycoplasma mobile 163K] (162 aa)
Score = 167, Expect = 2.1e-10, Identities = 56/142 (39%), Positives = 84/142 (59%)
  Q:    56 IVSTDTVSGL-LSL---NKPLIYKIKKRDKNKKLIRFVSNLDQ---IPEVNETFKKLASKFWPGKLTLIYKKESYRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKR 197
           IVSTDTV+G+ +S+   N  L+Y++K R KNKK+   V +++Q   +P  NE  +  A+  WPG +TLI   ++ RMP+ K + + I   GP + +SAN SG  PI  I +A + F +      F +G    N + S I DI+T    R
  S:    19 IVSTDTVTGIGISIHHENPNLLYELKNRPKNKKIAIVVGSIEQARKMPFWNEKAEAFANILWPGAVTLIVNDQAIRMPNCKKLQDFIIDEGPFFLTSANKSGEDPI-EINNAQKIFPEVTKIYNFCKG----NGKSSIIIDIETKKRLR 162
>gi|89898303|ref|YP_515413.1| translation factor SUA5 family protein [Chlamydophila felis Fe/C-56] >gi|89331675|dbj|BAE81268.1| translation factor SUA5 family protein [Chlamydophila felis Fe/C-56] (289 aa)
Score = 166, Expect = 2.7e-10, Identities = 57/160 (35%), Positives = 89/160 (55%)
  Q:    53 KAAIVSTDTVSGL-LSLNKP----LIYKIKKRDKNKKLIRFVSNLDQIPEVNE-----TFKKLASKFWPGKLTLIYKKESYRMPDDKF---------ILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKREGEIKYEWIKKTIEE 212
           K     TDTV GL ++LN P     IY +K+RD+ K  + +V+ ++ I +++      +  KL+ KF PG LTL+   ++ R   +K          I  LI  TGPL  +SAN+S  PP     +  E F+  K D+  I G      + STI  ++   + REG I  + I++ + E
  S:    27 KVIAFPTDTVYGLGVALNYPNAEEQIYALKRRDRGKSFVVYVNTIEDIEKISGHNLSLSALKLSQKFLPGPLTLLVDHKNPRFTQEKLGFRILSLPIIEKLIHITGPLLGTSANISSFPPAITSEEVIEDFS--KEDLFVIPGKCTYGLE-STIVSVNPLKIYREGIIPLQHIEEVLGE 202
>gi|148988474|ref|ZP_01819921.1| Sua5/YciO/YrdC/YwlC family protein [Streptococcus pneumoniae SP6-BS73] >gi|149019618|ref|ZP_01834937.1| Sua5/YciO/YrdC/YwlC family protein [Streptococcus pneumoniae SP23-BS72] >gi|147926155|gb|EDK77229.1| Sua5/YciO/YrdC/YwlC family protein [Streptococcus pneumoniae SP6-BS73] >gi|147930993|gb|EDK81973.1| Sua5/YciO/YrdC/YwlC family protein [Streptococcus pneumoniae SP23-BS72] (199 aa)
Score = 166, Expect = 3.0e-10, Identities = 56/165 (33%), Positives = 93/165 (56%)
  Q:    48 EIKNLKAAIVSTDTVSGLLSLNKPL-------IYKIKKRDKNKKLIRFVSNLDQIPEVNET----FKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLK--REGEIKYEWIKKTIEE 212
           E++N  A ++ T+TV GL S  K L       +Y++K+R ++K L   +++ + I   ++      +KL   F PG LT+I +                 +RMP     L+LI +TGPL   SAN+SG           + F++   +++ +E D +   Q STI D+  + +K  R+G IK E I   + E
  S:     7 ELENGGAVVLPTETVYGLFS--KALDEKAVDHVYQLKRRPRDKALNLNIASFEDILHFSKNQPAYLQKLVETFLPGPLTIILEANDRVPYWVNSDLATIGFRMPSHPITLDLIRETGPLIGPSANISGQASGVTFEQILKDFDQ---EVLGLEDDAFLTGQDSTIVDLSGDKVKILRQGAIKREDILARLPE 193
>gi|194246572|ref|YP_002004211.1| Translation factor [Candidatus Phytoplasma mali] >gi|193806929|emb|CAP18361.1| Translation factor [Candidatus Phytoplasma mali] (187 aa)
Score = 166, Expect = 3.2e-10, Identities = 57/138 (41%), Positives = 79/138 (57%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQIP---EVNETFKKLASKFWPGKLTLIYKKESY------------RMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNT---LKREGEIKYEWIKKTI 210
           IYK+KKRD +K L    ++L Q+    ++N T +KL + FWPG LTLI K  S+            R P     L L+ K GPL ++S N+SG PP+ N     + + K K D IF   +   +   ST+ D+  N    + REG I  E I K I
  S:    30 IYKLKKRDFSKPLSVLFADLSQVRHLVKINSTSRKLINYFWPGPLTLILKTTSFYKKKNKENNLGIRQPKHPLALKLLKKHGPLKTTSVNISGFPPLNNYKVIRQIYEK-KVDYIFYSSNQNLSKLSSTVLDLQLNNNFKILREGSITKEMIYKVI 184
>gi|91070575|gb|ABE11478.1| conserved hypothetical protein [uncultured Prochlorococcus marinus clone HOT0M-7C8] (193 aa)
Score = 166, Expect = 3.2e-10, Identities = 46/102 (45%), Positives = 66/102 (64%)
  Q:    49 IKNLKAA---IVSTDTVSGLLSLNK--PLIYKIKKRDKNKKLIRFVSNLDQIPE-----VNETFKKLASKFWPGKLTLIYKKESY--------------RMPDDKFILNLIDKTGPLYSSSANLSG 150
           +K L+A    I  TDT+  +  L K   +IY+ KKRD+NK LI   S   Q+ +       E F+K+ASK+WPG LT++     +              R+P      +LI +TGPL +SSAN+SG
  S:    10 LKTLRAGLPIIFPTDTLPAIGCLPKFSKIIYEFKKRDRNKPLILMGSKYKQLIDFVHESAKEDFEKIASKYWPGALTMVIPASEHQNALLTSKDHTLGLRIPHSSIAQSLIQETGPLLTSSANISG 135
>gi|15829084|ref|NP_326444.1| hypothetical protein MYPU_6130 [Mycoplasma pulmonis UAB CTIP] >gi|14090028|emb|CAC13786.1| conserved hypothetical protein [Mycoplasma pulmonis] (154 aa)
Score = 166, Expect = 3.2e-10, Identities = 50/121 (41%), Positives = 73/121 (60%)
  Q:    56 IVSTDTVSGL------LSLNKPLIYKIKKRDKNKKLIRFVSNLDQ---IPEVNETFKKLASKFWPGKLTLIYKKESYRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEG 176
           + +TDT+ GL      + L K  IY+IKKR  +KK+I  V +L Q     + N    K A K+WPG  TLI   + +RMP +K +   + + GPLY++SANLSG   I  + +A + F + K  I F +G
  S:    10 VFTTDTLIGLGGKVSDVILEK--IYEIKKRPIDKKMIILVGSLAQAQSFSQWNLKANKQAQKYWPGATTLIVNDQGFRMPKNKALCKFLIEQGPLYTTSANLSGFENIKTLDEAKKIFPQIKHFIDFGKG 137
>gi|183603392|ref|ZP_02711993.2| Sua5/YciO/YrdC/YwlC family protein [Streptococcus pneumoniae CDC1087-00] >gi|183569699|gb|EDT90227.1| Sua5/YciO/YrdC/YwlC family protein [Streptococcus pneumoniae CDC1087-00] (200 aa)
Score = 165, Expect = 4.2e-10, Identities = 55/165 (33%), Positives = 93/165 (56%)
  Q:    48 EIKNLKAAIVSTDTVSGLLSLNKPL-------IYKIKKRDKNKKLIRFVSNLDQIPEVNET----FKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLK--REGEIKYEWIKKTIEE 212
           E++N  A ++ T+TV GL +  K L       +Y++K+R ++K L   +++ + I   ++      +KL   F PG LT+I +                 +RMP     L+LI +TGPL   SAN+SG           + F++   +++ +E D +   Q STI D+  + +K  R+G IK E I   + E
  S:     8 ELENGGAVVLPTETVYGLFA--KALDEKAVDHVYQLKRRPRDKALNLNIASFEDILHFSKNQPTYLQKLVETFLPGSLTIILEANDRVPYWVNSDLATIGFRMPSHPITLDLIRETGPLIGPSANISGQASGVTFEQILKDFDQ---EVLGLEDDAFLTGQDSTIVDLSGDKVKILRQGAIKREDILARLPE 194
>gi|149006294|ref|ZP_01830006.1| Sua5/YciO/YrdC/YwlC family protein [Streptococcus pneumoniae SP18-BS74] >gi|147762071|gb|EDK69033.1| Sua5/YciO/YrdC/YwlC family protein [Streptococcus pneumoniae SP18-BS74] (199 aa)
Score = 165, Expect = 4.3e-10, Identities = 57/165 (34%), Positives = 93/165 (56%)
  Q:    48 EIKNLKAAIVSTDTVSGLLSLNKPL-------IYKIKKRDKNKKLIRFVSNLDQIPEVNET----FKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLK--REGEIKYEWIKKTIEE 212
           E++   A I+ T+TV GL +  K L       +Y++K+R ++K L   V++L+ I   ++      +KL   F PG LT+I +                 +RMP     L+LI +TGPL   SAN+SG           + F++   +++ +E D +   Q STI D+  + +K  R+G IK E I   + E
  S:     7 ELEKGGAVILPTETVYGLFA--KALDEKAVDHVYQLKRRPRDKALNLNVASLEDILHFSKNQPAYLQKLVETFLPGPLTIILEANDRVPYWVNSDLATIGFRMPSHPITLDLIRETGPLIGPSANISGQASGVTFEQILKDFDQ---EVLGLEDDAFLTGQDSTIVDLSGDKVKILRQGAIKREDILARLPE 193
>gi|182683970|ref|YP_001835717.1| Sua5/YciO/YrdC family protein [Streptococcus pneumoniae CGSP14] >gi|182629304|gb|ACB90252.1| Sua5/YciO/YrdC family protein [Streptococcus pneumoniae CGSP14] (209 aa)
Score = 164, Expect = 4.4e-10, Identities = 56/171 (32%), Positives = 96/171 (56%)
  Q:    42 LNGIVFEIKNLKAAIVSTDTVSGLLSLNKPL-------IYKIKKRDKNKKLIRFVSNLDQIPEVNET----FKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLK--REGEIKYEWIKKTIEE 212
           ++ I  E++N  A ++ T+TV GL +  K L       +Y++K+R ++K L   +++ + I   ++      +KL   F PG LT+I +                 +RMP     L+LI +TGPL   SAN+SG           + F++   +++ +E D +   Q STI D+  + +K  R+G IK E I   + E
  S:    11 MDKIRQELENGGAVVLPTETVYGLFA--KALDEKAVDHVYQLKRRPRDKALNLNIASFEDILHFSKNQPTYLQKLVETFLPGPLTIILEANDRVPYWVNSDLATIGFRMPSHPITLDLIRETGPLIGPSANISGQASGVTFEQILKDFDQ---EVLGLEDDAFLTGQDSTIVDLSGDKVKILRQGAIKREDILARLPE 203
>gi|172079499|ref|ZP_02708045.2| Sua5/YciO/YrdC/YwlC family protein [Streptococcus pneumoniae CDC1873-00] >gi|172043340|gb|EDT51386.1| Sua5/YciO/YrdC/YwlC family protein [Streptococcus pneumoniae CDC1873-00] (200 aa)
Score = 164, Expect = 4.5e-10, Identities = 55/165 (33%), Positives = 93/165 (56%)
  Q:    48 EIKNLKAAIVSTDTVSGLLSLNKPL-------IYKIKKRDKNKKLIRFVSNLDQIPEVNET----FKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLK--REGEIKYEWIKKTIEE 212
           E++N  A ++ T+TV GL +  K L       +Y++K+R ++K L   +++ + I   ++      +KL   F PG LT+I +                 +RMP     L+LI +TGPL   SAN+SG           + F++   +++ +E D +   Q STI D+  + +K  R+G IK E I   + E
  S:     8 ELENGGAVVLPTETVYGLFA--KALDEKAVDHVYQLKRRPRDKALNLNIASFEDILHFSKNQPAYLQKLVETFLPGPLTIILEANDRVPYWVNSDLATIGFRMPSHPITLDLIRETGPLIGPSANISGQASGVTFEQILKDFDQ---EVLGLEDDAFLTGQDSTIVDLSGDKVKILRQGAIKREDILARLPE 194
>gi|169833958|ref|YP_001694466.1| Sua5/YciO/YrdC/YwlC family protein [Streptococcus pneumoniae Hungary19A-6] >gi|183603195|ref|ZP_02713042.2| Sua5/YciO/YrdC/YwlC family protein [Streptococcus pneumoniae SP195] >gi|183603653|ref|ZP_02718594.2| Sua5/YciO/YrdC/YwlC family protein [Streptococcus pneumoniae CDC3059-06] >gi|168996460|gb|ACA37072.1| Sua5/YciO/YrdC/YwlC family protein [Streptococcus pneumoniae Hungary19A-6] >gi|183572442|gb|EDT92970.1| Sua5/YciO/YrdC/YwlC family protein [Streptococcus pneumoniae SP195] >gi|183575597|gb|EDT96125.1| Sua5/YciO/YrdC/YwlC family protein [Streptococcus pneumoniae CDC3059-06] (200 aa)
Score = 164, Expect = 5.1e-10, Identities = 55/165 (33%), Positives = 93/165 (56%)
  Q:    48 EIKNLKAAIVSTDTVSGLLSLNKPL-------IYKIKKRDKNKKLIRFVSNLDQIPEVNET----FKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLK--REGEIKYEWIKKTIEE 212
           E++N  A ++ T+TV GL +  K L       +Y++K+R ++K L   +++ + I   ++      +KL   F PG LT+I +                 +RMP     L+LI +TGPL   SAN+SG           + F++   +++ +E D +   Q STI D+  + +K  R+G IK E I   + E
  S:     8 ELENGGAVVLPTETVYGLFA--KALDEKAVDHVYQLKRRPRDKALNLNIASFEDILHFSKNQPTYLQKLVETFLPGPLTIILEANDRVPYWVNSDLATIGFRMPSHPITLDLIRETGPLIGPSANISGQASGVTFEQILKDFDQ---EVLGLEDDAFLTGQDSTIVDLSGDKVKILRQGAIKREDILARLPE 194
>gi|148994241|ref|ZP_01823534.1| Sua5/YciO/YrdC/YwlC family protein [Streptococcus pneumoniae SP9-BS68] >gi|148998844|ref|ZP_01826280.1| Sua5/YciO/YrdC/YwlC family protein [Streptococcus pneumoniae SP11-BS70] >gi|147755271|gb|EDK62322.1| Sua5/YciO/YrdC/YwlC family protein [Streptococcus pneumoniae SP11-BS70] >gi|147927382|gb|EDK78413.1| Sua5/YciO/YrdC/YwlC family protein [Streptococcus pneumoniae SP9-BS68] (199 aa)
Score = 164, Expect = 5.7e-10, Identities = 55/165 (33%), Positives = 93/165 (56%)
  Q:    48 EIKNLKAAIVSTDTVSGLLSLNKPL-------IYKIKKRDKNKKLIRFVSNLDQIPEVNET----FKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLK--REGEIKYEWIKKTIEE 212
           E++N  A ++ T+TV GL +  K L       +Y++K+R ++K L   +++ + I   ++      +KL   F PG LT+I +                 +RMP     L+LI +TGPL   SAN+SG           + F++   +++ +E D +   Q STI D+  + +K  R+G IK E I   + E
  S:     7 ELENGGAVVLPTETVYGLFA--KALDEKAVDHVYQLKRRPRDKALNLNIASFEDILHFSKNQPTYLQKLVETFLPGPLTIILEANDRVPYWVNSDLATIGFRMPSHPITLDLIRETGPLIGPSANISGQASGVTFEQILKDFDQ---EVLGLEDDAFLTGQDSTIVDLSGDKVKILRQGAIKREDILARLPE 193
>gi|149012961|ref|ZP_01833850.1| Sua5/YciO/YrdC/YwlC family protein [Streptococcus pneumoniae SP19-BS75] >gi|147763114|gb|EDK70055.1| Sua5/YciO/YrdC/YwlC family protein [Streptococcus pneumoniae SP19-BS75] (200 aa)
Score = 163, Expect = 5.7e-10, Identities = 55/165 (33%), Positives = 93/165 (56%)
  Q:    48 EIKNLKAAIVSTDTVSGLLSLNKPL-------IYKIKKRDKNKKLIRFVSNLDQIPEVNET----FKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLK--REGEIKYEWIKKTIEE 212
           E++N  A ++ T+TV GL +  K L       +Y++K+R ++K L   +++ + I   ++      +KL   F PG LT+I +                 +RMP     L+LI +TGPL   SAN+SG           + F++   +++ +E D +   Q STI D+  + +K  R+G IK E I   + E
  S:     8 ELENGGAVVLPTETVYGLFA--KALDEKAVDHVYQLKRRPRDKALNLNIASFEDILHFSKNQPTYLQKLVETFLPGPLTIILEANDRVPYWVNSDLATIGFRMPSHPITLDLIRETGPLIGPSANISGQASGVTFEQILKDFDQ---EVLGLEDDAFLTGQDSTIVDLSGDKVKILRQGAIKREDILARLPE 194
>gi|148377715|ref|YP_001256591.1| hypothetical protein MAG4520 [Mycoplasma agalactiae PG2] >gi|148291761|emb|CAL59150.1| Conserved hypothetical protein [Mycoplasma agalactiae PG2] (151 aa)
Score = 163, Expect = 5.9e-10, Identities = 51/136 (37%), Positives = 81/136 (59%)
  Q:    56 IVSTDTVSGLLSLNKPL-------IYKIKKRDKNKKLIRFVSNLDQ---IPEVNETFKKLASKFWPGKLTLIYKKESYRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDID 191
           I +TDTV+G+     P+       IY +K R  +KK+I  V +++Q     E N    + ASK+WPG  ++I   + +RMP++  +   + K GP+Y +SAN+SG  PI  I +A + F   K+   F +G    NN+ S IY++D
  S:     8 ICTTDTVTGI---GGPVNDNTLKSIYYLKNRPISKKIIILVGSVEQAREFKEWNHEADEFASKYWPGAYSVIVNNQGFRMPNNLKLCQFLLKNGPMYVTSANISGQEPI-EISEASKYFPLVKNVYDFGKG----NNKASQIYNLD 145
>gi|194397422|ref|YP_002037657.1| Sua5/YciO/YrdC/YwlC family protein [Streptococcus pneumoniae G54] >gi|194357089|gb|ACF55537.1| Sua5/YciO/YrdC/YwlC family protein [Streptococcus pneumoniae G54] (200 aa)
Score = 163, Expect = 6.2e-10, Identities = 56/165 (33%), Positives = 93/165 (56%)
  Q:    48 EIKNLKAAIVSTDTVSGLLSLNKPL-------IYKIKKRDKNKKLIRFVSNLDQIPEVNET----FKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLK--REGEIKYEWIKKTIEE 212
           E++   A I+ T+TV GL +  K L       +Y++K+R ++K L   +++L+ I   ++      +KL   F PG LT+I +                 +RMP     L+LI +TGPL   SAN+SG           + F++   +++ +E D +   Q STI D+  + +K  R+G IK E I   + E
  S:     8 ELEKGGAVILPTETVYGLFA--KALDEKAVDHVYQLKRRPRDKALNLNIASLEDILHFSKNQPAYLQKLVETFLPGPLTIILEANDRVPYWVNSDLATIGFRMPSHPITLDLIRETGPLIGPSANISGQASGVTFEQILKDFDQ---EVLGLEDDAFLTGQDSTIVDLSGDKVKILRQGAIKREDILARLPE 194
>gi|81096269|ref|ZP_00874616.1| Sua5/YciO/YrdC/YwlC [Streptococcus suis 89/1591] >gi|80977613|gb|EAP41149.1| Sua5/YciO/YrdC/YwlC [Streptococcus suis 89/1591] (202 aa)
Score = 162, Expect = 7.6e-10, Identities = 61/164 (37%), Positives = 93/164 (56%)
  Q:    49 IKNLKAAIVSTDTVSGLLS--LNKPLI---YKIKKRDKNKKLIRFVSNLDQIPEVNET----FKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLK--REGEIKYEWIKKTIEE 212
           ++N  A I+ T+TV GL +  LN+  +   Y++K+R ++K +   VSNL+ I   ++      +KL ++F PG LT+I K                 +R+P+ +  L LI +TGPL   SAN+SGN       D    F+    D+  IE D       STI D+     +  R+G I  E I+K I E
  S:    10 LENGGAVILPTETVYGLFAQALNEDAVNRVYQLKQRPRDKAMNLNVSNLNDIYFFSQNTPFFLEKLYNRFMPGPLTIILKANENVPFWVNSGLDTVGFRLPNHEQTLRLISETGPLIGPSANISGNESGKKFSDIQAQFS---VDLPGIEDDQALTGIDSTILDLSGQKARILRQGAISREEIQKAIPE 195
>gi|146318504|ref|YP_001198216.1| putative translation factor (SUA5) [Streptococcus suis 05ZYH33] >gi|146320695|ref|YP_001200406.1| putative translation factor (SUA5) [Streptococcus suis 98HAH33] >gi|145689310|gb|ABP89816.1| Putative translation factor (SUA5) [Streptococcus suis 05ZYH33] >gi|145691501|gb|ABP92006.1| Putative translation factor (SUA5) [Streptococcus suis 98HAH33] (202 aa)
Score = 162, Expect = 7.8e-10, Identities = 61/164 (37%), Positives = 93/164 (56%)
  Q:    49 IKNLKAAIVSTDTVSGLLS--LNKPLI---YKIKKRDKNKKLIRFVSNLDQIPEVNET----FKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLK--REGEIKYEWIKKTIEE 212
           ++N  A I+ T+TV GL +  LN+  +   Y++K+R ++K +   VSNL+ I   ++      +KL ++F PG LT+I K                 +R+P+ +  L LI +TGPL   SAN+SGN       D    F+    D+  IE D       STI D+     +  R+G I  E I+K I E
  S:    10 LENGGAVILPTETVYGLFAQALNEDAVNRVYQLKQRPRDKAMNLNVSNLNDIYFFSQNTPFFLEKLYNRFMPGPLTIILKANDNVPFWVNSGLDTVGFRLPNHEQTLRLISETGPLIGPSANISGNESGKKFSDIQAQFS---VDLPGIEDDQALTGIDSTILDLSGQKARILRQGAISREEIQKAIPE 195
>gi|111658251|ref|ZP_01408943.1| hypothetical protein SpneT_02000565 [Streptococcus pneumoniae TIGR4] (200 aa)
Score = 162, Expect = 8.0e-10, Identities = 55/157 (35%), Positives = 91/157 (57%)
  Q:    48 EIKNLKAAIVSTDTVSGLLSLNKPL-------IYKIKKRDKNKKLIRFVSNLDQIPEVNET----FKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLK--REGEIKYE 204
           E++N  A ++ T+TV GL +  K L       +Y++K+R ++K L   V++L+ I   ++      +KL   F PG LT+I +                 +RMP     L+LI +TGPL   SAN+SG           E F++   +++ +E D +   Q STI ++  + +K  R+G IK E
  S:     8 ELENGGAVVLPTETVYGLFA--KALDEKAVDHVYQLKRRRRDKALNLNVASLEDILYFSKNQPTYLQKLVEIFLPGPLTIILEANDRVPYWVNSGLATVGFRMPSHPITLDLIRETGPLIGPSANISGQASGVTFNQILEDFDQ---EVLGLEDDAFLTGQDSTILNLSGDKVKILRQGAIKRE 186
>gi|15900893|ref|NP_345497.1| Sua5/YciO/YrdC family protein [Streptococcus pneumoniae TIGR4] >gi|14972495|gb|AAK75137.1| Sua5/YciO/YrdC family protein [Streptococcus pneumoniae TIGR4] (199 aa)
Score = 162, Expect = 8.1e-10, Identities = 55/157 (35%), Positives = 91/157 (57%)
  Q:    48 EIKNLKAAIVSTDTVSGLLSLNKPL-------IYKIKKRDKNKKLIRFVSNLDQIPEVNET----FKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLK--REGEIKYE 204
           E++N  A ++ T+TV GL +  K L       +Y++K+R ++K L   V++L+ I   ++      +KL   F PG LT+I +                 +RMP     L+LI +TGPL   SAN+SG           E F++   +++ +E D +   Q STI ++  + +K  R+G IK E
  S:     7 ELENGGAVVLPTETVYGLFA--KALDEKAVDHVYQLKRRRRDKALNLNVASLEDILYFSKNQPTYLQKLVEIFLPGPLTIILEANDRVPYWVNSGLATVGFRMPSHPITLDLIRETGPLIGPSANISGQASGVTFNQILEDFDQ---EVLGLEDDAFLTGQDSTILNLSGDKVKILRQGAIKRE 185
>gi|15902970|ref|NP_358520.1| hypothetical protein spr0926 [Streptococcus pneumoniae R6] >gi|15458534|gb|AAK99730.1| Conserved hypothetical protein [Streptococcus pneumoniae R6] (203 aa)
Score = 161, Expect = 9.8e-10, Identities = 55/165 (33%), Positives = 92/165 (55%)
  Q:    48 EIKNLKAAIVSTDTVSGLLSLNKPL-------IYKIKKRDKNKKLIRFVSNLDQIPEVNET----FKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLK--REGEIKYEWIKKTIEE 212
           E++   A ++ T+TV GL S  K L       +Y++K+R ++K L   +++ + I   ++      +KL   F PG LT+I +                 +RMP     L+LI +TGPL   SAN+SG           + F++   +++ +E D +   Q STI D+  + +K  R+G IK E I   + E
  S:    11 ELEKGGAVVLPTETVYGLFS--KALDEKAVDHVYQLKRRPRDKALNLNIASFEDILHFSKNQPAYLQKLVETFLPGPLTIILEANDRVPYWVNSDLATIGFRMPSHPITLDLIRETGPLIGPSANISGQASGVTFEQILKDFDQ---EVLGLEDDAFLTGQDSTIVDLSGDKVKILRQGAIKREDILARLPE 197
>gi|16330823|ref|NP_441551.1| hypothetical protein sll1866 [Synechocystis sp. PCC 6803] >gi|1653316|dbj|BAA18231.1| sll1866 [Synechocystis sp. PCC 6803] (199 aa)
Score = 161, Expect = 1.2e-09, Identities = 40/106 (37%), Positives = 66/106 (62%)
  Q:    59 TDTVSGLL--SLNKPLIYKIKKRDKNKKLIRFVSNLDQI-------PEVNETFKKLASKFWPGKLTLIY---------------KKESYRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESF 164
           TDTV  L     N  LIY++K+R+ +K LI   + ++QI           + ++ + +++WPG LTL+                +    R+P     L ++ +TGPL ++SANLSG PP+  + D  E+F
  S:    23 TDTVPALAVRPENSALIYELKQREASKPLILMAATVEQILPYLAGSQREKQLWQAVMAEYWPGALTLVLPCSEKLPPEINPRQDQTIGVRIPRQAISLEILLQTGPLATTSANLSGQPPLEKLADIAETF 152
>gi|149003882|ref|ZP_01828705.1| Sua5/YciO/YrdC/YwlC family protein [Streptococcus pneumoniae SP14-BS69] >gi|147758112|gb|EDK65116.1| Sua5/YciO/YrdC/YwlC family protein [Streptococcus pneumoniae SP14-BS69] (199 aa)
Score = 160, Expect = 1.3e-09, Identities = 55/165 (33%), Positives = 92/165 (55%)
  Q:    48 EIKNLKAAIVSTDTVSGLLSLNKPL-------IYKIKKRDKNKKLIRFVSNLDQIPEVNET----FKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLK--REGEIKYEWIKKTIEE 212
           E++   A ++ T+TV GL S  K L       +Y++K+R ++K L   +++ + I   ++      +KL   F PG LT+I +                 +RMP     L+LI +TGPL   SAN+SG           + F++   +++ +E D +   Q STI D+  + +K  R+G IK E I   + E
  S:     7 ELEKGGAVVLPTETVYGLFS--KALDEKAVDHVYQLKRRPRDKALNLNIASFEDILHFSKNQPAYLQKLVETFLPGPLTIILEANDRVPYWVNSDLATIGFRMPSHPITLDLIRETGPLIGPSANISGQASGVTFEQILKDFDQ---EVLGLEDDAFLTGQDSTIVDLSGDKVKILRQGAIKREDILARLPE 193
>gi|116516461|ref|YP_816386.1| Sua5/YciO/YrdC/YwlC family protein [Streptococcus pneumoniae D39] >gi|116077037|gb|ABJ54757.1| Sua5/YciO/YrdC/YwlC family protein [Streptococcus pneumoniae D39] (200 aa)
Score = 160, Expect = 1.3e-09, Identities = 55/165 (33%), Positives = 92/165 (55%)
  Q:    48 EIKNLKAAIVSTDTVSGLLSLNKPL-------IYKIKKRDKNKKLIRFVSNLDQIPEVNET----FKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLK--REGEIKYEWIKKTIEE 212
           E++   A ++ T+TV GL S  K L       +Y++K+R ++K L   +++ + I   ++      +KL   F PG LT+I +                 +RMP     L+LI +TGPL   SAN+SG           + F++   +++ +E D +   Q STI D+  + +K  R+G IK E I   + E
  S:     8 ELEKGGAVVLPTETVYGLFS--KALDEKAVDHVYQLKRRPRDKALNLNIASFEDILHFSKNQPAYLQKLVETFLPGPLTIILEANDRVPYWVNSDLATIGFRMPSHPITLDLIRETGPLIGPSANISGQASGVTFEQILKDFDQ---EVLGLEDDAFLTGQDSTIVDLSGDKVKILRQGAIKREDILARLPE 194
>gi|170291088|ref|YP_001737904.1| Sua5/YciO/YrdC/YwlC family protein [Candidatus Korarchaeum cryptofilum OPF8] >gi|170175168|gb|ACB08221.1| Sua5/YciO/YrdC/YwlC family protein [Candidatus Korarchaeum cryptofilum OPF8] (209 aa)
Score = 159, Expect = 1.7e-09, Identities = 59/173 (34%), Positives = 100/173 (57%)
  Q:    36 EKDSSNLNGIVFEIKNLKAAIVSTDTVSGLLSLNKPL-----IYKIKKRDKNKKLIRFVSNLDQIPE---VNETFKKLASKFWPGKLTLIYKKES------------YRMPDDKFILNLIDK-TGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTN--TLKREGEIKYEWIKK 208
           E   S ++ +V  ++  K  I  TDTV GL +  + +     +Y++K R + K+L   VS++D       V+E  ++L  KF PGK+T I KK S             R+P+   IL +I +  G + ++SAN SG+PP    +D  E+  + ++D++   G     ++PSTI D+      L REG++ +  + K
  S:     8 EGGESTIDEVVDALRKGKLIIYPTDTVYGLGADAENIDAVRRVYEVKGRPEEKRLTIAVSDIDMAERYAVVDEISRRLMEKFLPGKVTFILKKTSRVPDIVNPEAIGIRIPNIPIILRIIREFGGAITATSANKSGSPP---KLDPEEAAMEIEADLLLDYGR-LPPSRPSTIVDLTRGEPVLVREGDVPFSLVMK 199
>gi|189485673|ref|YP_001956614.1| Sua5-related translation factor [uncultured Termite group 1 bacterium phylotype Rs-D17] >gi|170287632|dbj|BAG14153.1| Sua5-related translation factor [uncultured Termite group 1 bacterium phylotype Rs-D17] (202 aa)
Score = 156, Expect = 4.2e-09, Identities = 47/109 (43%), Positives = 68/109 (62%)
  Q:    49 IKNLKAAIVSTDTVSGLL--SLN---KPLIYKIKKRDKNKKLIRFVSNLDQIP---EVNETFKKLASKFWPGKLTLIY-------------KKESYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNI 157
           I+N   AIV TDTV G    + N   + ++YKIK R   K  I  V +++ I    E+ E   K+A +FWPG+LTLI              K    R+PD KF+L L+ + G P++++S N+S      NI
  S:    20 IRNGGIAIVPTDTVYGFAVDAFNIEAQKVVYKIKGRSHKKSFILMVPDIESIRILVEIPEKALKIAKRFWPGQLTLILPTTEMGKILSGGKKDLGVRIPDSKFMLKLLKEMGSPVFTTSVNMSNKKSAKNI 150
>gi|177664506|ref|ZP_02940308.1| SUA5/yciO/yrdC domain [Cyanothece sp. PCC 8801] >gi|196244656|ref|ZP_03143382.1| SUA5/yciO/yrdC domain protein [Cyanothece sp. PCC 8802] >gi|172076342|gb|EDT61754.1| SUA5/yciO/yrdC domain [Cyanothece sp. PCC 8801] >gi|196207400|gb|EDY02193.1| SUA5/yciO/yrdC domain protein [Cyanothece sp. PCC 8802] (197 aa)
Score = 156, Expect = 4.2e-09, Identities = 45/129 (34%), Positives = 74/129 (57%)
  Q:    59 TDTVSGLLSL--NKPLIYKIKKRDKNKKLIRFVSNLDQI-------PEVNETFKKLASKFWPGKLTLIYKKESY---------------RMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYK--SDIIFIEGDYYQNNQPSTI 187
           TDTV  L +L  N  LI+  KKR  +K LI   ++++ +       PE    ++++A  +WPG LTL+    S                R+P+      ++ +TG L ++SAN SG PP+  +     +F   +   DI   + D + + QPST+
  S:    23 TDTVPALAALPQNAALIFATKKRPPDKPLILMGASIEALWQYIQGTPEELALWQQIAESYWPGSLTLVLPASSLVPAAMNPLDPTTIGVRIPNHPIAQAILAETGCLATTSANRSGQPPLETMTAIAANFPDVRILDDINLNDKDKFGSGQPSTV 177
>gi|160916151|ref|ZP_02078358.1| hypothetical protein EUBDOL_02178 [Eubacterium dolichum DSM 3991] >gi|158431875|gb|EDP10164.1| hypothetical protein EUBDOL_02178 [Eubacterium dolichum DSM 3991] (202 aa)
Score = 155, Expect = 5.2e-09, Identities = 62/182 (34%), Positives = 93/182 (51%)
  Q:    31 EFVTYEKDSSNLNGIVFEIKNLKAAIVSTDTVSGLLSLNK-----PLIYKIKKRDKNKKLIRFVSNLDQIPEV---NETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLK--REGEIKYEWIKKTIEE 212
           E + Y K+  ++  +V ++K  K     TDTV GL  +        L Y  K R +NK +   V +L Q+ E+   NE  KKLA+ F PG  T+I KK+                RMP D F+L L+ + G P+  +SANLSG       +      +     I+  E         STI D+ +  LK  REG I    ++  +++
  S:     2 ETIRYHKE--DIQAVVKQLKQKKVIAFPTDTVYGLGVIYDEEALAALKYS-KGRPENKPIPTMVGSLAQMEEIAVLNEEAKKLAAAFMPGAFTMILKKKDSVADFVTNGMETIGIRMPQDDFVLELLRQVGSPMLVTSANLSGEATGLVDVQVLSQLDGRIDGIVLGEAG---GKVASTIVDMTSGKLKILREGPISKAMLEAALKK 202
>gi|166154358|ref|YP_001654476.1| hypothetical protein CTL0392 [Chlamydia trachomatis 434/Bu] >gi|166155233|ref|YP_001653488.1| hypothetical protein CTLon_0388 [Chlamydia trachomatis L2b/UCH-1/proctitis] >gi|165930346|emb|CAP03832.1| conserved hypothetical protein [Chlamydia trachomatis 434/Bu] >gi|165931221|emb|CAP06786.1| conserved hypothetical protein [Chlamydia trachomatis L2b/UCH-1/proctitis] (281 aa)
Score = 154, Expect = 6.9e-09, Identities = 52/152 (34%), Positives = 83/152 (54%)
  Q:    59 TDTVSGL------LSLNKPLIYKIKKRDKNKKLIRFVSNLDQIPEVNE-----TFKKLASKFWPGKLTLIYKKESYRMP---------DDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKREGEIKYEWIKKTI 210
           TDTV GL      L  ++ L + +K R   K L  +VS+L+++  V +     + +K+  KF PG LTLI K  + R P         +   +  +I K GP  ++SANLSG P   +  +  + F   + DI+ I G+     + ST+ D +   + REG I    I+  +
  S:    20 TDTVYGLGVSFHILDADQRL-FALKHRSSQKALSVYVSSLEELEAVAQQSLGASSRKIIQKFLPGPLTLITKHNNPRFPQKTLGFRIVNHPIVQQIIQKVGPFLATSANLSGFPSAVSADEVKQDFP--EEDIVMISGECSIGLE-STVIDPEERIVYREGAISIAEIETVL 187
>gi|172040387|ref|YP_001800101.1| hypothetical protein cu0707 [Corynebacterium urealyticum DSM 7109] >gi|171851691|emb|CAQ04667.1| conserved hypothetical protein [Corynebacterium urealyticum DSM 7109] (219 aa)
Score = 154, Expect = 7.1e-09, Identities = 38/117 (32%), Positives = 65/117 (55%)
  Q:    95 IPEVNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLK--REGEIKYEWIKKTIE 211
           + E +   ++L   FWPG L+L+  +                 RMP+    ++L+ +TGP+  SSAN+SG PP T +  A +      S  ++++G      +PSTI D+  +  +  REG I  E I + ++
  S:    79 VAEFSAHLRRLVEAFWPGGLSLVVPQAPSLPWNLGDTRGTVMLRMPNHPIAIDLLQRTGPMAVSSANVSGQPPATTVAMAEDQLG--DSVAVYLDGGEATIGEPSTIVDLAGHRPRILREGAISAEQIGEVLQ 209
>gi|172039116|ref|YP_001805617.1| putative YrdC-like RNA-binding protein [Cyanothece sp. ATCC 51142] >gi|171700570|gb|ACB53551.1| putative YrdC-like RNA-binding protein [Cyanothece sp. ATCC 51142] (199 aa)
Score = 154, Expect = 7.1e-09, Identities = 55/154 (35%), Positives = 89/154 (57%)
  Q:    49 IKNLKAAIVSTDTVSGLLSL--NKPLIYKIKKRDKNKKLIRFVSNLDQI-------PEVNETFKKLASKFWPGKLTLIYKKESY---------------RMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQ------PSTI---YDIDTNTLKREGEIK 202
           +K  K     TDTV  L +L  +  LI+  K+R  +K LI   S+ D I       P+  E ++K+  ++WPG+LTL+     +               R+P+     N++ +TG L ++SANLSG PPI  + +   +F     D++ +  +  +N +      PST+    D D   L R+G IK
  S:    13 VKQGKVISFPTDTVPALAALPESASLIFATKQRPPDKPLILMGSSSDAIWKYVKGTPQEFEIWEKVVKQYWPGQLTLVLPASEWVPKAMNPLEPTTIGVRIPNSIIAQNILKQTGCLATTSANLSGEPPIETLSEIAANF----PDVLVLNEEVLKNQKKYGSGLPSTVAKWTDTDWKIL-RQGSIK 194
>gi|62185126|ref|YP_219911.1| hypothetical protein CAB498 [Chlamydophila abortus S26/3] >gi|62148193|emb|CAH63950.1| hypothetical protein [Chlamydophila abortus S26/3] (295 aa)
Score = 153, Expect = 1.1e-08, Identities = 57/160 (35%), Positives = 87/160 (54%)
  Q:    53 KAAIVSTDTVSGL-LSLNKP----LIYKIKKRDKNKKLIRFVSNLDQIPE-----VNETFKKLASKFWPGKLTLIYKKESYRMPDDKF--------ILN-LIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKREGEIKYEWIKKTIEE 212
           K     TDTV GL ++LN P     IY +K RD+ K L+ +V+ ++ + +     ++    KL+ KF PG LTL+   ++ R   +K         I+N LID  GPL  +SAN+S  PP     +  E F+  + DI  I G        ST+   D   + REG +  + I+  + E
  S:    28 KIVAFPTDTVYGLGVALNYPNAEEKIYALKHRDRGKSLVVYVNTIEDMEKFSGCTLSTRALKLSQKFLPGPLTLLVDHKNPRFHQEKLGFRILSIPIVNKLIDLAGPLLGTSANISNFPPAITSNEVTEDFS--QEDICVIPG-CCSYGLESTVVSADPLKVYREGMVPRQVIEDVVGE 203
>gi|167044297|gb|ABZ08976.1| putative yrdC domain protein [uncultured marine crenarchaeote HF4000_APKG6B14] (199 aa)
Score = 152, Expect = 1.1e-08, Identities = 59/160 (36%), Positives = 94/160 (58%)
  Q:    49 IKNLKAAIVSTDTVSGL----------LSLNKPLIYKIKKRDKNKK--LIRFVSN-LDQIPEVNETFKKLASKFWPGKLTLIYK--------------KESYRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLK--REGEIKYEWIKK 208
           I +    +  TDTV GL          LSL     Y+IKKR K K   +I +    L++I E N   +K+A KFWPG +TLI K              K + R+P+++ +L L+ +   L ++SAN+SG  P  +  +  E+ + Y    + ++G    +   STI +I+ N ++  R+G +  E IKK
  S:    17 INDGATVVFPTDTVYGLGCNPYNHEAVLSL-----YEIKKRKKTKPFPVIGYAKKELEKIAEFNPLEEKIAEKFWPGPITLILKVKDKEIQKSLGLDGKIAVRVPNNQCVLALLKECKLLVATSANISGTAPFNDPKECSENLSGYD---LLMDGGIISSQGESTIVEIENNDVRILRKGNVSEEEIKK 197
>gi|119720716|ref|YP_921211.1| Sua5/YciO/YrdC/YwlC family protein [Thermofilum pendens Hrk 5] >gi|119525836|gb|ABL79208.1| translation factor SUA5 [Thermofilum pendens Hrk 5] (366 aa)
Score = 152, Expect = 1.1e-08, Identities = 44/105 (41%), Positives = 63/105 (60%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQI----PEVNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPP--------------ITNIIDAFESFNKYKSDIIFIEGD 177
           ++K+K+R  +  LI  +S+  QI     EV E   +LA KFWPG LT++  K S               RMP     L LI+  G P+ + SANLSG P               I  ++DA E+    +S +I +  D
  S:    66 VFKVKRRPPDNPLILHISSFSQIYTLASEVPEAVHRLAEKFWPGPLTVVLPKTSRVPYEVTGGLEKVAVRMPAHNVALRLIEAVGDPIAAPSANLSGRPSPTTAQHVLADLGDEIDGVLDAGETLYGVESTVIDLTAD 203
>gi|54020289|ref|YP_116178.1| hypothetical protein mhp670 [Mycoplasma hyopneumoniae 232] >gi|53987462|gb|AAV27663.1| conserved hypothetical protein [Mycoplasma hyopneumoniae 232] (287 aa)
Score = 151, Expect = 1.6e-08, Identities = 54/149 (36%), Positives = 84/149 (56%)
  Q:    50 KNLKAAIVSTDTVSGLLSLNK----PLIYKIKKRDKNKKLIRFVSNLDQIP-----EVNETFKKLASKFWPGKLTLIYKKESYRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKRE 198
           K  K  + +TDTV G+ S  K      I+ IKKRD +KK++  V+NL+QI      E  +  +K+  K WPG  TLI + +S+R+P+   +L L+ K GP + +SAN+S   P+ +I+ A   F +      F  G      + S I+D+D     R+
  S:   135 KYQKLFLTTTDTVPGIASFYKNCDLDAIFVIKKRDFSKKIVTLVANLEQIKPLIKQENYKKLRKITKKIWPGATTLIIENQSFRIPNQVKLLKLLKKNGPAFVTSANISNEKPL-DIVSAKRKFWQITKIFNFGPG----TGKVSRIFDLDNKKWIRK 287
>gi|145295341|ref|YP_001138162.1| hypothetical protein cgR_1281 [Corynebacterium glutamicum R] >gi|140845261|dbj|BAF54260.1| hypothetical protein [Corynebacterium glutamicum R] (216 aa)
Score = 151, Expect = 1.7e-08, Identities = 52/172 (30%), Positives = 91/172 (52%)
  Q:    39 SSNLNGIVFEIKNLKAAIVSTDTVSGL--LSLNKPLIYKI---KKRDKNKKLIRFVSNLDQIPEVNETF----KKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLK--REGEIKYEWIKKTI 210
           ++ L   V  +K  +  ++ TDT+ GL   + N   +  +   K R  +  +   V + D I  +  ++    K L   FWPG L++I  +                 RMP     + L+ +TGP+  SSAN+SG+ P + +++A +  N+  S  ++++G      +PSTI DI     K  REG I  E + + +
  S:    14 AAGLKAAVDAVKAGQLVVLPTDTLYGLGCDAFNNEAVANLLATKHRGPDMPVPVLVGSWDTIQGLVHSYSAQAKALVEAFWPGGLSIIVPQAPSLPWNLGDTRGTVMLRMPLHPVAIELLRQTGPMAVSSANISGHTPPSTVLEARQQLNQNVS--VYLDGGECAIGKPSTIVDISGPAPKILREGAISAERVGEVL 208
>gi|126657314|ref|ZP_01728473.1| hypothetical protein CY0110_00105 [Cyanothece sp. CCY0110] >gi|126621301|gb|EAZ92013.1| hypothetical protein CY0110_00105 [Cyanothece sp. CCY0110] (199 aa)
Score = 151, Expect = 1.8e-08, Identities = 43/101 (42%), Positives = 64/101 (63%)
  Q:    59 TDTVSGLLSL--NKPLIYKIKKRDKNKKLIRFVSNLDQI-------PEVNETFKKLASKFWPGKLTLIYKKESY---------------RMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIID 159
           TDTV  L +L  +  LI+  KKR  +K LI   S+ + I       PE    ++K+ +K+WPG+LTL+                     R+P+     N++ +TG L ++SANLSG PPI N+ D
  S:    23 TDTVPALAALPESASLIFATKKRPPDKPLILMGSSSEAIWKYVKGTPEEFRIWEKIVNKYWPGQLTLVLPASELVPQGINPLDPSTIGVRIPNSIIAQNILKQTGCLATTSANLSGEPPIENLSD 147
>gi|72080976|ref|YP_288034.1| hypothetical protein MHP7448_0649 [Mycoplasma hyopneumoniae 7448] >gi|71914100|gb|AAZ54011.1| conserved hypothetical protein [Mycoplasma hyopneumoniae 7448] (287 aa)
Score = 150, Expect = 1.9e-08, Identities = 45/109 (41%), Positives = 69/109 (63%)
  Q:    50 KNLKAAIVSTDTVSGLLSLNK----PLIYKIKKRDKNKKLIRFVSNLDQIP-----EVNETFKKLASKFWPGKLTLIYKKESYRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNII 158
           K  K  + +TDTV G+ S  K      I+ IKKRD +KK++  V+NL+QI      E  +  KK+  K WPG  TLI + +S+R+P+   +L L+ K GP + +SAN+S   P+  ++
  S:   135 KYQKLFLTTTDTVPGIASFYKNCDLDAIFVIKKRDFSKKIVTLVANLEQIKPLIKQENYKKLKKITRKIWPGATTLIIENQSFRIPNQVKLLKLLKKNGPAFVTSANISNEKPLDLVV 252
>gi|169351563|ref|ZP_02868501.1| hypothetical protein CLOSPI_02343 [Clostridium spiroforme DSM 1552] >gi|169291785|gb|EDS73918.1| hypothetical protein CLOSPI_02343 [Clostridium spiroforme DSM 1552] (200 aa)
Score = 150, Expect = 2.1e-08, Identities = 46/138 (33%), Positives = 81/138 (58%)
  Q:    73 IYKIKKRDKNKKLIRFVSN---LDQIPEVNETFKKLASKFWPGKLTLIYKKESY--------------RMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLK--REGEIKYEWIKKTI 210
           +Y++K RD++K +   ++N   +++   VN+  +K+   F PG +T+I KK  +              R+PDDKF+L+L++KTGP+  +SANLSG      ++D       +   I  I      + + STI D+    ++  R G+I  + I + I
  S:    47 LYELKHRDRHKAISMMINNPKDIEKYAYVNDQARKIIKSFMPGMVTIILKKREFIDDYFTASLDTIGIRIPDDKFVLSLLEKTGPMLVTSANLSGE---DTLVDDKAVMKVFSGKIPLIVKGESVSKKASTIIDLSKGKVEILRVGDISEKQILEVI 200
>gi|52550560|gb|AAU84409.1| putative translation factor [uncultured archaeon GZfos9E5] (222 aa)
Score = 150, Expect = 2.1e-08, Identities = 58/154 (37%), Positives = 92/154 (59%)
  Q:    49 IKNLKAAIVSTDTVSGLLS-----LNKPLIYKIKKRDKNKKLIRFVSNLDQIPEVN----ETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSG-NPPITNIIDAFESFNKYKSDI--IFIEGDYYQNNQPSTIYDIDTNTL--KREGEIK 202
           IKN    +  T+TV GL +          +YKIK+R   + +   VS+ + + EV     E F+ +A +  PG +T+++KK+                R PD++ +  +I +TGP+ ++SAN+SG NPP    I+  E   K K ++  I I G   + + PST+ D+   T   KRE EIK
  S:    16 IKNGGMVVYPTETVYGLGADAFSEAAVRNVYKIKRRAVTQPISIAVSSFEMLHEVADIDFECFEIIA-ELLPGPVTILFKKKDIVPAILTAASEVVGVRFPDNEIVTRIIKETGPITATSANVSGRNPP--TCIEEVEVELKLKVELLGIIINGGKCKYSMPSTVVDMSKATANEKREIEIK 194
>gi|13542129|ref|NP_111817.1| translation factor (SUA5-related) [Thermoplasma volcanium GSS1] >gi|14325560|dbj|BAB60463.1| hypothetical protein [Thermoplasma volcanium GSS1] (361 aa)
Score = 150, Expect = 2.1e-08, Identities = 63/171 (36%), Positives = 92/171 (53%)
  Q:    34 TYEKDSSNLNGIVFEIKNLKAAIVSTDTVSGL--LSLNKPLIYKI---KKRDKNKKLIRFVSNLDQI----PEVNETFKKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDI--DTNTLKREGEIKYE 204
           +Y KD  +L   V  +K+    +  T+TV GL   ++N     KI   K R  +  LI  +S++DQ+      V E +K +  + WPG LT++ +K               + RMPDD    NLID  GP+ + SAN+S  P IT+  DA   F   + D+I I+    +    STI D+  D   L R G    E
  S:    11 SYSKD--DLYYAVEALKHGGTVVFPTETVYGLGANAMNDEACKKIFIAKGRPSDNPLIVHISDMDQLENFSKNVKEEYKAILKELWPGPLTVVVEKANGIPDTVTAKLPTVAIRMPDDSIARNLIDMAGPIAAPSANISTKPSITDSKDAIR-FLDGRVDVI-IDAGKVKFGIESTIIDLTQDPVRLLRPGAFSVE 202
>gi|117927851|ref|YP_872402.1| translation factor SUA5 [Acidothermus cellulolyticus 11B] >gi|117648314|gb|ABK52416.1| translation factor SUA5 [Acidothermus cellulolyticus 11B] (219 aa)
Score = 150, Expect = 2.3e-08, Identities = 38/108 (35%), Positives = 62/108 (57%)
  Q:   105 LASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDI--DTNTLKREGEIKYEWIKKTIEE 212
           L   FWPG LT++ +                + RMP +   L L+ +TGP+  SSAN SG PP T   +A     +  +  ++++G    +  PS+I D+  +T TL R G I+ E +++ + E
  S:    90 LIDAFWPGGLTIVVRYNPSLAWDLGETNGTVALRMPAEDLALELLQRTGPMAVSSANRSGLPPATTCANARAQLGEAVA--VYLDGGPTTSTIPSSIVDLTGETPTLLRSGAIEAERLREVVPE 211
>gi|28493400|ref|NP_787561.1| hypothetical protein TWT433 [Tropheryma whipplei str. Twist] >gi|28572489|ref|NP_789269.1| hypothetical protein TW335 [Tropheryma whipplei TW08/27] >gi|28410621|emb|CAD67007.1| conserved hypothetical protein [Tropheryma whipplei TW08/27] >gi|28476441|gb|AAO44530.1| unknown [Tropheryma whipplei str. Twist] (225 aa)
Score = 149, Expect = 2.4e-08, Identities = 50/135 (37%), Positives = 77/135 (57%)
  Q:    56 IVSTDTVSGLLS-LNKP----LIYKIKKRDKNKKLI-----RFVSNLDQIPEVNETFKKLASKFWPGKLTLIYKKE---------SYRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQ--PSTIYDI 190
           +V TDTV GL +   +P     + +IK R     ++      F + +D +PE       LA +FWPG LTL+ +           + R+P   F+L L+D+ GPL  SSAN+SG  P  ++  A  S     +  ++I+GD   N    PS+I D+
  S:    29 VVPTDTVYGLAADAFQPEAVGRLLEIKGRTAAPPVLVGSIETFQAIVDVLPE---PALALAKRFWPGPLTLVLRTRPGLLWGDTVAVRIPRHSFLLQLLDEIGPLAVSSANISGRRPALSVRSARGSLRDKPA--MYIDGDRIDNPDRVPSSIVDL 179
>gi|39938501|ref|NP_950267.1| translation factor [Onion yellows phytoplasma OY-M] >gi|39721610|dbj|BAD04100.1| translation factor [Onion yellows phytoplasma OY-M] (185 aa)
Score = 148, Expect = 3.2e-08, Identities = 62/156 (39%), Positives = 87/156 (55%)
  Q:    56 IVSTDTVSGL---LSLNKPL--IYKIKKRDKNKKLIRFVSNLDQ---IPEVNETFKKLASKFWPGKLTLIY------------KKESYRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQP-----STIYDIDT--NTLKREGEIKYEWIKKTIE 211
           I  TDTV G+   L   K L  IY+IKKR  NK ++   ++L Q   + + +    KLA  FWPG LTLI             K    R+P+    L ++ K GPL ++S N S +PP+    D    FN Y + +  I    YQN  P     STI D+ T    + R+G I  E I + ++
  S:     8 IFPTDTVYGMGAKLYDKKGLNCIYQIKKRPLNKSIVVLCASLQQAKKLVQFSPQSLKLALHFWPGPLTLILPTTLKYFSKTKAKTLGIRIPNHPLALEILKKNGPLKTTSVNQSNHPPLN---DYQTIFNIYYNKVALI----YQNYHPILKISSTIVDLTTFQPVILRQGTITQEEILQILK 183
>gi|116671163|ref|YP_832096.1| translation factor SUA5 [Arthrobacter sp. FB24] >gi|116611272|gb|ABK03996.1| translation factor SUA5 [Arthrobacter sp. FB24] (245 aa)
Score = 148, Expect = 3.6e-08, Identities = 54/162 (33%), Positives = 87/162 (53%)
  Q:    49 IKNLKAAIVSTDTVSGLLS---LNKPLIYKIKKRDKNKK-----LIRFVSNLDQIP-EVNETFKKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAF----ESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLK--REGEIKYEWIKKTI 210
           I+  K  +  TDTV G+ +     + +   +  + +++K     LI  ++ LD +  +V    +KLA  FWPG LT+I+  +              + RMP D    +L+  TGPL  SSAN +G P      +A     ES   Y    +  +GD   +  PSTI D     L+  R+G I  E +++ +
  S:    24 IRQHKCVVFPTDTVYGIGADAFSPQAVTLLLASKGRSRKMPPPVLIPRLNALDGLATDVPAEARKLAEAFWPGGLTMIFHAQPSLDWDLGETKGTVALRMPADDVAQDLLTLTGPLAVSSANRTGQPAARTAAEAMTQLAESVEVYLEGGLRPDGDADADALPSTIVDATALPLRVVRQGAISVERLREVV 214
>gi|76788852|ref|YP_327938.1| sua5/YciO/YrdC/YwlC family protein [Chlamydia trachomatis A/HAR-13] >gi|76167382|gb|AAX50390.1| sua5/YciO/YrdC/YwlC family protein [Chlamydia trachomatis A/HAR-13] (281 aa)
Score = 148, Expect = 3.8e-08, Identities = 51/152 (33%), Positives = 82/152 (53%)
  Q:    59 TDTVSGL------LSLNKPLIYKIKKRDKNKKLIRFVSNLDQIPEVNE-----TFKKLASKFWPGKLTLIYKKESYRMP---------DDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKREGEIKYEWIKKTI 210
           TDTV GL      L  ++ L + +K R   K L  +VS+L+++  V +     + +K+  KF PG LTLI K  + R P         +   +  +I K GP  ++SANLSG P   +  +  + F   + DI+ I G+     + ST+ D +   + RE  I    I+  +
  S:    20 TDTVYGLGVSFHILDADQRL-FALKHRSSQKALSVYVSSLEELEAVAQQSLGASSRKIIQKFLPGPLTLITKHNNPRFPQKTLGFRIVNHPIVQQIIQKVGPFLATSANLSGFPSAVSADEVKQDFP--EEDIVMISGECSIGLE-STVIDPEERIVYRESAISIAEIETVL 187
>gi|15604856|ref|NP_219640.1| SuA5 superfamily-related protein [Chlamydia trachomatis D/UW-3/CX] >gi|3328537|gb|AAC67728.1| SuA5 Superfamily-related Protein [Chlamydia trachomatis D/UW-3/CX] (281 aa)
Score = 148, Expect = 3.8e-08, Identities = 51/152 (33%), Positives = 82/152 (53%)
  Q:    59 TDTVSGL------LSLNKPLIYKIKKRDKNKKLIRFVSNLDQIPEVNE-----TFKKLASKFWPGKLTLIYKKESYRMP---------DDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKREGEIKYEWIKKTI 210
           TDTV GL      L  ++ L + +K R   K L  +VS+L+++  V +     + +K+  KF PG LTLI K  + R P         +   +  +I K GP  ++SANLSG P   +  +  + F   + DI+ I G+     + ST+ D +   + RE  I    I+  +
  S:    20 TDTVYGLGVSFHILDADQRL-FALKHRSSQKALSVYVSSLEELEAVAQQSLGASSRKIIQKFLPGPLTLITKHNNPRFPQKTLGFRIVNHPIVQQIIQKVGPFLATSANLSGFPSAVSADEVKQDFP--EEDIVMISGECSIGLE-STVIDPEERIVYRESAISIAEIETVL 187
>gi|15643615|ref|NP_228661.1| hypothetical protein TM0852 [Thermotoga maritima MSB8] >gi|4981386|gb|AAD35934.1|AE001752_1 conserved hypothetical protein [Thermotoga maritima MSB8] (335 aa)
Score = 148, Expect = 3.9e-08, Identities = 58/164 (35%), Positives = 91/164 (55%)
  Q:    49 IKNLKAAIVSTDTVSGL--LSLNKPL---IYKIKKRDKNKKLIRFVSNLDQIPEVNETFK---KLASKFWPGKLTLIYKKES---------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDI--DTNTLKREGEIKYEWIKKTIEE 212
           ++N +  I  T+TV G+   + N+     I+K+K+R  +  LI  + +  Q+ E+ E ++       KFWPG LT+I++K+S                RMP     L LI+  G P+ + SAN+SG P  TN+    E F   K  +I   GD       STI D+  +   L R G ++ E +K+   E
  S:    24 LRNGEVIIFPTETVYGIGADAYNEEACKKIFKLKERPADNPLIVHIHSFKQLEEIAEGYEPHLDFLKKFWPGPLTVIFRKKSEKIPPVVTADLPTVAVRMPAHPVALKLIELFGHPIAAPSANISGRPSATNVKHVIEDFMG-KVKLIIDAGD-TPFGLESTIVDLTKEKPVLLRPGPVEVERLKELFPE 211
>gi|19552426|ref|NP_600428.1| putative translation factor (SUA5) [Corynebacterium glutamicum ATCC 13032] >gi|62390090|ref|YP_225492.1| putative translation factor (SUA5) [Corynebacterium glutamicum ATCC 13032] >gi|21323969|dbj|BAB98595.1| Putative translation factor (SUA5) [Corynebacterium glutamicum ATCC 13032] >gi|41325426|emb|CAF19906.1| Putative translation factor (SUA5) [Corynebacterium glutamicum ATCC 13032] (216 aa)
Score = 148, Expect = 3.9e-08, Identities = 52/172 (30%), Positives = 90/172 (52%)
  Q:    39 SSNLNGIVFEIKNLKAAIVSTDTVSGL--LSLNKPLIYKI---KKRDKNKKLIRFVSNLDQIPEVNETF----KKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLK--REGEIKYEWIKKTI 210
           ++ L   V  +K  +  ++ TDT+ GL   + N   +  +   K R  +  +   V + D I  +  ++    K L   FWPG L++I  +                 RMP     + L+ +TGP+  SSAN+SG+ P T +++A +  N+  +  ++++G       PSTI DI     K  REG I  E + + +
  S:    14 AAGLKAAVDAVKAGQLVVLPTDTLYGLGCDAFNNEAVANLLATKHRGPDMPVPVLVGSWDTIQGLVHSYSAQAKALVEAFWPGGLSIIVPQAPSLPWNLGDTRGTVMLRMPLHPVAIELLRQTGPMAVSSANISGHTPPTTVLEARQQLNQNVA--VYLDGGECALATPSTIVDISGPAPKILREGAISAERVGEVL 208
>gi|161528935|ref|YP_001582761.1| Sua5/YciO/YrdC/YwlC family protein [Nitrosopumilus maritimus SCM1] >gi|160340236|gb|ABX13323.1| Sua5/YciO/YrdC/YwlC family protein [Nitrosopumilus maritimus SCM1] (198 aa)
Score = 147, Expect = 4.8e-08, Identities = 55/153 (35%), Positives = 85/153 (55%)
  Q:    56 IVSTDTVSGL-----LSLNKPLIYKIKKRDKNKKLIRFVSNLD---QIPEVNETFKKLASKFWPGKLTL--------------IYKKESYRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLK--REGEIKYEWIKK 208
           I  TDTV G+        +   +Y+IK RD +K     V + +   QI E +E  +KL  KFWPG+LT+              +  K + R+P+ K  L+L++K   L  +SAN+SG P   +  +  +S   Y    +F++G    +   STI  I+   +K  REG +  E I K
  S:    24 IFPTDTVYGIGCNPYSKESAKKVYEIKSRDFSKPFPVLVYSKEIASQIAEFDEISEKLVEKFWPGQLTILLKLKDEKLKESLNLSDKIALRVPNHKCTLSLLEKCHYLIGTSANVSGQPSFFDPQECIKSVENYD---VFVDGGTITSKGESTIIAIEDGKIKIIREGSLSKEEILK 197
>gi|15835032|ref|NP_296791.1| hypothetical protein TC0414 [Chlamydia muridarum Nigg] >gi|7190456|gb|AAF39270.1| conserved hypothetical protein [Chlamydia muridarum Nigg] (280 aa)
Score = 147, Expect = 5.3e-08, Identities = 51/153 (33%), Positives = 86/153 (56%)
  Q:    59 TDTVSGL-LSLNKP----LIYKIKKRDKNKKLIRFVSNLDQIPEV-----NETFKKLASKFWPGKLTLIYKKES---------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKREGEIKYEWIKKTIE 211
           TDTV GL +S   P     ++ +K+R+  K L  +VS+L+++  V      E   K+A KF PG LTLI K  +         +R+ +   +  +I + GPL ++SAN+SG P   +  +  + F   + DI+ I G      + ST+ D +   + REG +    I+  ++
  S:    19 TDTVYGLGVSFLIPEADKQLFALKRRNPQKALSVYVSSLEELEYVAQRRLGEASIKIAQKFLPGPLTLITKHNNPRFSQKTLGFRIVEHPIVKQIIQEVGPLLATSANVSGFPSAVSSDEVKQDFP--EKDILVISGTCSIGLE-STVVDAEERIIYREGVVSAAEIEDVLQ 187
>gi|52548883|gb|AAU82732.1| conserved hypothetical protein [uncultured archaeon GZfos19C7] (224 aa)
Score = 146, Expect = 6.4e-08, Identities = 56/154 (36%), Positives = 92/154 (59%)
  Q:    49 IKNLKAAIVSTDTVSGLLS-----LNKPLIYKIKKRDKNKKLIRFVSNLDQIPEV----NETFKKLASKFWPGKLTLIYKKESY--------------RMPDDKFILNLIDKTGPLYSSSANLSG-NPPITNIIDAFESFNKYKSDI--IFIEGDYYQNNQPSTIYDIDT--NTLKREGEIK 202
           IKN    +  T+TV GL +          +YKIK+RD ++ +   VS+ + + EV    +E F+ +A +  PG +T++ +K+                R PD++    +I +TGP+ ++SAN+SG NPP    I+  E   K K ++  I I G   + + PST+ D+     T   +GEIK
  S:    16 IKNGGMVVYPTETVYGLGADAFSEAAVRNVYKIKRRDLSRPISIAVSSFEMLHEVADIDSECFEIIA-ELLPGPVTILLRKKDVVPAILTAASEVVGVRFPDNEIATRIIKETGPITATSANVSGRNPP--TCIEEVEVELKLKVELLGIIINGGKCKYSMPSTVVDMSKVGATANEKGEIK 194
>gi|15896136|ref|NP_349485.1| translation factor (SUA5) [Clostridium acetobutylicum ATCC 824] >gi|15025929|gb|AAK80825.1|AE007785_10 Predicted translation factor (SUA5) [Clostridium acetobutylicum ATCC 824] (350 aa)
Score = 146, Expect = 6.7e-08, Identities = 60/164 (36%), Positives = 93/164 (56%)
  Q:    49 IKNLKAAIVSTDTVSGLLSLNK-----PLIYKIKKRDKNKKLIRFVSNLDQIPEV----NETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTN--TLKREGEIKYEWIKKTIEE 212
           IKN K  +  T+TV GL +  +       I++ K R ++  LI  +S+ + + +V    +++ +KL  +FWPG +TLI +K+S               RMP DK    LI  +G  + + SANLSG P  T++    E  N  K D I I G+  +    ST+ D   N   + R G I  E ++K  E+
  S:    25 IKNGKLVVFPTETVYGLGANAEDGEATKKIFEAKGRPQDNPLIIHISDFEDVDKVVRNISDSARKLMREFWPGPMTLIMEKKSIISDVTSAGLTSVGVRMPSDKIARKLIKFSGVSIAAPSANLSGKPSPTDVERCIEDLNG-KVDYI-IGGNKCEYGLESTVIDCTVNPVCILRPGAITLEMVRKVDEK 212
>gi|68536429|ref|YP_251134.1| hypothetical protein jk1344 [Corynebacterium jeikeium K411] >gi|68264028|emb|CAI37516.1| conserved hypothetical protein [Corynebacterium jeikeium K411] (219 aa)
Score = 146, Expect = 6.8e-08, Identities = 38/116 (32%), Positives = 63/116 (54%)
  Q:    95 IPEVNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDI-IFIEGDYYQNNQPSTIYDIDTNTLK--REGEIKYEWIKKTI 210
           + E     +KL   FWPG L+++  +                 RMP+    L L+++TGP+  SSAN+SG PP TN+  A +      +D+  +I+G    +   STI D+ +   +  REG    E + + +
  S:    79 VREYTYNMRKLVEAFWPGGLSMVVHQAPSLPWNLGDTRGTVMLRMPNQPIALELLERTGPMAVSSANISGQPPATNVQMAEDQLG---ADVTTYIDGGEAHHGVASTIVDLSSGRPRILREGAATTERVAEVL 208
>gi|91202678|emb|CAJ72317.1| similar to YrdC protein [Candidatus Kuenenia stuttgartiensis] (210 aa)
Score = 145, Expect = 7.5e-08, Identities = 46/132 (34%), Positives = 79/132 (59%)
  Q:    59 TDTVSGL-LSLNKP----LIYKIKKRDKNKKLIRFVSNLDQIP----EVNETFKKLASKFWPGKLTLIYKKES-----YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFI-EGDYYQNNQPSTIYDI 190
           T+TV GL +  + P     +Y+ KKR   K+L   ++++ ++      V++  K+L   FWPG L +I+  +       R+PD+    +LI     P+ ++SAN SG+PP T   DA +    +K +I FI +G    +++PST+  I
  S:    41 TETVYGLGVHKDNPEAIERLYEAKKRPAEKRLTLMIADIGEVELYAGAVSDVAKRLMESFWPGPLAIIFPLKDGSDICVRLPDNAIARDLIRTANIPVATTSANTSGHPPST---DASQVTAYFKDEIDFILDGGPTPSHEPSTVVKI 185
>gi|196189166|gb|EDX84130.1| hypothetical protein S7335_1827 [Synechococcus sp. PCC 7335] (241 aa)
Score = 145, Expect = 7.9e-08, Identities = 44/105 (41%), Positives = 66/105 (62%)
  Q:    53 KAAIVS--TDTVSGLLSL--NKPLIYKIKKRDKNKKLIRFVSNL-DQIPEVN------ETFKKLASKFWPGKLTLIYKKESY-------------------RMPDDKFILNLIDKTGPLYSSSANLSGNPPITNI 157
           + A+VS  TDTV  L +      LI+  K+R   K LI   ++L D +P V+        ++ +A ++WPG+LTL+                         R+PD    L L+ +TGPL ++SANLSG P +T I
  S:    59 RPALVSFPTDTVPALAAAPSQADLIFAAKQRPPEKPLILMGASLGDLLPYVSGQDSAMAAWQSIAEQYWPGQLTLVLPASDLAPKNLNPHPTDQTAGTLGIRVPDHPVALALLSQTGPLATTSANLSGQPALTEI 193
>gi|157412681|ref|YP_001483547.1| putative translation factor (SUA5) [Prochlorococcus marinus str. MIT 9215] >gi|157387256|gb|ABV49961.1| Putative translation factor (SUA5) [Prochlorococcus marinus str. MIT 9215] (193 aa)
Score = 145, Expect = 8.1e-08, Identities = 49/102 (48%), Positives = 66/102 (64%)
  Q:    49 IKNLKAA---IVSTDTVS--GLLSLNKPLIYKIKKRDKNKKLIRFVSNLDQ-IPEVNETFKK----LASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSG 150
           +K LK+    I  TDT+   G L     +IY+ KKRDK+K LI   +   Q I  VNE+ KK    +ASK+WPG LT++                    R+P+     +LI +TGPL +SSANLSG
  S:    10 LKTLKSGLPIIFPTDTLPAIGCLPEFSNIIYEFKKRDKDKPLILMGAEHKQLIDYVNESAKKDYENIASKYWPGALTMVIPASETHTTIITSNDLTLGLRIPNSYMAQSLIRETGPLLTSSANLSG 135
>gi|148269220|ref|YP_001243680.1| Sua5/YciO/YrdC/YwlC family protein [Thermotoga petrophila RKU-1] >gi|147734764|gb|ABQ46104.1| translation factor SUA5 [Thermotoga petrophila RKU-1] (335 aa)
Score = 145, Expect = 8.9e-08, Identities = 60/175 (34%), Positives = 93/175 (53%)
  Q:    38 DSSNLNGIVFEIKNLKAAIVSTDTVSGL--LSLNKPL---IYKIKKRDKNKKLIRFVSNLDQIPEVNETFK---KLASKFWPGKLTLIYKKES---------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESF-NKYKSDIIFIEGDYYQNNQPSTIYDI--DTNTLKREGEIKYEWIKKTIEE 212
           D   L   V  ++N +  I  T+TV G+   + N+     I+++K R  +  LI  + + DQ+ E+ E ++       KFWPG LT+I +K+S                RMP     L LI+  G P+ + SANLSG P  TN+    E F  K K   + I+         STI D+  +   L R G ++ E +++   E
  S:    13 DEEVLKEAVELLRNGEVIIFPTETVYGIGADAYNEEACRKIFELKGRPTDNPLIVHIHSFDQLEEIAEGYEAHLDFLKKFWPGPLTVILRKKSEKIPLVVTAGLSTVAVRMPAHPVALKLIELFGNPIAAPSANLSGRPSATNVQHVIEDFMGKVK---LIIDAGNTPFGLESTIVDLTKEKPVLLRPGPVEVERLRELFPE 211
>gi|125717979|ref|YP_001035112.1| hypothetical protein SSA_1154 [Streptococcus sanguinis SK36] >gi|125497896|gb|ABN44562.1| Conserved hypothetical protein [Streptococcus sanguinis SK36] (196 aa)
Score = 144, Expect = 9.3e-08, Identities = 53/153 (34%), Positives = 86/153 (56%)
  Q:    54 AAIVSTDTVSGLLS--LNKPLI---YKIKKRDKNKKLIRFVSNLDQIPEVNET----FKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDI--DTNTLKREGEIKYEWI 206
           A ++ T+TV GL +  LN+  +   Y++K+R ++K L   V+++++I   ++      K+L   F PG LT+I +                 +R+P     L+LI K GPL   SANLSG    T+       F   + +I  +E D     Q STI D+  +   + R+G I  E+I
  S:    13 AVVLPTETVYGLFAQALNEEAVERVYELKRRPRDKALNLNVASIEEIYAFSKNQPSYLKQLYQAFLPGPLTIILQANDRVPTWINSGMETVGFRIPKHPVTLDLIRKYGPLIGPSANLSGKASGTSFQQIMMDF---QEEISGVEDDASLTGQDSTILDLSGEKALILRQGAITREYI 187
>gi|154509271|ref|ZP_02044913.1| hypothetical protein ACTODO_01796 [Actinomyces odontolyticus ATCC 17982] >gi|153798905|gb|EDN81325.1| hypothetical protein ACTODO_01796 [Actinomyces odontolyticus ATCC 17982] (224 aa)
Score = 144, Expect = 1.0e-07, Identities = 48/147 (32%), Positives = 77/147 (52%)
  Q:    48 EIKNLKAAIVSTDTVSGL--LSLNKPLIYKI---KKRDKNKKLIRFVSNLDQIP----EVNETFKKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNT 194
           E+++    +V TDTV G+   + N   +  +   K R +       V+++D I     ++ E  + LA  FWPG LTLI +                  RMP+   +L L+   GP+  +SANL+G PP T++  A   F    S   +++G   Q +  S+I D    T
  S:    27 ELRDGHLLVVPTDTVYGIGADAANPEAVAAVLAAKGRGRQMPPPVLVASVDAIDLLCVDIPEAARALARAFWPGGLTLILRARPDLGWDLGETGGTIGVRMPNQAALLRLLHDFGPMAVTSANLTGQPPATSVEQAVGYFGTRVS--AYLDGGPTQGSTASSIVDFAHET 194
>gi|25027862|ref|NP_737916.1| hypothetical protein CE1306 [Corynebacterium efficiens YS-314] >gi|23493145|dbj|BAC18116.1| conserved hypothetical protein [Corynebacterium efficiens YS-314] (216 aa)
Score = 144, Expect = 1.1e-07, Identities = 53/175 (30%), Positives = 90/175 (51%)
