>gi|26554127|ref|NP_758061.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454135|dbj|BAC44465.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (384 aa)
Score = 1424, Expect = 1.1e-155, Identities = 371/371 (100%), Positives = 371/371 (100%)
  Q:    14 MTGAFGIVATVPVIVSACSSTSDNNGNNNNGGDTNQQTQSITPKIKTESKLSGALSNIYDTANTGKTNELIANEIKKNLSEVFENGEDLSKVNDLQVSVTHTFPASTWTGLSFDAASGNWKHSTDSNQDVTITDANKLLYASKTQALDISSLSDLKTQLDDTKLKAILTDTGVTPAADTTYSVANALGFTNKKKDDTNNRDLLHVNVVGTKTGSNPGTTNYDLQIPVSDLNLKLTDLSVTVKGTNVAETTEKTTLTYNIGINDVVEFVDPSAKPTVAASVKTNKETMNALKALGYTATVSGQDQIDNDKVAAALGIYNCTFTLAAENPLVIDDATNKFTFNLVATPNSGYVWEDGTNTAKPVQFATDFTVS 384
           MTGAFGIVATVPVIVSACSSTSDNNGNNNNGGDTNQQTQSITPKIKTESKLSGALSNIYDTANTGKTNELIANEIKKNLSEVFENGEDLSKVNDLQVSVTHTFPASTWTGLSFDAASGNWKHSTDSNQDVTITDANKLLYASKTQALDISSLSDLKTQLDDTKLKAILTDTGVTPAADTTYSVANALGFTNKKKDDTNNRDLLHVNVVGTKTGSNPGTTNYDLQIPVSDLNLKLTDLSVTVKGTNVAETTEKTTLTYNIGINDVVEFVDPSAKPTVAASVKTNKETMNALKALGYTATVSGQDQIDNDKVAAALGIYNCTFTLAAENPLVIDDATNKFTFNLVATPNSGYVWEDGTNTAKPVQFATDFTVS
  S:    14 MTGAFGIVATVPVIVSACSSTSDNNGNNNNGGDTNQQTQSITPKIKTESKLSGALSNIYDTANTGKTNELIANEIKKNLSEVFENGEDLSKVNDLQVSVTHTFPASTWTGLSFDAASGNWKHSTDSNQDVTITDANKLLYASKTQALDISSLSDLKTQLDDTKLKAILTDTGVTPAADTTYSVANALGFTNKKKDDTNNRDLLHVNVVGTKTGSNPGTTNYDLQIPVSDLNLKLTDLSVTVKGTNVAETTEKTTLTYNIGINDVVEFVDPSAKPTVAASVKTNKETMNALKALGYTATVSGQDQIDNDKVAAALGIYNCTFTLAAENPLVIDDATNKFTFNLVATPNSGYVWEDGTNTAKPVQFATDFTVS 384
>gi|26554112|ref|NP_758046.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454120|dbj|BAC44450.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (399 aa)
Score = 748, Expect = 2.7e-77, Identities = 216/363 (59%), Positives = 269/363 (74%)
  Q:    15 TGAFGIVATVPVIVSACSSTSDNNGNNNNGGDTNQQTQSITPKIKTESKLSGALSNIYDTANTGKTNELIANEIKKNLSEVFENGEDLSKVNDLQVSVTHTFPASTWTGLSFDAASGNWKHSTDSNQDVTITDANKLLYASKTQALDISSLSDLKTQL-DDTKLKAILTDTGVTPAADTTYSVANALGFTNKKKDDTNNRDLLHVNVVGTK----TGSNPGTTNYDLQIPVSDLNLKLTDLSVTVKGTNVAETTEKTTLTYNIGINDVVEFVDPSAKPTVAASVKTNKETMNALKALGYTATVSG---QDQIDNDKVAAALGIYNCTF----TLAAENPLVIDDATNK-----FTFNLVATPNSGYVWEDGTNTAKPVQF 377
           TGAFGIVATVPVIVSACSSTSDNN     GG  N QT++ITP+IK+ S LSGALS+IY+ AN+  TN LIA+EIKKNL+EVF+NG+ L+ VNDL+++VTH+FP STWTGL+F++ +GNW +ST++  +V I +ANKLLY ++T  L+ISSLSDLK QL DD KL+ IL D G T  ADT YSV N LGFTNK    + NRDLLHVNVVGTK          TTNYDLQIPVSDL+L++++LSVTVKG+NV ETT  T  TYNIGIND   +VDPS KPT  A+ +   +  + L  LGY    +G   +  ++ND +   LGIYN TF    T   +  +  +DA+N      +T  L ATPN GYVWEDGT+ AK + F
  S:    15 TGAFGIVATVPVIVSACSSTSDNN----TGGGDNTQTKTITPQIKSTSTLSGALSSIYNPANSSNTNALIADEIKKNLTEVFDNGDALNNVNDLEITVTHSFPESTWTGLTFNSDTGNWGNSTNAQDNVEIQEANKLLYPTQTTELNISSLSDLKEQLNDDAKLEKILDDAGATVDADTVYSVNNGLGFTNKNS-GSENRDLLHVNVVGTKTTAGQTPTTTTTNYDLQIPVSDLDLEISNLSVTVKGSNVTETTATTNFTYNIGINDAENYVDPSTKPT--ATEEEAGKLDDVLVKLGYATAATGGATETTLNNDAIIQGLGIYNVTFARTTTEGVQGIVPKEDASNNGNEKTYTITLSATPNQGYVWEDGTSNAKDISF 387
>gi|26554125|ref|NP_758059.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454133|dbj|BAC44463.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (378 aa)
Score = 663, Expect = 1.9e-67, Identities = 203/370 (54%), Positives = 246/370 (66%)
  Q:    15 TGAFGIVATVPVIVSACSSTSDNNGNNNNGGDTNQQTQSITPKIKTESKLSGALSNIYDTANTG--KTNELIANEIKKNLSEVFENGEDLSKVNDLQVSVTHTFPASTWTGLSFDAASGNWKHSTDSNQDVTITDANKLLYASKTQALDISSLSDLKTQLDDTKLKAILTDTGVTPAADTTYSVANALGFTNKKKDDTNNRDLLHVNVVGT---KTGSNPGTTNYDLQIPVSDLNLKLTDLSVTVKGTNVAETTEKTTLTYNIGINDVVEFVDPSAKPTVAASVKTNKE---TMNALKALGYTATVSGQDQIDNDKVAAALGIYNCTFTLAAENPLVIDDATNKFTFNLVATPNSGYVWEDGTNTAKPVQFATDFTVS 384
           TGAFGIVATVPVIVS+CSSTSDNN   +N      QTQ+ITP+I++   L+GALS+IYDTAN+    TN  IA EIK NL  VF NG  LS V+DL+++V+H FP STW G ++   SG +    D+           +LY      L ISSLSDLKTQL D+K++ I T  G T   + TY+V NALGFTNK  +   NRDLLHVNV+ T   ++G +P T NYDLQIPVSDLNL+L DLSVTVKGTNVAETT  TTLTYNIGIN+   F  P+  PTV  S   N +      AL AL Y     GQ  +DN+K++A LGIYN  FT  +  P  +D   N++T  L ATP  GYVWEDG+NTAK V F   FTV+
  S:    15 TGAFGIVATVPVIVSSCSSTSDNNTGGDNN-GGGTQTQTITPQIQSAVTLNGALSDIYDTANSSSENTNAKIAEEIKNNLETVFTNGAALSDVSDLEITVSHNFPESTWIGTAYSGDSGWYSAQMDT-----------VLYDYTLNPLTISSLSDLKTQLSDSKIQEIFTAAGTTTTTNATYAVQNALGFTNKN-NGAENRDLLHVNVLETVPGQSGGDPTTKNYDLQIPVSDLNLELKDLSVTVKGTNVAETTLTTTLTYNIGINEAQNFTQPTTNPTVQGSDIQNDDANAANKALVALTYATEADGQTTLDNEKISAELGIYNSVFTAVSIKP--VDGGNNQYTITLSATPKDGYVWEDGSNTAKQVSFNVTFTVN 377
>gi|26554133|ref|NP_758067.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454141|dbj|BAC44471.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (439 aa)
Score = 628, Expect = 2.0e-63, Identities = 183/327 (55%), Positives = 219/327 (66%)
  Q:    51 TQSITPKIKTESKLSGALSNIYDTANTGKTNELIANEIKKNLSEVFENGEDLSKVNDLQVSVTHTFPASTWTGLSF----DAASGNWKHSTDSNQDVTITDANKLLYASKTQALDISSLSDLKTQLDDTKLKAILTDTGVTPAADTTYSVANALGFTNKKKDDTNNRDLLHVNVVGTKT--GSNPGTTNYDLQIPVSDLNLKLTDLSVTVKGTNVAETTEKTTLTYNIGINDVVEFVDPSAKPTVAASVKTNKETMNALKALGYTATVSGQDQIDNDKVAAALGIYNCTFTLAAENPLVI------DDATNKFTFNLVATPNSGYVWEDGTNTAKPVQF 377
           T++ITPKIK+   L GALSNIYDTANT  TN LIA+EIKKNLSEVF+NGE L  ++ L +SV H FP STWTGL F    D +S  W +       + I   NKLLY SKTQ L ISSLSDLKTQL+D+KLK IL DT   P A+TTYSV NALGFTNK    ++N+DLLHVNVVGT    GS   TTNYDLQIPVSDLNLKLTDL VTVKG NV  +T +TTLTYNIGIND     +  AKP    S     +T+          T   +  ++N+ +   LGIYN TF+  + + +        ++    +T  L A PN GYVWEDGT+TAK + F
  S:    90 TETITPKIKSTVTLGGALSNIYDTANTSNTNNLIADEIKKNLSEVFDNGEALKDISSLDISVNHKFPDSTWTGLPFNHSSDGSSVFWGNDQADQTSILIEPENKLLYPSKTQPLTISSLSDLKTQLNDSKLKEILKDTETKPEANTTYSVDNALGFTNKAL-GSDNKDLLHVNVVGTTKVEGSEDTTTNYDLQIPVSDLNLKLTDLEVTVKGDNVTTSTLRTTLTYNIGINDSTNQDNEGAKPQATESDAGKLDTILVKFGYANEGTQGQEATLNNENLIEGLGIYNVTFSKDSNSKIEPKTNSGNEENEKTYTITLSAKPNDGYVWEDGTSTAKNISF 427
>gi|26554109|ref|NP_758043.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454117|dbj|BAC44447.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (353 aa)
Score = 563, Expect = 7.2e-56, Identities = 172/350 (49%), Positives = 229/350 (65%)
  Q:    15 TGAFGIVATVPVIVSACSSTSDNNGNNNNGGDTNQQTQSITPKIKTESKLSGALSNIYDTANTGKTNELIANEIKKN-LSEVFENGEDLSKVNDLQVSVTHTFPASTWTGLSFDAASGNWKHSTDSNQDVTITDANKLLYASKTQALDISSLSDLKTQLD-DTKLKAILTDTGVTPAAD-TTYSVANALGFTNKKKDDTNNRDLLHVNVVGTKTGSNPGTTNYDLQIPVSDLNLKLTDLSVTVKGTNVAETTEKTT-LTYNIGINDVVEFVDPSAKPTVAASVKTNKETMNALKALGYTATVSGQD--QIDNDKVAAALGIYNCTFTLAAENPLVIDDATNKFTFNLVATPNSGYV 364
           TGAFGIVATVPVIVS+CSSTSDNN     GGD+N QTQ+ITP+++    LSGAL++IYD+      N+ IA +IK+N L +VF NGE LS+V+DL V+V   F   +W GL+F+  +GNW+ S ++  ++TI +ANKL+Y S+++ +DI SL+DL  +L     LK  L + GV    + TT ++ N LGFTN         DLLHVNV  T TGSNP  TNYDLQIPVS+LNL + +L++TV GTNV E    TT   +NIGIND V   D   K  +AA  ++  E + AL  L  ++T SG     IDND V+A +G+YNC F  A+     +D++   +T  L ATP  GYV
  S:    15 TGAFGIVATVPVIVSSCSSTSDNN----TGGDSNTQTQTITPELRETVNLSGALTDIYDSTGAQNANQKIAADIKENHLGDVFTNGEALSQVSDLTVTVNGNFSRDSWAGLTFNGETGNWEDSANNQNNITIAEANKLVYTSESEQIDIESLNDLHEKLSVRDTLKTALENAGVAQIPETTTLAINNNLGFTNG--------DLLHVNVSATPTGSNPTITNYDLQIPVSNLNLVVPNLTITVSGTNVGEANRTTTNFNFNIGINDTVSETD--EKGELAADNRSANEALVAL-GLATSSTDSGNTTYTIDNDAVSAVVGVYNCNF--ASPTIQAVDESAGTYTITLQATPLDGYV 353
>gi|26554108|ref|NP_758042.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454116|dbj|BAC44446.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (378 aa)
Score = 562, Expect = 9.9e-56, Identities = 185/371 (49%), Positives = 244/371 (65%)
  Q:    14 MTGAFGIVATVPVIVSACSSTSDNNGNNNNGGDTNQQTQSITPKIKTESKLSGALSNIYDTANTGKTNELIANEIKKNLSEVFENGEDLSKVNDLQVSVTHTFP-ASTWTGLSFDAASGNWKHSTDSNQDVTITDANKLLYASKTQALDISSLSDLKTQLDDTKLKAILTDTGVTPAADTTYSVA--NALGFTNKKK--DDTNNRDLLHVNVVGTKTGSNPGTTNYDLQIPVSDLNLKLTDLSVTVKGTNVAETTEKTT-LTYNIGINDVVEFVDPSAKPTVAASVKTNKETMNALKALGYTATVSGQDQIDNDKVAAALGIYNCTFTLAAENPLVI---DDATNKFTFNLVATPNSGYVWEDGTNTAKPVQFATDFTVS 384
           MTGAFGIVATVPVIVS+CSSTSDNN   +N G  N Q Q+I+ ++++   LSGALSNIY+  +   TN L+A +IK NL+ VFENGE L+ V+DL+++V   FP  S WTG +  A +  W      N    +TD   +LY   T AL+ISSL+DLKTQL   K+ +I+T+    PA+ T ++V   +ALG TN     D   +RDLLH++V GT+ GSN  TTNYDLQIPVSDLNL ++DL+VTV GTNV +T   TT  TYNIGIN+   FV P+  P++  S  TN +   AL ALGY     G   ++N+ ++A +G+YN  F+    NP +      ++N+FT  L ATP  GYVWEDGT  AK + F   FTV+
  S:    14 MTGAFGIVATVPVIVSSCSSTSDNNTGGDNNGGGNTQNQTISTQLRSSVTLSGALSNIYNPTSGSNTNTLLAAQIKSNLNSVFENGEALANVDDLEITVNGNFPTTSEWTGTTAFAGNNGW------NATQGLTD---VLYDWNTAALNISSLNDLKTQLTSEKITSIITEASSAPASGTVFTVVENSALGLTNNADSIDANASRDLLHIHVTGTE-GSN--TTNYDLQIPVSDLNLVVSDLTVTVTGTNVEQTGSTTTNFTYNIGINETANFVQPTQAPSI-NSADTNGDGNKALVALGYANESDGNYTLNNEAISAGIGVYNSEFS----NPTIAATQGGSSNQFTITLSATPKEGYVWEDGTRDAKSISFPVTFTVT 376
