>gi|26554125|ref|NP_758059.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454133|dbj|BAC44463.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (378 aa)
Score = 1329, Expect = 1.1e-144, Identities = 364/364 (100%), Positives = 364/364 (100%)
  Q:    15 TGAFGIVATVPVIVSSCSSTSDNNTGGDNNGGGTQTQTITPQIQSAVTLNGALSDIYDTANSSSENTNAKIAEEIKNNLETVFTNGAALSDVSDLEITVSHNFPESTWIGTAYSGDSGWYSAQMDTVLYDYTLNPLTISSLSDLKTQLSDSKIQEIFTAAGTTTTTNATYAVQNALGFTNKNNGAENRDLLHVNVLETVPGQSGGDPTTKNYDLQIPVSDLNLELKDLSVTVKGTNVAETTLTTTLTYNIGINEAQNFTQPTTNPTVQGSDIQNDDANAANKALVALTYATEADGQTTLDNEKISAELGIYNSVFTAVSIKPVDGGNNQYTITLSATPKDGYVWEDGSNTAKQVSFNVTFTVNS 378
           TGAFGIVATVPVIVSSCSSTSDNNTGGDNNGGGTQTQTITPQIQSAVTLNGALSDIYDTANSSSENTNAKIAEEIKNNLETVFTNGAALSDVSDLEITVSHNFPESTWIGTAYSGDSGWYSAQMDTVLYDYTLNPLTISSLSDLKTQLSDSKIQEIFTAAGTTTTTNATYAVQNALGFTNKNNGAENRDLLHVNVLETVPGQSGGDPTTKNYDLQIPVSDLNLELKDLSVTVKGTNVAETTLTTTLTYNIGINEAQNFTQPTTNPTVQGSDIQNDDANAANKALVALTYATEADGQTTLDNEKISAELGIYNSVFTAVSIKPVDGGNNQYTITLSATPKDGYVWEDGSNTAKQVSFNVTFTVNS
  S:    15 TGAFGIVATVPVIVSSCSSTSDNNTGGDNNGGGTQTQTITPQIQSAVTLNGALSDIYDTANSSSENTNAKIAEEIKNNLETVFTNGAALSDVSDLEITVSHNFPESTWIGTAYSGDSGWYSAQMDTVLYDYTLNPLTISSLSDLKTQLSDSKIQEIFTAAGTTTTTNATYAVQNALGFTNKNNGAENRDLLHVNVLETVPGQSGGDPTTKNYDLQIPVSDLNLELKDLSVTVKGTNVAETTLTTTLTYNIGINEAQNFTQPTTNPTVQGSDIQNDDANAANKALVALTYATEADGQTTLDNEKISAELGIYNSVFTAVSIKPVDGGNNQYTITLSATPKDGYVWEDGSNTAKQVSFNVTFTVNS 378
>gi|26554127|ref|NP_758061.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454135|dbj|BAC44465.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (384 aa)
Score = 683, Expect = 8.1e-70, Identities = 204/364 (56%), Positives = 248/364 (68%)
  Q:    14 LTGAFGIVATVPVIVSSCSSTSDNNTGGDNNGGGTQ-TQTITPQIQSAVTLNGALSDIYDTANSSSENTNAKIAEEIKNNLETVFTNGAALSDVSDLEITVSHNFPESTWIGTAYSGDSGWYSAQMDT-----------VLYDYTLNPLTISSLSDLKTQLSDSKIQEIFTAAGTTTTTNATYAVQNALGFTNKN-NGAENRDLLHVNVLETVPGQSGGDPTTKNYDLQIPVSDLNLELKDLSVTVKGTNVAETTLTTTLTYNIGINEAQNFTQPTTNPTVQGSDIQNDDANAANKALVALTYATEADGQTTLDNEKISAELGIYNSVFTAVSIKP--VDGGNNQYTITLSATPKDGYVWEDGSNTAKQVSFNVTFTVN 377
           +TGAFGIVATVPVIVS+CSSTSDNN   +N G   Q TQ+ITP+I++   L+GALS+IYDTAN+    TN  IA EIK NL  VF NG  LS V+DL+++V+H FP STW G ++   SG +    D+           +LY      L ISSLSDLKTQL D+K++ I T  G T   + TY+V NALGFTNK  +   NRDLLHVNV+ T   ++G +P T NYDLQIPVSDLNL+L DLSVTVKGTNVAETT  TTLTYNIGIN+   F  P+  PTV  S   N +      AL AL Y     GQ  +DN+K++A LGIYN  FT  +  P  +D   N++T  L ATP  GYVWEDG+NTAK V F   FTV+
  S:    14 MTGAFGIVATVPVIVSACSSTSDNNGNNNNGGDTNQQTQSITPKIKTESKLSGALSNIYDTANTGK--TNELIANEIKKNLSEVFENGEDLSKVNDLQVSVTHTFPASTWTGLSFDAASGNWKHSTDSNQDVTITDANKLLYASKTQALDISSLSDLKTQLDDTKLKAILTDTGVTPAADTTYSVANALGFTNKKKDDTNNRDLLHVNVVGT---KTGSNPGTTNYDLQIPVSDLNLKLTDLSVTVKGTNVAETTEKTTLTYNIGINDVVEFVDPSAKPTVAASVKTNKE---TMNALKALGYTATVSGQDQIDNDKVAAALGIYNCTFTLAAENPLVIDDATNKFTFNLVATPNSGYVWEDGTNTAKPVQFATDFTVS 384
>gi|26554112|ref|NP_758046.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454120|dbj|BAC44450.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (399 aa)
Score = 679, Expect = 2.9e-69, Identities = 209/364 (57%), Positives = 261/364 (71%)
  Q:    15 TGAFGIVATVPVIVSSCSSTSDNNTGGDNNGGGTQTQTITPQIQSAVTLNGALSDIYDTANSSSENTNAKIAEEIKNNLETVFTNGAALSDVSDLEITVSHNFPESTWIGTAYSGDSGWYS-----------AQMDTVLYDYTLNPLTISSLSDLKTQLSD-SKIQEIFTAAGTTTTTNATYAVQNALGFTNKNNGAENRDLLHVNVLET-VPGQSGGDPTTKNYDLQIPVSDLNLELKDLSVTVKGTNVAETTLTTTLTYNIGINEAQNFTQPTTNPTVQGSDIQNDDANAANKALVALTYATEADG---QTTLDNEKISAELGIYNSVFTAVSIKPV-----------DGGNNQYTITLSATPKDGYVWEDGSNTAKQVSFNVTFTVNS 378
           TGAFGIVATVPVIVS+CSSTSDNNTGG +N   TQT+TITPQI+S  TL+GALS IY+ ANSS  NTNA IA+EIK NL  VF NG AL++V+DLEITV+H+FPESTW G  ++ D+G +             + + +LY      L ISSLSDLK QL+D +K+++I   AG T   +  Y+V N LGFTNKN+G+ENRDLLHVNV+ T          TT NYDLQIPVSDL+LE+ +LSVTVKG+NV ETT TT  TYNIGIN+A+N+  P+T PT        ++A   +  LV L YAT A G   +TTL+N+ I   LGIYN  F   + + V           +G    YTITLSATP  GYVWEDG++ AK +SF+V   + +
  S:    15 TGAFGIVATVPVIVSACSSTSDNNTGGGDN---TQTKTITPQIKSTSTLSGALSSIYNPANSS--NTNALIADEIKKNLTEVFDNGDALNNVNDLEITVTHSFPESTWTGLTFNSDTGNWGNSTNAQDNVEIQEANKLLYPTQTTELNISSLSDLKEQLNDDAKLEKILDDAGATVDADTVYSVNNGLGFTNKNSGSENRDLLHVNVVGTKTTAGQTPTTTTTNYDLQIPVSDLDLEISNLSVTVKGSNVTETTATTNFTYNIGINDAENYVDPSTKPTA-----TEEEAGKLDDVLVKLGYATAATGGATETTLNNDAIIQGLGIYNVTFARTTTEGVQGIVPKEDASNNGNEKTYTITLSATPNQGYVWEDGTSNAKDISFDVILDITA 395
>gi|26554108|ref|NP_758042.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454116|dbj|BAC44446.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (378 aa)
Score = 612, Expect = 1.6e-61, Identities = 206/365 (56%), Positives = 260/365 (71%)
  Q:    14 LTGAFGIVATVPVIVSSCSSTS-DNNTGGDNNGGGTQTQTITPQIQSAVTLNGALSDIYDTANSSSENTNAKIAEEIKNNLETVFTNGAALSDVSDLEITVSHNFP-ESTWIG-TAYSGDSGWYSAQ-MDTVLYDYTLNPLTISSLSDLKTQLSDSKIQEIFTAAGTTTTTNATYAV--QNALGFTNKNNGAE---NRDLLHVNVLETVPGQSGGDPTTKNYDLQIPVSDLNLELKDLSVTVKGTNVAETTLTTT-LTYNIGINEAQNFTQPTTNPTVQGSDIQNDDANAANKALVALTYATEADGQTTLDNEKISAELGIYNSVFTAVSIKPVDGG-NNQYTITLSATPKDGYVWEDGSNTAKQVSFNVTFTVNS 378
           +TGAFGIVATVPVIVSSCSSTS +N  G +N GG TQ QTI+ Q++S+VTL+GALS+IY+   +S  NTN  +A +IK+NL +VF NG AL++V DLEITV+ NFP  S W G TA++G++GW + Q +  VLYD+    L ISSL+DLKTQL+  KI  I T A +   +   + V   +ALG TN  +  +   +RDLLH++V  T          T NYDLQIPVSDLNL + DL+VTV GTNV +T  TTT  TYNIGINE  NF QPT  P++  +D   D     NKALVAL YA E+DG  TL+NE ISA +G+YNS F+  +I    GG +NQ+TITLSATPK+GYVWEDG+  AK +SF VTFTV +
  S:    14 MTGAFGIVATVPVIVSSCSSTSDNNTGGDNNGGGNTQNQTISTQLRSSVTLSGALSNIYNP--TSGSNTNTLLAAQIKSNLNSVFENGEALANVDDLEITVNGNFPTTSEWTGTTAFAGNNGWNATQGLTDVLYDWNTAALNISSLNDLKTQLTSEKITSIITEASSAPASGTVFTVVENSALGLTNNADSIDANASRDLLHIHVTGT------EGSNTTNYDLQIPVSDLNLVVSDLTVTVTGTNVEQTGSTTTNFTYNIGINETANFVQPTQAPSINSADTNGD----GNKALVALGYANESDGNYTLNNEAISAGIGVYNSEFSNPTIAATQGGSSNQFTITLSATPKEGYVWEDGTRDAKSISFPVTFTVTT 377
>gi|26554133|ref|NP_758067.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454141|dbj|BAC44471.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (439 aa)
Score = 576, Expect = 2.4e-57, Identities = 181/329 (55%), Positives = 223/329 (67%)
  Q:    50 TQTITPQIQSAVTLNGALSDIYDTANSSSENTNAKIAEEIKNNLETVFTNGAALSDVSDLEITVSHNFPESTWIGTAYSGDSG-----WYSAQMDT----------VLYDYTLNPLTISSLSDLKTQLSDSKIQEIFTAAGTTTTTNATYAVQNALGFTNKNNGAENRDLLHVNVLETVPGQSGGDPTTKNYDLQIPVSDLNLELKDLSVTVKGTNVAETTLTTTLTYNIGINEAQNFTQPTTNPTVQGSDIQNDDANAANKALVALTYATEAD--GQTTLDNEKISAELGIYNSVFTAVS---IKPVDGGNNQ-----YTITLSATPKDGYVWEDGSNTAKQVSFNVTFTVNS 378
           T+TITP+I+S VTL GALS+IYDTAN+S  NTN  IA+EIK NL  VF NG AL D+S L+I+V+H FP+STW G  ++  S      W + Q D           +LY     PLTISSLSDLKTQL+DSK++EI     T    N TY+V NALGFTNK  G++N+DLLHVNV+ T   + G + TT NYDLQIPVSDLNL+L DL VTVKG NV  +TL TTLTYNIGIN++ N       P    S     DA   +  LV   YA E     + TL+NE +   LGIYN  F+  S   I+P     N+     YTITLSA P DGYVWEDG++TAK +SF+V   + +
  S:    90 TETITPKIKSTVTLGGALSNIYDTANTS--NTNNLIADEIKKNLSEVFDNGEALKDISSLDISVNHKFPDSTWTGLPFNHSSDGSSVFWGNDQADQTSILIEPENKLLYPSKTQPLTISSLSDLKTQLNDSKLKEILKDTETKPEANTTYSVDNALGFTNKALGSDNKDLLHVNVVGTTKVE-GSEDTTTNYDLQIPVSDLNLKLTDLEVTVKGDNVTTSTLRTTLTYNIGINDSTNQDNEGAKPQATES-----DAGKLDTILVKFGYANEGTQGQEATLNNENLIEGLGIYNVTFSKDSNSKIEPKTNSGNEENEKTYTITLSAKPNDGYVWEDGTSTAKNISFDVILDITA 435
>gi|26554126|ref|NP_758060.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454134|dbj|BAC44464.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (388 aa)
Score = 502, Expect = 8.3e-49, Identities = 182/363 (50%), Positives = 240/363 (66%)
  Q:    14 LTGAFGIVATVPVIVSSCSSTSDNNTGGDNNGGGTQTQTITPQIQSAVTLNGALSDIYDTANSSSENTNAKIAEEIKNN-LETVFTNGAALSDVSDLEITVSHNFPESTWIGTAYSGDS-GWYSAQMDT-------VLYDYTLNPLTISSLSDLKTQLS-DSKIQEIFTAAGTTTTTN-ATYAVQNALGFTNKNNGAENRDLLHVNVLETVPGQSGGDPTTKNYDLQIPVSDLNLELKDLSVTVKGTNVAETTLTTT-LTYNIGINEAQNFTQPTTNPTVQGSDIQNDDANAANKALVALTYATEADGQTTLDNEKISAELGIYNSVFTAVS------IKP---VDGGNNQYTITLSATPKD-GYVWEDGSNTAKQVSFNVTFTV 376
           +TGAFGIVATVPVIVSSCSSTSDNNTGGD NGGGTQTQTITPQ++ +V+L+G LSDI+D+  + ++N N KIA +IK+N L  VF NG AL  VSDL++TV+ +F   +W G  Y   S GW S   D        ++Y      L ISSL+DLKTQLS  + ++E    AG +T  +  T AV N +G T+        DLLH+NV  T    SG   TT NYDLQIPVS++NL + +L++TV GTNV E T TTT   +N+GI+   +F Q  T P V  ++ + + A  A+  L  L Y +  +   TL ++KISA LGIYN  FT  S      ++P   + G N  Y +T++ATP D  YVW+DG+   K +SF+V   V
  S:    14 MTGAFGIVATVPVIVSSCSSTSDNNTGGDGNGGGTQTQTITPQLKDSVSLSGPLSDIFDS--TGTQNANEKIAADIKDNHLSDVFDNGDALKQVSDLKVTVAGDFKRDSWSGGTYDAASGGWKSDSGDVTISAANKLVYASESPQLNISSLNDLKTQLSVKATLKEALEKAGVSTIADTTTLAVNNNIGLTD--------DLLHINVSSTPQVASGQTATTTNYDLQIPVSNINLVVNNLTITVAGTNVGEATKTTTNFKFNVGIDATLSFKQTGTAPDVSKTESEAEQATLASTILQKLGYVSSGN---TLSDDKISAALGIYNCKFTPKSATENTEVQPDSGITGSNKVYKVTVTATPYDTNYVWDDGTTGPKDISFDVNLKV 385
>gi|26554107|ref|NP_758041.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454115|dbj|BAC44445.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (386 aa)
Score = 496, Expect = 4.3e-48, Identities = 171/361 (47%), Positives = 239/361 (66%)
  Q:    15 TGAFGIVATVPVIVSSCSSTSDNNTGGDNNGGGTQTQTITPQIQSAVTLNGALSDIYDTANSSSENTNAKIAEEI-KNNLETVFTNGAALSDVSDLEITVSHNFPESTWIGTAYSGDSGWYSA--------------QMDTVLYDYTLNPLTISSLSDLKTQLSD-SKIQEIFTAAGTTTTTN-ATYAVQNALGFTNKNNGAENRDLLHVNVLETVPGQSGGDPTTKNYDLQIPVSDLNLELKDLSVTVKGTNVAETTLTTT-LTYNIGINEAQNFTQPTTNPTVQGSDIQNDDANAANKALVALTYATEA----DGQTTLDNEKISAELGIYNSVF--TAVSIKPVDGGNNQYTITLSATPKDGYVWEDGSNTAKQVSFNVTFT 375
           TGAFGIVATVPVIVS+CSSTSDNNTGG+  G GTQ QTI P+++ +V L+GALSDI+D+  + ++N N KIA +I +N+L  VF NG  LS V DL ++V+ NF  S+W G  ++G+SG + +              + + ++Y        ISSL D KT+LS   K++    AAG  T  N  T AV N +GFT+        DLLH+NV  T  G S   PT  NYDLQIPVS+LN+ + +L++TV GTN+ E   TTT  ++NIGI++       T + + + + +   + N A +ALVAL  A+ +    +   T+DN+ +SA +G+YN  F   + +I PV   N+ +TITL ATP +GYVW+DGSN +K V+ N TFT
  S:    15 TGAFGIVATVPVIVSACSSTSDNNTGGNTGGDGTQNQTINPELRESVNLSGALSDIFDS--TGAQNANQKIAADIQQNHLNDVFVNGQELSQVEDLTVSVTGNFSRSSWDGLTFNGESGNWGSVGEDGNITDSVNIEEANKLIYTSESEQFDISSLDDFKTKLSTGDKLKTALEAAGAGTIDNTTTLAVANNIGFTDD-------DLLHINVTATPAGDS---PTVTNYDLQIPVSNLNIVVPNLTITVAGTNIGEANRTTTNFSFNIGIDD-------TVSESNESASLATANRNDAKQALVALGLASSSTEGGNTTYTIDNDAVSAVVGVYNCRFDIDSATIAPVGESNDNFTITLQATPLEGYVWDDGSNGSKPVTINATFT 380