  Q:    36 EKDSSNLNGIVFEIKNLKAAIVSTDTVSGL--LSLNKPLIYKI---KKRDKNKKLIRFVSNLDQIPEV----NETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDT--NTLKREGEIKYEWIKKTI 210
           E   + L   V  +K  +  ++ TDT+ GL   + N   +  +   K R  +  +   V + D I  +    +E  + L   FWPG L++I  +                 RMP     + L+ +TGP+  SSAN+SG+ P + + +A +  N+  S  ++++G      +PS+I DI      L REG I  E I + +
  S:    11 ESRVAGLKAAVDAVKAGQLVVLPTDTLYGLGCDAFNNQAVANLLATKHRGPDMPVPVLVGSWDTIQGLVQHYSEQARTLVQAFWPGGLSIIVPQAPSLPWNLGDTRGTVMLRMPLHPVAIELLRETGPMAVSSANISGHTPPSTVTEARQQLNQNVS--VYLDGGECAIGKPSSIIDISGPHPKLLREGAISAERIGEVL 208
>gi|123965586|ref|YP_001010667.1| putative translation factor (SUA5) [Prochlorococcus marinus str. MIT 9515] >gi|123199952|gb|ABM71560.1| Putative translation factor (SUA5) [Prochlorococcus marinus str. MIT 9515] (193 aa)
Score = 144, Expect = 1.1e-07, Identities = 50/117 (42%), Positives = 69/117 (58%)
  Q:    56 IVSTDTVSGLLSLNK--PLIYKIKKRDKNKKLIRFVSNLDQIPE-----VNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDII 172
           I  TDT+  +  L K   +IYKIK+RD  K LI   +   Q+ E       E +K +AS++WPG LT+I                    R+P+      LI ++GPL +SSAN+SG PP TN  D   SF+    DI+
  S:    20 IFHTDTLPAIGCLPKFSEIIYKIKQRDVKKPLILMGAESFQLNEFVHKTAFEDYKYMASRYWPGPLTMIIPISEKSKPLFSNKNLTLGLRIPNSIMANYLIKESGPLLTSSANISGLPPSTNAKDI--SFDLPNVDIL 155
>gi|163811567|ref|ZP_02203252.1| Sua5/YciO/YrdC/YwlC family protein [Dehalococcoides sp. VS] >gi|157404879|gb|EDO70914.1| Sua5/YciO/YrdC/YwlC family protein [Dehalococcoides sp. VS] (213 aa)
Score = 144, Expect = 1.2e-07, Identities = 54/161 (33%), Positives = 91/161 (56%)
  Q:    49 IKNLKAAIVSTDTVSGLLSLNKPL-----IYKIKKRDKNKKLIRFVSNLDQIPEVNETF----KKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFI-EGDYYQNNQPSTIYDIDTNTLK--REGEIKYEWIKKT 209
           +K     I  TDTV  + +L +       ++ IK R   K L   + ++ QI +V + F    +KLA+++WPG LTL+  K               + R+P+   ++ ++ + G P+  +SANLSG     + ++A E+ ++    + FI +G        STI  ++ N LK  R+G IK   I KT
  S:    21 LKEGGVVIFPTDTVYAVGALARNTHAVNRVFDIKGRANTKGLPALIGDVSQINQVAKVFPELARKLAAEYWPGGLTLVLPKTNNIPLELTGGNETVAIRIPNQPAVIEMLKRIGEPITGTSANLSG---CKSSLNAAEARSQLGDRVDFILDGGQVSGGVESTIVAVNNNELKIIRQGAIKEADILKT 205
>gi|52548507|gb|AAU82356.1| putative translation factor [uncultured archaeon GZfos17A3] (241 aa)
Score = 143, Expect = 1.2e-07, Identities = 59/178 (33%), Positives = 104/178 (58%)
  Q:    25 KNYPKKEFVTYEKDSSNLNGIVFEIKNLKAAI-------VSTDTVSGLLS-----LNKPLIYKIKKRDKNKKLIRFVSN---LDQIPEVNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSG-NPPITNIIDAFESFNKYKSDI-IFIEGDYYQNNQPSTIYDIDT--NTLKREGEIK 202
           + YP+    TY K  +++N I  +I+   A I         T+TV GL +          +YKIK+R   + +   VS+   L ++ +++  + ++ ++  PG +T+++KK+                R PD++    +I +TGP+ ++SAN+SG NPP    I+  E   K K ++ I I G   + + PST+ D+     T   +GEIK
  S:     4 QTYPENLNPTY-KMQNDINDIEDQIRTATAIIKHGGMVVYPTETVYGLGADAFSEAAVRNVYKIKRRAATQPISIAVSSFEMLHEVADIDSEYVEIIAELLPGPVTILFKKKDIVPAILTAASEVIGVRFPDNEIATRIIKETGPITATSANVSGRNPP--TCIEEVEVELKLKVELGIIINGGKCKYSMPSTVVDMSKAGATANEKGEIK 211
>gi|42526970|ref|NP_972068.1| Sua5/YciO/YrdC/YwlC family protein [Treponema denticola ATCC 35405] >gi|41817394|gb|AAS11979.1| Sua5/YciO/YrdC/YwlC family protein [Treponema denticola ATCC 35405] (184 aa)
Score = 143, Expect = 1.3e-07, Identities = 52/140 (37%), Positives = 76/140 (54%)
  Q:    33 VTYEKDSSNLNGIVFEIKNLKAAIVSTDTV---SGLLSLNKPLIYKIKKRDKNKKLIRFVSNLDQIPEVNET-FKKLASKFWPGKLTLIYKKE------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDII 172
           V  +KD  +L      +K  +  IV TDTV   SG++   K  I KIKKR   K  I  +     I +  +T   ++    WP  L++I K +      ++R PDD ++ NLI KTG P+YS+S N SG P +++I D    F    S I+
  S:     2 VILKKDPKSLETAASVLKKGEIIIVPTDTVYGFSGIMPFTKEKIIKIKKRGAEKSFISLIEKPQDIYKYTDTPVPEILLNLWPAPLSIIVKDKEGRGTSAFRCPDDVWLRNLIGKTGFPIYSTSVNYSGEPVLSDIRDIISEFEDKVSLIV 152
>gi|168333894|ref|ZP_02692132.1| hypothetical protein Epulo_03232 [Epulopiscium sp. 'N.t. morphotype B'] (334 aa)
Score = 143, Expect = 1.3e-07, Identities = 63/172 (36%), Positives = 96/172 (55%)
  Q:    39 SSNLNGIVFEIKNLKAAIVSTDTVSGLLS--LNKPL---IYKIKKRDKNKKLIRFVSNL---DQ-IPEVNETFKKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDI--DTNTLKREGEIKYEWIKKTI 210
           + NL   +  +KN    +  T+TV GL +  L++     I+K K R  +  LI  +++L   DQ + E++   +KL   FWPG LTLI+K +              + R P++K I+ LI K+  PL + SAN SG P  TNI    E     K D I I+G   +    ST+ D+  D   + R G I    ++K +
  S:     9 TDNLELAINILKNGGLVVSPTETVYGLCANALDENAVENIFKAKGRPADNPLIVHIASLAMLDQLVAEISANAQKLIDAFWPGPLTLIFKSQNIIPNKTRANLQTVAIRFPENKIIIELIKKSKLPLAAPSANTSGKPSPTNIDRVIEDLFG-KVDCI-IDGGNCKIGLESTVVDVSGDNARILRPGFITAAMLEKIV 204
>gi|147919401|ref|YP_686860.1| YrdC family translation factor [uncultured methanogenic archaeon RC-I] >gi|110622256|emb|CAJ37534.1| putative translation factor (YrdC family) [uncultured methanogenic archaeon RC-I] (192 aa)
Score = 142, Expect = 1.6e-07, Identities = 54/158 (34%), Positives = 91/158 (57%)
  Q:    52 LKAAIVS--TDTVSGLLSLNKPL-----IYKIKKRDKNKKLIRFVSNLDQIPEVNETFK-KLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTGPLYSSSANLSGNP-PITNIIDAFESFNKYKSDIIFIEGDYY------QNNQPSTIYDIDTNTLKREGEIK---YEWIKKT 209
           LK  +++  T+TV G+ +L   +     ++K+K+R ++  L   VS+++ + EV E        KF PG +T+I +K+                R PD    L+LI +TGP+ S+SANL G P P+T             +D + +E DY       +    STI D+    + R+G +     E+++KT
  S:    15 LKGGVIAYPTETVYGIGALATDVKAISRVFKVKRRPESMPLSIAVSSIEMLQEVAEIVHPDFIEKFLPGPVTVILRKKPVLPDSLTAGSDYVGIRFPDHPVALDLIRRTGPIVSTSANLHGEPDPVT-------------ADEVTVEVDYLLEGGRAKYAGSSTIVDLREYKVLRKGAMYDEVEEYMRKT 191
>gi|89897678|ref|YP_521165.1| hypothetical protein DSY4932 [Desulfitobacterium hafniense Y51] >gi|89337126|dbj|BAE86721.1| hypothetical protein [Desulfitobacterium hafniense Y51] (348 aa)
Score = 142, Expect = 1.7e-07, Identities = 49/140 (35%), Positives = 79/140 (56%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQIPEVNETFKKLAS----KFWPGKLTLIYKKESY--------------RMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDI--DTNTLKREGEIKYEWIKKTIEE 212
           I+K+K R ++  LI  +S+L  +  + E +   A+    KFWPG LTL+ +K ++              RMP     L LI + G P+ + SANLSG P  T  I  ++   K K  +I ++G        ST+ D+  +  T+ R G I  E +++ + E
  S:    54 IFKVKGRPQDNPLIVHISDLAMVKRLVEEWTPQAALCADKFWPGPLTLVLEKTAFVPDVVSGGLGTVAIRMPKHPVALELIKEAGVPIAAPSANLSGKPSPTQGIHVWKDL-KGKIPLI-LDGGPCAVGVESTVLDLTDEVPTILRPGGITKEQLEEVLGE 212
>gi|109648007|ref|ZP_01371910.1| Sua5/YciO/YrdC/YwlC family protein [Desulfitobacterium hafniense DCB-2] >gi|109641097|gb|EAT50652.1| Sua5/YciO/YrdC/YwlC family protein [Desulfitobacterium hafniense DCB-2] (351 aa)
Score = 142, Expect = 1.7e-07, Identities = 49/140 (35%), Positives = 79/140 (56%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQIPEVNETFKKLAS----KFWPGKLTLIYKKESY--------------RMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDI--DTNTLKREGEIKYEWIKKTIEE 212
           I+K+K R ++  LI  +S+L  +  + E +   A+    KFWPG LTL+ +K ++              RMP     L LI + G P+ + SANLSG P  T  I  ++   K K  +I ++G        ST+ D+  +  T+ R G I  E +++ + E
  S:    57 IFKVKGRPQDNPLIVHISDLAMVKRLVEEWTPQAALCADKFWPGPLTLVLEKTAFVPDVVSGGLGTVAIRMPQHPVALELIKEAGVPIAAPSANLSGKPSPTRGIHVWKDL-KGKIPLI-LDGGPCAVGVESTVLDLTGEVPTILRPGGITKEQLEEVLGE 215
>gi|85057289|ref|YP_456205.1| translation factor SUA5 protein [Aster yellows witches'-broom phytoplasma AYWB] >gi|84789394|gb|ABC65126.1| translation factor SUA5 protein [Aster yellows witches'-broom phytoplasma AYWB] (196 aa)
Score = 142, Expect = 1.8e-07, Identities = 61/155 (39%), Positives = 84/155 (54%)
  Q:    56 IVSTDTVSGL---LSLNKPL--IYKIKKRDKNKKLIRFVSNLDQ---IPEVNETFKKLASKFWPGKLTLIYKKES------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQP-----STIYDIDT--NTLKREGEIKYEWIKKTI 210
           I  TDTV G+   L   K L  IY+IKKR  NK ++   S+L Q   + + +    KLA  FWPG LT +    S             R+P+    L ++ K GPL ++S N S +PP+    D    FN Y + +  I    Y+N  P     STI D+ T    + R+G I  E I   I
  S:     8 IFPTDTVYGMGAKLYDKKGLNYIYQIKKRPLNKSIVVLCSSLQQAKKLVQFSPQNLKLALHFWPGPLTFVLPTTSKYFSKTKEKTLGVRIPNHPLTLEILKKNGPLKTTSVNQSNHPPLN---DYQTIFNIYHNKVALI----YKNYHPILKISSTIVDLTTFQPVILRQGTITQEEISSQI 182
>gi|119961897|ref|YP_948325.1| putative Sua5/YciO/YrdC/YwlC family protein [Arthrobacter aurescens TC1] >gi|119948756|gb|ABM07667.1| putative Sua5/YciO/YrdC/YwlC family protein [Arthrobacter aurescens TC1] (304 aa)
Score = 142, Expect = 2.0e-07, Identities = 55/162 (33%), Positives = 85/162 (52%)
  Q:    49 IKNLKAAIVSTDTVSGLLS-----LNKPLIYKIKKRDKNKK---LIRFVSNLDQIP-EVNETFKKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYY----QNNQPSTIYDIDTNTLK--REGEIKYEWIKKTI 210
           I   K  ++ TDTV G+ +     L   ++   K R +      LI  V+ LD +  +V    + LA  FWPG LTLI   +              + RMPDD+  L L+  TGPL  SSAN +G        +A       +S  +++EG +         PSTI D  +   +  R+G I+ E +++ +
  S:    24 ISEKKCIVLPTDTVYGIAADAFSPLAVTMLLASKGRSRQMPPPVLIPRVNALDGLATDVPADARALAQAFWPGGLTLILHAQPSLDWDLGDTKGTVALRMPDDQIALELLGLTGPLAVSSANRTGQEAAQTASEA--RLQLAESVEVYLEGGFRPIKGTAALPSTIVDATSTPFRVVRQGAIELERLREIV 212
>gi|33860877|ref|NP_892438.1| hypothetical protein PMM0319 [Prochlorococcus marinus subsp. pastoris str. CCMP1986] >gi|33633819|emb|CAE18778.1| conserved hypothetical protein [Prochlorococcus marinus subsp. pastoris str. CCMP1986] (194 aa)
Score = 142, Expect = 2.0e-07, Identities = 47/101 (46%), Positives = 66/101 (65%)
  Q:    56 IVSTDTVSGLLSLNK--PLIYKIKKRDKNKKLIRF-VSNLDQIPEVNET----FKKLASKFWPGKLTLIY----KKESY----------RMPDDKFILNLIDKTGPLYSSSANLSGNPPITN 156
           +  TDT+  +  L K   +IYKIKKRD  K LI     N +    V+E+    FK +AS +WPG LT+I     K+ S+          R+P+ K    L+ ++GPL +SSANLSG P  T+
  S:    20 VFQTDTLPAIGCLPKFSEMIYKIKKRDIKKPLILMGAENFEFDDFVHESALGDFKYIASCYWPGPLTIIIPCSEKRRSFSSTSNFTLGLRIPNSKMAKLLLKESGPLLTSSANLSGLPTATS 141
>gi|171853610|emb|CAM11481.1| Translation factor [Candidatus Phytoplasma australiense] (188 aa)
Score = 141, Expect = 2.4e-07, Identities = 62/153 (40%), Positives = 87/153 (56%)
  Q:    56 IVSTDTVSGL---LSLNKPL--IYKIKKRDKNKKLIRFVSNLDQ---IPEVNETFKKLASKFWPGKLTLIYKKES------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTL--KREGEIKYEWIKK 208
           I  TDTV G+   L   K L  IY++KKR   K +I   S+L +   + + NE   +LA+KF+PG LTLI K ++             R+P+    L+L+ K GPL ++S N SG  P+      ++ +N  K   I+   DY      STI D  TN L   R+G I    IKK
  S:    12 IFPTDTVYGMGVSLYDEKGLKEIYQLKKRSLQKNIIVLCSSLKEAQTLVKFNEISYQLATKFFPGPLTLILKTQTSYLKKTGQKTLGIRIPNHPLALSLLKKYGPLKTTSVNESGKEPLNYYNTIYQMYNN-KVGFIY-PNDYPILKVASTIVDATTNKLIVLRQGSISEAEIKK 184
>gi|147669398|ref|YP_001214216.1| translation factor SUA5 [Dehalococcoides sp. BAV1] >gi|146270346|gb|ABQ17338.1| translation factor SUA5 [Dehalococcoides sp. BAV1] (213 aa)
Score = 141, Expect = 2.4e-07, Identities = 55/168 (32%), Positives = 93/168 (55%)
  Q:    42 LNGIVFEIKNLKAAIVSTDTVSGLLSLNKPL-----IYKIKKRDKNKKLIRFVSNLDQIPEVNETF----KKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFI-EGDYYQNNQPSTIYDIDTNTLK--REGEIKYEWIKKT 209
           +N  V  +KN    I  TDTV  + +L +       ++ IK R   K L   + ++ QI +V + F    +KLA+++WPG LTL+  K               + R+P+   ++ ++ +   P+  +SANLSG     + ++A E+  +    + FI +G        STI  ++ + LK  R+G IK   I KT
  S:    14 INRAVQVLKNGGVVIFPTDTVYAVGALARNTHAVNRVFDIKGRANTKGLPALIGDISQIHQVAKIFPLLARKLAAEYWPGGLTLVLPKTDNIPLELTGGNETVAIRIPNQAAVIEMLKRVAEPVTGTSANLSG---CKSSLNASEAKIQLGDRVDFILDGGQVSGGVESTIVAVNNDELKIIRQGAIKESDILKT 205
>gi|148361313|ref|YP_001252520.1| Sua5/YciO/YrdC/YwlC family protein [Legionella pneumophila str. Corby] >gi|148283086|gb|ABQ57174.1| SUA5/yciO/yrdC family:Sua5/YciO/YrdC/YwlC protein family [Legionella pneumophila str. Corby] (322 aa)
Score = 141, Expect = 2.5e-07, Identities = 57/172 (33%), Positives = 96/172 (55%)
  Q:    39 SSNLNGIVFEIKNLKAAIVSTDTVSGL---LSLNKPL--IYKIKKRDKNKKLIRFVSN----LDQIPEVNETFKKLASKFWPGKLTLIY--KKE-------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDI---DTNTLKREGEIKYEWIKKTI 210
           ++NLN  + +++  K   + T+TV GL   ++ N  +  ++++K R  N  LI  +++     D + EV E   +LA KFWPG LTL++  KK+             + R PD      L+ K   P+ + SAN  G    T  +   +SFN   +++  ++G   +    STI D    D+  + R G I  + I +TI
  S:     5 TTNLNRAIHDLQQGKPVAIPTETVYGLAAPINNNAAIRAVFEMKSRPLNHPLIVHIASNWDLHDLVEEVPEYAHQLAGKFWPGPLTLVFHCKKDQINPLITGGQSTIAIRCPDHPLTQKLLQKLNIPVVAPSANPFGKISPTTALHVKQSFN--DAELTILDGGRCRVGIESTIVDATNPDSYQILRHGIIDEKTIAETI 202
>gi|113954257|ref|YP_729767.1| YrdC domain-containing protein [Synechococcus sp. CC9311] >gi|113881608|gb|ABI46566.1| yrdC domain, putative [Synechococcus sp. CC9311] (205 aa)
Score = 140, Expect = 2.7e-07, Identities = 41/111 (36%), Positives = 65/111 (58%)
  Q:    54 AAIVSTDTVSGLLSL--NKPLIYKIKKRDKNKKLIRFVSNLDQI-----PEVNETFKKLASKFWPGKLTLIY--------------KKESYRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESF 164
           AA++ TDT+  L S+      I+++KKR ++K LI   +++D +     P        LA + WPG LTL+                    R+P  K +L+L+  +GPL ++SANLSG P      +A  +F
  S:    23 AALLPTDTLPALASMPEQAAQIWRLKKRPQDKPLILMGADVDALLCHVSPVARADASALAQRHWPGALTLVLPAFGPCAETLNPGCATLGLRIPACKPMLDLLRCSGPLATTSANLSGEPASRTETEAAGAF 154
>gi|57640883|ref|YP_183361.1| putative translation factor Sua5p-like protein [Thermococcus kodakarensis KOD1] >gi|57159207|dbj|BAD85137.1| putative translation factor Sua5p homolog [Thermococcus kodakarensis KOD1] (339 aa)
Score = 140, Expect = 2.7e-07, Identities = 58/152 (38%), Positives = 85/152 (55%)
  Q:    59 TDTVSGLLS--LNKPLIYKI---KKRDKNKKLIRFVSNLDQIP----EVNETFKKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTGPLYSSSANLSGNPPITN---IIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDI--DTNTLKREGEIKYEWIKKTI 210
           T+TV GL +  LN+  + +I   K R  +  LI  ++++D +     EV E  K LA +FWPG LTL+  K               + RMP     L LI  + PL + SAN+SG P  T+   +ID F  + K +     I+G        ST+ D+  +   L R G I  E ++K I
  S:    33 TETVYGLGADALNEGAVRRIFEAKGRPADNPLIIHIASIDDLEKVAREVPEKAKLLAERFWPGPLTLVLPKREEVPLVTTGGLDTVAVRMPAHPIALALIRASTPLAAPSANISGKPSPTSAEHVIDDF--YGKIEG---IIDGGETWVGVESTVVDLTEEPPVLLRPGGIPLEELEKVI 207
>gi|111018482|ref|YP_701454.1| hypothetical protein RHA1_ro01481 [Rhodococcus sp. RHA1] >gi|110818012|gb|ABG93296.1| conserved hypothetical protein [Rhodococcus sp. RHA1] (218 aa)
Score = 140, Expect = 3.0e-07, Identities = 37/99 (37%), Positives = 55/99 (55%)
  Q:   103 KKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLK--REGEI 201
           + L   FWPG L+L+ ++                 RMP     L L+ + GPL  SSAN+SG PP T + +A E      S  ++++G   +  Q STI D+   T +  REG +
  S:    87 RDLIRAFWPGGLSLVVEQAPSLAWDLGDTRGTVMLRMPLHPVALELLREVGPLAVSSANVSGQPPATTVEEAREQLGGSAS--VYLDGGRAEQGQASTIVDLTGATPRILREGAV 199
>gi|73748639|ref|YP_307878.1| putative translation factor Sua5 [Dehalococcoides sp. CBDB1] >gi|73660355|emb|CAI82962.1| putative translation factor Sua5 [Dehalococcoides sp. CBDB1] (213 aa)
Score = 140, Expect = 3.1e-07, Identities = 57/168 (33%), Positives = 93/168 (55%)
  Q:    42 LNGIVFEIKNLKAAIVSTDTV--SGLLSLNKPLI---YKIKKRDKNKKLIRFVSNLDQIPEVNETF----KKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFI-EGDYYQNNQPSTIYDIDTNTLK--REGEIKYEWIKKT 209
           +N  V  +KN    I  TDTV   G L+ N   +   + IK R   K L   + ++ QI +V + F    +KLA+++WPG LTL+  K               + R+P+   ++ ++ +   P+  +SANLSG     + ++A E+  +    + FI +G        STI  ++ + LK  R+G IK   I KT
  S:    14 INRAVQVLKNGGVVIFPTDTVYAVGALASNTHAVNRVFDIKGRTNTKGLPALIGDISQIHQVAKIFPPLARKLAAEYWPGGLTLVLPKTDNIPLELTGGNETVAIRIPNQAAVIEMLKRVAEPVTGTSANLSG---CKSSLNASEAKIQLGDRVDFILDGGQVSGGVESTIVTVNNDELKIIRQGAIKESDIMKT 205
>gi|170287882|ref|YP_001738120.1| Sua5/YciO/YrdC/YwlC family protein [Thermotoga sp. RQ2] >gi|170175385|gb|ACB08437.1| Sua5/YciO/YrdC/YwlC family protein [Thermotoga sp. RQ2] (335 aa)
Score = 140, Expect = 3.1e-07, Identities = 59/171 (34%), Positives = 92/171 (53%)
  Q:    38 DSSNLNGIVFEIKNLKAAIVSTDTVSGLLS--LNKPL---IYKIKKRDKNKKLIRFVSNLDQIPEVNETFK---KLASKFWPGKLTLIYKKES---------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDI--DTNTLKREGEIKYEWIKK 208
           D   L   V  ++N +  I  T+TV G+ +   N+     I+++K R  +  LI  + + +Q+ E+ E ++       KFWPG LT+I +K+S                RMP     L LI+  G P+ + SAN+SG P  TN+    E F   K  +I   GD       STI D+  +   L R G ++ E +K+
  S:    13 DEKVLKEAVELLQNGEVIIFPTETVYGIGADAYNEEACKKIFELKGRPADNPLIVHIHSFEQLEEIAEGYEPHLDFLKKFWPGPLTVILRKKSEKIPPVVTAGLPTVAMRMPAHPVALKLIELFGHPIAAPSANISGRPSATNVKHVVEDFMG-KVKLIIDAGD-TPFGLESTIVDLTKEKPVLLRPGPVEVERLKE 207
>gi|150386843|ref|ZP_01925340.1| Sua5/YciO/YrdC/YwlC family protein [Victivallis vadensis ATCC BAA-548] >gi|150256709|gb|EDM94201.1| Sua5/YciO/YrdC/YwlC family protein [Victivallis vadensis ATCC BAA-548] (193 aa)
Score = 140, Expect = 3.1e-07, Identities = 48/148 (32%), Positives = 83/148 (56%)
  Q:    56 IVSTDTVSGLL-----SLNKPLIYKIKKRDKNKKLIRFVSNLDQIPEVNETFK----KLASKFWPGKLTLIYKKES-----YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLK--REGEIKY 203
           ++ T+TV GL+     +     IY +K RD++K L  FV +  ++ E     +    +LA K+ PG +T+I +K++     +R+PD   IL ++   G PL  +SAN SG+P   ++  A    +    ++    GD   + Q ST+ D   N ++  R G I +
  S:    30 LLPTETVYGLVCRADDAAAVAKIYDLKDRDRSKLLGWFVGDWRKLAEYGVELEGLPSELAEKYCPGPITIIARKKAGGTLGFRVPDYPLILEILKLAGVPLAQTSANHSGHPNALSVKAALAELSG-DVELAVDGGDIPPDAQGSTVVDATGNAVRVLRPGPISF 193
>gi|94969639|ref|YP_591687.1| translation factor SUA5 [Acidobacteria bacterium Ellin345] >gi|94551689|gb|ABF41613.1| translation factor SUA5 [Acidobacteria bacterium Ellin345] (215 aa)
Score = 140, Expect = 3.2e-07, Identities = 60/185 (32%), Positives = 96/185 (51%)
  Q:    28 PKKEFVTYEKDSSNLNGIVFEIKNLKAAIV---STDTVSGLLSLNKPL-------IYKIKKRDKNKKLIRFVSNLDQIPEVNE----TFKKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNT----LKREGEIKYEWIKKTIEE 212
           P+++ V Y  D             LKA +V    TDT  GL +   P        IY+IK R ++K L   + ++DQ  E+ +    +F  LA +FWPG LT+I +                + R+P     L ++   G P+ ++SANLSG    T    A +   + +  +I I+G     +  STI D+ +      + REG +  E I +  E+
  S:    13 PEQKLVAYVAD------------QLKAGMVLGMPTDTFYGLAA--DPFNLRAVERIYEIKSRSRHKPLSLMIESVDQAEELAQDLPSSFYLLARRFWPGPLTMIIRAHARLPLKATANSGNIAVRIPSAPIPLAVLKAAGLPITATSANLSGQAECTT-ARALKQQMEERLPLI-IDGGNSPRDVHSTIVDLSSGDGQWRIIREGAVSQEQISEMFEQ 214
>gi|158312866|ref|YP_001505374.1| Sua5/YciO/YrdC/YwlC family protein [Frankia sp. EAN1pec] >gi|158108271|gb|ABW10468.1| Sua5/YciO/YrdC/YwlC family protein [Frankia sp. EAN1pec] (216 aa)
Score = 140, Expect = 3.4e-07, Identities = 49/149 (32%), Positives = 78/149 (52%)
  Q:    53 KAAIVSTDTVSGL--LSLNKPLIYKI---KKRDKNKKLIRFVSN---LDQIPE-VNETFKKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDID--TNTLKREGEI 201
           K  ++ TDT+ G+   + N+  +  +   K R +N  +   V +   LD + E V    + L   FWPG LTL+                  + RMP     + L+ +TGP+  SSAN+SG PP T+ +DA        +  ++++G        STI D      T+ REG +
  S:    27 KLVVLPTDTLYGIGADAFNRDAVTALLAAKGRGRNMPVPVLVGSWRTLDGLAEQVTGHIRDLVRAFWPGGLTLVVNHAPSLRWDLGDARGTVAVRMPLHPVAIELLGRTGPMAVSSANISGRPPATSAVDAVAQLGGAAA--VYLDGGTTPVGTASTIVDCTGPVPTVVREGAV 198
>gi|57234410|ref|YP_181562.1| Sua5/YciO/YrdC/YwlC family protein [Dehalococcoides ethenogenes 195] >gi|57224858|gb|AAW39915.1| Sua5/YciO/YrdC/YwlC family protein [Dehalococcoides ethenogenes 195] (213 aa)
Score = 140, Expect = 3.4e-07, Identities = 57/174 (32%), Positives = 92/174 (52%)
  Q:    40 SNLNGIVFEIKNLKAAIVSTDTV--SGLLSLNKPLI---YKIKKRDKNKKLIRFVSNLDQIPEVNETFKKLASK----FWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLK--REGEIKYEWIKKTIEEN 213
           S ++  V  +K     +  TDTV   G L+ N   +   + IK R   K L   + ++ QI +V + F  LASK    +WPG LTL+  K               + R+P+   ++ ++ + G P+  +SANLSG     N  +A +     + D I ++G        STI  ++ + LK  R+G IK   I +T  +N
  S:    12 SQIDQAVSILKRGGVVVFPTDTVYAVGALASNTQAVRRVFDIKGRANTKGLPALIGDISQINQVAKVFPPLASKLAKEYWPGGLTLVLPKTDNIPLELTGGNETVAIRIPNQPAVIEMLKRVGEPVTGTSANLSGCKSSLNAAEAEKQLGD-RVDFI-LDGGQVSGGVESTIIAVNPDGLKIIRQGAIKESDILETAAKN 209
>gi|78778710|ref|YP_396822.1| hypothetical protein PMT9312_0325 [Prochlorococcus marinus str. MIT 9312] >gi|78712209|gb|ABB49386.1| conserved hypothetical protein [Prochlorococcus marinus str. MIT 9312] (193 aa)
Score = 139, Expect = 3.5e-07, Identities = 40/95 (42%), Positives = 59/95 (62%)
  Q:    56 IVSTDTVSGLLSLNK--PLIYKIKKRDKNKKLIRFVSNLDQIPE-----VNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSG 150
           I  TDT+  +  L K   +IY  KKRD+NK LI   S   Q+ +       E ++ +ASK+WPG LT++                    R+P+     +L+ +TGPL +SSAN+SG
  S:    20 IFPTDTLPAIGCLPKFSNIIYDYKKRDRNKPLILMGSEYKQLIDYVHESAKEDYENIASKYWPGALTMVIPSSEKQTGILTSKDLTLGLRIPNFHMAQSLLKETGPLLTSSANISG 135
>gi|54298977|ref|YP_125346.1| hypothetical protein lpp3044 [Legionella pneumophila str. Paris] >gi|53752762|emb|CAH14197.1| hypothetical protein [Legionella pneumophila str. Paris] (322 aa)
Score = 139, Expect = 3.8e-07, Identities = 57/172 (33%), Positives = 96/172 (55%)
  Q:    39 SSNLNGIVFEIKNLKAAIVSTDTVSGL---LSLNKPL--IYKIKKRDKNKKLIRFVSN----LDQIPEVNETFKKLASKFWPGKLTLIY--KKE-------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDI---DTNTLKREGEIKYEWIKKTI 210
           ++NLN  + +++  K   + T+TV GL   ++ N  +  ++++K R  N  LI  +++     D + EV E   +LA KFWPG LTL++  KK+             + R PD      L+ K   P+ + SAN  G    T  +   +SFN   +++  ++G   +    STI D    D+  + R G I  + I +TI
  S:     5 TTNLNRAIHDLQQGKPVAIPTETVYGLAAPINNNAAIRAVFEMKSRPLNHPLIVHIASNWDLHDLVEEVPEYAHQLADKFWPGPLTLVFHCKKDQINPLITGGQSTIAIRCPDHPLTQKLLKKLNIPVVAPSANPFGKISPTTALHVKQSFN--DAELTILDGGRCRVGIESTIVDATNPDSYQILRHGIIDEKTIAETI 202
>gi|149640125|ref|XP_001515015.1| PREDICTED: hypothetical protein [Ornithorhynchus anatinus] (341 aa)
Score = 139, Expect = 4.5e-07, Identities = 42/100 (42%), Positives = 61/100 (61%)
  Q:    57 VSTDTVSGLLSLNK-----PLIYKIKKRDKNKKLIRFVSNLDQIPEVNETFKKL----ASKFWPGKLTLIYKKESY---------------------RMPDDKFILNLIDKTGPLYSSSANLSGNPPITN 156
           V TDTV  L +  K       IYKIK R ++K +  F+SNLDQ+   N  F  L     ++ +PG +  I KK  +                     R+PD   +++L++ TGPL  +SAN SG    T+
  S:   147 VPTDTVYALAASCKHSEAIEKIYKIKDRPQDKPICIFISNLDQLRAANPPFTPLLWDFMARVYPGSIGCIVKKGEWVKKLGVGAGFDRVGTKDSIMIRVPDQTVMVHLVEMTGPLAITSANPSGESDSTH 276
>gi|160937847|ref|ZP_02085206.1| hypothetical protein CLOBOL_02739 [Clostridium bolteae ATCC BAA-613] >gi|158439286|gb|EDP17039.1| hypothetical protein CLOBOL_02739 [Clostridium bolteae ATCC BAA-613] (412 aa)
Score = 138, Expect = 4.6e-07, Identities = 48/140 (34%), Positives = 71/140 (50%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQIP----EVNETFKKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTN--TLKREGEIKYEWIKKTIEE 212
           IY  K R  +  LI  VS ++++     E+ E  +KL   FWPG LT+I+ K               + RMPDD     LI   G P+ + SAN SG P  T     ++  N      + I+G        STI D+ +   ++ R G I  E + + + E
  S:    55 IYAAKGRPSDNPLIAHVSCVEEVAPLVKEIPEAGRKLMEAFWPGPLTMIFPKSEKVPYGTTGGLDTVAIRMPDDPVANRLIALAGVPVAAPSANTSGRPSPTTADHVWQDMNGRIE--MIIDGGPVGIGVESTIVDVSSAVPSVLRPGAITMEMLAEVLGE 213
>gi|123967880|ref|YP_001008738.1| putative translation factor (SUA5) [Prochlorococcus marinus str. AS9601] >gi|123197990|gb|ABM69631.1| Putative translation factor (SUA5) [Prochlorococcus marinus str. AS9601] (193 aa)
Score = 138, Expect = 4.6e-07, Identities = 42/102 (41%), Positives = 64/102 (62%)
  Q:    49 IKNLKAA---IVSTDTVSGLLSLNK--PLIYKIKKRDKNKKLIRFVSNLDQIPE-----VNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSG 150
           +K LK+    I  TDT+  +  L K   +IY+ KKRD+ K LI   S   Q+ +       E ++ +ASK+WPG LT++                    R+P+     +L+ +TGPL +SSAN+SG
  S:    10 LKTLKSGLPIIFPTDTLPAIGCLPKFSNIIYEFKKRDRGKPLILMGSEHKQLIDYVHESAKEDYENIASKYWPGALTMVVPASEKQTTILTSNDLTLGLRIPNSYMAKSLMRETGPLLTSSANISG 135
>gi|91069910|gb|ABE10839.1| conserved hypothetical protein [uncultured Prochlorococcus marinus clone ASNC2150] (193 aa)
Score = 138, Expect = 4.7e-07, Identities = 42/102 (41%), Positives = 65/102 (63%)
  Q:    49 IKNLKAA---IVSTDTVSGLLSLNK--PLIYKIKKRDKNKKLIRFVSNLDQIPE-----VNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSG 150
           +K LK+    I  TDT+  +  L K   +IY+ KKRD++K LI   S   Q+ +       E ++ +ASK+WPG LT++                    R+P+     +L+ +TGPL +SSAN+SG
  S:    10 LKTLKSGLPIIFPTDTLPAIGCLPKFSNIIYEFKKRDRDKPLILMGSEHKQLIDYVHESAKEDYENIASKYWPGALTMVIPASEKQTTILTSNDLTLGLRIPNSYMAQSLMRETGPLLTSSANISG 135
>gi|54295812|ref|YP_128227.1| hypothetical protein lpl2902 [Legionella pneumophila str. Lens] >gi|53755644|emb|CAH17146.1| hypothetical protein [Legionella pneumophila str. Lens] (322 aa)
Score = 138, Expect = 4.7e-07, Identities = 56/172 (32%), Positives = 96/172 (55%)
  Q:    39 SSNLNGIVFEIKNLKAAIVSTDTVSGL---LSLNKPL--IYKIKKRDKNKKLIRFVSN----LDQIPEVNETFKKLASKFWPGKLTLIY--KKE-------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDI---DTNTLKREGEIKYEWIKKTI 210
           ++NLN  + +++  K   + T+TV GL   ++ N  +  ++++K R  N  LI  +++     D + EV E   +LA KFWPG LTL++  KK+             + R PD      L+ K   P+ + SAN  G    T  +   +SFN   +++  ++G   +    STI D    D+  + R G I  + I +T+
  S:     5 TTNLNRAIHDLQQGKPVAIPTETVYGLAAPINNNAAIRAVFEMKSRPLNHPLIVHIASNWDLHDLVEEVPEYAHQLADKFWPGPLTLVFHCKKDQINPLITGGQSTIAIRCPDHPLTQKLLQKLNIPVVAPSANPFGKISPTTALHVKQSFN--DAELTILDGGRCRVGIESTIVDATNPDSYQILRHGIIDEKTIAETV 202
>gi|171323820|ref|ZP_02912338.1| Sua5/YciO/YrdC/YwlC family protein [Geobacillus sp. WCH70] >gi|171090131|gb|EDT36443.1| Sua5/YciO/YrdC/YwlC family protein [Geobacillus sp. WCH70] (348 aa)
Score = 138, Expect = 5.2e-07, Identities = 57/162 (35%), Positives = 84/162 (51%)
  Q:    49 IKNLKAAIVSTDTVSGLLSLNKPL-----IYKIKKRDKNKKLIRFVSNLDQ-------IPEVNETFKKLASKFWPGKLTLIYKKE---------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTN--TLKREGEIKYEWIKKTI 210
           +K+ +     T+TV GL +  K       I+  K R  +  LI  +++L Q       IP+V  T   L  +FWPG LTL+  K+               + RMP     L LI+ +G PL + SAN+SG P  T     F   N   + I  ++G        ST+ D  T   T+ R G +  E ++K I
  S:    28 LKSGEVVAFPTETVYGLGANAKDAKAVEKIFAAKGRPSDNPLIVHIAHLKQLEEMVSAIPDVAHT---LIKRFWPGPLTLVLPKKEGVISDPVTAGLPTVAVRMPAHPVALALIEASGLPLAAPSANISGRPSPTTAAHVFADLNGRIAGI--VDGGETGIGVESTVLDCTTKVPTILRPGGVTKEALEKVI 214
>gi|170077858|ref|YP_001734496.1| YrdC domain-containing protein [Synechococcus sp. PCC 7002] >gi|169885527|gb|ACA99240.1| yrdC domain protein [Synechococcus sp. PCC 7002] (197 aa)
Score = 138, Expect = 5.8e-07, Identities = 38/96 (39%), Positives = 62/96 (64%)
  Q:    59 TDTVSGLLSL--NKPLIYKIKKRDKNKKLIRFVSNLDQIPEV---NET----FKKLASKFWPGKLTLIYKKES---------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPI 154
           TDTV  L +     PLIY++K+R  +K LI   ++L +I +    +ET    ++ +A ++WPG LTL+                     R+PD      ++ +TGPL ++SAN SG+ P+
  S:    23 TDTVPALAAQPDAAPLIYQLKRRSPDKPLILMTASLPEIWDYVVGSETEKAQWQAIAQQYWPGALTLVLPASEKVSAAMNPTNSGTIGVRVPDLALAQGILRETGPLATTSANRSGSDPL 142
>gi|46200975|ref|ZP_00207919.1| COG0009: Putative translation factor (SUA5) [Magnetospirillum magnetotacticum MS-1] (328 aa)
Score = 138, Expect = 5.8e-07, Identities = 44/92 (47%), Positives = 55/92 (59%)
  Q:    59 TDTVSGL-----LSLNKPLIYKIKKRDKNKKLIRFVSNLDQ---IPEVNETFKKLASKFWPGKLTLIYKKE----------------SYRMPDDKFILNLIDKTG-PLYSSSANLSG 150
           T+TV GL       L    I+K K R     LI  VS+LDQ   + E+     +LA +FWPG LTL+ K+                 + RMPD    L LI   G PL + SANLSG
  S:    40 TETVYGLGGDATSDLAVAAIFKAKGRPSFNPLIAHVSSLDQAAALVEIGADAHRLAERFWPGPLTLVLKRRAASPVSLLASAGLDSVAVRMPDHPTALALIKAAGRPLAAPSANLSG 156
>gi|156937167|ref|YP_001434963.1| translation factor SUA5 [Ignicoccus hospitalis KIN4/I] >gi|156566151|gb|ABU81556.1| translation factor SUA5 [Ignicoccus hospitalis KIN4/I] (202 aa)
Score = 138, Expect = 5.9e-07, Identities = 49/155 (31%), Positives = 83/155 (53%)
  Q:    56 IVSTDTVSGLLSLNK--PLIYKIKKRDKNKKLI--RFVSNLDQIPEVNETFKKLASKFWPGKLTLIYKKESY--------------RMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLK--REGEIKYEWIKKTI 210
           I+ T+TV G+ S  +    IY+ K+R ++K L     +    ++ E +E  + LA  FWPG LT++ K + +              R+P   F L L++  GPL  +SANLSG     +  +        ++D++   G       PST+ +++   +K  R G I  E I+K +
  S:    30 IIPTETVYGIASKLEFAEKIYEAKRRPRDKPLPVQTPLGRHREVGEFDEAAEALAKAFWPGPLTIVVKAKPWLPEAVTAGTGKVGVRVPAHPFALKLLELVGPLAVTSANLSGGKSPKSAEEV-----TVEADLLIDMGPV--EGTPSTVVEVEGKKVKVLRRGPISEEEIQKVL 197
>gi|163799929|ref|ZP_02193835.1| Sua5/YciO/YrdC/YwlC family protein [Methanococcus voltae A3] >gi|158972342|gb|EDP39811.1| Sua5/YciO/YrdC/YwlC family protein [Methanococcus voltae A3] (209 aa)
Score = 137, Expect = 6.5e-07, Identities = 67/162 (41%), Positives = 100/162 (61%)
  Q:    49 IKNLKAAIVSTDTVSGL--LSLNKPL---IYKIKKRDKNKKL---IRFVSNLDQIPEVNETFKKLASKFWPGKLTLIY-KKES-----------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLK--REGEIKYEWIKKTI 210
           +KN + A+  TDT+ G+   +L+K +   IYKIK RD++K     ++  S++ +  +VN   KKL +KF PG +TLI  KKES            R+PD K IL L +   P+ S+SAN+SG P  +  I   +       DII  +GD  +  +PSTI  I  N ++  REG I ++ I K +
  S:    19 LKNGEIALCPTDTIYGICGYALDKNVVDRIYKIKNRDESKPFSISLQKKSDIQKYAKVNNVAKKLINKFLPGPITLILPKKESIPDYICKDYVGIRIPDSKIILELSEI--PITSTSANVSGRPS-SYSISKMDKEILNSVDIIIDDGD-CEYKKPSTIVKIIDNDIELIREGSISFDNILKEL 198
>gi|46198747|ref|YP_004414.1| sua5 protein [Thermus thermophilus HB27] >gi|55980762|ref|YP_144059.1| hypothetical protein TTHA0793 [Thermus thermophilus HB8] >gi|46196370|gb|AAS80787.1| sua5 protein [Thermus thermophilus HB27] >gi|55772175|dbj|BAD70616.1| conserved hypothetical protein [Thermus thermophilus HB8] (195 aa)
Score = 137, Expect = 7.1e-07, Identities = 49/146 (33%), Positives = 80/146 (54%)
  Q:    59 TDTVSGLLSLNK-----PLIYKIKKRDKNKKLIRFVSNLDQIPEVNE------TFKKLASKFWPGKLTLIYKKES------------YRMPDDKFILNLIDKT-GPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKREGEIKYE 204
           TDTV G+L+L +       IY++K R ++K L   V++L+   E+ +       F +LA  FWPG LT++   ++             RMPD   +  L+ +  G   ++S N SG PP+    +A      +  D +F  G+       S++ D+ T  + REG I  E
  S:    26 TDTVWGVLALMEDEAACKRIYEVKGRPEDKPLQVLVADLESALELVDLGPLEGKFLRLAEAFWPGGLTVVVPGKAIPPWISKDGSVGLRMPDHALLRELLRRVGGHAAATSLNKSGEPPVRTEAEA----RTFAVDFVF-PGE--AGGLASSVVDLRTGEVLREGAIPKE 188
>gi|126695682|ref|YP_001090568.1| putative translation factor (SUA5) [Prochlorococcus marinus str. MIT 9301] >gi|126542725|gb|ABO16967.1| Putative translation factor (SUA5) [Prochlorococcus marinus str. MIT 9301] (193 aa)
Score = 137, Expect = 7.3e-07, Identities = 44/95 (46%), Positives = 61/95 (64%)
  Q:    56 IVSTDTVSGLLSLNK--PLIYKIKKRDKNKKLIRFVSNLDQ-IPEVNETFKK----LASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSG 150
           I  TDT+  +  L K   +IYK KKRD+NK LI   S     I  V+E+ KK    +ASK+WPG LT++                    R+P+     +L+ +TGPL +SSAN+SG
  S:    20 IFPTDTLPAIGCLPKFSNIIYKFKKRDRNKPLILMGSEYKHLIDYVHESAKKDYENIASKYWPGALTIVVPASEKQTVNLTSNDLTIGLRIPNSCIAKSLLRETGPLLTSSANISG 135
>gi|70607376|ref|YP_256246.1| hypothetical protein Saci_1642 [Sulfolobus acidocaldarius DSM 639] >gi|68568024|gb|AAY80953.1| universally conserved protein [Sulfolobus acidocaldarius DSM 639] (352 aa)
Score = 136, Expect = 7.8e-07, Identities = 50/135 (37%), Positives = 73/135 (54%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQI----PEVNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTN--TLKREGEIKYEWIK 207
           I++ K R  +  LI  ++ LDQ+     ++NE   ++    WPG LTLI KK S               RMP     L LI ++G P+ + SANL+  P  T   D     N  + DII I+G +      STI ++ +N  TL R G    E ++
  S:    53 IFQAKNRPPDNPLIVHIAELDQLFDVAVDINEKVLEIVQVIWPGPLTLILKKSSKIPKEVSAGLDTVAVRMPAHPIALQLIRESGVPIAAPSANLATRPSPTRAEDVLNDLNG-RVDII-IDGGHTFFGVESTIVNVTSNPPTLLRPGPFTVEELR 206
>gi|52843166|ref|YP_096965.1| Sua5/YciO/YrdC/YwlC family protein [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] >gi|52630277|gb|AAU29018.1| SUA5/yciO/yrdC family:Sua5/YciO/YrdC/YwlC protein family [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] (322 aa)
Score = 136, Expect = 9.9e-07, Identities = 61/172 (35%), Positives = 96/172 (55%)
  Q:    39 SSNLNGIVFEIKNLKAAIVSTDTVSGL---LSLNKPL--IYKIKKRDKNKKLI-RFVSNLDQ---IPEVNETFKKLASKFWPGKLTLIY--KKE-------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLK----REGEIKYEWIKKTI 210
           ++NLN  + +++  K   + T+TV GL   ++ N  +  ++++K R  N  LI    SN D    + EV E   +LASKFWPG LTL++  KK+             + R PD      L+ K   P+ + SAN  G    T  +   +SFN   +++  ++G   +    STI D  TN +     R G I  + I +TI
  S:     5 TTNLNRAIHDLQQGKPVAIPTETVYGLAAPINNNAAIRAVFEMKGRPLNHPLIVHIASNWDLHKLVEEVPEYAHQLASKFWPGPLTLVFYCKKDQINPLITGGQSTIAIRCPDHPLTQKLLQKLNIPVVAPSANPFGKISPTTALHVKQSFN--DAELTILDGGRCRVGIESTIVDA-TNPVSYQILRHGIIDEKTIAETI 202
>gi|67924899|ref|ZP_00518292.1| SUA5/yciO/yrdC, N-terminal [Crocosphaera watsonii WH 8501] >gi|67853266|gb|EAM48632.1| SUA5/yciO/yrdC, N-terminal [Crocosphaera watsonii WH 8501] (199 aa)
Score = 136, Expect = 1.0e-06, Identities = 44/120 (36%), Positives = 66/120 (55%)
  Q:    45 IVFEIKNLKAAIVSTDTVSGLLSLNK--PLIYKIKKRDKNKKLIRFVSNLDQI-------PEVNETFKKLASKFWPGKLTLIYKKESY---------------RMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESF 164
           ++  +K  K     TDTV  L +L     LI+  KKR  +K LI   S+   I       PE    ++++  K+WPG+LTL+                     R+PD     N++ +TG L ++SANLSG PP   + +   SF
  S:     9 LIVGVKQGKVISFPTDTVPALAALPNYASLIFATKKRPPDKPLILMGSSPKAIWKYVQGTPEEFRIWQEVVQKYWPGQLTLVLPASELVPKDMNPLDNSTIGVRIPDSVIARNILKETGCLATTSANLSGEPPKEKLREIVVSF 152
>gi|148378148|ref|YP_001252689.1| Sua5/YciO/YrdC/YwlC family protein [Clostridium botulinum A str. ATCC 3502] >gi|153934330|ref|YP_001382549.1| Sua5/YciO/YrdC/YwlC family protein [Clostridium botulinum A str. ATCC 19397] >gi|153936453|ref|YP_001386101.1| Sua5/YciO/YrdC/YwlC family protein [Clostridium botulinum A str. Hall] >gi|148287632|emb|CAL81697.1| conserved hypothetical protein [Clostridium botulinum A str. ATCC 3502] >gi|152930374|gb|ABS35874.1| Sua5/YciO/YrdC/YwlC family protein [Clostridium botulinum A str. ATCC 19397] >gi|152932367|gb|ABS37866.1| Sua5/YciO/YrdC/YwlC family protein [Clostridium botulinum A str. Hall] (351 aa)
Score = 135, Expect = 1.0e-06, Identities = 53/140 (37%), Positives = 75/140 (53%)
  Q:    69 NKPLIYKIKKRDKNKKLIRFVSNLDQIPEVNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTN--TLKREGEIKYEWIKK 208
           + PLI  I K    +KL++      +IP V E   KL  KFWPG +T+I KK+                RMP +K  + LI   G P+ + SANLSG P  T++    E  +  K +II + GD  +    ST+ D   N   + R G I  E +K+
  S:    63 DNPLIVHISKMKDIEKLVQ------KIPSVAE---KLMDKFWPGPMTIILKKKDIIPNETSAGLDSIGIRMPSNKIAMKLISMAGVPIAAPSANLSGKPSPTDVETCIEDLDG-KVNII-LGGDNSEVGVESTVIDCTINPPCILRPGGITLEMVKE 208
>gi|167769909|ref|ZP_02441962.1| hypothetical protein ANACOL_01250 [Anaerotruncus colihominis DSM 17241] >gi|167667900|gb|EDS12030.1| hypothetical protein ANACOL_01250 [Anaerotruncus colihominis DSM 17241] (342 aa)
Score = 135, Expect = 1.0e-06, Identities = 41/103 (39%), Positives = 61/103 (59%)
  Q:    53 KAAIVSTDTVSGLLSLNKPL-----IYKIKKRDKNKKLIRFVSNLDQIP----EVNETFKKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPIT 155
           K  ++ T+TV GL +          IY  K R  +  LI  +++LD++P     V +   +LA +FWPG +T+I +K               + RMP       LI + G PL + SANLSG+P  T
  S:    29 KLVVIPTETVYGLAANALDPAAAAAIYTAKGRPCDNPLIVHIASLDELPPLVKAVPDALYRLADRFWPGPMTVILEKSDLVPSATTGGLDTVAVRMPAHPAARALIRRAGVPLAAPSANLSGSPSPT 155
>gi|196178074|gb|EDX73076.1| hypothetical protein MC7420_2694 [Microcoleus chthonoplastes PCC 7420] (205 aa)
Score = 135, Expect = 1.1e-06, Identities = 38/96 (39%), Positives = 61/96 (63%)
  Q:    59 TDTVSGLLSLNKP----LIYKIKKRDKNKKLI---RFVSNLDQIPEVN----ETFKKLASKFWPGKLTLIYKKES---------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPI 154
           TDT+  L    +P    LI+ +K+R  NK LI    F S+L    +      E ++++A  +WPG LTL+                     R+PD +  + ++ +TGPL ++SAN+SG PP+
  S:    23 TDTIPALAV--RPDYAELIFTLKQRSNNKPLILMGSFPSSLWSYVKGTDAELEIWQQVAKHYWPGALTLVLPASDKVPAAMNPTDPTTIGLRVPDSRVAIAILSQTGPLATTSANVSGKPPL 142
>gi|23466265|ref|NP_696868.1| Sua5/YciO/YrdC family protein [Bifidobacterium longum NCC2705] >gi|189440759|ref|YP_001955840.1| Putative translation factor [Bifidobacterium longum DJO10A] >gi|23327014|gb|AAN25504.1| conserved protein in the Sua5/YciO/YrdC family [Bifidobacterium longum NCC2705] >gi|189429194|gb|ACD99342.1| Putative translation factor [Bifidobacterium longum DJO10A] (224 aa)
Score = 135, Expect = 1.1e-06, Identities = 51/165 (30%), Positives = 91/165 (55%)
  Q:    49 IKNLKAAIVSTDTVSGLL--SLNKPLI---YKIKKRDKNKKLIRFVSNLDQIPEVN----ETFKKLASKFWPGKLTLIY-------------------KKESYRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDI-IFIEGDYYQNNQPSTI-----YDIDTNTLKREGEIKYEWIKKTIEEN 213
           I++    ++ TDTV G+     NK  I   Y++K+R + K L   +++ DQ+ E+         +L++ F PG  + I                      +  R+P+    L ++  TGPL +SSAN SG+     + +A ++F    S++ ++++G   Q +  ST+     Y  D   + REG I    I+K +  N
  S:    23 IRDGGLVVIPTDTVYGVACDPRNKAAIDRIYRLKRRPRYKALQVLLASTDQLDELGLDLPSPLNRLSAAFLPGAFSPIAVARPDCTLETLADTADGRPGTQGIRIPNSALCLAILKATGPLAASSANRSGDESAQTVQEAVDAFG---SEVDLYLDGGPTQGHVSSTVVKADPYARDGIEILREGVIAQNVIRKALHLN 218
>gi|152965228|ref|YP_001361012.1| Sua5/YciO/YrdC/YwlC family protein [Kineococcus radiotolerans SRS30216] >gi|151359745|gb|ABS02748.1| Sua5/YciO/YrdC/YwlC family protein [Kineococcus radiotolerans SRS30216] (241 aa)
Score = 135, Expect = 1.2e-06, Identities = 34/94 (36%), Positives = 52/94 (55%)
  Q:   103 KKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLK 196
           ++L   FWPG LT++ + +              + RMP     L L+ +TGP+  SSANLSG P  T + +A E     +S  ++++G       PSTI D     L+
  S:    87 RELIDAFWPGALTIVCRAQPSLTWDLGETNGTVALRMPLHPVALELLRRTGPMAVSSANLSGRPAATVVGEAVEQLG--ESVRVYLDGGPSTKGAPSTIVDASDGPLR 192
>gi|157150566|ref|YP_001450439.1| Sua5/YciO/YrdC/YwlC family protein [Streptococcus gordonii str. Challis substr. CH1] >gi|157075360|gb|ABV10043.1| Sua5/YciO/YrdC/YwlC family protein [Streptococcus gordonii str. Challis substr. CH1] (206 aa)
Score = 135, Expect = 1.2e-06, Identities = 55/157 (35%), Positives = 88/157 (56%)
  Q:    48 EIKNLKAA----IVSTDTVSGLLS--LNKPLI---YKIKKRDKNKKLIRFVSNLDQIPEVNET----FKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDI--DTNTLKREGEIKYE 204
           +I+N+ AA    ++ T+TV GL +  LN+  +   Y++K+R ++K L   V++L++I   ++       +L   F PG LT+I +                 +R+P     L+LI K GPL   SANLSG    T+       F +  S    +E D     Q STI D+  +   + R+G I  E
  S:    13 KIENILAAGGAVVLPTETVYGLFAQALNEEAVERVYELKRRPRDKALNLNVASLEEIYAFSKNQPTYLDQLYQAFLPGPLTIILQANDQVPTWINSGMDTVGFRIPKHPVTLDLIRKYGPLIGPSANLSGKVSGTSFQQIVMDFQEQVSG---VEDDAALTGQDSTILDLSGEKAHILRQGAIARE 195
>gi|154687810|ref|YP_001422971.1| YwlC [Bacillus amyloliquefaciens FZB42] >gi|154353661|gb|ABS75740.1| YwlC [Bacillus amyloliquefaciens FZB42] (346 aa)
Score = 135, Expect = 1.2e-06, Identities = 38/83 (45%), Positives = 49/83 (59%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQ----IPEVNETFKKLASKFWPGKLTLI---------------YKKESYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPIT 155
           IY+ K R  +  LI  +S++ Q    I  + ET KKL   FWPG LTL+                +  + RMPD    L LI   G P+ + SANLSG P  T
  S:    57 IYEAKGRPSDNPLIVHISHISQLDRFISHIPETAKKLMKLFWPGALTLVLPCKPGVLSPRVTAGLETVAVRMPDHPVALALISSAGLPIAAPSANLSGKPSPT 159
>gi|29377040|ref|NP_816194.1| Sua5/YciO/YrdC/YwlC family protein [Enterococcus faecalis V583] >gi|29344506|gb|AAO82264.1| Sua5/YciO/YrdC/YwlC family protein [Enterococcus faecalis V583] (340 aa)
Score = 135, Expect = 1.2e-06, Identities = 43/98 (43%), Positives = 63/98 (64%)
  Q:    59 TDTVSGL--LSLNKPLI---YKIKKRDKNKKLIRFVSNLDQIPE----VNETFKKLASKFWPGKLTLIYKKES---------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITN 156
           T+TV GL   +LN+  +   Y++K R  +  LI  V+N++ + +    + E   KL S FWPG LTLI+   S               +RMPD++  L LI++   PL   SAN SG P  T+
  S:    28 TETVYGLGADALNEAAVKKVYQVKGRPSDNPLIVHVNNVEMVKKYVATLPEVATKLVSAFWPGPLTLIFNVPSDTFSKTVTGGLETVAFRMPDNQATLALIEQANVPLVGPSANTSGKPSPTS 150
>gi|54023023|ref|YP_117265.1| hypothetical protein nfa10560 [Nocardia farcinica IFM 10152] >gi|54014531|dbj|BAD55901.1| hypothetical protein [Nocardia farcinica IFM 10152] (234 aa)
Score = 134, Expect = 1.4e-06, Identities = 49/163 (30%), Positives = 81/163 (49%)
  Q:    39 SSNLNGIVFEIKNLKAAIVSTDTVSGLL-----SLNKPLIYKIKKRDKNKKLIRFVSNLDQIP----EVNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDI--DTNTLKREGEI 201
           ++ L      +K+ +  ++ TDT+ GL      S     +   K+R ++  +   V + + I      V    + L   FWPG L+L+ ++                 RMP     L+L+   GPL  SSAN+SG PP T   +A E      S  ++++G    +   STI D+  D   + REG +
  S:    27 AAGLTAATSALKSGRLVVMPTDTLYGLAADAFDSTAVAELLAAKRRGRDMPVPVLVGSWNTIDGLVFSVRPQARDLIRAFWPGGLSLVVQQAPSLAWDLGDTRGTVMLRMPLHPVALDLLRDVGPLAVSSANVSGQPPATTAAEAREQLGSLVS--VYLDGGPAAHAVASTIVDLTADRPRILREGAV 212
>gi|18976678|ref|NP_578035.1| sua5 superfamily-related protein [Pyrococcus furiosus DSM 3638] >gi|18892255|gb|AAL80430.1| sua5 superfamily-related protein [Pyrococcus furiosus DSM 3638] (341 aa)
Score = 134, Expect = 1.4e-06, Identities = 58/164 (35%), Positives = 85/164 (51%)
  Q:    49 IKNLKAAIVSTDTVSGL--LSLNKPL---IYKIKKRDKNKKLIRFVSNLDQI----PEVNETFKKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDT--NTLKREGEIKYEWIKKTIEE 212
           I+  K     T+TV GL   +LN+     I++ K R  +  LI  ++   Q+     EV E  K LA KFWPG LT++  +               + RMP ++  L LI  +G P+ + SAN+SG P  T      + F  Y      I+G   +    ST+ D+      L R G +  E I+K I E
  S:    23 IREGKLVAFPTETVYGLGADALNEKAARRIFEAKGRPADNPLIVHIAEFSQVYELAREVPEEAKMLAKKFWPGPLTIVLPRREIVPDVTTGGLDTVAIRMPANEIALKLIKLSGRPIAAPSANISGKPSPTTAEHVADDF--YGKIECIIDGGETKIGVESTVIDLTEWPPVLLRPGGLPLEEIEKVIGE 210
>gi|187777267|ref|ZP_02993740.1| hypothetical protein CLOSPO_00819 [Clostridium sporogenes ATCC 15579] >gi|187774195|gb|EDU37997.1| hypothetical protein CLOSPO_00819 [Clostridium sporogenes ATCC 15579] (355 aa)
Score = 134, Expect = 1.4e-06, Identities = 57/153 (37%), Positives = 86/153 (56%)
  Q:    56 IVSTDTVSGL--LSLNKPLIYKI---KKRDKNKKLIRFVSNLDQIPEVNETF----KKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYD--IDTNTLKREGEIKYEWIKK 208
           +  T+TV GL   +L+K  + KI   K R ++  LI  +S +  I ++ E      +KL  KFWPG +T+I KK+                RMP +K  + LI   G P+ + SANLSG P  T++    E  +   + I  + GD  +    ST+ D  ID   + R G I  E +K+
  S:    36 VFPTETVYGLGANALDKDAVKKIFEAKGRPQDNPLIVHISKVKDIEKLVEKIPPIAQKLMDKFWPGPMTIILKKKDIIPNETSAGLDSIGIRMPSNKIAMELISMAGVPIAAPSANLSGKPSPTDLETCVEDLDGRVNAI--LGGDNSEVGVESTVIDCTIDPPCILRPGGITLEMLKE 212
>gi|75907707|ref|YP_322003.1| SUA5/yciO/yrdC-like [Anabaena variabilis ATCC 29413] >gi|75701432|gb|ABA21108.1| SUA5/yciO/yrdC-like [Anabaena variabilis ATCC 29413] (194 aa)
Score = 134, Expect = 1.5e-06, Identities = 42/118 (35%), Positives = 72/118 (61%)
  Q:    59 TDTVSGLLSLNKP--LIYKIKKRDKNKKLIRFVSNLDQI-PEV------NETFKKLASKFWPGKLTLIYKKES---------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNI--IDA-FESFNKYKSDIIFIEG 176
           TDTV  L +L +   LI+  K+R ++K LI   ++ + + P V       + ++++ S++WPG LTL+                     R+P +     ++ +TGPL ++SAN SG P +  +  IDA F S    +S  + +EG
  S:    23 TDTVPALATLPEQAGLIFAAKQRSQDKPLILMAASAEDLWPYVEGSEQDQQIWEQVVSQYWPGALTLVLPASKRVPKVMNPIDPTTIGIRVPKNAIAQKILSQTGPLATTSANFSGQPALLTMAEIDAQFPSVLTLESTALEMEG 167
>gi|168177474|ref|ZP_02612138.1| Sua5/YciO/YrdC/YwlC family protein [Clostridium botulinum NCTC 2916] >gi|182670936|gb|EDT82910.1| Sua5/YciO/YrdC/YwlC family protein [Clostridium botulinum NCTC 2916] (351 aa)
Score = 134, Expect = 1.5e-06, Identities = 53/140 (37%), Positives = 75/140 (53%)
  Q:    69 NKPLIYKIKKRDKNKKLIRFVSNLDQIPEVNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTN--TLKREGEIKYEWIKK 208
           + PLI  I K    +KL++      +IP V E   KL  KFWPG +T+I KK+                RMP +K  + LI   G P+ + SANLSG P  T++    E  +  K +II + GD  +    ST+ D   N   + R G I  E +K+
  S:    63 DNPLIVHISKMKDIEKLVQ------KIPSVAE---KLMDKFWPGPMTIILKKKDIIPNETSAGLDSIGIRMPSNKIAMKLISMAGVPIAAPSANLSGKPSPTDVETCIEDLDG-KVNII-LGGDNSEVGVESTVIDCTINPPCILRPGGITLEMLKE 208
>gi|14521794|ref|NP_127270.1| sua5 related protein [Pyrococcus abyssi GE5] >gi|5459014|emb|CAB50500.1| Putative translation factor, SUA5 related protein [Pyrococcus abyssi GE5] (340 aa)
Score = 134, Expect = 1.6e-06, Identities = 57/164 (34%), Positives = 85/164 (51%)
  Q:    49 IKNLKAAIVSTDTVSGL----LSLNK-PLIYKIKKRDKNKKLIRFVSNLDQI----PEVNETFKKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDT--NTLKREGEIKYEWIKKTIEE 212
           I+  K     T+TV GL    L  N    I++ K R  +  LI  +++ +Q+     E+ E  + LA +FWPG LTL+  K               + RMP  +  L LI+ +  P+ + SAN+SG P  T+     E F  Y      I+G   +    ST+ D+      L R G +  E I+K I E
  S:    23 IREGKLVAFPTETVYGLGANALDENAVKRIFEAKGRPADNPLIIHIASFEQLEVLAKEIPEEAEMLAKRFWPGPLTLVLPKSEVVPRVITGGLDTVAVRMPAHEIALKLIELSERPIAAPSANISGKPSPTSAHHVAEDF--YGKIECIIDGGETRIGVESTVIDLTEWPPVLLRPGGLPLEEIEKVIGE 210
>gi|169335782|ref|ZP_02862975.1| hypothetical protein ANASTE_02207 [Anaerofustis stercorihominis DSM 17244] >gi|169258520|gb|EDS72486.1| hypothetical protein ANASTE_02207 [Anaerofustis stercorihominis DSM 17244] (340 aa)
Score = 133, Expect = 1.7e-06, Identities = 55/138 (39%), Positives = 79/138 (57%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQIPE----VNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLK--REGEIKYEWIKKTI 210
           I+K K R  +  LI  +S+LD I +    +++  +KL SKF+PG LTLI KK S               RMP DK     I   G P+ + SAN+S  P ITN     E  +  K D+I    +     + ST+ D+ ++ +K  R G+I  E I+K I
  S:    54 IFKAKNRPSDNPLIVHISDLDMIDDLVTCISDDARKLMSKFFPGPLTLIMKKSSKVPNSVSNGLDTVGIRMPSDKEANGFIKACGVPIAAPSANISKRPSITNKKYLVEELSG-KVDMILCSKNSSIGLE-STVLDVSSDKVKLLRPGKISAEDIEKVI 210
>gi|167750774|ref|ZP_02422901.1| hypothetical protein EUBSIR_01752 [Eubacterium siraeum DSM 15702] >gi|167656209|gb|EDS00339.1| hypothetical protein EUBSIR_01752 [Eubacterium siraeum DSM 15702] (337 aa)
Score = 133, Expect = 1.7e-06, Identities = 51/139 (36%), Positives = 75/139 (53%)
  Q:    49 IKNLKAAIVSTDTVSGLLS-LNKP----LIYKIKKRDKNKKLIRFVSNLD----QIPEVNETFKKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTI 187
           IK  +   + T+TV GL +    P     I+K K R ++  LI  + +LD     + E+      LA  FW G LT+I+ K+              + RMPD++  LNLI   G PL + SANLSG+P  T     +   N      + I+G   +N   ST+
  S:    20 IKKGEVVAIPTETVYGLAADAYNPDACAKIFKAKGRPQDNPLIIHICDLDMLKNSVKEIPPLALTLAEHFWSGSLTMIFPKKDIVPDTTSGGLDTVAVRMPDNEDTLNLIKMCGVPLAAPSANLSGSPSPTTAQHVYADMNGRIP--LIIDGGECKNGVESTV 180
>gi|160881865|ref|YP_001560833.1| Sua5/YciO/YrdC/YwlC family protein [Clostridium phytofermentans ISDg] >gi|160430531|gb|ABX44094.1| Sua5/YciO/YrdC/YwlC family protein [Clostridium phytofermentans ISDg] (352 aa)
Score = 133, Expect = 1.7e-06, Identities = 63/173 (36%), Positives = 90/173 (52%)
  Q:    38 DSSNLNGIVFE-----IKNLKAAIVSTDTVSGL--LSLNKPL---IYKIKKRDKNKKLIRFVSNLDQIPE----VNETFKKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTGP-LYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDI--DTNTLKREGEIKYEWIKKTI 210
           D  NLN   F+     +K  +     T+TV GL   +L+K     IY+ K R  +  LI  ++N++ + E    V E   +LA  FWPG LT+I KK               + RMP D+    LI ++G  L + SAN SG P  T      E  +   S  + I+G        STI D+  D   + R G I  E + + I
  S:     9 DRDNLNSEDFKEAVELLKEGQLVAFPTETVYGLGGDALDKTAARRIYEAKGRPSDNPLIVHIANIEALKELAVEVPEEAYRLADDFWPGPLTMILKKSDLVPLETTGGLDTVAIRMPSDEIARRLIKESGLYLAAPSANKSGRPSTTKAEHVIEDLDGCVS--MIIDGGSSTIGLESTIVDLTGDNPVILRPGFITREMLNQCI 210
>gi|194341222|gb|EDX22188.1| Sua5/YciO/YrdC/YwlC [Streptomyces sp. Mg1] (215 aa)
Score = 133, Expect = 1.8e-06, Identities = 38/118 (32%), Positives = 63/118 (53%)
  Q:    95 IPEVNETFKKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDI--DTNTLKREGEIKYEWIKKTIEE 212
           + + +E   +L   FWPG LTL+ K +              + RMP     + L+ + GP+  SSANLSG+P   +   A E      S  ++++G      QPS+I D+      L REG +  E +++ + +
  S:    79 VTDFSEQAWELVDAFWPGALTLVAKHQPSLAWDLGETRGTVAVRMPLHPVAIELLTEVGPMAVSSANLSGHPAPEDCDAAREMLGDSVS--VYLDGGPTPGIQPSSIVDVTGKVPVLLREGALTAEQLREVVPD 210
>gi|45357749|ref|NP_987306.1| hypothetical protein MMP0186 [Methanococcus maripaludis S2] >gi|45047309|emb|CAF29742.1| conserved hypothetical protein [Methanococcus maripaludis S2] (206 aa)
Score = 133, Expect = 1.9e-06, Identities = 68/179 (37%), Positives = 98/179 (54%)
  Q:    34 TYEKDSSNLNGIVFEIKNLKAAIVS-------TDTVSGLLS--LNKPLI---YKIKKRDKNKKLIRFVSNLDQIPE---VNETFKKLASKFWPGKLTLIYKKES------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNT-LKREGEIKYEWIKKTIEE 212
           T+E   SNL     EI+  K  I+        TDT+ GL +  L+K  I   Y IK+RD NK +   +    QI     V+ET KK+  KF PG +T+I KK+              R+PD+  I  +     PL ++SAN+SG    T+ ++  +   K K D+I   G      Q + +  ID    L REG+I +E I K + E
  S:     3 TFEISESNLKNCEKEIETAKKMILGGKIILCGTDTLYGLSTNALDKNAIEKIYSIKERDPNKPISISLGEKKQIENYVYVDETAKKIIEKFMPGPITVILKKKDIIPDILGKDDVGVRIPDNDVIRKI--AVVPLTTTSANISGKTAPTS-LEEVDQIIKEKVDLIVDTGPCKYKVQSTIVKVIDGKIELIREGKIPFEEILKAVNE 206
>gi|196238339|ref|ZP_03137114.1| SUA5/yciO/yrdC domain protein [Cyanothece sp. PCC 7425] >gi|196217182|gb|EDY11826.1| SUA5/yciO/yrdC domain protein [Cyanothece sp. PCC 7425] (200 aa)
Score = 133, Expect = 2.2e-06, Identities = 38/108 (35%), Positives = 66/108 (61%)
  Q:    59 TDTVSGLLSLNKP----LIYKIKKRDKNKKLIRFVSNLDQI-PEVN------ETFKKLASKFWPGKLTLIY---------------KKESYRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNK 166
           TDTV  L +  +P    LI+  K+R  +K LI   +  + + P V       + ++ +A ++WPG LTL+                K    R+P+    L ++ +TGPL ++S N SG PP+T + +  + F++
  S:    24 TDTVPALAT--RPDRAELIFAAKQRQPDKPLILMAATPEALWPYVQGSTAEWQIWQSVAERYWPGALTLVLPASDRLPAVMNPIEGKTIGVRIPNWGLALTILQQTGPLATTSVNRSGQPPLTALNEIEQQFSQ 155
>gi|170761511|ref|YP_001785471.1| Sua5/YciO/YrdC/YwlC family protein [Clostridium botulinum A3 str. Loch Maree] >gi|169408500|gb|ACA56911.1| Sua5/YciO/YrdC/YwlC family protein [Clostridium botulinum A3 str. Loch Maree] (351 aa)
Score = 132, Expect = 2.3e-06, Identities = 51/136 (37%), Positives = 75/136 (55%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQIP----EVNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTN--TLKREGEIKYEWIKK 208
           I+K K R ++  LI  +S +  I     E+    +KL  KFWPG +T+I KK+                RMP +K  + LI   G P+ + SANLSG P  T++    E  +  K +II + GD  +    ST+ D   N   + R G I  E +K+