>gi|26554107|ref|NP_758041.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454115|dbj|BAC44445.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (386 aa)
Score = 551, Expect = 2.1e-54, Identities = 171/368 (46%), Positives = 229/368 (62%)
  Q:    15 TGAFGIVATVPVIVSACSSTSDNNGNNNNGGDTNQQTQSITPKIKTESKLSGALSNIYDTANTGKTNELIANEIKKN-LSEVFENGEDLSKVNDLQVSVTHTFPASTWTGLSFDAASGNWKHSTDS---NQDVTITDANKLLYASKTQALDISSLSDLKTQLDD-TKLKAILTDTGV-TPAADTTYSVANALGFTNKKKDDTNNRDLLHVNVVGTKTGSNPGTTNYDLQIPVSDLNLKLTDLSVTVKGTNVAETTEKTT-LTYNIGINDVVEFVDPSAKPTVAASVKTNKETMNALKALGYTATVSGQDQ----IDNDKVAAALGIYNCTFTLAAENPLVIDDATNKFTFNLVATPNSGYVWEDGTNTAKPVQFATDFT 382
           TGAFGIVATVPVIVSACSSTSDNN    N G    Q Q+I P+++    LSGALS+I+D+      N+ IA +I++N L++VF NG++LS+V DL VSVT  F  S+W GL+F+  SGNW    +       V I +ANKL+Y S+++  DISSL D KT+L    KLK  L   G  T    TT +VAN +GFT+         DLLH+NV  T  G +P  TNYDLQIPVS+LN+ + +L++TV GTN+ E    TT  ++NIGI+D V   + SA    A       +   AL ALG  ++ +        IDND V+A +G+YNC F + +     + ++ + FT  L ATP  GYVW+DG+N +KPV     FT
  S:    15 TGAFGIVATVPVIVSACSSTSDNN-TGGNTGGDGTQNQTINPELRESVNLSGALSDIFDSTGAQNANQKIAADIQQNHLNDVFVNGQELSQVEDLTVSVTGNFSRSSWDGLTFNGESGNWGSVGEDGNITDSVNIEEANKLIYTSESEQFDISSLDDFKTKLSTGDKLKTALEAAGAGTIDNTTTLAVANNIGFTDD--------DLLHINVTATPAGDSPTVTNYDLQIPVSNLNIVVPNLTITVAGTNIGEANRTTTNFSFNIGIDDTVSESNESASLATA----NRNDAKQALVALGLASSSTEGGNTTYTIDNDAVSAVVGVYNCRFDIDSATIAPVGESNDNFTITLQATPLEGYVWDDGSNGSKPVTINATFT 380
>gi|26554129|ref|NP_758063.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454137|dbj|BAC44467.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (384 aa)
Score = 546, Expect = 7.7e-54, Identities = 179/371 (48%), Positives = 242/371 (65%)
  Q:    14 MTGAFGIVATVPVIVSACSSTSDNNGNNNNGGDTNQQTQSITPKIKTESKLSGALSNIYDTANTGKTNELIANEIKKN-LSEVFENGEDLSKVNDLQVSVTHTFPASTWTGLSFDAASGNWKHSTDSNQDVTITDANKLLYASKTQALDISSLSDLKTQLD-DTKLKAILTDTGVTPAAD-TTYSVANALGFTNKKKDDTNNRDLLHVNVVGTKTGSNPGTTNYDLQIPVSDLNLKLTDLSVTVKGTNVAETTEKTT-LTYNIGINDVVEFVDPSAKPTVAASVKTNKETMNA-LKALGYTATVSGQDQIDNDKVAAALGIYNCTFTLAAENPLVIDDATNK----FTFNLVATP-NSGYVWEDGTNTAKPVQFATDFTVS 384
           MTGAFGIVATVPVIVS+CSSTSDNNGNNN G + NQQTQ+ITP++     LSG+LS+IYD+  T   N+ IA +IK N LS+VF NG+ LS+V+DL V+V+  F  + WTGL+F+  +GNW+ S D++ ++TI DANKL+Y S++  ++I SL DL  +L     LK  L + GV    + TT +V+N LGFTN         DLLHVNV  T TG++   TNYDLQIPVS+LNL + +L++TV GTNV E    TT   +N+GI+  + F      P+      T  +  +  L+ LGYT T +G   + NDK++AALGIYNC FT           ATN     +T  + A P ++ YVW+DG++ +K   F    TV+
  S:    14 MTGAFGIVATVPVIVSSCSSTSDNNGNNNGG-NGNQQTQTITPELNETVNLSGSLSDIYDSTGTLNANQKIAADIKDNHLSDVFANGQALSEVSDLSVTVSGEFSRALWTGLTFNGETGNWEDSEDNSNNITIADANKLVYTSESDQINIESLDDLHNKLSVRETLKTALENAGVASIPETTTLAVSNNLGFTNG--------DLLHVNVTATPTGASATATNYDLQIPVSNLNLVVPNLTITVAGTNVGEANRTTTNFNFNVGIDPTLNFSQTGNAPSATTDEVTGDDAASTILQKLGYT-TATGSTDLSNDKISAALGIYNCKFTPTNATENTSATATNNGNKVYTVTVTAEPYDTSYVWDDGSSGSKEFTFDVSLTVN 384
>gi|26554126|ref|NP_758060.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454134|dbj|BAC44464.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (388 aa)
Score = 525, Expect = 1.7e-51, Identities = 177/371 (47%), Positives = 240/371 (64%)
  Q:    14 MTGAFGIVATVPVIVSACSSTSDNNGNNNNGGDTNQQTQSITPKIKTESKLSGALSNIYDTANTGKTNELIANEIKKN-LSEVFENGEDLSKVNDLQVSVTHTFPASTWTGLSFDAASGNWKHSTDSNQDVTITDANKLLYASKTQALDISSLSDLKTQLD-DTKLKAILTDTGVTPAAD-TTYSVANALGFTNKKKDDTNNRDLLHVNVVGT---KTGSNPGTTNYDLQIPVSDLNLKLTDLSVTVKGTNVAETTEKTT-LTYNIGINDVVEFVDPSAKPTVAASVKTNKETMNALKALGYTATVSGQDQIDNDKVAAALGIYNCTFT--LAAENPLVIDDA----TNK-FTFNLVATP-NSGYVWEDGTNTAKPVQFATDFTVS 384
           MTGAFGIVATVPVIVS+CSSTSDNN    +G     QTQ+ITP++K    LSG LS+I+D+  T   NE IA +IK N LS+VF+NG+ L +V+DL+V+V   F   +W+G ++DAASG WK  +    DVTI+ ANKL+YAS++  L+ISSL+DLKTQL     LK  L   GV+  AD TT +V N +G T+         DLLH+NV  T    +G    TTNYDLQIPVS++NL + +L++TV GTNV E T+ TT   +N+GI+  + F      P V+ +    ++   A   L     VS  + + +DK++AALGIYNC FT   A EN  V  D+    +NK +   + ATP ++ YVW+DGT   K + F  +  V+
  S:    14 MTGAFGIVATVPVIVSSCSSTSDNN-TGGDGNGGGTQTQTITPQLKDSVSLSGPLSDIFDSTGTQNANEKIAADIKDNHLSDVFDNGDALKQVSDLKVTVAGDFKRDSWSGGTYDAASGGWKSDSG---DVTISAANKLVYASESPQLNISSLNDLKTQLSVKATLKEALEKAGVSTIADTTTLAVNNNIGLTD---------DLLHINVSSTPQVASGQTATTTNYDLQIPVSNINLVVNNLTITVAGTNVGEATKTTTNFKFNVGIDATLSFKQTGTAPDVSKTESEAEQATLASTILQKLGYVSSGNTLSDDKISAALGIYNCKFTPKSATENTEVQPDSGITGSNKVYKVTVTATPYDTNYVWDDGTTGPKDISFDVNLKVA 386
>gi|26554134|ref|NP_758068.1| P35 lipoprotein homolog reported as gene for P33 lipoprotein [Mycoplasma penetrans HF-2] >gi|27805657|sp|Q50368|P33_MYCPE Lipoprotein p33 precursor >gi|26454142|dbj|BAC44472.1| P35 lipoprotein homolog reported as gene for P33 lipoprotein [Mycoplasma penetrans HF-2] (376 aa)
Score = 497, Expect = 3.7e-48, Identities = 177/370 (47%), Positives = 228/370 (61%)
  Q:    15 TGAFGIVATVPVIVSACSS------TSDNNGNNNNGGDTNQQTQSITPKIKTESKLSGALSNIYDTANTG----KTNELIANEIKKNLSEVFENGEDLSKVNDLQVSVTHTFPA-STWTGLSFDAASGNWKHSTDSNQDVTITDANKLLYASKTQALDISSLSDLKTQLDDT-KLKAILTDTGV--TPAADTTYSVANALGFTNKKKDDTNNRDLLHVNVVGTKTGSNPGTTNYDLQIPVSDLNLKLTDLSVTV------KGTNVAETTEKTT-LTYNIGINDVVEFVDPSAKPTVAASVKTNKETMNALKALGYTATVSGQDQIDNDKVAAALGIYNCTFTLAAENPLVIDDATNKFTFNLVATPNSGYVWEDGTNTAKPVQFATDFTVS 384
           TGAFGIVATVPVIVS+CSS      T DNN      G   QQ  + TP IK++  LSGALS IYDT NTG     TN LIA +IK N    F NGEDL KV    V+V  +F + S WTG ++   S              + D +K +Y S ++ L+I+SL DLK+QLD + K+KAI  ++ +  + A   +Y + N LGFT          DLLH+NV  T+ G    T N DL IPVSDLNLK+TDL V+V       G NVA  ++ TT  TYNIGI +  E   P+ KP +A + K   E M  LKALGYT T   + ++DNDKV+ +LG+YNC FT  +  P  ++ + +KFT  L A P + YVWEDGTNT K + F   FT++
  S:    15 TGAFGIVATVPVIVSSCSSTDNNGGTGDNNTGGGGSGTDQQQGTTYTPAIKSDVTLSGALSKIYDTTNTGDSRKNTNTLIAEDIKANPENYFTNGEDLKKVEGWSVTVDGSFDSNSVWTGDAYSKWSA-------------VADTHKGVYKSTSKQLNINSLKDLKSQLDTSAKIKAICDESNLVFSTADADSYKIQNELGFTGG--------DLLHINVTATQAGK---TLNMDLGIPVSDLNLKITDLKVSVTASNNSTGNNVAAVSDLTTNFTYNIGIKE--EVTAPTEKPNLAKTDK--GEVMKVLKALGYTQT-GDETKLDNDKVSNSLGLYNCEFTAVSATP--VEGSEDKFTIKLKAKPLTDYVWEDGTNTEKEISFEATFTMT 374
>gi|26554136|ref|NP_758070.1| P35 lipoprotein homolog reported as IMP14 [Mycoplasma penetrans HF-2] >gi|26454144|dbj|BAC44474.1| P35 lipoprotein homolog reported as IMP14 [Mycoplasma penetrans HF-2] (375 aa)
Score = 463, Expect = 3.1e-44, Identities = 185/370 (50%), Positives = 224/370 (60%)
  Q:    15 TGAFGIVATVPVIVSACSSTSDNNGNNNNGGDT--------NQQTQSITPKIKTESKLSGALSNIYDTA---NTGKTNELIANEIKKNLSEVFENGEDLSKVNDLQVSVTHTFPA-STWTGLSFDAASGNWKHSTDSNQDVTITDANKLLYASKTQALDISSLSDLKTQL-DDTKLKAI---LTDTGVTPAADTTYSVANALGFTNKKKDDTNNRDLLHVNVVGTKTGSNPGTTNYDLQIPVSDLNLKLTDLSVTV-----KGTNVAETTEK--TTLTYNIGINDVVEFVDPSAKPTVAASVKTNKETMNALKALGYTATVSGQDQIDNDKVAAALGIYNCTFTLAAENPLVIDDATNKFTFNLVATPNSGYVWEDGTNTAKPVQFATDFTVS 384
           TGAFGIVATVPVIVS+CSSTSDNNGN NN  D          QQ  + TP IKTE  LSG+LS IYDT    +   TNE+IA +I  N  + F NG DL  V    V+V   F + STWTG ++ A S N   S               +YA  ++ L+I+SL+DLKTQL D TKLKAI   +     + A  ++Y V N +GFT          DLLH+NV   + G+N  T N +L IPVSDLNLK+T L V+V     +  N  E+ E   T  TYNIGI D V+F  P+  PT   + K N     ALKALGYT T      +DNDK+AAA+GIYNCTF   A +     +  NKFT  L ATPN  YVWEDGT  AK V F   FTV+
  S:    15 TGAFGIVATVPVIVSSCSSTSDNNGNGNNNNDNNGGGSGTDQQQGTTYTPAIKTEVSLSGSLSKIYDTTTGDSRKNTNEMIAQDILSNPEDYFTNGADLKNVQGWSVTVDGNFDSQSTWTGEAYSAWSANATFSG--------------VYAIASEQLNITSLNDLKTQLSDSTKLKAICDAIPGLRFSSATASSYQVQNQVGFTGD--------DLLHINVTA-QDGNN--TRNMNLGIPVSDLNLKITGLKVSVNGTNNETGNNVESVENLTTDFTYNIGIKDTVDFTQPTTTPTTTEANKNN--VNEALKALGYTKT---DGSLDNDKIAAAVGIYNCTFV--ASSIQEDSNTPNKFTITLKATPNENYVWEDGTREAKDVSFDVTFTVN 375
>gi|3850057|emb|CAA07195.1| putative lipoprotein [Mycoplasma penetrans] (360 aa)
Score = 461, Expect = 5.7e-44, Identities = 180/360 (50%), Positives = 219/360 (60%)
  Q:    14 MTGAFGIVATVPVIVSACSSTSDNNGNNNNGGDT--------NQQTQSITPKIKTESKLSGALSNIYDTA---NTGKTNELIANEIKKNLSEVFENGEDLSKVNDLQVSVTHTFPA-STWTGLSFDAASGNWKHSTDSNQDVTITDANKLLYASKTQALDISSLSDLKTQL-DDTKLKAI---LTDTGVTPAADTTYSVANALGFTNKKKDDTNNRDLLHVNVVGTKTGSNPGTTNYDLQIPVSDLNLKLTDLSVTV-----KGTNVAETTEK--TTLTYNIGINDVVEFVDPSAKPTVAASVKTNKETMNALKALGYTATVSGQDQIDNDKVAAALGIYNCTFTLAAENPLVIDDATNKFTFNLVATPNSGYVWEDGTNTAK 373
           +TGAFGIVATVPVIVS+CSSTSDNNGN NN  D          QQ  + TP IKTE  LSG+LS IYDT    +   TNE+IA +I  N  + F NG DL  V    V+V   F + STWTG ++ A S N   S               +YA  ++ L+I+SL+DLKTQL D TKLKAI   +     + A  ++Y V N +GFT          DLLH+NV   + G+N  T N +L IPVSDLNLK+T L V+V     +  N  E+ E   T  TYNIGI D V+F  P+  PT   + K N     ALKALGYT T      +DNDK+AAA+GIYNCTF   A +     +  NKFT  L ATPN  YVWEDGT  AK