>gi|26554134|ref|NP_758068.1| P35 lipoprotein homolog reported as gene for P33 lipoprotein [Mycoplasma penetrans HF-2] >gi|27805657|sp|Q50368|P33_MYCPE Lipoprotein p33 precursor >gi|26454142|dbj|BAC44472.1| P35 lipoprotein homolog reported as gene for P33 lipoprotein [Mycoplasma penetrans HF-2] (376 aa)
Score = 489, Expect = 3.1e-47, Identities = 181/362 (50%), Positives = 220/362 (60%)
  Q:    15 TGAFGIVATVPVIVSSCSSTSDNNTGGDNNGGGTQTQ-------TITPQIQSAVTLNGALSDIYDTANS--SSENTNAKIAEEIKNNLETVFTNGAALSDVSDLEITVSHNF-PESTWIGTAYSGDSGWYSAQMDTV--LYDYTLNPLTISSLSDLKTQLSDS-KIQEIFTAAGT--TTTTNATYAVQNALGFTNKNNGAENRDLLHVNVLETVPGQSGGDPTTKNYDLQIPVSDLNLELKDLSVTVKGTN-------VAETTLTTTLTYNIGINEAQNFTQPTTNPTVQGSDIQNDDANAANKALVALTYATEADGQTTLDNEKISAELGIYNSVFTAVSIKPVDGGNNQYTITLSATPKDGYVWEDGSNTAKQVSFNVTFTV 376
           TGAFGIVATVPVIVSSCSST +N   GDNN GG  +        T TP I+S VTL+GALS IYDT N+  S +NTN  IAE+IK N E  FTNG  L  V    +TV  +F   S W G AYS     +SA  DT   +Y  T   L I+SL DLK+QL  S KI+ I   +    +T    +Y +QN LGFT         DLLH+NV  T  G+      T N DL IPVSDLNL++ DL V+V  +N        A + LTT  TYNIGI E    T PT  P     ++   D     K L AL Y    D +T LDN+K+S  LG+YN  FTAVS  PV+G  +++TI L A P   YVWEDG+NT K++SF  TFT+
  S:    15 TGAFGIVATVPVIVSSCSSTDNNGGTGDNNTGGGGSGTDQQQGTTYTPAIKSDVTLSGALSKIYDTTNTGDSRKNTNTLIAEDIKANPENYFTNGEDLKKVEGWSVTVDGSFDSNSVWTGDAYSK----WSAVADTHKGVYKSTSKQLNINSLKDLKSQLDTSAKIKAICDESNLVFSTADADSYKIQNELGFTGG-------DLLHINVTATQAGK------TLNMDLGIPVSDLNLKITDLKVSVTASNNSTGNNVAAVSDLTTNFTYNIGIKE--EVTAPTEKP-----NLAKTDKGEVMKVLKALGYTQTGD-ETKLDNDKVSNSLGLYNCEFTAVSATPVEGSEDKFTIKLKAKPLTDYVWEDGTNTEKEISFEATFTM 373
>gi|26554109|ref|NP_758043.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454117|dbj|BAC44447.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (353 aa)
Score = 487, Expect = 4.6e-47, Identities = 169/343 (49%), Positives = 225/343 (65%)
  Q:    15 TGAFGIVATVPVIVSSCSSTSDNNTGGDNNGGGTQTQTITPQIQSAVTLNGALSDIYDTANSSSENTNAKIAEEIK-NNLETVFTNGAALSDVSDLEITVSHNFPESTWIGTAYSGDSGWYS-----------AQMDTVLYDYTLNPLTISSLSDLKTQLS--DSKIQEIFTAAGTTTTTNATYAVQNALGFTNKNNGAENRDLLHVNVLETVPGQSGGDPTTKNYDLQIPVSDLNLELKDLSVTVKGTNVAETTLTTT-LTYNIGINEAQNFTQPTTNPTVQGSDIQNDDANAANKALVALTYATEA----DGQTTLDNEKISAELGIYNSVFTAVSIKPVDGGNNQYTITLSATPKDGYV 357
           TGAFGIVATVPVIVSSCSSTSDNNTGGD+N   TQTQTITP+++  V L+GAL+DIYD+  + ++N N KIA +IK N+L  VFTNG ALS VSDL +TV+ NF   +W G  ++G++G +            A+ + ++Y      + I SL+DL  +LS  D+    +  A         T A+ N LGFTN        DLLHVNV  T    +G +PT  NYDLQIPVS+LNL + +L++TV GTNV E   TTT   +NIGIN+       T + T +  ++  D+  +AN+ALVAL  AT +    +   T+DN+ +SA +G+YN  F + +I+ VD     YTITL ATP DGYV
  S:    15 TGAFGIVATVPVIVSSCSSTSDNNTGGDSN---TQTQTITPELRETVNLSGALTDIYDS--TGAQNANQKIAADIKENHLGDVFTNGEALSQVSDLTVTVNGNFSRDSWAGLTFNGETGNWEDSANNQNNITIAEANKLVYTSESEQIDIESLNDLHEKLSVRDTLKTALENAGVAQIPETTTLAINNNLGFTNG-------DLLHVNVSAT---PTGSNPTITNYDLQIPVSNLNLVVPNLTITVSGTNVGEANRTTTNFNFNIGIND-------TVSETDEKGELAADN-RSANEALVALGLATSSTDSGNTTYTIDNDAVSAVVGVYNCNFASPTIQAVDESAGTYTITLQATPLDGYV 353
>gi|26554129|ref|NP_758063.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454137|dbj|BAC44467.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (384 aa)
Score = 484, Expect = 1.2e-46, Identities = 174/364 (47%), Positives = 228/364 (62%)
  Q:    14 LTGAFGIVATVPVIVSSCSSTSDNNTGGDNNGGGTQTQTITPQIQSAVTLNGALSDIYDTANSSSENTNAKIAEEIKNN-LETVFTNGAALSDVSDLEITVSHNFPESTWIGTAYSGDSGWYS-----------AQMDTVLYDYTLNPLTISSLSDLKTQLS--DSKIQEIFTAAGTTTTTNATYAVQNALGFTNKNNGAENRDLLHVNVLETVPGQSGGDPTTKNYDLQIPVSDLNLELKDLSVTVKGTNVAETTLTTT-LTYNIGINEAQNFTQPTTNPTVQGSDIQNDDANAANKALVALTYATEADGQTTLDNEKISAELGIYNSVFTA------VSIKPVDGGNNQYTITLSATPKD-GYVWEDGSNTAKQVSFNVTFTVN 377
           +TGAFGIVATVPVIVSSCSSTSDNN   +   G  QTQTITP++   V L+G+LSDIYD+  + + N N KIA +IK+N L  VF NG ALS+VSDL +TVS  F  + W G  ++G++G +            A  + ++Y    + + I SL DL  +LS  ++    +  A   +     T AV N LGFTN        DLLHVNV  T  G S    T  NYDLQIPVS+LNL + +L++TV GTNV E   TTT   +N+GI+   NF+Q    P+    ++  DD  AA+  L  L Y T A G T L N+KISA LGIYN  FT        S    + GN  YT+T++A P D  YVW+DGS+ +K+ +F+V+ TVN
  S:    14 MTGAFGIVATVPVIVSSCSSTSDNNGNNNGGNGNQQTQTITPELNETVNLSGSLSDIYDS--TGTLNANQKIAADIKDNHLSDVFANGQALSEVSDLSVTVSGEFSRALWTGLTFNGETGNWEDSEDNSNNITIADANKLVYTSESDQINIESLDDLHNKLSVRETLKTALENAGVASIPETTTLAVSNNLGFTNG-------DLLHVNVTATPTGASA---TATNYDLQIPVSNLNLVVPNLTITVAGTNVGEANRTTTNFNFNVGIDPTLNFSQTGNAPSATTDEVTGDD--AASTILQKLGYTT-ATGSTDLSNDKISAALGIYNCKFTPTNATENTSATATNNGNKVYTVTVTAEPYDTSYVWDDGSSGSKEFTFDVSLTVN 384
>gi|26553722|ref|NP_757656.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26453729|dbj|BAC44060.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (368 aa)
Score = 477, Expect = 6.2e-46, Identities = 171/360 (47%), Positives = 217/360 (60%)
  Q:    15 TGAFGIVATVPVIVSSCSS--------TSDNNTGGDNNGGGTQTQTITPQIQSAVTLNGALSDIYDTANSSSENTNAKIAEEIKNNLETVFTNGAALSDVSDLEITVSHNFPE-STWIGTAYSGDSGWYSAQMDTVLYDYTLNPLTISSLSDLKTQLSDS-KIQEIFTAAGTTTTTNATYAVQNALGFTNKNNGAENRDLLHVNVLETVPGQSGGDPTTKNYDLQIPVSDLNLELKDLSVTVK------GTNVAETT-LTTTLTYNIGINEAQNFTQPTTNPTVQGSDIQNDDANAANKALVALTYATEADGQTTLDNEKISAELGIYNSVFTAVSIKPVDGGNNQYTITLSATPKDGYVWEDGSNTAKQVSFNVTF 374
           TGAFGIVATVPVIVSSCSS         ++N  GG+     TQ QTITP++++ VT  GALS IYDT  ++ E+TN  IA++IK N ET F NGA L  +    +TV  NF   ++W G  Y  D    +A +   +Y+ T   L I+SL DLK+QLS S +I+++   +  T +    Y VQN LGFT+        DLLHVNV       +  + T    D+ IPVSDLNL++  L V+V       G NVAE   LTT  TYNIGIN+      PT         +   D   ANK L AL YATEA    TLDN+K+S  LG+YN  F AVS K  +   N+YT+TL ATP DGYVWE+G+  AK+VSF  T 
  S:    15 TGAFGIVATVPVIVSSCSSTDNNGGTGNNNNQGGGNGGNTDTQQQTITPKLKADVTTQGALSKIYDT--TAKEDTNTLIAKDIKANPETYFENGADLKSIEGWTVTVDGNFDSAASWEGQTY--DEWSKTANIKKGVYEQTSAQLNIASLKDLKSQLSTSEQIKKLCEDSNLTFSDATEYKVQNQLGFTDG-------DLLHVNV------TAKQNTTNLVMDVAIPVSDLNLKITGLKVSVSKTENQTGNNVAEVKDLTTNFTYNIGINDTVKEITPTA--------VLAQDKTDANKVLKALGYATEAANVYTLDNDKLSDALGLYNCKFEAVSSKATNEA-NKYTVTLKATPNDGYVWENGTKDAKEVSFVATL 365
>gi|26554193|ref|NP_758127.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454202|dbj|BAC44531.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (365 aa)
Score = 477, Expect = 6.9e-46, Identities = 158/359 (44%), Positives = 220/359 (61%)
  Q:    15 TGAFGIVATVPVIVSSCSSTSDNNTGGDNNGGGT-------QTQTITPQIQSAVTLNGALSDIYDTANSSS-ENTNAKIAEEIKNNLETVFTNGAALSDVSDLEITVSHNF-PESTWIGTAYSGDSGWYSAQMDTVLYDYTLNPLTISSLSDLKTQLSDSKIQEIFTAAGTTTTTNATYAVQNALGFTNKNNGAENRDLLHVNVLETVPGQSGGDPTTKNYDLQIPVSDLNLELKDLSVTVKGTNVAET-TLTTTLTYNIGINEAQNFTQPTTNPTVQGSDIQNDDANAANKALVALTYATEADGQTTLDNEKISAELGIYNSVFTAVSIKPVDGGNNQYTITLSATPKDGYVWEDGSNTAKQVSFNVT 373
           TGAFGIV+ VP+IVSSCSST ++ T  +NNG          Q Q +TP+++S++  +G L  IYD+++ ++ + T+  + EE   N + +FTN   L D  D +I V   F   + W GT YSG  GW ++ + +V Y  +L+ + I+SL+DLKT+L ++ I +I TAA +   +N TY VQN L         EN DLLHVNVL T+    G    +   DLQIP+SDLNL + +LS++V GT+V         L +NIGINE  NF Q  T  T        D+   A+KALVAL YAT ++  TTL+N KIS+ +GIYN  F+A ++       N YTI L A P   YVWEDG+NT+K +S +VT
  S:    15 TGAFGIVSAVPLIVSSCSSTDNDETNNNNNGQDNQGNTENPQNQKVTPKLKSSINFSGDLGKIYDSSSGTNRKTTDTLLEEEFTKNPDLIFTNAKELED-KDFKIEVDGGFDTNNAWTGTPYSGTGGWKTSVLRSVFYAESLSSIDITSLNDLKTKLDNATISKIITAA-SLQFSNTTYTVQNQLSL-------ENGDLLHVNVLGTI----GNSSRSFTLDLQIPISDLNLVIPNLSISVSGTDVELIDKQEVNLDFNIGINENTNFNQGATTLT-------KDNVVDADKALVALGYATTSNNVTTLNNTKISSAIGIYNCTFSASTVVLKSTDTNTYTINLVAKPNTEYVWEDGTNTSKIISLDVT 363
>gi|26554136|ref|NP_758070.1| P35 lipoprotein homolog reported as IMP14 [Mycoplasma penetrans HF-2] >gi|26454144|dbj|BAC44474.1| P35 lipoprotein homolog reported as IMP14 [Mycoplasma penetrans HF-2] (375 aa)
Score = 469, Expect = 5.8e-45, Identities = 183/363 (50%), Positives = 230/363 (63%)
  Q:    15 TGAFGIVATVPVIVSSCSSTSDNNTGGDNNGGGT---------QTQTITPQIQSAVTLNGALSDIYDTANSSS-ENTNAKIAEEIKNNLETVFTNGAALSDVSDLEITVSHNF-PESTWIGTAYSGDSGWYSAQMDTVLYDYTLNPLTISSLSDLKTQLSDSK----IQEIFTAAGTTTTTNATYAVQNALGFTNKNNGAENRDLLHVNVLETVPGQSGGDPTTKNYDLQIPVSDLNLELKDLSVTVKGTNVAETT-------LTTTLTYNIGINEAQNFTQPTTNPTVQGSDIQNDDANAANKALVALTYATEADGQTTLDNEKISAELGIYNSVFTAVSIKPVDGGNNQYTITLSATPKDGYVWEDGSNTAKQVSFNVTFTVN 377
           TGAFGIVATVPVIVSSCSSTSDNN  G+NN             Q  T TP I++ V+L+G+LS IYDT    S +NTN  IA++I +N E  FTNGA L +V    +TV  NF  +STW G AYS    W +    + +Y      L I+SL+DLKTQLSDS     I +       ++ T ++Y VQN +GFT         DLLH+NV      Q G +  T+N +L IPVSDLNL++  L V+V GTN            LTT  TYNIGI +  +FTQPTT PT   ++      N  N+AL AL Y T+ DG  +LDN+KI+A +GIYN  F A SI+      N++TITL ATP + YVWEDG+  AK VSF+VTFTVN
  S:    15 TGAFGIVATVPVIVSSCSSTSDNNGNGNNNNDNNGGGSGTDQQQGTTYTPAIKTEVSLSGSLSKIYDTTTGDSRKNTNEMIAQDILSNPEDYFTNGADLKNVQGWSVTVDGNFDSQSTWTGEAYSA---WSANATFSGVYAIASEQLNITSLNDLKTQLSDSTKLKAICDAIPGLRFSSATASSYQVQNQVGFTGD-------DLLHINV----TAQDGNN--TRNMNLGIPVSDLNLKITGLKVSVNGTNNETGNNVESVENLTTDFTYNIGIKDTVDFTQPTTTPTTTEAN-----KNNVNEALKALGY-TKTDG--SLDNDKIAAAVGIYNCTFVASSIQEDSNTPNKFTITLKATPNENYVWEDGTREAKDVSFDVTFTVN 375
>gi|26554160|ref|NP_758094.1| signal-peptide-less P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454169|dbj|BAC44498.1| signal-peptide-less P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (692 aa)
Score = 464, Expect = 2.5e-44, Identities = 158/369 (42%), Positives = 221/369 (59%)
  Q:    10 KALALTGAFGIVATVPVIVSS--------CSSTSDNNTGGDNNGGGTQTQTITPQIQSAVTLNGALSDIYDTANSSSENTNAKIAEEIKNNLETVFTNGAALSDVSDLEITVSHNFPE-STWIGTAYSGDSGWYSA-QMDTVLYDYTLNPLTISSLSDLKTQLSDSKIQEIFTAAGTTT-TTNATYAVQNALGFTNKNNGAENRDLLHVNVLETVPGQSGGDPTTKNYDLQIPVSDLNLELKDLSVTVKGTNVAETTLTTTLTYNIGINEAQNFTQPTTNPTVQGSDIQNDDANAANKALVALTYA-TEADGQTTLDNEKISAELGIYNSVFTAVSIKP----VDGGNNQYTITLSATP--KDGYVWEDGSNTAKQVSFNVTFTVNS 378
           K LA+TG F + A  P+ + S         +  S+NN          Q QTITP+++S++ L+G++  IY + NSS  +T   IA+EIKNNL++ F N   L  V++L I+V  +F + S+W G  YSG +GW S    + VLY   LN L ISSL+DLK QL+D+KI+EI  A+ ++   TNA Y V+N  GFT+ N       L+H+NV E +        + KN DLQIP S +N  + ++ ++V G NV  T  TTTL YN+ IN   N TQ  + PT   S+I +      NK LV L +A   +D   TL+ + +  ELGIYN VF+  SI P     DG +  Y I+  ATP    G+VWEDG++TAK VSF+V   V +