  S:    54 IFKAKGRPQDNPLIVHISKMKDIEKLVEEIPSVAEKLMDKFWPGPMTIILKKKDIIPNETSAGLDSIGIRMPSNKIAMKLISMAGVPIAAPSANLSGKPSPTDVETCIEDLDG-KVNII-LGGDNSEVGVESTVIDCTINPPCILRPGGITLEMLKE 208
>gi|20806674|ref|NP_621845.1| putative translation factor (Sua5) [Thermoanaerobacter tengcongensis MB4] >gi|20515125|gb|AAM23449.1| putative translation factor (Sua5) [Thermoanaerobacter tengcongensis MB4] (355 aa)
Score = 132, Expect = 2.3e-06, Identities = 58/188 (30%), Positives = 96/188 (51%)
  Q:    25 KNYPKKEFVTYEKDSSNLNGIVFEIKNLKAAIVSTDTVSGL--LSLNKPLIYKI---KKRDKNKKLIRFVSNLDQIPEVNETF----KKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDI--DTNTLKREGEIKYEWIKKTIEE 212
           K+ P+ E + Y  +     G+V            T+TV G+   S ++  + +I   K R ++  LI  ++ +DQ+ E+   F    KKLA +FWPG LT++ KK               + RMP +     LI + G P+ + SAN+SG P  T+     E    Y    + I+G        ST+ D+  +   + R G +  E +K+ + E
  S:    10 KDNPEIELIDYAAEVIKKGGLV---------AFPTETVYGIGANSFDEEAVKRIFIAKGRPQDNPLILHIALMDQVYELAAEFPEKAKKLAHRFWPGPLTVVLKKSDKVPYVNTAGMNTVAIRMPSNPIAHLLIKRAGVPISAPSANVSGKPSPTDASHVIEDL--YGKVDVIIDGGKCDVGLESTVVDLTEEVPVILRPGAVTLEMLKEVLGE 212
>gi|168182249|ref|ZP_02616913.1| Sua5/YciO/YrdC/YwlC family protein [Clostridium botulinum Bf] >gi|182674619|gb|EDT86580.1| Sua5/YciO/YrdC/YwlC family protein [Clostridium botulinum Bf] (351 aa)
Score = 132, Expect = 2.5e-06, Identities = 51/136 (37%), Positives = 75/136 (55%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQIPEVNETF----KKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTN--TLKREGEIKYEWIKK 208
           I+K K R ++  LI  +S +  I  + E      +KL  KFWPG +T+I KK+                RMP +K  + LI   G P+ + SANLSG P  T++    E  +  K +II + GD  +    ST+ D   N   + R G I  E +K+
  S:    54 IFKAKGRPQDNPLIVHISKMKDIERLVEKIPSVAEKLMDKFWPGPMTIILKKKDIIPNETSAGLDSIGIRMPSNKIAMKLISMAGVPIAAPSANLSGKPSPTDVETCIEDLDG-KVNII-LGGDNSEVGVESTVIDCTINPPCILRPGGITLEMLKE 208
>gi|116753773|ref|YP_842891.1| Sua5/YciO/YrdC/YwlC family protein [Methanosaeta thermophila PT] >gi|116665224|gb|ABK14251.1| translation factor SUA5 [Methanosaeta thermophila PT] (198 aa)
Score = 132, Expect = 2.5e-06, Identities = 42/129 (32%), Positives = 71/129 (55%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQIPEVNETFKK---LASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDI-IFIEGDYYQNNQPSTIYDIDTNTLKREGEI 201
           +Y IK+R  +K +   VS+ + + +V     +   +  K  PG +T + +K S               R PD +  L LI+ TGP+ S+SAN++G PP +   D  E   +  S + + I+G   +   PST+ D+ T  + R G +
  S:    45 VYAIKRRPLDKPISIAVSSFEMLCDVAHVRPEDLDMMRKLLPGPVTFLVRKRSIVPDMLTAGSPLVGVRYPDHEMALRLIEMTGPITSTSANITGAPPPS---DPKEIDPEILSRVDMLIDGGRCRYAVPSTLVDLSTRRILRMGAM 188
>gi|86742399|ref|YP_482799.1| translation factor SUA5 [Frankia sp. CcI3] >gi|86569261|gb|ABD13070.1| translation factor SUA5 [Frankia sp. CcI3] (216 aa)
Score = 132, Expect = 2.6e-06, Identities = 35/94 (37%), Positives = 50/94 (53%)
  Q:    96 PEVNETFKKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYD 189
           P+V E    L + FWPG LTL+ +                + RMP     + L+ +TGP+  SSAN+SG PP T I +A           ++++G       PSTI D
  S:    83 PQVRE----LITAFWPGGLTLVARHTPSLRWDLGESRGTVAVRMPLHPVAIELLGRTGPMAVSSANISGQPPATTIDEALHQLGGAAD--VYLDGGPCPAAVPSTIVD 184
>gi|153938602|ref|YP_001389505.1| Sua5/YciO/YrdC/YwlC family protein [Clostridium botulinum F str. Langeland] >gi|152934498|gb|ABS39996.1| Sua5/YciO/YrdC/YwlC family protein [Clostridium botulinum F str. Langeland] (351 aa)
Score = 132, Expect = 2.6e-06, Identities = 48/136 (35%), Positives = 74/136 (54%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQIPEVNETF----KKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTN--TLKREGEIKYEWIKK 208
           I++ K R ++  LI  +S +  I E+ +      +KL  KFWPG +T+I KK+                RMP +K  + LI   G P+ + SANLSG P  T+I    E  +   +  + + GD  +    ST+ D   N   + R G I  E +K+
  S:    54 IFEAKGRPQDNPLIVHISKIKDIDELVKKIPPIAEKLMDKFWPGPMTIILKKKDIIPNETSAGLDSIGIRMPSNKIAMELISMAGVPIAAPSANLSGKPSPTDIETCIEDLDGRVN--MILGGDNSEVGVESTVIDCTINPPCILRPGGITLEMVKE 208
>gi|14590350|ref|NP_142416.1| hypothetical protein PH0435 [Pyrococcus horikoshii OT3] >gi|3256838|dbj|BAA29521.1| 340aa long hypothetical protein [Pyrococcus horikoshii OT3] (340 aa)
Score = 132, Expect = 2.8e-06, Identities = 55/162 (33%), Positives = 87/162 (53%)
  Q:    49 IKNLKAAIVSTDTVSGL--LSLNKPLIYKI---KKRDKNKKLIRFVSNLDQI----PEVNETFKKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTN--TLKREGEIKYEWIKKTI 210
           I+  K     T+TV GL   +LN+  + +I   K R  +  LI  ++   Q+     EV E  K L  +FWPG LT++  ++              + RMP ++  L LI+ +G P+ + SAN+SG P  T+     + F  Y      I+G   +    ST+ D+  +   L R G +  E I+K I
  S:    23 IREGKLVAFPTETVYGLGADALNERAVRRIFEAKGRPADNPLILHIAKFSQVYELAREVPEEAKVLVERFWPGPLTIVLPRKDVVPDVTTGGLDTVAIRMPANEIALKLIELSGKPIAAPSANISGKPSPTSAEHVADDF--YGKIECIIDGGETRIGVESTVIDLTEHPPVLLRPGGLPLEEIEKVI 208
>gi|33239812|ref|NP_874754.1| putative translation factor (SUA5) [Prochlorococcus marinus subsp. marinus str. CCMP1375] >gi|33237338|gb|AAP99406.1| Putative translation factor (SUA5) [Prochlorococcus marinus subsp. marinus str. CCMP1375] (195 aa)
Score = 131, Expect = 3.5e-06, Identities = 39/107 (36%), Positives = 63/107 (58%)
  Q:    56 IVSTDTVSGLLSLNKPLI--YKIKKRDKNKKLIRFVSNLDQI-----PEVNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFE 162
           ++ TDT+  L +  K  I  + IKKR K+K LI   S  DQ+     P   +   ++ S +WPG LT++                    R+P  +  ++ ++K+GPL ++SANLSG      +ID +E
  S:    22 LIPTDTLPALATFPKNAIELWNIKKRPKSKPLILMGSTTDQLLKYVLPVAIKDAIRMCSSYWPGALTIVLPASGEIVQSLNPSGDSIGIRIPACEVSMDFLNKSGPLATTSANLSGQ---ETLIDPYE 146
>gi|71893997|ref|YP_279443.1| hypothetical protein MHJ_0649 [Mycoplasma hyopneumoniae J] >gi|71852124|gb|AAZ44732.1| conserved hypothetical protein [Mycoplasma hyopneumoniae J] (287 aa)
Score = 131, Expect = 3.5e-06, Identities = 45/105 (42%), Positives = 67/105 (63%)
  Q:    50 KNLKAAIVSTDTVSGLLSLNK----PLIYKIKKRDKNKKLIRFVSNLDQIP-----EVNETFKKLASKFWPGKLTLIYKKESYRMPDDKFILNLIDKTGPLYSSSANLSGNPPI 154
           K  K  + +TDTV G+ S  K      I+ IKKRD +KK++  V+NL+QI      E  +  KK+  K WPG  TLI + +S+R+P+   +L L+ K GP + +SAN+S   P+
  S:   135 KYQKLFLTTTDTVPGIASFYKNCDLDAIFVIKKRDFSKKIVTLVANLEQIKPLIKQENYKKLKKITKKIWPGATTLIIENQSFRIPNQVKLLKLLKKNGPAFVTSANISNEKPL 248
>gi|87124889|ref|ZP_01080736.1| hypothetical protein RS9917_02768 [Synechococcus sp. RS9917] >gi|86167209|gb|EAQ68469.1| hypothetical protein RS9917_02768 [Synechococcus sp. RS9917] (213 aa)
Score = 131, Expect = 3.5e-06, Identities = 41/126 (32%), Positives = 70/126 (55%)
  Q:    39 SSNLNGIVFEIKNLKAAIVSTDTVSGLLSL--NKPLIYKIKKRDKNKKLIRFVSNLDQI-----PEVNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESF 164
           +++ N ++ +++   AA++ TDT+  L SL  +   I+++K+R   K LI   +  + +     PEV      LAS  WPG LTL+                    R+PD     +L+  +GPL ++S N SG P   +  +A + F
  S:    16 ATDSNALLHQLRMGGAAMLPTDTLPALASLPEHARQIWQLKRRPLRKPLILMGAEPESLLTHVAPEVRGEAAALASAHWPGALTLVLPASGPTVQHLHPGAATLGLRIPDCAPTRHLLSLSGPLATTSINRSGEPAAQSAREATQCF 162
>gi|150399931|ref|YP_001323698.1| Sua5/YciO/YrdC/YwlC family protein [Methanococcus vannielii SB] >gi|150012634|gb|ABR55086.1| Sua5/YciO/YrdC/YwlC family protein [Methanococcus vannielii SB] (205 aa)
Score = 131, Expect = 3.6e-06, Identities = 68/179 (37%), Positives = 100/179 (55%)
  Q:    33 VTYEKDSSNLNGIVFEIKNLKAAIVS-------TDTVSGL----LSLNK-PLIYKIKKRDKNKKLIRFVSNLDQIPE---VNETFKKLASKFWPGKLTLIYKKES------------YRMPDDKFILNLIDKTGPLYSSSANLSGN-PPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNT-LKREGEIKYEWIKKTIE 211
           +T++    NLN    EI+ +K  ++        TDT+ GL    L  N    IYKIKKRD NK +   +    Q+ +   V++T +KL  KF PG +T+I KK+              R+PD+  I  +     PL ++SAN+SG   PI   ++  +   K K D+I   G      Q + I  ID    L REG+I +E I K +E
  S:     2 ITFKISEDNLNKFEKEIEIVKKVVLEGGVILCGTDTLYGLSTNALDENAIEKIYKIKKRDPNKPISISLGEKYQVEKYVYVDDTARKLIDKFMPGPITIILKKKDILPDILGKNDVGVRIPDNDVIRKI--SVVPLTTTSANISGEVSPIA--LEEVDPKVKEKVDLIIDSGTCKHRMQSTIIKVIDGKIELIREGKIPFEDILKALE 205
>gi|84494536|ref|ZP_00993655.1| Sua5/YciO/YrdC/YwlC [Janibacter sp. HTCC2649] >gi|84384029|gb|EAP99909.1| Sua5/YciO/YrdC/YwlC [Janibacter sp. HTCC2649] (260 aa)
Score = 131, Expect = 3.6e-06, Identities = 37/104 (35%), Positives = 55/104 (52%)
  Q:   103 KKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDID--TNTLKREGEIKYEWI 206
           + L  ++WPG LTL++K +              + RMPD++  L L+ + GP+  SSAN +G P    IIDA        S   +++G        STI D      T+ R G I  + I
  S:    87 RALIERYWPGPLTLVFKAQPSLMWDLGDTGGTVAVRMPDNEVALELLKEVGPMAVSSANRTGQPASRTIIDAATQLG--ASVEFYLDGGPVTGGLASTIVDCTHPEPTILRRGAIDADEI 204
>gi|124027648|ref|YP_001012968.1| hypothetical protein Hbut_0770 [Hyperthermus butylicus DSM 5456] >gi|123978342|gb|ABM80623.1| universally conserved protein [Hyperthermus butylicus DSM 5456] (214 aa)
Score = 131, Expect = 3.7e-06, Identities = 48/155 (30%), Positives = 84/155 (54%)
  Q:    56 IVSTDTVSGLLSLNKPL-------IYKIKKRDKNKKLIRFVSNL---DQIPEVNETFKKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKT-GPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNT--LKREGEIKYEWIKKTI 210
           +  TDTV GL +   P        +++ K+R  N+ +   VS+L   ++I E+++  ++LA +FWPG LT++   +                R+P+    L  I+   G +  +SANL   P    + +A +     + D I+++G       PST+ D+ T    L R G I  E I+  +
  S:    31 VYPTDTVYGLGA--NPFSSYAVWRVFRAKERPSNRPIPVLVSSLRAAEKIAELDDRARRLAERFWPGPLTIVVPAKPGLPSLLHAGTGRIGVRVPNHPIALKFIEAVGGAITGTSANLHRKPSPCTVQEAMKQLG-CRVD-IYLDGGPTPGGTPSTVVDLTTPKPRLVRRGPIPPEEIEAVL 208
>gi|16080748|ref|NP_391576.1| hypothetical protein BSU36950 [Bacillus subtilis subsp. subtilis str. 168] >gi|732384|sp|P39153|YWLC_BACSU Uncharacterized protein ywlC >gi|556881|emb|CAA86105.1| Similar to Saccharomyces cerevisiae SUA5 protein [Bacillus subtilis] >gi|2636220|emb|CAB15712.1| ywlC [Bacillus subtilis subsp. subtilis str. 168] >gi|1095419|prf||2108403D ipc-29d gene (346 aa)
Score = 130, Expect = 3.8e-06, Identities = 41/97 (42%), Positives = 59/97 (60%)
  Q:    59 TDTVSGLLSLNKPL-----IYKIKKRDKNKKLIRFVSNLDQIPEVN----ETFKKLASKFWPGKLTLI---------------YKKESYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPIT 155
           T+TV GL +  K       IY+ K R  +  LI  ++++ Q+ ++     E  K L  +FWPG LTLI                +  + RMPD    L LI ++G P+ + SANLSG P  T
  S:    38 TETVYGLGANAKNTDAVKKIYEAKGRPSDNPLIVHIADISQLEDLTGPAPEKAKTLMKRFWPGALTLILPCKPDALSPRVTAGLETVAIRMPDHPLALALIRESGLPIAAPSANLSGKPSPT 159
>gi|169824779|ref|YP_001692390.1| translation factor [Finegoldia magna ATCC 29328] >gi|167831584|dbj|BAG08500.1| translation factor [Finegoldia magna ATCC 29328] (342 aa)
Score = 130, Expect = 4.0e-06, Identities = 48/113 (42%), Positives = 68/113 (60%)
  Q:    49 IKNLKAAIVSTDTVSGLLS--LNKPL---IYKIKKRDKNKKLIRFVSNLDQI----PEVNETFKKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAF 161
           IKN       T+TV GL +  L++     I+ +K+R ++  LI  V+N D +     E+ E  KKL    WPG LT+I+KK               + R P D+    LIDK+G P+ + SAN SG P  TN  D +
  S:    24 IKNGSVVAFPTETVYGLGANGLDEEACKKIFDVKRRKRDNPLILHVTNEDMVKNLSSEITEDQKKLMDNLWPGPLTIIFKKSDKVNDVVSCGGDTVAIRNPSDEIARFLIDKSGCPIAAPSANKSGRPSPTNAQDVY 160
>gi|119486656|ref|ZP_01620706.1| hypothetical protein L8106_12935 [Lyngbya sp. PCC 8106] >gi|119456273|gb|EAW37405.1| hypothetical protein L8106_12935 [Lyngbya sp. PCC 8106] (201 aa)
Score = 130, Expect = 4.1e-06, Identities = 37/101 (36%), Positives = 61/101 (60%)
  Q:    59 TDTVSGLL--SLNKPLIYKIKKRDKNKKLIRFVSNLDQI-PEVNETFKKL------ASKFWPGKLTLIYKKES---------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIID 159
           TDTV  L        LI+++K+R  +K LI   +  + + P V  T ++L      A ++WPG LTL+                     R+P+ +    ++ +TGPL ++SANLSG PP+  + +
  S:    24 TDTVPALAVQPQQAELIFQLKQRSADKPLILMGATPESLWPFVQGTVEELQVWSQMARQYWPGALTLVLPASEKVPRAMNPSDPTTIGLRIPNAEISRAILQRTGPLATTSANLSGQPPLLTMAE 148
>gi|111225292|ref|YP_716086.1| putative translation factor [Frankia alni ACN14a] >gi|111152824|emb|CAJ64568.1| Putative translation factor [Frankia alni ACN14a] (216 aa)
Score = 130, Expect = 4.2e-06, Identities = 33/87 (37%), Positives = 47/87 (54%)
  Q:   103 KKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYD 189
           K L S FWPG LTL+ +  +               RMP     + L+ +TGP+  SSAN+SG PP T   +A +         ++++G       PSTI D
  S:    86 KDLISAFWPGGLTLVVRHAASLRWDLGEGRGTVAVRMPLHPVAIELLGRTGPMAVSSANISGQPPATTADEAVDQLGGAAE--VYLDGGPCPAAVPSTIVD 184
>gi|16081439|ref|NP_393782.1| sua5 related protein [Thermoplasma acidophilum DSM 1728] >gi|10639445|emb|CAC11447.1| sua5 related protein [Thermoplasma acidophilum] (352 aa)
Score = 130, Expect = 4.4e-06, Identities = 54/146 (36%), Positives = 81/146 (55%)
  Q:    56 IVSTDTVSGL--LSLNKPLIYKI---KKRDKNKKLIRFVSNLDQI-----PEVNETFKKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKREGEI 201
           +  T+TV GL  L+ N     KI   K R  +  LI  +S+++Q      P+ +   + L +K WPG LT++ +K               + RMPDD    +LI+  GP+ + SAN+S  P IT+  DA   F   + D+I I+    +    STI DI     KR  E+
  S:    31 VFPTETVYGLGALASNPEACKKIFIAKGRPSDNPLIVHISSMEQFFSYSDPDDSYPIEGL-NKAWPGPLTVVVRKAQGISDVVTAGLPTVAIRMPDDPIAHDLIEMAGPIAAPSANISTRPSITDSRDAIR-FLDGRVDVI-IDAGPTRFGIESTIIDIT----KRPAEL 193
>gi|170755509|ref|YP_001779769.1| Sua5/YciO/YrdC/YwlC family protein [Clostridium botulinum B1 str. Okra] >gi|169120721|gb|ACA44557.1| Sua5/YciO/YrdC/YwlC family protein [Clostridium botulinum B1 str. Okra] (351 aa)
Score = 130, Expect = 4.7e-06, Identities = 48/136 (35%), Positives = 74/136 (54%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQIPEVNETF----KKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTN--TLKREGEIKYEWIKK 208
           I++ K R ++  LI  +S +  I E+ +      +KL  KFWPG +T+I KK+                RMP +K  + LI   G P+ + SANLSG P  T+I    E  +   +  + + GD  +    ST+ D   N   + R G I  E +K+
  S:    54 IFEAKGRPQDNPLIVHISKIKDIDELVKKIPPIAEKLMDKFWPGPMTIILKKKDIIPNETSAGLDSIGIRMPSNKIAMELISMAGVPIAAPSANLSGKPSPTDIETCIEDLDGRVN--MILGGDNSEVGVESTVIDCTINPPCILRPGGITLEMVKE 208
>gi|22299666|ref|NP_682913.1| hypothetical protein tll2123 [Thermosynechococcus elongatus BP-1] >gi|22295850|dbj|BAC09675.1| tll2123 [Thermosynechococcus elongatus BP-1] (197 aa)
Score = 130, Expect = 4.7e-06, Identities = 39/99 (39%), Positives = 58/99 (58%)
  Q:    59 TDTVSGLLSL--NKPLIYKIKKRDKNKKLIRFVSNLDQI-PEVN------ETFKKLASKFWPGKLTLIYKKESY--------------RMPDDKFILNLIDKTGPLYSSSANLSGNPPITNI 157
           TDTV  L S      LIY  K+R  +K LI   +N +Q+ P V       E +  +A+++WPG +TL+                    R+PD      L+ +TGPL ++S N SG PP+  +
  S:    27 TDTVPALASRCDRGELIYTAKERQPDKPLILMGANPEQLWPFVRGSAAEWEQWSAMAARYWPGAVTLVLPAAELPPGLNPLGTGTIGLRVPDWPPAQALLQQTGPLATTSINRSGQPPLIEL 148
>gi|91070122|gb|ABE11046.1| conserved hypothetical protein [uncultured Prochlorococcus marinus clone ASNC729] (193 aa)
Score = 130, Expect = 4.7e-06, Identities = 45/120 (37%), Positives = 68/120 (56%)
  Q:    49 IKNLKAA---IVSTDTVSGLLSLNK--PLIYKIKKRDKNKKLIRFVSNLDQIPE-----VNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYK 168
           +K LK+    I  TDT+  +  L K    IY  K+RD++K LI   S   Q+ +       E ++ +ASK+WPG LT++                    R+P+     +L+ +TGPL +SSAN+SG    T + D    F   K
  S:    10 LKTLKSGLPIIFPTDTLPAIGCLPKFSNAIYTFKRRDRDKPLILMGSEPKQLIDYVHESAKEDYENIASKYWPGALTMVIPASEKQTKILTSNDLTLGLRVPNLYMAQSLMKETGPLLTSSANISGLKGSTTVEDIALDFPSLK 153
>gi|72383532|ref|YP_292887.1| putative translation factor (SUA5) [Prochlorococcus marinus str. NATL2A] >gi|72003382|gb|AAZ59184.1| putative translation factor (SUA5) [Prochlorococcus marinus str. NATL2A] (191 aa)
Score = 130, Expect = 5.0e-06, Identities = 41/120 (34%), Positives = 66/120 (55%)
  Q:    45 IVFEIKNLKAAIVSTDTVSGLLSLNK--PLIYKIKKRDKNKKLIRFVSNLDQI-----PEVNETFKKLASKFWPGKLTLIY--------------KKESYRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESF 164
           +  ++K    A+  TDT+  L S  K    I+ IKKR  +K LI      D +     P   E   +LA  +WPG LT++                   +R+P  +   +L+ +TGPL ++SAN+SG  P+ + ++A   F
  S:    11 LALKLKKGSLALFPTDTLPALCSYPKYSKKIWTIKKRPSSKPLILMGGCSDDLFEFVHPCALEESLQLAKIYWPGALTMVLPTIGNFSKYLNANSNAVGFRVPALRIARDLLMQTGPLATTSANISGETPVKDAMEASIQF 151
>gi|163814228|ref|ZP_02205619.1| hypothetical protein COPEUT_00381 [Coprococcus eutactus ATCC 27759] >gi|158450473|gb|EDP27468.1| hypothetical protein COPEUT_00381 [Coprococcus eutactus ATCC 27759] (350 aa)
Score = 129, Expect = 5.2e-06, Identities = 57/152 (37%), Positives = 81/152 (53%)
  Q:    59 TDTVSGLL--SLNKPL---IYKIKKRDKNKKLIRFVSNLDQIPE----VNETFKKLASKFWPGKLTLIYKKESY--------------RMPDDKFILNLIDKTGP-LYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDI--DTNTLKREGEIKYEWIKKTI 210
           T+TV GL   +LN      IY  K R  +  LI  +++ D + E    V++  KKL   FWPG LT+I  K++               RMP     + LI  +G  + + SANLSG P  T      +  +  + D+I I+G        STI D+  D  T+ R G I  E IK  +
  S:    33 TETVYGLGGDALNPDASHKIYSAKGRPSDNPLIVHIADTDSVYELAEYVSDDTKKLMEAFWPGPLTIILNKKAVVPHTTTGGLDTVAIRMPSHPVAMKLIKDSGVYIAAPSANLSGRPSPTTAHHVQQDMDG-RIDMI-IDGGAVGIGIESTIVDMTGDRPTILRPGYITPEMIKNIV 208
>gi|124025123|ref|YP_001014239.1| putative translation factor (SUA5) [Prochlorococcus marinus str. NATL1A] >gi|123960191|gb|ABM74974.1| Putative translation factor (SUA5) [Prochlorococcus marinus str. NATL1A] (199 aa)
Score = 129, Expect = 5.3e-06, Identities = 41/120 (34%), Positives = 66/120 (55%)
  Q:    45 IVFEIKNLKAAIVSTDTVSGLLSLNK--PLIYKIKKRDKNKKLIRFVSNLDQI-----PEVNETFKKLASKFWPGKLTLIY--------------KKESYRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESF 164
           +  ++K    A+  TDT+  L S  K    I+ IKKR  +K LI      D +     P   E   +LA  +WPG LT++                   +R+P  +   +L+ +TGPL ++SAN+SG  P+ + ++A   F
  S:    19 LALKLKKGSLALFPTDTLPALCSYPKYSKKIWTIKKRPSSKPLILMGGCSDDLFEFVHPCALEESLQLAKIYWPGALTMVLPTIGNFSKYLNGNSNAVGFRVPALRIARDLLMQTGPLATTSANISGETPVKDAMEASIQF 159
>gi|167038769|ref|YP_001661754.1| Sua5/YciO/YrdC/YwlC family protein [Thermoanaerobacter sp. X514] >gi|166853009|gb|ABY91418.1| Sua5/YciO/YrdC/YwlC family protein [Thermoanaerobacter sp. X514] (354 aa)
Score = 129, Expect = 5.3e-06, Identities = 62/186 (33%), Positives = 91/186 (48%)
  Q:    25 KNYPKKEFVTYEKDSSNLNGIVFEIKNLKAAIVSTDTVSGL--LSLNKPLIYKI---KKRDKNKKLIRFVSNLDQI----PEVNETFKKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTN--TLKREGEIKYEWIKKTI 210
           KN P+ E + +        G+V            T+TV G+   S N+  I KI   K R ++  LI  ++ L+QI     EV +  K L  KFWPG LTLI+KK               + RMP +     LI +   P+ + SAN+SG P  T+     E    Y    + I+G        ST+ D+      + R G +  E +K+ I
  S:     9 KNNPEIELIDFAAKVIKEGGLV---------AFPTETVYGIGANSFNEEAIKKIFIAKGRPQDNPLIVHIAELEQIYDLVKEVPQKAKTLMKKFWPGPLTLIFKKSQKVPYVNTAGMDTVAIRMPSNTIAHLLIKRAEVPISAPSANVSGKPSPTDASHVIEDL--YGKVDVIIDGGKCDVGVESTVLDLTEKVPVILRPGAVTLEMLKEVI 209
>gi|195978151|ref|YP_002123395.1| Sua5/YciO/YrdC/YwlC family protein [Streptococcus equi subsp. zooepidemicus str. MGCS10565] >gi|195974856|gb|ACG62382.1| Sua5/YciO/YrdC/YwlC family protein [Streptococcus equi subsp. zooepidemicus str. MGCS10565] (197 aa)
Score = 129, Expect = 5.7e-06, Identities = 55/164 (33%), Positives = 87/164 (53%)
  Q:    49 IKNLKAAIVSTDTVSGLLS--LNKPLI---YKIKKRDKNKKLIRFVSNLDQIPEVNET----FKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPP---ITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTN--TLKREGEIKYEWIKKTIEE 212
           IK   A I+ T+TV GL +  LN+  +   Y++KKR  +K +   V++ + I   ++       KL   F PG LT+I K  +              +R+P       +I  TGPL   SANLSG+       +I+ AF+      +D      D Y   + STI D+ +   ++ R+G I  E +   + E
  S:     9 IKAGGALILPTETVYGLFAQALNEEAVNAVYRLKKRPCDKAMNLNVADFESILAFSKQQPAYLSKLYEAFLPGPLTIILKANAKTPYWINSGLKTVGFRLPSHPLTAEIIRATGPLIGPSANLSGSKSGKCFNDIVKAFDGKVDGYAD------DAYLTGKDSTILDLSSPKVSILRQGAITKEQLLAKVPE 194
>gi|167760279|ref|ZP_02432406.1| hypothetical protein CLOSCI_02652 [Clostridium scindens ATCC 35704] >gi|167662162|gb|EDS06292.1| hypothetical protein CLOSCI_02652 [Clostridium scindens ATCC 35704] (352 aa)
Score = 129, Expect = 5.7e-06, Identities = 55/154 (35%), Positives = 81/154 (52%)
  Q:    59 TDTVSGL--LSLNKPL---IYKIKKRDKNKKLIRFVSNLDQIPEVN----ETFKKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTGP-LYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDT--NTLKREGEIKYEWIKKTIEE 212
           T+TV GL   +LN+     IY  K R  +  LI  ++N+D + ++     E  K +A K+WPG LT+I+ K               + RMP  +    +ID  G  + + SAN SG P  T  +   E     K D+I I+G        STI D+      + R G I  E + + I E
  S:    38 TETVYGLGADALNEHAAQKIYAAKGRPSDNPLIIHITNMDDLAKITSFIPEAAKVIADKYWPGPLTMIFDKSGIVPYGTTGGLDTVAVRMPSHEIAREVIDAGGGYIAAPSANTSGRPSPTTALHVEEDMTG-KIDMI-IDGGSVDIGVESTILDMTVVPPMILRPGAITREMLTELIGE 215
>gi|25011158|ref|NP_735553.1| Sua5/YciO/YrdC/YwlC family protein [Streptococcus agalactiae NEM316] >gi|76798420|ref|ZP_00780660.1| Sua5/YciO/YrdC/YwlC family protein [Streptococcus agalactiae 18RS21] >gi|77410541|ref|ZP_00786902.1| Sua5/YciO/YrdC/YwlC family protein [Streptococcus agalactiae CJB111] >gi|77413279|ref|ZP_00789475.1| Sua5/YciO/YrdC/YwlC family protein [Streptococcus agalactiae 515] >gi|23095557|emb|CAD46766.1| Unknown [Streptococcus agalactiae NEM316] >gi|76586215|gb|EAO62733.1| Sua5/YciO/YrdC/YwlC family protein [Streptococcus agalactiae 18RS21] >gi|77160666|gb|EAO71781.1| Sua5/YciO/YrdC/YwlC family protein [Streptococcus agalactiae 515] >gi|77163489|gb|EAO74439.1| Sua5/YciO/YrdC/YwlC family protein [Streptococcus agalactiae CJB111] (198 aa)
Score = 129, Expect = 5.8e-06, Identities = 52/159 (32%), Positives = 84/159 (52%)
  Q:    54 AAIVSTDTVSGLLSLNKPL-------IYKIKKRDKNKKLIRFVSNLDQIPEVNET----FKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLK--REGEIKYEWIKKTIEE 212
           A I+ T+TV G+ +  K L       +Y++KKR ++K +   + + + I + ++      K+L   F PG LT+I +                 +RMP     L++I   GPL   SAN+SG        +  + FN     ++ IE D       STI D+  + +K  R+G I  E +  TI E
  S:    13 AVIMPTETVYGIFA--KALSEEAVNHVYELKKRPRDKAMNLNICDFETILKYSKNQPTYLKQLYDAFLPGPLTIILEASQEVPHWINSGLLSVGFRMPKHPVTLDMIANHGPLIGPSANISGCDSGRVFSEIQKQFNH---QVLGIEDDKALTGVDSTIIDLSGDRVKILRQGAITQEVLTATIPE 193
>gi|160947260|ref|ZP_02094427.1| hypothetical protein PEPMIC_01193 [Peptostreptococcus micros ATCC 33270] >gi|158446394|gb|EDP23389.1| hypothetical protein PEPMIC_01193 [Peptostreptococcus micros ATCC 33270] (341 aa)
Score = 129, Expect = 6.0e-06, Identities = 48/142 (33%), Positives = 79/142 (55%)
  Q:    49 IKNLKAAIVSTDTV-----SGLLSLNKPLIYKIKKRDKNKKLIRFVSNLDQIP----EVNETFKKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDI 190
           I N K   + T+TV     +GL  +    I+K K R ++  LI  +S+ D +     E+N+  K+  + FWPG LT++ KK+              + RMP+++   + I + G P+ + SAN+SG P  T   D F   N   S  + ++G        ST+ D+
  S:    19 ILNDKIVAIPTETVYGLGANGLSDIAVSKIFKAKNRPQDNPLILHISDYDMMENLVYELNDEIKEFLNHFWPGPLTVVMKKKDIIPDAISCGLDTVAIRMPNNEIARSFIKQCGVPIAAPSANISGKPSPTTAEDVFTDMNGKIS--VILDGGLCNIGIESTVLDL 182
>gi|29829452|ref|NP_824086.1| hypothetical protein SAV_2910 [Streptomyces avermitilis MA-4680] >gi|29606560|dbj|BAC70621.1| hypothetical protein [Streptomyces avermitilis MA-4680] (215 aa)
Score = 129, Expect = 6.0e-06, Identities = 38/118 (32%), Positives = 62/118 (52%)
  Q:    95 IPEVNETFKKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNT--LKREGEIKYEWIKKTIEE 212
           + + +E   +L   FWPG LTL+ K +              + RMP     L L+ + GP+  SSANL+G+P   +   A E      S  ++++G       PS+I D+      L REG +  E ++K + +
  S:    79 VTDFSEMAWELVDAFWPGALTLVAKHQPSLQWDLGDTRGTVAVRMPLHPVALELLSEVGPMAVSSANLTGHPAPEDCDAAQEMLGDSIS--VYLDGGPTPGIVPSSIVDVSGKIPLLLREGALSAEELRKVVPD 210
>gi|194340641|gb|EDX21607.1| translation factor SUA5 [Streptomyces sp. Mg1] (214 aa)
Score = 129, Expect = 6.2e-06, Identities = 35/99 (35%), Positives = 55/99 (55%)
  Q:   103 KKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNT--LKREGEI 201
           ++L   FWPG LTL+ + E              + RMP     ++L+D+TGPL  SSANL+G P   +   A        +  ++++      + PS+I D+   T  L REG +
  S:    87 RELIDAFWPGGLTLVARHEPSIKWDLGETHGTVAIRMPAHPVAISLLDQTGPLAVSSANLTGRPSPQDCDAALAMLGDTVA--VYLDAGPTPADVPSSIVDVTAKTPVLLREGAL 199
>gi|85014437|ref|XP_955714.1| translation factor [Encephalitozoon cuniculi GB-M1] >gi|19171408|emb|CAD27133.1| similarity to PROTEIN REQUIRED FOR NORMAL GROWTH (SUA5/YRDC/YC10/YWLC FAMILY) [Encephalitozoon cuniculi GB-M1] (337 aa)
Score = 129, Expect = 6.3e-06, Identities = 41/108 (37%), Positives = 64/108 (59%)
  Q:    57 VSTDTVSGLL-SLNKPL----IYKIKKRDKNKKLIRFVSNLDQIPEV-----NETFKKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESF 164
           V T+TV GL  S+  P     + K+K+R  +  L   VS+   + E+      E +++L   FWPG LTL+++ +              + RMP  K +L +I++ G P+   SAN+SG P  T      E F
  S:    24 VPTETVYGLAASIYNPRAVERLLKLKRRPADNPLPVAVSSYRMLKEIVKEPIPEEYRRLMDMFWPGPLTLLFRSKDCVSSVIRSGLESVAVRMPKSKHLLEIIERLGAPVVLPSANISGRPSPTTAGHVVEDF 156
>gi|91772214|ref|YP_564906.1| translation factor SUA5 [Methanococcoides burtonii DSM 6242] >gi|91711229|gb|ABE51156.1| translation factor SUA5 [Methanococcoides burtonii DSM 6242] (350 aa)
Score = 129, Expect = 6.4e-06, Identities = 50/136 (36%), Positives = 75/136 (55%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQIPE----VNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDI--DTNTLKREGEIKYEWIKK 208
           I+K K R  +  LI  V++ DQ  +    +++T  KL  +FWPG LTLI K +                RMP ++  L  I ++G PL + SAN SG P  T+     +     K D I I+G   +    ST+ DI  D   + R G++  E I++
  S:    55 IFKAKGRPADNPLIVHVASKDQCNDLAKNISQTAFKLMDEFWPGPLTLILKAKKVVPEITTGGLDTVGLRMPANEIALEFIRRSGTPLAAPSANTSGRPSPTSAEHVTQDLEG-KIDAI-IDGGMVEIGLESTVVDITGDIPAILRPGKVSAEDIRE 209
>gi|150403108|ref|YP_001330402.1| Sua5/YciO/YrdC/YwlC family protein [Methanococcus maripaludis C7] >gi|150034138|gb|ABR66251.1| Sua5/YciO/YrdC/YwlC family protein [Methanococcus maripaludis C7] (206 aa)
Score = 128, Expect = 6.5e-06, Identities = 66/179 (36%), Positives = 101/179 (56%)
  Q:    34 TYEKDSSNLNGIVFEIKNLKAAIVS-------TDTVSGLLS--LNKPLI---YKIKKRDKNKKLIRFVSNLDQIPE---VNETFKKLASKFWPGKLTLIYKKES------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNT-LKREGEIKYEWIKKTIEE 212
           T+E   SNL     EI++ +  I+        TDT+ GL +  L+K  I   Y IK+RD NK +   +   DQI     V++  KK+  KF PG +T+I KK+              R+PD+  I  +     PL ++SAN+SG     + ++  +S  K K D+I   G      Q + +  ID    L REG+I +E I +T++E
  S:     3 TFEISESNLKNCNDEIESARKMILDGKIILCGTDTLYGLSTNALDKKAIEKIYSIKERDPNKPISISLGEKDQIENYVYVDKPAKKIIEKFMPGPITVILKKKDIIPDILGKNDVGVRIPDNDVIRKI--AIVPLTTTSANISGKTAPAS-LEEVDSIIKEKVDLIIDTGPCKYKVQSTIVKVIDGKIELIREGKIPFEDILRTVKE 206
>gi|116072664|ref|ZP_01469930.1| hypothetical protein BL107_09136 [Synechococcus sp. BL107] >gi|116064551|gb|EAU70311.1| hypothetical protein BL107_09136 [Synechococcus sp. BL107] (202 aa)
Score = 128, Expect = 6.8e-06, Identities = 40/110 (36%), Positives = 62/110 (56%)
  Q:    41 NLNGIVFEIKNLKAAIVSTDTVSGL--LSLNKPLIYKIKKRDKNKKLIRFVSNLDQIPE-----VNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSG 150
           ++  I   ++  +A I+ TDT+ GL  L  N   I+ +K+R  +K LI   + +D + E      +   K LA+K WPG +TL+                    R+P      NL+  +GPL +SSAN SG
  S:    11 SIASIARRLQASEAVIIPTDTLPGLAVLPQNAETIWTLKQRPADKPLILMGATVDALLEGVDSRCHNDAKTLAAKHWPGAITLVLPARGPYVDYLNPGGSNIGCRIPACAVTQNLLSFSGPLATSSANPSG 141
>gi|33866507|ref|NP_898066.1| hypothetical protein SYNW1975 [Synechococcus sp. WH 8102] >gi|33633285|emb|CAE08490.1| conserved hypothetical protein [Synechococcus sp. WH 8102] (201 aa)
Score = 128, Expect = 7.1e-06, Identities = 37/99 (37%), Positives = 60/99 (60%)
  Q:    54 AAIVSTDTVSGLLSLNKPL---IYKIKKRDKNKKLIRFVSNLDQI-----PEVNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSGNP 152
           AA++ TDTV GL ++  P    I+++K+R  +K LI   +  + +     P   +  + +A + WPG LTL+                    R+P+ +    L+ +TGPL +SSAN SG P
  S:    23 AAVIPTDTVPGL-AIAPPHAGDIWRLKRRPADKPLILMGATAEVLLRHAQPSCRDDARWMAERHWPGALTLVVPAHGAVLEALNPGGTCLGLRIPNCRQSRELLHRTGPLATSSANPSGEP 142
>gi|182623990|ref|ZP_02951778.1| Sua5/YciO/YrdC/YwlC family protein [Clostridium perfringens D str. JGS1721] >gi|177910883|gb|EDT73237.1| Sua5/YciO/YrdC/YwlC family protein [Clostridium perfringens D str. JGS1721] (350 aa)
Score = 128, Expect = 7.1e-06, Identities = 50/130 (38%), Positives = 75/130 (57%)
  Q:    36 EKDSSNLNGIVFEIKNLKAAIVSTDTVSGL--LSLNKPLIYKI---KKRDKNKKLIRFVSNLDQI----PEVNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFN 165
           +KD   L      IKN    +  T+TV GL   +L+   + KI   K R ++  LI  +++   I     E+ +  ++L  KFWPG LT+I KK+                RMP+D+  L LI+ +G P+ + SAN+SG P  T+I    E  N
  S:    12 DKDIKYLEEAAEIIKNGGIGVFPTETVYGLGANALDGEAVKKIFVAKGRPQDNPLIIHIADKKDIDKYVAEIPKYAQELMDKFWPGPLTIILKKKDIVSDVTSAGLDTVGVRMPNDEIALKLIELSGVPIAAPSANISGRPSPTDIERCEEDLN 165
>gi|14602037|ref|NP_148583.1| putative translation factor [Aeropyrum pernix K1] >gi|5106101|dbj|BAA81412.1| putative translation factor [Aeropyrum pernix K1] (367 aa)
Score = 128, Expect = 7.4e-06, Identities = 54/154 (35%), Positives = 82/154 (53%)
  Q:    59 TDTVSGL--LSLN---KPLIYKIKKRDKNKKLIRFVSNLDQ---IPEVNETFKKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTN--TLKREGEIKYEWIKKTIEE 212
           T+TV GL   +LN      I+++K R  +  LI  VS+L+    + E+     +L  K WPG LTL+  ++              + RMP  K  L L+   G P+ + SAN SG P  T+        +    D+I   G+ Y   + STI D+      L R G I  E +++ +EE
  S:    43 TETVYGLGADALNPRAAARIFEVKGRPPDNPLIVHVSSLEMARTVAEIPGKALRLVEKLWPGPLTLVLPRKPVVPDIVTAGLETVAVRMPAHKVALELVKAAGRPVAAPSANPSGRPSPTSGEHVIRDLD-CMVDVILDAGETYFGVE-STIIDLTRTPPVLLRPGPIPVEVLERLLEE 219
>gi|192809072|ref|ZP_03037747.1| Sua5/YciO/YrdC/YwlC family protein [Geobacillus sp. Y412MC10] >gi|192801743|gb|EDV78248.1| Sua5/YciO/YrdC/YwlC family protein [Geobacillus sp. Y412MC10] (392 aa)
Score = 128, Expect = 7.6e-06, Identities = 36/83 (43%), Positives = 49/83 (59%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQ----IPEVNETFKKLASKFWPGKLTLIYKKE---------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPIT 155
           I+  K R  +  LI  +S L Q    + +VNET + L + FWPG L+L+   +               + RMPD +  L LI   G PL + SAN SG P  T
  S:    86 IFAAKGRPSDNPLIVHISELAQLDGLVQQVNETERALMASFWPGPLSLVLPVKPGAVSPRVTAGLDTVAVRMPDHRVALALISAAGCPLAAPSANRSGRPSPT 188
>gi|46190984|ref|ZP_00120796.2| COG0009: Putative translation factor (SUA5) [Bifidobacterium longum DJO10A] (186 aa)
Score = 128, Expect = 8.2e-06, Identities = 43/141 (30%), Positives = 78/141 (55%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQIPEVN----ETFKKLASKFWPGKLTLIY-------------------KKESYRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDI-IFIEGDYYQNNQPSTI-----YDIDTNTLKREGEIKYEWIKKTIEEN 213
           IY++K+R + K L   +++ DQ+ E+         +L++ F PG  + I                      +  R+P+    L ++  TGPL +SSAN SG+     + +A ++F    S++ ++++G   Q +  ST+     Y  D   + REG I    I+K +  N
  S:    14 IYRLKRRPRYKALQVLLASTDQLDELGLDLPSPLNRLSAAFLPGAFSPIAVARPDCTLETLADTADGRPGTQGIRIPNSALCLAILKATGPLAASSANRSGDESAQTVQEAVDAFG---SEVDLYLDGGPTQGHVSSTVVKADPYARDGIEILREGVIAQNVIRKALHLN 180
>gi|76787929|ref|YP_329782.1| Sua5/YciO/YrdC/YwlC family protein [Streptococcus agalactiae A909] >gi|77405491|ref|ZP_00782583.1| Sua5/YciO/YrdC/YwlC family protein [Streptococcus agalactiae H36B] >gi|77408673|ref|ZP_00785406.1| Sua5/YciO/YrdC/YwlC family protein [Streptococcus agalactiae COH1] >gi|76562986|gb|ABA45570.1| Sua5/YciO/YrdC/YwlC family protein [Streptococcus agalactiae A909] >gi|77172721|gb|EAO75857.1| Sua5/YciO/YrdC/YwlC family protein [Streptococcus agalactiae COH1] >gi|77175888|gb|EAO78665.1| Sua5/YciO/YrdC/YwlC family protein [Streptococcus agalactiae H36B] (198 aa)
Score = 127, Expect = 9.1e-06, Identities = 52/159 (32%), Positives = 84/159 (52%)
  Q:    54 AAIVSTDTVSGLLSLNKPL-------IYKIKKRDKNKKLIRFVSNLDQIPEVNET----FKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLK--REGEIKYEWIKKTIEE 212
           A I+ T+TV G+ +  K L       +Y++KKR ++K +   + + + I + ++      K+L   F PG LT+I +                 +RMP     L++I   GPL   SAN+SG        +  + FN     ++ IE D       STI D+  + +K  R+G I  E +  TI E
  S:    13 AVIMPTETVYGIFA--KALSEEAVNHVYELKKRPRDKAMNLNICDFETILKYSKNQPTYLKQLYDAFLPGPLTIILEASQEVPDWINSGLSSVGFRMPKHPVTLDMIANHGPLIGPSANISGCDSGRVFSEIQKQFNH---QVLGIEDDKALTGVDSTIIDLSGDRVKILRQGAITQEVLTATIPE 193
>gi|148272340|ref|YP_001221901.1| hypothetical protein CMM_1160 [Clavibacter michiganensis subsp. michiganensis NCPPB 382] >gi|147830270|emb|CAN01204.1| conserved hypothetical protein [Clavibacter michiganensis subsp. michiganensis NCPPB 382] (309 aa)
Score = 127, Expect = 9.1e-06, Identities = 40/112 (35%), Positives = 63/112 (56%)
  Q:    53 KAAIVSTDTVSGLLS-------LNKPLIYKIKKRDKNKK-LIRFVSNLDQIPE-VNETFKKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESF 164
           +  ++ TDTV G+ +       + + L  K + RD     LI   S LD + + V +  ++L  +FWPG LT+I   +              + RMP + F L L+ +TGPL  SSAN +G P      +A +  
  S:    28 EVVVIPTDTVYGIAADAFNPDAVQRLLDAKGRGRDAPPPVLIPGQSTLDALADFVPDVVRRLVDEFWPGGLTVILVAQPSLVWDLGETRGTVALRMPANSFALELLAETGPLAVSSANRTGQPAAATAQEAVDQL 162
>gi|118089561|ref|XP_420283.2| PREDICTED: hypothetical protein [Gallus gallus] (687 aa)
Score = 127, Expect = 9.1e-06, Identities = 42/94 (44%), Positives = 58/94 (61%)
  Q:    57 VSTDTVSGLL-SLNKPL----IYKIKKRDKNKKLIRFVSNLDQI----PEVNETFKKLASKFWPGKLTLIYKK----------ESY-----------RMPDDKFILNLIDKTGPLYSSSANLSG 150
           V TDTV  L  S   P     +Y+IK R + K +  F+SNLDQ+    P ++    +     +PG +  I KK          E Y           R+PD   +++LID TGPL  +SAN SG
  S:   493 VPTDTVYALAASCRHPQAIEKVYRIKDRPQEKPICIFISNLDQLRAAAPPISPLLWEFMENVYPGGVGCIIKKGEWLKKLGVGEGYSRVGTQDSIMIRVPDLTVLVHLIDMTGPLAITSANPSG 616
>gi|167038488|ref|YP_001666066.1| Sua5/YciO/YrdC/YwlC family protein [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|166857322|gb|ABY95730.1| Sua5/YciO/YrdC/YwlC family protein [Thermoanaerobacter pseudethanolicus ATCC 33223] (354 aa)
Score = 127, Expect = 9.1e-06, Identities = 61/186 (32%), Positives = 91/186 (48%)
  Q:    25 KNYPKKEFVTYEKDSSNLNGIVFEIKNLKAAIVSTDTVSGL--LSLNKPLIYKI---KKRDKNKKLIRFVSNLDQI----PEVNETFKKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTN--TLKREGEIKYEWIKKTI 210
           KN P+ E + +        G+V            T+TV G+   S N+  I KI   K R ++  LI  ++ L+QI     EV +  K L  KFWPG LTLI+KK               + RMP +     LI +   P+ + SAN+SG P  T+     E    Y    + I+G        ST+ D+      + R G +  E +++ I
  S:     9 KNNPEIELIDFAAKVIKEGGLV---------AFPTETVYGIGANSFNEEAIKKIFIAKGRPQDNPLIVHIAELEQIYDLVKEVPQKAKTLMKKFWPGPLTLIFKKSQKVPYVNTAGMDTVAIRMPSNTIAHLLIKRAEVPISAPSANVSGKPSPTDASHVIEDL--YGKVDVIIDGGKCDVGVESTVLDLTEKVPVILRPGAVTLEMLREVI 209
>gi|81428744|ref|YP_395744.1| Sua5 family translation factor [Lactobacillus sakei subsp. sakei 23K] >gi|78610386|emb|CAI55436.1| Putative translation factor, SUA5 family [Lactobacillus sakei subsp. sakei 23K] (342 aa)
Score = 127, Expect = 1.0e-05, Identities = 33/83 (39%), Positives = 48/83 (57%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQIPEV----NETFKKLASKFWPGKLTLI---------------YKKESYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPIT 155
           +Y  K R  +  LI  V++++ +       N  F +L   FWPG LT+I                K  ++RMPD++  L+LI   G P+   SAN SG P  T
  S:    47 VYAAKGRPSDNPLIVHVASVETVEHYAVTSNPAFGQLVKAFWPGSLTIILPLKHGAFDAVVTGGLKTAAFRMPDNQVTLSLIKAAGVPIVGPSANTSGKPSPT 149
>gi|150401886|ref|YP_001325652.1| Sua5/YciO/YrdC/YwlC family protein [Methanococcus aeolicus Nankai-3] >gi|150014589|gb|ABR57040.1| Sua5/YciO/YrdC/YwlC family protein [Methanococcus aeolicus Nankai-3] (341 aa)
Score = 127, Expect = 1.1e-05, Identities = 55/139 (39%), Positives = 79/139 (56%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLD---QIPEVNETFKKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLK--REGEIKYEWIKKTIE 211
           I+K+K R  +  LI  V+NL+   +I  + E  K L  KF PG LT+I KK+              + R+P++K  L LI+K   P+ + SANLSG P  TNI    +      +    IEG+     + ST+ D+     K  R G I YE +KK I+
  S:    47 IFKVKGRPIDNPLIIHVNNLEMANKIAHITENAKILLQKFSPGPLTIILKKKEVVPAITCANLDTVAVRIPNNKIALELIEKANTPIAAPSANLSGKPSPTNIQHIIDDLGDKIN--YAIEGETTIGVE-STVLDLTEKKPKILRYGSITYEDLKKVID 202
>gi|159902895|ref|YP_001550239.1| putative translation factor (SUA5) [Prochlorococcus marinus str. MIT 9211] >gi|159888071|gb|ABX08285.1| Putative translation factor (SUA5) [Prochlorococcus marinus str. MIT 9211] (196 aa)
Score = 127, Expect = 1.1e-05, Identities = 41/116 (35%), Positives = 64/116 (55%)
  Q:    38 DSSNLNGIVFEIKNLKAAIVSTDTVSGLLSLNK--PLIYKIKKRDKNKKLIRFVSNLDQI-----PEVNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPP 153
           DS NL   V ++      +  TDT+  L +L K    +++IK R + K LI    +  Q+     P V E    +A+++WPG LT++    S               R+P+       + K+GPL ++SANLSG  P
  S:     7 DSCNL---VKKLNEGSPVVFPTDTLPALAALPKHSSQLWEIKNRSRMKPLILMGESPKQLFKFVYPNVLEDAIYMANRYWPGPLTMVLPSSSNLVGLLNPGGSSIGLRIPECDLAKKFLAKSGPLATTSANLSGQKP 140
>gi|186683986|ref|YP_001867182.1| SUA5/yciO/yrdC domain-containing protein [Nostoc punctiforme PCC 73102] >gi|186466438|gb|ACC82239.1| SUA5/yciO/yrdC, N-terminal domain protein [Nostoc punctiforme PCC 73102] (225 aa)
Score = 126, Expect = 1.1e-05, Identities = 36/106 (33%), Positives = 61/106 (57%)
  Q:    59 TDTVSGLLSLNKP--LIYKIKKRDKNKKLIRFVSNLDQI-----PEVNE--TFKKLASKFWPGKLTLIYKKES---------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESF 164
           TDTV  L ++ +   LI+  K+R ++K LI   ++ + +        NE   +++L  K WPG LTL+                     R+P+      ++ +TGPL ++SAN SG PP+  + +    F
  S:    46 TDTVPALAAIPEKAGLIFAAKQRSQDKPLILMAASAEDLWLYVKGSENEYKVWQELVGKHWPGGLTLVLPASERLPKVMNPIDPTTIGIRVPNSAIARTILAQTGPLATTSANFSGQPPLQTMAEIETQF 175
>gi|17227612|ref|NP_484160.1| hypothetical protein alr0116 [Nostoc sp. PCC 7120] >gi|17135094|dbj|BAB77640.1| alr0116 [Nostoc sp. PCC 7120] (194 aa)
Score = 126, Expect = 1.3e-05, Identities = 43/118 (36%), Positives = 67/118 (56%)
  Q:    59 TDTVSGLLSL--NKPLIYKIKKRDKNKKLIRF-VSNLDQIPEV------NETFKKLASKFWPGKLTLIYKKES---------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNI--IDA-FESFNKYKSDIIFIEG 176
           TDTV  L +L     LI+  K+R ++K LI    S  D  P V       + ++++ S++WPG LTL+                     R+P       ++ +TGPL ++SAN SG P +  +  IDA F +    +S  +  EG
  S:    23 TDTVPALATLPEQAELIFAAKQRSQDKPLILMGASAEDLWPYVEGREQDKQIWEQVVSQYWPGALTLVVPASKRVPEVMNPIDPTTIGIRVPKSAIAQKILSQTGPLATTSANFSGQPALLTMAEIDAQFPTVLTLESTAVEAEG 167
>gi|116629881|ref|YP_815053.1| putative translation factor (SUA5) [Lactobacillus gasseri ATCC 33323] >gi|116095463|gb|ABJ60615.1| translation factor SUA5 [Lactobacillus gasseri ATCC 33323] (334 aa)
Score = 126, Expect = 1.3e-05, Identities = 59/154 (38%), Positives = 83/154 (53%)
  Q:    59 TDTVSGL--LSLNKPLI---YKIKKRDKNKKLIRFVSNL----DQIPEVNETFKKLASKFWPGKLTLI-YKKE--------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYD--IDTNTLKREGEIKYEWIKKTIEE 212
           T+TV GL  L+ N+  +   Y  K R  +  LI  VS+     + + EV E  KKL   FWPG LT+I + KE              ++R PDD+   +LI + G P+   SAN S  P  T     +       + I  I+    +    STI D  ++T T+ R GEI  E I K + E
  S:    32 TETVYGLGALATNEKAVKGVYAAKGRPSDNPLIVTVSDEKMMENYVNEVPERAKKLIKHFWPGPLTIILFVKEGTLPDAVTGGLPTAAFRCPDDELTHDLISELGKPIVGPSANTSTKPSPTTAGHVYHDLKGKIAGI--IDNGPTEIGLESTIVDLSVETPTVLRPGEITPEEISKVLGE 210
>gi|119715988|ref|YP_922953.1| translation factor SUA5 [Nocardioides sp. JS614] >gi|119536649|gb|ABL81266.1| translation factor SUA5 [Nocardioides sp. JS614] (219 aa)
Score = 126, Expect = 1.4e-05, Identities = 36/109 (33%), Positives = 59/109 (54%)
  Q:   103 KKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDI-IFIEGDYYQNNQPSTIYDID--TNTLKREGEIKYEWIKKTIE 211
           + L   FWPG LTL+  ++S               RMPD      ++++TGPL  SSAN +G P  T   DA ++ +    D+ + ++G      + STI D+      + R G +  E + + +E
  S:    87 RALVEAFWPGPLTLVCHQQSSLQWDLGDTRGTVAVRMPDHDVAREILERTGPLAVSSANKTGMPAAT---DADQAEDMLGDDVAVIVDGGPAPGGEASTIVDVTGAQGRVLRRGALSLERLNEVLE 209
>gi|189911316|ref|YP_001962871.1| Translation factor, SUA5 family [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] >gi|167775992|gb|ABZ94293.1| Translation factor, SUA5 family [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] (338 aa)
Score = 125, Expect = 1.5e-05, Identities = 38/103 (36%), Positives = 56/103 (54%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQIPEV---NETFKKLASKFWPGKLTLIYKKE------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIE 175
           IY+IK R  +  LI   S++D I +V   NE   +L  +F PG  TL+  K             + R+P +  I   I+  G P+ + SANLSG P +T + D    F+     I+  E
  S:    45 IYQIKGRPSDNPLIAHFSSIDAIKKVCYVNEVANQLLCEFSPGPFTLVLPKTDPKIFPKQLPTLAVRIPKNPVIREWIEACGSPISAPSANLSGRPSLTRMTDVVRYFDGIVDGILIAE 163
>gi|78185423|ref|YP_377858.1| hypothetical protein Syncc9902_1857 [Synechococcus sp. CC9902] >gi|78169717|gb|ABB26814.1| conserved hypothetical protein [Synechococcus sp. CC9902] (202 aa)
Score = 125, Expect = 1.5e-05, Identities = 37/98 (37%), Positives = 58/98 (59%)
  Q:    53 KAAIVSTDTVSGL--LSLNKPLIYKIKKRDKNKKLIRFVSNLDQIPE-----VNETFKKLASKFWPGKLTLIYKKESY--------------RMPDDKFILNLIDKTGPLYSSSANLSG 150
           +A I+ TDT+ GL  L  N   I+ +K+R  +K LI   + ++ + E      ++  K +A+K WPG +TL+                    R+P      NL+  +GPL +SSAN SG
  S:    23 EAVIIPTDTLPGLAVLPQNANTIWTLKQRPADKPLILMGATVEALLEGVDSCCHDDAKTMATKHWPGAITLVLPARGIYVDYLNPGGSNIGCRIPACAITQNLLSISGPLATSSANPSG 141
>gi|184154905|ref|YP_001843245.1| hypothetical protein LAF_0429 [Lactobacillus fermentum IFO 3956] >gi|183226249|dbj|BAG26765.1| conserved hypothetical protein [Lactobacillus fermentum IFO 3956] (343 aa)
Score = 125, Expect = 1.6e-05, Identities = 46/138 (33%), Positives = 72/138 (52%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQI----PEVNETFKKLASKFWPGKLTLIYKKE---------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQP------STIYDIDTN--TLKREGEIKYEWIKKTI 210
           +Y  K R  +  LI  VS+L  +     E+    K+L  +FWPG LT+I + +               ++R PD +  L+LI + G P+   SAN SG P  T     +   N   + II        +N P      ST+ D+ T+   + R G +  + I+  I
  S:    48 VYLAKGRPSDNPLIVHVSSLAMVEHFAAEIPAKAKQLMDRFWPGSLTIILRVKPGTLSKTVTGGLDTVAFRFPDCQPTLDLISQAGVPIVGPSANTSGKPSPTTANHVYHDLNNKIAGII--------DNGPTRVGVESTVLDMSTSQPVILRPGAVTKQDIEGVI 205
>gi|183221225|ref|YP_001839221.1| putative translation factor SUA5 [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] >gi|167779647|gb|ABZ97945.1| Putative translation factor SUA5 [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] (318 aa)
Score = 125, Expect = 1.6e-05, Identities = 38/103 (36%), Positives = 56/103 (54%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQIPEV---NETFKKLASKFWPGKLTLIYKKE------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIE 175
           IY+IK R  +  LI   S++D I +V   NE   +L  +F PG  TL+  K             + R+P +  I   I+  G P+ + SANLSG P +T + D    F+     I+  E
  S:    25 IYQIKGRPSDNPLIAHFSSIDAIKKVCYVNEVANQLLCEFSPGPFTLVLPKTDPKIFPKQLPTLAVRIPKNPVIREWIEACGSPISAPSANLSGRPSLTRMTDVVRYFDGIVDGILIAE 143
>gi|134046516|ref|YP_001098001.1| translation factor SUA5 [Methanococcus maripaludis C5] >gi|132664141|gb|ABO35787.1| translation factor SUA5 [Methanococcus maripaludis C5] (205 aa)
Score = 125, Expect = 1.6e-05, Identities = 68/178 (38%), Positives = 99/178 (55%)
  Q:    34 TYEKDSSNLNGIVFEIKNLKAAIVS-------TDTVSGLLS--LNKPLI---YKIKKRDKNKKLIRFVSNLDQIPE---VNETFKKLASKFWPGKLTLIYKKES------------YRMPDDKFILNLIDKTGPLYSSSANLSG-NPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNT-LKREGEIKYEWIKKTIE 211
           T+E   SNL     EI+  K  I+        TDT+ GL +  L+K  I   Y IK+RD NK +   +    QI     V ET KK+  KF PG +T+I KK+              R+PD+  I  +     PL ++SAN+SG   PI+  ++  +S  K K D+I   G      Q + +  I     L REG+I +E I K+++
  S:     3 TFEISESNLKNCNEEIETAKKMILGGKIILCGTDTLYGLSTNALDKKAIERIYSIKERDPNKPISISLGEKKQIENYVYVGETAKKIIEKFMPGPITVILKKKDIIPDILGKDDVGVRIPDNDVIRKI--AIVPLTTTSANISGKTAPIS--LEEVDSVIKEKVDLIIDTGPSKYKVQSTIVKVIGGKIELIREGKIPFEEILKSVK 205
>gi|50122916|ref|YP_052083.1| putative DNA topoisomerase [Pectobacterium atrosepticum SCRI1043] >gi|49613442|emb|CAG76893.1| putative DNA topoisomerase [Erwinia carotovora subsp. atroseptica SCRI1043] (372 aa)
Score = 125, Expect = 1.6e-05, Identities = 50/155 (32%), Positives = 79/155 (50%)
  Q:    45 IVFEIKNLKAAIVSTDTVSGL-------LSLNKPLIYKIKKRDKNKKLIRFVSNLDQ-IPEVNETF-----KKLASKFWPGKLTLI--------------YKKESYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKREG 199
           ++ E+ N +     T+ V GL       +++N+ L   +K+R   K LI   +N  Q +P +N++      K +    WPG +T +              +   + R+ D   +  L    G PL S+SANLSG PP      A E   ++  D   + GD      PS I D+ T  L R+G
  S:   195 VLRELHNEQVIAYPTEAVFGLGCDPDSEVAVNRLL--ALKQRPWQKGLILIAANFSQLVPYINDSALSDEQKAMMFSTWPGPVTWVLPAKPTTPQWLTGQFSSLAVRVSDHPLVKELCQHYGKPLVSTSANLSGQPPCRT---AQEVSLQFGGDFPVLVGDVGGRMNPSEIRDVLTGELIRQG 372
>gi|28210066|ref|NP_781010.1| SUA5 protein [Clostridium tetani E88] >gi|28202501|gb|AAO34947.1| SUA5 protein [Clostridium tetani E88] (350 aa)
Score = 125, Expect = 1.6e-05, Identities = 63/159 (39%), Positives = 87/159 (54%)
  Q:    49 IKNLKAAIVSTDTVSGL--LSLNKPLIYKI---KKRDKNKKLIRFVSNLDQI-PEVNETFK---KLASKFWPGKLTLIYKKESY--------------RMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYD--IDTNTLKREGEIKYEWIK 207
           ++N K  +  T+TV GL   +L +  + KI   K R ++  LI  +S L++I P V E  K   KL  KFWPG +T+I  K S               RMP ++    LI +   P+ + SAN+SG P  TNI    E   K K D I I G+       ST+ D  I    + R G I  E +K
  S:    25 LRNGKLVVFPTETVYGLGANALKEDAVKKIFEAKGRPQDNPLIVHISELEEIAPLVEEVPKIAYKLMEKFWPGPMTIILPKSSLIPSRTSGGLNSVGIRMPSNEIARKLIKEAKVPIAAPSANISGRPSPTNIETCIEDL-KGKVDYI-IGGEKCDVGVESTVIDCTIYPPCVLRPGGITLEMLK 207
>gi|146296540|ref|YP_001180311.1| Sua5/YciO/YrdC/YwlC family protein [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145410116|gb|ABP67120.1| translation factor SUA5 [Caldicellulosiruptor saccharolyticus DSM 8903] (348 aa)
Score = 125, Expect = 1.6e-05, Identities = 57/154 (37%), Positives = 88/154 (57%)
  Q:    59 TDTVSGL--LSLNKPLIYKI---KKRDKNKKLIRFVSN---LDQIPEV-NETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNT--LKREGEIKYEWIKKTIEE 212
           T+TV GL   +L K  + KI   K R ++  LI  +S+   LD   +V +E   KL  KFWPG LT++  K+                RMP++K  L LI+  G P+ + SAN+SG P  T      E     K D+I I+G        ST+ D+ ++   + R G + +  +K+ +E+
  S:    33 TETVYGLGANALLKEAVDKIFVAKGRPQDNPLIVHISSKKMLDMCAKVTDERVYKLIEKFWPGPLTIVLPKKECIPDNVTAGLNTVGIRMPNNKIALELIELAGVPVAAPSANVSGKPSPTEAQHVIEDLFG-KVDVI-IDGGKCSFGLESTVIDLSSSKPYILRPGAVPFSILKEILED 210
>gi|11498387|ref|NP_069615.1| hypothetical protein AF0781 [Archaeoglobus fulgidus DSM 4304] >gi|2649831|gb|AAB90461.1| conserved hypothetical protein [Archaeoglobus fulgidus DSM 4304] (309 aa)
Score = 125, Expect = 1.8e-05, Identities = 51/139 (36%), Positives = 74/139 (53%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLD---QIPEVNETFKKLASKFWPGKLTLIYK-------------KESYRMPDDKFILNLIDK-TGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLK--REGEIKYEWIKKTIE 211
           +Y+IK R  NK  I  V + D   +I EV+E  +KL   F+PG LTL+ K             K + RMP  +  L L++    P+   SANLSG P +       E     + D + ++G+  +    STI D+     K  R G +  E IKK +E
  S:    48 LYEIKGRSLNKPFIVGVWSRDYVGKIAEVDERAEKLMEAFFPGPLTLVLKSKGVMPSLLSPKGKIAVRMPAHEVPLQLMEMLRKPIVVPSANLSGRPSLMRWEHVVEELGS-RIDAV-VKGE-CKVGVESTIVDLTETPAKVLRVGAVSVESIKKHVE 202
>gi|182420265|ref|ZP_02951494.1| Sua5/YciO/YrdC/YwlC family protein [Clostridium butyricum 5521] >gi|182375860|gb|EDT73452.1| Sua5/YciO/YrdC/YwlC family protein [Clostridium butyricum 5521] (349 aa)
Score = 125, Expect = 1.8e-05, Identities = 60/150 (40%), Positives = 89/150 (59%)
  Q:    59 TDTVSGLLS--LNKPLIYKI---KKRDKNKKLIRFVSN------LDQIPEVNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYD--IDTNTLKREGEIKYEWIKK 208
           T+TV GL +  LN+  + KI   K R ++  LI  V++      +D+IPE+    K+L  KFWPG LT+I KK                 RMPD++    LI+ +G  + + SAN+SG P  T+I    E  +  + D I I G + +    STI D  +D   + R G I  E +K+
  S:    35 TETVYGLGADALNEDAVKKIFVAKGRPQDNPLIIHVASKNIEHYVDEIPEIA---KELMDKFWPGPLTIILKKNDIIPNITSASLDSIGVRMPDNEIARKLIELSGTTIAAPSANISGRPSPTDIERCVEDLDG-RVDYI-IGGCHSKIGVESTIVDCTVDPPLVLRPGGITLEMLKE 207
>gi|168205563|ref|ZP_02631568.1| Sua5/YciO/YrdC/YwlC family protein [Clostridium perfringens E str. JGS1987] >gi|169344175|ref|ZP_02865157.1| Sua5/YciO/YrdC/YwlC family protein [Clostridium perfringens C str. JGS1495] >gi|169297633|gb|EDS79733.1| Sua5/YciO/YrdC/YwlC family protein [Clostridium perfringens C str. JGS1495] >gi|170662901|gb|EDT15584.1| Sua5/YciO/YrdC/YwlC family protein [Clostridium perfringens E str. JGS1987] (350 aa)
Score = 125, Expect = 1.8e-05, Identities = 50/130 (38%), Positives = 74/130 (56%)
  Q:    36 EKDSSNLNGIVFEIKNLKAAIVSTDTVSGL--LSLNKPLIYKI---KKRDKNKKLIRFVSNLDQI----PEVNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFN 165
           +KD   L      IKN       T+TV GL   +L+   + KI   K R ++  LI  +++   I     E+ +  ++L  KFWPG LT+I KK+                RMP+D+  L LI+ +G P+ + SAN+SG P  T+I    E  N
  S:    12 DKDIKYLEEAAEIIKNGGIGAFPTETVYGLGANALDGEAVKKIFVAKGRPQDNPLIIHIADKKDIDKYVAEIPKYAQELMDKFWPGPLTIILKKKDIVSDVTSAGLDTVGVRMPNDEIALKLIELSGVPIAAPSANISGRPSPTDIERCEEDLN 165
>gi|34763117|ref|ZP_00144087.1| SUA5 protein [Fusobacterium nucleatum subsp. vincentii ATCC 49256] >gi|27887215|gb|EAA24316.1| SUA5 protein [Fusobacterium nucleatum subsp. vincentii ATCC 49256] (217 aa)
Score = 125, Expect = 1.8e-05, Identities = 60/163 (36%), Positives = 91/163 (55%)
  Q:    48 EIKNLKAAIVSTDTVSGL-------LSLNKPLIYKIKKRDKNKKLIRFVSNLDQIPEV-------NETFKKLASKFWPGKLTLIYKKESY--------------RMPDDKFILNLIDKTGP-LYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLK--REGEIKYEWIKKTI 210
           EIK     I  TDTV GL        S+N   IY  K R     LI  +S++D++ EV           +KLA  FWPG LT+I K++ +              R+P+    + +I+  G  L ++SAN+SG     +  +  E+  K K DI+   G+  +  + STI D+ ++  K  R+G I    I+K I
  S:    24 EIKKGSLIIYPTDTVYGLGAIVTNEQSINN--IYLAKSRSFTSPLIALLSSVDKVEEVAYVSDKNKNLLEKLAKAFWPGALTVILKRKEHIPSIMVSGGDTIGVRIPNLDLAIKIIELAGGILATTSANISGEATPKSYDELSEAI-KSKVDILIDSGE-CKLGEASTIIDLTSDVPKILRKGAISIGEIEKII 213
>gi|187250922|ref|YP_001875404.1| Sua5/YciO/YrdC/YwlC family protein [Elusimicrobium minutum Pei191] >gi|186971082|gb|ACC98067.1| Sua5/YciO/YrdC/YwlC family protein [Elusimicrobium minutum Pei191] (210 aa)