  S:     1 LTGAFGIVATVPVIVSSCSSTSDNNGNGNNNNDNNGGGSGTDQQQGTTYTPAIKTEVSLSGSLSKIYDTTTGDSRKNTNEMIAQDILSNPEDYFTNGADLKNVQGWSVTVNGNFDSQSTWTGEAYSAWSANATFSG--------------VYAMASEQLNITSLNDLKTQLSDSTKLKAICDAIPGLRFSSATASSYQVQNQVGFTGD--------DLLHINVTA-QDGNN--TRNMNLGIPVSDLNLKITGLKVSVNGTNNETGNNVESVENLTTDFTYNIGIKDTVDFTQPTTTPTTTEANKNN--VNEALKALGYTKT---DGSLDNDKIAAAVGIYNCTFV--ASSIQEDSNTPNKFTITLKATPNENYVWEDGTREAK 351
>gi|26554196|ref|NP_758130.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454205|dbj|BAC44534.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (382 aa)
Score = 454, Expect = 3.2e-43, Identities = 174/370 (47%), Positives = 225/370 (60%)
  Q:    15 TGAFGIVATVPVIVSACSSTSDNNGNNNNGGDTNQQTQSITPKIKTESKLSGALSNIYDTANTGK--TNELIANEIKKNLSEVFENGEDLSKV-NDLQVSVTHTFPASTW-TGLSFDAASGNWKHSTDSNQDVTITDANKLLYASKTQALDISSLSDLKTQLDDTK-LKAILTDTGVTP-AADTTYSVANALGFTNKKKDDTNNRDLLHVNVVGTKTGSNPGTTNYDLQIPVSDLNLKLTDLSVTVKGTNVAETTEKTT-LTYNIGINDVVEFVDPSAKPTVAASVKTNKETMNALKALGYTATVSGQDQIDNDKVAAALGIYNCTFT-LAAENPLVIDDATNK--FTFNLVATPNSG-YVWEDGT--NTAKPVQFATDFTVS 384
           TGAFGIVATVPVIVS+CSSTS+NN  N N      QTQ +TP +K +  L GAL+ IYDT+ T +  TN LIA++IK N    F NG +L  V +D  V+V   F  ++W +GLS+DA +GNWK   D    VTI D+NKL+YAS ++ ++I+SL  LKT+L+ T  LK  L   G T  A+ TT +V N LGFTN         DL+H+NV  T T      TNYDLQIP SD+NL +TDLSVTV G N+   T+ TT  TYNIGI+  V F         AAS    K+    L+ L Y +T      +DN+ +   LGIYN  F+  + +   V   AT++  +T  L A P S  YVW DG+  NTAK + F     V+
  S:    15 TGAFGIVATVPVIVSSCSSTSENNNGNGN--GGADQTQKVTPVLKDDVSLEGALNKIYDTSTTDRKNTNTLIADDIKANPENYFTNGAELKNVISDATVTVDGKFSNASWASGLSYDATTGNWK---DDTTTVTIQDSNKLVYASSSKQINITSLDGLKTELEKTDVLKNALEAAGATTIASGTTLTVENKLGFTND--------DLIHINVKATPTSG--AETNYDLQIPTSDINLSVTDLSVTVTGNNIEAATKTTTNFTYNIGIDSEVHF--NQGANLTAASEDDAKDVNKVLEQLKYGSTTGSTFSLDNNAIIKGLGIYNVNFSNPSIQEKTVSSRATSEKTYTITLDAKPQSSEYVWADGSDVNTAKKISFDVKIDVT 380
>gi|26554106|ref|NP_758040.1| putative P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454114|dbj|BAC44444.1| P35 lipoprotein homolog fragment [Mycoplasma penetrans HF-2] (179 aa)
Score = 452, Expect = 5.5e-43, Identities = 111/165 (67%), Positives = 137/165 (83%)
  Q:    14 MTGAFGIVATVPVIVSACSSTSDNNGNNNNGGDTNQQTQSITPKIKTESKLSGALSNIYDTANTGKTNELIANEIKKNLSEVFENGEDLSKVNDLQVSVTHTFPASTWTGLSFDAASGNWKHSTDSNQDVTITDANKLLYASKTQALDISSLSDLKTQLDDTKLK 178
           MTGAFGI+ATVPVIVS+CSSTSDNNG N +     +Q+Q+I P+IK+   LSGAL++IY+  +  KTN LIA+EIK NL++VF+NG DL+ V+DL+VSVTHTFPASTWTGLSFD+ SGNWK    S  DVTI +ANKL+Y+S++Q L+ISSLSDLKTQLDDTKLK
  S:    14 MTGAFGIIATVPVIVSSCSSTSDNNGGNGDTNQGGEQSQTIIPQIKSSVTLSGALTDIYNPTDISKTNSLIADEIKNNLADVFDNGSDLTNVSDLEVSVTHTFPASTWTGLSFDSTSGNWKAEGSSGNDVTIDNANKLVYSSESQ-LNISSLSDLKTQLDDTKLK 177
>gi|26553722|ref|NP_757656.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26453729|dbj|BAC44060.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (368 aa)
Score = 450, Expect = 1.1e-42, Identities = 162/363 (44%), Positives = 208/363 (57%)
  Q:    15 TGAFGIVATVPVIVSACSSTSDNNGNNNNGGDTNQ-------QTQSITPKIKTESKLSGALSNIYDTANTGKTNELIANEIKKNLSEVFENGEDLSKVNDLQVSVTHTF-PASTWTGLSFDAASGNWKHSTDSNQDVTITDANKLLYASKTQALDISSLSDLKTQLDDT-KLKAILTDTGVTPAADTTYSVANALGFTNKKKDDTNNRDLLHVNVVGTKTGSNPGTTNYDLQIPVSDLNLKLTDLSVTVK------GTNVAETTEKTT-LTYNIGINDVVEFVDPSAKPTVAASVKTNKETMNALKALGYTATVSGQDQIDNDKVAAALGIYNCTFTLAAENPLVIDDATNKFTFNLVATPNSGYVWEDGTNTAKPVQF 377
           TGAFGIVATVPVIVS+CSST +N G  NN             Q Q+ITPK+K +    GALS IYDT     TN LIA +IK N    FENG DL  +    V+V   F  A++W G ++D  S                +  K +Y   +  L+I+SL DLK+QL  + ++K +  D+ +T +  T Y V N LGFT+         DLLHVNV   +  +N      D+ IPVSDLNLK+T L V+V       G NVAE  + TT  TYNIGIND V+ + P+A   V A  KT+   +  LKALGY    +    +DNDK++ ALG+YNC F   +       +  NK+T  L ATPN GYVWE+GT  AK V F
  S:    15 TGAFGIVATVPVIVSSCSSTDNNGGTGNNNNQGGGNGGNTDTQQQTITPKLKADVTTQGALSKIYDTTAKEDTNTLIAKDIKANPETYFENGADLKSIEGWTVTVDGNFDSAASWEGQTYDEWS-------------KTANIKKGVYEQTSAQLNIASLKDLKSQLSTSEQIKKLCEDSNLTFSDATEYKVQNQLGFTDG--------DLLHVNVTAKQNTTN---LVMDVAIPVSDLNLKITGLKVSVSKTENQTGNNVAEVKDLTTNFTYNIGINDTVKEITPTA---VLAQDKTDANKV--LKALGYATEAANVYTLDNDKLSDALGLYNCKFEAVSSKA---TNEANKYTVTLKATPNDGYVWENGTKDAKEVSF 361
>gi|26554138|ref|NP_758072.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454146|dbj|BAC44476.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (362 aa)
Score = 439, Expect = 1.8e-41, Identities = 157/359 (43%), Positives = 207/359 (57%)
  Q:    15 TGAFGIVATVPVIVSACSSTSD------NNGNNNNGGDTNQQTQSITPKIKTESKLSGALSNIYDTANTGKTNELIANEIKKNLSEVFENGEDLSK-VNDLQVSVTHTFPASTWTGLSFDAASGNWKHSTDSNQDVTITDANKLLYASKTQALDISSLSDLKTQLDDTKLKAILTDTGVTPAADTTYSVANALGFTNKKKDDTNNRDLLHVNVVGTKTGSNPGTTNYDLQIPVSDLNLKLTDLSVTVKGTNVAETTEKTT-LTYNIGINDVVEFVDPSAKPTVAASVKTNKETMNALKALGYTATVSGQ-DQIDNDKVAAALGIYNCTFTLAAENPLVIDDATNKFTFNLVATPNSGYVWEDGTNTAK 373
           TGAFGIVATVPVIVS+CSSTSD      NN NN N     QQ   ITP IK E  LSGALS IYD   +  T++LIA +IK N +  F+NGE L   + D  VSV   F  ST+ G +++  S                   K  YA  ++ LDI S++DL+TQL D+    I+ D      A  T  + N   +  +K     + DLLHVN+   + G+     + DL IPVSDLNLK+  L ++V GT + E+T+ TT   +N+GI++ V+   P    T   +    ++ M  +KALGY  TVSGQ D++DNDK++ ALG+YNC F   +  P  +    NK+T  L ATPN GYVWEDGTN  K
  S:    15 TGAFGIVATVPVIVSSCSSTSDNNGGNGNNNNNGNQDGNGQQQTEITPTIKKEVSLSGALSKIYDANKS--TSDLIAEDIKANPTNYFDNGEALKDLIKDATVSVNGGFTESTFKGDTYETWSAK-------------VGDKKGTYAQASKQLDIKSINDLETQLGDSNNIKIICD------AIPTLKLTNGSDYKVEKNALKLDGDLLHVNISAKENGTT--AVSMDLAIPVSDLNLKIDALKISVSGTGIKESTDLTTNYKFNVGIDNTVK---PITNATGTVTAGDREKVMTVMKALGY--TVSGQDDKLDNDKLSDALGLYNCNFEAVSSKP--VSGQANKYTITLKATPNEGYVWEDGTNNPK 352
>gi|26554128|ref|NP_758062.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454136|dbj|BAC44466.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (353 aa)
Score = 430, Expect = 2.2e-40, Identities = 157/351 (44%), Positives = 206/351 (58%)
  Q:    14 MTGAFGIVATVPVIVSACSSTSDNNGNNNNGGDTNQQTQSITPKIKTESKLSGALSNIYDT-----ANTGKTNELIANEIKKNLSEVFENGED---LSKVNDLQVSVTHTFPASTWTGLSFDAASGNWKHSTDSNQDVTITDANKLLYASKTQALDISSLSDLKTQLDDTK-------LKAILTDTGVTPAADTTYSVANALGFTNKKKDDTNNRDLLHVNVVGTKTGSNPGTTNYDLQIPVSDLNLKLTDLSVTVKGTNVAETTEKTT-LTYNIGINDVVEFVDPSAKPTVAASVKTNKETMNALKALGYTATVSGQDQIDNDKVAAALGIYNCTFTLAAENPLVIDDATNKFTFNLVATPNSGYV 364
           MTGAFGIVATVPVIVS+CSSTSDNNGN N   + N +TQ +TP +K    L G+LS I+DT     A+   TN LI+ +IK N  + F NG D    S +    + V   F  ++WTG ++D  +  W         VTI DANKL+Y S +  L    L  LK +L+ T         +  L   G T A+ TT ++ N LGFTN         DL+HVNV    +  NP   NYDLQIP SDLNL +T LS+ V G N+ E  + TT  TYNIGI + V  + P+ KP +A + K  +  M  ++ALGYT T    D +D++K++  LG+YNC FTL +      +  T  FT  + ATPN GYV
  S:    14 MTGAFGIVATVPVIVSSCSSTSDNNGNGNT--NGNTETQKVTPVLKDSVDLKGSLSKIFDTTATDAASRKSTNTLISEDIKANPEDYFTNGSDSNVQSAIQSATIDVEGNFSNASWTGNAYDTNTNTW-------SGVTIEDANKLVYTSNSAQLTFKDLDGLKAELEKTTGTDSKTVAQVALEAAGATFASGTTITIENRLGFTND--------DLIHVNVKAAPSSGNP--VNYDLQIPTSDLNLSVTGLSIKVTGENITEGEKTTTNFTYNIGIKEGV--IVPTDKPNLATADKGTQ--MKVMEALGYTNTAG--DALDDNKISVKLGLYNCKFTLVSATEDTNNAGT--FTIKISATPNEGYV 353
>gi|26554137|ref|NP_758071.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454145|dbj|BAC44475.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (361 aa)
Score = 428, Expect = 3.2e-40, Identities = 151/359 (42%), Positives = 209/359 (58%)
  Q:    15 TGAFGIVATVPVIVSACSSTS----DNNGNNNNGGDTNQQTQSITPKIKTESKLSGALSNIYDTANTGKTNELIANEIKKNLSEVFENGEDLSK-VNDLQVSVTHTFPASTWTGLSFDAASGNWKHSTDSNQDVTITDANKLLYASKTQALDISSLSDLKTQLDDTKLKAILTDTGVTPAADTTYSVANALGFTNKKKDDTNNRDLLHVNVVGTKTGSNPGTTNYDLQIPVSDLNLKLTDLSVTVKGTNVAETTEKTT-LTYNIGINDVVEFVDPSAKPTVAASVKTNKETMNALKALGYTATVSGQDQIDNDKVAAALGIYNCTFTLAAENPLVIDDATNKFTFNLVATPNSGYVWEDGTNTAK 373
           TGAFGIVATVPVIVS+CSSTS    +++ N    GD  QQ   +TP IKTE  LSGALS IYD   T  T++LIA +IK N +  F+NG+ L + + D  VSV   F  ST+ G ++D  S                DA K  Y      L+I S++DL+TQL D+K    L ++       ++  + N   +  +K     + DLLHVN+   + G        DL IPVSDLNLK+ DL ++V GT +  +T+ TT  T+N+GI++ V+ +   AK  +A + +  KE +  +KALGYT T      +DNDK++ ALG+YNC+F +   +P V    + ++T  L ATPN  YVWEDGTNT K
  S:    15 TGAFGIVATVPVIVSSCSSTSDNNGNSDNNPGGQGDGGQQQTEVTPTIKTEVSLSGALSKIYDGKKT--TSDLIAEDIKANPTNYFDNGDALKELIKDATVSVNGGFTESTFKGETYDVWS---------------KDAKKGTYPQSAAQLNIKSINDLETQLGDSKAIQTLCES------ISSLKITNGSDYKVEKNALKLDGDLLHVNITAKEDGKT-DRVKMDLAIPVSDLNLKIDDLKISVNGTGIKTSTDLTTKYTFNVGIDNTVKTIT-GAKGVLAENER--KEFLKVMKALGYTDTAG--TNLDNDKLSDALGLYNCSFEVTGVDP-VTGSTSGEYTIKLKATPNKDYVWEDGTNTPK 349