  S:    16 KILAITGIFTVSAATPIALVSKYVIFKNSSNGNSNNNNNNGGGNTNPQNQTITPKLKSSINLSGSIDKIYSSQNSS--DTKTLIAQEIKNNLDSAFENSEELKSVNNLNISVEGDFGDNSSWAGIEYSGTNGWSSTVSGNEVLYSTDLNTLNISSLNDLKYQLTDAKIKEILNASDSSKLKTNAEYTVKNKPGFTSNN-------LIHINVFEIL------GSSVKNLDLQIPYSSVNFNISNMQISVSGDNVQTTNATTTLNYNVAINTETNSTQIASRPTATASEISD-----VNKVLVKLGFAEIGSDNNVTLNQKALQEELGIYNVVFSNASIAPSGTTTDGQSGAYKISFDATPIANKGFVWEDGTSTAKSVSFDVNVDVGN 382
Score = 376, Expect = 3.2e-34, Identities = 133/320 (41%), Positives = 186/320 (58%)
  Q:    53 ITPQIQSAVTLNGALSDIYDTANSSS--ENTNAKIAEEIKNNLETVFTNGAALSDVSDLEITVSHNFPESTWIGTAYSGDSGWYSAQMDTV--LYDYTLNPLTISSLSDLKTQLSDSKIQEIFTAAGTTTTTNATYAVQNALGFTNKNNGAENRDLLHVNVLETVPGQSGGDPTTKNYDLQIPVSDLNLELKDLSVTVKGTNVAE-TTLTTTLTYNIGINEAQNFTQPTTNPTVQGSDIQNDDANAANKALVALTYATEADGQT----TLDNEKISAELGIYNSVFTAVSIKPVDGGNNQYTITLSATPKDGYVWEDGSNTAKQVSFNV 372
           ITP +   + L G++S I+DT  +S   ++TN  IAE+IK N E  F+NG+ L  +SDL +TV+ NFP STW G+ Y     W S    T   +Y  +L  L ISSLSDLKT+++   I  +   +G  T + AT+A QN LGFT+        DLLHV V  T            N DL IP+S +NL +  L+V+V GT V   T   T  TYNIGI++  NFT+PTT      S +  ++    N+ALV+L +AT+         TLD+ KIS  LG+YN  F  ++I+  +   N YTITL ATP   Y W+ G+N +++++F V
  S:   383 ITPDLNQTINLTGSVSKIFDTTTTSGTRKDTNTVIAEDIKANPENYFSNGSDLKTISDLAVTVNGNFPTSTWTGSPY---ETWKSTVTSTNVGIYSPSLPQLNISSLSDLKTKINQLGIYNVLLTSG-LTYSGATFAFQNELGFTDD-------DLLHVCVRVT------STYGNVNVDLGIPLSSINLTVSALAVSVNGTGVQTLTNGNTNYTYNIGIDDTVNFTKPTTV-----SPLTEENKTNVNEALVSLGFATKNTNSNPNTYTLDSTKISKALGVYNCTFEGIAIQ--EDSANNYTITLKATPNANYNWDSGTNESRELTFKV 687
>gi|3850057|emb|CAA07195.1| putative lipoprotein [Mycoplasma penetrans] (360 aa)
Score = 447, Expect = 1.9e-42, Identities = 175/353 (49%), Positives = 222/353 (62%)
  Q:    14 LTGAFGIVATVPVIVSSCSSTSDNNTGGDNNGGGT---------QTQTITPQIQSAVTLNGALSDIYDTANSSS-ENTNAKIAEEIKNNLETVFTNGAALSDVSDLEITVSHNF-PESTWIGTAYSGDSGWYSAQMDTVLYDYTLNPLTISSLSDLKTQLSDSK----IQEIFTAAGTTTTTNATYAVQNALGFTNKNNGAENRDLLHVNVLETVPGQSGGDPTTKNYDLQIPVSDLNLELKDLSVTVKGTNVAETT-------LTTTLTYNIGINEAQNFTQPTTNPTVQGSDIQNDDANAANKALVALTYATEADGQTTLDNEKISAELGIYNSVFTAVSIKPVDGGNNQYTITLSATPKDGYVWEDGSNTAK 366
           LTGAFGIVATVPVIVSSCSSTSDNN  G+NN             Q  T TP I++ V+L+G+LS IYDT    S +NTN  IA++I +N E  FTNGA L +V    +TV+ NF  +STW G AYS    W +    + +Y      L I+SL+DLKTQLSDS     I +       ++ T ++Y VQN +GFT         DLLH+NV      Q G +  T+N +L IPVSDLNL++  L V+V GTN            LTT  TYNIGI +  +FTQPTT PT   ++      N  N+AL AL Y T+ DG  +LDN+KI+A +GIYN  F A SI+      N++TITL ATP + YVWEDG+  AK
  S:     1 LTGAFGIVATVPVIVSSCSSTSDNNGNGNNNNDNNGGGSGTDQQQGTTYTPAIKTEVSLSGSLSKIYDTTTGDSRKNTNEMIAQDILSNPEDYFTNGADLKNVQGWSVTVNGNFDSQSTWTGEAYSA---WSANATFSGVYAMASEQLNITSLNDLKTQLSDSTKLKAICDAIPGLRFSSATASSYQVQNQVGFTGD-------DLLHINV----TAQDGNN--TRNMNLGIPVSDLNLKITGLKVSVNGTNNETGNNVESVENLTTDFTYNIGIKDTVDFTQPTTTPTTTEAN-----KNNVNEALKALGY-TKTDG--SLDNDKIAAAVGIYNCTFVASSIQEDSNTPNKFTITLKATPNENYVWEDGTREAK 351
>gi|26554159|ref|NP_758093.1| signal-peptide-less P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454168|dbj|BAC44497.1| signal-peptide-less P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (713 aa)
Score = 442, Expect = 8.0e-42, Identities = 153/376 (40%), Positives = 226/376 (60%)
  Q:     1 MKIKKIKLLKALALTGAFGIVATVPV------IVSSCSSTSDNNTGGDNNGGGT--------------------------QTQTITPQIQSAVTLNGALSDIYDTANSSSENTNAKIAEEIKNNLETVFTNGAALSDVSDLEITVSHNFPE-STWIGTAYSGDSGWY-SAQMDTVLYDYTLNPLTISSLSDLKTQLSDSKIQEIFTAAGTTT-TTNATYAVQNALGFTNKNNGAENRDLLHVNVLETVPGQSGGDPTTKNYDLQIPVSDLNLELKDLSVTVKGTNVAETTLTTTLTYNIGINEAQ-NFTQPTTNPTVQGSDIQNDDANAANKALVALTYA-TEADGQTTLDNEKISAELGIYNSVFTAVSIKPVDGGNNQ---YTITLSATP--KDGYVWEDGSNTAKQVSFNVTFTV 376
           MK K+ KLLK L++ G F + A VP+      ++ + +S+S+ N   ++                               Q  +I P+++S++ L+G +  IY++ N+S   TN  IAEEIK NLE  F N   L +V+DL ITV+ NF + S+W G  Y G +GW  S   + +LY  +LN L ISSL+DLK QL+D+KI+EI  ++ ++    +A Y V+N LGFTN N       L+HVN++E +          +N+DLQIP+S +N  + ++S++V GT+V  T  TT   YNI IN  + N  QPT+ P    S++ N     A+K LV L YA    +    L+ E +  E GIYN  F+   I P    N Q   Y ITL ATP    G++W+DG+ + K VSF+V   +
  S:     1 MKSKRSKLLKILSVIGIFAVSAAVPITLVSKYVIFTKTSSSNGNVDDNSGNNNGNDNSNPNDNNGNNDGGNDSNNNNTTPQDGSIVPRLKSSINLSGTVDKIYNSQNASE--TNNLIAEEIKTNLEQAFDNSTELENVNDLNITVNGNFADTSSWGGNPYDGTNGWSGSTTGNEILYSTSLNQLNISSLNDLKHQLTDAKIKEILRSSDSSKLNESAEYTVKNKLGFTNNN-------LVHVNIMEIL------GSGVRNFDLQIPISSINFNVSNMSISVSGTDVQTTNATTNFNYNIAINNTESNTPQPTSTPKASSSEVTN-----ADKILVKLGYADVGTNNSIVLNQELLQEEFGIYNVEFSNAKIAPNTSTNRQVGSYKITLDATPIANKGFIWQDGTTSTKSVSFDVNVDI 398
Score = 382, Expect = 8.3e-35, Identities = 127/320 (39%), Positives = 182/320 (56%)
  Q:    53 ITPQIQSAVTLNGALSDIYDTANSSS--ENTNAKIAEEIKNNLETVFTNGAALSDVSDLEITVSHNFPE-STWIGTAYSGDSGWYSAQMDTVLYDYTLNPLTISSLSDLKTQLSDSKIQEIFTAAGTTTTTNATYAVQNALGFTNKNNGAENRDLLHVNVLETVPGQSGGDPTTKNYDLQIPVSDLNLELKDLSVTVKGTNVAETTL-TTTLTYNIGINEAQNFTQPTTNPTVQGSDIQNDDANAANKALVALTYATEADGQT----TLDNEKISAELGIYNSVFTAVSIKPVDGGNNQYTITLSATPKDGYVWEDGSNTAKQVSFNV 372
           I+P + + + L G LS IYD   +S   ++TN  IAE+IK NL+T F+NG  L  V +L ++ S +FP  S+W GT YS    W ++   + +Y  +L  + ISSL+DLKT+ +   I  +   +G   + ++T+ VQN LGFT         DLLH+N+       + G       DLQIP S++NL +  L VT  G+NVA   + TT  TYNIGI +  +F +PTT  T     +   +    N+ALV+L +AT          TLD+EKISA LG++N  F  +SI   +   N YTI L A+P   Y WE GS+  K++SF V
  S:   401 ISPALNTTLNLTGPLSKIYDVEGTSGSRKSTNTLIAEDIKANLDTYFSNGNDLKTVENLSVSASGSFPTTSSWTGTEYST---WSTSVQYSAVYGQSLGQINISSLNDLKTKWNSQGIYNVLLGSGLRFS-DSTFTVQNLLGFTGG-------DLLHMNIF-----VNSGYTANFTVDLQIPASNINLTVPTLRVTANGSNVASLQVDTTNFTYNIGIKDTVDFVKPTTGVTA----LAPANKTNVNEALVSLGFATRNTSSNPYTYTLDSEKISAALGVFNCTFEGISITEDESNPNNYTIVLKASPNANYNWESGSSDPKELSFKV 708
>gi|26554156|ref|NP_758090.1| signal-peptide-less P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454165|dbj|BAC44494.1| signal-peptide-less P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (697 aa)
Score = 440, Expect = 1.5e-41, Identities = 133/325 (40%), Positives = 197/325 (60%)
  Q:    53 ITPQIQSAVTLNGALSDIYDTANSSS-ENTNAKIAEEIKNNLETVFTNGAALSDVSDLEITVSHNFPESTWIGTAYSGDSGWYSAQMDTVLYDYTLNPLTISSLSDLKTQLSDSKIQEIFTAAGTTTTTNATYAVQNALGFTNKNNGAENRDLLHVNVLETVPGQSGGDPTTKNYDLQIPVSDLNLELKDLSVTVKGTNV-AETTLTTTLTYNIGINEAQNFTQPTTNPTVQGSDIQNDDANAANKALVALTYATEADGQTTLDNEKISAELGIYNSVFTAVSIKPVDGGNNQYTITLSATPKDGYVWEDGSNTAKQVSFNVTFTVN 377
           ITP + S + L G+LS I+DT+ S + ++TN  IAE+IK+NL   F+NG  L  V DL++TV+ NFP STW G AY     W S+   T +Y      + I+SL+DLKT+L+   +  I  AAG   +  +++A+QN +G +         DLLHVN+   +  +   +P T   DL IPVSD+NL++ +L V+V G+NV A +  +   TYN+GI++  NF +PTT  T     + + +    N+ALV+L +AT++    TL+ +KISA LG++N  F  +SI+      N +TITL ATP   Y WEDG+N  K++SF V  TV+
  S:   390 ITPSLNSTLDLKGSLSRIFDTSGSGTRKDTNTVIAEDIKSNLNNYFSNGNDLKTVEDLDVTVNGNFPTSTWTGVAYDT---WKSSTSYTGIYSSESAQIDITSLNDLKTKLTTKGLYGILLAAGLKFS-GSSFAIQNEIGLSGG-------DLLHVNI--RITSEWTTNPFT--VDLAIPVSDINLKVSNLGVSVSGSNVKALSNGSVNYTYNVGIDDTVNFVKPTTGVTA----LSSANKTNVNEALVSLGFATKSGTNYTLNKDKISAALGVFNCTFEGISIQEDASTANNFTITLKATPNTNYYWEDGTNVPKELSFKVDLTVS 697
Score = 400, Expect = 5.6e-37, Identities = 151/377 (40%), Positives = 223/377 (59%)
  Q:     1 MKIKKIKLLKALALTGAFGIVATVPVIVSSCSSTSDNNTGGDNNGGGT------------QTQTITPQIQSAVTLNGALSDIYDTANSSSENTNAKIAEEIKNNLETVFTNGAALSDVSDLEITVSHNFPES-TWIGTAYSGDSGWYSAQM-DTVLYDYTLNPLTISSLSDLKTQL-SDSKIQEIFTAAGTTT-TTNATYAVQNALGFTNKNNGAENRDLLHVNVLETVPGQSGGDPTTKNYDLQIPVSDLNLELKDLSVTVKGTNV-AETTLTTTLTYNIGINEAQNFTQPTTNPTVQGSDIQNDDANAANKALVALTYA-TEADGQTTLDNEKISAELGIYNSVFT--AVSIKP----VDGGNNQYTITLSA--TPKDGYVWEDGSNTAKQVSFNVTFTVN 377
           MK ++ KLLK L++TG F   A VP+ + S    S + T   N                 Q QTI P+++S++ L+G+L  I+D  NSSS NTN+ IA+EIKNNL+  F N + L  V++L I+V   F    TW    Y  + GW    + + +LY  +L+   ISSL D K+QL +D+K+++I + +  +   + ATY++      +  N G    +L+HVNV+ET          TK+ DLQIP+S++NL + ++ V+V G NV  +T  TT  +YN+GI++   FT P   P    S+++     +ANK LV L YA   A+ Q TL+ + +  ELGIYN  F+    SI P     DG    Y I+L A  TP   +VWEDG++  K VSFNV  +V+
  S:     1 MKSQRKKLLKILSITGIFVATAAVPITLLSKYVISASLTNSKNQNNQDNNNQDGGGDTTPQAQTIVPKLKSSINLSGSLDKIFDAKNSSSSNTNSLIAQEIKNNLDKSFDNASDLEKVNNLSISVDGGFSGGVTWGNKQYDQNIGWGKETVGNEILYGSSLDQFNISSLDDFKSQLNNDTKLKDIISKSDASKFDSTATYSIA-----SGSNLGLVGDNLVHVNVIET-----DASSNTKSIDLQIPISNINLNVSNMIVSVSGDNVETQTNKTTNFSYNVGISDQSQFTNPVDAPVASASEVK-----SANKILVKLGYAEVAANNQITLNQDLLKEELGIYNVTFSNANASIAPNGSTTDGTTGSYKISLDATPTPNKDFVWEDGTSDTKPVSFNVNVSVD 388
>gi|986921|gb|AAC16392.1| p35 lipoprotein [Mycoplasma penetrans] >gi|1583185|prf||2120285A lipoprotein (362 aa)
Score = 434, Expect = 6.9e-41, Identities = 153/361 (42%), Positives = 195/361 (54%)
  Q:    15 TGAFGIVATVPVIVSSCSSTSD---NNTGGDNNGGGTQTQTITPQIQSAVTLNGALSDIYDTANSSS-ENTNAKIAEEIKNNLETVFTNGAALSDV-SDLEITVSHNFPESTWIGTAYSGDSGWYSAQMDTVLYDYTLNPLTISSLSDLKTQLSDSKIQEIFTAAGTTTTTNATYAVQNALGFTNKNNGAE-NRDLLHVNVLETVPGQSGGDPTTKNYDLQIPVSDLNLELKDLSVTVKGTNVAETTLTTTLTYNIGINEAQNFTQPTTNPTVQGSDIQNDDANAANKALVALTYATEADGQTTLDNEKISAELGIYNSVFTAVSIKPVDGGNNQYTITLSATPKDGYVWEDGSNTAK-QVSFNVTFT 375
           TGAFGIVATVPVIVSSCSSTS+   N  G     G TQ   +TP I+S V+L GALS IYDT   +  E T+  I ++IK N E  FTNG AL DV +   +TV   F EST+ G AYS  S    A +    Y      L I S++DL+T L DS       A            + N   +   NNG   + DLLH+NV       +    T  + DL IPVSDLNL++  L ++V GT +  + LTT   +NIGI+       P      +       D   A K L  L YAT +    TLD +K++  LG+YN  F AV  +     NN+YT+TL ATP DGY WEDG+N AK ++SF  TF+
  S:    15 TGAFGIVATVPVIVSSCSSTSENNGNGNGNGGTDGNTQQTEVTPAIKSEVSLTGALSKIYDTKTGTDRETTSQLIVKDIKANPENYFTNGEALKDVIASATVTVDGGFTESTFTGEAYSVWSA--KADVKKGTYSQASKQLDIKSINDLQTVLGDS------AAIKGICDLIPNLKLNNGTDYKVTNNGLSLSEDLLHINV------TAKDGQTDVSMDLAIPVSDLNLKIDGLKISVSGTGIKTSELTTNYKFNIGIDNTVKTLTPAAVTLAEA------DRTNAEKVLEKLGYATVSGSTYTLDQDKLADALGLYNCKFEAVKSEKDSTNNNKYTVTLKATPNDGYFWEDGTNGAKEEISFVATFS 362
>gi|26554135|ref|NP_758069.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|27805656|sp|Q50367|P35_MYCPE Lipoprotein p35 precursor >gi|26454143|dbj|BAC44473.1| P35 lipoprotein [Mycoplasma penetrans HF-2] (362 aa)
Score = 434, Expect = 7.2e-41, Identities = 153/361 (42%), Positives = 195/361 (54%)