Score = 125, Expect = 1.8e-05, Identities = 55/168 (32%), Positives = 91/168 (54%)
  Q:    46 VFEIKNLKAAIVSTDTVSGLLS--LNKPLIYK---IKKRDKNKKLIRFVSNLD---QIPEVNETFKKLASKFWPGKLTLI-------------YKKESYRMPDDKFILNLIDKTGPL-YSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKREGEIKYEWIKKTIEEN 213
           V ++KN    I  TDTV G+++  LN   + +   IK++  +  L    S++    +I   +     LA K+WPG LT+I             +     R+P + FI NL++  G +  +SSANL   P I +  +  + FN  K D IF  G +  +++ ST+  ++   + REG IK + +     EN
  S:    20 VNDLKNGAVIIAPTDTVYGIMADALNPQAVKRMCEIKQKPSDVPLQYLASDIKYAKRIALFSPKATLLAEKYWPGPLTIIVPPSKEGKKYLRGFDTLGIRVPKNDFIANLLNAFGGVAAASSANLHSKPVINSQEELIKEFNG-KVDYIFTGGQF--SSESSTVLSLEPFKIFREGGIKEKDVLNFFAEN 206
>gi|110800830|ref|YP_696878.1| Sua5/YciO/YrdC/YwlC family protein [Clostridium perfringens ATCC 13124] >gi|168210129|ref|ZP_02635754.1| Sua5/YciO/YrdC/YwlC family protein [Clostridium perfringens B str. ATCC 3626] >gi|110675477|gb|ABG84464.1| Sua5/YciO/YrdC/YwlC family protein [Clostridium perfringens ATCC 13124] >gi|170711785|gb|EDT23967.1| Sua5/YciO/YrdC/YwlC family protein [Clostridium perfringens B str. ATCC 3626] (350 aa)
Score = 124, Expect = 2.0e-05, Identities = 50/130 (38%), Positives = 74/130 (56%)
  Q:    36 EKDSSNLNGIVFEIKNLKAAIVSTDTVSGL--LSLNKPLIYKI---KKRDKNKKLIRFVSNLDQI----PEVNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFN 165
           +KD   L      IKN       T+TV GL   +L+   + KI   K R ++  LI  +++   I     E+ +  ++L  KFWPG LT+I KK+                RMP+D+  L LI+ +G P+ + SAN+SG P  T+I    E  N
  S:    12 DKDIKYLEEAAEIIKNGGIGAFPTETVYGLGANALDGEAVKKIFVAKGRPQDNPLIIHIADKKDIDKYVAEIPKYAQELMDKFWPGPLTIILKKKDIVSDVTSAGLDTVGVRMPNDEIALKLIELSGVPIAAPSANISGRPSPTDIERCEEDLN 165
>gi|110802725|ref|YP_699474.1| Sua5/YciO/YrdC/YwlC family protein [Clostridium perfringens SM101] >gi|110683226|gb|ABG86596.1| Sua5/YciO/YrdC/YwlC family protein [Clostridium perfringens SM101] (350 aa)
Score = 124, Expect = 2.0e-05, Identities = 50/130 (38%), Positives = 74/130 (56%)
  Q:    36 EKDSSNLNGIVFEIKNLKAAIVSTDTVSGL--LSLNKPLIYKI---KKRDKNKKLIRFVSNLDQI----PEVNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFN 165
           +KD   L      IKN       T+TV GL   +L+   + KI   K R ++  LI  +++   I     E+ +  ++L  KFWPG LT+I KK+                RMP+D+  L LI+ +G P+ + SAN+SG P  T+I    E  N
  S:    12 DKDIKYLEEAAEIIKNGGIGAFPTETVYGLGANALDGEAVKKIFVAKGRPQDNPLIIHIADKKDIDKYVAEIPKYAQELMDKFWPGPLTIILKKKDIVSDVTSAGLDTVGVRMPNDEIALKLIELSGVPIAAPSANISGRPSPTDIERCEEDLN 165
>gi|18311182|ref|NP_563116.1| Sua5/YciO/YrdC/YwlC family protein [Clostridium perfringens str. 13] >gi|18145865|dbj|BAB81906.1| conserved hypothetical protein [Clostridium perfringens str. 13] (350 aa)
Score = 124, Expect = 2.0e-05, Identities = 50/130 (38%), Positives = 74/130 (56%)
  Q:    36 EKDSSNLNGIVFEIKNLKAAIVSTDTVSGL--LSLNKPLIYKI---KKRDKNKKLIRFVSNLDQI----PEVNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFN 165
           +KD   L      IKN       T+TV GL   +L+   + KI   K R ++  LI  +++   I     E+ +  ++L  KFWPG LT+I KK+                RMP+D+  L LI+ +G P+ + SAN+SG P  T+I    E  N
  S:    12 DKDIKYLEEAAEIIKNGGIGAFPTETVYGLGANALDGEAVKKIFVAKGRPQDNPLIIHIADKKDIDKYVAEIPKYAQELMDKFWPGPLTIILKKKDIVSDVTSAGLDTVGVRMPNDEIALKLIELSGVPIAAPSANISGRPSPTDIERCEEDLN 165
>gi|148322438|gb|EDK87688.1| possible translation factor Sua5 [Fusobacterium nucleatum subsp. polymorphum ATCC 10953] (217 aa)
Score = 124, Expect = 2.1e-05, Identities = 55/149 (36%), Positives = 83/149 (55%)
  Q:    48 EIKNLKAAIVSTDTVSGL-------LSLNKPLIYKIKKRDKNKKLIRFVSNLDQIPEV-------NETFKKLASKFWPGKLTLIYKKESY--------------RMPDDKFILNLIDKTGP-LYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLK 196
           EIK     I  TDTV GL        S+N   +Y  K R     LI  +S++D++ EV        E   KLA  FWPG LT+I K++ +              R+P+    + +ID  G  L ++SAN+SG     +  +  E+  K K DI+   G+  +  + STI D+ ++  K
  S:    24 EIKKGSLIIYPTDTVYGLGAIVTNEQSINN--VYLAKSRSFTSPLIALLSSVDKVEEVAYVSDKNKELLDKLAKAFWPGALTVILKRKEHIPSIMVSGGDTIGVRIPNLDLAIKIIDLAGGILATTSANISGEATPKSYDELSEAI-KSKVDILIDSGE-CKLGEASTIIDLTSDVPK 197
>gi|166033062|ref|ZP_02235891.1| hypothetical protein DORFOR_02784 [Dorea formicigenerans ATCC 27755] >gi|166027419|gb|EDR46176.1| hypothetical protein DORFOR_02784 [Dorea formicigenerans ATCC 27755] (353 aa)
Score = 124, Expect = 2.1e-05, Identities = 57/154 (37%), Positives = 83/154 (53%)
  Q:    59 TDTVSGLLS--LNKPL---IYKIKKRDKNKKLIRFVSN---LDQIPEV-NETFKKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTGP-LYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTN--TLKREGEIKYEWIKKTIEE 212
           T+TV GL +  LNK     IY  K R  +  LI  ++N   LD+I ++  E   K+A  +WPG LT+I++K               + RMP D+    LID  G  + + SAN SG P  T      E  +  K ++I ++G        STI D+      + R G I  E + + I E
  S:    39 TETVYGLGADALNKTASTKIYAAKGRPSDNPLIVHITNMGALDKIADIIPEVAYKVADAYWPGPLTMIFQKTEEVPYETTGGLDTVAVRMPSDEIARALIDAGGGYIAAPSANTSGRPSPTKAEHVEEDLSG-KIEMI-LDGGAVDIGVESTILDMTVTPPMILRPGAITKEMLTELIGE 216
>gi|159111922|ref|XP_001706191.1| SUA5 protein [Giardia lamblia ATCC 50803] >gi|157434285|gb|EDO78517.1| SUA5 protein [Giardia lamblia ATCC 50803] (406 aa)
Score = 124, Expect = 2.2e-05, Identities = 48/157 (30%), Positives = 84/157 (53%)
  Q:    57 VSTDTVSGLLS--LNKPL---IYKIKKRDKNKKLIRFVSNLDQIP-------EVNETFKKLASKFWPGKLTLIY--------------KKESYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTN--TLKREGEIKYEWIKKTIEEN 213
           + T+TV GL +  L++     I+ +K+R  N  LI  +S++ Q+P       E++     LA+ FWPG LT++               +    RMP       +++    PL + SAN+ G+   T   D    F    SD++ I+G        ST+  ++ +  T+ R G++  E +  T+  N
  S:    65 IPTETVYGLAADALSEAACAKIFTLKQRPANDPLIVHISHISQLPMVAVVSVELSSIVDALAAAFWPGPLTMVLPAAPCVPSIVTAGSQTIGVRMPRHPVACAILELAARPLAAPSANMFGSISPTQAEDVAAEF--VNSDLLIIDGGRCDIGIESTVLLVEKDCLTILRRGQVNEEMLVATLPTN 248
>gi|50842729|ref|YP_055956.1| SUA5 related protein [Propionibacterium acnes KPA171202] >gi|50840331|gb|AAT82998.1| SUA5 related protein [Propionibacterium acnes KPA171202] (307 aa)
Score = 124, Expect = 2.4e-05, Identities = 49/153 (32%), Positives = 87/153 (56%)
  Q:    56 IVSTDTVSGL-------LSLNKPLIYKIKKRDKNKKLIRFVSNLDQIPEVNETF----KKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDI-IFIEGDYYQNNQPSTIYDIDTNT---LKREGEIKYEWIKK 208
           ++ TDTV G+       L++ + L  K + RD    ++  VS+   +P + +      K LA K+WPG LTL+ + +              + R+PD      L+  TGPL  SSAN SG+P     + A E+ ++   ++ ++++    +  + STI D  + T   + R+G +  E I +
  S:    92 VLPTDTVYGIGADALNALAVQRLLNAKERGRDMPPPVL--VSDSVALPALCQHIPAGAKALAEKYWPGGLTLVLRAQESLGMDLGETNGTLAVRVPDQDQTRELLRMTGPLAVSSANKSGHPA---ALTAQEAADQLGVEVAVYLDAGPSRVGESSTIIDFVSTTDGKVVRQGALSLEAIHE 268
>gi|153853663|ref|ZP_01995043.1| hypothetical protein DORLON_01034 [Dorea longicatena DSM 13814] >gi|149753818|gb|EDM63749.1| hypothetical protein DORLON_01034 [Dorea longicatena DSM 13814] (353 aa)
Score = 123, Expect = 2.6e-05, Identities = 58/154 (37%), Positives = 83/154 (53%)
  Q:    59 TDTVSGL--LSLNKPL---IYKIKKRDKNKKLIRFVSN---LDQI-PEVNETFKKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTGP-LYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTN--TLKREGEIKYEWIKKTIEE 212
           T+TV GL   +LN+     IY  K R  +  LI  ++N   LD+I  EV E   K+A K+WPG LT+I+ K               + RMP D+    +ID  G  + + SAN SG P  T      E     + D+I ++G   +    STI D+      + R G I  E  ++ I E
  S:    38 TETVYGLGADALNEDAAKKIYAAKGRPSDNPLIIHITNMKALDKIVSEVPEKAVKVAEKYWPGPLTMIFNKSDIVPYGTTGGLDTVAVRMPVDEIAREVIDAGGGYIAAPSANTSGRPSPTTAQHVAEDLTG-RVDMI-VDGGAVEIGVESTILDVTVEPPMILRPGAITKEMFEEVIGE 215
>gi|168185917|ref|ZP_02620552.1| Sua5/YciO/YrdC/YwlC family protein [Clostridium botulinum C str. Eklund] >gi|169296125|gb|EDS78258.1| Sua5/YciO/YrdC/YwlC family protein [Clostridium botulinum C str. Eklund] (350 aa)
Score = 123, Expect = 2.7e-05, Identities = 56/160 (35%), Positives = 84/160 (52%)
  Q:    49 IKNLKAAIVSTDTVSGL--LSLNKPLIYKI---KKRDKNKKLIRFVSNL---DQIPEVNETFKKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYD--IDTNTLKREGEIKYEWIKK 208
           I+N    +  T+TV GL   +L+   + KI   K R ++  LI  +++    D +  +    +K+ +KFWPG LT+I KK                 RMP +     LI K G P+ + SAN+SG P  TNI    E  +     I  I G+       STI D  ++   + R G I  E +K+
  S:    25 IRNGGLVVFPTETVYGLGANALDSEAVKKIFVAKGRPQDNPLIVHIADFNMNDLVNSIPPIAEKIINKFWPGPLTVIMKKSPKVPDVTSAGLDSIGIRMPSNLVARELIKKAGVPIAAPSANISGKPSPTNIERCIEDLDGKVESI--IGGEKCDVGLESTIVDCTVEPPCILRPGGITLEMLKE 207
>gi|68171141|ref|ZP_00544550.1| Sua5/YciO/YrdC/YwlC [Ehrlichia chaffeensis str. Sapulpa] >gi|88658214|ref|YP_507600.1| Sua5/YciO/YrdC/YwlC family protein [Ehrlichia chaffeensis str. Arkansas] >gi|67999466|gb|EAM86106.1| Sua5/YciO/YrdC/YwlC [Ehrlichia chaffeensis str. Sapulpa] >gi|88599671|gb|ABD45140.1| Sua5/YciO/YrdC/YwlC family protein [Ehrlichia chaffeensis str. Arkansas] (194 aa)
Score = 123, Expect = 2.8e-05, Identities = 43/138 (31%), Positives = 71/138 (51%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQIPE---VNETFKKLASKFWPGKLTLIYKKESY--------------RMPDDKFILNLIDK-TGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKREGEIKYEWIKKTI 210
           IY+IK R  NK L   +SN+D+I +   + E   K+  K  PG +T +    +Y              R+PD    L ++     P+  +S N+SG P +T      E+  ++ S  + IE D   N   ST+ D+ +  + R G +  + I+  I
  S:    38 IYQIKGRSYNKPLSLLLSNIDKIKQFSTLTEHTFKIIQKLSPGPVTFVLPIHNYNKLPRQFFNDTIGIRIPDHPIALEILSNFDNPVVGTSVNISGQPSVTASHQVQETIKQHIS--VIIEDDSLVNGIESTVIDLTSYKILRTGAVSEKKIQDII 191
>gi|150388176|ref|YP_001318225.1| Sua5/YciO/YrdC/YwlC family protein [Alkaliphilus metalliredigens QYMF] >gi|149948038|gb|ABR46566.1| Sua5/YciO/YrdC/YwlC family protein [Alkaliphilus metalliredigens QYMF] (356 aa)
Score = 123, Expect = 3.0e-05, Identities = 57/164 (34%), Positives = 83/164 (50%)
  Q:    49 IKNLKAAIVSTDTVSGL--LSLNKPLIYKI---KKRDKNKKLIRFVSNLDQIPE----VNETFKKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDI--DTNTLKREGEIKYEWIKKTIEE 212
           I+  K     T+TV GL   +L+   I KI   K R  +  LI  V++  ++      + E  KKL + FWPG LTL+ +K               + RMP       LI+K G P+ + SAN SG P  T      +   + K D I I G        ST+ D+  +T  + R G +  E ++  I E
  S:    28 IREGKTVAFPTETVYGLGANALDSKAINKIFVAKGRPSDNPLIVHVAHRVEVDALVRVIPEKAKKLMAHFWPGPLTLVMEKSHGIPGEISAGLSTVAIRMPVHPIARTLIEKAGVPVAAPSANTSGKPSPTRAAHVIQDL-RGKVDAI-IAGGPCDVGVESTVLDVTEETPMILRPGGVTKEMLEAVIGE 215
>gi|149183887|ref|ZP_01862278.1| SUA5 protein [Bacillus sp. SG-1] >gi|148848406|gb|EDL62665.1| SUA5 protein [Bacillus sp. SG-1] (348 aa)
Score = 123, Expect = 3.0e-05, Identities = 41/107 (38%), Positives = 61/107 (57%)
  Q:    49 IKNLKAAIVSTDTVSGLLSLNKP-----LIYKIKKRDKNKKLIRFVSNLDQ----IPEVNETFKKLASKFWPGKLTLIYKKES---------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPIT 155
           +K+ +     T+TV GL +  K       I+  K R  +  LI  +SN +Q    + E+ E  + +   FWPG LT+I+KK+                 RMPD    L LI+    P+ + SAN+SG P  T
  S:    28 LKDNEVVAFPTETVYGLGANAKSDEAVDKIFAAKGRPSDNPLIVHISNSEQLNELVEEIPEAAQIMMEHFWPGPLTIIFKKKEGVLSEKVTAGLDSVGIRMPDHPVALALIEAANLPIAAPSANVSGRPSPT 159
>gi|168215829|ref|ZP_02641454.1| Sua5/YciO/YrdC/YwlC family protein [Clostridium perfringens NCTC 8239] >gi|182382042|gb|EDT79521.1| Sua5/YciO/YrdC/YwlC family protein [Clostridium perfringens NCTC 8239] (350 aa)
Score = 123, Expect = 3.1e-05, Identities = 49/130 (37%), Positives = 74/130 (56%)
  Q:    36 EKDSSNLNGIVFEIKNLKAAIVSTDTVSGL--LSLNKPLIYKI---KKRDKNKKLIRFVSNLDQI----PEVNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFN 165
           +KD   L      IKN       T+TV GL   +L+   + KI   K R ++  LI  +++   I     E+ +  ++L  KFWPG LT+I +K+                RMP+D+  L LI+ +G P+ + SAN+SG P  T+I    E  N
  S:    12 DKDIKYLEEAAEIIKNGGIGAFPTETVYGLGANALDGEAVKKIFVAKGRPQDNPLIIHIADKKDIDKYVAEIPKYAQELMDKFWPGPLTIILRKKDIVSDVTSAGLDTVGVRMPNDEIALKLIELSGVPIAAPSANISGRPSPTDIERCEEDLN 165
>gi|55379248|ref|YP_137098.1| DNA binding protein [Haloarcula marismortui ATCC 43049] >gi|55231973|gb|AAV47392.1| DNA binding protein [Haloarcula marismortui ATCC 43049] (210 aa)
Score = 123, Expect = 3.1e-05, Identities = 34/127 (26%), Positives = 72/127 (56%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQIPEVNE-TFKKLA--SKFWPGKLTLIYKKESY--------------RMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKREG 199
           ++  K R+++K +   V +++   E    + ++LA   +F PG +T++ ++                 R+PD    L L+ +TGPL ++SAN+SGNP +   +D  ++  +  +  + ++         ST+ ++D+ T+ R G
  S:    56 VFDAKGRERDKPVSLAVPDIESAREYTRLSDRELAFMREFLPGPVTVVVERRDVVPDVLVAGQDRVGVRVPDHDLALELLAETGPLTATSANISGNPSV-RTVDDLDAIRERAA--VVLDAGETDGGTGSTVVNVDSGTIHRRG 196
>gi|52787618|ref|YP_093447.1| YwlC [Bacillus licheniformis ATCC 14580] >gi|52350120|gb|AAU42754.1| YwlC [Bacillus licheniformis DSM 13] (349 aa)
Score = 123, Expect = 3.1e-05, Identities = 40/97 (41%), Positives = 57/97 (58%)
  Q:    59 TDTVSGLLSLNK-----PLIYKIKKRDKNKKLIRFVSNLDQIPEVNET----FKKLASKFWPGKLTLIYKKE---------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPIT 155
           T+TV GL +  K       IY+ K R  +  LI  ++ ++Q+ E  E      + L  +FWPG LTL+   +               + RMPD    L LI + G P+ + SANLSG P  T
  S:    40 TETVYGLGANAKHSEAVAKIYEAKGRPSDNPLIVHIAEIEQLAEFAEVDSPQAEMLMKRFWPGPLTLVLPCKPGVLSTRVTAGLDTVAVRMPDHPVALELIRQAGVPVAAPSANLSGKPSPT 161
>gi|52082226|ref|YP_081017.1| hypothetical protein BL03986 [Bacillus licheniformis ATCC 14580] >gi|52005437|gb|AAU25379.1| conserved protein YwlC [Bacillus licheniformis ATCC 14580] (347 aa)
Score = 123, Expect = 3.1e-05, Identities = 40/97 (41%), Positives = 57/97 (58%)
  Q:    59 TDTVSGLLSLNK-----PLIYKIKKRDKNKKLIRFVSNLDQIPEVNET----FKKLASKFWPGKLTLIYKKE---------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPIT 155
           T+TV GL +  K       IY+ K R  +  LI  ++ ++Q+ E  E      + L  +FWPG LTL+   +               + RMPD    L LI + G P+ + SANLSG P  T
  S:    38 TETVYGLGANAKHSEAVAKIYEAKGRPSDNPLIVHIAEIEQLAEFAEVDSPQAEMLMKRFWPGPLTLVLPCKPGVLSTRVTAGLDTVAVRMPDHPVALELIRQAGVPVAAPSANLSGKPSPT 159
>gi|159040867|ref|YP_001540119.1| Sua5/YciO/YrdC/YwlC family protein [Caldivirga maquilingensis IC-167] >gi|157919702|gb|ABW01129.1| Sua5/YciO/YrdC/YwlC family protein [Caldivirga maquilingensis IC-167] (358 aa)
Score = 123, Expect = 3.2e-05, Identities = 54/137 (39%), Positives = 77/137 (56%)
  Q:    52 LKAAIVS--TDTVSGL--LSLNKPLI---YKIKKRDKNKKLIRFVSNLDQIPEVNETF-KKLASKF---WPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITN--------------IIDAFESFNKYKSDIIFIEGDYYQNNQPSTIY 188
           LK  +V+  T+TV GL   + N   I   Y +K R  +   I  +S+ +Q+ EV E    +L  +    WPG LT+I +K S               RMP     L LI ++ P+ + SAN+SG P  T               IID  E+F   +S II    DY    +P  +Y
  S:    31 LKGGLVAFPTETVYGLGASTYNDDAIRRIYAVKNRPMDNPSIVHISSFNQLYEVAEDIPSELEERLKVAWPGPLTVILRKSSRISEVASCGLSTVAVRMPAHPVALALIRESTPISAPSANISGKPSPTRAEHVIKDLWGKIDLIIDGGETFFGVESTII----DY--TKKPPVLY 200
>gi|150020136|ref|YP_001305490.1| Sua5/YciO/YrdC/YwlC family protein [Thermosipho melanesiensis BI429] >gi|149792657|gb|ABR30105.1| Sua5/YciO/YrdC/YwlC family protein [Thermosipho melanesiensis BI429] (335 aa)
Score = 123, Expect = 3.2e-05, Identities = 42/105 (40%), Positives = 63/105 (60%)
  Q:    73 IYKIKKRDKNKKLI---RFVSNLDQIPEVNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITN--------------IIDAFESFNKYKSDIIFIEGD 177
           I+K+K R K+  LI    FV  L +I EVNE ++K+  +  PG +T + +K++               R+P       L +  GP+ + SANLSG P  T+              IIDA  +    +S II + GD
  S:    52 IFKVKGRAKDNPLIVHVAFVDTLYEIGEVNEKYRKVIEQITPGPITFVIRKKASFPKNVTASLNTVGVRIPAHPVARKLCEYAGPIAAPSANLSGKPSPTDASAVIEDLFGKIECIIDAGNTPFGIESTIIDLSGD 187
>gi|28378948|ref|NP_785840.1| SUA5 family translation factor [Lactobacillus plantarum WCFS1] >gi|28271785|emb|CAD64691.1| SUA5 family translation factor (putative) [Lactobacillus plantarum WCFS1] (339 aa)
Score = 122, Expect = 3.7e-05, Identities = 43/138 (31%), Positives = 70/138 (50%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQIPE----VNETFKKLASKFWPGKLTLIYK---------------KESYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTN--TLKREGEIKYEWIKKTI 210
           +Y  K R  +  LI  V++++ +      ++E  KKL   FWPG LT+I+K                 ++R PD++  L LI   G P+   SAN SG P  T             + I  ++    +    ST+ D+ T+   + R G +  E I++ I
  S:    47 VYLAKGRPSDNPLIVHVADVETVERFAQPLSEAAKKLIKAFWPGPLTMIFKLKPDALAPEVTGGLQTAAFRNPDNEATLALIRAAGTPIVGPSANTSGKPSPTTAQHVLHDLRGKIAGI--LDDGPTKVGVESTVLDLSTDKPAILRPGAVTPEAIERVI 204
>gi|134300997|ref|YP_001114493.1| Sua5/YciO/YrdC/YwlC family protein [Desulfotomaculum reducens MI-1] >gi|134053697|gb|ABO51668.1| translation factor SUA5 [Desulfotomaculum reducens MI-1] (354 aa)
Score = 122, Expect = 3.7e-05, Identities = 34/84 (40%), Positives = 50/84 (59%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQIPEVNETFKKLAS----KFWPGKLTLIYKKESY--------------RMPDDKFILNLIDKTG-PLYSSSANLSGNPPITN 156
           IY+ K R  +  LI  V++ + + E+++     A+    KFWPG LTL+  + S+              RMP     L LI  +G P+ + SAN SG P  TN
  S:    57 IYRAKGRPSDNPLILHVADTNMVRELSKNLPPKATLLMKKFWPGPLTLVVPRASHIPREVTGGLATVAVRMPHHPVALALIKASGVPIAAPSANKSGRPSPTN 159
>gi|88855317|ref|ZP_01129981.1| translation factor [marine actinobacterium PHSC20C1] >gi|88815224|gb|EAR25082.1| translation factor [marine actinobacterium PHSC20C1] (218 aa)
Score = 122, Expect = 3.7e-05, Identities = 54/155 (34%), Positives = 82/155 (52%)
  Q:    56 IVSTDTVSGLLS-------LNKPLIYKIKKRDKNKK-LIRFVSNLDQIP-EVNETFKKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYD-----IDTNTLK--REGEIKYEWIKKTI 210
           ++ TDTV G+ +       + K +  K + R      LI  +  LD +  EV +  + L ++FWPG LT+I   +              + RMP  +  L L+ +TGPL  SSAN +G P   +  +A +      S +   EG+       STI D      +   L+  REG I  E I+K I
  S:    31 VIPTDTVYGVAADAFQPDAVQKLIDAKGRTRQSPPPVLIPGIPTLDALAAEVPDEVRTLVAEFWPGGLTIILPAQPSLSWDLGDTHGTVALRMPSSRIALELLSETGPLAVSSANSTGLPAARSAAEAQQMLGDSVS-VYLDEGE--GGELASTIVDATGLLTEGGKLRIVREGVIPSEAIRKLI 212
>gi|110597199|ref|ZP_01385488.1| Sua5/YciO/YrdC/YwlC [Chlorobium ferrooxidans DSM 13031] >gi|110341390|gb|EAT59855.1| Sua5/YciO/YrdC/YwlC [Chlorobium ferrooxidans DSM 13031] (315 aa)
Score = 122, Expect = 3.9e-05, Identities = 45/138 (32%), Positives = 73/138 (52%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQI----PEVNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLID-KTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDID--TNTLKREGEIKYEWIKKTI 210
           I++ K R  +  LI  + N+ Q+     E+NE+ +KL  +F+PG LTL+ KK                 R P +      +    GP+ + SANLSG P  T+    F+  +   S I  ++G+       STI D    +  L R G I +E +++ +
  S:    45 IFQAKGRPGDNPLIVHIYNIKQLDDVASEINESAEKLIERFFPGPLTLVLKKNKSVPDIVTAGLDTVGVRCPANPVAREFLRLACGPVAAPSANLSGLPSSTSWHAVFKDLDGRISCI--LKGEESTIGLESTIVDCSGASPVLLRAGAITFEALQEVV 201
>gi|113475329|ref|YP_721390.1| SUA5/yciO/yrdC-like [Trichodesmium erythraeum IMS101] >gi|110166377|gb|ABG50917.1| SUA5/yciO/yrdC-like [Trichodesmium erythraeum IMS101] (197 aa)
Score = 122, Expect = 3.9e-05, Identities = 35/106 (33%), Positives = 65/106 (61%)
  Q:    59 TDTVSGLLSLNKP----LIYKIKKRDKNKKLIRFVSNLDQI-PEVN------ETFKKLASKFWPGKLTLIYKKESY---------------RMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESF 164
           TDTV  L +  +P    LI+++K R ++K +I   +N   + P +       + ++++A K+WPG+LTL+                     R+P+      ++ +TGPL ++SAN+SG P +  + +    F
  S:    23 TDTVPALAA--RPDRANLIFQVKGRSQDKPVILMGANAASLWPYICGSDQELQLWQRVAGKYWPGQLTLVLPASEMVPRVMNPVEGTTIGVRVPNCDIARKIMARTGPLATTSANISGQPTLGKMAEISRQF 152
>gi|38233637|ref|NP_939404.1| hypothetical protein DIP1043 [Corynebacterium diphtheriae NCTC 13129] >gi|38199897|emb|CAE49563.1| Conserved hypothetical protein [Corynebacterium diphtheriae] (216 aa)
Score = 122, Expect = 4.0e-05, Identities = 46/176 (26%), Positives = 86/176 (48%)
  Q:    36 EKDSSNLNGIVFEIKNLKAAIVSTDTVSGL--LSLNKPLIYKI---KKRDKNKKLIRFVSNLDQ----IPEVNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDI--DTNTLKREGEIKYEWIKKTIE 211
           E   + L   +  +K+ +  ++ TDT+ G+   + +   + K+   K R  +  +   V + D     +   ++  + L   FWPG L+++ ++                 RMP     + L+ +TGP+  SSAN+SG  P T   +A        S  ++++         STI D+  D   + REG I  E + + +E
  S:    11 ETREAGLQQAISTVKDGRLVVIPTDTLYGIGCDAFDNTAVAKLLETKHRGPDMPVPVLVGSWDTARGLVHSYSDQLRTLIEAFWPGGLSIVVEQAPSLQWNLGDTRGTVMLRMPLHPVAIELLRETGPMAVSSANISGQTPATTAQEAQRQLGDNVS--VYLDAGETPVGTASTIIDLSGDHPRILREGAISAERVAEVLE 209
>gi|90961568|ref|YP_535484.1| Sua5/YciO/YrdC/YwlC family protein [Lactobacillus salivarius UCC118] >gi|90820762|gb|ABD99401.1| Sua5/YciO/YrdC/YwlC family protein [Lactobacillus salivarius UCC118] (336 aa)
Score = 122, Expect = 4.1e-05, Identities = 47/138 (34%), Positives = 72/138 (52%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQI----PEVNETFKKLASKFWPGKLTLI---------------YKKESYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTN--TLKREGEIKYEWIKKTI 210
           +Y  K R  +  LI  VS+L+ +    P +++  +K+  KFWPG LT++                K  ++RMP ++  LNLI   G P+   SAN SG P  T     +       + I  ++         STI D+ T   T+ R G +  E I+K I
  S:    48 VYLAKGRPSDNPLIVTVSSLEMVKRFVPSLSKEVEKIIEKFWPGSLTIVLKIKDGSLSKTVTGGLKTAAFRMPKNETTLNLITALGNPIVGPSANSSGKPSPTTAQHVYHDLEGRIAGI--LDDGPTDVGVESTIIDMSTEIPTILRPGAVTAEEIEKVI 205
>gi|90413785|ref|ZP_01221773.1| Putative Sua5/YciO/YrdC family protein [Photobacterium profundum 3TCK] >gi|90325254|gb|EAS41751.1| Putative Sua5/YciO/YrdC family protein [Photobacterium profundum 3TCK] (192 aa)
Score = 121, Expect = 4.6e-05, Identities = 49/167 (29%), Positives = 87/167 (52%)
  Q:    33 VTYEKDSSNLNGIVFEIKNLKAAIVSTDTVSGL-------LSLNKPLIYKIKKRDKNKKLIRFVSNLDQI-PEVNETF-----KKLASKFWPGKLTLI--------------YKKESYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKREG 199
           V YE D  NL  +V  +++ +     T+ V G+        ++ K L   +K+R   K LI   +N  Q+ P +++T      K+     WPG +T +              +   + R+ D   +  L  + G P+ S+SANL+G PP   + +      ++ S I  +EG+      P+ I D  ++T+ R+G
  S:     2 VIYEVDMDNLQQVVSALQSGEVIAYPTEGVFGVGCDPDHSQAIEKLL--ALKQRPIEKGLILIAANYQQLQPYIDDTQLSDLQKQKIFSTWPGPVTWVMPVKKGVSPLLTGKFTSIAVRVSDHPLVQKLCHQFGKPITSTSANLTGLPPCKTVAEVHSQLGEHLSAI--LEGETGGRENPTEIRDAFSDTVLRQG 192
>gi|138896951|ref|YP_001127404.1| Sua5/YciO/YrdC/YwlC family protein [Geobacillus thermodenitrificans NG80-2] >gi|134268464|gb|ABO68659.1| Sua5/YciO/YrdC/YwlC family protein [Geobacillus thermodenitrificans NG80-2] (345 aa)
Score = 121, Expect = 4.9e-05, Identities = 45/138 (32%), Positives = 67/138 (48%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQIPEVNETF----KKLASKFWPGKLTLIYKKE---------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDI--DTNTLKREGEIKYEWIKKTI 210
           I+  K R  +  LI  V++L Q+  +  +     K L  +FWPG LTL+  K                + RMPD    L LI+ +G  L + SAN SG P  T         N   + +  I+G        ST+ D   +  T+ R G +  E + + I
  S:    57 IFAAKGRPSDNPLIVHVASLAQVESIAASIPPVAKTLMERFWPGPLTLVLPKRDGAVSERVTAGLSTVAVRMPDHPLALALIEASGLALAAPSANRSGRPSPTTAAHVLADLNGRIAGV--IDGGPTGVGVESTVLDCSGEVPTILRPGGVTKEALSEVI 214
>gi|19705289|ref|NP_602784.1| SUA5 protein [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >gi|19713254|gb|AAL94083.1| SUA5 protein [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] (217 aa)
Score = 121, Expect = 4.9e-05, Identities = 56/149 (37%), Positives = 84/149 (56%)
  Q:    48 EIKNLKAAIVSTDTVSGL-------LSLNKPLIYKIKKRDKNKKLIRFVSNLDQIPEV-------NETFKKLASKFWPGKLTLIYKKESY--------------RMPDDKFILNLIDKTGP-LYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLK 196
           EIK     I  TDTV GL        S+N   IY  K R  +  LI  +S++D++ EV        E  KKL+  FWPG LT+I K + +              R+P+    + +ID  G  L ++SAN+SG     +  +  E+  K K DI+ I+    +  + STI D+ ++  K
  S:    24 EIKKGSLIIYPTDTVYGLGAIVTNEQSINN--IYLAKSRSFSSPLIALLSSVDKVEEVAYVSDKNRELLKKLSKVFWPGALTVILKSKEHIPSIMVSGGDTIGVRIPNLDLAIKIIDLAGGILATTSANISGEATPKSYDELSEAI-KSKVDIL-IDSGKCKLGEASTIIDLTSDVPK 197
>gi|118444234|ref|YP_879011.1| Sua5/YciO/YrdC/YwlC family protein [Clostridium novyi NT] >gi|118134690|gb|ABK61734.1| Sua5/YciO/YrdC/YwlC family protein [Clostridium novyi NT] (350 aa)
Score = 121, Expect = 5.3e-05, Identities = 58/155 (37%), Positives = 82/155 (52%)
  Q:    59 TDTVSGL--LSLNKPLIYKI---KKRDKNKKLIRFVSNL---DQIPEVNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYD--IDTNTLKREGEIKYEWIKKTIEEN 213
           T+TV GL   +L+   + KI   K R ++  LI  +++    D + ++    KK+  KFWPG LTLI KK                 RMP       LI K G P+ + SAN+SG P  TNI    E  +     I  I G+       STI D  ++   + R G I  E +++ IE N
  S:    35 TETVYGLGANALDSEAVKKIFIAKGRPQDNPLIVHIADFNMDDLVKDIPAIAKKIMDKFWPGPLTLIMKKSDKIPDVTSAGLDSIGIRMPSSIVARELIKKAGVPIAAPSANISGKPSPTNIERCIEDLDGKVEAI--IGGEKCDVGLESTIVDCTVEPPCILRPGGITLEMLRE-IEPN 211
>gi|56965628|ref|YP_177362.1| translation factor SUA5 [Bacillus clausii KSM-K16] >gi|56911874|dbj|BAD66401.1| translation factor SUA5 [Bacillus clausii KSM-K16] (342 aa)
Score = 121, Expect = 5.5e-05, Identities = 60/192 (31%), Positives = 93/192 (48%)
  Q:    19 LNNKEIKNYPKKEFVTYEKDSSNLNGIVFEIKNLKAAIVSTDTVSGL----LSLNK-PLIYKIKKRDKNKKLIRFVSNLDQIPEVNETF----KKLASKFWPGKLTLIYK-KES-------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDID--TNTLKREGEIKYEWIKKTI 210
           +N K+ K +   + +  +K +  +      IK  K     T+TV GL    LS      I+  K R  +  LI  + +  Q+ ++ ++      KL + FWPG LTLI + KE+              RMP     L L+ + G P+ + SAN+SG P  T         +  K D I ++G        ST+ D+   T  L R G +  E I+  I
  S:     1 MNYKQTKQWIVDKNIDSDKQTEMIQEAALWIKQNKLIAFPTETVYGLGANALSYEAVAQIFAAKGRPSDNPLIVHIGDSSQLDKLVKSIPLNANKLMAAFWPGALTLILEAKEAIAENVTAGLSTVGVRMPSHPVALKLLQECGLPVAAPSANMSGRPSPTTAAHVIADLDG-KIDGI-VDGGSTGIGLESTVLDVSKPTPMLYRPGGVSVEEIEAVI 216
>gi|170781880|ref|YP_001710212.1| hypothetical protein CMS_1485 [Clavibacter michiganensis subsp. sepedonicus] >gi|169156448|emb|CAQ01596.1| conserved hypothetical protein [Clavibacter michiganensis subsp. sepedonicus] (320 aa)
Score = 121, Expect = 5.5e-05, Identities = 53/158 (33%), Positives = 84/158 (53%)
  Q:    53 KAAIVSTDTVSGLLS-------LNKPLIYKIKKRDKNKK-LIRFVSNLDQIPE-VNETFKKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNT-------LKREGEIKYEWIKKTI 210
           +  ++ TDTV G+ +       + + L  K + RD     LI   S LD + + V +  +++  +FWPG LT+I   +              + RMP + + L L+ +TGPL  SSAN +G P      +A +     +S  IF++G        STI D    T       + REG I    I++ I
  S:    32 EVVVIPTDTVYGIAADAFNPEAVQRLLDAKGRGRDAPPPVLIPGQSTLDALADFVPDVVRRMVDEFWPGGLTVILVAQPSLVWDLGETRGTVALRMPANSYALVLLAETGPLAVSSANKTGQPAAATAQEAVDQLG--ESVDIFLDGG-AAGGAASTIVDASRVTQAGGRVRIVREGAITRAQIQQLI 216
>gi|33863926|ref|NP_895486.1| hypothetical protein PMT1659 [Prochlorococcus marinus str. MIT 9313] >gi|33635510|emb|CAE21834.1| conserved hypothetical protein [Prochlorococcus marinus str. MIT 9313] (196 aa)
Score = 120, Expect = 5.5e-05, Identities = 35/100 (35%), Positives = 59/100 (59%)
  Q:    54 AAIVSTDTVSGLLSLNKPL--IYKIKKRDKNKKLIRFVSNLDQI-----PEVNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPP 153
           AA++ TDT+  L +       ++ IK+R  +K LI   +  +++     P   E    +A ++WPG LTL+                    R+PD   +  L+ ++GPL ++SANLSG+ P
  S:    23 AALLPTDTLPALAAAPVHAAQLWTIKQRSADKPLILMGATPEELLAHVLPLALEDVWSMARRYWPGALTLVVPASGVLVEALNPGAFTLGLRVPDCGMLRTLLKQSGPLATTSANLSGSAP 143
>gi|24379520|ref|NP_721475.1| hypothetical protein SMU.1083c [Streptococcus mutans UA159] >gi|24377461|gb|AAN58781.1|AE014946_6 conserved hypothetical protein [Streptococcus mutans UA159] (196 aa)
Score = 120, Expect = 5.6e-05, Identities = 51/159 (32%), Positives = 85/159 (53%)
  Q:    53 KAAIVSTDTVSGLLS--LNKPLI---YKIKKRDKNKKLIRFVSNLDQI----PEVNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLK--REGEIKYEWIKKTIE 211
           +A ++ T+TV GL +  L+K  +   Y +KKR + K +   V++L+ I     E      +L   F PG LT++ K                 +R+P     L  I +TGPL   SANLSG        +  E+F    + ++ I+ D     + STI DI ++  K  R+G +  + I+  ++
  S:    12 QAVVLPTETVYGLFAQALSKRAVDNVYDLKKRPREKAMNLNVASLEDILAFSKEAPAYLAELYKAFLPGPLTIVLKANEKVPAWINGGLSTVGFRVPAHPQTLAYIKQTGPLIGPSANLSGQASGLVYREIQEAF---ANRLLGIQDDKAIKGRDSTILDISSSRAKILRQGALTQDAIQAHVK 192
>gi|159031016|emb|CAO88719.1| unnamed protein product [Microcystis aeruginosa PCC 7806] (195 aa)
Score = 120, Expect = 5.8e-05, Identities = 40/116 (34%), Positives = 68/116 (58%)
  Q:    39 SSNLNGIVFEIKNLKAAIVSTDTVSGLLSLNKP---LIYKIKKRDKNKKLIRFVSNLDQI-------PEVNETFKKLASKFWPGKLTLIY-----------KKES----YRMPDDKFILNLIDKTGPLYSSSANLSGNPPI 154
           +++LN IV    + +     TDTV  L +++ P   L++  KKR  +K LI   ++   +        E  E ++++  K+WPG LTL+             K+S     R+P       ++ +TG L ++SANLSG  P+
  S:     3 TASLNEIVHAALSGQVVSFPTDTVPAL-AVSPPYAALVFAAKKRTFDKPLILMAASAADLWDYVKGNQEEREIWRQMTEKYWPGSLTLVLPASEKVPKVLNPKDSSTIGIRVPAHAIAREILGRTGVLATTSANLSGQEPL 142
>gi|22537233|ref|NP_688084.1| Sua5/YciO/YrdC/YwlC family protein [Streptococcus agalactiae 2603V/R] >gi|22534100|gb|AAM99956.1|AE014241_7 Sua5/YciO/YrdC/YwlC family protein [Streptococcus agalactiae 2603V/R] (183 aa)
Score = 120, Expect = 6.1e-05, Identities = 44/140 (31%), Positives = 72/140 (51%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQIPEVNET----FKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLK--REGEIKYEWIKKTIEE 212
           +Y++KKR ++K +   + + + I + ++      K+L   F PG LT+I +                 +RMP     L++I   GPL   SAN+SG        +  + FN     ++ IE D       STI D+  + +K  R+G I  E +  TI E
  S:    22 VYELKKRPRDKAMNLNICDFETILKYSKNQPTYLKQLYDAFLPGPLTIILEASQEVPHWINSGLLSVGFRMPKHPVTLDMIANHGPLIGPSANISGCDSGRVFSEIQKQFNH---QVLGIEDDKALTGVDSTIIDLSGDRVKILRQGAITQEVLTATIPE 178
>gi|149195151|ref|ZP_01872242.1| hypothetical protein CMTB2_04512 [Caminibacter mediatlanticus TB-2] >gi|149134703|gb|EDM23188.1| hypothetical protein CMTB2_04512 [Caminibacter mediatlanticus TB-2] (144 aa)
Score = 120, Expect = 6.1e-05, Identities = 55/145 (37%), Positives = 79/145 (54%)
  Q:    53 KAAIVSTDTVSGLLSLNKPLIYKIKKRDKNKKLIRFVSN---LDQIPEVNETFKKLASKFWPGKLTLIYKK-ESYRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKR 197
           K  +  TDT  G LS NK  + KIK+R+ NKK++R V +   L +   V   FKK   +    K T IY   ES+R+  DK  L  + K   +YS+SANL+G        D  E + K  +DII +  D+++  +PSTIY +    +KR
  S:     5 KIYLTQTDTTVGFLSKNKEKLNKIKQRNLNKKILREVDSLYTLKKFVRVPNKFKKQVRR--AKKTTFIYSNGESFRVVRDKKHLEFLKKFKWMYSTSANLTG-----RYFD--EDWAKSVADII-VGSDFFE-GKPSTIYKLSKTNIKR 142
>gi|188589112|ref|YP_001919885.1| Sua5/YciO/YrdC/YwlC family protein [Clostridium botulinum E3 str. Alaska E43] >gi|188499393|gb|ACD52529.1| Sua5/YciO/YrdC/YwlC family protein [Clostridium botulinum E3 str. Alaska E43] (349 aa)
Score = 120, Expect = 6.2e-05, Identities = 61/159 (38%), Positives = 91/159 (57%)
  Q:    49 IKNLKAAIVSTDTVSGLLS--LNKPLIYKI---KKRDKNKKLIRFVSN------LDQIPEVNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSS-SANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNT--LKREGEIKYEWIK 207
           IK+       T+TV GL S  LN+  + KI   K R ++  LI  V++      ++ IP++ +   KL  K+WPG LTLI KK+S               RMP+++  L LI+ +  + ++ SAN+SG P  T++    E  +  K D I + GD       STI D   N   + R G I  E +K
  S:    25 IKDGGIVAFPTETVYGLGSDALNEDAVKKIFIAKGRPQDNPLIVHVASKNIQSLVEDIPDIAQ---KLIDKYWPGPLTLILKKKSIIPNITSADLDTIGIRMPNNEIALKLIEMSNTVIAAPSANISGRPSPTDVERCIEDLSG-KVDCI-VGGDKSNIGLESTILDCTVNPPLVLRPGGITLEMLK 206
>gi|154482619|ref|ZP_02025067.1| hypothetical protein EUBVEN_00286 [Eubacterium ventriosum ATCC 27560] >gi|149736519|gb|EDM52405.1| hypothetical protein EUBVEN_00286 [Eubacterium ventriosum ATCC 27560] (359 aa)
Score = 120, Expect = 6.3e-05, Identities = 55/154 (35%), Positives = 84/154 (54%)
  Q:    59 TDTVSGLLS--LNKPL---IYKIKKRDKNKKLIRFVSNLDQ----IPEVNETFKKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPIT---NIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTN--TLKREGEIKYEWIKKTIEE 212
           T+TV GL +  LN+     IY  K R  +  LI  +++L+     + E+    +KL   FWPG +TLI+ K               + R P+      LI   G  + + SANLSG P  T   ++ID  +     + D+I I+G        STI D+  N   + R G I YE +K+ + +
  S:    39 TETVYGLGADALNEEAAAKIYAAKGRPSDNPLIAHIADLEMLKPLVEEIPPVAEKLMDAFWPGPMTLIFNKSNLVPKGTTGGLDTVAVRYPNHPIAQALIKAAGVSIAAPSANLSGKPSPTLGEHVIDDMDG----RIDMI-IDGGMVGMGLESTIIDVTVNPPMILRPGFITYEMVKEIVPD 216
>gi|186908272|ref|ZP_02981175.1| SUA5/yciO/yrdC domain [Cyanothece sp. PCC 7424] >gi|186688548|gb|EDU13221.1| SUA5/yciO/yrdC domain [Cyanothece sp. PCC 7424] (195 aa)
Score = 120, Expect = 6.5e-05, Identities = 40/112 (35%), Positives = 65/112 (58%)
  Q:    53 KAAIVSTDTVSGLLSLN--KPLIYKIKKRDKNKKLIRFVSNL-DQIPEVN------ETFKKLASKFWPGKLTLIYKKESY---------------RMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESF 164
           K     TDTV  L +L     LI+  KKR ++K LI   +++ D  P V       E ++++A ++ PG LTL+                     R+P  +    ++ KTGPL ++SANLSG P + ++    ++F
  S:    17 KVVSFPTDTVPALAALPPLSDLIFLAKKRSQDKPLILMGASVKDLWPYVMGTCEQLEIWQQIAQEYLPGALTLVLPASGLVPRSMNPTDPTTIGIRVPQHQIAQMILAKTGPLATTSANLSGEPALLSMSAIAQTF 152
>gi|108804486|ref|YP_644423.1| translation factor SUA5 [Rubrobacter xylanophilus DSM 9941] >gi|108765729|gb|ABG04611.1| Sua5/YciO/YrdC/YwlC [Rubrobacter xylanophilus DSM 9941] (191 aa)
Score = 120, Expect = 6.6e-05, Identities = 36/102 (35%), Positives = 62/102 (60%)
  Q:    49 IKNLKAAIVSTDTVSGLLSLNKPL--IYKIKKRDKNKKLIRFVSNLDQI----PEVNETFKKLASKFWPGKLTLIYKKES-----YRMPDDKFILNLIDK-TGPLYSSSANLSG 150
           I+    A+V T+TV GL++    L  IY+IK R++ K +     + ++      +V    + LA  +WPG LTL+  +        R+P  + + +++D   GPLY++SAN+SG
  S:    13 IREGAVALVPTETVVGLVASEAGLERIYEIKVRERGKPIALLCRSAEEAFSLAAKVPPLARTLADLYWPGPLTLVLDRPGGGTIGLRVPRGR-VRDVLDAYGGPLYATSANISG 125
>gi|73668440|ref|YP_304455.1| translation factor SUA5 [Methanosarcina barkeri str. Fusaro] >gi|72395602|gb|AAZ69875.1| translation factor SUA5 [Methanosarcina barkeri str. Fusaro] (367 aa)
Score = 120, Expect = 6.9e-05, Identities = 42/94 (44%), Positives = 58/94 (61%)
  Q:    59 TDTVSGLLS--LNKPLIYKI---KKRDKNKKLIRFVSNLDQIPEVN----ETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNP 152
           T+TV GL +  LN   + KI   KKR     L   V + + + +V     E+  +L + FWPG LT+I +K                 RMPD +  L+LI + G PL + SANLSG P
  S:    42 TETVYGLGADGLNPEAVMKIFEAKKRPPGNPLSLLVHSREDVEKVARNIPESAFRLMNAFWPGPLTIILEKNDIVPDITSGRLKSIGVRMPDHRVPLDLIKRAGTPLAAPSANLSGKP 159
>gi|89210217|ref|ZP_01188609.1| Sua5/YciO/YrdC/YwlC [Halothermothrix orenii H 168] >gi|89160290|gb|EAR79946.1| Sua5/YciO/YrdC/YwlC [Halothermothrix orenii H 168] (362 aa)
Score = 120, Expect = 7.0e-05, Identities = 44/118 (37%), Positives = 67/118 (56%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQIPEV-----NETFKKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIF-IEGDYYQNNQPSTIYDI 190
           I+K K R ++  LI  +  +DQ+ ++     ++T ++L   FWPG LTLI++K+              + R PD+     LI  +  P+ + SANLSG+P  T    A   F   K  I F I+G        ST+ DI
  S:    65 IFKAKGRPRDNPLIVHIGEMDQLYDIIKNPLSDTTRRLIKHFWPGPLTLIFEKKETIPGVTTAGLESVAVRFPDNPVARALIGLSSVPVAAPSANLSGSPSPTR---AEHVFKDLKGRIPFIIDGGPSSVGVESTVIDI 200
>gi|169177786|ref|ZP_02839300.1| Sua5/YciO/YrdC/YwlC family protein [Arthrobacter chlorophenolicus A6] >gi|169014298|gb|EDS60859.1| Sua5/YciO/YrdC/YwlC family protein [Arthrobacter chlorophenolicus A6] (237 aa)
Score = 120, Expect = 7.1e-05, Identities = 51/155 (32%), Positives = 84/155 (54%)
  Q:    56 IVSTDTVSGLLS-------LNKPLIYKIKKRDKNKK-LIRFVSNLDQIP-EVNETFKKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYY----QNNQPSTIYDIDTNTLK--REGEIKYEWIKKTI 210
           ++ TDTV G+ +       +   L+ K + R      LI  ++ LD +  +++   +KLA  FWPG LTLI+  +              + RMP D+    L+  TGPL  SSAN +G+ P      A E      S  +++EG +      +  PSTI D     L+  R G +  + +++ +
  S:     2 VLPTDTVYGIAADAFSPQAVTMLLVSKGRSRTMPPPVLIPRINALDGLATDISAEARKLAEAFWPGGLTLIFHAQPSLDWDLGETKGTVALRMPADEIAQELLTLTGPLAVSSANRTGHAPAQTAAAAREQLA--DSVEVYLEGGFRPAEGADAVPSTIVDATGPRLRVVRNGAVSLDQLREHV 183
>gi|196235167|ref|ZP_03133971.1| Sua5/YciO/YrdC/YwlC family protein [Thermus aquaticus Y51MC23] >gi|196221123|gb|EDY15738.1| Sua5/YciO/YrdC/YwlC family protein [Thermus aquaticus Y51MC23] (196 aa)
Score = 119, Expect = 7.2e-05, Identities = 46/146 (31%), Positives = 75/146 (51%)
  Q:    59 TDTVSGLLSLNKP-----LIYKIKKRDKNKKLIRFVSNLDQ------IPEVNETFKKLASKFWPGKLTLIYKKE------------SYRMPDDKFILNLIDKT-GPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKREGEIKYE 204
           TDTV G+++  +       IY +K R++ K L   V+ L+       +  + E F +LA  FWPG LT++                  RMP  + +  L+ +  G   ++S N SG PP+    +A      +  D +F  G+       S++ D+ T  + REG I  E
  S:    26 TDTVWGVMARMEDEAACRRIYALKGREEKKPLQVLVAGLEDALRLSDLGPLEERFLRLAEAFWPGALTIVVPGRGIPPWISRDGSVGLRMPAHEALRELLRRVGGHATATSLNRSGEPPVKTEAEA----RAFPVDFVF-PGE--ATGLASSVVDLRTGEILREGAIPKE 188
>gi|71894113|ref|YP_278221.1| hypothetical protein MS53_0089 [Mycoplasma synoviae 53] >gi|71850901|gb|AAZ43510.1| conserved hypothetical protein [Mycoplasma synoviae 53] (157 aa)
Score = 119, Expect = 7.4e-05, Identities = 47/140 (33%), Positives = 78/140 (55%)
  Q:    56 IVSTDTVSGL-------LSLNKPLIYKIKKRDKNKKLIRFVSNLDQIPEVNETFKK---LASKFWPGKLTLIYKKESYRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTL 195
           ++STDTV GL        SL+K  +Y +K R  +KK++    + + I ++ +  KK   +A K  PG  ++I      R+P+   +   + K GP+Y +SAN+SG  P++ I +A   F K    I +I      +  PS IY++DT  +
  S:    10 LLSTDTVCGLGVKLENKDSLHK--LYALKNRPVDKKIMILAGSFNDIFKLTKFTKKQRVMAYKLLPGSNSIIVNNIGMRIPNCLKLRKFLIKNGPMYVTSANISGEKPLS-IEEAQVKFEK----IRYIVDYCSPSGSPSKIYNLDTGEI 152
>gi|116513793|ref|YP_812699.1| putative translation factor (SUA5) [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|116093108|gb|ABJ58261.1| translation factor SUA5 [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (331 aa)
Score = 119, Expect = 7.4e-05, Identities = 54/154 (35%), Positives = 79/154 (51%)
  Q:    59 TDTVSGLLSL-----NKPLIYKIKKRDKNKKLIRFVSNLDQI----PEVNETFKKLASKFWPGKLT-LIYKKE--------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTN--TLKREGEIKYEWIKKTIEE 212
           T+TV GL +L     +   +Y  K R  +  LI  V++   +     EV E  +KL   FWPG LT L+  KE              ++R PDD+   +LI K G P+   SAN S  P  T     +       + I  ++G   +    STI D+  N   + R G+I  E I + + E
  S:    28 TETVYGLGALATRDDSVKKVYAAKGRPSDNPLIVTVADEAMMRPYAKEVPERAEKLIKHFWPGPLTILLLAKEGALPESVTGGLPTVAFRCPDDQLTHDLIAKLGYPIVGPSANTSTKPSPTTAQHVYHDLKGKIAGI--VDGGETEVGLESTIVDLSVNPAVVLRPGKITPEEISQVLGE 206
>gi|88807794|ref|ZP_01123305.1| hypothetical protein WH7805_06526 [Synechococcus sp. WH 7805] >gi|88787833|gb|EAR18989.1| hypothetical protein WH7805_06526 [Synechococcus sp. WH 7805] (207 aa)
Score = 119, Expect = 7.6e-05, Identities = 34/100 (34%), Positives = 58/100 (57%)
  Q:    54 AAIVSTDTVSGLLSL--NKPLIYKIKKRDKNKKLIRFVSNLDQIPEVN-----ETFKKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTGPLYSSSANLSGNPP 153
           AA++ TDT+  L     +   I+ +K+R ++K LI   + +  + ++      E  + LA ++WPG LTL+   E                R+P      +L+ + GPL ++SAN SG  P
  S:    31 AALLPTDTLPALACTPSSAAQIWTLKQRPQDKPLILMAAEVSALLDLTTVIAREDARPLADRYWPGPLTLVLPAEGTLTNHLNPGQDTLGMRIPACAVTRSLLARCGPLATTSANRSGGTP 151
>gi|168213696|ref|ZP_02639321.1| Sua5/YciO/YrdC/YwlC family protein [Clostridium perfringens CPE str. F4969] >gi|170714770|gb|EDT26952.1| Sua5/YciO/YrdC/YwlC family protein [Clostridium perfringens CPE str. F4969] (350 aa)
Score = 119, Expect = 7.7e-05, Identities = 37/93 (39%), Positives = 57/93 (61%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQI----PEVNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFN 165
           I+  K R ++  LI  +++   I     E+ +  ++L  KFWPG LT+I KK+                RMP+D+  L LI+ +G P+ + SAN+SG P  T+I    E  N
  S:    54 IFVAKGRPQDNPLIIHIADKKDIDKYVAEIPKYAQELMDKFWPGPLTIILKKKDIVSDVTSAGLDTVGVRMPNDEIALKLIELSGVPIAAPSANISGRPSPTDIERCEEDLN 165
>gi|104773787|ref|YP_618767.1| Sua5 family translation factor [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|103422868|emb|CAI97530.1| Putative translation factor (Sua5 family) [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] (331 aa)
Score = 119, Expect = 7.7e-05, Identities = 54/154 (35%), Positives = 79/154 (51%)
  Q:    59 TDTVSGLLSL-----NKPLIYKIKKRDKNKKLIRFVSNLDQI----PEVNETFKKLASKFWPGKLT-LIYKKE--------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTN--TLKREGEIKYEWIKKTIEE 212
           T+TV GL +L     +   +Y  K R  +  LI  V++   +     EV E  +KL   FWPG LT L+  KE              ++R PDD+   +LI K G P+   SAN S  P  T     +       + I  ++G   +    STI D+  N   + R G+I  E I + + E
  S:    28 TETVYGLGALATRDDSVKKVYAAKGRPSDNPLIVTVADEAMMRPYAKEVPERAEKLIKHFWPGPLTILLLAKEGALPESVTGGLPTVAFRCPDDQLTHDLIAKLGYPIVGPSANTSTKPSPTTAQHVYHDLKGKIAGI--VDGGETEVGLESTIVDLSVNPAVVLRPGKITPEEISQVLGE 206
>gi|196154852|ref|YP_002124341.1| putative double-stranded RNA-binding protein with unique protein fold, with YrdC/RibB domain [Alteromonas macleodii 'Deep ecotype'] >gi|88772405|gb|EAR03693.1| putative double-stranded RNA-binding protein with unique protein fold, with YrdC/RibB domain [Alteromonas macleodii 'Deep ecotype'] >gi|196110631|gb|ACG64347.1| putative double-stranded RNA-binding protein with unique protein fold, with YrdC/RibB domain [Alteromonas macleodii 'Deep ecotype'] (201 aa)
Score = 119, Expect = 8.1e-05, Identities = 51/166 (30%), Positives = 86/166 (51%)
  Q:    32 FVTYEKDSSNLNGIVFEIKNLKAAIVSTDTVSGL-------LSLNKPLIYKIKKRDKNKKLIRFVSNLDQI-PEVNETFKKLASKF-----WPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKR 197
           F   E ++S ++ +V   +  +  +  T+ V G+        ++N  L   IK+R   K +I   +N  Q+ P V++   +   +      WPG  T +  K S               R+ +   ++ L +K G PL S+SANL+G PP T   D  E+   +   + ++EG      +PSTI D DT  + R
  S:    12 FTPVEANASEVDPVVAAFEAGRLIVYPTEAVMGIGCDPDNEAAVNALL--DIKQRPVEKGVILIAANYSQLLPYVDDNAIRPDRRTDIFSSWPGPNTWLLPKSSSAPVWLTGKHSKIAVRVTNHPVVVALCNKLGKPLVSTSANLTGQPPAT---DTDEAKAVFADSVFYVEGKVGGATKPSTIRDGDTAEVIR 200
>gi|160894646|ref|ZP_02075421.1| hypothetical protein CLOL250_02197 [Clostridium sp. L2-50] >gi|156863580|gb|EDO57011.1| hypothetical protein CLOL250_02197 [Clostridium sp. L2-50] (359 aa)
Score = 119, Expect = 8.4e-05, Identities = 54/152 (35%), Positives = 81/152 (53%)
  Q:    59 TDTVSGLL--SLNKPL---IYKIKKRDKNKKLIRFVSNL----DQIPEVNETFKKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTGP-LYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDI--DTNTLKREGEIKYEWIKKTI 210
           T+TV GL   +LN      IY  K R  +  LI  +++     + + EV+   + L   FWPG LT+I+KK+              + RMP     + LI  +G  + + SANLSG P  T      E  +  + D+I ++G        STI D+  D  T+ R G I  + IK  +
  S:    45 TETVYGLGGDALNPKASEKIYSAKGRPSDNPLIVHIADTASVWELVAEVSTQAQMLMEAFWPGPLTIIFKKKDIVPHETTGGLETVAIRMPSHPAAMKLIKDSGVYIAAPSANLSGRPSPTTAAHVEEDLSG-RIDMI-LDGGPVGIGIESTIVDVTGDRPTILRPGYISADMIKNIL 220
>gi|33241612|ref|NP_876553.1| SUA5 protein [Chlamydophila pneumoniae TW-183] >gi|33236120|gb|AAP98210.1| SUA5 protein [Chlamydophila pneumoniae TW-183] (286 aa)
Score = 119, Expect = 8.5e-05, Identities = 50/149 (33%), Positives = 77/149 (51%)
  Q:    53 KAAIVSTDTVSG-LLSLNKP----LIYKIKKRDKNKKLIRFVSNLDQIPEVN-----ETFKKLASKFWPGKLTLIYKKESYRMP---------DDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKREGEI 201
           K   + TDTV G +LSL  P     +Y +K R+ +K    +V++++ I  ++      T KKLA  F PG +TL+ K  + R P         D   +  ++D  G L  +SANLS  P      + F  F  +  D+   +G    +   ST+   D   + REG I
  S:    23 KIVALPTDTVYGFVLSLYAPEAEERLYALKDREPSKAFALYVNSIEDIENISGYPLSPTAKKLAQLF-PGAITLVVKHRNPRFPKETLAFRIVDHSVVREIVDHCGTLIGTSANLSEFPSALTAQEIFADFADH--DLCIFDGP-CSHGLESTVVASDPLYIYREGLI 186
>gi|148238861|ref|YP_001224248.1| translation factor [Synechococcus sp. WH 7803] >gi|147847400|emb|CAK22951.1| Possible translation factor [Synechococcus sp. WH 7803] (199 aa)
Score = 119, Expect = 8.6e-05, Identities = 36/112 (32%), Positives = 63/112 (56%)
  Q:    54 AAIVSTDTVSGLLSL--NKPLIYKIKKRDKNKKLIRFVSNLDQIPEVNETFKKL-----ASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFN 165
           AA++ TDT+  L     +   I+ +K+R ++K LI   +   ++ ++     KL     A ++WPG LTL+                    R+P      +L+ ++GPL ++SAN SG PP  +   A  +F+
  S:    23 AALLPTDTLPALACTPSSAAQIWTLKQRPQDKPLILMAAEAVELLDLTTHIAKLDALPLAERYWPGPLTLVLPAAGALVNHLNPGQDSLGMRIPACAATRSLLARSGPLATTSANRSGAPPSCSAEQAAAAFS 155
>gi|94994410|ref|YP_602508.1| Sua5/YciO/YrdC/YwlC family protein [Streptococcus pyogenes MGAS10750] >gi|94547918|gb|ABF37964.1| Sua5/YciO/YrdC/YwlC family protein [Streptococcus pyogenes MGAS10750] (206 aa)
Score = 119, Expect = 8.6e-05, Identities = 51/159 (32%), Positives = 78/159 (49%)
  Q:    54 AAIVSTDTVSGLLSLNKPL-------IYKIKKRDKNKKLIRFVSNLDQI----PEVNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDI--DTNTLKREGEIKYEWIKKTIEE 212
           A ++ T+TV GL +  K L       +Y +K+R ++K +   V++ + I     E     KKL   F PG LT+I K                 +R+P       LI KTGPL   SANLSG      + D       +   +     D +   + STI D+  +   + R+G I  E +   + E
  S:    23 ALVLPTETVYGLFA--KALDEKAVNAVYDLKQRPRDKAMNLNVADFNSILAFSKEQPRYLKKLYQAFLPGPLTIILKANDQVPYWINSGLSTVGFRLPSHPITAALIQKTGPLIGPSANLSGKAS-GRVFDHI--MQDFDFQVFGYADDPFLTGKDSTILDLSGECAVILRQGAITKEELLANVPE 203
>gi|114567901|ref|YP_755055.1| hypothetical protein Swol_2395 [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|114338836|gb|ABI69684.1| translation factor SUA5 [Syntrophomonas wolfei subsp. wolfei str. Goettingen] (318 aa)
Score = 119, Expect = 8.6e-05, Identities = 41/107 (38%), Positives = 58/107 (54%)
  Q:    49 IKNLKAAIVSTDTVSGL--LSLNKPLIYKI---KKRDKNKKLIRFVSNLDQIPEVNETFKK----LASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSGNP-PIT 155
           IK  +     T+TV GL   +     + KI   K R +   L+  +S ++Q+  V +        L  +FWPG L++I                    RMP     L LID+ GPL + SANLSG P P+T
  S:     7 IKAQELVAFPTETVYGLGAAAFQSQAVEKIFLAKGRAETNPLLLHLSCMEQVESVAKEIPPAAIMLMERFWPGPLSIILPARETVPAIVRGGKTTVGLRMPAHPVALALIDQAGPLAAPSANLSGRPSPVT 137
>gi|21910337|ref|NP_664605.1| hypothetical protein SpyM3_0801 [Streptococcus pyogenes MGAS315] >gi|28895912|ref|NP_802262.1| hypothetical protein SPs1000 [Streptococcus pyogenes SSI-1] >gi|21904533|gb|AAM79408.1| conserved hypothetical protein [Streptococcus pyogenes MGAS315] >gi|28811162|dbj|BAC64095.1| hypothetical protein [Streptococcus pyogenes SSI-1] (196 aa)
Score = 119, Expect = 8.9e-05, Identities = 52/164 (31%), Positives = 82/164 (50%)
  Q:    49 IKNLKAAIVSTDTVSGLLSLNKPL-------IYKIKKRDKNKKLIRFVSNLDQI----PEVNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDI--DTNTLKREGEIKYEWIKKTIEE 212
           I++  A ++ T+TV GL +  K L       +Y +K+R ++K +   V++ + I     E     KKL   F PG LT+I K                 +R+P+      LI KTGPL   SANLSG           + F+     +     D +   + STI D+  +   + R+G I  E +   + E
  S:     8 IESGDALVLPTETVYGLFA--KALDEKAVNAVYDLKQRPRDKAMNLNVADFNSILAFSKEQPRYLKKLYQAFLPGPLTIILKANDQVPYWINSGLSTVGFRLPNHPITAALIQKTGPLIGPSANLSGKASGRVFDHIMQDFD---FQVFGYADDPFLTGKDSTILDLSGERAVILRQGAITKEELLANVPE 193
>gi|154505651|ref|ZP_02042389.1| hypothetical protein RUMGNA_03190 [Ruminococcus gnavus ATCC 29149] >gi|153794090|gb|EDN76510.1| hypothetical protein RUMGNA_03190 [Ruminococcus gnavus ATCC 29149] (523 aa)
Score = 119, Expect = 9.0e-05, Identities = 48/137 (35%), Positives = 72/137 (52%)
  Q:    74 YKIKKRDKNKKLIRFVSNLDQIPEVNETF----KKLASKFWPGKLTLIYKKESY--------------RMPDDKFILNLIDKTGPLYSS-SANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTN--TLKREGEIKYEWIKKTI 210
           Y+ K R  +  LI  +++L+ + E+ E      + LA  FWPG LT+I++K S               RMP D     LI   G   S+ SAN SG P  T     +E  N  K ++I I+G        STI D+  +   + R G I  + +++ I
  S:    68 YEAKGRPSDNPLIVHIADLEDLSEITENVPPETELLAKHFWPGPLTMIFEKSSLVPYGTTGGLDTVAVRMPSDLIARKLILAAGGYVSAPSANTSGRPSPTTAEHVWEDLNG-KIEMI-IDGGSVDIGLESTILDMTVSPPMILRPGAITADMLEEVI 223
>gi|15897573|ref|NP_342178.1| hypothetical protein SSO0664 [Sulfolobus solfataricus P2] >gi|6015811|emb|CAB57638.1| hypothetical protein [Sulfolobus solfataricus] >gi|13813830|gb|AAK40968.1| SUA5 related conserved hypothetical protein [Sulfolobus solfataricus P2] (358 aa)
Score = 119, Expect = 9.0e-05, Identities = 53/160 (33%), Positives = 83/160 (51%)
  Q:    49 IKNLKAAIVSTDTVSGL--LSLNKPLIYKI---KKRDKNKKLIRFVSNLDQIPEVNETFKK----LASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTI-YDIDTNTLKREGEIKYEWIKK 208
           IK     +  T+TV GL   +L+   + KI   K R  +  LI  +SN+DQ+ EV +   K    L +  WPG LT + KK               + RMP     L LI+++G P+ + SANL+  P  T +    +     K D+I   G+ +   + + I   +D   L R G    E +++
  S:    24 IKAGGTVVFPTETVYGLGANALDPEAVKKIFIAKNRPMDNPLIVHISNIDQLYEVAKDIPKKIINLVNIVWPGPLTFVLKKTEKVPKETTGGLETVAVRMPAHPVALALINESGVPIAAPSANLATKPSPTRVEHVIDDIYG-KVDVILDSGETFFGVESTVINVTVDPPVLLRPGPFSVEELER 207
>gi|120405291|ref|YP_955120.1| Sua5/YciO/YrdC/YwlC family protein [Mycobacterium vanbaalenii PYR-1] >gi|119958109|gb|ABM15114.1| translation factor SUA5 [Mycobacterium vanbaalenii PYR-1] (220 aa)
Score = 119, Expect = 9.3e-05, Identities = 46/171 (26%), Positives = 80/171 (46%)
  Q:    36 EKDSSNLNGIVFEIKNLKAAIVSTDTVSGLLS-----LNKPLIYKIKKRDKNKKLIRFVSNLDQIP----EVNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLK--REGEIKYEWI 206
           E+  + +   +  +K  +  ++ TDTV G+ +          +   K R +N  +   V +   I      V  + K+L   FWPG L+L+ ++                 RMP     + L+ + GP+  SSAN+SG PP      A E         ++++G   +    STI D+     +  REG +  + I
  S:    11 EQRDTGIASAISALKGGRLVVMPTDTVYGIGADAFDGEAVAALLAAKGRGRNMPVPVLVGSWHTIQGLVYSVPNSAKELIRAFWPGALSLVVRQAPSLQWDLGDANGTVMLRMPLHPVAIELLREVGPMAVSSANISGRPPAVTAAQAREQLGDLVE--VYLDGGPAEQQAASTIVDLTGAHPRVLREGPVTLDAI 204
>gi|46445827|ref|YP_007192.1| hypothetical protein pc0193 [Candidatus Protochlamydia amoebophila UWE25] >gi|46399468|emb|CAF22917.1| conserved hypothetical protein [Candidatus Protochlamydia amoebophila UWE25] (311 aa)
Score = 119, Expect = 9.3e-05, Identities = 41/99 (41%), Positives = 55/99 (55%)
  Q:    59 TDTVSGLLS-LNKP----LIYKIKKRDKNKKLIRFVSNLDQI----PEVNETFKKLASKFWPGKLTLIYKKE---------------SYRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNI 157
           T+TV GL + L  P     I++IK R     LI  V+N   +      +   F  L   FWPG LTLI   +               ++RMP     L++I   GPL   SANLSG P  T++
  S:    22 TETVYGLAARLTCPGAIKKIFEIKGRSLVNPLIIHVANPIDVCAYAIALPPHFDALTHAFWPGPLTLIVPIQLDLVDSIVRAGLPTAAFRMPSHPLTLHVIRAVGPLVMPSANLSGKPSSTDV 144