>gi|26554123|ref|NP_758057.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454131|dbj|BAC44461.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (388 aa)
Score = 428, Expect = 3.6e-40, Identities = 160/370 (43%), Positives = 211/370 (57%)
  Q:    15 TGAFGIVATVPVIVSACSSTSDNNGNNNNGGDTNQQTQSITPKIKTESKLSGALSNIYDTANTG-----KTNELIANEIKKNLSEVFENGEDLS---KVNDLQVSVTHTFPASTWTGLSFDAASGNWKHSTDSNQDVTITDANKLLYASKTQALDISSLSDLKTQLD------DTKLKAILTDTGVTPAADTTYSVANALGFTNKKKDDTNNRDLLHVNVVGTKTGSNPGTTNYDLQIPVSDLNLKLTDLSVTVKGTNVAETTEKTT--LTYNIGINDVVEFVDPS-AKPTVAASVKTNKETM--NALKALGYTATVSGQDQIDNDKVAAALGIYNCTFT-------LAAENPLVIDDATNKFTFNLVATP-NSGYVWEDGTNTAKPVQFATDFTVS 384
           TGAFGIVATVP+IVS+CSSTSDNN   N  G   QQTQ +TP +K E  L G+LS I+DT  T       TN LI+ +IK N    F NG + +    +    + V   F  ++WTG +++  S  W         VTI DANKL+Y + +  L    L  LKT+L+       T L+  L   G T  ADTT ++ N +GFT+         DL+H+NV   K+G+    T YDLQIP S+LNL +T L++ V G N+  T EKTT    YNIGI+  + F     A P   A+  ++  T   N L  LGY  T  G D + NDK++AALGIYNC FT         A     + DA   +T  + ATP N  YVW+DG++  K   F     V+
  S:    15 TGAFGIVATVPIIVSSCSSTSDNNTGGNQDG---QQTQKVTPVLKDEVDLKGSLSKIFDTTATDASSRKSTNTLISEDIKANPENYFTNGNETNVKEAIEKATIDVEGNFSNASWTGNAYNTTSNGW-------DGVTIEDANKLIYTTSSAQLTFKDLDGLKTELEKNGTDNKTVLQNALEAAGATIEADTTLTIKNRVGFTSG--------DLIHINVEADKSGTQ---TQYDLQIPTSNLNLSVTGLTIKVSGDNI-NTNEKTTTNFKYNIGIDSTLGFEQAKGAAPEETANNLSDAATAAKNILVKLGYVTTTGGSD-LSNDKISAALGIYNCNFTPKSATEKQGATPDAGVTDANKVYTVTVTATPFNDTYVWDDGSSGEKDFSFDVSLKVN 388
>gi|26554156|ref|NP_758090.1| signal-peptide-less P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454165|dbj|BAC44494.1| signal-peptide-less P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (697 aa)
Score = 426, Expect = 5.3e-40, Identities = 138/339 (40%), Positives = 199/339 (58%)
  Q:    46 DTNQQTQSITPKIKTESKLSGALSNIYDTANTGK---TNELIANEIKKNLSEVFENGEDLSKVNDLQVSVTHTFPASTWTGLSFDAASGNWKHSTDSNQDVTITDANKLLYASKTQALDISSLSDLKTQLDDTKLKAILTDTGVTPAADTTYSVANALGFTNKKKDDTNNRDLLHVNV-VGTKTGSNPGTTNYDLQIPVSDLNLKLTDLSVTVKGTNV-AETTEKTTLTYNIGINDVVEFVDPSAKPTVAASVKTNKETMN-ALKALGYTATVSGQDQIDNDKVAAALGIYNCTFTLAAENPLVIDDAT--NKFTFNLVATPNSGYVWEDGTNTAKPVQFATDFTVS 384
           + N     ITP + +   L G+LS I+DT+ +G    TN +IA +IK NL+  F NG DL  V DL V+V   FP STWTG+++D     WK ST              +Y+S++  +DI+SL+DLKT+L    L  IL   G+  +  +++++ N +G +          DLLHVN+ + ++  +NP T   DL IPVSD+NLK+++L V+V G+NV A +      TYN+GI+D V FV P+   T  +S   NK  +N AL +LG+         ++ DK++AALG++NCTF    E   + +DA+  N FT  L ATPN+ Y WEDGTN  K + F  D TVS
  S:   382 NVNVSVDEITPSLNSTLDLKGSLSRIFDTSGSGTRKDTNTVIAEDIKSNLNNYFSNGNDLKTVEDLDVTVNGNFPTSTWTGVAYD----TWKSSTSYTG----------IYSSESAQIDITSLNDLKTKLTTKGLYGILLAAGLKFSG-SSFAIQNEIGLSGG--------DLLHVNIRITSEWTTNPFTV--DLAIPVSDINLKVSNLGVSVSGSNVKALSNGSVNYTYNVGIDDTVNFVKPTTGVTALSS--ANKTNVNEALVSLGFATKSGTNYTLNKDKISAALGVFNCTF----EGISIQEDASTANNFTITLKATPNTNYYWEDGTNVPKELSFKVDLTVS 697
Score = 379, Expect = 1.9e-34, Identities = 160/383 (41%), Positives = 223/383 (58%)
  Q:     1 MKIKKIKLLKALAMTGAFGIVATVPV------IVSACSSTSD-----NNGNNNNGGDTNQQTQSITPKIKTESKLSGALSNIYD--TANTGKTNELIANEIKKNLSEVFENGEDLSKVNDLQVSVTHTFPAS-TWTGLSFDAASGNWKHSTDSNQDVTITDANKLLYASKTQALDISSLSDLKTQL-DDTKLKAILTDTGVTPAADT-TYSVANA--LGFTNKKKDDTNNRDLLHVNVVGTKTGSNPGTTNYDLQIPVSDLNLKLTDLSVTVKGTNVAETTEKTT-LTYNIGINDVVEFVDPSAKPTVAASVKTNKETMNALKALGYTATVSGQDQI--DNDKVAAALGIYNCTFTLA----AENPLVIDDATNKFTFNLVA--TPNSGYVWEDGTNTAKPVQFATDFTV 383
           MK ++ KLLK L++TG F   A VP+      ++SA  + S      +N N + GGDT  Q Q+I PK+K+   LSG+L  I+D   +++  TN LIA EIK NL + F+N  DL KVN+L +SV   F    TW    +D   G  K           T  N++LY S     +ISSL D K+QL +DTKLK I++ +  +    T TYS+A+   LG            +L+HVNV+ T   SN  T + DLQIP+S++NL ++++ V+V G NV   T KTT  +YN+GI+D  +F +P   P  +AS    K     L  LGY A V+  +QI  + D +   LGIYN TF+ A    A N    D  T  +  +L A  TPN  +VWEDGT+  KPV F  + +V
  S:     1 MKSQRKKLLKILSITGIFVATAAVPITLLSKYVISASLTNSKNQNNQDNNNQDGGGDTTPQAQTIVPKLKSSINLSGSLDKIFDAKNSSSSNTNSLIAQEIKNNLDKSFDNASDLEKVNNLSISVDGGFSGGVTWGNKQYDQNIGWGKE----------TVGNEILYGSSLDQFNISSLDDFKSQLNNDTKLKDIISKSDASKFDSTATYSIASGSNLGLVGD--------NLVHVNVIETDASSN--TKSIDLQIPISNINLNVSNMIVSVSGDNVETQTNKTTNFSYNVGISDQSQFTNPVDAPVASAS--EVKSANKILVKLGY-AEVAANNQITLNQDLLKEELGIYNVTFSNANASIAPNGSTTDGTTGSYKISLDATPTPNKDFVWEDGTSDTKPVSFNVNVSV 387
>gi|26554118|ref|NP_758052.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454126|dbj|BAC44456.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (388 aa)
Score = 424, Expect = 1.1e-39, Identities = 147/363 (40%), Positives = 208/363 (57%)
  Q:    15 TGAFGIVATVPVIVSACSSTSDNNGNNNNGGDTNQQTQSITPKIKTESKLSGALSNIYDTANTGKTNELIANEIKKNLSEVFENGEDLSKVNDLQVSVTHTFPA--STWTGLSFDAASGNWKHSTDSNQDVTITDANKLLYASKTQALDISSLSDLKTQLDDTKLKAILTDTGVTPAADTTYSVANALGFTNKKKDDTNNRDLLHVNVVGTKTGSNPGTTNYDLQIPVSDLNLKLTDLSVTVKGTNV---AETTEKTTLTYNIGINDVVEFVDPSAKPTVAASVKTNKETMNALKALGYTATVSGQDQIDNDKVAAALGIYNCTFTLAAENPLVIDDATN-------KFTFNLVATP----NSGYVWEDGTNTAKPVQF 377
           TGAFGIVATVPVIVSACSST++   N   G     QT+ ITP++  +  L G+L +IYD+  T KTNELIA EIK N++ VF+NGE L+  +DL+++V   FP   S W  L +  +S    ++T           NK+LY + ++ +DI SL DL T+LD+  +KA L + GVT       +   +  FT K +    N DL+HVNV  TK  S+     +DLQIP SD+NL ++DL+V V+G N+     T   T   +NIGI+    +   S   T  A  +   +    LK L          ++DN+ +  ALG+Y  TF+L  ++  V  D+         K+T  L ATP    N+ YVW+DGT+ AK + F
  S:    15 TGAFGIVATVPVIVSACSSTNNGGNNQGGGSGGTTQTEKITPELNEKVSLGGSLKDIYDSTGTKKTNELIAEEIKANINSVFKNGEKLAAESDLKITVNGNFPETLSNWKDLPYLDSSETADNATADKSWSATASLNKVLYPTTSKQIDIKSLDDLYTKLDEATIKAALKEGGVT-------TTETSKSFTIKNRPGLTNDDLIHVNVEETK--SDDTKVQHDLQIPTSDINLVVSDLTVKVEGQNIETTENTKTTTEFDFNIGIDTTTHYNQGSETST--AQTEDAVKVEQVLKDLKLATADGNNTKLDNEALIKALGVYTVTFSL--DDAKVTKDSVQSRAPVDTKYTVTLKATPNKDSNNTYVWDDGTSDAKDITF 380
>gi|26554117|ref|NP_758051.1| P35 lipoprotein homolog reported as putative lipoprotein IMP13 [Mycoplasma penetrans HF-2] >gi|26454125|dbj|BAC44455.1| P35 lipoprotein homolog reported as putative lipoprotein IMP13 [Mycoplasma penetrans HF-2] >gi|27260911|dbj|BAC45034.1| lipoprotein P42 [Mycoplasma penetrans] (390 aa)
Score = 420, Expect = 2.7e-39, Identities = 150/363 (41%), Positives = 211/363 (58%)
  Q:    15 TGAFGIVATVPVIVSACSSTSDNNGNNNNGGDTNQ-----QTQSITPKIKTESKLSGALSNIYDTANTGKTNELIANEIKKNLSEVFENGEDLSKVNDLQVSVTHTFPA--STWTGLSFDAASGNWKHSTDSNQDVTITDANKLLYASKTQALDISSLSDLKTQLDDTK-LKAILTDTGVTPAADTTYSVANALGFTNKKKDDTNNRDLLHVNVVGTKTGSNPGTTNYDLQIPVSDLNLKLTDLSVTVKGTNVAETTEKTT---LTYNIGINDVVEFVDPSAKPTVAASVKTNKETMNALKALGYTATVSGQDQIDNDKVAAALGIYNCTF---TLAAENPLVIDDATNKFTFNLVATP----NSGYVWEDGTNTAKPVQF 377
           TGAFGIVATVPVIVS+CSSTSDNN  N N  +        Q++ ITP++  +  L+G+L +IYD+  T K+NELIA EIK N+ +VF+NGE L+   DL+++V   FP   + WT L +   + +      +     ITD N +LY++K+  ++I SL DLKT+L  T  LK  L D GV+ A  +T        F  K +    N DL+HVNV+ TK  S+  T  +DLQIP SD+NL +++LSV V+G N+  T    T     +NIGI+    +   SAK   AA+ + + +    LK L       G   ++N+ +  ALGIYN TF   ++              +   L ATP    N+ YVW+DGT  AK + F
  S:    15 TGAFGIVATVPVIVSSCSSTSDNNNGNGNNNNGGGSDGNTQSEKITPELNDKVSLAGSLKDIYDSTGTKKSNELIAEEIKNNIKDVFKNGEKLAAETDLKITVDGGFPEKLTNWTDLPYVDNTDDASKKDPNKSWSAITDLNPVLYSTKSNQINIKSLDDLKTELQKTDVLKNALKDAGVSTAETST-------AFEIKNQPALTNDDLVHVNVIETK--SDKSTVQHDLQIPTSDINLVVSNLSVKVEGKNIESTDTTKTTTEFNFNIGIDSTQHYDQGSAKS--AATTEGDVDVNKVLKDLNLATDDKG--ALNNEALIKALGIYNVTFSSPSIKKATVTARAATATSYEITLKATPNKEGNNTYVWDDGTTEAKDITF 382
>gi|26554104|ref|NP_758038.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454112|dbj|BAC44442.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (394 aa)
Score = 418, Expect = 5.0e-39, Identities = 169/358 (47%), Positives = 214/358 (59%)
  Q:    14 MTGAFGIVATVPVIVSACSSTSDNN---GNNNNGGDTNQQTQSITPKIKTESKLSGALSNIYDT----ANTGKTNELIANEIKKNLSEVFENGED---LSKVNDLQVSVTHTFPASTWT--GLSFDAASGNWKHSTDSNQDVTITDANKLLYASKTQALDISSLSDLKTQL-DDTKLKAILTDTGVTPAAD-TTYSVANALGFTNKKKDDTNNRDLLHVNVVGTKTGSNPGTTNYDLQIPVSDLNLKLTDLSVTVKGTNVAETTEKTT-LTYNIGINDVVEFVDPSAKPTVA--ASVKTNKETMNALKALGYTATVSGQDQIDNDKVAAALGIYNCTFTLAAENPLVIDDATNK------FTFNLVATP--NSGYVWEDGTNT 371
           MTGAFGIVATVPVIVSACSSTSDNN       + G  + QT+ +TP +K E  LSG+LS I+DT    +N   T  LI+++IK+N    F NG D      V +  V+V   F  S WT  GL      GNWK   DS   VTI  ANKL+YA+    ++ISSL+DLKTQL  D  LK IL  +G +  A+ TT S+ N LGFT          DLLHVNV    T  N   TNYDLQIPVSD+NL +  LS+ V G N+  + + TT   +NIGI+ VV   +  +KPT A  + VK N + +  LK        + +  +DN+ +  ALGIYN TF+  AE   +   +T        FT  L ATP  N  YVW D  N+