  Q:    15 TGAFGIVATVPVIVSSCSSTSD---NNTGGDNNGGGTQTQTITPQIQSAVTLNGALSDIYDTANSSS-ENTNAKIAEEIKNNLETVFTNGAALSDV-SDLEITVSHNFPESTWIGTAYSGDSGWYSAQMDTVLYDYTLNPLTISSLSDLKTQLSDSKIQEIFTAAGTTTTTNATYAVQNALGFTNKNNGAE-NRDLLHVNVLETVPGQSGGDPTTKNYDLQIPVSDLNLELKDLSVTVKGTNVAETTLTTTLTYNIGINEAQNFTQPTTNPTVQGSDIQNDDANAANKALVALTYATEADGQTTLDNEKISAELGIYNSVFTAVSIKPVDGGNNQYTITLSATPKDGYVWEDGSNTAKQ-VSFNVTFT 375
           TGAFGIVATVPVIVSSCSSTS+   N  G     G TQ   +TP I+S V+L GALS IYDT   +  E T+  I ++IK N E  FTNG AL DV +   +TV   F EST+ G AYS  S    A +    Y      L I S++DL+T L DS       A            + N   +   NNG   + DLLH+NV       +    T  + DL IPVSDLNL++  L ++V GT +  + LTT   +NIGI+       P      +       D   A K L  L YAT +    TLD +K++  LG+YN  F AV  +     NN+YT+TL ATP DGY WEDG+N AK+ +SF  TF+
  S:    15 TGAFGIVATVPVIVSSCSSTSENNGNGNGNGGTDGNTQQTEVTPAIKSEVSLTGALSKIYDTKTGTDRETTSQLIVKDIKANPENYFTNGEALKDVIASATVTVDGGFTESTFTGEAYSVWSA--KADVKKGTYSQASKQLDIKSINDLQTVLGDS------AAIKGICDLIPNLKLNNGTDYKVTNNGLSLSEDLLHINV------TAKDGQTDVSMDLAIPVSDLNLKIDGLKISVSGTGIKTSELTTNYKFNIGIDNTVKTLTPAAVTLAEA------DRTNAEKVLEKLGYATVSGSTYTLDQDKLADALGLYNCKFEAVKSEKDSTNNNKYTVTLKATPNDGYFWEDGTNGAKEDISFVATFS 362
>gi|26554123|ref|NP_758057.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454131|dbj|BAC44461.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (388 aa)
Score = 428, Expect = 3.6e-40, Identities = 161/363 (44%), Positives = 211/363 (58%)
  Q:    15 TGAFGIVATVPVIVSSCSSTSDNNTGGDNNGGGTQTQTITPQIQSAVTLNGALSDIYDTA---NSSSENTNAKIAEEIKNNLETVFTNGAALSDVSDLE---ITVSHNFPESTWIGTAYSGDS-GWYSAQMD---TVLYDYTLNPLTISSLSDLKTQL------SDSKIQEIFTAAGTTTTTNATYAVQNALGFTNKNNGAENRDLLHVNVLETVPGQSGGDPTTKNYDLQIPVSDLNLELKDLSVTVKGTNVAETTLTTT-LTYNIGINEAQNFTQPTTNPTVQGSDIQNDDANAANKALVALTYATEADGQTTLDNEKISAELGIYNSVFTAVSIKPVDG---------GNNQYTITLSATP-KDGYVWEDGSNTAKQVSFNVTFTVN 377
           TGAFGIVATVP+IVSSCSSTSDNNTGG  N  G QTQ +TP ++  V L G+LS I+DT     SS ++TN  I+E+IK N E  FTNG   +    +E   I V  NF  ++W G AY+  S GW    ++    ++Y  +   LT   L  LKT+L      + + +Q    AAG T   + T  ++N +GFT+        DL+H+NV     G      T   YDLQIP S+LNL +  L++ V G N+     TTT   YNIGI+    F Q       + ++  +D A AA   LV L Y T   G + L N+KISA LGIYN  FT  S     G          N  YT+T++ATP  D YVW+DGS+  K  SF+V+  VN
  S:    15 TGAFGIVATVPIIVSSCSSTSDNNTGG--NQDGQQTQKVTPVLKDEVDLKGSLSKIFDTTATDASSRKSTNTLISEDIKANPENYFTNGNETNVKEAIEKATIDVEGNFSNASWTGNAYNTTSNGWDGVTIEDANKLIYTTSSAQLTFKDLDGLKTELEKNGTDNKTVLQNALEAAGATIEADTTLTIKNRVGFTSG-------DLIHINVEADKSG------TQTQYDLQIPTSNLNLSVTGLTIKVSGDNINTNEKTTTNFKYNIGIDSTLGFEQAKGAAPEETANNLSDAATAAKNILVKLGYVTTTGG-SDLSNDKISAALGIYNCNFTPKSATEKQGATPDAGVTDANKVYTVTVTATPFNDTYVWDDGSSGEKDFSFDVSLKVN 388
>gi|26554196|ref|NP_758130.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454205|dbj|BAC44534.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (382 aa)
Score = 417, Expect = 7.0e-39, Identities = 165/364 (45%), Positives = 211/364 (57%)
  Q:    15 TGAFGIVATVPVIVSSCSSTSDNNTGGDNNGGGTQTQTITPQIQSAVTLNGALSDIYDTANSSSENTNAKIAEEIKNNLETVFTNGAALSDV-SDLEITVSHNFPESTWI-GTAYSGDSGWYSAQMDTV--------LYDYTLNPLTISSLSDLKTQLSDSKI--QEIFTAAGTTTTTNATYAVQNALGFTNKNNGAENRDLLHVNVLETVPGQSGGDPTTKNYDLQIPVSDLNLELKDLSVTVKGTNV-AETTLTTTLTYNIGINEAQNFTQPTTNPTVQGSDIQNDDANAANKALVALTYATEADGQTTLDNEKISAELGIYNSVFTAVSIKPVD-----GGNNQYTITLSATPKDG-YVWEDGS--NTAKQVSFNVTFTVNS 378
           TGAFGIVATVPVIVSSCSSTS+NN  G+ NGG  QTQ +TP ++  V+L GAL+ IYDT+ +  +NTN  IA++IK N E  FTNGA L +V SD  +TV   F  ++W  G +Y   +G +     TV        +Y  +   + I+SL  LKT+L  + +    +  A  TT  +  T  V+N LGFTN        DL+H+NV  T    +       NYDLQIP SD+NL + DLSVTV G N+ A T  TT  TYNIGI+   +F Q              DDA   NK L  L Y +      +LDN  I   LGIYN  F+  SI+             YTITL A P+   YVW DGS  NTAK++SF+V   V +
  S:    15 TGAFGIVATVPVIVSSCSSTSENNN-GNGNGGADQTQKVTPVLKDDVSLEGALNKIYDTSTTDRKNTNTLIADDIKANPENYFTNGAELKNVISDATVTVDGKFSNASWASGLSYDATTGNWKDDTTTVTIQDSNKLVYASSSKQINITSLDGLKTELEKTDVLKNALEAAGATTIASGTTLTVENKLGFTND-------DLIHINVKATPTSGA-----ETNYDLQIPTSDINLSVTDLSVTVTGNNIEAATKTTTNFTYNIGIDSEVHFNQGANLTAA-----SEDDAKDVNKVLEQLKYGSTTGSTFSLDNNAIIKGLGIYNVNFSNPSIQEKTVSSRATSEKTYTITLDAKPQSSEYVWADGSDVNTAKKISFDVKIDVTT 381
>gi|26554118|ref|NP_758052.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454126|dbj|BAC44456.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (388 aa)
Score = 416, Expect = 7.5e-39, Identities = 156/364 (42%), Positives = 216/364 (59%)
  Q:    15 TGAFGIVATVPVIVSSCS-STSDNNTGGDNNGGGTQTQTITPQIQSAVTLNGALSDIYDTANSSSENTNAKIAEEIKNNLETVFTNGAALSDVSDLEITVSHNFPE--STWIGTAY----------SGDSGWY-SAQMDTVLYDYTLNPLTISSLSDLKTQLSDSKIQEIFTAAGTTTT-TNATYAVQNALGFTNKNNGAENRDLLHVNVLETVPGQSGGDPTTKNYDLQIPVSDLNLELKDLSVTVKGTNV---AETTLTTTLTYNIGINEAQNFTQPTTNPTVQGSDIQNDDANAANKALVALTYATEADGQTTLDNEKISAELGIYNSVF-------TAVSIKPVDGGNNQYTITLSATP----KDGYVWEDGSNTAKQVSFNVTFTVNS 378
           TGAFGIVATVPVIVS+CS + +  N  G  +GG TQT+ ITP++   V+L G+L DIYD+  + ++ TN  IAEEIK N+ +VF NG  L+  SDL+ITV+ NFPE  S W    Y          + D  W  +A ++ VLY  T   + I SL DL T+L ++ I+      G TTT T+ ++ ++N  G TN        DL+HVNV ET       D T   +DLQIP SD+NL + DL+V V+G N+     T  TT   +NIGI+   ++ Q +   T      Q +DA    + L  L  AT     T LDNE +   LG+Y   F       T  S++     + +YT+TL ATP     + YVW+DG++ AK ++F VT  + S
  S:    15 TGAFGIVATVPVIVSACSSTNNGGNNQGGGSGGTTQTEKITPELNEKVSLGGSLKDIYDS--TGTKKTNELIAEEIKANINSVFKNGEKLAAESDLKITVNGNFPETLSNWKDLPYLDSSETADNATADKSWSATASLNKVLYPTTSKQIDIKSLDDLYTKLDEATIKAALKEGGVTTTETSKSFTIKNRPGLTND-------DLIHVNVEET-----KSDDTKVQHDLQIPTSDINLVVSDLTVKVEGQNIETTENTKTTTEFDFNIGIDTTTHYNQGSETSTA-----QTEDAVKVEQVLKDLKLATADGNNTKLDNEALIKALGVYTVTFSLDDAKVTKDSVQSRAPVDTKYTVTLKATPNKDSNNTYVWDDGTSDAKDITFPVTIKIGS 388
>gi|26554138|ref|NP_758072.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454146|dbj|BAC44476.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (362 aa)
Score = 416, Expect = 8.9e-39, Identities = 162/360 (45%), Positives = 204/360 (56%)
  Q:    15 TGAFGIVATVPVIVSSCSSTSDNNTGGDNNGGGTQTQT-------ITPQIQSAVTLNGALSDIYDTANSSSENTNAKIAEEIKNNLETVFTNGAALSD-VSDLEITVSHNFPESTWIGTAYSGDSGWYSAQMDTVLYDYTLNPLTISSLSDLKTQLSDS-KIQEIFTAAGTTTTTNAT-YAVQNALGFTNKNNGAENRDLLHVNVLETVPGQSGGDPTTKNYDLQIPVSDLNLELKDLSVTVKGTNVAETT-LTTTLTYNIGINEAQNFTQPTTNPTVQGSDIQNDDANAANKALVALTYATEADGQTTLDNEKISAELGIYNSVFTAVSIKPVDGGNNQYTITLSATPKDGYVWEDGSNTAK-QVSFNVTF 374
           TGAFGIVATVPVIVSSCSSTSDNN G  NN               ITP I+  V+L+GALS IYD   S+S+     IAE+IK N    F NG AL D + D  ++V+  F EST+ G  Y   S     +  T  Y      L I S++DL+TQL DS  I+ I  A  T   TN + Y V+       KN    + DLLHVN+     G      T  + DL IPVSDLNL++  L ++V GT + E+T LTT   +N+GI+   N  +P TN T     +   D       + AL Y T +     LDN+K+S  LG+YN  F AVS KPV G  N+YTITL ATP +GYVWEDG+N  K  ++F  T 
  S:    15 TGAFGIVATVPVIVSSCSSTSDNNGGNGNNNNNGNQDGNGQQQTEITPTIKKEVSLSGALSKIYDANKSTSD----LIAEDIKANPTNYFDNGEALKDLIKDATVSVNGGFTESTFKGDTYETWSAKVGDKKGT--YAQASKQLDIKSINDLETQLGDSNNIKIICDAIPTLKLTNGSDYKVE-------KNALKLDGDLLHVNISAKENGT-----TAVSMDLAIPVSDLNLKIDALKISVSGTGIKESTDLTTNYKFNVGID---NTVKPITNAT---GTVTAGDREKVMTVMKALGY-TVSGQDDKLDNDKLSDALGLYNCNFEAVSSKPVSGQANKYTITLKATPNEGYVWEDGTNNPKTDITFEATL 361
>gi|26554119|ref|NP_758053.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454127|dbj|BAC44457.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (386 aa)
Score = 412, Expect = 2.3e-38, Identities = 162/365 (44%), Positives = 217/365 (59%)
  Q:    14 LTGAFGIVATVPVIVSSCSSTSDNNTGGDNNGGGTQTQTITPQIQSAVTLNGALSDIYDTANSSS-ENTNAKIAEEIKNNLETVFTNG---AALSDVSDLEITVSHNF----PESTWIGTAY-----------SGDSGWYSAQMDTVLYDYTLNPLTISSLSDLKTQLS-DSKIQEIFTAAGTTTTTNATYAVQNALGFTNKNNGAENRDLLHVNVLETVPGQSGGDPTTKNYDLQIPVSDLNLELKDLSVTVKGTNVAETTLTTT-LTYNIGINEAQNFTQPTTNPTVQGSDIQNDDANAANKALVALTYATEADGQTTLDNEKISAELGIYNSVFTAVSIKPVDGGNNQ----YTITLSATPK-DGYVWEDG--SNTAKQVSFNVTFTVNS 378
           +TGAFGIVATVPVIVSSCSSTSDNNTGG+NN    QTQ +TP ++ +V+L+G+LS IYDT    + + TN  I E+IK N E  FTNG   A    V +  +TV  NF     ES W    Y           +  S   +  +  V Y    + + I SL DL T+LS +  +++    AG   T   T+ ++N  GFTN        DL+HVNV     G      T   YDLQIP SD+NL + DL++ V+GTN+  +  TTT   +NIGI    ++ Q +T  T       ND A   NK L  L+ AT+A+G  TL+NE +   LG+YN  F+  +I P +G   +    YTITL A P+ + YVW DG  SNT K+V+F+V   V +
  S:    14 MTGAFGIVATVPVIVSSCSSTSDNNTGGENN--NQQTQKVTPVLKDSVSLSGSLSKIYDTTTGENRKTTNDLITEDIKENPENYFTNGSESAVKEAVKNATVTVEGNFTTAGSESPWKELPYLDSSETSENATAAKSWKATTGLQEVTYATNSDQIEIKSLDDLHTKLSVEQTLKDAMKGAGVADTDTTTFTIKNRAGFTNG-------DLIHVNVEGDKSG------TKTQYDLQIPTSDINLSVTDLTIKVEGTNIETSQKTTTNYDFNIGIEPETHYDQGSTTVTA-----ANDAAVTVNKVLQDLSLATDANG--TLNNEALIKALGVYNVNFSNPTIAPKEGATTRAEKTYTITLDAKPQSEKYVWSDGSDSNTTKKVTFDVKVDVTT 384
>gi|26554157|ref|NP_758091.1| signal-peptide-less P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454166|dbj|BAC44495.1| signal-peptide-less P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (448 aa)
Score = 409, Expect = 4.9e-38, Identities = 129/320 (40%), Positives = 182/320 (56%)
  Q:    53 ITPQIQSAVTLNGALSDIYD--TANSSSENTNAKIAEEIKNNLETVFTNGAALSDVSDLEITVSHNFPE-STWIGTAYSGDSGWYSAQMDTVLYDYTLNPLTISSLSDLKTQLSDSKIQEIFTAAGTTTTTNATYAVQNALGFTNKNNGAENRDLLHVNVLETVPGQSGGDPTTKNYDLQIPVSDLNLELKDLSVTVKGTNVAETTL-TTTLTYNIGINEAQNFTQPTTNPTVQGSDIQNDDANAANKALVALTYATEADGQTTLDNEKISAELGIYNSVFTAVSIKPVDGGNNQYTITLSATPKDGYVWEDGSNTAKQVSFNV 372
           ITP I   + L G+L+ I+D  T  S  ++T+  IA++I  NLE  F+NG  +  V++L I  S +FP  S+W G AY+    W S    + +Y  +L  + I+SL+DLKT+     +Q I   +G   + N+T+ +QN LGFT+        DL+H+N+   V    G D T    DLQIPVSD+NL +  L VT  G NV    + TT  TYNIGI++  NF +P T  T     + + + N  N+ALV+L +AT   G  TL++ KISA LG++N  F  VSI       N +TI L ATP   Y WE+GS   K++SF V
  S:   140 ITPAINKTINLTGSLTRIFDVNTPASYRKSTDIMIAQDIHANLEKYFSNGNDIKTVNNLTIDASGSFPSVSSWTGLAYAN---WSSNVKHSTVYASSLPQINITSLNDLKTKWDSQGLQNILLESGLKFS-NSTFTIQNLLGFTDG-------DLVHMNIF--VESGYGEDFTV---DLQIPVSDINLTIPGLRVTANGENVQYLLIDTTNFTYNIGIDDTVNFVKPKTGVT----SLSSANKNKVNEALVSLGFATRNSGSYTLNSNKISAALGVFNCTFEGVSITEDQSKPNNFTIVLRATPNVNYYWENGSRDYKELSFKV 443
Score = 175, Expect = 8.3e-11, Identities = 56/135 (41%), Positives = 75/135 (55%)
  Q:   242 LSVTVKGTNVAETTLTTTLTYNIGINEAQNFTQPTTNPTVQGSDIQNDDANAANKALVALTYATEA-DGQTTLDNEKISAELGIYNSVFTAVSIKPV----DGGNNQYTITLSATP--KDGYVWEDGSNTAKQVSFNVTFTV 376