>gi|21223722|ref|NP_629501.1| hypothetical protein SCO5362 [Streptomyces coelicolor A3(2)] >gi|8568784|emb|CAB94533.1| conserved hypothetical protein [Streptomyces coelicolor A3(2)] (215 aa)
Score = 119, Expect = 9.3e-05, Identities = 35/118 (29%), Positives = 62/118 (52%)
  Q:    95 IPEVNETFKKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDI--DTNTLKREGEIKYEWIKKTIEE 212
           + + +E   +L   FWPG LTL+ K +              + RMP     + L+ + GP+  SSANL+G+P   +   A +      S  ++++G       PS+I D+  +   L R G +  E ++K + +
  S:    79 VTDFSEMAWELVDAFWPGALTLVAKHQPSLQWDLGETRGTVAVRMPLHPVAIELLTEVGPMAVSSANLTGHPAPEDCDAAQQMLGDSVS--VYLDGGPTPGIVPSSIVDVTREVPVLLRAGALSAEELRKVVPD 210
>gi|73666905|ref|YP_302921.1| translation factor SUA5 [Ehrlichia canis str. Jake] >gi|72394046|gb|AAZ68323.1| translation factor SUA5 [Ehrlichia canis str. Jake] (198 aa)
Score = 118, Expect = 9.7e-05, Identities = 40/129 (31%), Positives = 68/129 (52%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQIPE---VNETFKKLASKFWPGKLTLIYKKESY--------------RMPDDKFILNLIDKT-GPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKREGEI 201
           IY+IK R  NK L   V N+++I +   + +   K+  K  PG +T +    +Y              R+P+    L +++K   P+  +S N+SG P +T      E+  K+ S  + IE D   N   ST+ D+ +  + R G +
  S:    38 IYQIKGRSYNKPLSLLVGNINKIKQFSNLTDHAIKIIQKLSPGPITFVLPIHNYHKLPRQFFNNTIGIRIPNHPIALEIVNKIENPVVGTSINISGQPSVTAAHQIHETIKKHIS--VTIEDDSLVNGTESTVIDLTSYKILRAGAV 182
>gi|50914207|ref|YP_060179.1| hypothetical protein M6_Spy0861 [Streptococcus pyogenes MGAS10394] >gi|50903281|gb|AAT86996.1| Sua5 [Streptococcus pyogenes MGAS10394] (206 aa)
Score = 118, Expect = 9.8e-05, Identities = 52/164 (31%), Positives = 81/164 (49%)
  Q:    49 IKNLKAAIVSTDTVSGLLSLNKPL-------IYKIKKRDKNKKLIRFVSNLDQI----PEVNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDI--DTNTLKREGEIKYEWIKKTIEE 212
           I++  A ++ T+TV GL +  K L       +Y +K+R ++K +   V++ + I     E     KKL   F PG LT+I K                 +R+P       LI KTGPL   SANLSG           + F+     +     D +   + STI D+  +   + R+G I  E +   + E
  S:    18 IESGDALVLPTETVYGLFA--KALDEKAVNAVYDLKQRPRDKAMNLNVADFNSILAFSKEQPRYLKKLYQAFLPGPLTIILKANDQVPYWINSGLSTVGFRLPSHPITAALIQKTGPLIGPSANLSGKASGRVFDHIMQDFD---FQVFGYADDPFLTGKDSTILDLSGERAVILRQGAITKEELLANVPE 203
>gi|152977511|ref|YP_001377028.1| Sua5/YciO/YrdC/YwlC family protein [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|152026263|gb|ABS24033.1| Sua5/YciO/YrdC/YwlC family protein [Bacillus cereus subsp. cytotoxis NVH 391-98] (347 aa)
Score = 118, Expect = 9.8e-05, Identities = 58/178 (32%), Positives = 86/178 (48%)
  Q:    33 VTYEKDSSNLNGIVFEIKNLKAAIVSTDTVSGL--LSLNKPLIYKI---KKRDKNKKLIRFVSNLDQIP----EVNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTN--TLKREGEIKYEWIKKTI 210
           V  +KD   L      ++  +A    T+TV GL   ++N   I KI   K R  +  LI  + +  Q+     EV    + L   FWPG LT+I  K+                RMPD +  L LI+    P+ + SAN SG P  T     +E  N   + I  ++G        ST+ D  +   T+ R G I  E +++ I
  S:    12 VEIKKDYPQLQEAAKLLRENEAVAFPTETVYGLGANAMNDEAIVKIFEAKGRPSDNPLIVHIGSKSQLTDIVREVPPVAEVLMKHFWPGPLTIILPKKDGISEKVTAGLDTVGVRMPDHEVALALIEAANVPVAAPSANRSGRPSPTLASHVYEDLNGKIAGI--VDGGATGVGVESTVIDCTSKVPTILRPGGITKEQLEEVI 213
>gi|163789458|ref|ZP_02183897.1| Sua5/YciO/YrdC/YwlC family protein [Carnobacterium sp. AT7] >gi|159875312|gb|EDP69377.1| Sua5/YciO/YrdC/YwlC family protein [Carnobacterium sp. AT7] (341 aa)
Score = 118, Expect = 9.9e-05, Identities = 39/83 (46%), Positives = 52/83 (62%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQIPEVNETFKKLASK----FWPGKLTLIYK-KE--------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPIT 155
           +Y  K R  +  LI  VS ++++ +      ++ASK    FWPG LTLI+K KE              + RMPD+   L LI +TG PL   SAN SG P  T
  S:    49 VYSAKGRPSDNPLIVHVSAIEEVEQYVVEVSEVASKLMETFWPGPLTLIFKVKEQAFAPTATAGLDSVAMRMPDNALTLQLIRETGKPLVGPSANTSGKPSPT 151
>gi|58337082|ref|YP_193667.1| Sua5 family translation factor [Lactobacillus acidophilus NCFM] >gi|58254399|gb|AAV42636.1| putative translation factor SUA5 family [Lactobacillus acidophilus NCFM] (334 aa)
Score = 118, Expect = 9.9e-05, Identities = 60/198 (30%), Positives = 89/198 (44%)
  Q:    15 FKKNLNNKEIKNYPKKEFVTYEKDSSNLNGIVFEIKNLKAAIVSTDTVSGLLSLNKPLIYKIKKRDKNKKLIRFVSNLDQI----PEVNETFKKLASKFWPGKLTLI---------------YKKESYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYD--IDTNTLKREGEIKYEWIKKTIEE 212
           FKK+  +  ++   K E V +  ++         +  L A     D+V G        +Y  K R  +  LI  VS+   +     EV E  KKL   FWPG LT++                K  ++R PDD    +LI K G P+   SAN S  P  T     +       + I  I+G   +    STI D  ++T  + R GEI  E + + + E
  S:     7 FKKDQLDDAVELLAKGELVAFPTET---------VYGLGAIATKEDSVRG--------VYAAKGRPSDNPLIVTVSDEKMMERYAKEVPERAKKLIKHFWPGPLTILLFVKPNTLPDAVTGGLKTVAFRCPDDSLTHDLIAKLGYPIVGPSANTSTKPSPTTAEHVYHDLKGKIAGI--IDGGPTRVGLESTIIDLSVETPIVLRPGEITPEELSEVLGE 207
>gi|56808654|ref|ZP_00366379.1| COG0009: Putative translation factor (SUA5) [Streptococcus pyogenes M49 591] (196 aa)
Score = 118, Expect = 1.0e-04, Identities = 52/164 (31%), Positives = 81/164 (49%)
  Q:    49 IKNLKAAIVSTDTVSGLLSLNKPL-------IYKIKKRDKNKKLIRFVSNLDQI----PEVNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDI--DTNTLKREGEIKYEWIKKTIEE 212
           I++  A ++ T+TV GL +  K L       +Y +K+R ++K +   V++ + I     E     KKL   F PG LT+I K                 +R+P       LI KTGPL   SANLSG           + F+     +     D +   + STI D+  +   + R+G I  E +   + E
  S:     8 IESGDALVLPTETVYGLFA--KALDEKAVNAVYDLKQRPRDKAMNLNVADFNSILAFSKEQPRYLKKLYQAFLPGPLTIILKANDQVPYWINSGLSTVGFRLPSHPITAALIQKTGPLIGPSANLSGKASGRVFDHIMQDFD---FQVFGYADDPFLTGKDSTILDLSGERAVILRQGAITKEELLANVPE 193
>gi|94990488|ref|YP_598588.1| Sua5/YciO/YrdC/YwlC family protein [Streptococcus pyogenes MGAS10270] >gi|94543996|gb|ABF34044.1| Sua5/YciO/YrdC/YwlC family protein [Streptococcus pyogenes MGAS10270] (206 aa)
Score = 118, Expect = 1.1e-04, Identities = 52/164 (31%), Positives = 81/164 (49%)
  Q:    49 IKNLKAAIVSTDTVSGLLSLNKPL-------IYKIKKRDKNKKLIRFVSNLDQI----PEVNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDI--DTNTLKREGEIKYEWIKKTIEE 212
           I++  A ++ T+TV GL +  K L       +Y +K+R ++K +   V++ + I     E     KKL   F PG LT+I K                 +R+P       LI KTGPL   SANLSG           + F+     +     D +   + STI D+  +   + R+G I  E +   + E
  S:    18 IESGDALVLPTETVYGLFA--KALDEKAVNTVYDLKQRPRDKAMNLNVADFNSILAFSKEQPRYLKKLYQAFLPGPLTIILKANDQVPYWINSGLSTVGFRLPSHPITTALIQKTGPLIGPSANLSGKASGRVFDHIMQDFD---FQVFGYADDPFLTGKDSTILDLSGERAVILRQGAITKEELLANVPE 203
>gi|183984067|ref|YP_001852358.1| hypothetical protein MMAR_4096 [Mycobacterium marinum M] >gi|183177393|gb|ACC42503.1| conserved hypothetical protein [Mycobacterium marinum M] (216 aa)
Score = 118, Expect = 1.1e-04, Identities = 29/88 (32%), Positives = 46/88 (52%)
  Q:   103 KKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDI 190
           ++L   FWPG L+L+  +                 RMP     + L+ + GP+  SSAN+SG PP  ++ DA   F       ++++G        STI D+
  S:    87 RELIRAFWPGALSLVVVQAPSLQWDLGNAHGTVMLRMPLHPVAIELLRQVGPMAVSSANVSGQPPAVDVADARNQFGDLVD--VYLDGGPAAQQAASTIVDL 186
>gi|118619167|ref|YP_907499.1| hypothetical protein MUL_3963 [Mycobacterium ulcerans Agy99] >gi|118571277|gb|ABL06028.1| conserved hypothetical protein [Mycobacterium ulcerans Agy99] (216 aa)
Score = 118, Expect = 1.1e-04, Identities = 29/88 (32%), Positives = 46/88 (52%)
  Q:   103 KKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDI 190
           ++L   FWPG L+L+  +                 RMP     + L+ + GP+  SSAN+SG PP  ++ DA   F       ++++G        STI D+
  S:    87 RELIRAFWPGALSLVVVQAPSLQWDLGNAHGTVMLRMPLHPVAIELLRQVGPMAVSSANVSGQPPAVDVADARNQFGDLVD--VYLDGGPAAQQAASTIVDL 186
>gi|71903504|ref|YP_280307.1| SUA5 protein [Streptococcus pyogenes MGAS6180] >gi|71802599|gb|AAX71952.1| SUA5 protein [Streptococcus pyogenes MGAS6180] (206 aa)
Score = 118, Expect = 1.1e-04, Identities = 52/164 (31%), Positives = 81/164 (49%)
  Q:    49 IKNLKAAIVSTDTVSGLLSLNKPL-------IYKIKKRDKNKKLIRFVSNLDQI----PEVNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDI--DTNTLKREGEIKYEWIKKTIEE 212
           I++  A ++ T+TV GL +  K L       +Y +K+R ++K +   V++ + I     E     KKL   F PG LT+I K                 +R+P       LI KTGPL   SANLSG           + F+     +     D +   + STI D+  +   + R+G I  E +   + E
  S:    18 IESGDALVLPTETVYGLFA--KALDEKAVNAVYDLKQRPRDKAMNLNVADFNSILAFSKEQPRYLKKLYQAFLPGPLTIILKANDQVPYWINSGLSTVGFRLPSHPITTALIQKTGPLIGPSANLSGKASGRVFDHIMQDFD---FQVFGYADDPFLTGKDSTILDLSGERAVILRQGAITKEELLANVPE 203
>gi|15675120|ref|NP_269294.1| hypothetical protein SPy_1143 [Streptococcus pyogenes M1 GAS] >gi|19746090|ref|NP_607226.1| hypothetical protein spyM18_1103 [Streptococcus pyogenes MGAS8232] >gi|71910678|ref|YP_282228.1| SUA5 protein [Streptococcus pyogenes MGAS5005] >gi|13622279|gb|AAK34015.1| hypothetical protein SPy_1143 [Streptococcus pyogenes M1 GAS] >gi|19748262|gb|AAL97725.1| hypothetical protein [Streptococcus pyogenes MGAS8232] >gi|71853460|gb|AAZ51483.1| SUA5 protein [Streptococcus pyogenes MGAS5005] (196 aa)
Score = 118, Expect = 1.2e-04, Identities = 52/164 (31%), Positives = 81/164 (49%)
  Q:    49 IKNLKAAIVSTDTVSGLLSLNKPL-------IYKIKKRDKNKKLIRFVSNLDQI----PEVNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDI--DTNTLKREGEIKYEWIKKTIEE 212
           I++  A ++ T+TV GL +  K L       +Y +K+R ++K +   V++ + I     E     KKL   F PG LT+I K                 +R+P       LI KTGPL   SANLSG           + F+     +     D +   + STI D+  +   + R+G I  E +   + E
  S:     8 IESGDALVLPTETVYGLFA--KALDEKAVNAVYDLKQRPRDKAMNLNVADFNSILAFSKEQPRYLKKLYQAFLPGPLTIILKANDQVPYWINSGLSTVGFRLPSHPITAALIQKTGPLIGPSANLSGKASGRVFDHIMQDFD---FQVFGYADDPFLTGKDSTILDLSGERAVILRQGAITKEELLANVPE 193
>gi|21227350|ref|NP_633272.1| SUA5 protein [Methanosarcina mazei Go1] >gi|20905707|gb|AAM30944.1| SUA5 protein [Methanosarcina mazei Go1] (364 aa)
Score = 118, Expect = 1.2e-04, Identities = 49/128 (38%), Positives = 70/128 (54%)
  Q:    25 KNYPKKEFVTYEKDSSNLNGIVFEIKNL--KAAIVS--TDTVSGLLS--LNKPLIYKI---KKRDKNKKLIRFVSNLDQIPEVNETFKK----LASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNP 152
           +N  KKE         N + I+ E   +  K   V+  T+TV GL +  LN   + KI   K+R     L   V + + I +V +   +    L   FWPG LT++ +K+                RMPD +  L LI + G PL + SANLSG P
  S:     4 ENGNKKETRILRVSEVNFDVIIDEAAEIIRKGGTVAFPTETVYGLGADGLNPDTVLKIFEAKERPPGNPLSLLVHSREDIKKVAKNIPEKALLLMDTFWPGPLTIVLEKKDTVPEITSGNLPTIGLRMPDHRIPLELIKRAGTPLAAPSANLSGKP 159
>gi|50954445|ref|YP_061733.1| translation factor [Leifsonia xyli subsp. xyli str. CTCB07] >gi|50950927|gb|AAT88628.1| translation factor [Leifsonia xyli subsp. xyli str. CTCB07] (232 aa)
Score = 118, Expect = 1.2e-04, Identities = 26/58 (44%), Positives = 35/58 (60%)
  Q:   103 KKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDA 160
           + L   FWPG LT++                  + RMP D+  L L+ +TGPL  SSANLSG P     ++A
  S:    87 EALVEAFWPGGLTIVLPAAPLLVWGLGETSGTVALRMPQDRIALELLAETGPLAVSSANLSGRPAARTAVEA 158
>gi|139473766|ref|YP_001128482.1| hypothetical protein SpyM50925 [Streptococcus pyogenes str. Manfredo] >gi|134272013|emb|CAM30252.1| conserved hypothetical protein [Streptococcus pyogenes str. Manfredo] (196 aa)
Score = 118, Expect = 1.2e-04, Identities = 52/164 (31%), Positives = 81/164 (49%)
  Q:    49 IKNLKAAIVSTDTVSGLLSLNKPL-------IYKIKKRDKNKKLIRFVSNLDQI----PEVNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDI--DTNTLKREGEIKYEWIKKTIEE 212
           I++  A ++ T+TV GL +  K L       +Y +K+R ++K +   V++ + I     E     KKL   F PG LT+I K                 +R+P       LI KTGPL   SANLSG           + F+     +     D +   + STI D+  +   + R+G I  E +   + E
  S:     8 IESGDALVLPTETVYGLFA--KALDEKAVNAVYDLKQRPRDKAMNLNVADFNSILAFSKEQPRYLKKLYQAFLPGPLTIILKANDQVPYWINSGLSTVGFRLPSHPITTALIQKTGPLIGPSANLSGKASGRVFDHIMQDFD---FQVFGYADDPFLTGKDSTILDLSGERAVILRQGAITKEELLANVPE 193
>gi|153004279|ref|YP_001378604.1| Sua5/YciO/YrdC/YwlC family protein [Anaeromyxobacter sp. Fw109-5] >gi|152027852|gb|ABS25620.1| Sua5/YciO/YrdC/YwlC family protein [Anaeromyxobacter sp. Fw109-5] (205 aa)
Score = 117, Expect = 1.2e-04, Identities = 46/149 (30%), Positives = 80/149 (53%)
  Q:    59 TDTVSGLLSLNK-----PLIYKIKKRDKNKKLIRFVSNLDQIPEV---NETFKKLASKFWPGKLTLIY--------------KKESYRMPDDKFILNLIDKT-GPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDI--DTNTLKREGEIKYEWIK 207
           T+T  GL +L +       + + K R + K L    ++ DQ+ EV   +    +LA +FWPG LTL+               +  + R+P  +    L  +  G + S+SANLSG+PP ++      S       +  ++G      +PSTI ++  +   L R+G I +E ++
  S:    28 TETFYGLGALARDPAALERLARAKLRPEGKPLPLLAADADQVREVARLDGLASRLAERFWPGPLTLVLPALPGLDAAVTAGSRTVAVRVPGSELARALARQAGGAIVSTSANLSGDPPPSSAAQLSPSLVARIDHV--LDGGSTPGGRPSTIVEVVGERVRLVRDGVIPFEEVQ 199
>gi|94988612|ref|YP_596713.1| sua5/YciO/YrdC/YwlC family protein [Streptococcus pyogenes MGAS9429] >gi|94992436|ref|YP_600535.1| Sua5/YciO/YrdC/YwlC family protein [Streptococcus pyogenes MGAS2096] >gi|94542120|gb|ABF32169.1| sua5/YciO/YrdC/YwlC family protein [Streptococcus pyogenes MGAS9429] >gi|94545944|gb|ABF35991.1| Sua5/YciO/YrdC/YwlC family protein [Streptococcus pyogenes MGAS2096] (206 aa)
Score = 117, Expect = 1.2e-04, Identities = 52/164 (31%), Positives = 81/164 (49%)
  Q:    49 IKNLKAAIVSTDTVSGLLSLNKPL-------IYKIKKRDKNKKLIRFVSNLDQI----PEVNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDI--DTNTLKREGEIKYEWIKKTIEE 212
           I++  A ++ T+TV GL +  K L       +Y +K+R ++K +   V++ + I     E     KKL   F PG LT+I K                 +R+P       LI KTGPL   SANLSG           + F+     +     D +   + STI D+  +   + R+G I  E +   + E
  S:    18 IESGDALVLPTETVYGLFA--KALDEKAVNAVYDLKQRPRDKAMNLNVADFNSILVFSKEQPRYLKKLYQAFLPGPLTIILKANDQVPYWINSGLSTVGFRLPSHPITTALIQKTGPLIGPSANLSGKASGRVFDHIMQDFD---FQVFGYADDPFLTGKDSTILDLSGERAVILRQGAITKEELLANVPE 203
>gi|167636681|ref|ZP_02394969.1| sua5/yciO/yrdC/ywlC family protein [Bacillus anthracis str. A0442] >gi|167527881|gb|EDR90703.1| sua5/yciO/yrdC/ywlC family protein [Bacillus anthracis str. A0442] (346 aa)
Score = 117, Expect = 1.3e-04, Identities = 56/158 (35%), Positives = 81/158 (51%)
  Q:    53 KAAIVSTDTVSGL--LSLNKPLIYKI---KKRDKNKKLIRFV---SNLDQI-PEVNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTN--TLKREGEIKYEWIKKTI 210
           +A    T+TV GL   ++N   I KI   K R  +  LI  +   S LD I  E+    +KL   FWPG LT+I  ++                RMPD    L LI++   P+ + SAN SG P  T     +E  N+  + I  ++G        ST+ D  +   T+ R G I  E ++  I
  S:    32 EAIAFPTETVYGLGANAMNDEAIAKIFEAKGRPSDNPLIVHIGTKSQLDGIVKEIPPVAEKLMEHFWPGPLTIILPRKEGISEKVTAGLHTVGVRMPDHPVALALIEEANVPVAAPSANRSGRPSPTLASHVYEDLNEKIAGI--VDGGATGVGVESTVIDCTSTVPTILRPGGITKEQLEAVI 213
>gi|164688897|ref|ZP_02212925.1| hypothetical protein CLOBAR_02545 [Clostridium bartlettii DSM 16795] >gi|164602101|gb|EDQ95566.1| hypothetical protein CLOBAR_02545 [Clostridium bartlettii DSM 16795] (346 aa)
Score = 117, Expect = 1.3e-04, Identities = 47/138 (34%), Positives = 72/138 (52%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQIPEVNETFKKLAS----KFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDI--DTNTLKREGEIKYEWIKKTI 210
           IYK K R  +  LI  + +  Q+  + ++  K A     KFWPG +T+I  K+              + RMP +K    LI +   P+ + SAN+SG P  T     +E  N   S II   G+       ST+ D+  +  T+ R G I  E ++K +
  S:    54 IYKAKGRPSDNPLIVHIGDKKQVYNLVQSVTKEAEIVMDKFWPGPITIILNKKDIIPKRTSGGLDTVAIRMPSNKIANALIKEANIPIAAPSANISGRPSPTRAKHVYEEMNHRVSGIIM--GNDCVYGLESTVLDLTGEIPTILRPGSITKEQLEKEL 210
>gi|149200145|ref|ZP_01877169.1| sua5 related protein [Lentisphaera araneosa HTCC2155] >gi|149136786|gb|EDM25215.1| sua5 related protein [Lentisphaera araneosa HTCC2155] (322 aa)
Score = 117, Expect = 1.4e-04, Identities = 55/168 (32%), Positives = 89/168 (52%)
  Q:    41 NLNGIVFEIKNLKAAIVSTDTVSGL--LSLNKPL---IYKIKKRDKNKKLIRFVSNL----DQIPEVNETFKKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDI-IFIEGDYYQNNQPSTIYDIDTN--TLKREGEIKYEWIKK 208
           N+      +KN      +T+TV GL   +L+ P    I+K KKR K   LI  ++ +    D + E+ +    LA  +WPG LTL++KK               + RMP     L L+ +   P+ + SAN  G    T+   A   F++ ++++ I ++G        STI D  +    L R+G I  E I++
  S:    10 NIKKAAEHLKNDNLVAFATETVYGLGANALSPPACEKIFKAKKRPKYDPLIVHIAEIYQLSDLVKEIPDVALDLAEAYWPGPLTLVFKKTDLIPSLITSGLDTVAIRMPAHPLALGLLSEAQIPVAAPSANPFGYLSPTS---AEHVFSQLENEVDIILDGGECDWGIESTIVDCSSGEAILLRQGGISAEDIRR 201
>gi|190570595|ref|YP_001974953.1| Sua5/YciO/YrdC/YwlC family protein [Wolbachia pipientis] >gi|190356867|emb|CAQ54241.1| Sua5/YciO/YrdC/YwlC family protein [Wolbachia pipientis] (195 aa)
Score = 117, Expect = 1.4e-04, Identities = 58/162 (35%), Positives = 94/162 (58%)
  Q:    45 IVFEIKNLKAAIVSTDTVSGLL-------SLNKPLIYKIKKRDKNKKLIRFVSNLD---QIPEVNETFKKLASKFWPGKLTLI------------YKKES--YRMPDDKFILNLIDK-TGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLK--REGEIKYEWI 206
           ++  IKN   A   T+TV  L        S+ K  IY+IKKR +NK L  FVS++D    I +V E +  L + F PG +T I            + K+S   R+PD    ++++++   P+ ++S N+SG   I    D  +S  ++ S +  IE D   +   STI D+  + +K  R+G+I  + I
  S:     5 VINAIKNNLLACFPTETVYALACNALGKESIEK--IYRIKKRSQNKPLSIFVSDVDSLTNIAKVKEEYINLINYFSPGPMTYILPLQDNSILPNEFFKDSIGIRIPDHPIAISILNELKTPVVATSINISGEKSICKARDIPQSIKQHLSAV--IEDDELVSGIESTIIDLTGDKIKVLRKGKISLQTI 189
>gi|58696928|ref|ZP_00372427.1| Sua5/YciO/YrdC/YwlC family protein [Wolbachia endosymbiont of Drosophila simulans] >gi|58536842|gb|EAL60054.1| Sua5/YciO/YrdC/YwlC family protein [Wolbachia endosymbiont of Drosophila simulans] (195 aa)
Score = 117, Expect = 1.4e-04, Identities = 48/134 (35%), Positives = 79/134 (58%)
  Q:    73 IYKIKKRDKNKKLIRFVS---NLDQIPEVNETFKKLASKFWPGKLTLI------------YKKES--YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLK--REGEIKYEWI 206
           IY+IKKR +NK L  FVS   NL +I +V E +  L + F PG +T I            + K+S   R+P+    +++++K   P+ ++S N+SG   +    D  +S  ++ S  + IE D   +   STI D+  + +K  REG I  + +
  S:    38 IYQIKKRSQNKPLSIFVSDIYNLTKIAKVKERYIDLINHFSPGPITYILPLKNNNILPNEFFKDSIGIRIPEHPIAISILNKLKVPIVATSTNISGKESVCKANDIPQSIKQHLS--VVIEDDELVSGIESTIIDLTEDKIKVLREGAISLQTV 189
>gi|15791118|ref|NP_280942.1| hypothetical protein VNG2312C [Halobacterium sp. NRC-1] >gi|169236871|ref|YP_001690071.1| hypothetical protein OE4244F [Halobacterium salinarum R1] >gi|10581723|gb|AAG20422.1| conserved hypothetical protein [Halobacterium sp. NRC-1] >gi|167727937|emb|CAP14725.1| conserved hypothetical protein [Halobacterium salinarum R1] (198 aa)
Score = 117, Expect = 1.5e-04, Identities = 44/153 (28%), Positives = 83/153 (54%)
  Q:    56 IVSTDTVSGLLS--LNKPLI---YKIKKRDKNKKLIRFVSNLDQIPE---VNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKREGEIK---YEWIKK 208
           +  T+TV GL +  L+   I   ++ K+R + K L     +++   E   V ET +   ++F PG +T++ +K                 R+PD +  + L+++  PL ++SAN+SG P +TN   A +   + + D +   G+       ST+ D+    + R G +     EW+ +
  S:    21 VFPTETVYGLAADALDPDAIEAAFEAKRRPREKPLSFAFPDVEAAVEHVAVGETERAFMAEFLPGPVTVVCEKRDSVPDVLTGGRDRVGVRVPDSEVAVALLERVAPLTATSANVSGEPSVTNPA-ALDPAFRARVDAVVDAGE-SPGGTGSTVVDVARGEILRAGAVGDAVREWLAE 196
>gi|42520658|ref|NP_966573.1| Sua5/YciO/YrdC/YwlC family protein [Wolbachia endosymbiont of Drosophila melanogaster] >gi|42410398|gb|AAS14507.1| Sua5/YciO/YrdC/YwlC family protein [Wolbachia endosymbiont of Drosophila melanogaster] (195 aa)
Score = 117, Expect = 1.5e-04, Identities = 48/134 (35%), Positives = 79/134 (58%)
  Q:    73 IYKIKKRDKNKKLIRFVS---NLDQIPEVNETFKKLASKFWPGKLTLI------------YKKES--YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLK--REGEIKYEWI 206
           IY+IKKR +NK L  FVS   NL +I +V E +  L + F PG +T I            + K+S   R+P+    +++++K   P+ ++S N+SG   +    D  +S  ++ S  + IE D   +   STI D+  + +K  REG I  + +
  S:    38 IYQIKKRSQNKPLSIFVSDIYNLTKIAKVKERYIDLINHFSPGPITYILPLKNNNMLPNEFFKDSIGIRIPEHPIAISILNKLKVPIVATSTNISGKESVCKANDIPQSIKQHLS--VVIEDDELVSGIESTIIDLTEDKIKVLREGAISLQTV 189
>gi|42518857|ref|NP_964787.1| hypothetical protein LJ0932 [Lactobacillus johnsonii NCC 533] >gi|41583143|gb|AAS08753.1| hypothetical protein LJ_0932 [Lactobacillus johnsonii NCC 533] (330 aa)
Score = 116, Expect = 1.6e-04, Identities = 59/154 (38%), Positives = 80/154 (51%)
  Q:    59 TDTVSGL--LSLNKPLI---YKIKKRDKNKKLIRFVSNL----DQIPEVNETFKKLASKFWPGKLTLI-YKKE--------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQP------STIYD--IDTNTLKREGEIKYEWIKKTIEE 212
           T+TV GL  L+ N+  +   Y  K R  +  LI  VS+     + + EV E  KKL   FWPG LT+I + KE              ++R P+D    +LI   G P+   SAN S  P  T     F       + II        +N P      STI D  ++  T+ R GEI  E I   + E
  S:    28 TETVYGLGALATNEKAVKSVYAAKGRPSDNPLIVTVSDEQMMENYVSEVPERAKKLIKHFWPGPLTIILFVKEGTLPDAVTGGLPTAAFRCPNDDMTHDLISGLGKPIVGPSANTSTKPSPTTAEHVFHDLKGKIAGII--------DNGPTEIGLESTIVDLSVEKPTVLRPGEITPEEISAVLGE 206
>gi|67459737|ref|YP_247361.1| putative translation factor protein [Rickettsia felis URRWXCal2] >gi|67005270|gb|AAY62196.1| Putative translation factor protein [Rickettsia felis URRWXCal2] (361 aa)
Score = 116, Expect = 1.7e-04, Identities = 58/162 (35%), Positives = 90/162 (55%)
  Q:    49 IKNLKAAIVSTDTVSGL---LSLNKPL--IYKIKKRDKNKKLIRFVSNLDQ---IPEVNETFKKLASKFWPGKLTLIYK-KE---------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQ--PSTIYDIDTN--TLKREGEIKYEWIKKTI 210
           IK+ K  +  T+TV G+    + N+    I++ K R     LI  VS+++Q   I E N+   K+A KFWPG L+++   KE               + R+P     L LI ++G P+ + SAN S     TN     + F K   +I  +  + YQ+     STI D  T   T+ REG I  E +++ +
  S:    59 IKSGKVVVFPTETVYGIGADATNNEACLKIFQFKNRPAINPLIVHVSSIEQAKEIGEFNDLATKIAEKFWPGPLSIVVSLKENANIAPSVTAGLNTIAIRIPSYPLALELIRQSGVPIAAPSANPSNYISPTNAEHVTKHF-KDNQEIFILAPEIYQSEYGLESTIIDTTTATPTILREGFITAEILEEVL 248
>gi|30265348|ref|NP_847725.1| sua5/yciO/yrdC/ywlC family protein [Bacillus anthracis str. Ames] >gi|47778411|ref|YP_022236.2| sua5/yciO/yrdC/ywlC family protein [Bacillus anthracis str. 'Ames Ancestor'] >gi|49188160|ref|YP_031413.1| sua5/yciO/yrdC/ywlC family protein [Bacillus anthracis str. Sterne] >gi|49480413|ref|YP_039318.1| sua5/yciO/yrdC/ywlC family protein [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|52140237|ref|YP_086594.1| sua5/yciO/yrdC/ywlC family protein [Bacillus cereus E33L] >gi|65317301|ref|ZP_00390260.1| COG0009: Putative translation factor (SUA5) [Bacillus anthracis str. A2012] >gi|165871252|ref|ZP_02215901.1| sua5/yciO/yrdC/ywlC family protein [Bacillus anthracis str. A0488] >gi|166986492|ref|ZP_02257743.1| sua5/yciO/yrdC/ywlC family protein [Bacillus cereus AH187] >gi|168164297|ref|ZP_02599530.1| sua5/yciO/yrdC/ywlC family protein [Bacillus cereus H3081.97] >gi|170688185|ref|ZP_02879396.1| sua5/yciO/yrdC/ywlC family protein [Bacillus anthracis str. A0465] >gi|170709376|ref|ZP_02899789.1| sua5/yciO/yrdC/ywlC family protein [Bacillus anthracis str. A0389] >gi|177651870|ref|ZP_02934453.1| sua5/yciO/yrdC/ywlC family protein [Bacillus anthracis str. A0174] >gi|30260026|gb|AAP29211.1| sua5/yciO/yrdC/ywlC family protein [Bacillus anthracis str. Ames] >gi|47552116|gb|AAT34711.2| sua5/yciO/yrdC/ywlC family protein [Bacillus anthracis str. 'Ames Ancestor'] >gi|49182087|gb|AAT57463.1| sua5/yciO/yrdC/ywlC family protein [Bacillus anthracis str. Sterne] >gi|49331969|gb|AAT62615.1| sua5/yciO/yrdC/ywlC family protein [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|51973706|gb|AAU15256.1| sua5/yciO/yrdC/ywlC family protein [Bacillus cereus E33L] >gi|164712919|gb|EDR18447.1| sua5/yciO/yrdC/ywlC family protein [Bacillus anthracis str. A0488] >gi|170125724|gb|EDS94638.1| sua5/yciO/yrdC/ywlC family protein [Bacillus anthracis str. A0389] >gi|170667878|gb|EDT18630.1| sua5/yciO/yrdC/ywlC family protein [Bacillus anthracis str. A0465] >gi|172082574|gb|EDT67638.1| sua5/yciO/yrdC/ywlC family protein [Bacillus anthracis str. A0174] (346 aa)
Score = 116, Expect = 1.7e-04, Identities = 56/158 (35%), Positives = 81/158 (51%)
  Q:    53 KAAIVSTDTVSGL--LSLNKPLIYKI---KKRDKNKKLIRFV---SNLDQI-PEVNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTN--TLKREGEIKYEWIKKTI 210
           +A    T+TV GL   ++N   I KI   K R  +  LI  +   S LD I  E+    +KL   FWPG LT+I  ++                RMPD    L LI++   P+ + SAN SG P  T     +E  N+  + I  ++G        ST+ D  +   T+ R G I  E ++  I
  S:    32 EAIAFPTETVYGLGANAMNDEAIAKIFEAKGRPSDNPLIVHIGTKSQLDGIVKEIPPVAEKLMEHFWPGPLTIILPRKEGISEKVTAGLHTVGVRMPDHPVALALIEEANVPVAAPSANRSGRPSPTLASHVYEDLNEKIAGI--VDGGATGVGVESTVIDCTSAVPTILRPGGITKEQLEAVI 213
>gi|161506044|ref|YP_001573156.1| putative ribosome maturation factor [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] >gi|160867391|gb|ABX24014.1| hypothetical protein SARI_04225 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] (200 aa)
Score = 116, Expect = 1.7e-04, Identities = 39/127 (30%), Positives = 66/127 (51%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQI-PEVNETF-----KKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKREG 199
           + ++K+R  +K LI   ++ +Q+ P ++++      +K     WPG +T ++   +               R+ D   ++ L +  G PL S+SANLSG PP   + +    F     D   +EG       PS I D  T  L R+G
  S:    56 LLELKQRPVDKGLILIAASFEQLKPYIDDSILTTAQRKAVFDCWPGPVTFVFPASATTPRWLTGRFDSLAVRVTDHPLVVALCNAYGKPLVSTSANLSGLPPCRTVEEVRAQFG---DDFPMVEGATGGRLNPSEIRDALTGELFRQG 200
>gi|119509584|ref|ZP_01628731.1| SUA5/yciO/yrdC-like protein [Nodularia spumigena CCY9414] >gi|119465773|gb|EAW46663.1| SUA5/yciO/yrdC-like protein [Nodularia spumigena CCY9414] (200 aa)
Score = 116, Expect = 1.8e-04, Identities = 37/106 (34%), Positives = 59/106 (55%)
  Q:    59 TDTVSGLLSLNKP--LIYKIKKRDKNKKLIRF-VSNLDQIPEVN------ETFKKLASKFWPGKLTLIYKKES---------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESF 164
           TDTV  L +L +   LI+  K+R ++K LI    S  D  P V       + ++ +A++ WPG LTL+                     R+P       ++ +TG L ++SAN SG  P+  + +  E F
  S:    27 TDTVPALAALPEKAGLIFAAKQRSQDKPLILMGASAEDLWPYVQGSENELKIWQDVANRHWPGALTLVLPASQKVPKQMNPTDPSTIGIRVPQSAIAQTILAQTGALATTSANFSGQQPLLKLAEIAEQF 156
>gi|177670769|ref|ZP_02943859.1| Sua5/YciO/YrdC/YwlC family protein [Micrococcus luteus NCTC 2665] >gi|172072197|gb|EDT58234.1| Sua5/YciO/YrdC/YwlC family protein [Micrococcus luteus NCTC 2665] (244 aa)
Score = 116, Expect = 1.9e-04, Identities = 36/116 (31%), Positives = 59/116 (50%)
  Q:    97 EVNETFKKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLK--REGEIKYEWIKKTIEE 212
           +V E  + LA +FWPG LTLI K +              + R+PDD     L+   GP+  SSAN +G    T    A       +S  ++++    ++  PSTI D      +  R+G +  E ++  + +
  S:    84 DVPEEAEALAERFWPGALTLILKSQPTLTWDLGETRGTVALRVPDDAVARELLYAVGPMAVSSANRTGMDAATTADAARSMLG--ESVALYLDAGPRESRDPSTIVDCTVTPFRVARQGSVPLEELRAVVPD 213
>gi|157148857|ref|YP_001456176.1| putative ribosome maturation factor [Citrobacter koseri ATCC BAA-895] >gi|157086062|gb|ABV15740.1| hypothetical protein CKO_04695 [Citrobacter koseri ATCC BAA-895] (200 aa)
Score = 116, Expect = 1.9e-04, Identities = 39/127 (30%), Positives = 67/127 (52%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQI-PEVNE-----TFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKREG 199
           + ++K+R   K LI   +N +Q+ P +++     T ++     WPG +T ++   +               R+ D   +++L    G PL S+SANL+G PP   + +    F    +D   +EG+      PS I D  T  L R+G
  S:    56 LLELKQRPVEKGLILIAANFEQLKPYIDDSMLTDTQREAIFACWPGPVTFVFPAPATTPRWLTGRFDSLAVRVTDHPLVVSLCQAYGKPLVSTSANLTGLPPCRTVEEVRAQFG---ADFPVVEGETGGRLNPSEIRDALTGELFRQG 200
>gi|189424902|ref|YP_001952079.1| Sua5/YciO/YrdC/YwlC family protein [Geobacter lovleyi SZ] >gi|189421161|gb|ACD95559.1| Sua5/YciO/YrdC/YwlC family protein [Geobacter lovleyi SZ] (203 aa)
Score = 116, Expect = 1.9e-04, Identities = 50/158 (31%), Positives = 83/158 (52%)
  Q:    49 IKNLKAAIVSTDTVSGLLS--LNKP---LIYKIKKRDKNKKLIRFVSNLDQIPE----VNETFKKLASKFWPGKLT------------LIYKKESY--RMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTN-TLKREGEIKYEWI 206
           +KN       TDT  GL     NK     IY++K+RDK K      S+L ++       N  F K+  ++ PG  T            LI K+++   RMPD+   L+++   G P+ ++SANLSG  P+ + ++    F  +  D++ ++G     +  S +  +     L REG     W+
  S:    22 LKNGGIVAYPTDTTYGLGCSIFNKKGLERIYQVKQRDKRKPFSFICSDLSEVSRYARLTNHAF-KIMKRYLPGPYTFVLEASREVPDLLITKQKTVGIRMPDNAICLSIVQGLGVPIVTTSANLSGEDPVGDPLEINRLFG-HALDLV-VDGGLLTTDVSSVVSLVGKEPELLREGAGDLSWL 201
>gi|167768294|ref|ZP_02440347.1| hypothetical protein CLOSS21_02850 [Clostridium sp. SS2/1] >gi|167709818|gb|EDS20397.1| hypothetical protein CLOSS21_02850 [Clostridium sp. SS2/1] (350 aa)
Score = 116, Expect = 2.0e-04, Identities = 34/93 (36%), Positives = 51/93 (54%)
  Q:    63 SGLLSLNKPLIYKIKKRDKNKKLIRFVSNLDQI----PEVNETFKKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPIT 155
           +GLL      IY  K R  +  LI  V ++  +     E+ +  ++    FWPG +T+I +K               + RMPD    L LI ++G P+ + SAN SG P  T
  S:    44 NGLLPDAAKKIYAAKGRPSDNPLILHVCDMQMVESLVKEIPDNARRAMEHFWPGPMTVILQKADQVPDCVTGGLDTVAIRMPDHPVALELIRRSGVPIAAPSANTSGRPSPT 155
>gi|118480360|ref|YP_897511.1| translation factor SUA5 [Bacillus thuringiensis str. Al Hakam] >gi|196042389|ref|ZP_03109654.1| sua5/yciO/yrdC/ywlC family protein [Bacillus cereus NVH0597-99] >gi|118419585|gb|ABK88004.1| translation factor SUA5 [Bacillus thuringiensis str. Al Hakam] >gi|196026781|gb|EDX65423.1| sua5/yciO/yrdC/ywlC family protein [Bacillus cereus NVH0597-99] (346 aa)
Score = 116, Expect = 2.0e-04, Identities = 56/158 (35%), Positives = 81/158 (51%)
  Q:    53 KAAIVSTDTVSGL--LSLNKPLIYKI---KKRDKNKKLIRFV---SNLDQI-PEVNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTN--TLKREGEIKYEWIKKTI 210
           +A    T+TV GL   ++N   I KI   K R  +  LI  +   S LD I  E+    +KL   FWPG LT+I  ++                RMPD    L LI++   P+ + SAN SG P  T     +E  N+  + I  ++G        ST+ D  +   T+ R G I  E ++  I
  S:    32 EAIAFPTETVYGLGANAMNDEAIAKIFEAKGRPSDNPLIVHIGTKSQLDGIVKEIPPVAEKLMEHFWPGPLTIILPRKEGISEKVTAGLHTVGVRMPDHPVALALIEEANVPVAAPSANRSGRPSPTLASHVYEDLNEKIAGI--VDGGATGVGVESTVIDCTSAVPTILRPGGITKEQLEAVI 213
>gi|124023897|ref|YP_001018204.1| putative translation factor (SUA5) [Prochlorococcus marinus str. MIT 9303] >gi|123964183|gb|ABM78939.1| Putative translation factor (SUA5) [Prochlorococcus marinus str. MIT 9303] (196 aa)
Score = 116, Expect = 2.0e-04, Identities = 35/100 (35%), Positives = 58/100 (57%)
  Q:    54 AAIVSTDTVSGLLSLNKPL--IYKIKKRDKNKKLIRFVSNLDQI-----PEVNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPP 153
           AA++ TDT+  L +       ++ +K+R  +K LI   +  +++     P   E    +A ++WPG LTL+                    R+PD   I  L+ ++GPL ++SANLSG  P
  S:    23 AALLPTDTLPALAAAPVHAAQLWTMKQRSADKPLILMAATPEELLAHVSPLALEDAWSMARRYWPGALTLVVPASGVLVEALNPGAFTLGLRVPDCGVIRCLLKQSGPLATTSANLSGAAP 143
>gi|166363633|ref|YP_001655906.1| putative translation factor [Microcystis aeruginosa NIES-843] >gi|166086006|dbj|BAG00714.1| putative translation factor [Microcystis aeruginosa NIES-843] (195 aa)
Score = 116, Expect = 2.0e-04, Identities = 39/116 (33%), Positives = 64/116 (55%)
  Q:    39 SSNLNGIVFEIKNLKAAIVSTDTVSGLLSLNKP---LIYKIKKRDKNKKLIRFVSNLDQI-------PEVNETFKKLASKFWPGKLTLIYKKES---------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPI 154
           +++LN IV    + +     TDTV  L +++ P   LI+  KKR  +K LI   ++   +        E  E ++++  K WPG LTL+                     R+P       ++ +TG L ++SANLSG  P+
  S:     3 TASLNEIVHAALSGQVVSFPTDTVPAL-AVSPPYAALIFAAKKRTFDKPLILMAASAADLWDYVEGNQEEREIWRQMTEKHWPGSLTLVLPAAEKVPKVLNPKNPSTIGIRVPAHAIAREILGRTGVLATTSANLSGQEPL 142
>gi|148543689|ref|YP_001271059.1| translation factor SUA5 [Lactobacillus reuteri F275] >gi|184153099|ref|YP_001841440.1| putative translation factor [Lactobacillus reuteri F275] >gi|148530723|gb|ABQ82722.1| translation factor SUA5 [Lactobacillus reuteri F275] >gi|183224443|dbj|BAG24960.1| putative translation factor [Lactobacillus reuteri F275] (342 aa)
Score = 116, Expect = 2.1e-04, Identities = 45/138 (32%), Positives = 74/138 (53%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQI----PEVNETFKKLASKFWPGKLTLIYKKE---------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQP------STIYDIDTN--TLKREGEIKYEWIKKTI 210
           +Y  K R  +  LI  V+++  +     E+ +  +KL   FWPG LT+I K +               ++R PD +  L+LI++ G P+   SAN SG P  T     +   +   S I+        +N P      ST+ D+ T+   + R G +  + I+K I
  S:    47 VYLAKGRPSDNPLIVHVNSIAMVEKYAAEIPDNARKLMDAFWPGSLTIILKIKKGALSKTVTGGLKTVAFRYPDCQPTLDLIEEAGVPMVGPSANTSGKPSPTTAQHVYHDLHGKISGIV--------DNGPTRVGVESTVLDMSTDHPVILRPGAVTKKDIEKVI 204
>gi|83312811|ref|YP_423075.1| putative translation factor [Magnetospirillum magneticum AMB-1] >gi|82947652|dbj|BAE52516.1| Putative translation factor [Magnetospirillum magneticum AMB-1] (368 aa)
Score = 115, Expect = 2.1e-04, Identities = 35/78 (44%), Positives = 46/78 (58%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQ---IPEVNETFKKLASKFWPGKLTLIYKKE----------------SYRMPDDKFILNLIDKTG-PLYSSSANLSG 150
           I+K K R     LI  VS+L+Q   + E+      LA +FWPG LTL+ ++                 + RMPD    L LI   G PL + SAN SG
  S:    98 IFKAKGRPSFNPLIAHVSSLEQAAALVELGADAHLLAERFWPGPLTLVLRRRADSPVSLLASAGLDSVAVRMPDHPVALALIKAAGRPLAAPSANRSG 195
>gi|116873906|ref|YP_850687.1| Sua5/YciO/YrdC/YwlC family protein [Listeria welshimeri serovar 6b str. SLCC5334] >gi|116742784|emb|CAK21908.1| unnamed protein product [Listeria welshimeri serovar 6b str. SLCC5334] (345 aa)
Score = 115, Expect = 2.1e-04, Identities = 55/152 (36%), Positives = 80/152 (52%)
  Q:    59 TDTVSGL--LSLNKPLIYKI---KKRDKNKKLIRFVSNLDQIPEVNETFK----KLASKFWPGKLTLIYK--KESY-------------RMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDI--DTNTLKREGEIKYEWIKKTI 210
           T+TV GL   + N+  I KI   K R  +  LI  ++  +Q+ +  E++     +L  KFWPG LTLI    K+S              RMP+    L+LI     P+ + SAN SG P  T      E  +   + I  I+G        ST+ D   +T  + R G I  E I++ I
  S:    35 TETVYGLGADATNQAAIQKIYTAKGRPSDNPLIVHIARREQMDQFVESYPPKAIQLMEKFWPGPLTLILPLIKDSLAANVSAGLSTVGVRMPEHPVSLDLIKTANIPVAAPSANRSGKPSPTTAAHVIEDLDGKIAGI--IDGGPTGVGLESTVIDCSQETPVILRPGGITKEQIERVI 211
>gi|188587452|ref|YP_001918997.1| Sua5/YciO/YrdC/YwlC family protein [Natranaerobius thermophilus JW/NM-WN-LF] >gi|179352139|gb|ACB86409.1| Sua5/YciO/YrdC/YwlC family protein [Natranaerobius thermophilus JW/NM-WN-LF] (367 aa)
Score = 115, Expect = 2.2e-04, Identities = 34/83 (40%), Positives = 50/83 (60%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQIPEVN---ETFKKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPIT 155
           I++ K R  +  +I  + +++Q+  +    E F  LA KFWPG LT+I  K+              + RMPD    L LI +   P+ + SANLSG P  T
  S:    53 IFQAKNRPLDNPVILHLHSVNQVETLGFPPEEFFFLAEKFWPGPLTMIIPKKNIVPREASGGLDTVAVRMPDHNVALALIQEAQVPMAAPSANLSGRPSPT 153
>gi|187604002|ref|ZP_02990213.1| Sua5/YciO/YrdC/YwlC family protein [Exiguobacterium sp. AT1b] >gi|187484064|gb|EDU22057.1| Sua5/YciO/YrdC/YwlC family protein [Exiguobacterium sp. AT1b] (336 aa)
Score = 115, Expect = 2.2e-04, Identities = 52/152 (34%), Positives = 77/152 (50%)
  Q:    59 TDTVSGLL--SLNKPLIYKI---KKRDKNKKLIRFVSNLDQ----IPEVNETFKKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDI--DTNTLKREGEIKYEWIKKTI 210
           T+TV GL   ++N   I KI   K R  +  LI  +++++Q    +  +    K+L   FWPG LT+I                    RMP+    L LI K+G  L + SAN SG P  T      +  N   + I  ++G        ST+ D   DT T+ R G +  E ++  I
  S:    28 TETVYGLAGDAMNDVAIRKIFEAKGRPSDNPLIVHIASIEQTSLFVDSIPPVAKRLMDAFWPGALTIILPSNGRASSLVTAGLDSIGLRMPNHPAALELIRKSGLGLAAPSANRSGRPSPTTAQHVADDLNGRIAGI--VDGGPTGIGVESTVVDCTGDTVTILRPGGVTREEMEAVI 203
>gi|54310611|ref|YP_131631.1| putative Sua5/YciO/YrdC family protein [Photobacterium profundum SS9] >gi|46915054|emb|CAG21829.1| Putative Sua5/YciO/YrdC family protein [Photobacterium profundum SS9] (192 aa)
Score = 115, Expect = 2.3e-04, Identities = 48/167 (28%), Positives = 87/167 (52%)
  Q:    33 VTYEKDSSNLNGIVFEIKNLKAAIVSTDTVSGL-LSLNKPL----IYKIKKRDKNKKLIRFVSNLDQI------PEVNETFKKLASKFWPGKLTLIY--KKE------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKREG 199
           V YE D  NL  +V  +++ +     T+ V G+    + P     +  +K+R   K LI   +N  Q+       ++++  K+     WPG +T +   KK+            + R+ D   +  L  + G P+ S+SANL+G PP   + +      ++ S I  +EG+      P+ I D  ++T+ R+G
  S:     2 VIYEVDMDNLQQVVSALQSGEVIAYPTEGVFGVGCDPDNPQAVEKLLALKQRPIEKGLILIAANYQQLQPYIDDAQLSDLQKQKIFSTWPGPVTWVMPVKKDISPLLTGKFTSIAVRVSDHPLVQKLCHQFGKPITSTSANLTGLPPCKTVTEVQNQLGEHLSAI--LEGETGGRENPTEIRDAFSDTVLRQG 192
>gi|58584895|ref|YP_198468.1| putative translation factor, SUA5 [Wolbachia endosymbiont strain TRS of Brugia malayi] >gi|58419211|gb|AAW71226.1| Putative translation factor, SUA5 [Wolbachia endosymbiont strain TRS of Brugia malayi] (208 aa)
Score = 115, Expect = 2.3e-04, Identities = 44/138 (31%), Positives = 78/138 (56%)
  Q:    73 IYKIKKRDKNKKLIRFVSN---LDQIPEVNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLK--REGEIKYEWIKKTI 210
           IY++KKR ++K L  FVS+   L +I  + E +  L + F PG +T I   ++               R+PD    ++++++   P+ ++S N+SG   +    D  +S  ++ S +  IEGD   +   STI D+  N +K  REG I  + +   +
  S:    38 IYQVKKRSQDKPLSIFVSDVCSLVKIARLEEKYIDLINHFSPGPITYILPLKNNNMLPNRFFKGSIGIRIPDHPIAISILNRLKIPIVATSINVSGEKSVCKASDIPQSIKQHLSAV--IEGDELVSGIESTITDLTGNRIKFLREGIISLQVVNNML 193
>gi|157804239|ref|YP_001492788.1| bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase [Rickettsia canadensis str. McKiel] >gi|157785502|gb|ABV74003.1| bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase [Rickettsia canadensis str. McKiel] (312 aa)
Score = 115, Expect = 2.4e-04, Identities = 62/168 (36%), Positives = 92/168 (54%)
  Q:    42 LNGIVFEIKNLKAAIVSTDTVSGL---LSLNKPL--IYKIKKRDKNKKLIRFVSNLDQ---IPEVNETFKKLASKFWPGKLTLI--YKKE--------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQ--PSTIYDIDTN--TLKREGEIKYEWIKKT 209
           +N  V  IK+ K  +  T+TV G+    + N+    I++ K R     LI  V++++Q   I E N+   K+A KFW G L+++   KK               + RMP     L LI ++G P+ + SAN S     TN     + F K   +I  +  + YQ+     STI D  T   TL REG I  E ++KT
  S:     2 INKAVQFIKSGKVVVFPTETVYGIGADATNNEACLKIFQFKNRPAINPLIVHVASIEQAKEIGEFNDLATKIAEKFWSGPLSIVVPLKKNVNIALSVTAGLNTIAIRMPSYPLALELIRQSGKPIAAPSANPSNYISPTNAEHVTKHF-KDNEEIFILAPEIYQSEYGLESTIIDTTTATPTLLREGFIMSEVLEKT 197
>gi|56551895|ref|YP_162734.1| putative translation factor [Zymomonas mobilis subsp. mobilis ZM4] >gi|56543469|gb|AAV89623.1| putative translation factor [Zymomonas mobilis subsp. mobilis ZM4] (329 aa)
Score = 115, Expect = 2.4e-04, Identities = 46/137 (33%), Positives = 72/137 (52%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQ---IPEVNETFKKLASKFWPGKLTLI--YKKE--------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLK--REGEIKYEWIKKT 209
           IY+ K R     LI  +++++Q   I E N+    LA KFWPG LT++   KK+              + RMP    +  +I   G PL + SAN SG+   T  +   ES N   + +  ++G        STI  +  + +K  R G I  E + ++
  S:    56 IYQAKGRPSFNPLIVHIAHIEQAAEIVEFNDEALSLAQKFWPGALTMVLPLKKDAKIASIVTAGLDTVAIRMPSHPVMRQVIKAFGHPLAAPSANKSGSISPTTALHVKESLNGKIAAV--LDGGIADKGLESTIIYVGADEIKLLRPGPITSEELAQS 212
>gi|169188289|ref|ZP_02848435.1| Sua5/YciO/YrdC/YwlC family protein [Paenibacillus sp. JDR-2] >gi|169004938|gb|EDS51793.1| Sua5/YciO/YrdC/YwlC family protein [Paenibacillus sp. JDR-2] (356 aa)
Score = 115, Expect = 2.4e-04, Identities = 45/140 (32%), Positives = 73/140 (52%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQIPEVNETFKKLASKF----WPGKLTLIYKKES---------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDI-DTNTLK--REGEIKYEWIKKTIEE 212
           I+K K R  +  LI  +++ +Q+ E+   + +LA +     WPG LT++    +                RMPD    L LI ++G P+ + SAN SG P  T      E      S I  ++G        ST+ ++ D+NT++  R G I  E ++    E
  S:    58 IFKAKGRPSDNPLIVHIADENQLAELVLPYPELAGRLMKELWPGPLTIVLPVRTGAVSPLVTAGLTTVGIRMPDHPAALALIRQSGCPVAAPSANRSGRPSPTLAAHVLEDLAGKISGI--VDGGATGVGLESTVIELPDSNTIRILRPGGITAEQLRSAAPE 218
>gi|161507268|ref|YP_001577222.1| Sua5 family translation factor [Lactobacillus helveticus DPC 4571] >gi|160348257|gb|ABX26931.1| putative translation factor, SUA5 family [Lactobacillus helveticus DPC 4571] (333 aa)
Score = 115, Expect = 2.5e-04, Identities = 59/198 (29%), Positives = 88/198 (44%)
  Q:    15 FKKNLNNKEIKNYPKKEFVTYEKDSSNLNGIVFEIKNLKAAIVSTDTVSGLLSLNKPLIYKIKKRDKNKKLIRFVSNLDQI----PEVNETFKKLASKFWPGKLTLI---------------YKKESYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNT--LKREGEIKYEWIKKTIEE 212
           FKK+  ++ +K   + E V +  ++         +  L A      +V G        +Y  K R  +  LI  VS+   +     EV E  KKL   FWPG LTL+                   ++R PDD+   +LI K G P+   SAN S  P  T     +       + I  I+G   +    STI D+   T  + R GEI  E + + + E
  S:     6 FKKDQIDEAVKLLAEGELVAFPTET---------VYGLGAIATKEKSVKG--------VYAAKGRPSDNPLIVTVSDEKMMERYAKEVPERAKKLIKHFWPGPLTLLLFVKPGTLPDAVTGGLDTVAFRCPDDQLTHDLIAKLGYPIVGPSANTSTKPSPTTAEHVYHDLKDKIAGI--IDGGPTRVGLESTIIDLSVKTPIVLRPGEITPEELSEVLGE 206
>gi|15668233|ref|NP_247026.1| hypothetical protein MJ0062 [Methanocaldococcus jannaschii DSM 2661] >gi|2500922|sp|Q60369|Y062_METJA Uncharacterized protein MJ0062 >gi|1498824|gb|AAB98044.1| hypothetical protein MJ_0062 [Methanocaldococcus jannaschii DSM 2661] (207 aa)
Score = 115, Expect = 2.5e-04, Identities = 54/139 (38%), Positives = 78/139 (56%)
  Q:    19 LNNKEIKNYPKKEFVTYEKDSSNLNGIVFEIKNLKAAIVSTDTVSGLLS--LNKPLI---YKIKKRDKNKKL---IRFVSNLDQIPEVNETFKKLASKFWPGKLTLIYKKE------------SYRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNI 157
           L NK IK Y   E    E+    L  +  EI N K  I  TDT+ G+ +  LN+  +   Y IK+R+ NK L   +R  + +++   VN+  KK+  KF PG LT+I KK+              R+PD+  I  L     PL ++SAN+SG    T +
  S:     3 LKNKIIKIYELNE----EERKKVLEFLKKEILNGKIVICGTDTLYGISANALNEKAVRKVYNIKRREFNKPLSICVRDKNEIEKYAYVNDLAKKIIDKFLPGPLTIILKKKPGIPDIVAKDYIGIRIPDEPIIREL--SIVPLTTTSANISGKESPTTV 155
>gi|42784497|ref|NP_981744.1| sua5/yciO/yrdC/ywlC family protein [Bacillus cereus ATCC 10987] >gi|42740429|gb|AAS44352.1| sua5/yciO/yrdC/ywlC family protein [Bacillus cereus ATCC 10987] (346 aa)
Score = 115, Expect = 2.6e-04, Identities = 56/158 (35%), Positives = 81/158 (51%)
  Q:    53 KAAIVSTDTVSGL--LSLNKPLIYKI---KKRDKNKKLIRFV---SNLDQI-PEVNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTN--TLKREGEIKYEWIKKTI 210
           +A    T+TV GL   ++N   I KI   K R  +  LI  +   S LD I  E+    +KL   FWPG LT+I  ++                RMPD    L LI++   P+ + SAN SG P  T     +E  N+  + I  ++G        ST+ D  +   T+ R G I  E ++  I
  S:    32 EAIAFPTETVYGLGANAMNDEAIAKIFEAKGRPSDNPLIVHIGTKSQLDGIVKEIPPVAEKLMEHFWPGPLTIILPRKEGISEKVTAGLNTVGVRMPDHPVALALIEEANVPVAAPSANRSGRPSPTLASHVYEDLNEKIAGI--VDGGATGVGVESTVIDCTSAVPTILRPGGITKEQLESVI 213
>gi|196249769|ref|ZP_03148465.1| Sua5/YciO/YrdC/YwlC family protein [Geobacillus sp. G11MC16] >gi|196210645|gb|EDY05408.1| Sua5/YciO/YrdC/YwlC family protein [Geobacillus sp. G11MC16] (345 aa)
Score = 114, Expect = 2.8e-04, Identities = 44/138 (31%), Positives = 66/138 (47%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQIPEVNETF----KKLASKFWPGKLTLIYKKE---------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDI--DTNTLKREGEIKYEWIKKTI 210
           I+  K R  +  LI  V++  Q+  +  +     K L  +FWPG LTL+  K                + RMPD    L LI+ +G  L + SAN SG P  T         N   + +  I+G        ST+ D   +  T+ R G +  E + + I
  S:    57 IFAAKGRPSDNPLIVHVASRAQVESIAASIPPVAKTLMERFWPGPLTLVLPKRDGAVSERVTAGLSTVAVRMPDHPLALALIEASGLALAAPSANRSGRPSPTTAAHVLADLNGRIAGV--IDGGPTGVGVESTVLDCSGEVPTILRPGGVTKEALSEVI 214
>gi|156062334|ref|XP_001597089.1| hypothetical protein SS1G_01283 [Sclerotinia sclerotiorum 1980] >gi|154696619|gb|EDN96357.1| hypothetical protein SS1G_01283 [Sclerotinia sclerotiorum 1980] (459 aa)
Score = 114, Expect = 2.8e-04, Identities = 52/159 (32%), Positives = 71/159 (44%)
  Q:    49 IKNLKAAIVSTDTVSGLLSLNKPLIYKIKKRDKNKKLIRFVSNLDQI----------------PEVNETFKKLASKFWPGKLTLIYKKES----------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYD--IDTNTLKREGEIKYEWIK 207
           +  L A    +D V G        IYK K R  +  LI  V +L  +                PE+ E +K L   FWPG LT++    S                 RMP     L+LI   G PL + SAN S  P  T     +   N      I ++G   Q    ST+ D   D   + R G +  + I+
  S:    68 VYGLGADATRSDAVKG--------IYKTKGRPSDNPLIIHVCDLTMLRSLLSSTENQSSGADFPEIPEIYKPLIKCFWPGPLTILLPNPSPSKLAPEVTAGLQTFGARMPSSPLALSLIRLAGVPLAAPSANASTKPSCTTAEHVYHDLNGRIE--IILDGGACQVGVESTVVDGMCDPPVVLRPGGVSIDEIR 251
>gi|50552650|ref|XP_503735.1| hypothetical protein [Yarrowia lipolytica] >gi|49649604|emb|CAG79325.1| unnamed protein product [Yarrowia lipolytica CLIB122] (373 aa)
Score = 114, Expect = 2.9e-04, Identities = 52/160 (32%), Positives = 79/160 (49%)
  Q:    49 IKNLKAAIVSTDTVSGLLSLNKPLIYKIKKRDKNKKLIRFVSNLDQIP-------EVNETFKKLASKFWPGKLTLIYKKES----------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDI-IFIEGDYYQNNQPSTIYD--IDTNTLKREGEIKYEWIKK 208
           +  L A+ +ST++V          IY  K R  +  LI  VS+LDQ+        E+ + +  L  KFWPG LT++   +S                 RMPD     +LI  +  PL + SAN S  P  T    A   ++  +  I + ++G        ST+ D   D   L R G +  E I++
  S:    56 VYGLGASALSTESVKS--------IYAAKNRPADNPLIVHVSSLDQLKRKILKGREIPDVYTPLIEKFWPGPLTILLPLDSDSDVSPACTVGQPTVAVRMPDHPVARSLIALSDLPLAAPSANASTRPSPTT---ADHVYHDLQGRIPLILDGGACHVGVESTVVDGLSDPPMLLRPGGVSLEQIRE 231
>gi|194016307|ref|ZP_03054921.1| YwlC [Bacillus pumilus ATCC 7061] >gi|194011780|gb|EDW21348.1| YwlC [Bacillus pumilus ATCC 7061] (350 aa)
Score = 114, Expect = 3.0e-04, Identities = 39/97 (40%), Positives = 54/97 (55%)
  Q:    59 TDTVSGLLSLNKPL-----IYKIKKRDKNKKLIRFVSNLDQIPEV----NETFKKLASKFWPGKLTLIYKKE---------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPIT 155
           T+TV GL +  K       IY+ K R  +  LI  ++ ++Q+ E     +E  K L   FWPG LT++   +                 RMPD    L LI   G P+ + SAN SG P  T
  S:    39 TETVYGLGANAKETEAVMKIYEAKGRPSDNPLIVHIAEIEQLHEFAQIESEKAKALMDAFWPGALTIVLPCKPGTLSKQVTAGLSTVGVRMPDHPIALELIRTAGLPIAAPSANRSGKPSPT 160
>gi|30023356|ref|NP_834987.1| SUA5 protein [Bacillus cereus ATCC 14579] >gi|29898917|gb|AAP12188.1| SUA5 protein [Bacillus cereus ATCC 14579] (346 aa)
Score = 114, Expect = 3.0e-04, Identities = 55/158 (34%), Positives = 81/158 (51%)
  Q:    53 KAAIVSTDTVSGL--LSLNKPLIYKI---KKRDKNKKLIRFV---SNLDQI-PEVNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTN--TLKREGEIKYEWIKKTI 210
           +A    T+TV GL   +++   I KI   K R  +  LI  +   S LD I  E+    +KL + FWPG LT+I  ++                RMPD    L LI++   P+ + SAN SG P  T     +E  N   + I  ++G        ST+ D  +   T+ R G I  E ++  I
  S:    32 EAVAFPTETVYGLGANAMDDEAIAKIFEAKGRPSDNPLIVHIGTKSQLDGIVKEIPPVAEKLMAHFWPGPLTIILPRKEGISEKVTAGLNTVGVRMPDHPIALALIEEANVPVAAPSANRSGRPSPTLASHVYEDLNGKIAGI--VDGGATGVGVESTVIDCTSTVPTILRPGGITKEQLEAVI 213
>gi|171696344|ref|XP_001913096.1| unnamed protein product [Podospora anserina] >gi|170948414|emb|CAP60578.1| unnamed protein product [Podospora anserina] (413 aa)
Score = 114, Expect = 3.1e-04, Identities = 39/105 (37%), Positives = 53/105 (50%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQIPEVN---ETFKKLASKFWPGKLTLIYKKESY-----------------RMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGD 177
           IY  K R  +  LI  VS+L  +  ++   E + +L SKFWPG LT++    +                  RMPD      LI   G PL + SAN S  P  T  +   E     K ++I   GD
  S:    92 IYTAKGRPSDNPLIVHVSDLSMLSTLSTIPEIYHELISKFWPGPLTILLPVPTSGQLLAPEVTAGLTTFGARMPDSPLARALIQLVGKPLAAPSANASTRPSPTKAVHVLEDLEG-KIELILDGGD 216
>gi|168138692|ref|ZP_02581921.1| SUA5 protein [Bacillus cereus B4264] (346 aa)
Score = 114, Expect = 3.1e-04, Identities = 55/158 (34%), Positives = 81/158 (51%)
  Q:    53 KAAIVSTDTVSGL--LSLNKPLIYKI---KKRDKNKKLIRFV---SNLDQI-PEVNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTN--TLKREGEIKYEWIKKTI 210
           +A    T+TV GL   +++   I KI   K R  +  LI  +   S LD I  E+    +KL + FWPG LT+I  ++                RMPD    L LI++   P+ + SAN SG P  T     +E  N   + I  ++G        ST+ D  +   T+ R G I  E ++  I
  S:    32 EAVAFPTETVYGLGANAMDDEAIAKIFEAKGRPSDNPLIVHIGTKSQLDGIVTEIPPVAEKLMAHFWPGPLTIILPRKEGISEKVTAGLNTVGVRMPDHPIALALIEEANVPVAAPSANRSGRPSPTLASHVYEDLNGKIAGI--VDGGATGVGVESTVIDCTSTVPTILRPGGITKEQLEAVI 213
>gi|157694091|ref|YP_001488553.1| hypothetical protein BPUM_3340 [Bacillus pumilus SAFR-032] >gi|157682849|gb|ABV63993.1| hypothetical protein BPUM_3340 [Bacillus pumilus SAFR-032] (351 aa)
Score = 114, Expect = 3.1e-04, Identities = 46/127 (36%), Positives = 65/127 (51%)
  Q:    29 KKEFVTYEKDSS----NLNGIVFEIKNLKAAIVSTDTVSGLLSLNKPL-----IYKIKKRDKNKKLIRFVSNLDQIPEV----NETFKKLASKFWPGKLTLIYKKE---------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPIT 155
           K+  V  EKD S     +      +K  +     T+TV GL +  K       IY+ K R  +  LI  ++ ++Q+ E     +E  K L   FWPG LT++   +                 RMPD    L LI   G P+ + SAN SG P  T
  S:     6 KRWSVDLEKDLSTYYPQIEQAALLLKQNEVVAFPTETVYGLGANAKETEAVMKIYEAKGRPSDNPLIVHIAEVEQLHEFAQIESERAKALMKAFWPGALTIVLPCKLGTLSKQVTAGLSTVGVRMPDHPIALELIRTAGLPIAAPSANRSGKPSPT 161
>gi|168144629|ref|ZP_02587858.1| SUA5 protein [Bacillus cereus G9842] (346 aa)
Score = 114, Expect = 3.3e-04, Identities = 55/158 (34%), Positives = 81/158 (51%)
  Q:    53 KAAIVSTDTVSGL--LSLNKPLIYKI---KKRDKNKKLIRFV---SNLDQI-PEVNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTN--TLKREGEIKYEWIKKTI 210
           +A    T+TV GL   +++   I KI   K R  +  LI  +   S LD I  E+    +KL + FWPG LT+I  ++                RMPD    L LI++   P+ + SAN SG P  T     +E  N   + I  ++G        ST+ D  +   T+ R G I  E ++  I
  S:    32 EAVAFPTETVYGLGANAMDDEAIAKIFEAKGRPSDNPLIVHIGTKSQLDGIVKEIPPVAEKLMAHFWPGPLTIILPRKEGISERVTAGLNTVGVRMPDHPVALALIEEANVPVAAPSANRSGRPSPTLASHVYEDLNGKIAGI--VDGGATGVGVESTVIDCTSTVPTILRPGGITKEQLEAVI 213
>gi|159905153|ref|YP_001548815.1| Sua5/YciO/YrdC/YwlC family protein [Methanococcus maripaludis C6] >gi|159886646|gb|ABX01583.1| Sua5/YciO/YrdC/YwlC family protein [Methanococcus maripaludis C6] (206 aa)
Score = 114, Expect = 3.3e-04, Identities = 64/179 (35%), Positives = 98/179 (54%)
  Q:    34 TYEKDSSNLNGIVFEIKNLKAAIVS-------TDTVSGLLS--LNKPLI---YKIKKRDKNKKLIRFVSNLDQIPE---VNETFKKLASKFWPGKLTLIYKKES------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNT-LKREGEIKYEWIKKTIEE 212
           T+E   SNL     EI+  K  I++       TDT+ GL +  L+K  I   Y IK+RD NK +   +    QI     V+   KK+  KF PG +T+I KK+              R+PD+  I  +     PL ++SAN+SG    ++ ++  ++  K K D+I   G      Q + +  I     L REG+I +E I K ++E