  S:    14 MTGAFGIVATVPVIVSACSSTSDNNTGGNGGTDQGGGSTQTEKVTPTLKDEVDLSGSLSKIFDTTSEASNRKTTATLISDDIKENPENYFTNGNDEKVKEAVKNANVTVNGNFSNSEWTKEGLLPFGEDGNWK---DSTTTVTIEAANKLVYATSLDQINISSLNDLKTQLTKDNGLKNILEKSGASTIAEGTTLSIENRLGFTGG--------DLLHVNVKAKPTTGN--ETNYDLQIPVSDINLSVPSLSIEVTGDNIEASNKTTTKYDFNIGIDPVVNNYNQGSKPTAATDSDVKVN-QVLQDLKFGTIDTQDNTKINLDNEALIKALGIYNVTFS--AEGASINKKSTTTRATDTVFTVTLKATPTANKNYVWADNGNS 380
>gi|26554120|ref|NP_758054.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454128|dbj|BAC44458.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (389 aa)
Score = 418, Expect = 5.3e-39, Identities = 148/363 (40%), Positives = 203/363 (55%)
  Q:    15 TGAFGIVATVPVIVSACSSTSDNNGNNNNGGDTNQQ----TQSITPKIKTESKLSGALSNIYDTANTGKTNELIANEIKKNLSEVFENGEDLSKVNDLQVSVTHTFPA--STWTGLSFDAASGNWKHSTDSNQDVTITDANKLLYASKTQALDISSLSDLKTQLDDTK-LKAILTDTGVTPAADTTYSVANALGFTNKKKDDTNNRDLLHVNVVGTKTGSNPGTTNYDLQIPVSDLNLKLTDLSVTVKGTNVAETTEKTT---LTYNIGINDVVEFVDPSAKPTVAASVKTNKETMNALKALGYTATVSGQDQIDNDKVAAALGIYNCTFTL-----AAENPLVIDDATNKFTFNLVATPNSG----YVWEDGTNTAKPVQF 377
           TGAFGIVATVPVIVS+CSSTSDNN   +            ++ ITP++  +  LSG+L +IYD+    KTNEL+A EIK N++ VF+NGE L    DL+++V   FP   S W  L +   S    + T +      T+   ++YA+ ++ ++I SL DL TQL   K LK IL   GVT    +TY + N  G TN         DL+HVNV GT   +N   T YDLQIP SD+NL ++DLSV V+G N+  T    T   L +NIGI+    +   +    V  + + N E    L+ L +  T      IDN+ +   LG+YN TF+L     A +          ++   L ATPN      YVW+DGT+  K + F
  S:    15 TGAFGIVATVPVIVSSCSSTSDNNTGGDTNQGGGTGGDTQSEKITPELNDKVSLSGSLKDIYDSTGATKTNELLAKEIKDNINTVFKNGEKLEAETDLKITVNGNFPETLSNWKDLPY-IDSTEASNPTPAKSWSATTNLQTVVYATSSEQINIKSLDDLHTQLSVEKTLKDILKAAGVTNTDTSTYEIKNRPGLTND--------DLIHVNVGGTANDTNKTKTIYDLQIPTSDINLVVSDLSVKVEGKNIETTDSTKTTTELDFNIGIDSTTHY---NQTIDVTEADEKNVEVNKVLETLKFVKT---DKTIDNEALIKELGVYNVTFSLDGASIAKKETTARAATPTEYVVTLKATPNKNDKNTYVWDDGTSGTKDITF 381
>gi|26553715|ref|NP_757649.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26453722|dbj|BAC44053.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (519 aa)
Score = 408, Expect = 7.7e-38, Identities = 148/363 (40%), Positives = 209/363 (57%)
  Q:    15 TGAFGIVATVPVIVSACSSTSD----NNGNNNNGGDTNQQTQSITPKIKTESKLSGALSNIYDTANTGKTNELIANEIKKNLSEVFENGEDLSKVNDLQVSVTHTFPASTWTGLSFDAASGNWKHSTDSNQDVTITDANKLLYASKTQALDISSLSDLKTQL-DDTKLKAILTDTGVTPAADTTYSVANALGFTNKKKDDTNNRDLLHVNVVGTKTGSNPGTTNYDLQIPVSDLNLKLTDLSVTVKGTNVAETTEKTTLTYNIGINDVVEFVDP--SAKPTVAASVKTNKETM-----NALKALGYTATVSGQDQ---------IDNDKVAAALGIYNCTFT------LAAENPL-VIDDATNKFTF--NLVATPNSGYVWEDGTNTAKPVQF 377
           TGAFGI+ATVPVIVS+CS+TSD    NN      G    QT+ +TPK K+   L GAL++IY+ +    TN L+  EIK NL   FEN  +L   N   V+V   F  S+W G  +   +GNW         VTITD NKL Y S++  +DISSL+DLK +L D+T LK  L+  GV     +TY++ N LG T+         +L+HVNV G    S+  TT YDLQIPVSD+NL L+++ +++ G +V    E   L +NIGIN    +  P  + K T  A+V +  E +     +  K +  T+    QD          +D DK+A +LGI+N  F       ++  NP   + +  N  T+  ++  +P  GY ++DG    K   F
  S:    15 TGAFGIIATVPVIVSSCSTTSDNNGGNNNTGGGSGGGTTQTEKVTPKFKSSINLIGALTDIYNPSEGKNTNTLLGEEIKNNLDSAFENSNELENKN-FAVTVKGNFSNSSWGGEQY--TNGNW-------NGVTITDDNKLYYDSESPQIDISSLNDLKNKLSDETTLKEALSKAGVADTEGSTYTIKNRLGLTDN--------NLIHVNVEGK---SSTATTQYDLQIPVSDINLDLSNVDISISGDDVNPVEESVNLNFNIGINSKTTYTAPTETQKLTKKATVDSVMEQLGFKATSTTKNVVRTSITLTQDNGASTTSLVGLDTDKIAESLGIFNTEFKNITLTRVSEWNPYDEVQENQNYLTYRIDITGSPKQGYYFDDGKTEDKTFSF 386
>gi|26554189|ref|NP_758123.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454198|dbj|BAC44527.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (517 aa)
Score = 406, Expect = 1.2e-37, Identities = 139/368 (37%), Positives = 206/368 (55%)
  Q:    15 TGAFGIVATVPVIVSACSS-------TSDNNGNNN------------NGGDTNQQTQSITPKIKTESKLSGALSNIYDTANTGKTNELIANEIKKNLSEVFENGEDLSKVNDLQVSVTHTFPASTWTGLSFDAASGNWKHSTDSNQDVTITDANKLLYASKTQALDISSLSDLKTQLDDTKLKAILTDTGVTPAADTTYSVANALGFTNKKKDDTNNRDLLHVNVVGTKTGSNPGTTNYDLQIPVSDLNLKLTDLSVTVKGTNVAETTEKTTLTYNIGINDVVEFVDPSAKPTVAASVKTNKETMNALKALGYTATVSGQD-QIDNDKVAAALGIYNCTFTLAA--ENPLVIDDATNKF-TFNLV--ATPNSGYVWEDGTNTAKPVQFATDFT 382
           TG FGIV T+P IVSACSS       +  NNGNN             NGG TNQ+   I PKI +   L G+L++IYD+      N L+  ++  N S++F N ++L   N   ++V   F   +W+G  +DA +  W   +       I  AN+++Y+SK++ L+ISSL DLK+QL +  LK  L   GVT     TY+VAN LG T    DD     LLHVNV  T +G+   + N+DLQIPVSD+ L + DL V V G++V +      L +NIGI     +   S +     +V  N +++ A      ++  S +   ++++ +  ALG+YN TF+  A   N  +  D T  F T+ ++   +PN GY ++D T+ +K   F    T
  S:    15 TGTFGIVITIPAIVSACSSIKEKNDGSQSNNGNNQDNSKDQGSEGSGNGGITNQK---IVPKINSSVDLIGSLTDIYDSTGNKDINVLLGEKLSNNASKIFTNADELENKN-YAIAVKGNFSRDSWSGDQYDAGNNKWGSGS------KIDPANQVVYSSKSKQLNISSLDDLKSQLTNDFLKKELEKAGVTVNQSATYAVANKLGLT----DDI----LLHVNVTETASGTTSVSKNFDLQIPVSDIKLDIKDLKVIVSGSDVEQIESDINLKFNIGIKSKTNY---SPRDIKKFNVTPNVDSIIATLGFKDSSVTSTEGVALNSEALGKALGVYNTTFSKPALTLNSDIKPDVTGSFLTYTVIVDGSPNQGYYFDDETDYSKKFIFNIKVT 386
>gi|26554193|ref|NP_758127.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454202|dbj|BAC44531.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (365 aa)
Score = 406, Expect = 1.4e-37, Identities = 147/363 (40%), Positives = 211/363 (58%)
  Q:    15 TGAFGIVATVPVIVSACSSTSDNNGNNNNGGDT------NQQTQSITPKIKTESKLSGALSNIYDTA---NTGKTNELIANEIKKNLSEVFENGEDLSKVNDLQVSVTHTFPA-STWTGLSFDAASGNWKHSTDSNQDVTITDANKLLYASKTQALDISSLSDLKTQLDDTKLKAILTDTGVTPAADTTYSVANALGFTNKKKDDTNNRDLLHVNVVGTKTGSNPGTTNYDLQIPVSDLNLKLTDLSVTVKGTNVAET-TEKTTLTYNIGINDVVEFVDPSAKPTVAASVKTNKETMNALKALGYTATVSGQDQIDNDKVAAALGIYNCTFTLAAENPLVIDDATNKFTFNLVATPNSGYVWEDGTNTAKPVQF 377
           TGAFGIV+ VP+IVS+CSST ++  NNNN G        N Q Q +TPK+K+    SG L  IYD++   N   T+ L+  E  KN   +F N ++L    D ++ V   F   + WTG  + + +G WK S              + YA    ++DI+SL+DLKT+LD+  +  I+T   +   ++TTY+V N L   N         DLLHVNV+GT  G++  +   DLQIP+SDLNL + +LS++V GT+V     ++  L +NIGIN+   F   +   T    V  +K    AL ALGY  T +    ++N K+++A+GIYNCTF+  A   ++    TN +T NLVA PN+ YVWEDGTNT+K +  
  S:    15 TGAFGIVSAVPLIVSSCSSTDNDETNNNNNGQDNQGNTENPQNQKVTPKLKSSINFSGDLGKIYDSSSGTNRKTTDTLLEEEFTKNPDLIFTNAKELED-KDFKIEVDGGFDTNNAWTGTPY-SGTGGWKTSV----------LRSVFYAESLSSIDITSLNDLKTKLDNATISKIITAASLQ-FSNTTYTVQNQLSLENG--------DLLHVNVLGT-IGNSSRSFTLDLQIPISDLNLVIPNLSISVSGTDVELIDKQEVNLDFNIGINENTNFNQGATTLTKDNVVDADK----ALVALGYATTSNNVTTLNNTKISSAIGIYNCTFS--ASTVVLKSTDTNTYTINLVAKPNTEYVWEDGTNTSKIISL 360
>gi|26554157|ref|NP_758091.1| signal-peptide-less P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454166|dbj|BAC44495.1| signal-peptide-less P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (448 aa)
Score = 402, Expect = 3.6e-37, Identities = 130/339 (38%), Positives = 190/339 (56%)
  Q:    46 DTNQQTQSITPKIKTESKLSGALSNIYDTANTGK----TNELIANEIKKNLSEVFENGEDLSKVNDLQVSVTHTFPA-STWTGLSFDAASGNWKHSTDSNQDVTITDANKLLYASKTQALDISSLSDLKTQLDDTKLKAILTDTGVTPAADTTYSVANALGFTNKKKDDTNNRDLLHVNVVGTKTGSNPGTTNYDLQIPVSDLNLKLTDLSVTVKGTNVAET-TEKTTLTYNIGINDVVEFVDPSAKPTVAASVKTNKETMNALKALGYTATVSGQDQIDNDKVAAALGIYNCTFTLAAENPLVIDDAT--NKFTFNLVATPNSGYVWEDGTNTAKPVQFATDFTVS 384
           DTN     ITP I     L+G+L+ I+D          T+ +IA +I  NL + F NG D+  VN+L +  + +FP+ S+WTGL++   S N KHST              +YAS    ++I+SL+DLKT+ D   L+ IL ++G+   +++T+++ N LGFT+         DL+H+N+   ++G     T  DLQIPVSD+NL +  L VT  G NV     + T  TYNIGI+D V FV P    T  +S   NK    AL +LG+    SG   ++++K++AALG++NCTF    E   + +D +  N FT  L ATPN  Y WE+G+   K + F  D   S
  S:   132 DTNVDVALITPAINKTINLTGSLTRIFDVNTPASYRKSTDIMIAQDIHANLEKYFSNGNDIKTVNNLTIDASGSFPSVSSWTGLAYANWSSNVKHST--------------VYASSLPQINITSLNDLKTKWDSQGLQNILLESGLK-FSNSTFTIQNLLGFTDG--------DLVHMNIF-VESGYGEDFT-VDLQIPVSDINLTIPGLRVTANGENVQYLLIDTTNFTYNIGIDDTVNFVKPKTGVTSLSSANKNK-VNEALVSLGFATRNSGSYTLNSNKISAALGVFNCTF----EGVSITEDQSKPNNFTIVLRATPNVNYYWENGSRDYKELSFKVDLVSS 448
Score = 119, Expect = 2.3e-04, Identities = 44/135 (32%), Positives = 64/135 (47%)
  Q:   250 LSVTVKGTNVAETTEKTTLTYNIGINDVVEFVDPSAKPTVAASVKTNKETMNALKALGYTATVSGQDQIDNDKV-AAALGIYNCTFTLAAENPL--VIDDATNKFTFNLVATP--NSGYVWEDGTNTAKPVQFATDFTVS 384
           + ++V GT+V  T       YNIGIN       P    T   S    K+    L  LGY    S ++   N +V     GIYN  F+ A+ +P     +  +  +T  L  TP  N G+VWEDG++  K + F T+  V+
  S:     1 MQISVSGTDVRTTNTTINFNYNIGINSQSSL--PQLTSTPRGSSSEAKDPNKILVKLGYAEIASNKEITLNQEVLQEEFGIYNVEFSNASISPSKNTQNGYSGVYTITLDVTPITNKGFVWEDGSSNTKKISFDTNVDVA 138
>gi|26554161|ref|NP_758095.1| signal-peptide-less P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454170|dbj|BAC44499.1| signal-peptide-less P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (494 aa)