           + ++V GT+V  T  T    YNIGIN   +  Q T+ P    S     +A   NK LV L YA  A + + TL+ E +  E GIYN  F+  SI P     +G +  YTITL  TP    G+VWEDGS+  K++SF+    V
  S:     1 MQISVSGTDVRTTNTTINFNYNIGINSQSSLPQLTSTPRGSSS-----EAKDPNKILVKLGYAEIASNKEITLNQEVLQEEFGIYNVEFSNASISPSKNTQNGYSGVYTITLDVTPITNKGFVWEDGSSNTKKISFDTNVDV 137
>gi|26554120|ref|NP_758054.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454128|dbj|BAC44458.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (389 aa)
Score = 405, Expect = 1.6e-37, Identities = 158/364 (43%), Positives = 215/364 (59%)
  Q:    15 TGAFGIVATVPVIVSSCSSTSDNN-----TGGDNNGGGTQTQTITPQIQSAVTLNGALSDIYDTANSSSENTNAKIAEEIKNNLETVFTNGAALSDVSDLEITVSHNFPE--STWIGTAY----------SGDSGWYSAQMDTVLYDYTLNPLTISSLSDLKTQLSDSK-IQEIFTAAGTTTTTNATYAVQNALGFTNKNNGAENRDLLHVNVLETVPGQSGGDPTTKNYDLQIPVSDLNLELKDLSVTVKGTNVAETTLTTT---LTYNIGINEAQNFTQPTTNPTVQGSDIQNDDANAANKALVALTYATEADGQTTLDNEKISAELGIYNSVFT--AVSIKPVD-----GGNNQYTITLSATP----KDGYVWEDGSNTAKQVSFNVTFTVNS 378
           TGAFGIVATVPVIVSSCSSTSDNN       G   GG TQ++ ITP++   V+L+G+L DIYD+  ++   TN  +A+EIK+N+ TVF NG  L   +DL+ITV+ NFPE  S W    Y             S   +  + TV+Y  +   + I SL DL TQLS  K +++I  AAG T T  +TY ++N  G TN        DL+HVNV  T    +  + T   YDLQIP SD+NL + DLSV V+G N+  T  T T   L +NIGI+   ++ Q          +++       NK L  L +        T+DNE +  ELG+YN  F+    SI   +         +Y +TL ATP    K+ YVW+DG++  K ++F VT  + S
  S:    15 TGAFGIVATVPVIVSSCSSTSDNNTGGDTNQGGGTGGDTQSEKITPELNDKVSLSGSLKDIYDSTGAT--KTNELLAKEIKDNINTVFKNGEKLEAETDLKITVNGNFPETLSNWKDLPYIDSTEASNPTPAKSWSATTNLQTVVYATSSEQINIKSLDDLHTQLSVEKTLKDILKAAGVTNTDTSTYEIKNRPGLTND-------DLIHVNVGGTA---NDTNKTKTIYDLQIPTSDINLVVSDLSVKVEGKNIETTDSTKTTTELDFNIGIDSTTHYNQTIDVTEADEKNVE------VNKVLETLKFVKT---DKTIDNEALIKELGVYNVTFSLDGASIAKKETTARAATPTEYVVTLKATPNKNDKNTYVWDDGTSGTKDITFPVTIKIGS 389
>gi|26554162|ref|NP_758096.1| signal-peptide-less P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454171|dbj|BAC44500.1| signal-peptide-less P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (685 aa)
Score = 403, Expect = 2.4e-37, Identities = 136/370 (36%), Positives = 204/370 (55%)
  Q:     7 KLLKALALTGAFGIVATVPVI-VSSCSSTSDNNTGGDNNGGGTQTQTITPQIQSAVTLNGALSDIYDTANSSSENTNAKIAEEIKNNLETVFTNGAALSDVSDLEITVSHNFP-ESTWIGTAYSGDSGWYS-AQMDTVLYDYTLNPLTISSLSDLKTQL-SDSKIQEIFTAAGTTT-TTNATYAVQNALGFTNKNNGAENRDLLHVNVLETVPGQSGGDPTTKNYDLQIPVSDLNLELKDLSVTVKGTNVAE-TTLTTTLTYNIGINEAQNFTQPTTNPTVQGSDIQNDDANAANKALVALTYA-TEADGQTTLDNEKISAELGIYNSVFTAVSIKP----VDGGNNQYTITLSATP--KDGYVWEDGSNTAKQVSFNVTFTV 376
           K +K   LTG F   A +PV+ +S      ++++  + N     +Q ITP+++S+++L+G +  IYD+  ++   TN  +A+EI NNL+ VF N   L  V++L+I V  +F   S+W G  Y GD+GW    + + +LY      L ISSL+DLKTQL +D+KI+EI     ++    NA Y++QN    TN N       LLHVNV+  +         TK +DLQIP S +NL + ++S++V G NV   T+   +  YN+ +     F  P + P    S++ N     ANK LV L  A      Q  L  + I  +LGIYN  F+  SI P     +G +  Y I+L ATP     +VW+DG NT + ++F V   V
  S:     6 KKIKTWGLTGIFAASAAIPVVLISRYVLFRNSSSINNQNSESDNSQFITPKLKSSISLSGTIDKIYDSQKATV--TNTLVAQEIHNNLDQVFENSQDLQKVNNLKIAVEGDFTNSSSWSGVDYEGDNGWKGLTKGNVILYSSKFGQLNISSLNDLKTQLDNDAKIKEIIREFDSSKLNQNAIYSIQNKPAVTNDN-------LLHVNVIAIL------GSNTKYFDLQIPTSSINLNISNMSISVSGNNVKPLTSAVASFNYNVSLAPKSYFMNPASTPVASASEVTN-----ANKILVKLGLAEVTTRNQIVLTQKAIQEQLGIYNVEFSNASIAPSGTTTNGKSGLYQISLQATPIANGDFVWDDGQNTVRTITFEVWVNV 368
Score = 390, Expect = 9.8e-36, Identities = 123/325 (37%), Positives = 181/325 (55%)
  Q:    53 ITPQIQSAVTLNGALSDIYDTANSSSEN---TNAKIAEEIKNNLETVFTNGAALSDVSDLEITVSHNFPE-STWIGTAYSGDSGWYSAQMDTVLYDYTLNPLTISSLSDLKTQLSDSKIQEIFTAAGTTTTTNATYAVQNALGFTNKNNGAENRDLLHVNVLETVPGQSGGDPTTKNYDLQIPVSDLNLELKDLSVTVKGTNVAETTLTTTLTYNIGINEAQNFTQPTTNPTVQGSDIQNDDANAANKALVALTYATE----ADGQTTLDNEKISAELGIYNSVFTAVSIKPVDGGNNQ-YTITLSATPKDGYVWEDGSNTAKQVSFNVTFTVN 377
           ITP + S + + G  S I+     +  N   TN  IA++IK+NL   F+NG  L  V +L I V  NFPE S W G  Y     W        +Y  +   + I+SL+DLKT+L+   + + F         +A++ + N LGFT         DL+HVN+L   P   G    T   D+ IP SD+NL + +L +   G NV   ++    TYNIGIN++ +F +PTT  T     + + + N  N+ALV+L +AT       G  TL+ +KISA LG++N  F  +SIK V  G+++ +TI+L ATP + Y WEDG+NT+K++SF V  T +
  S:   371 ITPTVNSTLNITGPFSKIFAANTGTGNNRVRTNDVIADDIKSNLSKYFSNGNDLKTVENLNIRVEGNFPETSVWTGEPYEV---WSKTTRFKGIYSSSSQKINITSLNDLKTKLNSIGLGK-FLLDSNLLFRDASFTILNQLGFTGG-------DLIHVNILVNSPYTQG----TFTVDVGIPTSDINLIISNLKIASFGDNVTLQSVPVNFTYNIGINDSVDFIKPTTGVT----PLSDANKNNVNEALVSLGFATRNIDSNPGTYTLNPDKISAALGVFNCTFEGISIKDVSNGSSRSFTISLIATPNNNYYWEDGTNTSKELSFTVNLTAS 685
>gi|26554117|ref|NP_758051.1| P35 lipoprotein homolog reported as putative lipoprotein IMP13 [Mycoplasma penetrans HF-2] >gi|26454125|dbj|BAC44455.1| P35 lipoprotein homolog reported as putative lipoprotein IMP13 [Mycoplasma penetrans HF-2] >gi|27260911|dbj|BAC45034.1| lipoprotein P42 [Mycoplasma penetrans] (390 aa)
Score = 400, Expect = 5.6e-37, Identities = 152/364 (41%), Positives = 212/364 (58%)
  Q:    15 TGAFGIVATVPVIVSSCSST------SDNNTGGDNNGGGTQTQTITPQIQSAVTLNGALSDIYDTANSSSENTNAKIAEEIKNNLETVFTNGAALSDVSDLEITVSHNFPE--STWIGTAYSGDSGWYSAQ-----------MDTVLYDYTLNPLTISSLSDLKTQLSDSKI--QEIFTAAGTTTTTNATYAVQNALGFTNKNNGAENRDLLHVNVLETVPGQSGGDPTTKNYDLQIPVSDLNLELKDLSVTVKGTNVAETTLTTT---LTYNIGINEAQNFTQPTTNPTVQGSDIQNDDANAANKALVALTYATEADGQTTLDNEKISAELGIYNSVFTAVSIKP-----VDGGNNQYTITLSATP----KDGYVWEDGSNTAKQVSFNVTFTVNS 378
           TGAFGIVATVPVIVSSCSST      + NN  G  + G TQ++ ITP++   V+L G+L DIYD+  + ++ +N  IAEEIKNN++ VF NG  L+  +DL+ITV   FPE  + W    Y  ++   S +           ++ VLY    N + I SL DLKT+L  + +    +  A  +T  T+  + ++N    TN        DL+HVNV+ET       D +T  +DLQIP SD+NL + +LSV V+G N+  T  T T     +NIGI+  Q++ Q +       S    +     NK L  L  AT+  G   L+NE +   LGIYN  F++ SIK             Y ITL ATP     + YVW+DG+  AK ++F VT  + S
  S:    15 TGAFGIVATVPVIVSSCSSTSDNNNGNGNNNNGGGSDGNTQSEKITPELNDKVSLAGSLKDIYDS--TGTKKSNELIAEEIKNNIKDVFKNGEKLAAETDLKITVDGGFPEKLTNWTDLPYVDNTDDASKKDPNKSWSAITDLNPVLYSTKSNQINIKSLDDLKTELQKTDVLKNALKDAGVSTAETSTAFEIKNQPALTND-------DLVHVNVIET-----KSDKSTVQHDLQIPTSDINLVVSNLSVKVEGKNIESTDTTKTTTEFNFNIGIDSTQHYDQGSAK-----SAATTEGDVDVNKVLKDLNLATDDKG--ALNNEALIKALGIYNVTFSSPSIKKATVTARAATATSYEITLKATPNKEGNNTYVWDDGTTEAKDITFPVTIDIGS 390
>gi|26554189|ref|NP_758123.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454198|dbj|BAC44527.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (517 aa)
Score = 398, Expect = 1.0e-36, Identities = 134/361 (37%), Positives = 203/361 (56%)
  Q:    15 TGAFGIVATVPVIVSSCSSTSDNNTGGDNNGGGTQ-----------------TQTITPQIQSAVTLNGALSDIYDTANSSSENTNAKIAEEIKNNLETVFTNGAALSDVSDLEITVSHNFPESTWIGTAY-SGDSGWYSAQ----MDTVLYDYTLNPLTISSLSDLKTQLSDSKIQEIFTAAGTTTTTNATYAVQNALGFTNKNNGAENRDLLHVNVLETVPGQSGGDPTTKNYDLQIPVSDLNLELKDLSVTVKGTNVAETTLTTTLTYNIGINEAQNFTQPTTNPTVQGSDIQNDDANAANKALVALTYATEADGQTT----LDNEKISAELGIYNSVFTAVS------IKP-VDGGNNQYTITLSATPKDGYVWEDGSNTAKQVSFNVTFT 375
           TG FGIV T+P IVS+CSS  + N G  +N G  Q                  Q I P+I S+V L G+L+DIYD+  + +++ N  + E++ NN   +FTN   L +  +  I V  NF   +W G  Y +G++ W S       + V+Y      L ISSL DLK+QL++  +++    AG T   +ATYAV N LG T+         LLHVNV ET    SG    +KN+DLQIPVSD+ L++KDL V V G++V +      L +NIGI    N++           DI+  +      +++A     ++   +T    L++E +   LG+YN+ F+  +      IKP V G    YT+ +  +P  GY ++D ++ +K+  FN+  T
  S:    15 TGTFGIVITIPAIVSACSSIKEKNDGSQSNNGNNQDNSKDQGSEGSGNGGITNQKIVPKINSSVDLIGSLTDIYDS--TGNKDINVLLGEKLSNNASKIFTNADELEN-KNYAIAVKGNFSRDSWSGDQYDAGNNKWGSGSKIDPANQVVYSSKSKQLNISSLDDLKSQLTNDFLKKELEKAGVTVNQSATYAVANKLGLTDD-------ILLHVNVTETA---SGTTSVSKNFDLQIPVSDIKLDIKDLKVIVSGSDVEQIESDINLKFNIGIKSKTNYSP---------RDIKKFNVTPNVDSIIATLGFKDSSVTSTEGVALNSEALGKALGVYNTTFSKPALTLNSDIKPDVTGSFLTYTVIVDGSPNQGYYFDDETDYSKKFIFNIKVT 386
>gi|26554101|ref|NP_758035.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454109|dbj|BAC44439.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (394 aa)
Score = 393, Expect = 4.1e-36, Identities = 145/364 (39%), Positives = 210/364 (57%)
  Q:    15 TGAFGIVATVPVIVSSCSST-------SDNNTGGDNNGGGTQTQTITPQIQSAVTLNGALSDIYDTANSSSENTNAKIAEEIKNNLETVFTNG---AALSDVSDLEITVSHNF----PESTWIGTAYSGDS----------GWYSAQ-MDTVLYDYTLNPLTISSLSDLKTQLSDSKIQEIFTAAGTTTTTNATYAVQNALGFTNKNNGAENRDLLHVNVLETVPGQSGGDPTTKNYDLQIPVSDLNLELKDLSVTVKGTNV-AETTLTTTLTYNIGINEAQNFTQPTTNPTVQGSDIQNDDANAANKALVALTYATEADGQTTLDNEKISAELGIYNSVFTAVSIKPV-----DGGNNQYTITLSATP-KDGYVWEDGSNT-AKQVSFNVTFTVNS 378
           TGAFGIVATVP+IVSSCSST        DNN G      G QT+ +TP+++S V+L+G+L  IYD++    + TN  IA+++K + E  FTNG        + +  +TV   F     ES W   AY  +S           W + + +  VL+  T + + I SL DL ++L+++K++E+FT A        T+ V+N LGFTN        DL+HVNV      +     T   YDLQIP SD+NL + DLS+ V+GTN+ A+   +T   +NIGI+  +NF Q +T       D+   D     + L  L +A +    T LDN+ I   LGIYN  F+   IK       +  +  YT++L A P  + YVW D S +  K +SF+VT  + +
  S:    15 TGAFGIVATVPIIVSSCSSTGDNNGGSGDNNNGNQGGQDGQQTEKVTPELKSEVSLSGSLDKIYDSSTKDRKTTNQLIADDVKAHPENYFTNGDKTEVKETIKNATVTVDGKFTTEETESPWKDVAYLDESSDANKTDANKSWSATKDLKPVLFPTTSDQIDIKSLDDLHSKLNEAKLKEVFTNAKIANADKTTFTVKNKLGFTNS-------DLIHVNV------EGDNSGTKTQYDLQIPTSDINLSVSDLSIKVEGTNIEAQEKTSTKFDFNIGIDSKENFNQGSTEIAYNTKDLVKVD-----EVLEKLGFAKKNGSSTELDNDAIIKGLGIYNVNFSGQEIKEKTVTTREQKDTTYTVSLKAKPTSNKYVWADDSTSDEKTISFDVTIKIGT 393
>gi|26553715|ref|NP_757649.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26453722|dbj|BAC44053.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (519 aa)
Score = 392, Expect = 4.5e-36, Identities = 145/358 (40%), Positives = 210/358 (58%)
  Q:    15 TGAFGIVATVPVIVSSCSSTSD-----NNTGGDNNGGGTQTQTITPQIQSAVTLNGALSDIYDTANSSSENTNAKIAEEIKNNLETVFTNGAALSDVSDLEITVSHNFPESTWIGTAYSGD--SGWYSAQMDTVLYDYTLNPLTISSLSDLKTQLSD-SKIQEIFTAAGTTTTTNATYAVQNALGFTNKNNGAENRDLLHVNVLETVPGQSGGDPTTKNYDLQIPVSDLNLELKDLSVTVKGTNVAETTLTTTLTYNIGINEAQNFTQPTTNPTVQGSDIQND---------DANAANKALVALTYATEADGQTT----LDNEKISAELGIYNSVFTAVSIKPVDGGN-------NQ----YTITLSATPKDGYVWEDGSNTAKQVSFNV 372
           TGAFGI+ATVPVIVSSCS+TSD     NNTGG + GG TQT+ +TP+ +S++ L GAL+DIY+   S  +NTN  + EEIKNNL++ F N   L +  +  +TV  NF  S+W G  Y+    +G      + + YD     + ISSL+DLK +LSD + ++E  + AG   T  +TY ++N LG T+ N       L+HVNV      +      T  YDLQIPVSD+NL+L ++ +++ G +V     +  L +NIGIN    +T PT    +      +           +   N    ++T   +    TT    LD +KI+  LGI+N+ F  +++  V   N       NQ    Y I ++ +PK GY ++DG    K  SFNV