  S:     3 TFEISESNLKNCEKEIETAKKMILNGKVILCGTDTLYGLSTNALDKNAIEKIYSIKERDPNKPISISLGEKKQIENYVYVDSIAKKIIEKFMPGPITVILKKKDIIPDILGKDDVGVRIPDNDVIRKI--AIVPLTTTSANISGKTAPSS-LEEVDTVIKEKVDLIINTGPSKYKVQSTIVKVIGGKIELIREGKIPFEEILKAVKE 206
>gi|75762684|ref|ZP_00742523.1| Sua5/YciO/YrdC/YwlC family protein [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|74489830|gb|EAO53207.1| Sua5/YciO/YrdC/YwlC family protein [Bacillus thuringiensis serovar israelensis ATCC 35646] (346 aa)
Score = 114, Expect = 3.3e-04, Identities = 60/186 (32%), Positives = 93/186 (50%)
  Q:    25 KNYPKKEFVTYEKDSSNLNGIVFEIKNLKAAIVSTDTVSGL--LSLNKPLIYKI---KKRDKNKKLIRFV---SNLDQI-PEVNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTN--TLKREGEIKYEWIKKTI 210
           KNYP+ +      +++ L      ++  +A    T+TV GL   +++   I KI   K R  +  LI  +   S LD I  E+    +KL + FWPG LT+I  ++                RMPD    L LI++   P+ + SAN SG P  T     +E  N   + I  ++G        ST+ D  +   T+ R G I  E ++  I
  S:    16 KNYPQLQ------EAAKL------LRENEAVAFPTETVYGLGANAMDDEAIAKIFEAKGRPSDNPLIVHIGTKSQLDGIVKEIPPVAEKLMAHFWPGPLTIILPRKEGISERVTAGLNTVGVRMPDHPVALALIEEANVPVAAPSANRSGRPSPTLASHVYEDLNGKIAGI--VDGGATGVGVESTVIDCTSTVPTILRPGGITKEQLEAVI 213
>gi|167940287|ref|ZP_02527362.1| SUA5 protein [Bacillus cereus AH1134] (346 aa)
Score = 114, Expect = 3.4e-04, Identities = 55/158 (34%), Positives = 81/158 (51%)
  Q:    53 KAAIVSTDTVSGL--LSLNKPLIYKI---KKRDKNKKLIRFV---SNLDQI-PEVNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTN--TLKREGEIKYEWIKKTI 210
           +A    T+TV GL   +++   I KI   K R  +  LI  +   S LD I  E+    +KL + FWPG LT+I  ++                RMPD    L LI++   P+ + SAN SG P  T     +E  N   + I  ++G        ST+ D  +   T+ R G I  E ++  I
  S:    32 EAVAFPTETVYGLGANAMDDEAIAKIFEAKGRPSDNPLIVHIGTKSQLDGIVKEIPPVAEKLMAHFWPGPLTIILPRKEGISEKVTAGLNTVGVRMPDHPIALALIEEANVPVAAPSANRSGRPSPTLASHVYEDLNGKIAGI--VDGGATGVGVESTVIDCTSAVPTILRPGGITKEQLEAVI 213
>gi|153812520|ref|ZP_01965188.1| hypothetical protein RUMOBE_02919 [Ruminococcus obeum ATCC 29174] >gi|149831445|gb|EDM86533.1| hypothetical protein RUMOBE_02919 [Ruminococcus obeum ATCC 29174] (354 aa)
Score = 114, Expect = 3.5e-04, Identities = 48/138 (34%), Positives = 67/138 (48%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQI----PEVNETFKKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTGPLYSS-SANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTN--TLKREGEIKYEWIKKTI 210
           IY  K R  +  LI  ++ L+Q+     E+ E  K LA K+WPG LT+I  K               + R P D+    LI   G   ++ SAN SG P  T      E       D+I I+G        STI D       + R G I  E +++T+
  S:    54 IYAAKGRPSDNPLIVHIAELEQLEKITTEIPEGAKILAEKYWPGPLTMILPKADIVPRETTGGLDSVAVRFPSDRIAQELIKAGGGFVAAPSANTSGRPSPTMAEHVEEDLGD-AIDMI-IDGGQVGIGLESTIVDFTEKVPVVLRPGYISLEMLQETL 210
>gi|78212027|ref|YP_380806.1| hypothetical protein Syncc9605_0477 [Synechococcus sp. CC9605] >gi|78196486|gb|ABB34251.1| conserved hypothetical protein [Synechococcus sp. CC9605] (199 aa)
Score = 113, Expect = 3.6e-04, Identities = 36/108 (33%), Positives = 63/108 (58%)
  Q:    45 IVFEIKNLKAAIVSTDTVSGLLSL--NKPLIYKIKKRDKNKKLIRFVSNL-DQIPEV----NETFKKLASKFWPGKLTLIYKKES---------------YRMPDDKFILNLIDKTGPLYSSSANLSGNP 152
           +   ++  +AAI+ TDT+ GL         ++++K+R  +K LI   +++ D + EV    +   + LA ++WPG LTL+                     R+P  +    L+  +GPL ++SAN SG P
  S:    11 LALRLRAGEAAIIPTDTLPGLAVCPDQAQTLWRLKRRPADKPLILMGASVNDLLHEVAVPCHREVEALAERYWPGALTLVLPARDGGAGRYLNPGGTTLGCRIPACEQTRALLQISGPLATTSANRSGEP 140
>gi|168266771|ref|ZP_02688736.1| hypothetical protein LmonFSL_15930 [Listeria monocytogenes FSL J2-071] (345 aa)
Score = 113, Expect = 3.7e-04, Identities = 56/162 (34%), Positives = 84/162 (51%)
  Q:    49 IKNLKAAIVSTDTVSGL--LSLNKPLIYKI---KKRDKNKKLIRFVSNLDQIPEVNETFK----KLASKFWPGKLTLI--YKKESY-------------RMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYD--IDTNTLKREGEIKYEWIKKTI 210
           ++N +     T+TV GL   + N+  I KI   K R  +  LI  ++ LDQ+     ++     +L  KFWPG LT+I   KK+S              RMP+    L LI+    P+ + SAN SG P  T      E  +   + I  I+G        ST+ D  ++   + R G I  E I++ I
  S:    25 LQNGECVAFPTETVYGLGADATNQAAIQKIYAAKGRPSDNPLIVHIARLDQMNSFVASYPPKAIQLMEKFWPGPLTVILPLKKDSLAANVSAGLSTVGVRMPEHPVSLALINAANVPVAAPSANRSGKPSPTTADHVIEDLDGKIAGI--IDGGATGVGLESTVIDCSLEMPIILRPGGITKEQIEQVI 211
>gi|194442465|ref|YP_002042654.1| Sua5/YciO/YrdC/YwlC family protein [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194401128|gb|ACF61350.1| Sua5/YciO/YrdC/YwlC family protein [Salmonella enterica subsp. enterica serovar Newport str. SL254] (190 aa)
Score = 113, Expect = 3.7e-04, Identities = 39/124 (31%), Positives = 65/124 (52%)
  Q:    76 IKKRDKNKKLIRFVSNLDQI-PEVNETFKKLASK-----FWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKREG 199
           +K+R  +K LI   ++ +Q+ P +++T   +A +      WPG +T ++   +               R+ +   ++ L +  G PL S+SANLSG PP   + +    F     D   +EG       PS I D  T  L R+G
  S:    49 LKQRPVDKGLILIAASFEQLKPYIDDTILTVAQRKAVFDCWPGPVTFVFPAPATTPRWLTGRFDSLAVRVTNHPLVVALCNAYGKPLVSTSANLSGLPPCRTVEEVRAQFG---DDFPVVEGATGGRLNPSEIRDALTGELFRQG 190
>gi|37522843|ref|NP_926220.1| hypothetical protein glr3274 [Gloeobacter violaceus PCC 7421] >gi|35213845|dbj|BAC91215.1| glr3274 [Gloeobacter violaceus PCC 7421] (197 aa)
Score = 113, Expect = 3.7e-04, Identities = 46/144 (31%), Positives = 76/144 (52%)
  Q:    59 TDTVSGLLSLNK--PLIYKIKKRDKNKKLIRFVSNLDQ----IPEVNETFKKLASKFWPGKLTLIYK--------------KESYRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTI--YDIDTNTLKREGEIK 202
           TDTV GL+ L +    IY +K RD++K LI   +          +    + +LA + WPG LTL+                    R+P+      L+ KTGPL S+SAN SG P    ++   ++  +  + +  + G Y  +   ST+  ++ D   + R+G+ K
  S:    35 TDTVPGLVCLPEYAEQIYALKGRDEHKPLILLGAAAADLAFYTAQWRSEWTELAERGWPGALTLVLPVGGRVPAAVHRGGGTVGVRIPNHPDAHALLAKTGPLASTSANRSGQP----VLIEPQAIRRTFAGVALLAGTYRGSGTASTVVRWEDDGWQVLRQGDFK 196
>gi|172058702|ref|YP_001815162.1| Sua5/YciO/YrdC/YwlC family protein [Exiguobacterium sibiricum 255-15] >gi|171991223|gb|ACB62145.1| Sua5/YciO/YrdC/YwlC family protein [Exiguobacterium sibiricum 255-15] (332 aa)
Score = 113, Expect = 3.8e-04, Identities = 44/138 (31%), Positives = 67/138 (48%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQ----IPEVNETFKKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTN--TLKREGEIKYEWIKKTI 210
           I+  K R  +  LI  V++++Q    +  + +   +L   FWPG LT+I +                  RMPD    L LI+ TG  L + SAN SG P  T+        +   + I  ++G        ST+ D  TN   + R G +  E I+  I
  S:    47 IFAAKGRPSDNPLIVHVASVEQAKQFVTHIPDVAAQLMDTFWPGALTIILESNGRASSLVTAGLDTIGLRMPDHPLALQLIEATGLGLAAPSANRSGKPSPTSSAHVAHDLSGRIAAI--VDGGETGIGVESTVIDCTTNPPVILRPGGVTREQIESVI 203
>gi|169826582|ref|YP_001696740.1| hypothetical protein Bsph_0998 [Lysinibacillus sphaericus C3-41] >gi|168991070|gb|ACA38610.1| Hypothetical ywlC protein [Lysinibacillus sphaericus C3-41] (344 aa)
Score = 113, Expect = 4.1e-04, Identities = 51/152 (33%), Positives = 75/152 (49%)
  Q:    59 TDTVSGL--LSLNKPLIYKI---KKRDKNKKLIRFVSNLDQ----IPEVNETFKKLASKFWPGKLTLIYKKE---------------SYRMPDDKFILNLIDK-TGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDI--DTNTLKREGEIKYEWIKKTI 210
           T+TV GL  ++ N   + KI   K R  +  LI  V   ++    I  ++E  K+    FWPG LTL+   +                 RMPD    L L+ +   PL + SAN SG P  T  I   +    Y   I  ++G        ST+ D+  +   + R G I  E ++ TI
  S:    35 TETVYGLGAVATNDTAVKKIFEAKGRPSDNPLIVHVGTKEEVTNYIEHISEIAKQCIDLFWPGPLTLVMPAKPNVLAQSVTAGLSTVGIRMPDHPVALALLQQLQKPLAAPSANRSGKPSPTEAIHVLDDLGGYIPYI--LDGGSTGIGLESTVLDVTHEPPVILRPGGITKEILEATI 211
>gi|72162816|ref|YP_290473.1| translation factor SUA5 [Thermobifida fusca YX] >gi|71916548|gb|AAZ56450.1| translation factor SUA5 [Thermobifida fusca YX] (259 aa)
Score = 113, Expect = 4.2e-04, Identities = 34/113 (30%), Positives = 57/113 (50%)
  Q:    95 IPEVNETFKKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLK--REGEIKYEWIK 207
           I ++ +  + L  +FWPG LTL+                  + RMP     L L+ + GP+  S AN++G P  T + +A   F    S  ++++     +  PSTI D+     +  R G I  E ++
  S:    79 IDDLGKYGQDLIEEFWPGPLTLVCAATPSLSWDLGDTKGTVAVRMPMHPVALELLKEVGPMAVSGANVTGKPAATTVEEAETQFGDAVS--VYLDAGPCTSTPPSTIVDLTYAVPRVLRSGAITLEQLR 205
>gi|194468252|ref|ZP_03074238.1| Sua5/YciO/YrdC/YwlC family protein [Lactobacillus reuteri 100-23] >gi|194453105|gb|EDX42003.1| Sua5/YciO/YrdC/YwlC family protein [Lactobacillus reuteri 100-23] (342 aa)
Score = 113, Expect = 4.3e-04, Identities = 44/138 (31%), Positives = 74/138 (53%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQI----PEVNETFKKLASKFWPGKLTLIYKKE---------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQP------STIYDIDTN--TLKREGEIKYEWIKKTI 210
           +Y  K R  +  LI  V+++  +     E+ +  +KL   FWPG LT+I K +               ++R PD +  L+LI++ G P+   SAN SG P  T     +   +   + I+        +N P      ST+ D+ T+   + R G +  + I+K I
  S:    47 VYLAKGRPSDNPLIVHVNSIAMVEKYAAEIPDNARKLMDAFWPGSLTIILKIKKGALSKTVTGGLKTVAFRYPDCQPTLDLIEEAGVPMVGPSANTSGKPSPTTAQHVYHDLHGKIAGIV--------DNGPTRVGVESTVLDMSTDHPVILRPGAVTKKDIEKVI 204
>gi|15618190|ref|NP_224475.1| SuA5 superfamily-related protein [Chlamydophila pneumoniae CWL029] >gi|15835805|ref|NP_300329.1| SuA5 superfamily-related protein [Chlamydophila pneumoniae J138] >gi|16752768|ref|NP_445036.1| Sua5/YciO/YrdC family protein [Chlamydophila pneumoniae AR39] >gi|4376543|gb|AAD18419.1| SuA5 Superfamily-related Protein [Chlamydophila pneumoniae CWL029] >gi|7189407|gb|AAF38319.1| Sua5/YciO/YrdC family protein [Chlamydophila pneumoniae AR39] >gi|8978644|dbj|BAA98480.1| SuA5 superfamily-related protein [Chlamydophila pneumoniae J138] (286 aa)
Score = 113, Expect = 4.5e-04, Identities = 47/149 (31%), Positives = 75/149 (50%)
  Q:    53 KAAIVSTDTVSGLL-----SLNKPLIYKIKKRDKNKKLIRFVSNLDQIPEVN-----ETFKKLASKFWPGKLTLIYKKESYRMP---------DDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKREGEI 201
           K   + TDTV G +     S  +  +Y +K R+ +K    +V++++ I  ++      T KKLA  F PG +TL+ K  + R P         D   +  ++D  G L  +SANLS  P      + F  F  +  D+   +G      + ST+   D   + REG I
  S:    23 KIVALPTDTVYGFVLSLYASEAEERLYALKDREPSKAFALYVNSIEDIENISGYPLSPTAKKLAQLF-PGAITLVVKHRNPRFPKETLAFRIVDHSVVREIVDHCGTLIGTSANLSEFPSALTAQEIFADFADH--DLCIFDGPCSHGLE-STVVASDPLYIYREGLI 186
>gi|89095606|ref|ZP_01168500.1| sua5/yciO/yrdC/ywlC family protein [Bacillus sp. NRRL B-14911] >gi|89089352|gb|EAR68459.1| sua5/yciO/yrdC/ywlC family protein [Bacillus sp. NRRL B-14911] (346 aa)
Score = 113, Expect = 4.5e-04, Identities = 42/140 (30%), Positives = 72/140 (51%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQIPEVNETF----KKLASKFWPGKLTLIYKKES---------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDI--DTNTLKREGEIKYEWIKKTIEE 212
           I++ K R  +  LI  +++ +Q+  + E+      KL   FWPG LT+I+ K+                 RMPD    L ++ ++G P+ + SAN SG P  T      E  N   + I  ++G        ST+ D   +   + R G +  E +++ + E
  S:    57 IFEAKGRPSDNPLIIHIADREQLEGIVESVPASADKLMEAFWPGPLTIIFNKKDGQLSETATAGLNTVGIRMPDHPVALAILRESGVPVAAPSANRSGRPSPTTAGHVKEDLNGRIAGI--VDGGPTGVGVESTVLDCTGEIPVILRPGGVTKEQLERVVGE 216
>gi|47570467|ref|ZP_00241100.1| Sua5/YciO/YrdC/YwlC family protein [Bacillus cereus G9241] >gi|47552863|gb|EAL11281.1| Sua5/YciO/YrdC/YwlC family protein [Bacillus cereus G9241] (299 aa)
Score = 113, Expect = 4.7e-04, Identities = 47/138 (34%), Positives = 70/138 (50%)
  Q:    73 IYKIKKRDKNKKLIRFV---SNLDQI-PEVNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTN--TLKREGEIKYEWIKKTI 210
           I++ K R  +  LI  +   S LD I  E+    +KL   FWPG LT+I  ++                RMPD    L LI++   P+ + SAN SG P  T     +E  N+  + I  ++G        ST+ D  +   T+ R G I  E ++  I
  S:     9 IFEAKGRPSDNPLIVHIGTKSQLDGIVKEIPPVAEKLMEHFWPGPLTIILPRKEGISERVTAGLNTVGVRMPDHPVALALIEEANVPVAAPSANRSGRPSPTLASHVYEDLNEKIAGI--VDGGATGVGVESTVIDCTSAVPTILRPGGITKEQLEAVI 165
>gi|148978490|ref|ZP_01814964.1| Sua5/YciO/YrdC family protein [Vibrionales bacterium SWAT-3] >gi|145962397|gb|EDK27677.1| Sua5/YciO/YrdC family protein [Vibrionales bacterium SWAT-3] (185 aa)
Score = 112, Expect = 5.2e-04, Identities = 38/127 (29%), Positives = 72/127 (56%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQI-PEVNE---TFKKLAS--KFWPGKLTLI--------------YKKESYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKREG 199
           + ++K+R   K LI   ++ +Q+ P ++E   T ++LA+    WPG +T I              +   + R+ D   +  + ++ G PL S+SANL+G PP     +  +   ++   +  +EG     ++PS I D  T+ + R+G
  S:    40 LLELKQRPVEKGLILIAASYEQLLPYIDESQLTDEQLATVKATWPGPVTWIMPTSAKVTDWVSGQFDSLAVRVTDHPLVQRMCNEFGKPLTSTSANLTGEPPCMTTEEVQQQLGQHL--VAILEGKTGGRDKPSEIRDAKTSKILRQG 185
>gi|191164420|ref|ZP_03026286.1| Sua5/YciO/YrdC/YwlC family protein [Geobacter sp. M21] >gi|190994553|gb|EDV70015.1| Sua5/YciO/YrdC/YwlC family protein [Geobacter sp. M21] (202 aa)
Score = 112, Expect = 5.6e-04, Identities = 32/84 (38%), Positives = 50/84 (59%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQIPEV----NETFKKLASKFWPGKLTLIYKKESY--------------RMPDDKFILNLIDKTG-PLYSSSANLSGNPPITN 156
           IY++K+RD+ K      S++ +I       N  FK+L  +  PG  T + +  S               RMPD+   L ++ + G P+ ++SANLSG  PI N
  S:    51 IYQVKQRDRKKPFSFICSDISEISRYARVSNYAFKQL-RRLLPGPYTFVLEANSVVPDLVTTKQRTVGIRMPDNNICLAIVKELGHPIVTTSANLSGEDPIGN 152
>gi|81300673|ref|YP_400881.1| hypothetical protein Synpcc7942_1864 [Synechococcus elongatus PCC 7942] >gi|81169554|gb|ABB57894.1| conserved hypothetical protein [Synechococcus elongatus PCC 7942] (195 aa)
Score = 112, Expect = 5.8e-04, Identities = 28/84 (33%), Positives = 48/84 (57%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQI-------PEVNETFKKLASKFWPGKLTLIYKKES---------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITN 156
           IY++K+R   K LI   +   ++       PE    +  +A+++WPG LTL+                     R+P       ++ +TGPL ++SAN SG P + +
  S:    39 IYRLKQRPSEKPLILMAATAAELWPFAQGSPEDQAQWNAIANQYWPGALTLVLPASDRLPAAVNPLDRSSIGLRIPACALARQILAETGPLATTSANRSGEPALLD 144
>gi|56752239|ref|YP_172940.1| hypothetical protein syc2230_c [Synechococcus elongatus PCC 6301] >gi|56687198|dbj|BAD80420.1| hypothetical protein [Synechococcus elongatus PCC 6301] (202 aa)
Score = 111, Expect = 6.2e-04, Identities = 31/84 (36%), Positives = 51/84 (60%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQI-------PEVNETFKKLASKFWPGKLTLIYKKESYRMPDDKFILN----------------LIDKTGPLYSSSANLSGNPPITN 156
           IY++K+R   K LI   +   ++       PE    +  +A+++WPG LTL+    S R+P     L+                ++ +TGPL ++SAN SG P + N
  S:    39 IYRLKQRPSEKPLILMAATAAELWPFAQGSPEDQAQWNAIANQYWPGALTLVLPA-SDRLPAAANPLDRSSIGLHIPACALARQILAETGPLATTSANRSGEPALLN 144
>gi|158337414|ref|YP_001518589.1| hypothetical protein AM1_4293 [Acaryochloris marina MBIC11017] >gi|158307655|gb|ABW29272.1| conserved hypothetical protein [Acaryochloris marina MBIC11017] (194 aa)
Score = 111, Expect = 6.3e-04, Identities = 35/113 (30%), Positives = 66/113 (58%)
  Q:    59 TDTVSGLLSL--NKPLIYKIKKRDKNKKLIRFVSNLDQI--------PEVNETFKKLASKFWPGKLTLIY---------------KKESYRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDI 171
           TDTV  L +       I+  K+R  +K LI   ++ + +         E+N+ ++++A+ +WPG LTL+                     R+P+ +    ++ +TGPL ++S N SG P +T +    E+ N++  D+
  S:    23 TDTVPALAARPDQASQIFAAKQRQPDKPLILMGASPEMLWPYVRKDGKELNQ-WQQMAADYWPGALTLVLPACDRVPPAMNPLTPDSIGIRVPNSQVAQMILQQTGPLATTSINRSGQPALTTV----EAINQHFPDV 155
>gi|145620872|ref|ZP_01776885.1| Sua5/YciO/YrdC/YwlC family protein [Geobacter bemidjiensis Bem] >gi|144942815|gb|EDJ77927.1| Sua5/YciO/YrdC/YwlC family protein [Geobacter bemidjiensis Bem] >gi|197087063|gb|ACH38334.1| Sua5/YciO/YrdC/YwlC family protein [Geobacter bemidjiensis Bem] (202 aa)
Score = 111, Expect = 6.6e-04, Identities = 32/84 (38%), Positives = 50/84 (59%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQIPEV----NETFKKLASKFWPGKLTLIYKKESY--------------RMPDDKFILNLIDKTG-PLYSSSANLSGNPPITN 156
           IY++K+RD+ K      S++ +I       N  FK+L  +  PG  T + +  S               RMPD+   L ++ + G P+ ++SANLSG  PI N
  S:    51 IYQVKQRDRKKPFSFICSDISEISRYARVSNYAFKQL-RRLLPGPYTFVLEANSVVPDLVTTKQRTVGIRMPDNNICLAIVKELGHPIVTTSANLSGEDPIGN 152
>gi|146304759|ref|YP_001192075.1| translation factor SUA5 [Metallosphaera sedula DSM 5348] >gi|145703009|gb|ABP96151.1| translation factor SUA5 [Metallosphaera sedula DSM 5348] (350 aa)
Score = 111, Expect = 6.8e-04, Identities = 39/100 (39%), Positives = 59/100 (59%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQIPEVN----ETFKKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPIT--------------NIIDAFESFNKYKSDII 172
           ++K K+R  +  LI  +++L Q+ EV+         LA + WPG LT I K+               + RMP     L LI ++G P+ + SANL+  P  T               +ID  E+F   +S II
  S:    52 VFKAKRRPMDNPLIVHIADLSQLEEVSVDVPPEVLDLAQRVWPGPLTFILKRNPRVPLETTGGLDTVAVRMPAHPIALQLIRESGVPIAAPSANLATKPSPTLAEHVIQDLDGSVDVVIDGGETFFGVESTII 184
>gi|118726904|ref|ZP_01575519.1| Sua5/YciO/YrdC/YwlC family protein [Clostridium cellulolyticum H10] >gi|118663719|gb|EAV70365.1| Sua5/YciO/YrdC/YwlC family protein [Clostridium cellulolyticum H10] (359 aa)
Score = 111, Expect = 6.9e-04, Identities = 44/127 (34%), Positives = 71/127 (55%)
  Q:    29 KKEFVTYEKDSSNLNGIVFEIKNLKAAIV---STDTVSGL-------LSLNKPLIYKIKKRDKNKKLIRFVSNLDQIPEVNETFKK----LASKFWPGKLTLIYKKESY--------------RMPDDKFILNLIDKTG-PLYSSSANLSGNPPIT 155
           K + +  + ++ N N +    + LK  +     T+TV GL       ++++K  I+K K R  +  LI  +++ +++ E+          L  K WPG LTL+ KK S               RMP+    L LI   G P+ + SAN+SG P  T
  S:     2 KTQVIKIDAENINENALKPAAEALKQGMTVAFPTETVYGLGANALDGIAVSK--IFKAKGRPSDNPLIVHIADREKVSELTSFIPDKAVALMDKLWPGPLTLVMKKSSVIPKEITAGLDTVGIRMPEHPVALELIKLAGIPVAAPSANVSGKPSPT 155
>gi|163943013|ref|YP_001647897.1| Sua5/YciO/YrdC/YwlC family protein [Bacillus weihenstephanensis KBAB4] >gi|163865210|gb|ABY46269.1| Sua5/YciO/YrdC/YwlC family protein [Bacillus weihenstephanensis KBAB4] (346 aa)
Score = 111, Expect = 7.3e-04, Identities = 46/142 (32%), Positives = 68/142 (47%)
  Q:    69 NKPLIYKIKKRDKNKKLIRFVSNLDQIPEVNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTN--TLKREGEIKYEWIKKTI 210
           + PLI  I  + +   ++R      +IP V E   KL   FWPG LT+I  ++                RMPD    L LI++   P+ + SAN SG P  T     +E  N   + I  ++G        ST+ D  +   T+ R G I  E ++  I
  S:    66 DNPLIVHIGTKSQLDGIVR------EIPPVAE---KLMEHFWPGPLTIILPRKKGISERVTAGLNTVGVRMPDHPVALALIEEANVPVAAPSANRSGRPSPTLASHVYEDLNGKIAGI--VDGGATGVGVESTVIDCTSEVPTILRPGGITKEQLEAVI 213
>gi|20093338|ref|NP_619413.1| SUA5/yciO/yrdC family protein [Methanosarcina acetivorans C2A] >gi|19918700|gb|AAM07893.1| SUA5/yciO/yrdC family protein [Methanosarcina acetivorans C2A] (360 aa)
Score = 111, Expect = 7.4e-04, Identities = 43/130 (33%), Positives = 70/130 (53%)
  Q:    23 EIKNYPKKEFVTYEKDSSNLNGIVFE----IKNLKAAIVSTDTVSGLLS--LNKPLIYKI---KKRDKNKKLIRFVSNLDQIPEVNETFK----KLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNP 152
           + +N  K+E   +     N + ++ E    I+        T+TV GL +  L+   + KI   K+R     L   V + + + +V +       +L   FWPG LT++ +K+                RMPD +  L L+ + G PL + SANLSG P
  S:     2 QAENGNKRETRLFRVSEENFDAVLDEAAEIIRRGGTVAFPTETVYGLGANGLDPEAVRKIFEAKERPPGNPLSLLVHSGEDVGKVAKNIPEKAFRLMDSFWPGPLTIVLEKKDIVPEITSGNLPSIGLRMPDHRIPLELVKRAGTPLAAPSANLSGKP 159
>gi|182435967|ref|YP_001823686.1| hypothetical protein SGR_2174 [Streptomyces griseus subsp. griseus NBRC 13350] >gi|178464483|dbj|BAG19003.1| conserved hypothetical protein [Streptomyces griseus subsp. griseus NBRC 13350] (215 aa)
Score = 111, Expect = 7.4e-04, Identities = 36/118 (30%), Positives = 62/118 (52%)
  Q:    95 IPEVNETFKKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDID--TNTLKREGEIKYEWIKKTIEE 212
           + + +E   +L   FWPG LTL+ K +              + RMP     + L+ + GP+  SSANL+G+P   +  DA +      S  ++++G       PS+I D+   T  L R G +  E ++  + +
  S:    79 VTDFSEEAWELVDAFWPGALTLVAKHQPSLQWDLGDTRGTVAIRMPLHPVAIELLTEVGPMAVSSANLTGHPSPED-CDAAQGMLG-DSVSVYLDGGPTPGIVPSSIVDVTGATPVLLRAGALSAEELRTVVPD 210
>gi|88608553|ref|YP_506460.1| Sua5/YciO/YrdC/YwlC family protein [Neorickettsia sennetsu str. Miyayama] >gi|88600722|gb|ABD46190.1| Sua5/YciO/YrdC/YwlC family protein [Neorickettsia sennetsu str. Miyayama] (195 aa)
Score = 111, Expect = 7.6e-04, Identities = 34/100 (34%), Positives = 55/100 (55%)
  Q:    73 IYKIKKRDKNKKL---IRFVSNLDQIPEVNETFKKLASKFWPGKLTLIYKKE-------------SYRMPDDKFILNLIDK-TGPLYSSSANLSGNPPITNIIDAFESFNKYKSDII 172
           IY IK+R+  K L   +  +S+L      NE+  +L  +  PG +T I K++             + R+PD K  L ++     P++++S NLSG P ++N         K  S II
  S:    38 IYDIKQRNFRKSLPIMVAGISDLGSFASFNESQARLIQECCPGPVTFILKRKKSAHLRFRFPEKVAVRVPDSKVALKILRGFKRPVFATSVNLSGRPAVSNFTQIGSYIKKRVSRII 154
>gi|56421910|ref|YP_149228.1| hypothetical protein GK3375 [Geobacillus kaustophilus HTA426] >gi|56381752|dbj|BAD77660.1| hypothetical conserved protein [Geobacillus kaustophilus HTA426] (349 aa)
Score = 110, Expect = 8.1e-04, Identities = 41/97 (42%), Positives = 55/97 (56%)
  Q:    59 TDTVSGL--LSLNKPLIYKI---KKRDKNKKLIRFVSNLDQIPEVNETF----KKLASKFWPGKLTLIYKKE---------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPIT 155
           T+TV GL   + N   + KI   K R  +  LI  V+++ Q   V  +     K L  +FWPG LTL+  K                + RMPD    L LI+ +G  L + SAN SG P  T
  S:    38 TETVYGLGADAANTAAVEKIFAAKGRPSDNPLIVHVASMAQAEAVAASIPPMAKTLMERFWPGPLTLVLPKRAKAVSERVTAGLPTVAVRMPDHPLALALIEASGLALAAPSANRSGRPSPT 159
>gi|84393448|ref|ZP_00992205.1| Sua5/YciO/YrdC family protein [Vibrio splendidus 12B01] >gi|84375964|gb|EAP92854.1| Sua5/YciO/YrdC family protein [Vibrio splendidus 12B01] (185 aa)
Score = 110, Expect = 8.1e-04, Identities = 38/124 (30%), Positives = 69/124 (55%)
  Q:    76 IKKRDKNKKLIRFVSNLDQI-PEVNE---TFKKLAS--KFWPGKLTLI--------------YKKESYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKREG 199
           +K+R   K LI   ++ +Q+ P ++E   T  +LA+    WPG +T I              ++  + R+ D   +  + ++ G PL S+SANL+G PP     +  +   ++   +  +EG      +PS I D  T+ + R+G
  S:    43 LKQRPMEKGLILIAASYEQLLPYIDESQLTEAQLATVKATWPGPVTWIMPTSSKVTDWVSGQFESIAVRVTDHPLVQRMCNEFGKPLTSTSANLTGEPPCMTTEEVQQQLGQHL--VAILEGQTGGREKPSEIRDAKTSKILRQG 185
>gi|194435076|ref|ZP_03067314.1| Sua5/YciO/YrdC/YwlC family protein [Shigella dysenteriae 1012] >gi|194416683|gb|EDX32814.1| Sua5/YciO/YrdC/YwlC family protein [Shigella dysenteriae 1012] (190 aa)
Score = 110, Expect = 8.7e-04, Identities = 40/127 (31%), Positives = 65/127 (51%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQI-PEVNETFKKLASK-----FWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKREG 199
           + ++K+R  +K LI   +N +Q+ P +++T    A +      WPG +T ++   S               R+ D   ++ L    G PL S+SANLSG PP   + +    F    +    + G+      PS I D  T  L R+G
  S:    46 LLELKQRPVDKGLILIAANYEQLKPYIDDTMLTDAQRETIFSRWPGPVTFVFPAPSTTPRWLTGRFDSLAVRVTDHPLVVALCQAYGKPLVSTSANLSGLPPCRTVDEVRAQFG---AAFPVVPGETGGRLNPSEIRDALTGELFRQG 190
>gi|46908713|ref|YP_015102.1| Sua5/YciO/YrdC/YwlC family protein [Listeria monocytogenes str. 4b F2365] >gi|47094309|ref|ZP_00232012.1| Sua5/YciO/YrdC/YwlC family protein [Listeria monocytogenes str. 4b H7858] >gi|153204126|ref|ZP_01944976.1| hypothetical protein LMSG_02316 [Listeria monocytogenes HPB2262] >gi|167015627|ref|ZP_02278160.1| Sua5/YciO/YrdC/YwlC family protein [Listeria monocytogenes FSL J1-194] >gi|167215211|ref|ZP_02285518.1| Sua5/YciO/YrdC/YwlC family protein [Listeria monocytogenes FSL R2-503] >gi|167218328|ref|ZP_02287964.1| Sua5/YciO/YrdC/YwlC family protein [Listeria monocytogenes FSL J1-175] >gi|46881985|gb|AAT05279.1| Sua5/YciO/YrdC/YwlC family protein [Listeria monocytogenes str. 4b F2365] >gi|47017319|gb|EAL08149.1| Sua5/YciO/YrdC/YwlC family protein [Listeria monocytogenes str. 4b H7858] >gi|133734358|gb|EBA36056.1| hypothetical protein LMSG_02316 [Listeria monocytogenes HPB2262] (345 aa)
Score = 110, Expect = 8.7e-04, Identities = 47/138 (34%), Positives = 70/138 (50%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQIPEVNETFK----KLASKFWPGKLTLI--YKKESY-------------RMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYD--IDTNTLKREGEIKYEWIKKTI 210
           IY+ K R  +  LI  ++  +Q+     ++     +L  KFWPG LT+I   KK+S              RMP+    L LID    P+ + SAN SG P  T      E  +   + I  I+G        ST+ D  +D   + R G +  E I++ I
  S:    54 IYEAKGRPSDNPLIVHIARREQMDPFVASYPVKAIQLMEKFWPGPLTVILPLKKDSLATNVSAGLSTVGVRMPEHPVSLALIDAANIPVAAPSANRSGKPSPTTASHVIEDLDGKIAGI--IDGGATGVGLESTVIDCSLDIPVILRPGGVTKEQIEQII 211
>gi|51246039|ref|YP_065923.1| hypothetical protein DP2187 [Desulfotalea psychrophila LSv54] >gi|50877076|emb|CAG36916.1| hypothetical protein [Desulfotalea psychrophila LSv54] (218 aa)
Score = 110, Expect = 9.4e-04, Identities = 43/139 (30%), Positives = 69/139 (49%)
  Q:    73 IYKIKKRDKNKKLIRFVSN----LDQIPEVNETFKKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTL--KREGEIKYEWIKKTIE 211
           +Y +K R ++K L+  V+N    LD +  +   +K L ++FWPG LTLI++ +              + R          ++  G PL ++SAN S   P     D    F     D I  +G    N   STI  +    L   REGE+  + I + ++
  S:    58 LYSLKGRHRSKPLLLLVANHAQLLDCVCAIPPLYKPLIARFWPGPLTLIFQAKETIPAILTGGSKTIAIRRSPHPVAQFFVESAGIPLTATSANFSQKKPALTAQDCLHMFGDL-VDYIIDDGQRGLNGF-STILAVKKEGLIVIREGELSLKTIARELD 215
>gi|170769585|ref|ZP_02904038.1| Sua5/YciO/YrdC/YwlC family protein [Escherichia albertii TW07627] >gi|170121642|gb|EDS90573.1| Sua5/YciO/YrdC/YwlC family protein [Escherichia albertii TW07627] (190 aa)
Score = 110, Expect = 9.5e-04, Identities = 40/124 (32%), Positives = 63/124 (50%)
  Q:    76 IKKRDKNKKLIRFVSNLDQI-PEVNETFKKLASK-----FWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKREG 199
           +K+R  +K LI   +N +Q+ P ++++    A +      WPG +T ++   S               R+ D   ++ L    G PL SSSANLSG PP   + +    F     +   + G+      PS I D  T  L R+G
  S:    49 LKQRPVDKGLILIAANYEQLKPYIDDSMLTKAQRETIFSRWPGPVTFVFPAPSTTPRWLTGRFDSLAVRVTDHPLVVALCQAYGKPLVSSSANLSGLPPCRTVEEVRAQFG---VEFPVVPGETGGRLNPSEIRDALTGELFRQG 190
>gi|67468340|ref|XP_650214.1| hypothetical protein, conserved [Entamoeba histolytica HM-1:IMSS] >gi|56466800|gb|EAL44828.1| hypothetical protein, conserved [Entamoeba histolytica HM-1:IMSS] (357 aa)
Score = 110, Expect = 9.7e-04, Identities = 31/83 (37%), Positives = 47/83 (56%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQI----PEVNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPIT 155
           I+K+K R  +  LI  +S+++ +      V+E   KL  +FWPG LT+I+ +                 RMP        I + G P+ + SANLS  P  T
  S:    68 IFKVKGRPNDNPLICHISDIEMLNKLAAHVSEDAHKLIKRFWPGALTIIFPRNEAVPNEVTAGLNTVGVRMPSHPIAYEFIKQCGTPIAAPSANLSTKPSPT 169
>gi|148235871|ref|NP_001082069.1| putative transmembrane protein TA-2 [Xenopus laevis] >gi|12007284|gb|AAG45109.1|AF310008_1 putative transmembrane protein TA-2 [Xenopus laevis] (912 aa)
Score = 110, Expect = 1.0e-03, Identities = 51/157 (32%), Positives = 83/157 (52%)
  Q:    39 SSNLNGIVFEIKNLKAAIVSTDTVSGLLS-LNKP----LIYKIKKRDKNKKLIRFVSNLDQIPEVNETFKKLASKF----WPGKLTLIY----------KKES-----------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYD---IDTNTL 195
           +S++  I   +KN     + TDTV  L++  N+P      YK K++ +++ +  ++S+L+Q+      F  L   F    WP  ++L+            KES            R+PD     +LID  GP+  +SAN SG    T+    F      K D +  +G   + N  ST+ D   ID+  L
  S:   633 TSSVRQIAEIMKNGGICGIPTDTVYVLVAACNQPDAVEKAYKTKRQAQDRPMSLWISSLEQLASAKHLFSPLLWDFMHKAWPSSISLVIPRGPWLEVLGAKESSKYIGTPQSIAIRIPDCTVTTHLIDMVGPIAVTSANPSGEADTTHHNQVFAKLGD-KVDGVLCDGPSPE-NIASTVVDCTKIDSGNL 820
>gi|163762330|ref|ZP_02169395.1| acyl-CoA dehydrogenase domain protein [Bacillus selenitireducens MLS10] >gi|160357069|gb|EDP83717.1| acyl-CoA dehydrogenase domain protein [Bacillus selenitireducens MLS10] (352 aa)
Score = 110, Expect = 1.0e-03, Identities = 40/117 (34%), Positives = 62/117 (52%)
  Q:    49 IKNLKAAIVSTDTVSGL---LSLNKPL--IYKIKKRDKNKKLIRFVSNLDQIPE----VNETFKKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFN 165
           I+N +     T+TV GL    + ++ +  I++ K R  +  LI  V++++        + +T K L + FWPG LT++                    RMPD    L LI+ +G PL + S N SG P  T      E  N
  S:    34 IRNGEVVAFPTETVYGLGGDATSDEAIRRIFEAKGRPADNPLIVHVASIEDAARWTLTLPKTAKDLMAAFWPGPLTIVLPHNGTLSGAVTAGLPTVGLRMPDHPVALRLIEASGRPLAAPSGNRSGRPSPTEAAHVEEDLN 174
>gi|108800849|ref|YP_641046.1| translation factor SUA5 [Mycobacterium sp. MCS] >gi|119869989|ref|YP_939941.1| translation factor SUA5 [Mycobacterium sp. KMS] >gi|126436447|ref|YP_001072138.1| translation factor SUA5 [Mycobacterium sp. JLS] >gi|108771268|gb|ABG09990.1| translation factor SUA5 [Mycobacterium sp. MCS] >gi|119696078|gb|ABL93151.1| translation factor SUA5 [Mycobacterium sp. KMS] >gi|126236247|gb|ABN99647.1| translation factor SUA5 [Mycobacterium sp. JLS] (218 aa)
Score = 110, Expect = 1.0e-03, Identities = 29/93 (31%), Positives = 47/93 (50%)
  Q:    98 VNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDI 190
           V  T ++L   FWPG L+L+ ++                 RMP     + L+ + GP+  SSAN+SG P   +  DA E         ++++    +    STI D+
  S:    82 VPHTARELIRAFWPGALSLVVRQAPSLPWDLGDAHGTVMLRMPLHPVAIELLREVGPMAVSSANISGRPAAVSAADAREQLGDLVD--VYLDAGPSEQQAASTIVDL 186
>gi|194477096|ref|YP_002049275.1| Putative translation factor (SUA5) [Paulinella chromatophora] >gi|171192103|gb|ACB43065.1| Putative translation factor (SUA5) [Paulinella chromatophora] (203 aa)
Score = 110, Expect = 1.0e-03, Identities = 35/99 (35%), Positives = 61/99 (61%)
  Q:    55 AIVSTDTVSGLLSL--NKPLIYKIKKRDKNKKLI----------RFVSNLDQIPEVNETFKKLASKFWPGKLTLIYKKESY--------------RMPDDKFILNLIDKTGPLYSSSANLSGNPP 153
            I  TDT+  + ++      I+++K R K+K LI          +F++     P +++ +K +  ++WPG LT+I                    R+P  +  L+L+ +TGPL +SSAN+SG  P
  S:    20 GIFPTDTLPAIATIPGKAKQIWELKHRIKSKPLILMGHEAELLFKFIAQ----PILSDCYK-VGERYWPGALTIIVPASGLIVKELNPLGNSIGLRVPACRSTLDLLSRTGPLATSSANISGKYP 139
>gi|167546872|ref|ZP_02342433.1| putative ribosome maturation factor [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23] (190 aa)
Score = 110, Expect = 1.0e-03, Identities = 39/124 (31%), Positives = 64/124 (51%)
  Q:    76 IKKRDKNKKLIRFVSNLDQI-PEVNETF-----KKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKREG 199
           +K+R  +K LI   ++ +Q+ P ++++      +K     WPG +T ++   +               R+ +   ++ L +  G PL S+SANLSG PP   I +    F     D   +EG       PS I D  T  L R+G
  S:    49 LKQRPVDKGLILIAASFEQLKPYIDDSILTAAQRKAVFDCWPGPVTFVFPAPATTPRWLTGRFDSLAVRVTNHPLVVALCNAYGKPLVSTSANLSGLPPCRTIEEVRAQFG---DDFPVVEGATGGRLNPSEIRDALTGELFRQG 190
>gi|167747415|ref|ZP_02419542.1| hypothetical protein ANACAC_02135 [Anaerostipes caccae DSM 14662] >gi|167652777|gb|EDR96906.1| hypothetical protein ANACAC_02135 [Anaerostipes caccae DSM 14662] (351 aa)
Score = 109, Expect = 1.0e-03, Identities = 44/148 (29%), Positives = 70/148 (47%)
  Q:    63 SGLLSLNKPLIYKIKKRDKNKKLIRFVSNLDQIPEVNETF----KKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDI--DTNTLKREGEIKYEWIKKTI 210
           SG +      IY+ K R  +  LI  + +++ I E+        KK    FWPG LT+I  K               + RMP     L L+ + G P+ + SAN SG P  T      E  +      + ++G   +    STI D   +   + R G+I  + ++K +
  S:    46 SGWMEEAASRIYEAKGRPSDNPLILHIGSMEMIDEIASCVPGPAKKAMDAFWPGPLTVILPKSDKVPYRVTGGLDSVAVRMPSHPAALALLREAGVPVAAPSANTSGRPSPTKAEHVVEDLDGKIP--MVLDGGKVEVGVESTIVDFTGEVPVILRPGKITKDELEKAL 212
>gi|56415322|ref|YP_152397.1| putative ribosome maturation factor [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|56129579|gb|AAV79085.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] (190 aa)
Score = 109, Expect = 1.1e-03, Identities = 38/124 (30%), Positives = 65/124 (52%)
  Q:    76 IKKRDKNKKLIRFVSNLDQI-PEVNETF-----KKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKREG 199
           +K+R  +K LI   ++ +Q+ P ++++      +K     WPG +T ++   +               R+ +   ++ L +  G PL S+SANLSG PP   + +    F     D   +EG      +PS I D  T  L R+G
  S:    49 LKQRPVDKGLILIAASFEQLKPYIDDSILTAAQRKAVFDCWPGPVTFVFPAPATTPRWLTGRFDSLAVRVTNHPLVVALCNAYGKPLVSTSANLSGLPPCRTVEEVRAQFG---DDFPVVEGATGGRLKPSEIRDALTGELFRQG 190
>gi|171779354|ref|ZP_02920318.1| hypothetical protein STRINF_01199 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gi|171281971|gb|EDT47402.1| hypothetical protein STRINF_01199 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] (199 aa)
Score = 109, Expect = 1.1e-03, Identities = 38/97 (39%), Positives = 59/97 (60%)
  Q:    54 AAIVSTDTVSGLLS--LNKPLI---YKIKKRDKNKKLIRFVSNLDQIPEVNET----FKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSG 150
           A I+ T+TV GL +  +N+  +   Y++K R K+K +   V++ + I   ++      KKL   F PG LT+I +                 +R+P     L LI +TGPL   SAN+SG
  S:    13 AVILPTETVYGLFAQAMNEEAVEHVYRLKCRPKDKAMNLNVADYETILAFSKNQPTYLKKLYDAFLPGPLTIILQANDRVPAWINSGLSTIGFRIPKHPQTLALIKETGPLIGPSANISG 132
>gi|114561217|ref|YP_748730.1| SUA5/yciO/yrdC domain-containing protein [Shewanella frigidimarina NCIMB 400] >gi|114332510|gb|ABI69892.1| SUA5/yciO/yrdC, N-terminal domain protein [Shewanella frigidimarina NCIMB 400] (188 aa)
Score = 109, Expect = 1.1e-03, Identities = 40/124 (32%), Positives = 60/124 (48%)
  Q:    76 IKKRDKNKKLIRFVSNLDQ------IPEVNETFKKLASKFWPGKLTLIYKKESY--------------RMPDDKFILNLIDK-TGPLYSSSANLSGNPPITNIIDAFESFNKYKSDI-IFIEGDYYQNNQPSTIYDIDTNTLKREG 199
           +K+R   K LI   S+ +Q      I ++ E   + A   WPG  T +   +S+              R+     +  L D    PL S+SANL+G  P   ++DA      +   I   I G   +  QPSTI D  +  + R G
  S:    45 VKQRPWQKGLILVASSFEQLLPYLDITQLTEQQLQFAQSKWPGPFTFVMPIQSHVSKLLCGEFDSIAVRVSAHPVVRELCDTLNKPLVSTSANLAGEQP---VVDAQHIITDFSDKIDALILGKLGEQRQPSTIIDARSGQILRNG 187
>gi|187933769|ref|YP_001884698.1| Sua5/YciO/YrdC/YwlC family protein [Clostridium botulinum B str. Eklund 17B] >gi|187721922|gb|ACD23143.1| Sua5/YciO/YrdC/YwlC family protein [Clostridium botulinum B str. Eklund 17B] (349 aa)
Score = 109, Expect = 1.2e-03, Identities = 57/160 (35%), Positives = 91/160 (56%)
  Q:    49 IKNLKAAIVSTDTVSGLLS--LNKPLIYKI---KKRDKNKKLIRFVSN------LDQIPEVNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSS-SANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTN--TLKREGEIKYEWIKK 208
           IK+       T+TV GL S  LN+  + KI   K R ++  LI  V++      ++ IP++ +   +L  K+WPG LTLI KK+S               RMP+++  L LI+ +  + ++ SAN+SG P  T++    +  +  + D I + G        STI D   N   + R G I  E +K+
  S:    25 IKDGGIVAFPTETVYGLGSDALNEDAVKKIFIAKGRPQDNPLIVHVASKNIQSLVEDIPDIAQ---RLIDKYWPGPLTLILKKKSIIPDMTSANLDTIGIRMPNNEIALKLIEMSNTVIAAPSANISGRPSPTDVERCIDDLSG-RVDCI-VGGKKSDIGLESTILDCTVNPPIVLRPGGITLEMLKE 207
>gi|110770001|ref|XP_001120082.1| PREDICTED: similar to CG33786-PA, isoform A [Apis mellifera] (271 aa)
Score = 109, Expect = 1.2e-03, Identities = 39/93 (41%), Positives = 57/93 (61%)
  Q:    57 VSTDTVSGLLSLNKPL-----IYKIKKRDKNKKLIRFVSNLDQIPE---VNETFKKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTGPLYSSSANLS 149
           + TDT+ GL  +         +Y+IKKRDK+K L   V+N++ I +   V+   + L S   PG +T+I K+                 R+P  KFI  +   TGPL  +SANLS
  S:    79 IPTDTIYGLAGIVSSTSSIEKLYEIKKRDKDKPLSISVNNINDIKKWGIVDHLPQDLLSLILPGPITIIVKRTPALNPALNPNHDTVGIRIPSFKFISYISAITGPLALTSANLS 193
>gi|20094073|ref|NP_613920.1| translation factor (SUA5) [Methanopyrus kandleri AV19] >gi|19887062|gb|AAM01850.1| Translation factor (SUA5) [Methanopyrus kandleri AV19] (212 aa)
Score = 109, Expect = 1.3e-03, Identities = 51/178 (28%), Positives = 95/178 (53%)
  Q:    33 VTYEKDSSNLNGIVFEIKNLKAAIVSTDTVSGLL--SLNKPLI---YKIKKRDKNKKLIRFVSNLDQIPEVNETFKKLAS---KFWPGKLTLIYKKE---------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTN---TLKREGEIKYEWIKKTI 210
           V  E+D   +  +V  ++  K   +  DTV  L   + N   +   Y  K+R K+K +   V + ++  E+ E   +L +      PG +T++  +                  R+PD  F L ++ + G P+ ++SAN+SG P  T+  + FE     + DI+ +EG+  +  +PST+ ++       + REG +  E I +T+
  S:     4 VLEEEDPHAVKHVVRALRAGKLVAIPCDTVYSLSCDATNSEAVRRLYAAKERPKDKPVSVAVHSPEKALELLEPVPRLEAALETLTPGPVTIVAPRRPGVVAPEVAAGRRTLGVRIPDHPFFLRVVRRFGKPIVTTSANVSGRPAPTDPDEVFEQLGD-RLDIL-VEGE-CRFGEPSTVIELTPEGNIDILREGAMPKEEILETL 205
>gi|15679686|ref|NP_276803.1| hypothetical protein MTH1692 [Methanothermobacter thermautotrophicus str. Delta H] >gi|22218836|pdb|1JCU|A Chain A, Solution Structure Of Mth1692 Protein From Methanobacterium Thermoautotrophicum >gi|2622823|gb|AAB86164.1| conserved protein [Methanothermobacter thermautotrophicus str. Delta H] (208 aa)
Score = 108, Expect = 1.5e-03, Identities = 41/138 (29%), Positives = 75/138 (54%)
  Q:    56 IVSTDTVSGL--LSLNKPLI---YKIKKRDKNKKLIRFVSNLDQIPEVNE---TFKKLASKFWPGKLTLIYKKESY--------------RMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTN 193
           I  TDT+ GL   +L++  +   +++K R  +K +   VS +D+IP  +       +L  +  PG  T++ ++                 R+PDD+ I   I    P+ ++SAN+SG PP   + +     +    D++   GD   + +PST+ D+  N
  S:    30 IYPTDTIYGLGVNALDEDAVRRLFRVKGRSPHKPVSICVSCVDEIPRFSRPSGDAMELMERILPGPYTVVLERNELIPDVITGGSSRVGIRVPDDE-ICRRIAARFPVTATSANISGKPPSPRLEEIVRDLDAV--DLVLDAGDCL-DMEPSTVIDLTVN 185
>gi|26249867|ref|NP_755907.1| putative ribosome maturation factor [Escherichia coli CFT073] >gi|26110295|gb|AAN82481.1|AE016767_241 Protein yrdC [Escherichia coli CFT073] (205 aa)
Score = 108, Expect = 1.5e-03, Identities = 39/127 (30%), Positives = 65/127 (51%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQI-PEVNETFKKLASK-----FWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKREG 199
           + ++K+R  +K LI   +N +Q+ P +++T    A +      WPG +T ++   +               R+ D   ++ L    G PL S+SANLSG PP   + +    F    +    + G+      PS I D  T  L R+G
  S:    61 LLELKRRPVDKGLILIAANYEQLKPYIDDTMLTDAQRETIFSRWPGPVTFVFPAPATTPRWLTGRFDSLAVRVTDHPLVVALCQAYGKPLVSTSANLSGLPPCRTVDEVRAQFG---AAFPVVPGETGGRLNPSEIRDALTGELFRQG 205
>gi|160872705|ref|ZP_02062837.1| Sua5/YciO/YrdC family protein [Rickettsiella grylli] >gi|159121504|gb|EDP46842.1| Sua5/YciO/YrdC family protein [Rickettsiella grylli] (307 aa)
Score = 108, Expect = 1.5e-03, Identities = 35/100 (35%), Positives = 47/100 (47%)
  Q:    28 PKKEFVTYEKDSSNLNGIVFEIKNLKAAIVSTDTVSGLLSLNKPLIYKIKKRDKNKKLIRFVSNLDQIPEVNETFKKLASKFWPGKLTLIYKKESYRMPD 127
           P +       D++NLN I+ +I +LK              LN+PL   + K     +  R       IPEV E   KLA +FWPG LTLI KKE   +P+
  S:    23 PTETVYALAGDATNLNAIL-QIFSLKRR-----------PLNQPLSVLLAKEHPMTRWAR------DIPEVAE---KLAERFWPGPLTLILKKEKTVLPE 101
>gi|168468041|ref|ZP_02701878.1| Sua5/YciO/YrdC/YwlC family protein [Salmonella enterica subsp. enterica serovar Newport str. SL317] >gi|168823240|ref|ZP_02835240.1| putative ribosome maturation factor [Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537] >gi|195628882|gb|EDX48292.1| Sua5/YciO/YrdC/YwlC family protein [Salmonella enterica subsp. enterica serovar Newport str. SL317] (190 aa)
Score = 108, Expect = 1.6e-03, Identities = 38/124 (30%), Positives = 64/124 (51%)
  Q:    76 IKKRDKNKKLIRFVSNLDQI-PEVNETF-----KKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKREG 199
           +K+R  +K LI   ++ +Q+ P ++++      +K     WPG +T ++   +               R+ +   ++ L +  G PL S+SANLSG PP   + +    F     D   +EG       PS I D  T  L R+G
  S:    49 LKQRPVDKGLILIAASFEQLKPYIDDSILTAAQRKAVFDCWPGPVTFVFPAPATTPRWLTGRFDSLAVRVTNHPLVVALCNAYGKPLVSTSANLSGLPPCRTVEEVRAQFG---DDFPVVEGATGGRLNPSEIRDALTGELFRQG 190
>gi|168229099|ref|ZP_02654330.1| putative ribosome maturation factor [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433] >gi|168239765|ref|ZP_02664823.1| putative ribosome maturation factor [Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480] >gi|194734742|ref|YP_002116346.1| Sua5/YciO/YrdC/YwlC family protein [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|194710244|gb|ACF89465.1| Sua5/YciO/YrdC/YwlC family protein [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] (190 aa)
Score = 108, Expect = 1.6e-03, Identities = 38/124 (30%), Positives = 64/124 (51%)
  Q:    76 IKKRDKNKKLIRFVSNLDQI-PEVNETF-----KKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKREG 199
           +K+R  +K LI   ++ +Q+ P ++++      +K     WPG +T ++   +               R+ +   ++ L +  G PL S+SANLSG PP   + +    F     D   +EG       PS I D  T  L R+G
  S:    49 LKQRPVDKGLILIAASFEQLKPYIDDSILTAAQRKAVFDCWPGPVTFVFPAPATTPRWLTGRFDSLAVRVTNHPLVVALCNAYGKPLVSTSANLSGLPPCRTVEEVRAQFG---DDFPVVEGATGGRLNPSEIRDALTGELFRQG 190
>gi|161616428|ref|YP_001590393.1| putative ribosome maturation factor [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|167554199|ref|ZP_02347940.1| putative ribosome maturation factor [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] >gi|167560573|ref|ZP_02353576.1| putative ribosome maturation factor [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853] >gi|168224008|ref|ZP_02649240.1| putative ribosome maturation factor [Salmonella enterica subsp. enterica serovar Agona str. SL483] >gi|168245229|ref|ZP_02670161.1| putative ribosome maturation factor [Salmonella enterica subsp. enterica serovar Heidelberg str. SL486] >gi|168264717|ref|ZP_02686690.1| putative ribosome maturation factor [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] >gi|194449529|ref|YP_002047427.1| Sua5/YciO/YrdC/YwlC family protein [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|161365792|gb|ABX69560.1| hypothetical protein SPAB_04243 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|194407833|gb|ACF68052.1| Sua5/YciO/YrdC/YwlC family protein [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] (190 aa)
Score = 108, Expect = 1.6e-03, Identities = 38/124 (30%), Positives = 64/124 (51%)
  Q:    76 IKKRDKNKKLIRFVSNLDQI-PEVNETF-----KKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKREG 199
           +K+R  +K LI   ++ +Q+ P ++++      +K     WPG +T ++   +               R+ +   ++ L +  G PL S+SANLSG PP   + +    F     D   +EG       PS I D  T  L R+G
  S:    49 LKQRPVDKGLILIAASFEQLKPYIDDSILTAAQRKAVFDCWPGPVTFVFPAPATTPRWLTGRFDSLAVRVTNHPLVVALCNAYGKPLVSTSANLSGLPPCRTVEEVRAQFG---DDFPVVEGATGGRLNPSEIRDALTGELFRQG 190
>gi|62181908|ref|YP_218325.1| putative ribosome maturation factor [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|62129541|gb|AAX67244.1| putative translation factor [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] (200 aa)
Score = 108, Expect = 1.6e-03, Identities = 38/124 (30%), Positives = 64/124 (51%)
  Q:    76 IKKRDKNKKLIRFVSNLDQI-PEVNETF-----KKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKREG 199
           +K+R  +K LI   ++ +Q+ P ++++      +K     WPG +T ++   +               R+ +   ++ L +  G PL S+SANLSG PP   + +    F     D   +EG       PS I D  T  L R+G
  S:    59 LKQRPVDKGLILIAASFEQLKPYIDDSILTAAQRKAVFDCWPGPVTFVFPAPATTPRWLTGRFDSLAVRVTNHPLVVALCNAYGKPLVSTSANLSGLPPCRTVEEVRAQFG---DDFPVVEGATGGRLNPSEIRDALTGELFRQG 200
>gi|16766691|ref|NP_462306.1| putative ribosome maturation factor [Salmonella typhimurium LT2] >gi|167995177|ref|ZP_02576267.1| putative ribosome maturation factor [Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701] >gi|16421958|gb|AAL22265.1| putative translation factor [Salmonella typhimurium LT2] (190 aa)
Score = 108, Expect = 1.6e-03, Identities = 38/124 (30%), Positives = 64/124 (51%)
  Q:    76 IKKRDKNKKLIRFVSNLDQI-PEVNETF-----KKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKREG 199
           +K+R  +K LI   ++ +Q+ P ++++      +K     WPG +T ++   +               R+ +   ++ L +  G PL S+SANLSG PP   + +    F     D   +EG       PS I D  T  L R+G
  S:    49 LKQRPVDKGLILIAASFEQLKPYIDDSILTAAQRKAVFDCWPGPVTFVFPAPATTPRWLTGRFDSLAVRVTNHPLVVALCNAYGKPLVSTSANLSGLPPCRTVEEVRAQFG---DDFPVVEGATGGRLNPSEIRDALTGELFRQG 190
>gi|31792494|ref|NP_854987.1| hypothetical protein Mb1333 [Mycobacterium bovis AF2122/97] >gi|121637230|ref|YP_977453.1| hypothetical protein BCG_1361 [Mycobacterium bovis BCG str. Pasteur 1173P2] >gi|31618083|emb|CAD94194.1| CONSERVED HYPOTHETICAL PROTEIN [Mycobacterium bovis AF2122/97] >gi|121492877|emb|CAL71348.1| Conserved hypothetical protein [Mycobacterium bovis BCG str. Pasteur 1173P2] (217 aa)
Score = 108, Expect = 1.6e-03, Identities = 32/108 (29%), Positives = 60/108 (55%)
  Q:   103 KKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDI-IFIEGDYYQNNQPSTIYDIDTNTLK--REGEIKYEWIKKTI 210
           ++L   FWPG L+L+  +                 RMP     + L+ + GP+  SSAN+SG+PP    +DA ++ ++    + ++++    +    STI D+   T +  R+G +  E I + +
  S:    87 RELIRAFWPGALSLVVVQAPSLQWDLGDAHGTVMLRMPLHPVAIELLREVGPMAVSSANISGHPP---PVDAEQARSQLGDHVAVYLDAGPSEQQAGSTIVDLTGATPRVLRQGPVSTERIAEVL 208
>gi|16762880|ref|NP_458497.1| putative ribosome maturation factor [Salmonella enterica subsp. enterica serovar Typhi str. CT18] >gi|29144367|ref|NP_807709.1| putative ribosome maturation factor [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] >gi|25305392|pir||AF1010 conserved hypothetical protein yrdC [imported] - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) >gi|16505187|emb|CAD09183.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Typhi] >gi|29140005|gb|AAO71569.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Typhi Ty2] (190 aa)
Score = 108, Expect = 1.6e-03, Identities = 38/124 (30%), Positives = 64/124 (51%)
  Q:    76 IKKRDKNKKLIRFVSNLDQI-PEVNETF-----KKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKREG 199
           +K+R  +K LI   ++ +Q+ P ++++      +K     WPG +T ++   +               R+ +   ++ L +  G PL S+SANLSG PP   + +    F     D   +EG       PS I D  T  L R+G
  S:    49 LKQRPVDKGLILIAASFEQLKPYIDDSILTAAQRKAVFDCWPGPVTFVFPAPATTPRWLTGRFDSLAVRVTNHPLVVALCNAYGKPLVSTSANLSGLPPCRTVEEVRAQFG---DDFPVVEGATGGRLNPSEIRDALTGELFRQG 190
>gi|148241524|ref|YP_001226681.1| translation factor [Synechococcus sp. RCC307] >gi|147849834|emb|CAK27328.1| Possible translation factor [Synechococcus sp. RCC307] (195 aa)
Score = 108, Expect = 1.6e-03, Identities = 35/98 (35%), Positives = 58/98 (59%)
  Q:    55 AIVSTDTVSGLLSLNKPL--IYKIKKRDKNKKLIRFVSNLDQI-----PEVNETFKKLASKFWPGKLTLIYK---------------KESYRMPDDKFILNLIDKTGPLYSSSANLSGNP 152
           A+  TDT+  L ++      I+++K+R  +K LI   ++++Q+      E    +++LA   WPG LTL+                     R+P  +  L L+  +GPL +SSAN SG P
  S:    19 ALFPTDTLPALAAIPSAAQAIWQLKQRPADKPLILMGASVEQLLPCLGQEPPAGWQRLAELGWPGALTLVLPACGPVVEALNPEGGCSLGLRVPACEAALQLLRCSGPLATSSANRSGEP 138
>gi|48478016|ref|YP_023722.1| Sua5 superfamily-related protein [Picrophilus torridus DSM 9790] >gi|48430664|gb|AAT43529.1| Sua5 superfamily-related protein [Picrophilus torridus DSM 9790] (337 aa)
Score = 108, Expect = 1.7e-03, Identities = 51/160 (31%), Positives = 81/160 (50%)
  Q:    49 IKNLKAAIVSTDTVSGL-----LSLNKPLIYKIKKRDKNKKLIRFVSNLDQIPEVNE---TFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYD--IDTNTLKREGEIKYEWIKK 208
           I+     +  T+TV GL      S     I++ K R  +  LI  VSN + + +V+       K+    WP  LTL+ KK+S               R P ++  L LI + G P+ + SAN++  P I +  DA +  +  + D I I+    +    STI D  ++   L R G    E I++
  S:    19 IRKGGTVVFPTETVYGLGANALSSEASAKIFRAKDRPADNPLIVTVSNFNMVKDVSYIDCKLLKIMEGVWPAPLTLLLKKKSIVPDIVTAGMDTVCVRFPKNEIALRLISEAGVPVAAPSANIATRPSIVDSKDAIDELDG-RVDAI-IDAGRVEYGVESTIIDATVEPYNLLRPGAFPVEEIER 201
>gi|189218176|ref|YP_001938818.1| Putative translation factor SUA5 [Methylokorus infernorum V4] >gi|189185034|gb|ACD82219.1| Putative translation factor SUA5 [Methylacidiphilum infernorum V4] (324 aa)
Score = 108, Expect = 1.7e-03, Identities = 41/110 (37%), Positives = 63/110 (57%)
  Q:    57 VSTDTVSGLLS--LNKPL---IYKIKKRDKNKKLIRFVSNLDQIP----EVNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNK 166
           + T+TV GL +  LN      I+++KKR K   +I   S+L ++     ++ +  + L   FWPG LTL+ KK+               +R+P     L LI K G PL + SAN  G    T     +E F++
  S:    29 IPTETVYGLAADGLNPEAVARIFELKKRPKIDPVIVHCSSLKEVGFYVCDLPDEARILGESFWPGPLTLVLKKKESIPDIVTAGLPFAGFRVPKHPLTLELIQKFGRPLAAPSANKFGKISPTTAQAVYEEFDQ 162
>gi|126653458|ref|ZP_01725554.1| hypothetical protein BB14905_19345 [Bacillus sp. B14905] >gi|126589814|gb|EAZ83947.1| hypothetical protein BB14905_19345 [Bacillus sp. B14905] (344 aa)
Score = 108, Expect = 1.7e-03, Identities = 50/152 (32%), Positives = 74/152 (48%)
  Q:    59 TDTVSGL--LSLNKPLIYKI---KKRDKNKKLIRFVSNLDQ----IPEVNETFKKLASKFWPGKLTLIYKKE---------------SYRMPDDKFILNLIDK-TGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDI--DTNTLKREGEIKYEWIKKTI 210
           T+TV GL  ++ N   + KI   K R  +  LI  V   ++    I  ++E  K+    FWPG LTL+   +                 RMPD    L L+ +   PL + SAN SG P  T  I   +    Y   I  ++G        ST+ D+  +   + R G I  E ++  I
  S:    35 TETVYGLGAVATNDVAVKKIFEAKGRPSDNPLIVHVGTKEEVTNYIEHISEIAKQCMDLFWPGPLTLVMPAKPNVLAQSVTAGLSTVGIRMPDHPVALALLQQLQKPLAAPSANRSGKPSPTEAIHVLDDLGGYIPYI--LDGGSTGIGLESTVLDVTHEPPVILRPGGITKEMLEAKI 211
>gi|56480306|ref|NP_709070.2| putative ribosome maturation factor [Shigella flexneri 2a str. 301] >gi|56383857|gb|AAN44777.2| orf, conserved hypothetical protein [Shigella flexneri 2a str. 301] (190 aa)
Score = 107, Expect = 1.8e-03, Identities = 38/127 (29%), Positives = 65/127 (51%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQI-PEVNETF-----KKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKREG 199
           + ++K+R  +K LI   +N +Q+ P +++T      ++     WPG +T ++   +               R+ D   ++ L    G PL S+SANLSG PP   + +    F    +    + G+      PS I D  T  L R+G
  S:    46 LLELKQRPVDKGLILIAANYEQLKPYIDDTMLTDVQRETIFSCWPGPVTFVFPAPATTPRWLTGRFDSLAVRVTDHPLVVALCQAYGKPLVSTSANLSGLPPCRTVDEVRAQFG---AAFPVVPGETRGRLNPSEIRDALTGELFRQG 190
>gi|91212709|ref|YP_542695.1| putative ribosome maturation factor [Escherichia coli UTI89] >gi|110643521|ref|YP_671251.1| putative ribosome maturation factor [Escherichia coli 536] >gi|117625565|ref|YP_858888.1| putative ribosome maturation factor [Escherichia coli APEC O1] >gi|157154846|ref|YP_001464750.1| putative ribosome maturation factor [Escherichia coli E24377A] >gi|187733572|ref|YP_001881966.1| Sua5/YciO/YrdC/YwlC family protein [Shigella boydii CDC 3083-94] >gi|188494830|ref|ZP_03002100.1| Sua5/YciO/YrdC/YwlC family protein [Escherichia coli 53638] >gi|91074283|gb|ABE09164.1| protein YrdC [Escherichia coli UTI89] >gi|110345113|gb|ABG71350.1| Sua5/YciO/YrdC family protein [Escherichia coli 536] >gi|115514689|gb|ABJ02764.1| putative ribosome maturation factor [Escherichia coli APEC O1] >gi|157076876|gb|ABV16584.1| Sua5/YciO/YrdC/YwlC family protein [Escherichia coli E24377A] >gi|187430564|gb|ACD09838.1| Sua5/YciO/YrdC/YwlC family protein [Shigella boydii CDC 3083-94] >gi|188490029|gb|EDU65132.1| Sua5/YciO/YrdC/YwlC family protein [Escherichia coli 53638] (205 aa)