Score = 392, Expect = 4.6e-36, Identities = 119/373 (31%), Positives = 199/373 (53%)
  Q:     1 MKIKKIKLLKALAMTGAFGIVATVPVIVSACSSTSDNNGNNNNG------GDTNQQTQSITPKIKTESKLSGALSNIYDTANTGKTNELIANEIKKNLSEVFENGEDLSKVNDLQVSVTHTFPASTWTGLSFDAASGNWKHSTDSNQDVTITDANKLLYASKTQALDISSLSDLKTQLD-DTKLKAILTDTGVTPAADTTYSVANALGFTNKKKDDTNNRDLLHVNVVGTKTGSNPGTTNYDLQIPVSDLNLKLTDLSVTVKGTNVAETTEKTTLTYNIGINDVVEFVDPSAKPTVAASVKTNKETMNALKALGYTATVSGQDQIDNDKVAAALGIYNCTFT---LAAENPLVIDDATNKFTFNLVATPNSGYVWEDGTNTAK 373
           MK ++ K+ K +A++G F + A VP  V + ++ + N  NN +G        +  +   +TPK+K+  ++ G+  +++D  +   TNEL+A +IK N S  FEN E L+  N   V V     +S WTG S+D + GNW +        TI ++NKLLY+S +    ISSL D K +L+  ++LK  LT  G+   ++TT S+ N +G ++          L H+NV  + +       +YDLQIP S++N    +L++ V G +V ET ++    Y+IGI  + ++   S    +     +    M+ L  L  +   S +  +DN+KV+ ALG++N TF+   L  +N  V +     F   +    N+ Y +EDGT + +
  S:     1 MKTQRSKIGKVIALSGIFTVTAAVPAAVLSSAALNGNFANNQSGDALIPSNPSGHENTKVTPKLKSSIQMMGS-EDLFDLGSNKTTNELLAQKIKDNPSLFFENPEVLAGKN-FDVVVEDNLSSSAWTGQSYDVSKGNWGN--------TIEESNKLLYSSSSPNFTISSLDDFKAKLNAGSRLKDSLTAAGLNVDSNTTPSIKNKIGLSD---------GLFHINVEASVSNKK---ADYDLQIPTSNINFSFENLNIKVTGNDVVETKQRVAFKYSIGIKSISKYNGSSE--IMKMWYASESAVMSGLGFLSSSKNESSELILDNNKVSKALGVFNTTFSNTKLELDNSAVNEGNYLTFKVTITGNANADYCFEDGTTSKE 359
>gi|986921|gb|AAC16392.1| p35 lipoprotein [Mycoplasma penetrans] >gi|1583185|prf||2120285A lipoprotein (362 aa)
Score = 392, Expect = 5.9e-36, Identities = 146/359 (40%), Positives = 198/359 (55%)
  Q:    15 TGAFGIVATVPVIVSACSSTSDNNGNNNNGGDTNQQTQS--ITPKIKTESKLSGALSNIYDT---ANTGKTNELIANEIKKNLSEVFENGEDLSKV-NDLQVSVTHTFPASTWTGLSFDAASGNWKHSTDSNQDVTITDANKLLYASKTQALDISSLSDLKTQLDDTKLKAILTDTGVTPAADTTYSVANALGFTNKKKDDTNNRDLLHVNVVGTKTGSNPGTTNYDLQIPVSDLNLKLTDLSVTVKGTNVAETTEKTTLTYNIGINDVVEFVDPSAKPTVAASVKTNKETMNALKALGYTATVSGQDQIDNDKVAAALGIYNCTFTLAAENPLVIDDATNKFTFNLVATPNSGYVWEDGTNTAK 373
           TGAFGIVATVPVIVS+CSSTS+NNGN N  G T+  TQ   +TP IK+E  L+GALS IYDT    +   T++LI  +IK N    F NGE L  V     V+V   F  ST+TG ++   S                D  K  Y+  ++ LDI S++DL+T L D+   AI     + P       + N   +       + + DLLH+NV      ++    + DL IPVSDLNLK+  L ++V GT +  +   T   +NIGI++ V+ + P+A  T+A + +TN E +  L+ LGY         +D DK+A ALG+YNC F          ++  NK+T  L ATPN GY WEDGTN AK
  S:    15 TGAFGIVATVPVIVSSCSSTSENNGNGNGNGGTDGNTQQTEVTPAIKSEVSLTGALSKIYDTKTGTDRETTSQLIVKDIKANPENYFTNGEALKDVIASATVTVDGGFTESTFTGEAYSVWSAK-------------ADVKKGTYSQASKQLDIKSINDLQTVLGDS--AAIKGICDLIP----NLKLNNGTDYKVTNNGLSLSEDLLHINVTAKDGQTD---VSMDLAIPVSDLNLKIDGLKISVSGTGIKTSELTTNYKFNIGIDNTVKTLTPAAV-TLAEADRTNAEKV--LEKLGYATVSGSTYTLDQDKLADALGLYNCKFEAVKSEKDSTNN--NKYTVTLKATPNDGYFWEDGTNGAK 352
>gi|26554111|ref|NP_758045.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454119|dbj|BAC44449.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (374 aa)
Score = 390, Expect = 8.3e-36, Identities = 146/370 (39%), Positives = 206/370 (55%)
  Q:    15 TGAFGIVATVPVIVSACSST------------SDNNGNNNNGGDTNQQTQSITPKIKTESKLSGALSNIYDTANTGK-TNELIANEIKKNLSEVFENGEDLSKV-NDLQVSVTHTFPASTWTGLSFDAASGNWKHSTDSNQDVTITDANKLLYASKTQALDISSLSDLKTQL--DDTKLKAILTDTGVTPAADTTYSVANALGFTNKKKDDTNNRDLLHVNVVGTKTGSNPGTTNYDLQIPVSDLNLKLT-----DLSVTVKGTNVAETTEKTT-LTYNIGINDVVEFVDPSAKPTVAASVKTNKETMNALKALGYTATVSGQDQIDNDKVAAALGIYNCTFTLAAENPLVIDDATNKFTFNLVATP-NSGYVWEDGTNTAKPVQFATDFTVS 384
           TGAFGIVATVPVIVS+CSST             +      +GG   Q+ +++ P++  +  L G+LS IY + +  K TNELI+ ++K N  + F NG +L  V    +V+V   F AS W           +   + SN  V +T      Y +    +DI+SL+DLK +   DD  ++  LT   +T    T Y+V N L  ++         DLLHVN+ GTK+G   G  N DLQIPVS++NLK T     D +    GTN+   T+ TT  +YNIGI+  V F    A PT  A+    K+    L+ LGY ++ +    +DNDK++AALG+YNC F   +  P        K+   L ATP +S Y+W+DGT+  K +QF    TVS
  S:    15 TGAFGIVATVPVIVSSCSSTDNGGSGNNTGGNGNQGDGGGSGGTGQQENKTVKPELLKDVSLGGSLSTIYSSGSDSKTTNELISEDVKTNPEKYFTNGTELKDVIKQTKVTVDGGFSASEWQN------GDPYSTWSTSNGIVKVT------YPAAAPQIDIASLNDLKQKTFKDDAAIQTFLTAANLTFTGVTNYTVENQLSLSSG--------DLLHVNLKGTKSG---GNLNVDLQIPVSNINLKATLKISVDATNNESGTNIEAVTDLTTNFSYNIGIDSTVNFTQTGATPT--ATEAEAKDAQKVLEKLGYVSSGA----LDNDKISAALGVYNCKFVAKSSEP----GEGGKYNVTLTATPFDSNYIWDDGTSGPKDLQFPVSLTVS 374
>gi|26554135|ref|NP_758069.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|27805656|sp|Q50367|P35_MYCPE Lipoprotein p35 precursor >gi|26454143|dbj|BAC44473.1| P35 lipoprotein [Mycoplasma penetrans HF-2] (362 aa)
Score = 390, Expect = 8.5e-36, Identities = 146/359 (40%), Positives = 198/359 (55%)
  Q:    15 TGAFGIVATVPVIVSACSSTSDNNGNNNNGGDTNQQTQS--ITPKIKTESKLSGALSNIYDT---ANTGKTNELIANEIKKNLSEVFENGEDLSKV-NDLQVSVTHTFPASTWTGLSFDAASGNWKHSTDSNQDVTITDANKLLYASKTQALDISSLSDLKTQLDDTKLKAILTDTGVTPAADTTYSVANALGFTNKKKDDTNNRDLLHVNVVGTKTGSNPGTTNYDLQIPVSDLNLKLTDLSVTVKGTNVAETTEKTTLTYNIGINDVVEFVDPSAKPTVAASVKTNKETMNALKALGYTATVSGQDQIDNDKVAAALGIYNCTFTLAAENPLVIDDATNKFTFNLVATPNSGYVWEDGTNTAK 373
           TGAFGIVATVPVIVS+CSSTS+NNGN N  G T+  TQ   +TP IK+E  L+GALS IYDT    +   T++LI  +IK N    F NGE L  V     V+V   F  ST+TG ++   S                D  K  Y+  ++ LDI S++DL+T L D+   AI     + P       + N   +       + + DLLH+NV      ++    + DL IPVSDLNLK+  L ++V GT +  +   T   +NIGI++ V+ + P+A  T+A + +TN E +  L+ LGY         +D DK+A ALG+YNC F          ++  NK+T  L ATPN GY WEDGTN AK
  S:    15 TGAFGIVATVPVIVSSCSSTSENNGNGNGNGGTDGNTQQTEVTPAIKSEVSLTGALSKIYDTKTGTDRETTSQLIVKDIKANPENYFTNGEALKDVIASATVTVDGGFTESTFTGEAYSVWSAK-------------ADVKKGTYSQASKQLDIKSINDLQTVLGDS--AAIKGICDLIP----NLKLNNGTDYKVTNNGLSLSEDLLHINVTAKDGQTD---VSMDLAIPVSDLNLKIDGLKISVSGTGIKTSELTTNYKFNIGIDNTVKTLTPAAV-TLAEADRTNAEKV--LEKLGYATVSGSTYTLDQDKLADALGLYNCKFEAVKSEKDSTNN--NKYTVTLKATPNDGYFWEDGTNGAK 352
>gi|26554162|ref|NP_758096.1| signal-peptide-less P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454171|dbj|BAC44500.1| signal-peptide-less P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (685 aa)
Score = 390, Expect = 9.5e-36, Identities = 122/331 (36%), Positives = 187/331 (56%)
  Q:    54 ITPKIKTESKLSGALSNIYDTANTG------KTNELIANEIKKNLSEVFENGEDLSKVNDLQVSVTHTFP-ASTWTGLSFDAASGNWKHSTDSNQDVTITDANKLLYASKTQALDISSLSDLKTQLDDTKLKAILTDTGVTPAADTTYSVANALGFTNKKKDDTNNRDLLHVNVVGTKTGSNPGTTNYDLQIPVSDLNLKLTDLSVTVKGTNVAETTEKTTLTYNIGINDVVEFVDPSAKPTVAASVKTNKETMNALKALGYTA----TVSGQDQIDNDKVAAALGIYNCTFTLAAENPLVIDDATNKFTFNLVATPNSGYVWEDGTNTAKPVQFATDFTVS 384
           ITP + +   ++G  S I+  ANTG      +TN++IA++IK NLS+ F NG DL  V +L + V   FP  S WTG  ++     W  +T            K +Y+S +Q ++I+SL+DLKT+L+   L   L D+ +    D ++++ N LGFT          DL+HVN++   +    GT   D+ IP SD+NL +++L +   G NV   +     TYNIGIND V+F+ P+   T  +    N     AL +LG+      +  G   ++ DK++AALG++NCTF   +    V + ++  FT +L+ATPN+ Y WEDGTNT+K + F  + T S
  S:   371 ITPTVNSTLNITGPFSKIF-AANTGTGNNRVRTNDVIADDIKSNLSKYFSNGNDLKTVENLNIRVEGNFPETSVWTGEPYEV----WSKTTRF----------KGIYSSSSQKINITSLNDLKTKLNSIGLGKFLLDSNLL-FRDASFTILNQLGFTGG--------DLIHVNIL-VNSPYTQGTFTVDVGIPTSDINLIISNLKIASFGDNVTLQSVPVNFTYNIGINDSVDFIKPTTGVTPLSDANKNN-VNEALVSLGFATRNIDSNPGTYTLNPDKISAALGVFNCTFEGISIKD-VSNGSSRSFTISLIATPNNNYYWEDGTNTSKELSFTVNLTAS 685
Score = 389, Expect = 1.2e-35, Identities = 132/371 (35%), Positives = 206/371 (55%)
  Q:     7 KLLKALAMTGAFGIVATVPVIVSACSSTSDNNGNNNNGGDTNQQTQSITPKIKTESKLSGALSNIYDTANTGKTNELIANEIKKNLSEVFENGEDLSKVNDLQVSVTHTFP-ASTWTGLSFDAASGNWKHSTDSNQDVTITDANKLLYASKTQALDISSLSDLKTQLD-DTKLKAILTDTGVTPAADTTYSVANALGFTNKKKDDTNNRDLLHVNVVGTKTGSNPGTTNYDLQIPVSDLNLKLTDLSVTVKGTNVAE-TTEKTTLTYNIGINDVVEFVDPSAKPTVAASVKTNKETMNALKALGYTATVSGQDQIDNDKVAAALGIYNCTFTLAAENP--LVIDDATNKFTFNLVATP--NSGYVWEDGTNTAKPVQF 377
           K +K   +TG F   A +PV++ +      N+ + NN    +  +Q ITPK+K+   LSG +  IYD+     TN L+A EI  NL +VFEN +DL KVN+L+++V   F  +S+W+G+ ++  +G WK          +T  N +LY+SK   L+ISSL+DLKTQLD D K+K I+ +       D++    NA+ ++ + K    N +LLHVNV+    GSN  T  +DLQIP S +NL ++++S++V G NV   T+   +  YN+ +     F++P++ P  +AS  TN   +     L    T   Q  +    +   LGIYN  F+ A+  P     +  +  +  +L ATP  N  +VW+DG NT + + F
  S:     6 KKIKTWGLTGIFAASAAIPVVLISRYVLFRNSSSINNQNSESDNSQFITPKLKSSISLSGTIDKIYDSQKATVTNTLVAQEIHNNLDQVFENSQDLQKVNNLKIAVEGDFTNSSSWSGVDYEGDNG-WK---------GLTKGNVILYSSKFGQLNISSLNDLKTQLDNDAKIKEIIREF------DSSKLNQNAI-YSIQNKPAVTNDNLLHVNVIAI-LGSN--TKYFDLQIPTSSINLNISNMSISVSGNNVKPLTSAVASFNYNVSLAPKSYFMNPASTPVASASEVTNANKILVKLGLA-EVTTRNQIVLTQKAIQEQLGIYNVEFSNASIAPSGTTTNGKSGLYQISLQATPIANGDFVWDDGQNTVRTITF 362
>gi|3850055|emb|CAA07194.1| putative lipoprotein [Mycoplasma penetrans] (336 aa)
Score = 389, Expect = 1.0e-35, Identities = 136/322 (42%), Positives = 193/322 (59%)