  S:    15 TGAFGIIATVPVIVSSCSTTSDNNGGNNNTGGGSGGGTTQTEKVTPKFKSSINLIGALTDIYNP--SEGKNTNTLLGEEIKNNLDSAFENSNELEN-KNFAVTVKGNFSNSSWGGEQYTNGNWNGVTITDDNKLYYDSESPQIDISSLNDLKNKLSDETTLKEALSKAGVADTEGSTYTIKNRLGLTDNN-------LIHVNV------EGKSSTATTQYDLQIPVSDINLDLSNVDISISGDDVNPVEESVNLNFNIGINSKTTYTAPTETQKLTKKATVDSVMEQLGFKATSTTKNVVRTSITLTQDNGASTTSLVGLDTDKIAESLGIFNTEFKNITLTRVSEWNPYDEVQENQNYLTYRIDITGSPKQGYYFDDGKTEDKTFSFNV 388
>gi|26554110|ref|NP_758044.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454118|dbj|BAC44448.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (391 aa)
Score = 390, Expect = 8.1e-36, Identities = 165/365 (45%), Positives = 217/365 (59%)
  Q:    14 LTGAFGIVATVPVIVSSCSSTSDNNTGGDNNGGGTQTQTITPQIQSAVTLNGALSDIYDTA---NSSSENTNAKIAEEIKNN-----LETVFTNGAALSDVSDLEITVSHNFPESTWIGTAYSGDSGWYSAQMDTV--------LYDYTLNPLTISSLSDLKTQL------SDSKIQEIFTAAGTTTTTNATYAVQNALGFTNKNNGAENRDLLHVNVLETVPGQSGGDPTTKNYDLQIPVSDLNLELKDLSVTVKGTNVAETTLTTT-LTYNIGINEAQNFTQPTTNPTVQGSDIQNDDANA-ANKALVALTYATEADGQTTLDNEKISAELGIYNSVFTAVSIKPVDGG-----NNQYTITLSATP--KDGYVWEDGSNT-AKQVSFNVTFTVNS 378
           +TGAFGIVATVPVIVSSCSSTSDNNTGG NNGG TQTQ ++ Q++ +V L G+LS I+DT     SS ++TN  I+E+IK N       T  T       + +  + V  NF  S+W G AY+ +SG + A    V        LY   L+ LT   L  LKT+L      + + +Q     AG T    A  +++N LG TN        DLLHVNV ET       +   KNYDLQIPVSDLNL + DLS+ V   N+     TTT   YNIGI+   ++ Q TT P+       ND+A+   NK L  L+ AT+A+G  TLDNE +   LG+YN  F+  +I           +  YTITL ATP     YVW D  N+  + ++F+VT  + +
  S:    14 MTGAFGIVATVPVIVSSCSSTSDNNTGGGNNGGDTQTQKVSLQLKDSVDLKGSLSKIFDTEATNASSRKSTNTLISEDIKANPGTYFTFTETTEETVKETIQNATVEVEGNFSSSSWEGQAYNQESGNWGADSSVVTIDPANKYLYPTNLDQLTFKDLDGLKTELEKTGTNNKTVLQNALETAGATIDAGAQLSIENRLGLTND-------DLLHVNVKET-----KANTADKNYDLQIPVSDLNLSVSDLSIKVTSDNIETGEKTTTKYDYNIGIDPTTHYVQGTTKPSA------NDEASVDVNKVLEDLSLATDANG--TLDNEALIKALGVYNVQFSNPTIAKKATTTRAIEDTVYTITLKATPTANKNYVWSDNGNSEERDITFDVTLAIGT 390
>gi|26554111|ref|NP_758045.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454119|dbj|BAC44449.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (374 aa)
Score = 386, Expect = 2.9e-35, Identities = 157/363 (43%), Positives = 211/363 (58%)
  Q:    15 TGAFGIVATVPVIVSSCSSTSDNNTGGDNNGGGT-------------QTQTITPQIQSAVTLNGALSDIYDTANSSSENTNAKIAEEIKNNLETVFTNGAALSDV-SDLEITVSHNFPESTWI-GTAYSGDSGWYSAQMDTVLYDYTLNPLTISSLSDLKTQL--SDSKIQEIFTAAGTTTTTNATYAVQNALGFTNKNNGAENRDLLHVNVLETVPGQSGGDPTTKNYDLQIPVSDLNLELK-----DLSVTVKGTNV-AETTLTTTLTYNIGINEAQNFTQPTTNPTVQGSDIQNDDANAANKALVALTYATEADGQTTLDNEKISAELGIYNSVFTAVSIKPVDGGNNQYTITLSATPKDG-YVWEDGSNTAKQVSFNVTFTVN 377
           TGAFGIVATVPVIVSSCSST +  +G +  G G              + +T+ P++   V+L G+LS IY ++ S S+ TN  I+E++K N E  FTNG  L DV    ++TV   F  S W  G  YS  S   S  +  V Y      + I+SL+DLK +    D+ IQ   TAA  T T    Y V+N L  ++        DLLHVN+  T   +SGG+    N DLQIPVS++NL+       D +    GTN+ A T LTT  +YNIGI+   NFTQ    PT   +     +A  A K L  L Y +       LDN+KISA LG+YN  F A S +P +GG  +Y +TL+ATP D  Y+W+DG++  K + F V+ TV+
  S:    15 TGAFGIVATVPVIVSSCSSTDNGGSGNNTGGNGNQGDGGGSGGTGQQENKTVKPELLKDVSLGGSLSTIY-SSGSDSKTTNELISEDVKTNPEKYFTNGTELKDVIKQTKVTVDGGFSASEWQNGDPYSTWST--SNGIVKVTYPAAAPQIDIASLNDLKQKTFKDDAAIQTFLTAANLTFTGVTNYTVENQLSLSSG-------DLLHVNLKGT---KSGGN---LNVDLQIPVSNINLKATLKISVDATNNESGTNIEAVTDLTTNFSYNIGIDSTVNFTQTGATPTATEA-----EAKDAQKVLEKLGYVSSG----ALDNDKISAALGVYNCKFVAKSSEPGEGG--KYNVTLTATPFDSNYIWDDGTSGPKDLQFPVSLTVS 374
>gi|26554137|ref|NP_758071.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454145|dbj|BAC44475.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (361 aa)
Score = 383, Expect = 6.0e-35, Identities = 154/361 (42%), Positives = 205/361 (56%)
  Q:    15 TGAFGIVATVPVIVSSCSSTSDNNTGGDNNGGGTQTQT-----ITPQIQSAVTLNGALSDIYDTANSSSENTNAKIAEEIKNNLETVFTNGAALSD-VSDLEITVSHNFPESTWIGTAYSGDSGWYSAQMDTVLYDYTLNPLTISSLSDLKTQLSDSK-IQEIFTAAGTTTTTNAT-YAVQNALGFTNKNNGAENRDLLHVNVLETVPGQSGGDPTTKNYDLQIPVSDLNLELKDLSVTVKGTNVAETT-LTTTLTYNIGINEAQNFTQPTTNPTVQGSD--IQNDDANAANKALVALTYATEADGQTTLDNEKISAELGIYNSVFTAVSIKPVDGGNN-QYTITLSATPKDGYVWEDGSNTAK-QVSFNVTFT 375
           TGAFGIVATVPVIVSSCSSTSDNN   DNN GG          +TP I++ V+L+GALS IYD   ++S+     IAE+IK N    F NG AL + + D  ++V+  F EST+ G  Y      +S       Y  +   L I S++DL+TQL DSK IQ +  +  +   TN + Y V+       KN    + DLLHVN    +  +  G       DL IPVSDLNL++ DL ++V GT +  +T LTT  T+N+GI+         T  T+ G+   +  ++     K + AL Y   A   T LDN+K+S  LG+YN  F    + PV G  + +YTI L ATP   YVWEDG+NT K  VSF  T +
  S:    15 TGAFGIVATVPVIVSSCSSTSDNNGNSDNNPGGQGDGGQQQTEVTPTIKTEVSLSGALSKIYDGKKTTSD----LIAEDIKANPTNYFDNGDALKELIKDATVSVNGGFTESTFKGETYD----VWSKDAKKGTYPQSAAQLNIKSINDLETQLGDSKAIQTLCESISSLKITNGSDYKVE-------KNALKLDGDLLHVN----ITAKEDGKTDRVKMDLAIPVSDLNLKIDDLKISVNGTGIKTSTDLTTKYTFNVGID--------NTVKTITGAKGVLAENERKEFLKVMKALGYTDTAG--TNLDNDKLSDALGLYNCSFEVTGVDPVTGSTSGEYTIKLKATPNKDYVWEDGTNTPKTDVSFVATLS 359
>gi|26553716|ref|NP_757650.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26453723|dbj|BAC44054.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (518 aa)
Score = 382, Expect = 7.5e-35, Identities = 138/375 (36%), Positives = 210/375 (56%)
  Q:     1 MKIKKIKLLKALALTGAFGIVATVPVIVSSCSSTSDNNTGGDNNGGGTQT-------QTITPQIQSAVTLNGALSDIYDTANSSSENTNAKIAEEIKNNLETVFTNGAALSDVSDLEITVSHNFPESTWIGTAYS-GDSGWYSAQMDTVLYDYTLNPLTISSLSDLKTQLSDS-KIQEIFTAAGTTTTTNATYAVQNALGFTNKNNGAENRDLLHVNVLETVPGQSGGDPTTKNYDLQIPVSDLNLELKDLSVTVKGTNVAETTLTTTLTYNIGINEAQNFTQPTTNPTVQGSDIQND---------DANAANKALVALTYATEADGQTT-----LDNEKISAELGIYNSVFTAVSIKPVDGGNN-----------QYTITLSATPKDGYVWEDGSNTAKQVSFNVTFT 375
           MK  K K+LK LA+TGAFGI+ATVPVI+S+CSS S+N+     N  G  +       Q +TP+++S++ L G+++DIY+  +  +  ++  + ++IK+NL  VF N + L +  D+ I +  +F  S WIG  Y+  +  W S     + Y ++L  +  SSL+DLK QLSD  KI+EI   +G   T   TY ++N  G T  N       +LH+NV+E       G  + KNYDLQIPVSDL L L  ++V V   ++        + +NIGI    N+  P     +      N            N  N     +T+ TE +G +      LD++K+   LG++N+ F+ V +  +   N             Y I L+  P  GY +EDG+  +K+ SFNV  T
  S:     1 MKTAKKKVLKTLAITGAFGIIATVPVIISACSSASNNSNTNGGNNTGDNSGNGTRDPQKVTPKLKSSINLVGSITDIYN--HEVNNTSHDLLIKKIKSNLGLVFENESELVN-KDINIKLESDFSNSEWIGETYNVTNKNWGSDTTTKLTYAHSLAQINFSSLNDLKMQLSDQIKIKEILKESGVPDTYLNTYKIENKTGLTENN-------ILHINVIEV------GKSSPKNYDLQIPVSDLKLVLPQVNVLVSENDINSINQPIDINFNIGIESHSNYVGPVETQIIDERASANSILEKLGFIKMTNTKNSNKTNMTF-TEINGASVTTNIDLDSDKVGETLGVFNTTFSDVKLTRISEWNPYDVVSTEDNYLTYKIDLNGRPNKGYYFEDGTTESKEFSFNVKTT 392
>gi|26554113|ref|NP_758047.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454121|dbj|BAC44451.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (365 aa)
Score = 378, Expect = 2.2e-34, Identities = 148/378 (39%), Positives = 198/378 (52%)
  Q:     1 MKIKKIKLLKALALTGAFGIVATVPVIVSSCSSTSDNNTGGDNNGGGTQTQTITPQIQSAVTLNGALSDIYDTANSSS-ENTNAKIAEEIKNNLETVFTNGAALSDVSDLE-ITVSHNFPE-STWIGTAYSGDSGWYSAQMDTVLYDYTLNPLTISSLSDLKTQL--SDSKIQEIFTAAGTTTTTNATYAVQNALGFTNKNNGAENRDLLHVNVLETVPGQSGGDPTTKNYDLQIPVSDLNLELK-----DLSVTVKGTNVAET-TLTTTLTYNIGINEAQNFTQPTTNPTVQGSDIQNDDANAANKALVALTYATEADGQTTLDNEKISAELGIYNSVFTAVSIKPVDGGNNQYTITLSATP-KDGYVWEDGSNTAKQVSFNVTFTVNS 378
           MK KKIKLLK LA  G+F IV+TVP I+S+CSST+D  TG            ITP I+S V+L G L+ IYDT+  S  ++TN  IAE+IK NL+  F N   L DV     ITV   F E STW G  +   S   +  +    Y      + I+SL+ LK ++   D+ IQ+    A    T+NA+          NK  G EN DLLHVN+       +  D    N DLQIPVS+ NL+         S  V G N+ +   LTT   Y+IGI+ A N+    T   V   +        +  A   L  +   D    LDN+KI++ +G++NS FT VS   V+G  + Y ITL+A P  D Y W+DGS  +K + F +   V S
  S:     1 MKNKKIKLLKTLATVGSFVIVSTVPAIISACSSTADQYTG------------ITPVIKSEVSLQGKLTGIYDTSTGSDRKDTNTLIAEDIKANLDKYFVNVDELKDVIQTSTITVDGGFSEKSTWEGENFETWST-DARGVTKAPYPSAAPKIDITSLNALKDEILKDDASIQKFLKDANLPFTSNAS-----NFRLLNK-PGLENGDLLHVNIKANRNRNNNSD---LNLDLQIPVSNFNLKTTLKVSVSASNNVDGQNIGKDFNLTTHFNYSIGIDPAVNYKALKTALEVTPQE--------SVDATEILKLSDYTDFSGNLDNDKIASAVGVFNSKFTPVSSVKVEGSQDMYNITLTAEPFSDLYFWDDGSTGSKTIQFQIKLNVKS 360
>gi|26554128|ref|NP_758062.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454136|dbj|BAC44466.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (353 aa)
Score = 373, Expect = 7.2e-34, Identities = 152/344 (44%), Positives = 194/344 (56%)
  Q:    14 LTGAFGIVATVPVIVSSCSSTSDNNTGGDNNGGGTQTQTITPQIQSAVTLNGALSDIYDTANS---SSENTNAKIAEEIKNNLETVFTNGA---ALSDVSDLEITVSHNFPESTWIGTAYSGDSGWYSA----QMDTVLYDYTLNPLTISSLSDLKTQL-----SDSKI--QEIFTAAGTTTTTNATYAVQNALGFTNKNNGAENRDLLHVNVLETVPGQSGGDPTTKNYDLQIPVSDLNLELKDLSVTVKGTNVAETTLTTT-LTYNIGINEAQNFTQPTTNPTVQGSDIQNDDANAANKALVALTYATEADGQTTLDNEKISAELGIYNSVFTAVSIKPVDGGNNQYTITLSATPKDGYV 357
           +TGAFGIVATVPVIVSSCSSTSDNN    N  G T+TQ +TP ++ +V L G+LS I+DT  +   S ++TN  I+E+IK N E  FTNG+     S +    I V  NF  ++W G AY  ++  +S       + ++Y      LT   L  LK +L     +DSK   Q    AAG T  +  T  ++N LGFTN        DL+HVNV       S G+P   NYDLQIP SDLNL +  LS+ V G N+ E   TTT  TYNIGI E      PT  P     ++   D     K + AL Y   A     LD+ KIS +LG+YN  FT VS          +TI +SATP +GYV
  S:    14 MTGAFGIVATVPVIVSSCSSTSDNNG-NGNTNGNTETQKVTPVLKDSVDLKGSLSKIFDTTATDAASRKSTNTLISEDIKANPEDYFTNGSDSNVQSAIQSATIDVEGNFSNASWTGNAYDTNTNTWSGVTIEDANKLVYTSNSAQLTFKDLDGLKAELEKTTGTDSKTVAQVALEAAGATFASGTTITIENRLGFTND-------DLIHVNV---KAAPSSGNPV--NYDLQIPTSDLNLSVTGLSIKVTGENITEGEKTTTNFTYNIGIKEG--VIVPTDKP-----NLATADKGTQMKVMEALGYTNTAG--DALDDNKISVKLGLYNCKFTLVSATEDTNNAGTFTIKISATPNEGYV 353
>gi|26554121|ref|NP_758055.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454129|dbj|BAC44459.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (378 aa)
Score = 366, Expect = 5.9e-33, Identities = 164/362 (45%), Positives = 216/362 (59%)
  Q:    15 TGAFGIVATVPVIVSSCSSTSDNNTGGDNNGGGTQTQT--ITPQIQSAVTLNGALSDIYDTANSSSENTNAKIAEEIKNNLETVFTNGAALSD-VSDLEITVSHNFP-ESTWIGTAYSGDSGWYSAQMDTVLYDYTLNPLTISSLSDLK--TQLSDSKIQEIFTAAGTTTTTNATYAVQNALGFTNKNN-GAENRDLLHVNVLETVPGQSGGDPTTKNYDLQIPVSDLNLELKDLSVTVK-GTNVAETT-LTTTLTYNIGINEAQNFTQPT-TNPTVQGSDIQNDDANAANKALVALTYATEADGQTTLDNEKISAELGIYNSVFTAVSIK---------PVDGGNNQYTITLSATPKDG-YVWEDGSNTAKQVSFNVTFTV 376