Score = 107, Expect = 2.0e-03, Identities = 39/127 (30%), Positives = 65/127 (51%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQI-PEVNETFKKLASK-----FWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKREG 199
           + ++K+R  +K LI   +N +Q+ P +++T    A +      WPG +T ++   +               R+ D   ++ L    G PL S+SANLSG PP   + +    F    +    + G+      PS I D  T  L R+G
  S:    61 LLELKQRPVDKGLILIAANYEQLKPYIDDTMLTDAQRETIFSRWPGPVTFVFPAPATTPRWLTGRFDSLAVRVTDHPLVVALCQAYGKPLVSTSANLSGLPPCRTVDEVRAQFG---AAFPVVPGETGGRLNPSEIRDALTGELFRQG 205
>gi|74313802|ref|YP_312221.1| putative ribosome maturation factor [Shigella sonnei Ss046] >gi|170683354|ref|YP_001745545.1| Sua5/YciO/YrdC/YwlC family protein [Escherichia coli SMS-3-5] >gi|191169298|ref|ZP_03031047.1| Sua5/YciO/YrdC/YwlC family protein [Escherichia coli B7A] >gi|191174443|ref|ZP_03035944.1| Sua5/YciO/YrdC/YwlC family protein [Escherichia coli F11] >gi|193066486|ref|ZP_03047530.1| Sua5/YciO/YrdC/YwlC family protein [Escherichia coli E22] >gi|193071546|ref|ZP_03052455.1| Sua5/YciO/YrdC/YwlC family protein [Escherichia coli E110019] >gi|73857279|gb|AAZ89986.1| conserved hypothetical protein [Shigella sonnei Ss046] >gi|170521072|gb|ACB19250.1| Sua5/YciO/YrdC/YwlC family protein [Escherichia coli SMS-3-5] >gi|190900653|gb|EDV60453.1| Sua5/YciO/YrdC/YwlC family protein [Escherichia coli B7A] >gi|190905251|gb|EDV64889.1| Sua5/YciO/YrdC/YwlC family protein [Escherichia coli F11] >gi|192925867|gb|EDV80517.1| Sua5/YciO/YrdC/YwlC family protein [Escherichia coli E22] >gi|192955134|gb|EDV85628.1| Sua5/YciO/YrdC/YwlC family protein [Escherichia coli E110019] (190 aa)
Score = 107, Expect = 2.0e-03, Identities = 39/127 (30%), Positives = 65/127 (51%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQI-PEVNETFKKLASK-----FWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKREG 199
           + ++K+R  +K LI   +N +Q+ P +++T    A +      WPG +T ++   +               R+ D   ++ L    G PL S+SANLSG PP   + +    F    +    + G+      PS I D  T  L R+G
  S:    46 LLELKQRPVDKGLILIAANYEQLKPYIDDTMLTDAQRETIFSRWPGPVTFVFPAPATTPRWLTGRFDSLAVRVTDHPLVVALCQAYGKPLVSTSANLSGLPPCRTVDEVRAQFG---AAFPVVPGETGGRLNPSEIRDALTGELFRQG 190
>gi|134102725|ref|YP_001108386.1| SUA5/YciO/YrdC/YwlC [Saccharopolyspora erythraea NRRL 2338] >gi|133915348|emb|CAM05461.1| SUA5/YciO/YrdC/YwlC [Saccharopolyspora erythraea NRRL 2338] (216 aa)
Score = 107, Expect = 2.0e-03, Identities = 32/104 (30%), Positives = 54/104 (51%)
  Q:    98 VNETFKKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLK--REGEI 201
           V +  + L   FWPG L+++  +               + RMP     L+L+ + GP+  SSAN +G+PP +   +A E      S  ++++G        STI D+     +  REG +
  S:    82 VPQQARALIEAFWPGGLSIVLPQAPSLSWDLGNTRGTVNLRMPLHPVALDLLREVGPMAVSSANRTGHPPASTATEAREQLGDSVS--VYLDGGPSGEPVASTIVDLTQAQPRVLREGAV 199
>gi|83319443|ref|YP_424138.1| hypothetical protein MCAP_0147 [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|83283329|gb|ABC01261.1| conserved hypothetical protein [Mycoplasma capricolum subsp. capricolum ATCC 27343] (166 aa)
Score = 107, Expect = 2.0e-03, Identities = 54/149 (36%), Positives = 83/149 (55%)
  Q:    40 SNLNGIVFEIKNLKAAIVSTDTVSGLLSL----NKPLIYKIKKRDKNKKLIRFVSNLDQIPEVN---ETFKKLASKFWPGKLTLIYKKES----YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIY 188
           + +N  +  +KN +  I+ TDT+ GL ++    N+  I ++KK D NK LI  +S+LDQ+ +++    T K       P   T+I+K  S     R+     I  +I+ TGP+ S+S N+ G  P+TN  D   +FNK     I +  D   NN PS IY
  S:     5 TKINKAIELLKNNQIVILPTDTIYGLSAIYSLENQIKINQVKKADINKPLIVLISSLDQLDKLDILDLTDKDFLLNTDP--TTVIFKTTSSSIAIRLVKRNDIKQIINNTGPIISTSVNIHGFDPLTNKKDLI-NFNKN----IEVFFDEELNNNPSKIY 157
>gi|37681401|ref|NP_936010.1| putative translation factor [Vibrio vulnificus YJ016] >gi|37200153|dbj|BAC95981.1| putative translation factor [Vibrio vulnificus YJ016] (237 aa)
Score = 107, Expect = 2.2e-03, Identities = 53/167 (31%), Positives = 87/167 (52%)
  Q:    33 VTYEKDSSNLNGIVFEIKNLKAAIVSTDTVSGL-------LSLNKPLIYKIKKRDKNKKLIRFVSNLDQI-PEVNET---FKKLASKF--WPGKLTLI-------------YKKE-SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKREG 199
           V  E+  SNL  +V  +K  +     T+ V GL       +++ + L   IK+R  +K LI   ++  Q+ P ++ T    ++L   F  WPG  T +             Y++  + R+ D   +  L  + G PL S+SANLSG      +    +      S I+F  G+  + ++PS I D  T  L R+G
  S:    47 VYREEVVSNLQQVVKALKQGQVVAYPTEGVFGLGCDPDNEVAIERLL--TIKQRPSDKGLILIAADFQQLQPYLDLTSLSAEQLQRVFATWPGPYTWVMPASARASALVTGYRQTVAVRVSDHPLVQKLCSEYGKPLTSTSANLSGQTECKTVEQVQDQLGSQISVILF--GEIGERHRPSEIRDARTEQLLRQG 237
>gi|157752680|ref|XP_001680052.1| Hypothetical protein CBG20783 [Caenorhabditis briggsae AF16] >gi|187023055|emb|CAP37734.1| Hypothetical protein CBG20783 [Caenorhabditis briggsae] (216 aa)
Score = 107, Expect = 2.3e-03, Identities = 46/139 (33%), Positives = 77/139 (55%)
  Q:    52 LKAAIVS--TDTVSGLLSLNKPL---IYKIKKRDKNKKLIRFVSNLDQIPEVNETF--KKLASKFWPGKLTLIYKK--------------ESYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDI 190
           L+  IV+  TDT+ G+ +L  P    +Y +K+R   K L  F+ +   +  V++     +LA+   PG +TL++++               + R+PD   +  +  K G PL  +SAN+SG+P     ID F+    Y  D+I   G      + STI D+
  S:    27 LRGGIVALPTDTLYGISTL-LPFSDRLYALKQRPFEKPLGIFLPSPTSMKLVSKQTISDELANCLLPGPVTLMFERLPTLPAEFNPGVANVACRVPDCPIVSMICRKLGQPLAQTSANVSGSPLNPTSIDHFKDLQPY-IDLILDNGQIVSTGEGSTIVDL 185
>gi|168478341|ref|ZP_02707364.1| putative ribosome maturation factor [Salmonella enterica subsp. enterica serovar Virchow str. SL491] (190 aa)
Score = 106, Expect = 2.4e-03, Identities = 38/124 (30%), Positives = 64/124 (51%)
  Q:    76 IKKRDKNKKLIRFVSNLDQI-PEVNETF-----KKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKREG 199
           +K+R  +K LI   ++ +Q+ P ++++      +K     WPG +T ++   +               R+ +   ++ L +  G PL S+SANLSG PP   + +    F     D   +EG       PS I D  T  L R+G
  S:    49 LKQRPVDKGLILIAASFEQLKPYIDDSILTAAQRKAVFDCWPGPVTFVFPAPATTPRWLTGRFDSLAVRVTNHPLVVALCNAYGKPLVSTSANLSGLPPCRTVEEVRAQFG---DDFPVVEGVTGGRLNPSEIRDALTGELFRQG 190
>gi|91791398|ref|YP_561049.1| SUA5/yciO/yrdC-like protein [Shewanella denitrificans OS217] >gi|91713400|gb|ABE53326.1| SUA5/yciO/yrdC-like protein [Shewanella denitrificans OS217] (188 aa)
Score = 106, Expect = 2.4e-03, Identities = 39/125 (31%), Positives = 60/125 (48%)
  Q:    76 IKKRDKNKKLIRFVSNLDQ------IPEVNETFKKLASKFWPGKLTLIYKKESY--------------RMPDDKFILNLIDK-TGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKREGE 200
           +K+R   K LI   S+ +Q      + ++ +     A   WPG  T +   +S+              R+     +  L D    PL S+SANL+G  P+         F   K D + + GD  Q  QPSTI D  +  + R G+
  S:    45 VKQRPWQKGLILVASSFEQLLPYVDVAQLTQAQLDFAHSKWPGPFTFVMPVKSHVSNKLRGEFDSIAVRVSAHPIVRELCDSLNKPLVSTSANLAGQDPVLTSRQILTDFAD-KIDALVL-GDLGQQAQPSTIIDARSGLVLRNGQ 188
>gi|58263054|ref|XP_568937.1| cell growth and/or maintenance-related protein [Cryptococcus neoformans var. neoformans JEC21] >gi|57223587|gb|AAW41630.1| cell growth and/or maintenance-related protein, putative [Cryptococcus neoformans var. neoformans JEC21] (488 aa)
Score = 106, Expect = 2.6e-03, Identities = 42/113 (37%), Positives = 58/113 (51%)
  Q:    53 KAAIVSTDTVSGLL--SLNK---PLIYKIKKRDKNKKLIRFVSNLDQIPEV-------NETFKKLASKFWPG-----------KLTLIYKKESYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFN 165
           K   V T+TV GL   SL+     +IYKIK R  +  LI  VS+LD +  +       +  +  L + FWPG             +   +  + RMP     L LI  +  PL + SAN SG P  T     +   N
  S:    75 KTVAVPTETVYGLAASSLDPEACKMIYKIKNRPSDNPLIIHVSSLDMLRRLLPPDYSFSSLYLALINAFWPGPLSLLFPSPSPPPSPAPQTNAIRMPSHPLALALIAHSNLPLSAPSANSSGRPSPTKAQHVWNDLN 211
>gi|110807131|ref|YP_690651.1| putative ribosome maturation factor [Shigella flexneri 5 str. 8401] >gi|110616679|gb|ABF05346.1| conserved hypothetical protein [Shigella flexneri 5 str. 8401] (205 aa)
Score = 106, Expect = 2.6e-03, Identities = 38/127 (29%), Positives = 65/127 (51%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQI-PEVNETF-----KKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKREG 199
           + ++K+R  +K LI   +N +Q+ P +++T      ++     WPG +T ++   +               R+ D   ++ L    G PL S+SANLSG PP   + +    F    +    + G+      PS I D  T  L R+G
  S:    61 LLELKQRPVDKGLILIAANYEQLKPYIDDTMLTDVQRETIFSCWPGPVTFVFPAPATTPRWLTGRFDSLAVRVTDHPLVVALCQAYGKPLVSTSANLSGLPPCRTVDEVRAQFG---AAFPVVPGETGGRLNPSEIRDALTGELFRQG 205
>gi|30064604|ref|NP_838775.1| putative ribosome maturation factor [Shigella flexneri 2a str. 2457T] >gi|30042863|gb|AAP18586.1| hypothetical protein S3538 [Shigella flexneri 2a str. 2457T] (190 aa)
Score = 106, Expect = 2.6e-03, Identities = 38/127 (29%), Positives = 65/127 (51%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQI-PEVNETF-----KKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKREG 199
           + ++K+R  +K LI   +N +Q+ P +++T      ++     WPG +T ++   +               R+ D   ++ L    G PL S+SANLSG PP   + +    F    +    + G+      PS I D  T  L R+G
  S:    46 LLELKQRPVDKGLILIAANYEQLKPYIDDTMLTDVQRETIFSCWPGPVTFVFPAPATTPRWLTGRFDSLAVRVTDHPLVVALCQAYGKPLVSTSANLSGLPPCRTVDEVRAQFG---AAFPVVPGETGGRLNPSEIRDALTGELFRQG 190
>gi|170590097|ref|XP_001899809.1| yrdC domain containing protein [Brugia malayi] >gi|158592728|gb|EDP31325.1| yrdC domain containing protein [Brugia malayi] (232 aa)
Score = 106, Expect = 2.7e-03, Identities = 48/154 (31%), Positives = 88/154 (57%)
  Q:    46 VFEIKNLKAAIVSTDTVSGLLSL--NKPLIYKIKKRDKNKKLIRFVSNLDQIPE-VNETF-KKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG--PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQ-----NNQPSTIYDID---TNTLKREG 199
           +FE   + A  + TDTV G+ +   N   +YK+K+R + K L  FVSN+ ++    ++T          PG +TLI+++ +               R+PD  F+ +L+ +    PL  +SAN+S +      I+ F+     + D+I  +G  +Q     N + ST+ ++    T ++ R+G
  S:    29 IFESGGIVA--LPTDTVYGVATALPNSDKLYKLKRRSRLKPLGLFVSNVREVQRWCHQTIDNNQLRTLLPGPVTLIFERSTSLPSIFNPEHGTVGIRIPDHDFVRSLMTRLDDVPLAQTSANISNDQSSPVCIEDFKDLWP-ELDLIIDDGIVFQRDGNVNREGSTVVNLSIPGTYSIIRDG 207
>gi|134107902|ref|XP_777333.1| hypothetical protein CNBB1350 [Cryptococcus neoformans var. neoformans B-3501A] >gi|50260023|gb|EAL22686.1| hypothetical protein CNBB1350 [Cryptococcus neoformans var. neoformans B-3501A] (488 aa)
Score = 106, Expect = 2.7e-03, Identities = 42/113 (37%), Positives = 58/113 (51%)
  Q:    53 KAAIVSTDTVSGLL--SLNK---PLIYKIKKRDKNKKLIRFVSNLDQIPEV-------NETFKKLASKFWPG-----------KLTLIYKKESYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFN 165
           K   V T+TV GL   SL+     +IYKIK R  +  LI  VS+LD +  +       +  +  L + FWPG             +   +  + RMP     L LI  +  PL + SAN SG P  T     +   N
  S:    75 KTVAVPTETVYGLAASSLDPEACKMIYKIKNRPSDNPLIIHVSSLDMLRRLLPPDYSFSSLYLALINAFWPGPLSLLFPSPSPPPSPAPQTNAIRMPSHPLALALIAHSNLPLSAPSANSSGRPSPTKAQHVWNDLN 211
>gi|160945366|ref|ZP_02092592.1| hypothetical protein FAEPRAM212_02888 [Faecalibacterium prausnitzii M21/2] >gi|158443097|gb|EDP20102.1| hypothetical protein FAEPRAM212_02888 [Faecalibacterium prausnitzii M21/2] (344 aa)
Score = 106, Expect = 2.7e-03, Identities = 44/140 (31%), Positives = 70/140 (50%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQIP----EVNETFKKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTGPLYSS-SANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDI--DTNTLKREGEIKYEWIKKTIEE 212
           I+  K R ++  LI  V+  + +P    EV E  + L + F PG LT+I  +                 RMP       +I ++G  +++ SANLSG P  TN  D F   +      + ++G        ST+  +  D  TL R G I  E +++ + E
  S:    54 IFVAKGRPQDNPLIVHVTGPEMLPGLVSEVPERAQLLMAAFCPGPLTIIMPRGPEVADECCAGLDTVGIRMPSHPVARAVIQQSGCAFAAPSANLSGKPSPTNAQDVFTDMDGRLP--LILDGGECDVGVESTVVSVVGDKPTLFRPGHITLEDLERALGE 212
>gi|182413416|ref|YP_001818482.1| Sua5/YciO/YrdC/YwlC family protein [Opitutus terrae PB90-1] >gi|177840630|gb|ACB74882.1| Sua5/YciO/YrdC/YwlC family protein [Opitutus terrae PB90-1] (331 aa)
Score = 106, Expect = 2.7e-03, Identities = 39/116 (33%), Positives = 61/116 (52%)
  Q:    35 YEKDSSNLNGIVFEIKNLKAAIVSTDTVSGLLS--LNKPL---IYKIKKRDKNKKLIRFV---SNLDQIPEVNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSG 150
           Y     NL  +   +++ +   V T+TV GL +  L+      I++ K R  N  LI  +   + LD + E N   ++LA  FWPG LT++  + S               RMP       L+ + G P+ + SAN  G
  S:    10 YRGTPRNLARLARMLRDGELVAVPTETVYGLAANALDARACRKIFRAKGRPANDPLIVHIHDRAQLDLLAETNSAAERLARAFWPGPLTMVLPRRSIVPAVVSSGLPSVAVRMPAHPLFRQLLRRAGMPVAAPSANPFG 148
>gi|168234459|ref|ZP_02659517.1| putative ribosome maturation factor [Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191] >gi|194469757|ref|ZP_03075741.1| Sua5/YciO/YrdC/YwlC family protein [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|194456121|gb|EDX44960.1| Sua5/YciO/YrdC/YwlC family protein [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] (190 aa)
Score = 106, Expect = 2.8e-03, Identities = 38/124 (30%), Positives = 63/124 (50%)
  Q:    76 IKKRDKNKKLIRFVSNLDQI-PEVNETF-----KKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKREG 199
           +K+R  +K LI   ++ +Q+ P ++++      +K     WPG +T ++   +               R+     ++ L +  G PL S+SANLSG PP   + +    F     D   +EG       PS I D  T  L R+G
  S:    49 LKQRPVDKGLILIAASFEQLKPYIDDSILTAAQRKAVFDCWPGPVTFVFPAPATTPRWLTGRFDSLAVRVTKHPLVVALCNAYGKPLVSTSANLSGLPPCRTVEEVRAQFG---DDFPVVEGATGGRLNPSEIRDALTGELFRQG 190
>gi|167629001|ref|YP_001679500.1| sua5/ycio/yrdc/ywlc family protein [Heliobacterium modesticaldum Ice1] >gi|167591741|gb|ABZ83489.1| sua5/ycio/yrdc/ywlc family protein [Heliobacterium modesticaldum Ice1] (422 aa)
Score = 106, Expect = 2.9e-03, Identities = 41/135 (30%), Positives = 63/135 (46%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQIPEVNETF----KKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDI--DTNTLKREGEIKYEWIK 207
           I+  K R  +  LI  +++ D +  +   F    ++LA +FWPG LTL+                  + RMP       LI + G P+ + SAN SG P  T     +E        I  ++G        ST+ D   D   + R G +  E I+
  S:    59 IFTAKGRPSDNPLIVHIADRDDVARLTVGFPALARRLAERFWPGPLTLVLPASPQIPAVVTAGLATVAVRMPSHPVARALIGEAGTPVAAPSANRSGRPSPTTAAHVWEDLGGRIDGI--VDGGDCDLGLESTVVDATGDVAVILRPGGVTREMIE 212
>gi|157162756|ref|YP_001460074.1| putative ribosome maturation factor [Escherichia coli HS] >gi|157068436|gb|ABV07691.1| Sua5/YciO/YrdC/YwlC family protein [Escherichia coli HS] (205 aa)
Score = 106, Expect = 3.0e-03, Identities = 38/127 (29%), Positives = 65/127 (51%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQI-PEVNETF-----KKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKREG 199
           + ++K+R  +K LI   +N +Q+ P +++T      ++     WPG +T ++   +               R+ D   ++ L    G PL S+SANLSG PP   + +    F    +    + G+      PS I D  T  L R+G
  S:    61 LLELKQRPVDKGLILIAANYEQLKPYIDDTMLTDVQRETIFSRWPGPVTFVFPAPATTPRWLTGRFDSLAVRVTDHPLVVALCQAYGKPLVSTSANLSGLPPCRTVDEVRAQFG---AAFPVVPGETGGRLNPSEIRDALTGELFRQG 205
>gi|606216|gb|AAA58079.1| ORF_f176 [Escherichia coli] (176 aa)
Score = 106, Expect = 3.0e-03, Identities = 38/127 (29%), Positives = 65/127 (51%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQI-PEVNETF-----KKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKREG 199
           + ++K+R  +K LI   +N +Q+ P +++T      ++     WPG +T ++   +               R+ D   ++ L    G PL S+SANLSG PP   + +    F    +    + G+      PS I D  T  L R+G
  S:    32 LLELKQRPVDKGLILIAANYEQLKPYIDDTMLTDVQRETIFSRWPGPVTFVFPAPATTPRWLTGRFDSLAVRVTDHPLVVALCQAYGKPLVSTSANLSGLPPCRTVDEVRAQFG---AAFPVVPGETGGRLNPSEIRDALTGELFRQG 176
>gi|15803810|ref|NP_289844.1| putative ribosome maturation factor [Escherichia coli O157:H7 EDL933] >gi|15833402|ref|NP_312175.1| putative ribosome maturation factor [Escherichia coli O157:H7 str. Sakai] >gi|168708897|ref|ZP_02741174.1| putative ribosome maturation factor [Escherichia coli O157:H7 str. EC4045] >gi|168721980|ref|ZP_02754257.1| putative ribosome maturation factor [Escherichia coli O157:H7 str. EC4206] >gi|168752269|ref|ZP_02777291.1| Sua5/YciO/YrdC/YwlC family protein [Escherichia coli O157:H7 str. EC4113] >gi|168758510|ref|ZP_02783517.1| Sua5/YciO/YrdC/YwlC family protein [Escherichia coli O157:H7 str. EC4401] >gi|168769144|ref|ZP_02794151.1| Sua5/YciO/YrdC/YwlC family protein [Escherichia coli O157:H7 str. EC4486] >gi|168777860|ref|ZP_02802867.1| Sua5/YciO/YrdC/YwlC family protein [Escherichia coli O157:H7 str. EC4196] >gi|168783849|ref|ZP_02808856.1| Sua5/YciO/YrdC/YwlC family protein [Escherichia coli O157:H7 str. EC4076] >gi|168786172|ref|ZP_02811179.1| Sua5/YciO/YrdC/YwlC family protein [Escherichia coli O157:H7 str. EC869] >gi|168796532|ref|ZP_02821539.1| putative ribosome maturation factor [Escherichia coli O157:H7 str. EC4042] >gi|168802908|ref|ZP_02827915.1| Sua5/YciO/YrdC/YwlC family protein [Escherichia coli O157:H7 str. EC508] >gi|195939830|ref|ZP_03085212.1| putative ribosome maturation factor [Escherichia coli O157:H7 str. EC4024] >gi|12517909|gb|AAG58404.1|AE005555_4 orf, hypothetical protein [Escherichia coli O157:H7 EDL933] >gi|13363621|dbj|BAB37571.1| hypothetical protein [Escherichia coli O157:H7 str. Sakai] >gi|187767015|gb|EDU30859.1| Sua5/YciO/YrdC/YwlC family protein [Escherichia coli O157:H7 str. EC4196] >gi|188013856|gb|EDU51978.1| Sua5/YciO/YrdC/YwlC family protein [Escherichia coli O157:H7 str. EC4113] >gi|188998860|gb|EDU67846.1| Sua5/YciO/YrdC/YwlC family protein [Escherichia coli O157:H7 str. EC4076] >gi|189354694|gb|EDU73113.1| Sua5/YciO/YrdC/YwlC family protein [Escherichia coli O157:H7 str. EC4401] >gi|189361748|gb|EDU80167.1| Sua5/YciO/YrdC/YwlC family protein [Escherichia coli O157:H7 str. EC4486] >gi|189374185|gb|EDU92601.1| Sua5/YciO/YrdC/YwlC family protein [Escherichia coli O157:H7 str. EC869] >gi|189375257|gb|EDU93673.1| Sua5/YciO/YrdC/YwlC family protein [Escherichia coli O157:H7 str. EC508] (190 aa)
Score = 106, Expect = 3.0e-03, Identities = 38/127 (29%), Positives = 65/127 (51%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQI-PEVNETF-----KKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKREG 199
           + ++K+R  +K LI   +N +Q+ P +++T      ++     WPG +T ++   +               R+ D   ++ L    G PL S+SANLSG PP   + +    F    +    + G+      PS I D  T  L R+G
  S:    46 LLELKQRPVDKGLILIAANYEQLKPYIDDTMLTDVQRETIFSRWPGPVTFVFPAPATTPRWLTGRFDSLAVRVTDHPLVVALCQAYGKPLVSTSANLSGLPPCRTVDEVRAQFG---AAFPVVPGETGGRLNPSEIRDALTGELFRQG 190
>gi|16131163|ref|NP_417741.1| predicted ribosome maturation factor [Escherichia coli str. K-12 substr. MG1655] >gi|89110728|ref|AP_004508.1| dsRNA-binding protein [Escherichia coli W3110] >gi|170018482|ref|YP_001723436.1| SUA5/yciO/yrdC domain-containing protein [Escherichia coli ATCC 8739] >gi|170082803|ref|YP_001732123.1| ribosome maturation factor [Escherichia coli str. K12 substr. DH10B] >gi|194440014|ref|ZP_03072072.1| Sua5/YciO/YrdC/YwlC family protein [Escherichia coli 101-1] >gi|2851671|sp|P45748|YRDC_ECOLI Uncharacterized protein yrdC >gi|2367210|gb|AAC76307.1| predicted ribosome maturation factor [Escherichia coli str. K-12 substr. MG1655] >gi|85676759|dbj|BAE78009.1| dsRNA-binding protein [Escherichia coli W3110] >gi|169753410|gb|ACA76109.1| SUA5/yciO/yrdC domain [Escherichia coli ATCC 8739] >gi|169890638|gb|ACB04345.1| predicted ribosome maturation factor [Escherichia coli str. K12 substr. DH10B] >gi|194421066|gb|EDX37095.1| Sua5/YciO/YrdC/YwlC family protein [Escherichia coli 101-1] (190 aa)
Score = 106, Expect = 3.0e-03, Identities = 38/127 (29%), Positives = 65/127 (51%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQI-PEVNETF-----KKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKREG 199
           + ++K+R  +K LI   +N +Q+ P +++T      ++     WPG +T ++   +               R+ D   ++ L    G PL S+SANLSG PP   + +    F    +    + G+      PS I D  T  L R+G
  S:    46 LLELKQRPVDKGLILIAANYEQLKPYIDDTMLTDVQRETIFSRWPGPVTFVFPAPATTPRWLTGRFDSLAVRVTDHPLVVALCQAYGKPLVSTSANLSGLPPCRTVDEVRAQFG---AAFPVVPGETGGRLNPSEIRDALTGELFRQG 190
>gi|16801746|ref|NP_472014.1| hypothetical protein lin2685 [Listeria innocua Clip11262] >gi|16415221|emb|CAC97911.1| lin2685 [Listeria innocua] (345 aa)
Score = 105, Expect = 3.1e-03, Identities = 54/162 (33%), Positives = 82/162 (50%)
  Q:    49 IKNLKAAIVSTDTVSGL--LSLNKPLIYKI---KKRDKNKKLIRFVSNLDQIPEVNETFK----KLASKFWPGKLTLI--YKKESY-------------RMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYD--IDTNTLKREGEIKYEWIKKTI 210
           ++N +     T+TV GL   + N+  I KI   K R  +  LI  ++  +Q+ +   ++     +L   FWPG LT+I   KK+S              RMP+    L LI     P+ + SAN SG P  T      E  +   + I  I+G        ST+ D  +D   + R G I  E I++ I
  S:    25 LQNGECVAFPTETVYGLGADATNQAAIQKIYAAKGRPSDNPLIVHIAKREQMDQFIASYPPKALQLMEAFWPGPLTVILPLKKDSLAANVSAGLSTVGVRMPEHPVSLELIATANIPIAAPSANRSGKPSPTTAEHVIEDLDGEIAGI--IDGGPTGVGLESTVIDCSLDVPIILRPGGITIEQIEQVI 211
>gi|171741085|ref|ZP_02916892.1| hypothetical protein BIFDEN_00151 [Bifidobacterium dentium ATCC 27678] >gi|171276699|gb|EDT44360.1| hypothetical protein BIFDEN_00151 [Bifidobacterium dentium ATCC 27678] (220 aa)
Score = 105, Expect = 3.1e-03, Identities = 43/158 (27%), Positives = 83/158 (52%)
  Q:    56 IVSTDTVSGLLSLNKPL-----IYKIKKRDKNKKLIRFVSNLDQIP----EVNETFKKLASKFWPGKLTLIYK-------------------KESYRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTN-----TLKREGEIKYEWIKKTIEEN 213
           ++ TDTV G+    + +     IY +K+R K K L   ++++D +     ++     +LA+ F PG  + I +                    +  R+P+    L ++   GPL ++SAN SG      + +A E+        ++++G     +  ST+   D +     ++ REG I+   I+K +  N
  S:    26 VIPTDTVYGVACDPRNVEAIRKIYMVKQRPKYKPLQVLLASIDGLDALRLDLPVPLNRLAAMFMPGAFSPIAEARDNCSLATIRRDPATGKTTQGVRIPNSAATLRILRAVGPLAATSANRSGEESAQTVDEAVEALGDAVG--LYLDGGATPGHVSSTVVAADPHGRDGISILREGVIREAVIRKALTLN 214
>gi|170017814|ref|YP_001728733.1| putative translation factor (SUA5) [Leuconostoc citreum KM20] >gi|169804671|gb|ACA83289.1| Putative translation factor (SUA5) [Leuconostoc citreum KM20] (336 aa)
Score = 105, Expect = 3.2e-03, Identities = 39/138 (28%), Positives = 68/138 (49%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQIP---EVNETFKKLASKFWPGKLTLI---------------YKKESYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDI--DTNTLKREGEIKYEWIKKTI 210
           ++  K R  +  LI  V++ +Q+     V+E  K L   FWPG LT+I                   ++R+PD++    +I + G P+   SAN SG P  T     +       + I  ++    Q    ST+ D+  D  T+ R G +  + ++  +
  S:    48 VFVAKGRPADNPLIMTVADAEQLTNFVSVSEAAKALIDAFWPGSLTIILPIKPGQVSMMVTGGLDTAAFRLPDNETTRAIIREAGVPIVGPSANTSGKPSPTTAQHVWHDMQGKIAAI--VDDGPTQVGVESTVVDMAADVPTILRPGAVTQQQLEDVL 204
>gi|82545645|ref|YP_409592.1| putative ribosome maturation factor [Shigella boydii Sb227] >gi|81247056|gb|ABB67764.1| conserved hypothetical protein [Shigella boydii Sb227] (190 aa)
Score = 105, Expect = 3.2e-03, Identities = 39/127 (30%), Positives = 65/127 (51%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQI-PEVNETFKKLASK-----FWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKREG 199
           + ++K+R  +K LI   +N +Q+ P +++T    A +      WPG +T ++   +               R+ D   ++ L    G PL S+SANLSG PP   + +    F    +    + G+      PS I D  T  L R+G
  S:    46 LLELKQRPVDKGLILIAANYEQLKPYIDDTMLTDAQRETIFSRWPGPVTFVFPAPATTPRWLTGRFDSLAVRVTDHPLVVALCQAYGKPLVSTSANLSGLPPCRTVDEVRAQFG---AAFPVVLGETGGRLNPSEIRDALTGELFRQG 190
>gi|27364487|ref|NP_760015.1| Sua5/YciO/YrdC family protein [Vibrio vulnificus CMCP6] >gi|27360606|gb|AAO09542.1|AE016800_147 Sua5/YciO/YrdC family protein [Vibrio vulnificus CMCP6] (186 aa)
Score = 105, Expect = 3.3e-03, Identities = 51/160 (31%), Positives = 84/160 (52%)
  Q:    40 SNLNGIVFEIKNLKAAIVSTDTVSGL-------LSLNKPLIYKIKKRDKNKKLIRFVSNLDQI-PEVNET---FKKLASKF--WPGKLTLI-------------YKKE-SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKREG 199
           SNL  +V  +K  +     T+ V GL       +++ + L   IK+R  +K LI   ++  Q+ P ++ T    ++L   F  WPG  T +             Y++  + R+ D   +  L  + G PL S+SANLSG      +    +      S I+F  G+  + ++PS I D  T  L R+G
  S:     3 SNLQQVVKALKQGQVVAYPTEGVFGLGCDPDNEVAIERLL--TIKQRPSDKGLILIAADFQQLQPYLDLTSLSAEQLQRVFATWPGPYTWVMPASARASALVTGYRQTVAVRVSDHPLVQKLCSEYGKPLTSTSANLSGQTECKTVEQVQDQLGSQISVILF--GEIGERHRPSEIRDARTEQLLRQG 186
>gi|163761038|ref|ZP_02168116.1| hypothetical protein HPDFL43_03344 [Hoeflea phototrophica DFL-43] >gi|162281819|gb|EDQ32112.1| hypothetical protein HPDFL43_03344 [Hoeflea phototrophica DFL-43] (323 aa)
Score = 105, Expect = 3.3e-03, Identities = 44/113 (38%), Positives = 64/113 (56%)
  Q:    38 DSSNLNGIVFEIKNLKAAIVSTDTVSGLLS-LNKP----LIYKIKKRDKNKKLIRFVSNLDQIPEVNETF----KKLASKFWPGKLTLI----------------YKKESYRMPDDKFILNLIDK-TGPLYSSSANLSG 150
           D + L   V  ++  +A  V T+TV GL +    P     IY+ K R +   LI  VS++D +   +  F    +KLA+ FWPG LTL+                 +  + R+P+  F   LI    GPL + SAN SG
  S:     9 DPNTLRAAVEALRRGEAVAVPTETVYGLAADATNPSAITAIYEAKGRPRFNPLISHVSDMD-MARAHVLFTPLAEKLAAAFWPGPLTLVLPLNPDGGIHELATAGLETAAVRIPEG-FARTLIKSFGGPLAAPSANRSG 145
>gi|153895270|ref|ZP_02015852.1| Sua5/YciO/YrdC/YwlC family protein [Halorubrum lacusprofundi ATCC 49239] >gi|151585650|gb|EDN49075.1| Sua5/YciO/YrdC/YwlC family protein [Halorubrum lacusprofundi ATCC 49239] (251 aa)
Score = 105, Expect = 3.4e-03, Identities = 44/173 (25%), Positives = 85/173 (49%)
  Q:    29 KKEFVTYEKDSSNLNGIVFEIKNLKAAIVSTDTVSGL--LSLNKPLI---YKIKKRDKNKKLIRFVSNLD---QIPEVNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKREGEI 201
           + E +   KD+  L      + +    +  T+TV GL   +L+   +   + +K R+++  L   V ++D   +  +  E     A  F PG +T++ ++                 R+PD     +L+ +TGPL ++SAN+SG   +T+  D  +   + +  +  +  D       ST+ D D  T+ R G +
  S:    47 RHERIPVTKDTDTLRRAAEAVADGDLVVYPTETVYGLGGDALDPTAVERVFDLKGRERSNPLSLGVPSVDAALRYTKPTEFAVAFARAFLPGPVTVVVERGDPVPDALTAGSDRVGVRVPDHPIARDLLRETGPLTATSANVSGRGSVTHPDDLDD---RIREGVAVVIDDGETPGTESTVVDPDARTIHRRGAM 238
>gi|145222897|ref|YP_001133575.1| Sua5/YciO/YrdC/YwlC family protein [Mycobacterium gilvum PYR-GCK] >gi|145215383|gb|ABP44787.1| translation factor SUA5 [Mycobacterium gilvum PYR-GCK] (221 aa)
Score = 105, Expect = 3.5e-03, Identities = 33/109 (30%), Positives = 53/109 (48%)
  Q:    98 VNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLK--REGEIKYEWI 206
           V  + K+L   FWPG L+L+  +                 RMP     + L+ + GP+  SSAN+SG+P       A E         ++++G   +    STI D+     +  R+G +  E I
  S:    83 VPNSAKELIRAFWPGALSLVVHQAPSLQWDLGDANGTVMLRMPLHPVAIELLREVGPMAVSSANISGSPAAVTAAQAREQLGDRVE--VYLDGGPAEQQAASTIVDLTGAHPRVLRQGPVTLEAI 205
>gi|118467540|ref|YP_889200.1| Sua5/YciO/YrdC/YwlC family protein [Mycobacterium smegmatis str. MC2 155] >gi|118168827|gb|ABK69723.1| Sua5/YciO/YrdC/YwlC family protein [Mycobacterium smegmatis str. MC2 155] (221 aa)
Score = 105, Expect = 3.6e-03, Identities = 31/109 (28%), Positives = 54/109 (49%)
  Q:   103 KKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLK--REGEIKYEWIKKTIE 211
           ++L   FWPG L+L+  +                 RMP     + L+ + GP+  SSAN+SG P      +A E         ++++G   +    STI D+  +  +  R G I  E + + ++
  S:    87 RELIRAFWPGALSLVVHQAPSLQWDLGDTRGSVMLRMPLHPVAIELLREVGPMAVSSANISGRPAAGTATEAREQLGDLVE--VYLDGGPAEQQAASTIVDLTGSDPRILRTGPISAEDVARVLD 209
>gi|71892003|ref|YP_277733.1| RNA-binding protein [Candidatus Blochmannia pennsylvanicus str. BPEN] >gi|71796109|gb|AAZ40860.1| putative RNA-binding protein with unique protein fold, with YrdC/RibB domain [Candidatus Blochmannia pennsylvanicus str. BPEN] (194 aa)
Score = 105, Expect = 3.6e-03, Identities = 53/160 (33%), Positives = 76/160 (47%)
  Q:    39 SSNLNGIVFEIKNLKAAIVSTDTVSGLL--SLNKPLI---YKIKKRDKNKKLIRFVSNLDQIPE------VNETFKKLASKFWPGKLTLIYKKESYRM------------------PDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKRE 198
           S N+  ++ ++   K  I  T++V GL     NK  I    KIK R   K LI   +N  Q+ +      +NET +      WPG +T ++  ++ R                   P  +  L       PL S+SANLSG  P   I +  +    YK  I  +  D      PS I D+ T  L RE
  S:    12 SPNMKDLLIQLSQGKVIIYPTESVFGLGCDPDNKNAISTLLKIKNRSWKKGLILVAANYTQLLKYIDDSCLNETQRSRVFSTWPGPMTWVFPAQANRSYWLTGQFSSVAVRVSHFEPIQRLCLAF---GKPLVSTSANLSGQLPARTIEEVHDQLG-YK--IPIMHEDILGRPNPSKIRDVMTGKLIRE 194
>gi|15608441|ref|NP_215817.1| hypothetical protein Rv1301 [Mycobacterium tuberculosis H37Rv] >gi|15840751|ref|NP_335788.1| hypothetical protein MT1340 [Mycobacterium tuberculosis CDC1551] >gi|148661089|ref|YP_001282612.1| hypothetical protein MRA_1309 [Mycobacterium tuberculosis H37Ra] >gi|148822519|ref|YP_001287273.1| hypothetical protein TBFG_11328 [Mycobacterium tuberculosis F11] >gi|167969628|ref|ZP_02551905.1| hypothetical protein MtubH3_17041 [Mycobacterium tuberculosis H37Ra] >gi|194543611|ref|YP_002078640.1| conserved hypothetical protein [Mycobacterium tuberculosis C] >gi|1722959|sp|Q10618|Y1301_MYCTU Uncharacterized protein Rv1301/MT1340 >gi|1322425|emb|CAA97734.1| CONSERVED HYPOTHETICAL PROTEIN [Mycobacterium tuberculosis H37Rv] >gi|13880943|gb|AAK45602.1| Sua5/YciO/YrdC/YwlC family protein [Mycobacterium tuberculosis CDC1551] >gi|124600618|gb|EAY59628.1| conserved hypothetical protein [Mycobacterium tuberculosis C] >gi|134149712|gb|EBA41757.1| conserved hypothetical protein [Mycobacterium tuberculosis str. Haarlem] >gi|148505241|gb|ABQ73050.1| conserved hypothetical protein [Mycobacterium tuberculosis H37Ra] >gi|148721046|gb|ABR05671.1| conserved hypothetical protein [Mycobacterium tuberculosis F11] (217 aa)
Score = 105, Expect = 3.7e-03, Identities = 32/108 (29%), Positives = 59/108 (54%)
  Q:   103 KKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDI-IFIEGDYYQNNQPSTIYDIDTNTLK--REGEIKYEWIKKTI 210
           ++L   FWPG L+L+  +                 RMP     + L+ + GP+  SSAN+SG+PP    +DA ++ ++    + ++++    +    STI D+   T +  R G +  E I + +
  S:    87 RELIRAFWPGALSLVVVQAPSLQWDLGDAHGTVMLRMPLHPVAIELLREVGPMAVSSANISGHPP---PVDAEQARSQLGDHVAVYLDAGPSEQQAGSTIVDLTGATPRVLRPGPVSTERIAEVL 208
>gi|157964998|ref|YP_001499822.1| Sua5/YciO/YrdC/YwlC family translation factor protein [Rickettsia massiliae MTU5] >gi|157844774|gb|ABV85275.1| Sua5/YciO/YrdC/YwlC family putative translation factor protein [Rickettsia massiliae MTU5] (312 aa)
Score = 105, Expect = 3.9e-03, Identities = 58/163 (35%), Positives = 90/163 (55%)
  Q:    42 LNGIVFEIKNLKAAIVSTDTVSGL---LSLNKPL--IYKIKKRDKNKKLIRFVSNLDQ---IPEVNETFKKLASKFWPGKLTLIYK-KE---------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQ--PSTIYDID--TNTLKREGEIKYE 204
           +N  V  IK+ K  +  T+TV G+    + N+    I++ K+R     LI  VS+++Q   I E+N+   K+A KFW G L+++   KE               + R+P     L LI ++G P+ + SAN +     TN     + F K   +I  +  + YQ+     STI D    T T+ REG I  E
  S:     2 INKAVQFIKSGKVVVFPTETVYGIGADATNNEACLKIFQFKERPAINPLIVHVSSIEQAKEIGELNDLATKIAEKFWSGPLSIVVPLKENANIAPSVTAGLNTIALRIPSYPVALELIRQSGIPIAAPSANPANYISPTNAEHVTKHF-KDNQEIFILAPEIYQSKYGLESTIIDTTTVTPTILREGFITAE 192
>gi|118580209|ref|YP_901459.1| Sua5/YciO/YrdC/YwlC family protein [Pelobacter propionicus DSM 2379] >gi|118502919|gb|ABK99401.1| translation factor SUA5 [Pelobacter propionicus DSM 2379] (202 aa)
Score = 105, Expect = 3.9e-03, Identities = 28/84 (33%), Positives = 48/84 (57%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQIPE---VNETFKKLASKFWPGKLTLIY--------------KKESYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITN 156
           IY++K+R+  K       NL ++     V+ T  K+  ++ PG  T +               K    R+PD++  L ++   G P+ ++SANLSG+ P  N
  S:    51 IYRMKQREHKKPFSFICPNLSEVARFARVSNTAFKILKRYLPGPYTFVLEATRDVPDLLLTRQKTVGIRIPDNRICLEIVQMLGSPIVTTSANLSGDEPTGN 152
>gi|194684591|emb|CAR46453.1| putative RNA-binding protein [Proteus mirabilis HI4320] (189 aa)
Score = 104, Expect = 4.4e-03, Identities = 42/127 (33%), Positives = 67/127 (52%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQI-PEVNE---TFKKLASKF--WPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKREG 199
           + ++K+R   K LI    N +Q+ P +++   T ++    F  WPG +T +   +S               R+ D   +  L    G PL S+SANLSG PP  ++ +  E F   ++ I  + G+      PS I D  T  L R+G
  S:    45 LLELKQRAIEKGLILIADNYEQLKPYIDDNALTQEQRERMFASWPGPITWVIPAKSTTPKWLTGRFSSLAVRVTDHPIVKALCVAYGKPLVSTSANLSGLPPCRSVEEVQEQF---RNRIAIVNGEVGGRKNPSEIRDALTGELYRQG 189
>gi|116333897|ref|YP_795424.1| putative translation factor (SUA5) [Lactobacillus brevis ATCC 367] >gi|116099244|gb|ABJ64393.1| translation factor SUA5 [Lactobacillus brevis ATCC 367] (338 aa)
Score = 104, Expect = 4.4e-03, Identities = 42/138 (30%), Positives = 67/138 (48%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQIPE----VNETFKKLASKFWPGKLTLIYKKE---------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTN--TLKREGEIKYEWIKKTI 210
           +Y  K R  +  LI  V+  + +      +++  + L   FWPG LTLI+  +               ++R PD+   L LI   G PL   SAN SG P  T     +   N   + I  ++    +    ST+ D+ T+  T+ R G +  E +   I
  S:    47 VYLAKGRPSDNPLIVHVTGEETVKAFAQPLSDKAEALIKAFWPGPLTLIFALQPGKLSSAVTGGLNTAAFRNPDNAATLALIKAAGVPLVGPSANTSGKPSPTLAKHVYHDLNGKIAGI--LDDGPTKVGVESTVLDMSTDIPTILRPGGVTEEQLAAVI 204
>gi|156932272|ref|YP_001436188.1| putative ribosome maturation factor [Enterobacter sakazakii ATCC BAA-894] >gi|156530526|gb|ABU75352.1| hypothetical protein ESA_00043 [Enterobacter sakazakii ATCC BAA-894] (190 aa)
Score = 104, Expect = 4.8e-03, Identities = 40/127 (31%), Positives = 67/127 (52%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQI-PEVNE---TFKKLASKF--WPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKREG 199
           + ++K+R   K LI   +N DQ+ P +++   T ++  + F  WPG +T ++  +              + R+ +   ++ L +  G PL S+SANLSG  P      A E   ++  D   + G       PS I D  T  L R+G
  S:    46 LLELKQRPMEKGLILIAANFDQLKPYIDDAALTAEQREAVFARWPGPVTFVFPAKPSTPRWLTGRFDSLAVRVTNHPQVIALCEAFGKPLVSTSANLSGLEPCRT---AQEVLAQFGDDFPVLHGATGGRQNPSEIRDALTGELFRQG 190
>gi|169628535|ref|YP_001702184.1| hypothetical protein MAB_1444 [Mycobacterium abscessus] >gi|169240502|emb|CAM61530.1| Conserved hypothetical protein (Sua5/YciO/YRDC/ YwlC family protein?) [Mycobacterium abscessus] (226 aa)
Score = 104, Expect = 5.0e-03, Identities = 33/108 (30%), Positives = 53/108 (49%)
  Q:   103 KKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDID--TNTLKREGEIKYEWIKKTI 210
           ++L   FWPG L++I +                  RMP     + L+   GP+  SSAN+SG P      +A    +   +  ++++G   +    STI D+      + REG I  E I + I
  S:    87 RELIEAFWPGPLSIIVRHAPSLSWDLGDAQGSVMLRMPMHPVAIELLRAVGPMAVSSANVSGRPAALTAAEARGQLDDKVA--VYLDGGQAELGAASTIVDLTGPAPVIVREGPISREQIVEVI 208
>gi|150015296|ref|YP_001307550.1| Sua5/YciO/YrdC/YwlC family protein [Clostridium beijerinckii NCIMB 8052] >gi|149901761|gb|ABR32594.1| Sua5/YciO/YrdC/YwlC family protein [Clostridium beijerinckii NCIMB 8052] (343 aa)
Score = 104, Expect = 5.1e-03, Identities = 46/117 (39%), Positives = 70/117 (59%)
  Q:    49 IKNLKAAIVSTDTVSGL--LSLNKPL---IYKIKKRDKNKKLIRFVSN--LD----QIPEVNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLID-KTGPLYSSSANLSGNPPITNIIDAFESFN 165
           IKN    +  T+TV GL   +LN+     I+K K R ++  LI  VS+  LD    +IP+V +   +L ++FWPG LT+I  K+                RMPD++    LI+     + + SAN+SG P  T+     E  +
  S:    19 IKNGGTVVFPTETVYGLGADALNEEAVEKIFKAKGRPQDNPLIIHVSSKKLDLYAKEIPKVAD---ELINRFWPGPLTIILSKKDIIPNVTSANLNSIGIRMPDNEVARKLIELSQTTIAAPSANISGRPSPTDFQRCIEDLD 158
>gi|91218516|ref|ZP_01255455.1| Sua5/YciO/YrdC/YwlC [Psychroflexus torquis ATCC 700755] >gi|91183347|gb|EAS69751.1| Sua5/YciO/YrdC/YwlC [Psychroflexus torquis ATCC 700755] (318 aa)
Score = 103, Expect = 5.5e-03, Identities = 48/138 (34%), Positives = 71/138 (51%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQIPEVNETF----KKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTN--TLKREGEIKYEWIKKTI 210
           I+++K+R     LI  + ++DQ+ +V   F    +KLA  FWPG LTLI  K+S               R+P+    L+L+ +   PL + SAN       T+       F       + +EG   +N   STI   + N   L R G I  E I+K I
  S:    44 IFQVKQRPLFNPLIVHIPSIDQLEKVAREFPIKAQKLAEAFWPGSLTLILPKKSNILEIVTGGKDTVGVRIPNHPVTLSLLKQLSFPLAAPSANPYNRISPTSSYHVEGYFGNALP--MVLEGGECKNGIESTIIGFENNEAILYRLGAISVEEIEKII 200
>gi|195953581|ref|YP_002121871.1| Sua5/YciO/YrdC/YwlC family protein [Hydrogenobaculum sp. Y04AAS1] >gi|195933193|gb|ACG57893.1| Sua5/YciO/YrdC/YwlC family protein [Hydrogenobaculum sp. Y04AAS1] (192 aa)
Score = 103, Expect = 5.6e-03, Identities = 52/154 (33%), Positives = 88/154 (57%)
  Q:    59 TDTVSGLLSLNKP----LIYKIKKRDKNKKLIRFVSNLDQIPEVNETFKKLASKFWPGKL---TLIYKKES----YRMPDDKFILNLIDK-TGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLK--REGEIKYEWIKKTIEE 212
           TDT+ G+L+L+      L+YKI++  K K  +R + ++  +      FK     F   KL   ++I K +     +R+P   FI  L+DK   P+ + S N  G PP  +I +A   F    S  ++I+  + ++  PSTI +I+ NT+K  REG +  + +K+ IE+
  S:    31 TDTIYGVLALDNEEALELLYKIRRPSK-KPFLRLLPDIAFLEMYG--FKPNDKVFELSKLEGVSIIIKAQDKSLGFRIPQKGFIKELLDKLQKPILAPSCNKEGEPPAKSIEEAISYFKDEIS--LYIDSGFIES-PPSTIVEIEQNTIKIVREG-MSIDKVKELIEK 191
>gi|153093897|gb|EDN74825.1| possible translation factor [Mannheimia haemolytica PHL213] (184 aa)
Score = 103, Expect = 5.7e-03, Identities = 48/160 (30%), Positives = 82/160 (51%)
  Q:    40 SNLNGIVFEIKNLKAAIVSTDTVSGL-------LSLNKPLIYKIKKRDKNKKLIRFVSNLDQI-PEVNETFKKLASKFW---------------------PGKLTLIYKKESYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKREG 199
           +N   IV ++K  +     T+ V GL        ++ K L+  +K+R + K LI   S+L  + P ++E   ++  + W                     P  LT  +   + R+ +   ++ L + +G  L S+SANLSG PP  N   A E  +++  D   +  D      PS I DI +  + R+G
  S:     2 NNFLEIVNQLKQEEVVAYPTEAVFGLGCNPQSEKAVRKLLV--LKQRPEEKGLILLASDLKYLLPYIDEA--RMTEQAWQRLSHIGEQAITWIVPVKNTVPSYLTGKFDSIAVRLCNVPAVVQLCEASGVALTSTSANLSGEPPCRN---AKEVIDQFGQDFPVLHADTLGRENPSEIRDIFSQQIFRQG 184
>gi|82778580|ref|YP_404929.1| putative ribosome maturation factor [Shigella dysenteriae Sd197] >gi|81242728|gb|ABB63438.1| conserved hypothetical protein [Shigella dysenteriae Sd197] (190 aa)
Score = 103, Expect = 5.7e-03, Identities = 39/127 (30%), Positives = 64/127 (50%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQI-PEVNETFKKLASK-----FWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKREG 199
           + ++K R  +K LI   +N +Q+ P +++T    A +      WPG +T ++   +               R+ D   ++ L    G PL S+SANLSG PP   + +    F    +    + G+      PS I D  T  L R+G
  S:    46 LLELKLRPVDKGLILIAANYEQLKPYIDDTMLTDAQRETIFSRWPGPVTFVFPAPATTPRWLTGRFDSLAVRVTDHPLVVALCQAYGKPLVSTSANLSGLPPCRTVDEVRAQFG---AAFPVVPGETGGRLNPSEIRDALTGELFRQG 190
>gi|195950221|ref|ZP_03091321.1| hypothetical protein BburW_07764 [Borrelia burgdorferi WI91-23] (330 aa)
Score = 103, Expect = 5.9e-03, Identities = 51/139 (36%), Positives = 76/139 (54%)
  Q:    72 LIYKIKKRDKNKKLIRFVSNLDQIPE----VNETFKKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDK-TGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQN-NQPSTIYDIDTN---TLKREGEIKYEWIKKTI 210
           +I  +KK+  N+ L+ +V  +++I E    V ++ K L  KF PG LT + KK               + R+P +K  LNLI K   PL  SSANLS  P  T+   A +  N     II  + +   N    STI + D+     + R G I  + I+K +
  S:    47 MINLVKKKSINEPLMLYVDTIEKIKELSSHVPKSAKILMEKFSPGPLTYVLKKSIKIPKFINNNLDTVAIRIPKNKTALNLIRKLKNPLVVSSANLSKRPSSTSFSMALKELNGLVGGIIMPKKNKDSNIGIESTIIEFDSKDNVIILRPGAITKKMIEKVL 208
>gi|87300985|ref|ZP_01083827.1| hypothetical protein WH5701_06035 [Synechococcus sp. WH 5701] >gi|87284856|gb|EAQ76808.1| hypothetical protein WH5701_06035 [Synechococcus sp. WH 5701] (213 aa)
Score = 103, Expect = 5.9e-03, Identities = 31/81 (38%), Positives = 48/81 (59%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQIPEVNE-----TFKKLASKFWPGKLTLIY------------------KKESYRMPDDKFILNLIDKTGPLYSSSANLSGNPP 153
           I+++K R  NK LI   S  + +    E      + +LA + WPG LTL+                    +   R+P  +    L+ +TGPL ++SAN SG+PP
  S:    52 IWELKSRPSNKPLILMGSEPETLFAALELSPRPQWLELAERCWPGALTLVLPARGAVVAALQPGVVAAEARLGLRIPACERARELLRRTGPLATTSANRSGDPP 155
>gi|157826525|ref|YP_001495589.1| putative translation factor protein [Rickettsia bellii OSU 85-389] >gi|157801829|gb|ABV78552.1| Putative translation factor protein [Rickettsia bellii OSU 85-389] (312 aa)
Score = 103, Expect = 6.0e-03, Identities = 45/139 (32%), Positives = 71/139 (51%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQIPEVNE---TFKKLASKFWPGKLTLI----------------YKKESYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQN-NQPSTIYDI--DTNTLKREGEIKYEWIKKTIE 211
           I++ K R     LI  VS+++Q  E+ E     +K+A KFW G L+++                 K  + R+P     L LI ++G P+ + SAN S     T +      F + +   I  + DY       STI D   D  T+ REG I  E ++  ++
  S:    38 IFQFKNRPAVNPLIVHVSSIEQAKEIGEFNYIAEKIAEKFWSGPLSIVVPLKENANVATAVTAGLKTIAIRIPSHPLALELIKQSGKPIAAPSANPSNYISPTRLDHVTRHFKENEEIFILTDKDYQSKYGLESTIVDTTADIPTILREGFITAEVLETVLD 199
>gi|149174845|ref|ZP_01853469.1| sua5 related protein [Planctomyces maris DSM 8797] >gi|148846182|gb|EDL60521.1| sua5 related protein [Planctomyces maris DSM 8797] (325 aa)
Score = 103, Expect = 6.2e-03, Identities = 51/155 (32%), Positives = 77/155 (49%)
  Q:    58 STDTVSGL--LSLNKPL---IYKIKKRDKNKKLIRFVSNLDQIPEVNETF----KKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDI--DTNTLKREGEIKYEWIKKTIEE 212
           +T+TV GL   +LN      I+ +K+R     LI  +++  Q+ E+   F    +KLAS FWPG LTL+  K+              + R+P       L++ T  P+ + SAN  G    T  +D  E         + ++G        ST+     D   L R G I  E I+  I E
  S:    25 ATETVYGLGANALNPEAVAQIFAVKQRPHFDPLIVHIASTGQLDELTTEFSSTAEKLASTFWPGPLTLVLPKKKVVPDLVTSGLDSVAIRIPAHPVARKLLEITQLPIAAPSANKFGRLSPTRAVDVAEQLGDEIK--LILDGGPCTVGVESTVIQCLGDQPVLLRPGGISLEEIQACIGE 203
>gi|11497366|ref|NP_051465.1| hypothetical protein BBU11 [Borrelia burgdorferi B31] >gi|11497448|ref|NP_051542.1| hypothetical protein BB_T06 [Borrelia burgdorferi B31] >gi|167932837|ref|ZP_02519924.1| hypothetical protein Bbur1_07441 [Borrelia burgdorferi 156a] >gi|6382387|gb|AAF07698.1|AE001582_6 conserved hypothetical protein [Borrelia burgdorferi B31] >gi|6435847|gb|AAF08548.1|AE001583_3 conserved hypothetical protein [Borrelia burgdorferi B31] >gi|34734011|gb|AAQ81893.1| conserved hypothetical protein [Borrelia burgdorferi] (330 aa)
Score = 103, Expect = 6.2e-03, Identities = 51/139 (36%), Positives = 76/139 (54%)
  Q:    72 LIYKIKKRDKNKKLIRFVSNLDQIPE----VNETFKKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDK-TGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQN-NQPSTIYDIDTN---TLKREGEIKYEWIKKTI 210
           +I  +KK+  N+ L+ +V  +++I E    V ++ K L  KF PG LT + KK               + R+P +K  LNLI K   PL  SSANLS  P  T+   A +  N     II  + +   N    STI + D+     + R G I  + I+K +
  S:    47 MINLVKKKSINEPLMLYVDTIEKIKELSSHVPKSAKILMEKFSPGPLTYVLKKSIKIPKFINNNLDTVAIRIPKNKTALNLIRKLKNPLVVSSANLSKRPSSTSFSMALKELNGLVGGIIMPKKNKDSNIGIESTIIEFDSKDNVIILRPGAITKKMIEKVL 208
>gi|21674532|ref|NP_662597.1| SUA5/YciO/YrdC family protein [Chlorobium tepidum TLS] >gi|21647726|gb|AAM72939.1| SUA5/yciO/yrdC family protein [Chlorobium tepidum TLS] (323 aa)
Score = 103, Expect = 6.2e-03, Identities = 42/140 (30%), Positives = 66/140 (47%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQI----PEVNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNT--LKREGEIKYEWIKKTIEE 212
           I+K K R  +  LI  V+  +QI     E+ ET K L  +F+PG LTL+ KK +               R P        +     P+ + SAN+SG P  T+    +       +    + G+       STI D   N   L R G +  E +++ + +
  S:    45 IFKAKGRPSDNPLIVHVATPEQIGEVAAEIGETAKILVERFFPGPLTLVLKKRAAVPEIVSAGLPTIGVRCPSHPIASEFLRHCKHPVAAPSANVSGRPSPTDWKTVYHDLGGKIA--CLLRGEPSTIGLESTIVDCSVNPPRLLRTGAVSIELLRELVPD 203
>gi|193215580|ref|YP_001996779.1| Sua5/YciO/YrdC/YwlC family protein [Chloroherpeton thalassium ATCC 35110] >gi|193089057|gb|ACF14332.1| Sua5/YciO/YrdC/YwlC family protein [Chloroherpeton thalassium ATCC 35110] (315 aa)
Score = 103, Expect = 6.3e-03, Identities = 31/83 (37%), Positives = 45/83 (54%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQ----IPEVNETFKKLASKFWPGKLTLIYKKESY--------------RMPDDKFILNLIDKTG-PLYSSSANLSGNPPIT 155
           I+++K R     LI  +SNL +    +  V  + +KL   F+PG LTL+  K  Y              RMP  +     +   G  + + SANLSG P  T
  S:    45 IFRVKGRPAQNPLIAHISNLTELILLVKRVTASAEKLIDAFFPGPLTLVLPKSKYVPYVVTSGLDTIGVRMPSHQVAQAFLKACGVSVAAPSANLSGRPSPT 146
>gi|82701740|ref|YP_411306.1| Sua5/YciO/YrdC/YwlC [Nitrosospira multiformis ATCC 25196] >gi|82409805|gb|ABB73914.1| translation factor SUA5 [Nitrosospira multiformis ATCC 25196] (364 aa)
Score = 103, Expect = 6.3e-03, Identities = 53/161 (32%), Positives = 87/161 (54%)
  Q:    53 KAAIVS--TDTVSGL-LSLNKP----LIYKIKKRDKNKKLIRFVSNLDQIP----EVNETFKKLASKFWPGKLTLIYKKESY--------------RMPDDKFILNLIDKTGP---LYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTI--YDIDTNTLKREGEIKYEWIKKTIEEN 213
           K  +V+  T+TV GL   ++ P     I++IKKR  +  LI   ++  ++     EV +   +LA  FWPG LTLI  +  +              R+PD    L L+ + GP   L + SAN  G+   T      E F   + D++ ++G   Q    STI  ++  T  + R G I+   + + ++ N
  S:    18 KGGVVAFPTETVYGLGAEVSSPSAVARIFEIKKRPLDHPLIVHFADASRLSHWAREVPQQAWRLAECFWPGPLTLILPRSRHVPEKVTGGQDTVGLRVPDHPVALALLRELGPDRALAAPSANRFGHVSPTTAAHVREEFGD-ELDMV-LDGGPCQVGLESTIVGFEGQTAVILRPGGIQLAALAEVLDGN 206
>gi|51891213|ref|YP_073904.1| putative translation factor [Symbiobacterium thermophilum IAM 14863] >gi|51854902|dbj|BAD39060.1| putative translation factor [Symbiobacterium thermophilum IAM 14863] (349 aa)
Score = 103, Expect = 6.4e-03, Identities = 32/83 (38%), Positives = 45/83 (54%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQ----IPEVNETFKKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPIT 155
           I+  K R  +  LI  +++  Q    +  V  T ++L  + WPG LTL+ +K                 RMPD    L LI   G P+ + SAN SG P  T
  S:    55 IFAAKGRPSDNPLIVHIADTAQLEGLVESVPPTAERLMERCWPGPLTLVMRKGPAVPPEVTAGLDTVGIRMPDHPVALALIRAAGVPIAAPSANASGRPSPT 156
>gi|66362214|ref|XP_628071.1| SUA5 like RNA binding domain containing protein [Cryptosporidium parvum Iowa II] >gi|46227629|gb|EAK88564.1| SUA5 like RNA binding domain containing protein [Cryptosporidium parvum Iowa II] (390 aa)
Score = 103, Expect = 6.4e-03, Identities = 48/127 (37%), Positives = 73/127 (57%)
  Q:    40 SNLNGIVFEIKNLKAAIVSTDTVSGL-------LSLNKPLIYKIKKRDKNKKLIRFVSNL----DQIPEVNE----TFKKLASKFWPGKLTLIYKKE-------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNK 166
           SNL+     I N +   + T+TV GL        S+ K  I+KIK R  N  LI  V +     D + E++E     +K L  KFWPG LT+I KK                R P+++  L+L+  +  P+ + SAN SG+   T  +   + F++
  S:     3 SNLSDYAKYILNGELVAIPTETVYGLGGNAYDRSSILK--IFKIKGRPINNPLICHVHSFKFAEDNVFELSERTRVIYKILTDKFWPGPLTVISKKRHNIVDEVSVSGKVGVRCPNNQLTLDLLKLSSVPIAAPSANRSGHISPTTPLHVSKEFDQ 156
>gi|160935044|ref|ZP_02082430.1| hypothetical protein CLOLEP_03920 [Clostridium leptum DSM 753] >gi|156866497|gb|EDO59869.1| hypothetical protein CLOLEP_03920 [Clostridium leptum DSM 753] (335 aa)
Score = 103, Expect = 6.7e-03, Identities = 37/99 (37%), Positives = 56/99 (56%)
  Q:    57 VSTDTVSGLL--SLNKPL---IYKIKKRDKNKKLIRFVSNLDQ----IPEVNETFKKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPIT 155
           + T+TV GL   +LN  +   I+  K R  +  LI  ++  ++    + E  E  +KLA+ +WPG LT++  K               + R+P       LI   G PL + S NLSG P  T
  S:    24 IPTETVYGLAGNALNGSVSRKIFAAKGRPSDNPLIVHIAAEEEARPLVKEFPEPARKLAAAYWPGPLTMVLPKSELVPMETSGGLSTVAVRLPAHPVANRLIRACGCPLAAPSGNLSGRPSPT 146
>gi|71010426|ref|XP_758389.1| hypothetical protein UM02242.1 [Ustilago maydis 521] >gi|46098131|gb|EAK83364.1| hypothetical protein UM02242.1 [Ustilago maydis 521] (516 aa)
Score = 102, Expect = 6.9e-03, Identities = 33/83 (39%), Positives = 48/83 (57%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQI----PE---VNETFKKLASKFWPGKLTLIYKKES-----------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPIT 155
           IY  KKR  +  LI  VS+L+ +    P+   +++ +  L   FWPG LTL++  ++                  RMP       LI  +G P+   SAN SG P  T
  S:    99 IYAAKKRPADNPLIVHVSDLEMLDTLLPQSYTMSQAYSDLIKAFWPGALTLLFPVDTQRPAVPTVVTCGHPSVAVRMPSHPIARALIAISGLPMAGPSANASGRPSPT 206
>gi|167388661|ref|XP_001738645.1| sua5, putative [Entamoeba dispar SAW760] >gi|165898009|gb|EDR25013.1| sua5, putative [Entamoeba dispar SAW760] (357 aa)
Score = 102, Expect = 7.1e-03, Identities = 30/83 (36%), Positives = 46/83 (55%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQI----PEVNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDK-TGPLYSSSANLSGNPPIT 155
           I+K+K R  +  LI  +S+++ +      V+E   KL  +FWPG LT+I+ +                 RMP        I +   P+ + SANLS  P  T
  S:    68 IFKVKGRPNDNPLICHISDIEMLNKLAAHVSEDAHKLIKRFWPGALTIIFPRNETVPNEVTAGLNTVGVRMPSHPIAYEFIKQCKTPIAAPSANLSTKPSPT 169
>gi|167378326|ref|XP_001734759.1| sua5, putative [Entamoeba dispar SAW760] >gi|165903590|gb|EDR29072.1| sua5, putative [Entamoeba dispar SAW760] (289 aa)
Score = 102, Expect = 7.1e-03, Identities = 30/83 (36%), Positives = 46/83 (55%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQI----PEVNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDK-TGPLYSSSANLSGNPPIT 155
           I+K+K R  +  LI  +S+++ +      V+E   KL  +FWPG LT+I+ +                 RMP        I +   P+ + SANLS  P  T
  S:    68 IFKVKGRPNDNPLICHISDIEMLNKLAAHVSEDAHKLIKRFWPGALTIIFPRNETVPNEVTAGLNTVGVRMPSHPIAYEFIKQCKTPIAAPSANLSTKPSPT 169
>gi|47096963|ref|ZP_00234539.1| Sua5/YciO/YrdC/YwlC family protein [Listeria monocytogenes str. 1/2a F6854] >gi|153175794|ref|ZP_01931098.1| hypothetical protein LMIG_01615 [Listeria monocytogenes FSL N3-165] >gi|153180630|ref|ZP_01933673.1| hypothetical protein LMMG_02051 [Listeria monocytogenes F6900] >gi|153184882|ref|ZP_01935530.1| hypothetical protein LMOG_01448 [Listeria monocytogenes J0161] >gi|153192197|ref|ZP_01939242.1| hypothetical protein LMPG_01328 [Listeria monocytogenes J2818] >gi|153197153|ref|ZP_01941423.1| hypothetical protein LMRG_01706 [Listeria monocytogenes 10403S] >gi|47014673|gb|EAL05630.1| Sua5/YciO/YrdC/YwlC family protein [Listeria monocytogenes str. 1/2a F6854] >gi|126942394|gb|EBA20133.1| hypothetical protein LMOG_01448 [Listeria monocytogenes J0161] >gi|127633204|gb|EBA22621.1| hypothetical protein LMRG_01706 [Listeria monocytogenes 10403S] >gi|127764525|gb|EBA25057.1| hypothetical protein LMPG_01328 [Listeria monocytogenes J2818] >gi|133729219|gb|EBA30917.1| hypothetical protein LMIG_01615 [Listeria monocytogenes FSL N3-165] >gi|133732023|gb|EBA33721.1| hypothetical protein LMMG_02051 [Listeria monocytogenes F6900] (345 aa)