  Q:    14 MTGAFGIVATVPVIVSACSSTSDNNGNNNNGGDTNQ-----QTQSITPKIKTESKLSGALSNIYDTANTGKTNELIANEIKKNLSEVFENGEDLSKVNDLQVSVTHTFPA--STWTGLSFDAASGNWKHSTDSNQDVTITDANKLLYASKTQALDISSLSDLKTQLDDTK-LKAILTDTGVTPAADTTYSVANALGFTNKKKDDTNNRDLLHVNVVGTKTGSNPGTTNYDLQIPVSDLNLKLTDLSVTVKGTNVAETTEKTT---LTYNIGINDVVEFVDPSAKPTVAASVKTNKETMNALKALGYTATVSGQDQIDNDKVAAALGIYNCTFT 335
           +TGAFGIVATVPVIVS+CSSTSDNN  N N  +        Q++ ITP++  +  L+G+L +IYD+  T K+NELIA EIK N+ +VF+NGE L+   DL+++V   FP   + WT L +   + +      +     ITD N +LY++K+  ++I SL DLKT+L  T  LK  L D GV+ A  +T        F  K +    N DL+HVNV+ TK  S+  T  +DLQIP SD+NL +++LSV V+G N+  T    T     +NIGI+    +   SAK   AA+ + + +    LK L       G   ++N+ +  ALGIYN TF+
  S:     1 LTGAFGIVATVPVIVSSCSSTSDNNNGNGNNNNGGGSDGNTQSEKITPELNDKVSLAGSLKDIYDSTGTKKSNELIAEEIKNNIKDVFKNGEKLAAETDLKITVDGGFPEKLTNWTDLPYVDNTDDASKKDPNKSWSAITDLNPVLYSTKSNQINIKSLDDLKTELQKTDVLKNALKDAGVSTAETST-------AFEIKNQPALTNDDLVHVNVIETK--SDKSTVQHDLQIPTSDINLVVSNLSVKVEGKNIESTDTTKTTTEFNFNIGIDSTQHYDQGSAKS--AATTEGDVDVNKVLKDLNLATDDKG--ALNNEALIKALGIYNVTFS 320
>gi|26554119|ref|NP_758053.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454127|dbj|BAC44457.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (386 aa)
Score = 377, Expect = 2.8e-34, Identities = 149/371 (40%), Positives = 203/371 (54%)
  Q:    14 MTGAFGIVATVPVIVSACSSTSDNNGNNNNGGDTNQQTQSITPKIKTESKLSGALSNIYDTA---NTGKTNELIANEIKKNLSEVFENGEDLS---KVNDLQVSVTHTFPA----STWTGLSFDAASGNWKHSTDSNQDVTITDANKLLYASKTQALDISSLSDLKTQLD-DTKLKAILTDTGVTPAADTTYSVANALGFTNKKKDDTNNRDLLHVNVVGTKTGSNPGTTNYDLQIPVSDLNLKLTDLSVTVKGTNVAETTEKTTLTYNIGINDVVEFVDPSAKPTVAASVKTNKETMNALKALGYTATVSGQDQIDNDKVAAALGIYNCTFTLAAENPL--VIDDATNKFTFNLVATPNS-GYVWEDG--TNTAKPVQFATDFTVS 384
           MTGAFGIVATVPVIVS+CSSTSD   NN  G + NQQTQ +TP +K    LSG+LS IYDT    N   TN+LI  +IK+N    F NG + +    V +  V+V   F      S W  L +  +S   +++T +      T   ++ YA+ +  ++I SL DL T+L  +  LK  +   GV     TT+++ N  GFTN         DL+HVNV G K+G+    T YDLQIP SD+NL +TDL++ V+GTN+ ET++KTT  Y+  I    E        TV A+          L+ L      +G   ++N+ +  ALG+YN  F+     P       A   +T  L A P S  YVW DG  +NT K V F     V+
  S:    14 MTGAFGIVATVPVIVSSCSSTSD---NNTGGENNNQQTQKVTPVLKDSVSLSGSLSKIYDTTTGENRKTTNDLITEDIKENPENYFTNGSESAVKEAVKNATVTVEGNFTTAGSESPWKELPYLDSSETSENATAAKSWKATTGLQEVTYATNSDQIEIKSLDDLHTKLSVEQTLKDAMKGAGVADTDTTTFTIKNRAGFTNG--------DLIHVNVEGDKSGTK---TQYDLQIPTSDINLSVTDLTIKVEGTNI-ETSQKTTTNYDFNIGIEPETHYDQGSTTVTAANDAAVTVNKVLQDLSLATDANG--TLNNEALIKALGVYNVNFSNPTIAPKEGATTRAEKTYTITLDAKPQSEKYVWSDGSDSNTTKKVTFDVKVDVT 383
>gi|26554159|ref|NP_758093.1| signal-peptide-less P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454168|dbj|BAC44497.1| signal-peptide-less P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (713 aa)
Score = 376, Expect = 3.5e-34, Identities = 137/383 (35%), Positives = 211/383 (55%)
  Q:     1 MKIKKIKLLKALAMTGAFGIVATVPVIVSA----CSSTSDNNGN---------------------------NNNGGDTNQQTQSITPKIKTESKLSGALSNIYDTANTGKTNELIANEIKKNLSEVFENGEDLSKVNDLQVSVTHTFP-ASTWTGLSFDAASGNWKHSTDSNQDVTITDANKLLYASKTQALDISSLSDLKTQLDDTKLKAILTDTGVTPAADTT-YSVANALGFTNKKKDDTNNRDLLHVNVVGTKTGSNPGTTNYDLQIPVSDLNLKLTDLSVTVKGTNVAETTEKTTLTYNIGINDVVEFV-DPSAKPTVAASVKTNKETMNALKALGYTATVSGQDQIDNDK-VAAALGIYNCTFTLAAENPLVIDD---ATNKFTFNLVATPNSGYVWEDGTNTAKPVQFATDFTV 383
           MK K+ KLLK L++ G F + A VP+ + +     + TS +NGN                           ++N  +T  Q  SI P++K+   LSG +  IY++ N  +TN LIA EIK NL + F+N  +L  VNDL ++V   F   S+W G  +D  +G W  ST  N+         +LY++    L+ISSL+DLK QL D K+K IL  +  +   ++  Y+V N LGFTN         +L+HVN++        G  N+DLQIP+S +N  ++++S++V GT+V  T   T   YNI IN+       P++ P  ++S  TN + +  L  LGY    +    + N + +    GIYN  F+ A   P    +    + K T +     N G++W+DGT + K V F  +  +
  S:     1 MKSKRSKLLKILSVIGIFAVSAAVPITLVSKYVIFTKTSSSNGNVDDNSGNNNGNDNSNPNDNNGNNDGGNDSNNNNTTPQDGSIVPRLKSSINLSGTVDKIYNSQNASETNNLIAEEIKTNLEQAFDNSTELENVNDLNITVNGNFADTSSWGGNPYDGTNG-WSGSTTGNE---------ILYSTSLNQLNISSLNDLKHQLTDAKIKEILRSSDSSKLNESAEYTVKNKLGFTNN--------NLVHVNIMEI---LGSGVRNFDLQIPISSINFNVSNMSISVSGTDVQTTNATTNFNYNIAINNTESNTPQPTSTPKASSSEVTNADKI--LVKLGYADVGTNNSIVLNQELLQEEFGIYNVEFSNAKIAPNTSTNRQVGSYKITLDATPIANKGFIWQDGTTSTKSVSFDVNVDI 398
Score = 344, Expect = 2.2e-30, Identities = 127/339 (37%), Positives = 184/339 (54%)
  Q:    46 DTNQQTQSITPKIKTESKLSGALSNIYDTANTG----KTNELIANEIKKNLSEVFENGEDLSKVNDLQVSVTHTFP-ASTWTGLSFDAASGNWKHSTDSNQDVTITDANKLLYASKTQALDISSLSDLKTQLDDTKLKAILTDTGVTPAADTTYSVANALGFTNKKKDDTNNRDLLHVNVVGTKTGSNPGTTNYDLQIPVSDLNLKLTDLSVTVKGTNVAE-TTEKTTLTYNIGINDVVEFVDPSAKPTVAASVKTNKETMN-ALKALGYTATVSGQD----QIDNDKVAAALGIYNCTFTLAAENPLVIDDAT--NKFTFNLVATPNSGYVWEDGTNTAKPVQFATDFTVS 384
           D N     I+P + T   L+G LS IYD   T      TN LIA +IK NL   F NG DL  V +L VS + +FP  S+WTG  +   S + ++S               +Y      ++ISSL+DLKT+ +   +  +L  +G+   +D+T++V N LGFT          DLLH+N+    +G     T  DLQIP S++NL +  L VT  G+NVA    + T  TYNIGI D V+FV P+    V A    NK  +N AL +LG+    +  +     +D++K++AALG++NCTF    E   + +D +  N +T  L A+PN+ Y WE G++  K + F  D   S
  S:   393 DVNVDIGEISPALNTTLNLTGPLSKIYDVEGTSGSRKSTNTLIAEDIKANLDTYFSNGNDLKTVENLSVSASGSFPTTSSWTGTEYSTWSTSVQYSA--------------VYGQSLGQINISSLNDLKTKWNSQGIYNVLLGSGLR-FSDSTFTVQNLLGFTGG--------DLLHMNIF-VNSGYTANFT-VDLQIPASNINLTVPTLRVTANGSNVASLQVDTTNFTYNIGIKDTVDFVKPTTG--VTALAPANKTNVNEALVSLGFATRNTSSNPYTYTLDSEKISAALGVFNCTF----EGISITEDESNPNNYTIVLKASPNANYNWESGSSDPKELSFKVDLASS 713
>gi|26554160|ref|NP_758094.1| signal-peptide-less P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454169|dbj|BAC44498.1| signal-peptide-less P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (692 aa)
Score = 376, Expect = 3.7e-34, Identities = 130/339 (38%), Positives = 188/339 (55%)
  Q:    46 DTNQQTQSITPKIKTESKLSGALSNIYDTANTG----KTNELIANEIKKNLSEVFENGEDLSKVNDLQVSVTHTFPASTWTGLSFDAASGNWKHSTDSNQDVTITDANKLLYASKTQALDISSLSDLKTQLDDTKLKAILTDTGVTPAADTTYSVANALGFTNKKKDDTNNRDLLHVNVVGTKTGSNPGTTNYDLQIPVSDLNLKLTDLSVTVKGTNVAETTE-KTTLTYNIGINDVVEFVDPSAKPTVAASVKTNKETMN-ALKALGYTATVSGQD----QIDNDKVAAALGIYNCTFTLAAENPLVIDDATNKFTFNLVATPNSGYVWEDGTNTAKPVQFATDFTVS 384
           D N    +ITP +     L+G++S I+DT  T      TN +IA +IK N    F NG DL  ++DL V+V   FP STWTG  ++     WK         T+T  N  +Y+     L+ISSLSDLKT+++   +  +L  +G+T +   T++  N LGFT+         DLLHV V   +  S  G  N DL IP+S +NL ++ L+V+V GT V   T   T  TYNIGI+D V F  P+   TV+   + NK  +N AL +LG+    +  +     +D+ K++ ALG+YNCTF    E   + +D+ N +T  L ATPN+ Y W+ GTN ++ + F  D   S
  S:   375 DVNVDVGNITPDLNQTINLTGSVSKIFDTTTTSGTRKDTNTVIAEDIKANPENYFSNGSDLKTISDLAVTVNGNFPTSTWTGSPYE----TWKS--------TVTSTNVGIYSPSLPQLNISSLSDLKTKINQLGIYNVLLTSGLTYSG-ATFAFQNELGFTDD--------DLLHVCV---RVTSTYGNVNVDLGIPLSSINLTVSALAVSVNGTGVQTLTNGNTNYTYNIGIDDTVNFTKPT---TVSPLTEENKTNVNEALVSLGFATKNTNSNPNTYTLDSTKISKALGVYNCTF----EGIAIQEDSANNYTITLKATPNANYNWDSGTNESRELTFKVDLASS 692
Score = 370, Expect = 2.0e-33, Identities = 143/374 (38%), Positives = 202/374 (54%)
  Q:    10 KALAMTGAFGIVATVP-------VIVSACSSTSDNNGNNNNGGDTNQQTQSITPKIKTESKLSGALSNIYDTANTGKTNELIANEIKKNLSEVFENGEDLSKVNDLQVSVTHTF-PASTWTGLSFDAASGNWKHSTDSNQDVTITDANKLLYASKTQALDISSLSDLKTQLDDTKLKAILTDTGVTP-AADTTYSVANALGFTNKKKDDTNNRDLLHVNVVGTKTGSNPGTTNYDLQIPVSDLNLKLTDLSVTVKGTNVAETTEKTTLTYNIGINDVVEFVDPSAKPTVAASVKTNKETMNALKALGYTATVSGQDQIDNDK-VAAALGIYNCTFTLAAENP--LVIDDATNKFTFNLVATP--NSGYVWEDGTNTAKPVQFATDFTV 383
           K LA+TG F + A  P       VI    S+ + NN NNN GG+TN Q Q+ITPK+K+   LSG++  IY + N+  T  LIA EIK NL   FEN E+L  VN+L +SV   F   S+W G+ +   +G W  +   N+         +LY++    L+ISSL+DLK QL D K+K IL  +  +    +  Y+V N  GFT+         +L+H+NV      S     N DLQIP S +N  ++++ ++V G NV  T   TTL YN+ IN        +++PT  AS  +  +    L  LG+    S  +   N K +   LGIYN  F+ A+  P     D  +  +  +  ATP  N G+VWEDGT+TAK V F  +  V
  S:    16 KILAITGIFTVSAATPIALVSKYVIFKNSSNGNSNNNNNNGGGNTNPQNQTITPKLKSSINLSGSIDKIYSSQNSSDTKTLIAQEIKNNLDSAFENSEELKSVNNLNISVEGDFGDNSSWAGIEYSGTNG-WSSTVSGNE---------VLYSTDLNTLNISSLNDLKYQLTDAKIKEILNASDSSKLKTNAEYTVKNKPGFTSN--------NLIHINVFEILGSS---VKNLDLQIPYSSVNFNISNMQISVSGDNVQTTNATTTLNYNVAINTETNSTQIASRPTATASEIS--DVNKVLVKLGFAEIGSDNNVTLNQKALQEELGIYNVVFSNASIAPSGTTTDGQSGAYKISFDATPIANKGFVWEDGTSTAKSVSFDVNVDV 380
>gi|26554101|ref|NP_758035.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454109|dbj|BAC44439.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (394 aa)
Score = 367, Expect = 4.4e-33, Identities = 140/363 (38%), Positives = 213/363 (58%)