           TGAFGIVATVPVIVSSCSSTSDNN G +NNG G   Q   +TP ++S V L G L+ IYDT  +  +NT+  I  ++K N +  FTNG  + + +   EITV   F   S+W G AY      +      V+Y      + I+SL+DLK  T   ++ I + FT A  + +      V++  G    N    EN DLLHVNV  T       D +    DLQIPVS+LNL+   L V++K GTN+ E T L T+ +YNIGI+   NFTQ   T P V  SD+ +D+A AA   L  L Y T +D    +DN+KISA LGIYN  FTA + K          V G N  YT+T++ATP D  YVW+DG+   K +SF+V+  +
  S:    15 TGAFGIVATVPVIVSSCSSTSDNNGGSNNNGNGDNQQQTELTPALKSNVNLQGKLTGIYDTNTTDRKNTSTLIVADMKANPDNYFTNGNEIKEGIQSSEITVDGGFSTTSSWDGDAYDT----WKTGATQVMYPTAAPQINIASLNDLKETTFKDETAINKFFTDASLSES------VKDVTGLNVANKLHLENGDLLHVNVKGT-----KTDKSEVKIDLQIPVSNLNLK-TTLKVSIKGGTNIKEVTDLETSFSYNIGIDATLNFTQTKGTAPEVTSSDV-SDEAAAAKAILKKLGYTTGSD--DAIDNDKISAALGIYNCKFTAKTAKVNDKETPNAEVTGSNKVYTVTVTATPYDSTYVWDDGAEGGKDISFDVSLNL 377
>gi|26553723|ref|NP_757657.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26453730|dbj|BAC44061.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (383 aa)
Score = 363, Expect = 1.3e-32, Identities = 148/363 (40%), Positives = 199/363 (54%)
  Q:    15 TGAFGIVATVPVIVSSCSS------TSDNNTGGDNNGGGTQTQTITPQIQSAVTLNGALSDIYDTANSSSENTNAKIAEEIKNNLETVFTNGAALSD-VSDLEITVSHNF-PESTWIGTAYSGDSGWYSAQMDTVLYDYTLNPLTISSLSDLK-TQLSDSKIQEIFTAAGTTTTTNAT-YAVQNALGFTNKNNGAENRDLLHVNVLETVPGQSGGDPTTKNYDLQIPVSDLNLELK-----DLSVTVKGTNV-AETTLTTTLTYNIGINEAQNFTQPTTNPTVQGSDIQNDDANAANKALVALTYATEADGQTTLDNEKISAELGIYNSVFTAVS------IKP---VDGGNNQYTITLSATP-KDGYVWEDGSNTAKQVSFNVTFTVN 377
           TGAFGIVATVPVIVSSCSS            G    G   Q  T+ P+I++ V L+G LS IYD + +  ++TN  I  ++K N E  FTNG  + D + D  +TV   F  ES+W G  YS     +S      LY      + I+SL+DLK T+L DS   E F      + T A+ ++VQN  G T+        DLLH+N+      ++  +    N DLQIPVS++NLE       D +    G  + A   L T  +YNIGI+    F Q         ++  +D A AA   LV L Y +  D   TL ++KISA LGIYN  FT  S       KP   V   N  YT+T++ATP  + YVW+DGS   K +SF+V+  V+
  S:    15 TGAFGIVATVPVIVSSCSSTDNGNNNQGGTGGNGQGGDTQQQSTVKPEIKTDVKLSGKLSGIYDASETDRKDTNTLITNDVKTNPENYFTNGDQIKDAIKDATVTVDGGFKKESSWSGNPYST----WSTGTTATLYPSAAPQINIASLNDLKDTKLKDSTAIETFLKDANISFTGASGFSVQNQPGLTDG-------DLLHINI------KAKQNSQDLNLDLQIPVSNINLETTLKISIDATTNTTGNKIEAVKDLETKFSYNIGIDATLKFEQQKGEAPAATTNEVSDAATAAKNILVKLGYVSSGD---TLSDDKISAALGIYNCKFTPKSATENTNAKPNAEVTNSNKVYTVTVTATPYNETYVWDDGSTGPKDISFDVSLKVS 383
>gi|3850055|emb|CAA07194.1| putative lipoprotein [Mycoplasma penetrans] (336 aa)
Score = 355, Expect = 9.4e-32, Identities = 135/322 (41%), Positives = 189/322 (58%)
  Q:    14 LTGAFGIVATVPVIVSSCSST------SDNNTGGDNNGGGTQTQTITPQIQSAVTLNGALSDIYDTANSSSENTNAKIAEEIKNNLETVFTNGAALSDVSDLEITVSHNFPE--STWIGTAYSGDSGWYSAQ-----------MDTVLYDYTLNPLTISSLSDLKTQLSDSKI--QEIFTAAGTTTTTNATYAVQNALGFTNKNNGAENRDLLHVNVLETVPGQSGGDPTTKNYDLQIPVSDLNLELKDLSVTVKGTNVAETTLTTT---LTYNIGINEAQNFTQPTTNPTVQGSDIQNDDANAANKALVALTYATEADGQTTLDNEKISAELGIYNSVFTAVSIK 335
           LTGAFGIVATVPVIVSSCSST      + NN  G  + G TQ++ ITP++   V+L G+L DIYD+  + ++ +N  IAEEIKNN++ VF NG  L+  +DL+ITV   FPE  + W    Y  ++   S +           ++ VLY    N + I SL DLKT+L  + +    +  A  +T  T+  + ++N    TN        DL+HVNV+ET       D +T  +DLQIP SD+NL + +LSV V+G N+  T  T T     +NIGI+  Q++ Q +       S    +     NK L  L  AT+  G   L+NE +   LGIYN  F++ SIK
  S:     1 LTGAFGIVATVPVIVSSCSSTSDNNNGNGNNNNGGGSDGNTQSEKITPELNDKVSLAGSLKDIYDS--TGTKKSNELIAEEIKNNIKDVFKNGEKLAAETDLKITVDGGFPEKLTNWTDLPYVDNTDDASKKDPNKSWSAITDLNPVLYSTKSNQINIKSLDDLKTELQKTDVLKNALKDAGVSTAETSTAFEIKNQPALTND-------DLVHVNVIET-----KSDKSTVQHDLQIPTSDINLVVSNLSVKVEGKNIESTDTTKTTTEFNFNIGIDSTQHYDQGSAK-----SAATTEGDVDVNKVLKDLNLATDDKG--ALNNEALIKALGIYNVTFSSPSIK 325
>gi|26554122|ref|NP_758056.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454130|dbj|BAC44460.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (383 aa)
Score = 354, Expect = 1.3e-31, Identities = 148/364 (40%), Positives = 205/364 (56%)
  Q:    15 TGAFGIVATVPVIVSSCSSTS--DNNTGGDNNGGGTQTQTITPQIQSAVTLNGALSDIYDTANSSSENTNAKIAEEIKNNLETVFTNGAALSD-VSDLEITVSHNFPESTWIGTAYSGDSGWY---SAQMDTVLYDYTLNPLTISSLSDLKT-QLSDSKIQEIFTAAGTTTTTNAT----YAVQNALGFTNKNNGAENRDLLHVNVL--ETVPGQSGGDPTTKNYDLQIPVSDLNLELKDLSVTVKGTN-------VAETTLTTTLTYNIGINEAQNFTQPTTNPTVQGSDIQNDDANAANKALVALTYATEADGQTTLDNEKISAELGIYNSVFTAVSIK-----PVDGGNNQYTITLSATPKDG-YVWEDGSNTAKQVSFNVTFTVNS 378
           TGAFGIVATVPVIVSSCSSTS  + N  G   G      ++ P ++S V L+G L+ +YDT+  + ++TN  I+++IK N +  F N A + D + D ++TV+ NF  S W        + W    S  + TV Y      + I+SL++LKT    DS     F      T    +    + V+N L  ++        DLLHVN+       GQ+G      N DLQIPVS++NL+   L+V+V  T         A + L T  +YNIGI+   NFT P  + ++  +     +A+ A + L  L YA   DG  T+DN+K+SA +G+YN  FTAVS K         G   Y +TLSA P D  YVW+DG   AKQV F V  TVN+
  S:    15 TGAFGIVATVPVIVSSCSSTSDNNVNGNGGQGGDQQTQTSVKPDLKSEVNLSGKLTGVYDTSADNRKDTNTLISDDIKANPDKYFNNAADIKDAIKDAKVTVNGNFSASEWNTQGAKDYAEWSKDNSQAIPTVTYPTAAKQIDIASLNELKTVTFKDSDTISTFITESKITIDKFSEMEKFRVENKLHLSSG-------DLLHVNLKADNKTTGQAG-----LNLDLQIPVSNINLK-TSLTVSVDATTNTTGNKIEAVSDLKTNFSYNIGIDSTVNFTDPKISQSLTKT-----EADDATEVLKKLGYAG-TDG--TIDNDKVSAAIGVYNCKFTAVSSKEDTTVSAKTGKKAYKVTLSAEPFDSNYVWDDGQIGAKQVDFTVQLTVNN 383
>gi|26554132|ref|NP_758066.1| P35 lipoprotein homolog reported as gene for P38 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454140|dbj|BAC44470.1| P35 lipoprotein homolog reported as gene for P38 lipoprotein [Mycoplasma penetrans HF-2] (383 aa)
Score = 350, Expect = 3.4e-31, Identities = 157/363 (43%), Positives = 207/363 (57%)
  Q:    15 TGAFGIVATVPVIVSSCSSTSDNNTGGDNNGGGT-------------QTQTITPQIQSAVTLNGALSDIYDTANSSSENTNAKIAEEIKNNLETVFTNGAALSDV-SDLEITVSHNFPESTWIGTAYSGDSGWYSAQ-MDTVLYDYTLNPLTISSLSDLKTQL--SDSKIQEIFTAAGTTTTTNATYAVQNALGFTNKNNGAENRDLLHVNVLETVPGQSGGDPTTKNYDLQIPVSDLNLELKDLSVTVKGTNVAETT-------LTTTLTYNIGINEAQNFTQPTTNPTVQGSDIQNDDANAANKALVALTYATEADGQTTLDNEKISAELGIYNSVFTAVSIKPVD------GGNNQYTITLSATPKDG-YVWEDGSNTAKQVSFNVTFTVN 377
           TGAFGIVATVP+IVSSCSST +  +G +  G G              + +T+ P+++  V LNG LS IY T    S+ TN  I+E+IK N E  FTNG+ L DV +   +TV   F  S W  T  S  + W +   +  V Y      + I+SL+ LK +    D+ IQ   TAA  + +  +++ V+N LG TN        DLLHVN+       +GG+    N DLQIPVS++NL+   L V+V  TN +  T       LTT  +YNIGI+   NFTQ  T PT   ++  N     A + L  L Y T       LDN+KISA LGIYN  FT  S           GGN  YT+ + A P D  YVW+DGS   K+ SF+V+ TVN
  S:    15 TGAFGIVATVPIIVSSCSSTDNGGSGNNTGGNGNQGDGGGSGNTDQQENKTVKPELKDNVELNGKLSTIYGT---DSKTTNELISEDIKANPENYFTNGSELKDVINQSTVTVDGGFSASQW--TEGSDYTTWSAVTGVVKVTYPAAAPQIDIASLNALKQETFKDDTTIQAFLTAANLSFSNTSSFTVENKLGLTNG-------DLLHVNIKANRTAANGGN---LNLDLQIPVSNINLK-TILKVSVSATNNSTGTNIEAVSDLTTNFSYNIGIDSTLNFTQTGTAPTATTAEANN-----ATEVLKKLGYQT----GNNLDNDKISAALGIYNCKFTPKSATEKQGATAGLGGNKVYTVVVDAAPYDSNYVWDDGSTDTKEFSFDVSLTVN 383
>gi|26554104|ref|NP_758038.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454112|dbj|BAC44442.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (394 aa)
Score = 350, Expect = 3.6e-31, Identities = 153/363 (42%), Positives = 214/363 (58%)
  Q:    14 LTGAFGIVATVPVIVSSCSSTSDNNT----GGDNNGGGTQTQTITPQIQSAVTLNGALSDIYDTANSSS--ENTNAKIAEEIKNNLETVFTNG---AALSDVSDLEITVSHNFPESTWI--GTAYSGDSGWYSAQMDTV--------LYDYTLNPLTISSLSDLKTQLS-DSKIQEIFTAAGTTTTTNA-TYAVQNALGFTNKNNGAENRDLLHVNVLETVPGQSGGDPTT---KNYDLQIPVSDLNLELKDLSVTVKGTNVAETTLTTT-LTYNIGINE-AQNFTQPTTNPTVQGSDIQNDDANAANKALVALTYATEADGQTTLDNEKISAELGIYNSVFTAVSIK------PVDGGNNQYTITLSATP--KDGYVWEDGSNT-AKQVSFNVTFTV 376
           +TGAFGIVATVPVIVS+CSSTSDNNT    G D  GG TQT+ +TP ++  V L+G+LS I+DT + +S  + T   I+++IK N E  FTNG        V +  +TV+ NF  S W   G    G+ G +     TV        +Y  +L+ + ISSL+DLKTQL+ D+ ++ I   +G +T     T +++N LGFT         DLLHVNV           PTT    NYDLQIPVSD+NL +  LS+ V G N+  +  TTT   +NIGI+    N+ Q +       SD++    N   + L   T  T+ + +  LDNE +   LGIYN  F+A               +  +T+TL ATP     YVW D  N+  + ++F+VT ++
  S:    14 MTGAFGIVATVPVIVSACSSTSDNNTGGNGGTDQGGGSTQTEKVTPTLKDEVDLSGSLSKIFDTTSEASNRKTTATLISDDIKENPENYFTNGNDEKVKEAVKNANVTVNGNFSNSEWTKEGLLPFGEDGNWKDSTTTVTIEAANKLVYATSLDQINISSLNDLKTQLTKDNGLKNILEKSGASTIAEGTTLSIENRLGFTGG-------DLLHVNV--------KAKPTTGNETNYDLQIPVSDINLSVPSLSIEVTGDNIEASNKTTTKYDFNIGIDPVVNNYNQGSKPTAATDSDVK---VNQVLQDLKFGTIDTQDNTKINLDNEALIKALGIYNVTFSAEGASINKKSTTTRATDTVFTVTLKATPTANKNYVWADNGNSEERDITFDVTLSI 393
>gi|986922|gb|AAC16393.1| p33 lipoprotein [Mycoplasma penetrans] >gi|1583186|prf||2120285B lipoprotein (318 aa)
Score = 341, Expect = 4.1e-30, Identities = 133/271 (49%), Positives = 160/271 (59%)
  Q:    15 TGAFGIVATVPVIVSSCSS-------TSDNNTGGDNNGGGTQTQTITPQIQSAVTLNGALSDIYDTANS--SSENTNAKIAEEIKNNLETVFTNGAALSDVSDLEITVSHNF-PESTWIGTAYSGDSGWYSAQMDT--VLYDYTLNPLTISSLSDLKTQLSDS-KIQEIFTAAGT--TTTTNATYAVQNALGFTNKNNGAENRDLLHVNVLETVPGQSGGDPTTKNYDLQIPVSDLNLELKDLSVTVKGTN-------VAETTLTTTLTYNIGINEAQNFTQPTTNPTVQGSD 285
           TGAFGIVATVPVIV SCSS         +N  GG +     Q  T TP I+S VTL+GALS IYDT N+  S +NTN  IAE+IK N E  FTNG  L  V    +TV  +F   S W G AYS     +SA  DT   +Y  T   L I+SL DLK+QL  S KI+ I   +    +T    +Y +QN LGFT         DLLH+NV  T  G+      T N DL IPVSDLNL++ DL V+V  +N        A + LTT  TYNIGI E    T PT  P +  +D
  S:    15 TGAFGIVATVPVIVYSCSSTDNNGGTGDNNTGGGGSGTDQQQGTTYTPAIKSDVTLSGALSKIYDTTNTGDSRKNTNTLIAEDIKANPENYFTNGEDLKKVEGWSVTVDGSFDSNSVWTGDAYSK----WSAVADTHKGVYKSTSKQLNINSLKDLKSQLDTSAKIKAICDESNLVFSTADADSYKIQNELGFTGG-------DLLHINVTATQAGK------TLNMDLGIPVSDLNLKITDLKVSVTASNNSTGNNVAAVSDLTTNFTYNIGIKE--EVTAPTEKPNLAKTD 288
>gi|3850052|emb|CAA07192.1| putative lipoprotein [Mycoplasma penetrans] (353 aa)
Score = 337, Expect = 1.3e-29, Identities = 138/322 (42%), Positives = 186/322 (57%)
  Q:    14 LTGAFGIVATVPVIVSSCSSTSDNNTGGDNNGGGT---------QTQTITPQIQSAVTLNGALSDIYDTANSSS-ENTNAKIAEEIKNNLETVFTNGAALSDVSDLEITVSHNFPE--STWIGTAYSGDSGWYSAQ-----------MDTVLYDYTLNPLTISSLSDLKTQLSDSKI--QEIFTAAGTTTTTNATYAVQNALGFTNKNNGAENRDLLHVNVLETVPGQSGGDPTTKNYDLQIPVSDLNLELKDLSVTVKGTNVAETTLTTT---LTYNIGINEAQNFTQPTTNPTVQGSDIQNDDANAANKALVALTYATEADGQTTLDNEKISAELGIYNSVFTAVSIK 335
           LTGAFGIVATVPVIVSSCSSTSDNN  G+NN             Q  T TP I++ V+L+G+LS IYDT    S +NTN  IA++I +N E  FTNGA L +V    +TV   FPE  + W    Y  ++   S +           ++ VLY    N + I SL DLKT+L  + +    +  A  +T  T+  + ++N    TN        DL+HVNV+ET       D +T  +DLQIP SD+NL + +LSV V+G N+  T  T T     +NIGI+  Q++ Q +       S    +     NK L  L  AT+  G   L+NE +   LGIYN  F++ SIK