Score = 102, Expect = 7.1e-03, Identities = 45/138 (32%), Positives = 70/138 (50%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQIPEVNETFK----KLASKFWPGKLTLI--YKKESY-------------RMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYD--IDTNTLKREGEIKYEWIKKTI 210
           IY+ K R  +  LI  ++  +Q+ +   ++     +L  KFWPG LT+I   KK+S              RMP+    L LI     P+ + SAN SG P  T      E  +   + I  I+G        ST+ D  ++   + R G +  E I++ I
  S:    54 IYEAKGRPSDNPLIVHIARREQMDQFVASYPAKAIQLMEKFWPGPLTVILPLKKDSLATNVSAGLSTVGVRMPEHPVSLALIGTANIPIAAPSANRSGKPSPTTASHVIEDLDGKIAGI--IDGGATGVGLESTVIDCSLEIPIILRPGGVTKEQIEQII 211
>gi|167575720|ref|ZP_02368594.1| hypothetical protein BvalV_02833 [Borrelia valaisiana VS116] (335 aa)
Score = 102, Expect = 7.7e-03, Identities = 51/140 (36%), Positives = 75/140 (53%)
  Q:    72 LIYKIKKRDKNKKLIRFVSNLDQIPEVNETFKK----LASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDII-FIEGDYYQNNQPSTI--YDIDTNTL-KREGEIKYEWIKKTIE 211
           +I+ +KKR  N  LI  V  + +I E++E   K    L  KF PG LT + KK               + R+P +K  LNLI  +  P+ + SAN+S  P  TN   A +  N     II   E   +     ST+  +D+  N L  R G I  + I+K ++
  S:    47 MIFLVKKRPINNPLIVHVDTVKKIKELSEYIPKSALMLIKKFSPGPLTYVLKKSIKISRFVSGNLNTVAIRIPANKIALNLIKASKVPIVAPSANISKRPSSTNFEMALKELNGLVGGIIKTTENKDFNIGIESTVIGFDLKDNVLILRPGAITKKMIEKELQ 209
>gi|150395706|ref|YP_001326173.1| Sua5/YciO/YrdC/YwlC family protein [Sinorhizobium medicae WSM419] >gi|150027221|gb|ABR59338.1| Sua5/YciO/YrdC/YwlC family protein [Sinorhizobium medicae WSM419] (324 aa)
Score = 102, Expect = 7.8e-03, Identities = 44/94 (46%), Positives = 58/94 (61%)
  Q:    57 VSTDTVSGL-----LSLNKPLIYKIKKRDKNKKLIRFVSNLDQIPEVNETF----KKLASKFWPGKLTLIY--KKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSG 150
           + T+TV GL      S     IY++K R +   LI  VS+L  + E + TF    ++LA  FWPG LTLI   + ES               RMPD  F   +I + G PL + SAN SG
  S:    30 IPTETVYGLAADATTSDAISRIYEMKGRPRFNPLICHVSDL-AMAEAHVTFDPLSRRLAEAFWPGPLTLILPQRHESTVHTLASAGLDTLGIRMPDG-FSRRVIARFGRPLAAPSANTSG 147
>gi|91206173|ref|YP_538528.1| putative translation factor protein [Rickettsia bellii RML369-C] >gi|91069717|gb|ABE05439.1| Putative translation factor protein [Rickettsia bellii RML369-C] (312 aa)
Score = 102, Expect = 7.9e-03, Identities = 45/139 (32%), Positives = 71/139 (51%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQIPEV---NETFKKLASKFWPGKLTLI----------------YKKESYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQN-NQPSTIYDI--DTNTLKREGEIKYEWIKKTIE 211
           I++ K R     LI  VS+++Q  E+   N   +K+A KFW G L+++                 K  + R+P     L LI ++G P+ + SAN S     T +      F + +   I  + DY       STI D   D  T+ REG I  E ++  ++
  S:    38 IFQFKNRPAVNPLIVHVSSIEQAKEIGDFNYIAEKIAEKFWSGPLSIVVPLKENANVATAVTAGLKTIAIRIPSHPLALELIKQSGKPIAAPSANPSNYISPTRLDHVTRHFKENEEIFILTDKDYQSKYGLESTIVDTTADIPTILREGFITAEVLETVLD 199
>gi|157829148|ref|YP_001495390.1| hypothetical protein A1G_07205 [Rickettsia rickettsii str. 'Sheila Smith'] >gi|157801629|gb|ABV76882.1| hypothetical protein A1G_07205 [Rickettsia rickettsii str. 'Sheila Smith'] (311 aa)
Score = 102, Expect = 8.2e-03, Identities = 58/163 (35%), Positives = 88/163 (53%)
  Q:    42 LNGIVFEIKNLKAAIVSTDTVSGL---LSLNKPL--IYKIKKRDKNKKLIRFVSNLDQIPEVNE---TFKKLASKFWPGKLTLIYK-KE---------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQ--PSTIYDID--TNTLKREGEIKYE 204
           +N  V  IK+ K  +  T+TV G+    + N+    I++ K+R     LI  VS+++Q  E+ E      K+A KFW G L+++   KE               + R+P     L LI ++G P+ + SAN S     TN     + F K   +I  +  + YQ+     STI D    T T+ REG I  E
  S:     2 INKAVQFIKSGKVVVFPTETVYGIGADATNNEACLKIFQFKERPAINPLIVHVSSIEQAKEIGEFDDLATKIAEKFWSGPLSIVVPLKENANIAPSVTAGLNTIALRIPSYPVALELIKQSGIPIAAPSANPSNYISPTNAEHVTKHF-KDNQEIFILAPEIYQSKYGLESTIIDTTTVTPTILREGFITAE 192
>gi|184200616|ref|YP_001854823.1| hypothetical protein KRH_09700 [Kocuria rhizophila DC2201] >gi|183580846|dbj|BAG29317.1| hypothetical protein [Kocuria rhizophila DC2201] (354 aa)
Score = 102, Expect = 8.3e-03, Identities = 21/56 (37%), Positives = 36/56 (64%)
  Q:    97 EVNETFKKLASKFWPGKLTLI--------------YKKESYRMPDDKFILNLIDKTGPLYSSSANLSGNP 152
           E+++  + LA  FWPG LT++              +   + R+PDD     ++++ GP+  SSAN +G P
  S:    81 EISDDARALARAFWPGALTIVCWARPSLGWDLGETHGTVALRVPDDAVTRAVLERVGPMAVSSANRTGMP 150
>gi|85858566|ref|YP_460768.1| sua5/yciO/yrdC/ywlC family protein [Syntrophus aciditrophicus SB] >gi|85721657|gb|ABC76600.1| sua5/yciO/yrdC/ywlC family protein [Syntrophus aciditrophicus SB] (217 aa)
Score = 102, Expect = 8.6e-03, Identities = 52/195 (26%), Positives = 81/195 (41%)
  Q:    17 KNLNNKEIKNYPKKEFVTYEKDSSNLNGI--VFEIKNLKAAIVSTDTVSGLLSLNKPLIYKIKKRDKNKKLIRFVSNLDQIPEVNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDI--DTNTLKREGEIKYEWIKKTIE 211
           +NL    +  YP + F     D+ N   I  +F IK  +               N P+   I  RD+   L+        IPE  +   +L   FWPG LTL+++                  R+       +L    G PL ++SAN SG    T   +   +       I  ++G   + N+ ST+ +I  D   + R G I    I+K +E
  S:    24 ENLRKGRVVAYPTETFYGLGADAGNERAIEKIFSIKGRQ--------------FNNPIPLIIGDRDELDSLV------TAIPEAAQ---RLIHVFWPGPLTLVFRASKNVSPRLTANTGLIGIRISSHPIARSLARSLGAPLTATSANFSGQKESTTAHEVARTLGSLIDGI--VDGGQTRGNKGSTVVNIAVDPPLILRVGVITEIEIRKALE 212
>gi|86147122|ref|ZP_01065438.1| Sua5/YciO/YrdC family protein [Vibrio sp. MED222] >gi|85835006|gb|EAQ53148.1| Sua5/YciO/YrdC family protein [Vibrio sp. MED222] (185 aa)
Score = 102, Expect = 8.7e-03, Identities = 37/124 (29%), Positives = 68/124 (54%)
  Q:    76 IKKRDKNKKLIRFVSNLDQI-PEVNE---TFKKLAS--KFWPGKLTLI--------------YKKESYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKREG 199
           +K+R   K LI   ++ +Q+ P ++E   T  +LA+    WPG +T I              ++  + R+ D   +  + ++ G PL S+SANL+G  P     +  +   ++   +  +EG      +PS I D  T+ + R+G
  S:    43 LKQRPMEKGLILIAASYEQLLPYIDESQLTEAQLATVKATWPGPVTWIMPTSSKVTDWVSGQFESIAVRVTDHPLVQRMCNEFGKPLTSTSANLTGESPCMTTEEVQQQLGQHL--VAILEGQTGGREKPSEIRDAKTSKILRQG 185
>gi|16804579|ref|NP_466064.1| hypothetical protein lmo2541 [Listeria monocytogenes EGD-e] >gi|167058613|ref|ZP_02280870.1| hypothetical protein LmonF_25545 [Listeria monocytogenes FSL F2-515] >gi|16412029|emb|CAD00619.1| lmo2541 [Listeria monocytogenes] (345 aa)
Score = 102, Expect = 8.8e-03, Identities = 45/138 (32%), Positives = 70/138 (50%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQIPEVNETFK----KLASKFWPGKLTLI--YKKESY-------------RMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYD--IDTNTLKREGEIKYEWIKKTI 210
           IY+ K R  +  LI  ++  +Q+ +   ++     +L  KFWPG LT+I   KK+S              RMP+    L LI     P+ + SAN SG P  T      E  +   + I  I+G        ST+ D  ++   + R G +  E I++ I
  S:    54 IYEAKGRPSDNPLIVHIARREQMDQFVASYPAKAIQLMEKFWPGPLTVILPLKKDSLATNVSAGLSTVGVRMPEHPVSLALIGTANIPIAAPSANRSGKPSPTTASHVIEDLDGKIAGI--IDGGATGVGLESTVIDCSLEIPIILRPGGVTKEQIEQII 211
>gi|119025466|ref|YP_909311.1| Sua5/YciO/YrdC family protein [Bifidobacterium adolescentis ATCC 15703] >gi|154486893|ref|ZP_02028300.1| hypothetical protein BIFADO_00726 [Bifidobacterium adolescentis L2-32] >gi|118765050|dbj|BAF39229.1| conserved protein in the Sua5/YciO/YrdC family [Bifidobacterium adolescentis ATCC 15703] >gi|154084756|gb|EDN83801.1| hypothetical protein BIFADO_00726 [Bifidobacterium adolescentis L2-32] (220 aa)
Score = 102, Expect = 8.8e-03, Identities = 42/158 (26%), Positives = 84/158 (53%)
  Q:    56 IVSTDTVSGLLSLNKPL-----IYKIKKRDKNKKLIRFVSNLDQIPEVNETF----KKLASKFWPGKLTLIYKKES-------------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTI-----YDIDTNTLKREGEIKYEWIKKTIEEN 213
           ++ TDTV G+    + +     ++  K+R K K L   + +++ + +++ T      +LA+ F PG  + I + E                     R+P+    L ++  TGPL ++SAN SG      + +A ++        ++++G     +  ST+     ++ D   + REG I+   I+K +  N
  S:    26 VIPTDTVYGVACDPRNIEAIRKVFAAKQRPKYKSLQVLLPSIESMEKLHLTLPVPLNRLAAMFMPGAFSPIAEAEDDCSLATLRHDPTTGKATQGVRIPNSAVALRILRATGPLAATSANRSGEESAQTVQEAADALGDAVD--LYLDGGATPGHVSSTVVAADPHERDGIAILREGVIRELVIRKALTLN 214
>gi|116494653|ref|YP_806387.1| putative translation factor (SUA5) [Lactobacillus casei ATCC 334] >gi|116104803|gb|ABJ69945.1| translation factor SUA5 [Lactobacillus casei ATCC 334] (333 aa)
Score = 101, Expect = 8.9e-03, Identities = 31/83 (37%), Positives = 42/83 (50%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLD---QIPEVNETFKKLASKFWPGKLTLI---------------YKKESYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPIT 155
           +Y  K R  +  LI  V++ D   Q   +     KL   FWPG LT+I                +  ++R PD+     LI   G P+   SAN SG P  T
  S:    46 VYAAKGRPSDNPLIVTVADADMVGQYATITPLAAKLMQAFWPGPLTIILNILPGRLSMKVTGGLQTAAFRNPDNALTRKLIATAGVPIVGPSANTSGKPSPT 147
>gi|15893238|ref|NP_360952.1| hypothetical protein RC1315 [Rickettsia conorii str. Malish 7] >gi|15620456|gb|AAL03853.1| unknown [Rickettsia conorii str. Malish 7] (312 aa)
Score = 101, Expect = 9.4e-03, Identities = 58/163 (35%), Positives = 88/163 (53%)
  Q:    42 LNGIVFEIKNLKAAIVSTDTVSGL---LSLNKPL--IYKIKKRDKNKKLIRFVSNLDQIPEVNE---TFKKLASKFWPGKLTLIYK-KE---------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQ--PSTIYDID--TNTLKREGEIKYE 204
           +N  V  IK+ K  +  T+TV G+    + N+    I++ K+R     LI  VS+++Q  E+ E      K+A KFW G L+++   KE               + R+P     L LI ++G P+ + SAN S     TN     + F K   +I  +  + YQ+     STI D    T T+ REG I  E
  S:     2 INKAVQFIKSGKVVVFPTETVYGIGADATNNEACLKIFQFKERPAINPLIVHVSSIEQAKEIGEFDDLATKIAEKFWSGPLSIVVPLKENANIAPSVTAGLNTIALRIPSYPVALELIRQSGIPIAAPSANPSNYISPTNAEHVTKHF-KDNQEIFILAPEIYQSKYGLESTIIDTTTVTPTILREGFITAE 192
>gi|183600716|ref|ZP_02962209.1| hypothetical protein PROSTU_04312 [Providencia stuartii ATCC 25827] >gi|188019696|gb|EDU57736.1| hypothetical protein PROSTU_04312 [Providencia stuartii ATCC 25827] (189 aa)
Score = 101, Expect = 9.5e-03, Identities = 43/133 (32%), Positives = 65/133 (48%)
  Q:    67 SLNKPLIYKIKKRDKNKKLIRFVSNLDQI------PEVNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKREG 199
           ++NK L  ++K+R   K LI    N +Q+       ++ +  K+     WPG +T +   +S               R+ D   +  L  + G PL S+SANLSG  P     +  E F   K  I  ++G       PS I D  T  L R+G
  S:    41 AVNKLL--ELKQRPWEKGLILIADNYEQLKDYVDDSQLTDEQKQTMFASWPGPVTWVIPAKSSTPKWLTGRFDTLAVRVTDHGLVKELCREYGKPLVSTSANLSGQEPCRTTNEVLEQF---KGSIPVLDGMVGGRQNPSEIRDAKTGQLYRKG 189
>gi|183602495|ref|ZP_02963860.1| conserved protein in the Sua5/YciO/YrdC family [Bifidobacterium animalis subsp. lactis HN019] >gi|183218136|gb|EDT88782.1| conserved protein in the Sua5/YciO/YrdC family [Bifidobacterium animalis subsp. lactis HN019] (222 aa)
Score = 101, Expect = 9.6e-03, Identities = 43/157 (27%), Positives = 81/157 (51%)
  Q:    56 IVSTDTVSGLL-----SLNKPLIYKIKKRDKNKKLIRFVSNLDQIPEVN----ETFKKLASKFWPGKLTLIY------------------KKESYRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTN-----TLKREGEIKYEWIKKTIEE 212
           ++ TDTV G+      +     IY  K R  +K L   + +L  +P++          LA +F PG  + I                   + +  R+PD +  L ++   GP+ +SSAN SGN     + +A  +     S  ++I+G    ++  ST+   D +      + REG ++ + +++ + E
  S:    26 VIPTDTVYGIACDPCNAAAIARIYAAKHRPADKALQVIMPDLSVLPKLGLALPTPLDALARRFLPGAFSPIAVADDDSPLLTVRVDDSGARTQGIRVPDSEVTLRVLRAIGPVAASSANRSGNESAQTVDEAVAALG--DSVDLYIDGGPTVSHTASTVVAADPDAPDGIVILREGRLEADAVRRAVRE 212
>gi|34581094|ref|ZP_00142574.1| hypothetical protein [Rickettsia sibirica 246] >gi|167472433|ref|ZP_02337137.1| hypothetical protein RafrE_07465 [Rickettsia africae ESF-5] >gi|28262479|gb|EAA25983.1| unknown [Rickettsia sibirica 246] (312 aa)
Score = 101, Expect = 9.7e-03, Identities = 58/163 (35%), Positives = 88/163 (53%)
  Q:    42 LNGIVFEIKNLKAAIVSTDTVSGL---LSLNKPL--IYKIKKRDKNKKLIRFVSNLDQIPEVNE---TFKKLASKFWPGKLTLIYK-KE---------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQ--PSTIYDID--TNTLKREGEIKYE 204
           +N  V  IK+ K  +  T+TV G+    + N+    I++ K+R     LI  VS+++Q  E+ E      K+A KFW G L+++   KE               + R+P     L LI ++G P+ + SAN S     TN     + F K   +I  +  + YQ+     STI D    T T+ REG I  E
  S:     2 INKAVQFIKSGKVVVFPTETVYGIGADATNNEACLKIFQFKERPAINPLIVHVSSIEQAKEIGEFDDLATKIAEKFWSGPLSIVVPLKENANIAPSVTAGLNTIALRIPSYPVALELIRQSGIPIAAPSANPSNYISPTNAEHVTKHF-KDNQEIFILAPEIYQSKYGLESTIIDTTTVTPTILREGFITAE 192
>gi|94499923|ref|ZP_01306459.1| Sua5/YciO/YrdC/YwlC family protein [Oceanobacter sp. RED65] >gi|94428124|gb|EAT13098.1| Sua5/YciO/YrdC/YwlC family protein [Oceanobacter sp. RED65] (182 aa)
Score = 101, Expect = 9.9e-03, Identities = 31/88 (35%), Positives = 47/88 (53%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQ----IPEVNETFKKLASKFWPGKLTLIYKKESYRMP--DDKFILNLIDKT-------------GPLYSSSANLSGNPPITNIIDA 160
           I  IKKRD++K LI    N+ Q    + E+NE  +      WPG  T +   ++   P    +F    I  +             GP+ S+SAN SG P + + + A
  S:    41 IVSIKKRDQHKGLILVAGNIGQFDFLLNEINEQQRAKLESLWPGPYTFLVPHKNRVQPLVHGRFSTVAIRVSPHPRVQALCKYFGGPIVSTSANYSGQPTVRSAVQA 147
>gi|39996696|ref|NP_952647.1| Sua5/YciO/YrdC/YwlC family protein [Geobacter sulfurreducens PCA] >gi|39983577|gb|AAR34970.1| Sua5/YciO/YrdC/YwlC family protein [Geobacter sulfurreducens PCA] (203 aa)
Score = 101, Expect = 9.9e-03, Identities = 29/94 (30%), Positives = 53/94 (56%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQIP---EVNETFKKLASKFWPGKLTLIYKKESY--------------RMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNK 166
           IY +K+R+K K      S L ++    +V+    K+  ++ PG  T +    S               R+PD++  + L+ + G P+ ++SANLSG  PI + ++   +  K
  S:    51 IYLLKQREKKKPFSFICSELSEVARYAKVSNYAYKILKRYLPGPYTFVIDATSVVPDLLVTKQKTVGIRIPDNRICIALVKELGHPIVTTSANLSGEEPIGDPLEVERTLGK 162
>gi|46107246|ref|XP_380682.1| hypothetical protein FG00506.1 [Gibberella zeae PH-1] (433 aa)
Score = 101, Expect = 1.0e-02, Identities = 33/83 (39%), Positives = 45/83 (54%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQIPE-----------VNETFKKLASKFWPGKLTLI----------------YKKESYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPIT 155
           IY  K R  +  LI  V +LD + +           + E ++ L  +FWPG LT++                 K    RMP     L+LI   G PL + SAN S  P  T
  S:    79 IYSAKGRPSDNPLISHVCDLDMLRQYIGHTDETQDPIPERYRALIERFWPGPLTILLPNPVPSKLAPEVTAGLKTFGVRMPSSPLALSLIKLAGVPLAAPSANASTKPSPT 189
>gi|50365446|ref|YP_053871.1| putative translation factor [Mesoplasma florum L1] >gi|50364002|gb|AAT75987.1| putative translation factor [Mesoplasma florum L1] (168 aa)
Score = 101, Expect = 1.0e-02, Identities = 47/142 (33%), Positives = 75/142 (52%)
  Q:    56 IVSTDTVSGLLSL----NKPLIYKIKKRDKNKKLIRFVSNLDQIPEVNETFKKLASKFWPGKLTLIYKKES------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPIT---NIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKR 197
           I+ TDT+ GL ++    N+  I  IK  ++ K LI  +SN++Q+  +     +     +    T+I+K +S       R+     I  +I+KTGP++S+S NL G  PI     +I+   S N Y   +I        N +PS IY+  TN   R
  S:    21 ILPTDTIYGLSAIWNFENEKRINNIKNANEEKPLIVLISNIEQLSILGIEKNEFVDLLFNESTTVIFKTKSNNKTIAVRLIIRDDIKKIIEKTGPIFSTSVNLHGEQPINEKDELINFDRSINVYFDKVI-------TNIKPSKIYNSITNIWVR 168
>gi|156972719|ref|YP_001443626.1| translation factor [Vibrio harveyi ATCC BAA-1116] >gi|156524313|gb|ABU69399.1| hypothetical protein VIBHAR_00384 [Vibrio harveyi ATCC BAA-1116] (185 aa)
Score = 101, Expect = 1.1e-02, Identities = 38/127 (29%), Positives = 66/127 (51%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQI-PEVNE---TFKKL--ASKFWPGKLTLI--------------YKKESYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKREG 199
           + ++K+R   K LI   ++ +Q+ P ++E   T ++L      WPG  T I              +   + R+ D   +  + +  G PL S+SANL+G PP     +  E        +  + G+    N+PS I D  T+ + R+G
  S:    40 LLELKQRPVEKGLILIAASYEQLLPYIDESQLTQEQLDQVHATWPGPYTWIMPASDKVSHWVSGQFDSIAVRVTDHPLVQKMCNAFGKPLTSTSANLTGQPPCMTTEEVEEQLGDRL--VAILRGETSGRNKPSEIRDAKTSQILRQG 185
>gi|92114981|ref|YP_574909.1| SUA5/yciO/yrdC-like protein [Chromohalobacter salexigens DSM 3043] >gi|91798071|gb|ABE60210.1| SUA5/yciO/yrdC-like protein [Chromohalobacter salexigens DSM 3043] (185 aa)
Score = 101, Expect = 1.1e-02, Identities = 37/122 (30%), Positives = 63/122 (51%)
  Q:    76 IKKRDKNKKLIRFVSNLDQIPE----VNETFKKLASKFWPGKLTLI--------------YKKESYRMPDDKFILNLIDK-TGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDT-NTLKR 197
           +K+RD  K LI    ++DQ+      ++   +   ++ WPG  T +              +   + R+ D   +  L     GPL SSSAN +G PP  +  D   +F +    +  ++G      +PSTI D+ +  TL+R
  S:    47 LKQRDPAKGLILIAGDMDQLEPWLAGLDALQRARLAESWPGPNTWLVPDNGRARPLLRGEHTSLAVRVSDHPLVRQLCAAFGGPLVSSSANRAGEPPAMSAADVRAAFGE---AVTLLDGALGGYARPSTIRDLQSGETLRR 185
>gi|157826326|ref|YP_001494046.1| hypothetical protein A1C_06575 [Rickettsia akari str. Hartford] >gi|157800284|gb|ABV75538.1| hypothetical protein A1C_06575 [Rickettsia akari str. Hartford] (312 aa)
Score = 101, Expect = 1.1e-02, Identities = 56/162 (34%), Positives = 89/162 (54%)
  Q:    49 IKNLKAAIVSTDTVSGL---LSLNKPL--IYKIKKRDKNKKLIRFVSNLDQ---IPEVNETFKKLASKFWPGKLTLIYK-KE---------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQ--PSTIYDIDTN--TLKREGEIKYEWIKKTI 210
           IK+ K  +  T+TV G+    + N+    I++ K R  +  LI  V +++Q   I E N+   K+A KFW G L+++   KE               + R+P     L LI ++G P+ + SAN S     TN     + F K   +I  +  + YQ+     STI D  T   T+ REG I  E +++ +
  S:     9 IKSGKVVVFPTETVYGIGADATNNEACLKIFQFKNRPASNPLIVHVFSIEQAKEIGEFNDLAIKIAEKFWSGPLSIVVPLKENANIAPSAAAGLNTIALRIPSYPVALELIRQSGVPIAAPSANPSNYISPTNAEHVTKHF-KDNQEIFILAPEIYQSEYGLESTIIDTTTATPTILREGFITVEILEEVL 198
>gi|94987331|ref|YP_595264.1| hypothetical protein LI0889 [Lawsonia intracellularis PHE/MN1-00] >gi|94731580|emb|CAJ54943.1| conserved hypothetical protein [Lawsonia intracellularis PHE/MN1-00] (210 aa)
Score = 101, Expect = 1.1e-02, Identities = 43/140 (30%), Positives = 69/140 (49%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQI---PEVNETFKKLASKFWPGKLTLIY--------------KKESYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTN---TLKREGEIKYEWIKKTIEE 212
           I+  K+R  N  L   + N +Q+    EV +    L   FWPG L+++               +K + R+        + D  G P+ ++SAN++ NPP+T I         Y   II I         PST+ ++  N   ++ REG IK   +K+   E
  S:    44 IFIAKQRAINMPLPLIIGNWEQLTITAEVPQIIYPLLQHFWPGALSIVLNAKKNISPYITASTQKVAVRLSSHPIAKEIADLVGEPIIATSANINKNPPVTKITQLDIRLYPYIEGIIDIP-PIPTGGLPSTLIELHPNNTISILREGIIKSNKVKEKAAE 203
>gi|15964621|ref|NP_384974.1| hypothetical protein SMc00984 [Sinorhizobium meliloti 1021] >gi|15073799|emb|CAC45440.1| Conserved hypothetical protein [Sinorhizobium meliloti 1021] (324 aa)
Score = 101, Expect = 1.1e-02, Identities = 43/94 (45%), Positives = 59/94 (62%)
  Q:    57 VSTDTVSGLLS-LNKP----LIYKIKKRDKNKKLIRFVSNLDQIPEVNETF----KKLASKFWPGKLTLIY--KKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSG 150
           + T+TV GL +    P     IY++K R +   LI  V +L  + E + TF    ++LA  FWPG LTLI   ++ES               RMPD  F   +I + G PL + SAN SG
  S:    30 IPTETVYGLAADATTPDAISRIYEMKGRPRFNPLICHVCDL-AMAEAHVTFDPVSRRLAEAFWPGPLTLILPQRRESTVHTLASAGLDTLGIRMPDG-FSRRVIARFGRPLAAPSANTSG 147
>gi|67623713|ref|XP_668139.1| hypothetical protein Chro.10272 [Cryptosporidium hominis TU502] >gi|54659320|gb|EAL37902.1| hypothetical protein Chro.10272 [Cryptosporidium hominis] (389 aa)
Score = 101, Expect = 1.1e-02, Identities = 47/127 (37%), Positives = 74/127 (58%)
  Q:    40 SNLNGIVFEIKNLKAAIVSTDTVSGL-------LSLNKPLIYKIKKRDKNKKLIRFVSNL----DQIPEVNE----TFKKLASKFWPGKLTLIYKKE-------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNK 166
           +NL+     I N +   + T+TV GL        S+ K  I+KIK R  N  LI  V +     D + E++E     +K L  KFWPG LT+I KK                R P+++  L+L+  +  P+ + SAN SG+   T+ +   + F++
  S:     2 NNLSDYAKYILNGELVAIPTETVYGLGGNAYDRSSILK--IFKIKGRPINNPLICHVHSFKFAEDNVFELSERTRVIYKILTDKFWPGPLTVISKKRRNIVDEVSVSGKVGVRCPNNQLTLDLLKLSSVPIAAPSANRSGHISPTSPLHVSKEFDQ 155
>gi|159901360|ref|YP_001547607.1| Sua5/YciO/YrdC/YwlC family protein [Herpetosiphon aurantiacus ATCC 23779] >gi|159894399|gb|ABX07479.1| Sua5/YciO/YrdC/YwlC family protein [Herpetosiphon aurantiacus ATCC 23779] (207 aa)
Score = 100, Expect = 1.2e-02, Identities = 46/143 (32%), Positives = 77/143 (53%)
  Q:    59 TDTVSGL--LSLNKPLI---YKIKKRDKNKKLIRFVSNLDQIPEVNETFK----KLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDI--DTNTLKREGEI 201
           TDTV G+   +L++  I   ++ K R     L   +++LD + +V         +LA  +WPG LTL+                  + R+P+   + NLI + G P+  +SANL G     N   A       +  ++ ++G +    QPSTI D+  +  T+ R+G I
  S:    30 TDTVYGIGGSALDEAAIAQVFQAKARPATVALPMLLADLDDLSKVARDIPDLAWRLAEAWWPGGLTLVLPAVAQLPQLLTAGKATIAVRVPNHGQLRNLIRQFGTPIAGTSANLHGK-ATPNTAQAVAEQLAGRVPLV-LDGGFAMGEQPSTIVDLSGEQPTILRQGVI 196
>gi|195962468|ref|ZP_03098673.1| hypothetical protein BspiA_02807 [Borrelia spielmanii A14S] (333 aa)
Score = 100, Expect = 1.3e-02, Identities = 49/140 (35%), Positives = 74/140 (52%)
  Q:    72 LIYKIKKRDKNKKLIRFVSNLDQIPEVNETFKK----LASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTI--YDIDTNTL-KREGEIKYEWIKKTIE 211
           +I+ +KKR     LI  V  + +I E++E   K    L  KF PG LT + KK               + R+P +K  LNLI  +  P+ + SAN+S  P  T+   A +  N     II  E   +     ST+  +D+  N L  R G I  + I+K ++
  S:    47 MIFLVKKRPIENPLIVHVDTVKKIKELSEYIPKSALMLIKKFSPGPLTYVLKKSIKISRFISGNLDTVAIRIPANKIALNLIKASKVPIAAPSANISKRPSSTSFEMALKELNGLVRGIIKTENKDFNIGIESTVIGFDLKDNVLILRPGAITKKMIEKELK 208
>gi|125975078|ref|YP_001038988.1| translation factor SUA5 [Clostridium thermocellum ATCC 27405] >gi|196251798|ref|ZP_03150464.1| Sua5/YciO/YrdC/YwlC family protein [Clostridium thermocellum DSM 4150] >gi|125715303|gb|ABN53795.1| translation factor SUA5 [Clostridium thermocellum ATCC 27405] >gi|196198738|gb|EDX93569.1| Sua5/YciO/YrdC/YwlC family protein [Clostridium thermocellum DSM 4150] (351 aa)
Score = 100, Expect = 1.3e-02, Identities = 43/139 (30%), Positives = 70/139 (50%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQI----PEVNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPIT---NIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDI--DTNTLKREGEIKYEWIKKTIE 211
           I++ K R  +  LI  ++  + +      V    + L  +FWPG LTL+ +K                 R P     L LI + G P+ + SANLSG P  T   ++ID     + Y    + I+G        ST+ D+  D   + R G + +E +K  ++
  S:    54 IFEAKGRPSDNPLIVHIAGKEDVYGLAANVPPKAQILMDRFWPGPLTLVLEKSDKIPSVITAGLSTVGLRAPSHPIALALIREAGIPIAAPSANLSGRPSPTVPKHVID-----DLYGRVDVIIDGGNANIGVESTVLDVTADVPVILRPGGVSFEQLKDVLK 211
>gi|154249397|ref|YP_001410222.1| Sua5/YciO/YrdC/YwlC family protein [Fervidobacterium nodosum Rt17-B1] >gi|154153333|gb|ABS60565.1| Sua5/YciO/YrdC/YwlC family protein [Fervidobacterium nodosum Rt17-B1] (331 aa)
Score = 100, Expect = 1.3e-02, Identities = 31/93 (33%), Positives = 51/93 (54%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQIPEV---NETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFN 165
           I+++K R  +  LI  VS++D+I  +   +E +  +  K  PG +T + KK+                R+P       LI+ +GP+ + SAN SG P  T+     E  N
  S:    56 IFQVKGRPADNPLIVHVSSVDEIENIAYLSEKYIDIIKKVTPGPITFVLKKKENIPSEVTAGLETVGVRIPAHPVAQKLINCSGPIAAPSANRSGKPSPTDANAVIEDLN 165
>gi|124009997|ref|ZP_01694660.1| translation factor SUA5 [Microscilla marina ATCC 23134] >gi|123983955|gb|EAY24343.1| translation factor SUA5 [Microscilla marina ATCC 23134] (320 aa)
Score = 100, Expect = 1.4e-02, Identities = 51/155 (32%), Positives = 85/155 (54%)
  Q:    53 KAAIVSTDTVSGLLS--LNKPLIYKI---KKRDKNKKLIRFVSNLDQIPE----VNETFKKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTG-PLYSSSANLSG--NPPITNIIDAFESFNKYKSDIIF-IEGDYYQNNQPSTIYDIDTN--TLKREGEIKYEWIK 207
           K   + T+TV GL +   +K  + +I   K R     LI    +++Q+ +    + E  KKLA +FWPG LT++ +K               + R+P+    L L+ +   PL + SAN  G  +P     ++A     + K+ + + I+G   Q    STI ++  N  T+ R G I  E I+
  S:    20 KLVAIPTETVYGLAANAFDKKAVTRIFEAKNRPTFDPLIVHTHSIEQVQQFTKNIPEKAKKLAKQFWPGSLTILLEKNDLIPDLVTAGLSTVAVRIPNHPLTLELLKQLDFPLAAPSANPFGYISPTTAGHVEA-----QLKNKVSYIIDGGPCQVGIESTIVEVKNNQTTIYRLGGISVENIE 198
>gi|91226311|ref|ZP_01261151.1| Sua5/YciO/YrdC family protein [Vibrio alginolyticus 12G01] >gi|91189322|gb|EAS75601.1| Sua5/YciO/YrdC family protein [Vibrio alginolyticus 12G01] (185 aa)
Score = 99, Expect = 1.6e-02, Identities = 39/127 (30%), Positives = 67/127 (52%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQI-PEVNE---TFKKLAS--KFWPGKLTLI--------------YKKESYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKREG 199
           + ++K+R   K LI   ++ DQ+ P ++E   T ++L +    WPG  T I              +   + R+ D   +  + +  G PL S+SANLSG PP     +  E        +  + G+    ++PS I D  T+ + R+G
  S:    40 LLELKQRPVEKGLILIAASYDQLLPYIDESQLTEEQLQTVHATWPGPYTWIMPASDKVSNWVSGQFDSIAVRVTDHPLVQKMCNAFGKPLTSTSANLSGLPPCMTTEEVEEQLG--DKLVAILRGETSGRDKPSEIRDAKTSQILRQG 185
>gi|157364237|ref|YP_001471004.1| Sua5/YciO/YrdC/YwlC family protein [Thermotoga lettingae TMO] >gi|157314841|gb|ABV33940.1| Sua5/YciO/YrdC/YwlC family protein [Thermotoga lettingae TMO] (338 aa)
Score = 99, Expect = 1.6e-02, Identities = 45/138 (32%), Positives = 66/138 (47%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQIPEVNE----TFKKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDI--DTNTLKREGEIKYEWIKKTI 210
           I++IK R  +  LI  + +  Q+ E+ E        +   FWPG +T I++K+              + RMP        +  +G P+ + SANLSG P  T           Y S  + I+G        STI D+  D   L R G    E IKK +
  S:    53 IFQIKNRPADNPLIIHIYDKKQLEELVEGDIEQNSYVMDVFWPGPVTFIFRKKANVPKEVTGGLETVAIRMPSHPVAQVFLRLSGTPVAAPSANLSGKPSPTRAEHVIADL--YGSVDVIIDGGETPLGLESTIVDLSRDYPVLLRPGPATIEEIKKIV 209
>gi|152972191|ref|YP_001337337.1| putative ribosome maturation factor [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] >gi|150957040|gb|ABR79070.1| putative RNA-binding protein with unique protein fold [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] (190 aa)
Score = 99, Expect = 1.6e-02, Identities = 33/127 (25%), Positives = 62/127 (48%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQI------PEVNETFKKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKREG 199
           + ++K+R   K LI   ++ +Q+        ++++ ++     WPG +T ++                 + R+ +   ++ L +  G PL S+SANL+G PP     +    F         ++G       PS I D  T  L R+G
  S:    46 LLELKQRPVEKGLILIAASFEQLKPYIDDSRLSDSQREAIFSCWPGPVTFVFPARPETPRWLTGRFDSLAVRVTNHPLVIELCEAYGKPLVSTSANLTGQPPCRTTAEVHAQFG---DSFPVVDGATGGRQNPSEIRDALTGELFRQG 190
>gi|78222805|ref|YP_384552.1| translation factor SUA5 [Geobacter metallireducens GS-15] >gi|78194060|gb|ABB31827.1| translation factor SUA5 [Geobacter metallireducens GS-15] (203 aa)
Score = 99, Expect = 1.7e-02, Identities = 29/82 (35%), Positives = 49/82 (59%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQIP---EVNETFKKLASKFWPGKLTLIYKKESY--------------RMPDDKFILNLIDKTG-PLYSSSANLSGNPPI 154
           IY +K+R+K K      S+L ++    +V+    K+  +  PG  T +    S               R+PD++  L+L+ + G P+ ++SANLSG  PI
  S:    51 IYLLKQREKKKPFSFICSDLSEVARYAKVSNYAYKMLKRHLPGPYTFVLDATSIVPDLLVTKQKTVGIRIPDNRICLSLVKELGHPIITTSANLSGEEPI 150
>gi|86135055|ref|ZP_01053637.1| putative translation factor Sua5p-like protein [Tenacibaculum sp. MED152] >gi|85821918|gb|EAQ43065.1| putative translation factor Sua5p-like protein [Polaribacter dokdonensis MED152] (318 aa)
Score = 99, Expect = 1.7e-02, Identities = 55/172 (31%), Positives = 88/172 (51%)
  Q:    39 SSNLNGIVFEIKNLKAAIVSTDTVSGL---LSLNKPL--IYKIKKRDKNKKLIRFVSNLDQ----IPEVNETFKKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTN--TLKREGEIKYEWIKKTI 210
           S ++   +  ++N +   + T+TV GL   +   K +  I++ K+R     LI  VS +DQ    + E+    K LA KFWPG +TL+ KK               + R+P+ K  L L+ K   PL + SAN   N   T        F   +S  + ++G   +N   STI   + N   + R G +  E I+  +
  S:     5 SKDIQKAISILENEELVAIPTETVYGLAGNIFSEKAIKSIFETKQRPLFNPLIVHVSGIDQLDKIVAEIPAKAKLLAEKFWPGSMTLVLKKNPNIPDLITAGKSTVAVRIPNHKTTLELLSKLPFPLAAPSANPFNNISPTKPEHVARYFK--ESLEMVLDGGTCKNGIESTIIGFNNNEPVIYRLGALALEEIENVV 200
>gi|119773191|ref|YP_925931.1| SUA5/YciO/YrdC-like protein [Shewanella amazonensis SB2B] >gi|119765691|gb|ABL98261.1| SUA5/YciO/YrdC-like protein [Shewanella amazonensis SB2B] (190 aa)
Score = 99, Expect = 1.7e-02, Identities = 40/124 (32%), Positives = 59/124 (47%)
  Q:    76 IKKRDKNKKLIRFVSNLDQI------PEVNETFKKLASKFWPGKLTLIYKKESYRMPDDKFILNLIDK---------------TGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKREG 199
           +K+R   K LI   S+ DQ+        V E   + A   WPG  T +   ++   P  +   + I                   PL S+SANL+G  P   + +        K D + + G   Q+ QPSTI DI T  + R+G
  S:    48 VKQRPWEKGLILIASSFDQLKPYIDLSRVTEAQLQAAFDKWPGPFTFVIPAKADVSPMLRGCFDTIAVRVSAHQDVRAMCYACQKPLVSTSANLAGEQPALTLAEVQTQLGD-KIDAVVL-GALGQSCQPSTIIDIQTGHIFRQG 190
>gi|149190428|ref|ZP_01868699.1| Sua5/YciO/YrdC family protein [Vibrio shilonii AK1] >gi|148835682|gb|EDL52648.1| Sua5/YciO/YrdC family protein [Vibrio shilonii AK1] (185 aa)
Score = 99, Expect = 1.7e-02, Identities = 41/124 (33%), Positives = 65/124 (52%)
  Q:    76 IKKRDKNKKLIRFVSNLDQI-PEVNETFKKLASKF------WPGKLTLI--------------YKKESYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKREG 199
           +K+R   K LI   +N +Q+ P V+ET K  A++       WPG  T I              +   + R+ D + +  L    G P+ S+SANLSG P      +         ++I  ++G+    N+PS I D  T  + R+G
  S:    43 VKQRPVEKGLILIAANYEQLRPYVDET-KLTATQLESVQNTWPGPYTWIMPASDRVSSWLSGAFDTIAVRVTDHELVQQLCLSYGKPITSTSANLSGMPSCMTTEEVKSQLGDRLAEI--LDGETGGRNKPSEIRDARTLKVLRQG 185
>gi|116493076|ref|YP_804811.1| translation factor SUA5 [Pediococcus pentosaceus ATCC 25745] >gi|116103226|gb|ABJ68369.1| translation factor SUA5 [Pediococcus pentosaceus ATCC 25745] (340 aa)
Score = 99, Expect = 1.7e-02, Identities = 30/83 (36%), Positives = 47/83 (56%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQIPE---VNETFKKLASKFWPGKLTLI---------------YKKESYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPIT 155
           +Y  K R  +  LI  V++  ++ +   +++  KKL  +FWPG LT+I                   ++R P  +  ++LI   G PL   SAN SG P  T
  S:    46 VYAAKGRPSDNPLIVHVADQTEVAKFANIDDKSKKLMDQFWPGPLTIILPIKKGALNSIVTGGLDTAAFRNPATQVTIDLIRAAGVPLVGPSANTSGKPSPT 147
>gi|114773495|ref|ZP_01450632.1| Sua5/YciO/YrdC family protein [alpha proteobacterium HTCC2255] (188 aa)
Score = 99, Expect = 1.9e-02, Identities = 41/125 (32%), Positives = 64/125 (51%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQI---PEVNETFKKLASKF---WPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIF-IEGDYYQNNQPSTIYDIDTNTLKR 197
           +  IK R ++K LI   +  +Q+    +++E   ++ +K    WPG  T I  K               + R+     ++ L +    PL S+SAN SG  P   +    E    Y +D IF I+G+   N QPS I D  T  + R
  S:    45 VLAIKTRPQDKGLILIAATFEQLLPYIDISELEPEIINKVHATWPGPYTWIMPKAKTTPDYLTGGRNTIAVRVSAHPTVIALCNAVNKPLVSTSANPSGETPARTL----EQIKTYFADTIFAIDGEVDHNAQPSKIQDAVTGKVLR 187
>gi|125834532|ref|XP_693825.2| PREDICTED: similar to ischemia/reperfusion inducible protein [Danio rerio] (678 aa)
Score = 98, Expect = 2.0e-02, Identities = 47/153 (30%), Positives = 74/153 (48%)
  Q:     4 LKDRKDNKKDSFKKNLNNKEIKNYPKKEFVTYEKDSSNLNGIVFEIKNLKAAIVSTDTVSGLL-SLNKPL----IYKIKKRDKNKKLIRFVSNLDQIPEVNETFKKLASKF----WPGKLTLIYKKESY---------------------RMPDDKFILNLIDKTGPLYSSSANLSGNPPITN 156
           +KD+K NK ++            YP    +   +++S L  I   ++N     + TDTV  L  S   P     IY IK R   K +   +S+++Q+      F  L  +F    +PG ++ I  K  +                     R+PD     +L + TGPL  +SAN SG    T+
  S:   444 IKDKKKNKSET-----------TYPC--LIANSRETSGLLKIAKLLENNGVCGIPTDTVYALAASCKNPSAIEKIYTIKDRPAEKPICICISSVEQLVAAKPPFSPLLWEFMRNVYPGGISCIVPKGDWLLKLGVGPAYDRVGTRESIMIRVPDHTATAHLCEFTGPLAITSANPSGEADSTH 613
>gi|116750183|ref|YP_846870.1| Sua5/YciO/YrdC/YwlC family protein [Syntrophobacter fumaroxidans MPOB] >gi|116699247|gb|ABK18435.1| translation factor SUA5 [Syntrophobacter fumaroxidans MPOB] (225 aa)
Score = 98, Expect = 2.0e-02, Identities = 23/54 (42%), Positives = 34/54 (62%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQIPEVNETF----KKLASKFWPGKLTLIYKKESYRMP 126
           I+ IKKR++ K L    S +  + E  E F    ++LA+ FWPG LTLI +   +R+P
  S:    67 IFAIKKREREKALPLIASGIQAVREWVEEFPALAERLAAAFWPGPLTLILRA-VHRLP 123
>gi|88601863|ref|YP_502041.1| Sua5/YciO/YrdC/YwlC [Methanospirillum hungatei JF-1] >gi|88187325|gb|ABD40322.1| translation factor SUA5 [Methanospirillum hungatei JF-1] (180 aa)
Score = 98, Expect = 2.1e-02, Identities = 40/100 (40%), Positives = 61/100 (61%)
  Q:    56 IVSTDTVSGL----LSLNKPL-IYKIKKRDKNKKLIRFVSNLDQI---PEVNETFKKLASKFWPGKLTLIY--------------KKESYRMPDDKFILNLIDK-TGPLYSSSANLSGNP-PIT 155
           +  TDT+ GL    LS    L +++ K R+ +K +   VS+ D I     V+E  ++   +F PG +TLI               KK   R P+ +  L LI +   P+ ++SANLSG P P+T
  S:     7 VYPTDTLYGLGADALSDEAILKVFEAKGREYHKPISIAVSDPDMIGAVAYVDEMAEQFIEEFLPGPVTLILPARNILSTRLTAGTKKIGIRYPNHEVALELISRYDTPITATSANLSGGPDPVT 130
>gi|71394063|gb|AAZ32102.1| putative translation factor [uncultured euryarchaeote Alv-FOS5] (342 aa)
Score = 98, Expect = 2.1e-02, Identities = 51/145 (35%), Positives = 74/145 (51%)
  Q:    49 IKNLKAAIVSTDTVSGL--LSLNKPLIYKI---KKRDKNKKLIRFVSNLDQI----PEVNETFKKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPIT---NIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTN 193
           I+  K     T+TV GL   +LN   + +I   K R ++  LI  +++ + I     EV    K L  +FWPG LTLI KK               + RMP       LI  +  P+ + SAN SG P  T   ++ID      +Y      I+G        ST+ D+ T+
  S:    26 IREGKLVAFPTETVYGLGADALNAEAVKRIFEAKGRPQDNPLIVHIAHEEGIYNLAREVPRKAKDLIDRFWPGPLTLILKKSPIIPDRTTAGLDTVAIRMPSHPIARKLILLSERPIAAPSANTSGKPSPTTGKHVIDDLYGKVEY-----IIDGGPTNVGLESTVIDLTTD 192
>gi|195947741|ref|ZP_03088927.1| hypothetical protein BgarP_01540 [Borrelia garinii PBr] (335 aa)
Score = 98, Expect = 2.2e-02, Identities = 39/104 (37%), Positives = 57/104 (54%)
  Q:    72 LIYKIKKRDKNKKLIRFVSNLDQIPEVNETFKK----LASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIE 175
           +I+ +KKR     LI  V  + +I E++E   K    L  +F PG LT + KK               + R+P +K  LNLI  +  P+ + SAN+S  P  TN   A +  N     II +E
  S:    47 MIFLVKKRSIQNPLIVHVDTVKKIKELSEYIPKSALMLIKRFSPGPLTYVLKKSIKISRFVSGNLDTVAIRIPANKIALNLIKASKVPIAAPSANISKRPSATNFEMALKELNGLVRGIIKLE 169
>gi|152992697|ref|YP_001358418.1| hypothetical protein SUN_1106 [Sulfurovum sp. NBC37-1] >gi|151424558|dbj|BAF72061.1| conserved hypothetical protein [Sulfurovum sp. NBC37-1] (146 aa)
Score = 98, Expect = 2.4e-02, Identities = 46/149 (30%), Positives = 75/149 (50%)
  Q:    49 IKNLKAAI--VSTDTVSGLLSLNKPLIYKIKKRDKNKKLIRFVSNLD------QIPEVNETFKKLASKFWPGKLTLIYKKESYRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKR 197
           +K+LK  +    TDT  G +S +   + +IKKR  +K  I+ V++L       +IP  ++   + A K       ++    SYR+  D   L L+++    Y++SANLSG P         E F K  +D+I          +PS IY +  +TL+R
  S:     1 MKDLKHLVFLTQTDTTIGFVSQSAERLTQIKKRPPHKYYIKAVNSLKTLKTFTRIPSSHKNRVRRARK----STFIMPDGHSYRVIRDTHHLLLLNRLQWAYTTSANLSGQP-------YDEIFAKEAADVIVTP--LKIKKKPSIIYKLGKHTLQR 144
>gi|168697771|ref|ZP_02730048.1| hypothetical protein CdifQCD_20222 [Clostridium difficile QCD-37x79] >gi|168714958|ref|ZP_02747235.1| hypothetical protein CdifQCD-6_14708 [Clostridium difficile QCD-63q42] >gi|168726406|ref|ZP_02758683.1| hypothetical protein CdifQCD-7_18599 [Clostridium difficile QCD-76w55] >gi|168730148|ref|ZP_02762425.1| hypothetical protein CdifQCD-_02485 [Clostridium difficile QCD-97b34] >gi|196124989|ref|ZP_03116738.1| hypothetical protein CdifA_05362 [Clostridium difficile ATCC 43255] >gi|196162311|ref|ZP_03122872.1| hypothetical protein CdifC_16976 [Clostridium difficile CIP 107932] (346 aa)
Score = 98, Expect = 2.5e-02, Identities = 51/160 (31%), Positives = 84/160 (52%)
  Q:    53 KAAIVSTDTVSGL----LSLNK-PLIYKIKKRDKNKKLIRFVSNLDQI----PEVNETFKKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDI--DTNTLKREGEIKYEWIKKTIEE 212
           K  I  T+TV GL    L  N    IY+ K R  +  LI  +   +++     ++++  K +  K WPG +T+I  K+              + RMP +     +I + G P+ + SAN+SG P  T     +E  N  + D I + GD       ST+ D+  +T  + R G I  E +++ + E
  S:    29 KTVIFPTETVYGLGANALDENAVKKIYEAKGRPSDNPLIVHIYEKEEVYDLAKDISDKAKLVIEKLWPGPITIILNKKDIIPYKTSGGLDTVAIRMPSNVIARAIIKEAGIPIAAPSANISGRPSPTKAKHVYEEMNG-RVDGIVLGGD-SNFGLESTVLDLTEETPMILRPGSITKEVLEELLGE 212
>gi|126701105|ref|YP_001090002.1| hypothetical protein CD3482 [Clostridium difficile 630] >gi|145952636|ref|ZP_01801645.1| hypothetical protein CdifQ_04004012 [Clostridium difficile QCD-32g58] >gi|115252542|emb|CAJ70385.1| conserved hypothetical protein [Clostridium difficile 630] (353 aa)
Score = 98, Expect = 2.5e-02, Identities = 51/160 (31%), Positives = 84/160 (52%)
  Q:    53 KAAIVSTDTVSGL----LSLNK-PLIYKIKKRDKNKKLIRFVSNLDQI----PEVNETFKKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDI--DTNTLKREGEIKYEWIKKTIEE 212
           K  I  T+TV GL    L  N    IY+ K R  +  LI  +   +++     ++++  K +  K WPG +T+I  K+              + RMP +     +I + G P+ + SAN+SG P  T     +E  N  + D I + GD       ST+ D+  +T  + R G I  E +++ + E
  S:    36 KTVIFPTETVYGLGANALDENAVKKIYEAKGRPSDNPLIVHIYEKEEVYDLAKDISDKAKLVIEKLWPGPITIILNKKDIIPYKTSGGLDTVAIRMPSNVIARAIIKEAGIPIAAPSANISGRPSPTKAKHVYEEMNG-RVDGIVLGGD-SNFGLESTVLDLTEETPMILRPGSITKEVLEELLGE 219
>gi|158321595|ref|YP_001514102.1| Sua5/YciO/YrdC/YwlC family protein [Alkaliphilus oremlandii OhILAs] >gi|158141794|gb|ABW20106.1| Sua5/YciO/YrdC/YwlC family protein [Alkaliphilus oremlandii OhILAs] (349 aa)
Score = 97, Expect = 2.6e-02, Identities = 47/142 (33%), Positives = 66/142 (46%)
  Q:    69 NKPLIYKIKKRDKNKKLIRFVSNLDQIPEVNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDI--DTNTLKREGEIKYEWIKKTI 210
           + PLI  I K++    +I  V N   IPE+    + L  KFWPG LTL+++K                 RMP       LI+    P+ + SAN SG P  T      E     + D I I G        ST+ DI  D   + R G +  E ++  +
  S:    60 DNPLIVHIAKKED---VIPLVKN---IPEIG---RILMEKFWPGPLTLLFEKSDIIPNEVTAGLSTVGIRMPSHPIAGALIEAAQVPVAAPSANTSGRPSPTKGQHVIEDMMG-RVDAI-ISGGECNVGLESTVLDITGDIPMILRPGGVTKEMLEAVL 207
>gi|28899809|ref|NP_799414.1| Sua5/YciO/YrdC family protein [Vibrio parahaemolyticus RIMD 2210633] >gi|153837692|ref|ZP_01990359.1| protein YrdC [Vibrio parahaemolyticus AQ3810] >gi|28808061|dbj|BAC61298.1| Sua5/YciO/YrdC family protein [Vibrio parahaemolyticus RIMD 2210633] >gi|149748982|gb|EDM59809.1| protein YrdC [Vibrio parahaemolyticus AQ3810] (185 aa)
Score = 97, Expect = 2.7e-02, Identities = 40/124 (32%), Positives = 67/124 (54%)
  Q:    76 IKKRDKNKKLIRFVSNLDQI-PEVNE---TFKKLAS--KFWPGKLTLI--------------YKKESYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSD--IIFIEGDYYQNNQPSTIYDIDTNTLKREG 199
           +K+R   K LI   ++ +Q+ P ++E   T ++LA+    WPG  T I              +   + R+ D   +  + +  G PL S+SANLSG PP        E   +   D  +  + G+    ++PS I D  T+ + R+G
  S:    43 LKQRPVEKGLILIAASYEQLLPYIDESQLTPEQLATVHATWPGPYTWIMPASDKVSNWVSGQFDSIAVRVTDHPLVQKMCNAFGKPLTSTSANLSGLPPCMTT----EEVEQQLGDKLVAILRGETSGRDKPSEIRDAKTSQILRQG 185
>gi|188996882|ref|YP_001931133.1| Sua5/YciO/YrdC/YwlC family protein [Sulfurihydrogenibium sp. YO3AOP1] >gi|188931949|gb|ACD66579.1| Sua5/YciO/YrdC/YwlC family protein [Sulfurihydrogenibium sp. YO3AOP1] (195 aa)
Score = 97, Expect = 2.7e-02, Identities = 53/158 (33%), Positives = 89/158 (56%)
  Q:    39 SSNLNGIVFEIKNLKAAIVSTDTVSGLLS--LNKPLI---YKIKKRDKNKKLIRFVSNLDQIPEVNETFKKLASKFWPGK-LTLIY----------------KKESYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLK 196
           S+ L+  +  IK+    I  TDT+ G+L+  L+K  +   Y IK+R+K+K  I  + N   + ++       A K    K +T+I+                K  ++R+PDD   L+ ++K   P+ + SAN SG  P  +I  A E F K K D ++I+    + N PSTI  ++ + +K
  S:     6 STKLDDAIDVIKHGGIVITKTDTIYGILANALDKEAVEKVYLIKEREKDKPFIILIPNTKFLKKIKVKENPQAEKILNLKGITVIFDVNDPNNELEYLHRGTKTLAFRIPDDPEFLSFLNKLDTPIVAPSANPSGLKPAEDINKAIEYF-KDKVD-LYIDRGKSETNIPSTIVKVENSKIK 184
>gi|153956296|ref|YP_001397061.1| hypothetical protein CKL_3705 [Clostridium kluyveri DSM 555] >gi|146349154|gb|EDK35690.1| Conserved hypothetical protein [Clostridium kluyveri DSM 555] (350 aa)
Score = 97, Expect = 2.8e-02, Identities = 42/140 (30%), Positives = 71/140 (50%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLDQIP----EVNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYD--IDTNTLKREGEIKYEWIKKTIEE 212
           I+K K R ++  LI  ++ ++ +     +++    K    FWPG +T+I  K S               RMP +     LI     P+ + SAN+SG P  T++    E  N  K D+I + G        ST+ D  +  + + R G I  E +++  +E
  S:    54 IFKAKGRPQDNPLIVHIAEIEDMKPLAIDISPVALKFIQNFWPGPMTVILPKSSIVPDITSASLDSVGIRMPSNVIARELIKAAKVPIAAPSANVSGKPSPTDVDRCIEDLNG-KVDLI-LGGSMCDVGVESTVIDCTVSPSCILRPGGITLEMLREIEKE 212
>gi|59713143|ref|YP_205919.1| ribosome maturation factor [Vibrio fischeri ES114] >gi|59481244|gb|AAW87031.1| predicted ribosome maturation factor [Vibrio fischeri ES114] (185 aa)
Score = 97, Expect = 2.9e-02, Identities = 36/124 (29%), Positives = 60/124 (48%)
  Q:    76 IKKRDKNKKLIRFVSNLDQI------PEVNETFKKLASKFWPGKLTLIYKKESYRMP-----------------DDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKREG 199
           +KKR K K LI   ++++Q+       ++ E         WPG +T I   ++  +P                   K I N   K  P+ S+SANLSG  P  ++ +         + ++  +G+     QP+ I D  T    R+G
  S:    43 VKKRPKEKGLILIAASIEQLLPYIDLEQLTEEQVNTIKASWPGPVTWIVPVKTSTLPLVTGQFDSIAVRVTAHPQVKAICNAFGK--PITSTSANLSGLEPCRSVTEVEAQLG--DTGVVIFQGEVGNRTQPTEIRDAKTGNTLRQG 185
>gi|121602316|ref|YP_988708.1| Sua5/YciO/YrdC family protein [Bartonella bacilliformis KC583] >gi|120614493|gb|ABM45094.1| Sua5/YciO/YrdC family protein [Bartonella bacilliformis KC583] (320 aa)
Score = 97, Expect = 2.9e-02, Identities = 59/176 (33%), Positives = 92/176 (52%)
  Q:    38 DSSNLNGIVFEIKNLKAAIVSTDTVSGLL---SLNKPL--IYKIKKRDKNKKLIRFVSNLDQIP---EVNETFKKLASKFWPGKLTLIYKKESY----------------RMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQP------STIYDI-DTNT-LKREGEIKYEWIKKTIEEN 213
           +S ++   V  +K  +  ++ T+TV GL    +  K +  I+ IK R +   LI  VS++       E++   ++L   FWPG LTL+   + +                R PD  F   ++   G PL + SAN SG    T+    F+S  +  S II        +N P      STI  + D N  L R G I  E I+K +E++
  S:     7 NSHSIKEAVEILKKGQLVVLPTETVYGLAGDATNGKAVASIFAIKGRPQFNPLIAHVSSIKMAECYVEIDCLSRRLMEAFWPGPLTLVLPLKPHHNIHPLTTAGLNTLAVRFPDGGFA-EIVQCFGRPLAAPSANQSGYLSPTSAASVFDSLGEKVSLII--------DNGPAKIGLESTIVKVCDGNIYLLRPGGIIAEDIEKVVEKS 206
>gi|51598986|ref|YP_073174.1| hypothetical protein BG0756 [Borrelia garinii PBi] >gi|51573557|gb|AAU07582.1| conserved hypothetical protein [Borrelia garinii PBi] (337 aa)
Score = 97, Expect = 3.0e-02, Identities = 39/104 (37%), Positives = 56/104 (53%)
  Q:    72 LIYKIKKRDKNKKLIRFVSNLDQIPEVNETFKK----LASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIE 175
           +I+ +KKR     LI  V  + +I E+ E   K    L  +F PG LT + KK               + R+P +K  LNLI  +  P+ + SAN+S  P  TN   A +  N     II +E
  S:    47 MIFLVKKRSIQNPLIVHVDTVKKIKELTEYIPKSALMLIKRFSPGPLTYVLKKSIKISRFVSGNLDTVAIRIPANKIALNLIKASKVPIAAPSANISKRPSATNFEMALKELNGLVRGIIKLE 169
>gi|109896360|ref|YP_659615.1| SUA5/yciO/yrdC-like [Pseudoalteromonas atlantica T6c] >gi|109698641|gb|ABG38561.1| SUA5/yciO/yrdC-like [Pseudoalteromonas atlantica T6c] (187 aa)
Score = 97, Expect = 3.0e-02, Identities = 39/121 (32%), Positives = 66/121 (54%)
  Q:    67 SLNKPLIYKIKKRDKNKKLIRFVSNLDQI-PEVNETFKKLASKF-----WPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTI 187
           ++NK L   +K+RD +K LI    N  Q+ P V+++  K+  +      WPG +T +  K               + R+     I +L  +   PL S+SAN +G+PP    + A E  + + + +I I+G    +  PS I
  S:    39 AVNKLL--ALKQRDVSKGLILVGDNYSQLLPYVDDSAIKMTKRTEIFSSWPGPITWLLPKSKTAPSWVTGESEFIAVRVSAHPLIKDLCQRANKPLVSTSANTAGHPP---ALSADEVTSYFSNQVILIDGSLGGSRSPSKI 175
>gi|191638152|ref|YP_001987318.1| Translation factor SUA5 [Lactobacillus casei] >gi|190712454|emb|CAQ66460.1| Translation factor SUA5 [Lactobacillus casei BL23] (333 aa)
Score = 97, Expect = 3.1e-02, Identities = 30/83 (36%), Positives = 42/83 (50%)
  Q:    73 IYKIKKRDKNKKLIRFVSNLD---QIPEVNETFKKLASKFWPGKLTLI---------------YKKESYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPIT 155
           +Y  K R  +  LI  V++ +   Q   +     KL   FWPG LT+I                +  ++R PD+     LI   G P+   SAN SG P  T
  S:    46 VYAAKGRPSDNPLIVTVADAEMVGQYATITPLAAKLMEAFWPGPLTIILNILPGRLSMKVTGGLQTAAFRNPDNALTRKLIATAGVPIVGPSANTSGKPSPT 147
>gi|110832995|ref|YP_691854.1| Sua5/YciO/YrdC/YwlC family protein [Alcanivorax borkumensis SK2] >gi|110646106|emb|CAL15582.1| Sua5/YciO/YrdC/YwlC family protein [Alcanivorax borkumensis SK2] (182 aa)
Score = 97, Expect = 3.1e-02, Identities = 38/122 (31%), Positives = 62/122 (50%)
  Q:    76 IKKRDKNKKLIRFVSNLDQIP---EVNETFKKLASKFWPGKLTLI--------------YKKESYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFI-EGDYYQNNQPSTIYDIDTNTLKR 197
           IK R  +K LI    +L Q+     +NE       K WP  +T +              ++K + R+PD      L    G P+ S+SAN+SG P   N    ++   +  + + FI  G   +  +PSTI D+++  + R
  S:    44 IKHRPVSKGLILIGESLAQLAPYLHLNEQQSAQLEKKWPAPITYLVDASDRLPAWVRGEHRKVAVRVPDHPLARQLCQLAGQPIISTSANISGRPAARN---RYQVARQLGNQLDFIVSGACDRAAKPSTIIDLESGRILR 181
>gi|116618871|ref|YP_819242.1| translation factor SUA5 [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|116097718|gb|ABJ62869.1| translation factor SUA5 [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (337 aa)
Score = 97, Expect = 3.1e-02, Identities = 38/107 (35%), Positives = 59/107 (55%)
  Q:    49 IKNLKAAIVSTDTVSGL--LSLNKPLIYKI---KKRDKNKKLIRFVSN---LDQIPEVNETFKKLASKFWPGKLTLI---------------YKKESYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPIT 155
           I+N +     T+TV GL   + N+  I K+   K R  +  LI  V++   LD+   +++  + L   FWPG LT+I                +  ++R+P +     LI   G P+   SAN SG P  T
  S:    20 IQNGEVVAFPTETVYGLGADATNESAIKKVFVAKGRPADNPLIMTVADAAQLDEFVTISDQARGLMDHFWPGSLTIILPIKPGKVSMLVTGGLQTVAFRLPANDAARTLIRAAGVPIVGPSANTSGKPSPT 150
>gi|15616333|ref|NP_244638.1| hypothetical protein BH3771 [Bacillus halodurans C-125] >gi|10176395|dbj|BAB07490.1| BH3771 [Bacillus halodurans C-125] (348 aa)
Score = 97, Expect = 3.2e-02, Identities = 40/120 (33%), Positives = 64/120 (53%)
  Q:    37 KDSSNLNGIVFEIKNLKAAIVSTDTVSGL--LSLNKPLIYKI---KKRDKNKKLIRFVSNLDQ----IPEVNETFKKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITN 156
           K+S+ +      IK  +   + T+TV GL   +L+   + KI   K R  +  LI  +S  +Q    +  + ++   L + FWPG LT+I+ K               + RMP       LI+    P+ + SAN SG P  T+
  S:    19 KNSNEIKEAALWIKKGELVALPTETVYGLGANALSDEAVQKIFIAKGRPSDNPLIVHISRKEQLLRLVSHIPDSANLLINAFWPGPLTIIFPKGEEVSTVVTAGLDTVAVRMPSHPVAQALIEAANVPIAAPSANRSGKPSPTS 162
>gi|55820818|ref|YP_139260.1| Sua5/YciO/YrdC family protein [Streptococcus thermophilus LMG 18311] >gi|55736803|gb|AAV60445.1| hypothetical protein, Sua5/YciO/YrdC family protein [Streptococcus thermophilus LMG 18311] (201 aa)
Score = 97, Expect = 3.2e-02, Identities = 47/153 (30%), Positives = 81/153 (52%)
  Q:    49 IKNLKAAIVSTDTVSGLLS--LNKP---LIYKIKKRDKNKKLIRFVSNLDQI----PEVNETFKKLASKFWPGKLTLIYKKES--------------YRMPDDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQ----PSTIYDIDTNTLK--REGEI 201
           + N +A ++ T+TV GL +  L++     +Y++K R ++K +   V++ + I     E  +  K+L   F PG LT+I K                 +R+P+      LI   GPL   SAN SG        ++   F+  ++   F    Y  +N      STI D+  +  +  R+G+I
  S:    12 LNNGEAVVLPTETVYGLFAKALDEKAVDYVYELKNRPRDKAMNLNVASYEDILFYSKEQPKYLKQLYDAFLPGPLTIILKANDQVPRWINSGLATVGFRLPNHPVTRELIQAEGPLIGPSANKSGK-------ESGRHFDDIRAQFDFQVTGYQDDNALLGVDSTILDLSVSPARILRQGKI 186
>gi|187918590|ref|YP_001884153.1| Sua5/YciO/YrdC/YwlC family protein [Borrelia hermsii DAH] >gi|119861438|gb|AAX17233.1| Sua5/YciO/YrdC/YwlC family protein [Borrelia hermsii DAH] (336 aa)
Score = 97, Expect = 3.2e-02, Identities = 46/140 (32%), Positives = 73/140 (52%)
  Q:    72 LIYKIKKRDKNKKLIRFVSNLDQIPEVNETFKK----LASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTG-PLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTI-YDIDTN-TLKREGEIKYEWIKKTIE 211
           +I+ +KKR     LI  V ++++I E+ E   K    L  KF PG LT I K                + R+P +   L LI  +G P+ + SANLS  P  TN   A +  +     II    +     + + I +D+  N ++ R G I  E I++ ++
  S:    49 MIFLVKKRPITNPLIVHVESIEKINELVEHIPKSALILMQKFTPGPLTFILKNAGKISNLISGGLESIAVRIPSEPVALKLIKISGVPIAAPSANLSRRPSATNFKMAIKELDGLVKGIIKKNEESKIGIESTVIGFDLKGNISILRPGSITKEMIERELK 209
>gi|88802068|ref|ZP_01117596.1| hypothetical protein PI23P_05377 [Polaribacter irgensii 23-P] >gi|88782726|gb|EAR13903.1| hypothetical protein PI23P_05377 [Polaribacter irgensii 23-P] (318 aa)
Score = 97, Expect = 3.3e-02, Identities = 53/172 (30%), Positives = 92/172 (53%)
  Q:    39 SSNLNGIVFEIKNLKAAIVSTDTVSGL---LSLNKPL--IYKIKKRDKNKKLIRFVSNLDQ----IPEVNETFKKLASKFWPGKLTLIYKKE--------------SYRMPDDKFILNLIDKTG-PLYSSSANLSG--NPPITNIIDAFESFNKYKSDI-IFIEGDYYQNNQPSTI--YDIDTNTLKREGEIKYEWIKKTI 210
           S+++   V  + + +   + T+TV GL   +   K +  I+  KKR     LI  + ++      +  + E  K LA+ FWPG LTL+ KK               + R+P+    L L+ +   PL + SAN  G  +P     ++A+     +K+DI + ++G    N   STI  ++ DT  + R G +  E I+  +
  S:     5 STDIEKAVQLLTDAQLVAIPTETVYGLAGNIYSEKAIHRIFSTKKRPFFNPLIVHIPSIASLESIVTHIPEKAKLLAAAFWPGSLTLVLKKNRSIPDLITAGKDTVAVRVPNHPVTLALLQQLPFPLAAPSANPFGSISPTKAAHVEAY-----FKNDIQMILDGGSCANGIESTIIGFENDTPIIYRLGALALEDIEAVV 200
>gi|163731104|ref|ZP_02138570.1| SUA5 protein [Vibrio fischeri MJ11] >gi|161395664|gb|EDQ19967.1| SUA5 protein [Vibrio fischeri MJ11] (185 aa)
Score = 97, Expect = 3.3e-02, Identities = 47/159 (29%), Positives = 75/159 (47%)
  Q:    41 NLNGIVFEIKNLKAAIVSTDTVSG----------LLSLNKPLIYKIKKRDKNKKLIRFVSNLDQI------PEVNETFKKLASKFWPGKLTLIYKKESYRMP-----------------DDKFILNLIDKTGPLYSSSANLSGNPPITNIIDAFESFNKYKSDIIFIEGDYYQNNQPSTIYDIDTNTLKREG 199
           NLN +V  +K        T+ V G          LL+L       +KKR K K LI   ++++Q+       ++ E         WPG +T I   ++  +P                   K I N   K  P+ S+SANLSG  P  ++ +         + ++  +G+     QP+ I D  T    R+G
  S:     3 NLNQVVDALKQGNVIAYPTEGVFGVGCDPDNEQALLNL-----LDVKKRPKEKGLILIAASIEQLLPYIDLEQLTEEQVNTIKASWPGPVTWIVPVKTSTLPLVTGQFDSIAVRVTAHPQVKAICNAFGK--PITSTSANLSGLEPCRSVAEVEAQLG--DTGVVIFQGEVGNRTQPTEIRDAKTGNTLRQG 185