  S:     1 LTGAFGIVATVPVIVSSCSSTSDNNGNGNNNNDNNGGGSGTDQQQGTTYTPAIKTEVSLSGSLSKIYDTTTGDSRKNTNEMIAQDILSNPEDYFTNGADLKNVQGWSVTVDGGFPEKLTNWTDLPYVDNTDDASKKDPNKSWSAITDLNPVLYSTKSNQINIKSLDDLKTELQKTDVLKNALKDAGVSTAETSTAFEIKNQPALTND-------DLVHVNVIET-----KSDKSTVQHDLQIPTSDINLVVSNLSVKVEGKNIESTDTTKTTTEFNFNIGIDSTQHYDQGSAK-----SAATTEGDVDVNKVLKDLNLATDDKG--ALNNEALIKALGIYNVTFSSPSIK 331
>gi|26554106|ref|NP_758040.1| putative P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454114|dbj|BAC44444.1| P35 lipoprotein homolog fragment [Mycoplasma penetrans HF-2] (179 aa)
Score = 328, Expect = 1.3e-28, Identities = 94/156 (60%), Positives = 121/156 (77%)
  Q:    14 LTGAFGIVATVPVIVSSCSSTSDNNTG-GDNNGGGTQTQTITPQIQSAVTLNGALSDIYDTANSSSENTNAKIAEEIKNNLETVFTNGAALSDVSDLEITVSHNFPESTWIGTAYSGDSGWYSAQMDT----------VLYDYTLNPLTISSLSDLKTQLSDSKIQE 169
           +TGAFGI+ATVPVIVSSCSSTSDNN G GD N GG Q+QTI PQI+S+VTL+GAL+DIY+  + S   TN+ IA+EIKNNL  VF NG+ L++VSDLE++V+H FP STW G ++   SG + A+  +           L   + + L ISSLSDLKTQL D+K++E
  S:    14 MTGAFGIIATVPVIVSSCSSTSDNNGGNGDTNQGGEQSQTIIPQIKSSVTLSGALTDIYNPTDIS--KTNSLIADEIKNNLADVFDNGSDLTNVSDLEVSVTHTFPASTWTGLSFDSTSGNWKAEGSSGNDVTIDNANKLVYSSESQLNISSLSDLKTQLDDTKLKE 178
>gi|26554161|ref|NP_758095.1| signal-peptide-less P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454170|dbj|BAC44499.1| signal-peptide-less P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (494 aa)
Score = 322, Expect = 6.7e-28, Identities = 109/372 (29%), Positives = 196/372 (52%)
  Q:     1 MKIKKIKLLKALALTGAFGIVATVPVIVSSCSSTSDN---NTGGD----NNGGGTQTQTITPQIQSAVTLNGALSDIYDTANSSSENTNAKIAEEIKNNLETVFTNGAALSDVSDLEITVSHNFPESTWIGTAY---SGDSGWYSAQMDTVLYDYTLNPLTISSLSDLKTQL-SDSKIQEIFTAAGTTTTTNATYAVQNALGFTNKNNGAENRDLLHVNVLETVPGQSGGDPTTKNYDLQIPVSDLNLELKDLSVTVKGTNVAETTLTTTLTYNIGINEAQNFTQPTTNPTVQGSDIQNDDANAANKALVALTYATEADGQTTLDNEKISAELGIYNSVFTAVSIKPVDGGNNQ-----YTITLSATPKDGYVWEDGSNTAKQVSFNV 372
           MK ++ K+ K +AL+G F + A VP  V S ++ + N   N  GD    +N  G +   +TP+++S++ + G+  D++D    S++ TN  +A++IK+N    F N   L+   + ++ V  N   S W G +Y    G+ G    + + +LY  +    TISSL D K +L + S++++  TAAG    +N T +++N +G ++         L H+NV  +V  +        +YDLQIP S++N   ++L++ V G +V ET       Y+IGI     +     N + +   +     +A    L  L+ +     +  LDN K+S  LG++N+ F+   ++  +   N+     + +T++      Y +EDG+ T+K+ SF V
  S:     1 MKTQRSKIGKVIALSGIFTVTAAVPAAVLSSAALNGNFANNQSGDALIPSNPSGHENTKVTPKLKSSIQMMGS-EDLFDLG--SNKTTNELLAQKIKDNPSLFFENPEVLAG-KNFDVVVEDNLSSSAWTGQSYDVSKGNWGNTIEESNKLLYSSSSPNFTISSLDDFKAKLNAGSRLKDSLTAAGLNVDSNTTPSIKNKIGLSD--------GLFHINVEASVSNKKA------DYDLQIPTSNINFSFENLNIKVTGNDVVETKQRVAFKYSIGIKSISKY-----NGSSEIMKMWYASESAVMSGLGFLSSSKNESSELILDNNKVSKALGVFNTTFSNTKLELDNSAVNEGNYLTFKVTITGNANADYCFEDGT-TSKEFSFPV 364
>gi|26554103|ref|NP_758037.1| putative P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|22901855|gb|AAN10106.1| putative lipoprotein mp8 [Mycoplasma penetrans] >gi|26454111|dbj|BAC44441.1| P35 lipoprotein homolog fragment [Mycoplasma penetrans HF-2] (329 aa)
Score = 310, Expect = 1.6e-26, Identities = 126/310 (40%), Positives = 174/310 (56%)
  Q:    14 LTGAFGIVATVPVIVSSCSSTS----DNNTGGDNNGGGTQTQTITPQIQSAVTLNGALSDIYDTANSSSENTNAKIAEEIKNNLETVFTNGAALSD-VSDLEITVSHNFPESTWIGTAYSGDSGWY---SAQMDTVLYDYTLNPLTISSLSDLKTQ-LSDSKIQEIFTAAGTTTTTN----ATYAVQNALGFTNKNNGAENRDLLHVNVLETVPGQSGGDPTTKNYDLQIPVSDLNLELKDLSVTVKGTN-------VAETTLTTTLTYNIGINEAQNFTQPTTNPTVQGSDIQNDDANAANKALVALTYATEADGQTTLDNEKISAELG 323
           +TGAFGIVATVPVIVSSCSSTS    + N  G   G      TI P I+S V L+G L++IYD + +  ++TN  I+++IK N +  FTNGA + D + D ++TV+ NF  S W        S W    +  +  +LY      + I+SL++LKT+   DS+    F      T  N      + V+N L  +++       DLLHVN+          + +  N DL+IPVS++NL+   L+V+V  T         A + LTT  +YNIGI+    FT P T PTV       D+A  A   L  L YAT   G  TLDN+KISA +G
  S:    14 MTGAFGIVATVPVIVSSCSSTSDNNGNGNNNGGQGGDQQTQTTIKPAIKSDVQLSGKLNNIYDASTTDRKDTNTLISDDIKANPDKYFTNGADIKDAIKDAKVTVNGNFSASEWNDQGAKEYSEWSKDGNNNISKILYPTEAAQIDIASLNELKTKTFKDSETINKFITDSKITIANLANMQNFRVENKLYLSDE-------DLLHVNLKAD---NKTANQSGLNLDLEIPVSNINLK-TTLTVSVDATTNTTGNKIEAVSGLTTNFSYNIGIDSTVKFTDPKTYPTV-----TTDEAKKAETVLEKLGYATNTSGNITLDNDKISAAIG 327
>gi|7839543|gb|AAF70318.1|AF260642_1 P38 [Mycoplasma penetrans] (352 aa)
Score = 300, Expect = 2.7e-25, Identities = 135/329 (41%), Positives = 181/329 (55%)
  Q:    49 QTQTITPQIQSAVTLNGALSDIYDTANSSSENTNAKIAEEIKNNLETVFTNGAALSDV-SDLEITVSHNFPESTWIGTAYSGDSGWYSAQ-MDTVLYDYTLNPLTISSLSDLKTQL--SDSKIQEIFTAAGTTTTTNATYAVQNALGFTNKNNGAENRDLLHVNVLETVPGQSGGDPTTKNYDLQIPVSDLNLELKDLSVTVKGTNVAETT-------LTTTLTYNIGINEAQNFTQPTTNPTVQGSDIQNDDANAANKALVALTYATEADGQTTLDNEKISAELGIYNSVFTAVSIKPVD------GGNNQYTITLSATPKDG-YVWEDGSNTAKQVSFNVTFTVN 377
           + +T+ P+++  V LNG LS IY T    S+ TN  I+E+IK N E  FTNG+ L DV +   +TV   F  S W  T  S  + W +   +  V Y      + I+SL+ LK +    D+ IQ   TAA  + +  +++ V+N LG TN        DLLHVN+       +GG+    N DLQIPVS++NL+   L V+V  TN +  T       LTT  +YNIGI+   NFTQ  T PT   ++  N     A + L  L Y T       LDN+KISA LGIYN  FT  S           GGN  YT+ + A P D  YVW+DGS   K+ SF+V+ TVN
  S:    31 ENKTVKPELKDNVELNGKLSTIYGT---DSKTTNELISEDIKANPENYFTNGSELKDVINQSTVTVDGGFSASQW--TEGSDYTTWSAVTGVVKVTYPAAAPQIDIASLNALKQETFKDDTTIQAFLTAANLSFSNTSSFTVENKLGLTNG-------DLLHVNIKANRTAANGGN---LNLDLQIPVSNINLK-TILKVSVSATNNSTGTNIEAVSDLTTNFSYNIGIDSTLNFTQTGTAPTATTAEANN-----ATEVLKKLGYQT----GNNLDNDKISAALGIYNCKFTPKSATEKQGATAGLGGNKVYTVVVDAAPYDSNYVWDDGSTDTKEFSFDVSLTVN 352
>gi|26554194|ref|NP_758128.1| putative P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454203|dbj|BAC44532.1| P35 lipoprotein homolog fragment [Mycoplasma penetrans HF-2] (381 aa)
Score = 241, Expect = 1.5e-18, Identities = 89/233 (38%), Positives = 125/233 (53%)
  Q:   143 YDYTLNPLTISSLSDLKTQLSD-SKIQEIFTAAGTTTTTNATYAVQNALGFTNKNNGAENRDLLHVNVLETVPGQSGGDPTTKNYDLQIPVSDLNLELKDLSVTVKGTNVAETTLTTTLTYNIGINEAQNFTQPTTNPTVQGSDIQNDDANAAN-KALVALTYATEADGQTT--LDNEKISAELGIYNSVFTAVSIKPVDGGNN--------QYTITLSATPKDGYVWEDGSNTAKQVSFNVTFT 375
           Y Y    + I SL DLKTQLSD +K+++    AG T    ATY ++N  G T+        DL+HVNV       S    T  NYDLQIP SD+NL + DL+V V G +V E      L YNI I +  ++T P     +  +  ++        KA      +T+A    T  L++EKI   LG++N+ F+   ++ +D  NN         Y IT++ TPK+GY +E G  T+KQ SF V  T
  S:    21 YSYNSPQIDIKSLDDLKTQLSDQTKLKDALKEAGATVDETATYTIKNQPGLTDD-------DLIHVNV-----ESSKASATATNYDLQIPASDINLVISDLNVKVSGADVTEVNEKVNLNYNIAIKDETSYTGPADIKKMNATPTEDSVMQELGFKATTRTKRSTDATPAATVALNSEKIGETLGVFNTEFSNPVLE-LDSTNNPSSTNNFFTYKITVTGTPKEGYHFE-GGETSKQFSFLVKIT 251
>gi|26554158|ref|NP_758092.1| signal-peptide-less P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454167|dbj|BAC44496.1| signal-peptide-less P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (204 aa)
Score = 241, Expect = 1.6e-18, Identities = 72/195 (36%), Positives = 117/195 (60%)
  Q:     1 MKIKKIKLLKALALTGAFGIVATVPVIVSSC---SSTSDNNTGGDNNGGGTQTQTITPQIQSAVTLNGALSDIYDTANSSSENTNAKIAEEIKNNLETVFTNGAALSDVSDLEITVSHNFPEST-WIGTAYSGDSGWYS-AQMDTVLYDYTLNPLTISSLSDLKTQLSDSKIQEIFTAAGTTTTT-NATYAVQNALGFTNK 195
           MK    KLLK  ++ G F      P+ + S    S+ S +++ G+++    +  +I P+++S++ L+G L  IY++ N+S    N  IA+EIK NL+  F N   L  V+DL I ++ +F +S+ W G  Y G++GW S  + + +LY  +L  L +SSL+DLK QL+DSKI+EI     ++     A Y+V+N  GFT +
  S:     1 MKSNVAKLLKISSVVGIFAASTAAPISLVSMYVFSNKSLSDSNGNDSNTNPEDGSIIPKLKSSINLSGPLDKIYNSQNASE--ANDWIAQEIKTNLDLAFENSEELKSVTDLNILINGDFLDSSSWDGNPYDGNNGWSSLTKENQILYSASLEQLNVSSLTDLKNQLTDSKIKEILNEYDSSKLNWTAEYSVKNKPGFTRQ 199
>gi|26554105|ref|NP_758039.1| putative P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454113|dbj|BAC44443.1| P35 lipoprotein homolog fragment [Mycoplasma penetrans HF-2] (159 aa)
Score = 239, Expect = 2.9e-18, Identities = 72/151 (47%), Positives = 98/151 (64%)
  Q:   228 LQIPVSDLNLELKDLSVTVKGTNVAETTLTTTLTYNIGINEAQNFTQPTTNPTVQGSDIQNDDANAANKALVALTYATEADGQTTLDNEKISAELGIYNSVFT---AVSIKPVDGGN----NQYTITLSATPKDGYVWEDGSNTAKQVSFNVTFTVNS 378
           +QIPVSDLNL + +LSVTVKGTNV ETTL T  TYNIGIN A N+ +PT  P++  +  Q  DAN   + L  +T ++      T++N+ I   LG+YN  FT   A   +  D  N      YTITL+ATP DG+VWED +NT+K ++F+    + +
  S:     1 MQIPVSDLNLVISNLSVTVKGTNVTETTLETNFTYNIGINSASNYEEPTNKPSITQAQSQTLDANVILEKLGYVTASSGTPTTYTVNNDTIVKALGVYNVTFTNTGATVTEKTDANNAANQKTYTITLNATPNDGHVWEDATNTSKPITFDAILGITT 158
>gi|3850053|emb|CAA07193.1| putative lipoprotein [Mycoplasma penetrans] (120 aa)
Score = 189, Expect = 1.7e-12, Identities = 54/89 (60%), Positives = 69/89 (77%)
  Q:     8 LLKALALTGAFGIVATVPVIVSSCSST------SDNNTGGDNNGGGTQTQTITPQIQSAVTLNGALSDIYDTANSSSENTNAKIAEEIKNNLETV 96
           LLKALALTGAFGIVATVPVIVSSCSST      + NN  G  + G TQ++ ITP++   V+L G+L DIYD+  + ++ +N  IAEEIKNN++ V
  S:     1 LLKALALTGAFGIVATVPVIVSSCSSTSDNNNGNGNNNNGGGSDGNTQSEKITPELNDKVSLAGSLKDIYDS--TGTKKSNELIAEEIKNNIKDV 93
>gi|26554195|ref|NP_758129.1| putative P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454204|dbj|BAC44533.1| P35 lipoprotein homolog fragment [Mycoplasma penetrans HF-2] (144 aa)
Score = 185, Expect = 5.5e-12, Identities = 60/119 (50%), Positives = 80/119 (67%)
  Q:     9 LKALALTGAFGIVATVPVIVSSCSSTSDNNTGGDNNGGG------------TQTQTITPQIQSAVTLNGALSDIYDTANSSSENTNAKIAEEIKNNLETVFTNGAALSDVSDLEITVSHNFPESTWIGTAY 127
           +KALALTGAFGI+ATVPVIVSSCSSTS+NN G  N G G            T TQ +TP+++S++ L GAL DIY+ A  S + T   +A+EIKNN    F +   L+   + +++V   F  S+W    Y
  S:     1 MKALALTGAFGIIATVPVIVSSCSSTSENNGGSGNGGTGDNQGGGGSGGGTTDTQKVTPKLKSSINLVGALKDIYNPA--SGKTTKDLLAQEIKNNPSLAFEDSEKLNG-KNFDVSVEATFSRSSWTDKTY 128
>gi|26554102|ref|NP_758036.1| putative P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454110|dbj|BAC44440.1| P35 lipoprotein homolog fragment [Mycoplasma penetrans HF-2] (69 aa)
Score = 122, Expect = 1.1e-04, Identities = 32/57 (56%), Positives = 38/57 (66%)
  Q:   321 ELGIYNSVFTAVSIKP-----VDGGNNQYTITLSATPKDG-YVWEDGSNTAKQVSFNVTFTVN 377
           +LG+YN  FTAVS  P      D G   Y + LSA P D  YVW+DG+  AKQVSF V  TV+
  S:     7 QLGVYNCKFTAVSSDPDTSVTADAGKTAYKVVLSAEPYDSNYVWDDGTTDAKQVSFTVQLTVS 69