  Q:    15 TGAFGIVATVPVIVSACSST------SDNNGNNNNGGDTNQQTQSITPKIKTESKLSGALSNIYDTANTGK--TNELIANEIKKNLSEVFENGEDL---SKVNDLQVSVTHTFPA----STWTGLSFDAASGNWKHSTDSNQDVTIT-DANKLLYASKTQALDISSLSDLKTQLDDTKLKAILTDTGVTPAADTTYSVANALGFTNKKKDDTNNRDLLHVNVVGTKTGSNPGTTNYDLQIPVSDLNLKLTDLSVTVKGTNV-AETTEKTTLTYNIGINDVVEFVDPSAKPTVAASVKTNKETMNALKALGYTATVSGQDQIDNDKVAAALGIYNCTFT---LAAENPLVIDDATNKFTFNLVATPNSG-YVW-EDGTNTAKPVQF 377
           TGAFGIVATVP+IVS+CSST      S +N N N GG   QQT+ +TP++K+E  LSG+L  IYD++   +  TN+LIA+++K +    F NG+       + +  V+V   F      S W  +++   S +  + TD+N+  + T D   +L+ + +  +DI SL DL ++L++ KLK + T+  +  A  TT++V N LGFTN         DL+HVNV G  +G+    T YDLQIP SD+NL ++DLS+ V+GTN+ A+    T   +NIGI+    F   S +  +A + K   +    L+ LG+        ++DND +   LGIYN  F+   +  +     +     +T +L A P S  YVW +D T+  K + F
  S:    15 TGAFGIVATVPIIVSSCSSTGDNNGGSGDNNNGNQGGQDGQQTEKVTPELKSEVSLSGSLDKIYDSSTKDRKTTNQLIADDVKAHPENYFTNGDKTEVKETIKNATVTVDGKFTTEETESPWKDVAYLDESSD-ANKTDANKSWSATKDLKPVLFPTTSDQIDIKSLDDLHSKLNEAKLKEVFTNAKIANADKTTFTVKNKLGFTNS--------DLIHVNVEGDNSGTK---TQYDLQIPTSDINLSVSDLSIKVEGTNIEAQEKTSTKFDFNIGIDSKENFNQGSTE--IAYNTKDLVKVDEVLEKLGFAKKNGSSTELDNDAIIKGLGIYNVNFSGQEIKEKTVTTREQKDTTYTVSLKAKPTSNKYVWADDSTSDEKTISF 385
>gi|3850052|emb|CAA07192.1| putative lipoprotein [Mycoplasma penetrans] (353 aa)
Score = 365, Expect = 7.4e-33, Identities = 144/343 (41%), Positives = 193/343 (56%)
  Q:    14 MTGAFGIVATVPVIVSACSSTSDNNGNNNNGGDT--------NQQTQSITPKIKTESKLSGALSNIYDTA---NTGKTNELIANEIKKNLSEVFENGEDLSKVNDLQVSVTHTFPA--STWTGLSFDAASGNWKHSTDSNQDVTITDANKLLYASKTQALDISSLSDLKTQLDDTK-LKAILTDTGVTPAADTTYSVANALGFTNKKKDDTNNRDLLHVNVVGTKTGSNPGTTNYDLQIPVSDLNLKLTDLSVTVKGTNVAETTEKTT---LTYNIGINDVVEFVDPSAKPTVAASVKTNKETMNALKALGYTATVSGQDQIDNDKVAAALGIYNCTFTLAAENPLVIDDATNKFTFNLV 356
           +TGAFGIVATVPVIVS+CSSTSDNNGN NN  D          QQ  + TP IKTE  LSG+LS IYDT    +   TNE+IA +I  N  + F NG DL  V    V+V   FP   + WT L +   + +      +     ITD N +LY++K+  ++I SL DLKT+L  T  LK  L D GV+ A  +T        F  K +    N DL+HVNV+ TK  S+  T  +DLQIP SD+NL +++LSV V+G N+  T    T     +NIGI+    +   SAK   AA+ + + +    LK L       G   ++N+ +  ALGIYN TF+  +     +        FN+V
  S:     1 LTGAFGIVATVPVIVSSCSSTSDNNGNGNNNNDNNGGGSGTDQQQGTTYTPAIKTEVSLSGSLSKIYDTTTGDSRKNTNEMIAQDILSNPEDYFTNGADLKNVQGWSVTVDGGFPEKLTNWTDLPYVDNTDDASKKDPNKSWSAITDLNPVLYSTKSNQINIKSLDDLKTELQKTDVLKNALKDAGVSTAETST-------AFEIKNQPALTNDDLVHVNVIETK--SDKSTVQHDLQIPTSDINLVVSNLSVKVEGKNIESTDTTKTTTEFNFNIGIDSTQHYDQGSAKS--AATTEGDVDVNKVLKDLNLATDDKG--ALNNEALIKALGIYNVTFSSPSIKKATVTARAFNNIFNIV 347
>gi|986922|gb|AAC16393.1| p33 lipoprotein [Mycoplasma penetrans] >gi|1583186|prf||2120285B lipoprotein (318 aa)
Score = 360, Expect = 3.0e-32, Identities = 140/292 (47%), Positives = 176/292 (60%)
  Q:    15 TGAFGIVATVPVIVSACSS------TSDNNGNNNNGGDTNQQTQSITPKIKTESKLSGALSNIYDTANTG----KTNELIANEIKKNLSEVFENGEDLSKVNDLQVSVTHTFPA-STWTGLSFDAASGNWKHSTDSNQDVTITDANKLLYASKTQALDISSLSDLKTQLDDT-KLKAILTDTGV--TPAADTTYSVANALGFTNKKKDDTNNRDLLHVNVVGTKTGSNPGTTNYDLQIPVSDLNLKLTDLSVTV------KGTNVAETTEKTT-LTYNIGINDVVEFVDPSAKPTVAASVKTNKETMNALKAL 306
           TGAFGIVATVPVIV +CSS      T DNN      G   QQ  + TP IK++  LSGALS IYDT NTG     TN LIA +IK N    F NGEDL KV    V+V  +F + S WTG ++   S              + D +K +Y S ++ L+I+SL DLK+QLD + K+KAI  ++ +  + A   +Y + N LGFT          DLLH+NV  T+ G    T N DL IPVSDLNLK+TDL V+V       G NVA  ++ TT  TYNIGI +  E   P+ KP +A + K   E M  LKAL
  S:    15 TGAFGIVATVPVIVYSCSSTDNNGGTGDNNTGGGGSGTDQQQGTTYTPAIKSDVTLSGALSKIYDTTNTGDSRKNTNTLIAEDIKANPENYFTNGEDLKKVEGWSVTVDGSFDSNSVWTGDAYSKWSA-------------VADTHKGVYKSTSKQLNINSLKDLKSQLDTSAKIKAICDESNLVFSTADADSYKIQNELGFTGG--------DLLHINVTATQAGK---TLNMDLGIPVSDLNLKITDLKVSVTASNNSTGNNVAAVSDLTTNFTYNIGIKE--EVTAPTEKPNLAKTDK--GEVMKVLKAL 299
>gi|26553716|ref|NP_757650.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26453723|dbj|BAC44054.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (518 aa)
Score = 359, Expect = 3.1e-32, Identities = 136/382 (35%), Positives = 204/382 (53%)
  Q:     1 MKIKKIKLLKALAMTGAFGIVATVPVIV------SACSSTSDNNGNNNNGGDTNQQTQSITPKIKTESKLSGALSNIYDTANTGKTNELIANEIKKNLSEVFENGEDLSKVNDLQVSVTHTFPASTWTGLSFDAASGNWKHSTDSNQDVTITDANKLLYASKTQALDISSLSDLKTQLDDT-KLKAILTDTGVTPAADTTYSVANALGFTNKKKDDTNNRDLLHVNVVGTKTGSNPGTTNYDLQIPVSDLNLKLTDLSVTVKGTNVAETTEKTTLTYNIGINDVVEFVDPSAKPTVAASVKTNK-----------ETMNALKA-LGYT----ATVSGQDQIDNDKVAAALGIYNCTFT------LAAENPL-VIDDATNKFTF--NLVATPNSGYVWEDGTNTAKPVQFATDFT 382
           MK  K K+LK LA+TGAFGI+ATVPVI+      S  S+T+  N   +N G+  +  Q +TPK+K+   L G++++IY+      +++L+  +IK NL  VFEN  +L    D+ + +   F  S W G +++  + NW   T +          KL YA     ++ SSL+DLK QL D  K+K IL ++GV      TY + N  G T          ++LH+NV+     S     NYDLQIPVSDL L L  ++V V   ++    +   + +NIGI     +V P     +      N             T N+ K  + +T    A+V+    +D+DKV   LG++N TF+      ++  NP  V+    N  T+  +L   PN GY +EDGT  +K   F    T
  S:     1 MKTAKKKVLKTLAITGAFGIIATVPVIISACSSASNNSNTNGGNNTGDNSGNGTRDPQKVTPKLKSSINLVGSITDIYNHEVNNTSHDLLIKKIKSNLGLVFENESELVN-KDINIKLESDFSNSEWIGETYNVTNKNWGSDTTT----------KLTYAHSLAQINFSSLNDLKMQLSDQIKIKEILKESGVPDTYLNTYKIENKTGLTEN--------NILHINVIEVGKSS---PKNYDLQIPVSDLKLVLPQVNVLVSENDINSINQPIDINFNIGIESHSNYVGPVETQIIDERASANSILEKLGFIKMTNTKNSNKTNMTFTEINGASVTTNIDLDSDKVGETLGVFNTTFSDVKLTRISEWNPYDVVSTEDNYLTYKIDLNGRPNKGYYFEDGTTESKEFSFNVKTT 392
>gi|26554110|ref|NP_758044.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454118|dbj|BAC44448.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (391 aa)
Score = 358, Expect = 4.6e-32, Identities = 148/358 (41%), Positives = 189/358 (52%)
  Q:    14 MTGAFGIVATVPVIVSACSSTSDNNGNNNNGGDTNQQTQSITPKIKTESKLSGALSNIYDTANTG-----KTNELIANEIKKN-----LSEVFENGEDLSKVNDLQVSVTHTFPASTWTGLSFDAASGNWKHSTDSNQDVTITDANKLLYASKTQALDISSLSDLKTQLDDTK------LKAILTDTGVTPAADTTYSVANALGFTNKKKDDTNNRDLLHVNVVGTKTGSNPGTTNYDLQIPVSDLNLKLTDLSVTVKGTNVAETTEKTTLT--YNIGINDVVEFVDPSAKPTV--AASVKTNKETMNALKALGYTATVSGQDQIDNDKVAAALGIYNCTFT-----LAAENPLVIDDATNKFTFNLVATPNSGYVWEDGTNT 371
           MTGAFGIVATVPVIVS+CSSTSDNN         + QTQ ++ ++K    L G+LS I+DT  T       TN LI+ +IK N                  + +  V V   F +S+W G +++  SGNW   +     VTI  ANK LY +    L    L  LKT+L+ T       L+  L   G T  A    S+ N LG TN         DLLHVNV  TK  +N    NYDLQIPVSDLNL ++DLS+ V   N+ ET EKTT    YNIGI+    +V  + KP+    ASV  NK     L+ L      +G   +DN+ +  ALG+YN  F+       A     I+D     T     T N  YVW D  N+
  S:    14 MTGAFGIVATVPVIVSSCSSTSDNN-TGGGNNGGDTQTQKVSLQLKDSVDLKGSLSKIFDTEATNASSRKSTNTLISEDIKANPGTYFTFTETTEETVKETIQNATVEVEGNFSSSSWEGQAYNQESGNWGADSSV---VTIDPANKYLYPTNLDQLTFKDLDGLKTELEKTGTNNKTVLQNALETAGATIDAGAQLSIENRLGLTND--------DLLHVNVKETK--ANTADKNYDLQIPVSDLNLSVSDLSIKVTSDNI-ETGEKTTTKYDYNIGIDPTTHYVQGTTKPSANDEASVDVNK----VLEDLSLATDANG--TLDNEALIKALGVYNVQFSNPTIAKKATTTRAIEDTVYTITLKATPTANKNYVWSDNGNS 375
>gi|26554113|ref|NP_758047.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454121|dbj|BAC44451.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (365 aa)
Score = 356, Expect = 8.3e-32, Identities = 138/383 (36%), Positives = 197/383 (51%)
  Q:     1 MKIKKIKLLKALAMTGAFGIVATVPVIVSACSSTSDNNGNNNNGGDTNQQTQSITPKIKTESKLSGALSNIYDT---ANTGKTNELIANEIKKNLSEVFENGEDLSKV-NDLQVSVTHTFP-ASTWTGLSFDAASGNWKHSTDSNQDVTITDANKLLYASKTQALDISSLSDLKTQL--DDTKLKAILTDTGVTPAADTTYSVANALGFTNKKKDDTNNRDLLHVNVVGTKTGSNPGTTNYDLQIPVSDLNLKLT-----DLSVTVKGTNVAETTEKTT-LTYNIGINDVVEFVDPSAKPTVAASVKTNKETMNALKALGYTATVSGQDQIDNDKVAAALGIYNCTFTLAAENPLVIDDATNKFTFNLVATPNSG-YVWEDGTNTAKPVQFATDFTV 383
           MK KKIKLLK LA  G+F IV+TVP I+SACSST+D             Q   ITP IK+E  L G L+ IYDT   ++   TN LIA +IK NL + F N ++L  V     ++V   F   STW G +F+  S + +  T            K  Y S    +DI+SL+ LK ++  DD  ++  L D  +          +NA  F    K    N DLLHVN+   +  +N    N DLQIPVS+ NLK T       S  V G N+ +    TT   Y+IGI+  V +     K    A   T +E+++A + L  +        +DNDK+A+A+G++N  FT  +   + ++ + + +   L A P S  Y W+DG+  +K +QF     V
  S:     1 MKNKKIKLLKTLATVGSFVIVSTVPAIISACSSTAD-------------QYTGITPVIKSEVSLQGKLTGIYDTSTGSDRKDTNTLIAEDIKANLDKYFVNVDELKDVIQTSTITVDGGFSEKSTWEGENFETWSTDARGVT------------KAPYPSAAPKIDITSLNALKDEILKDDASIQKFLKDANLP-------FTSNASNFRLLNKPGLENGDLLHVNIKANRNRNNNSDLNLDLQIPVSNFNLKTTLKVSVSASNNVDGQNIGKDFNLTTHFNYSIGIDPAVNY-----KALKTALEVTPQESVDATEILKLSDYTDFSGNLDNDKIASAVGVFNSKFTPVSS--VKVEGSQDMYNITLTAEPFSDLYFWDDGSTGSKTIQFQIKLNV 358
>gi|26554121|ref|NP_758055.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454129|dbj|BAC44459.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (378 aa)
Score = 353, Expect = 1.7e-31, Identities = 150/363 (41%), Positives = 208/363 (57%)
  Q:    15 TGAFGIVATVPVIVSACSSTSDNNGNNNNGGDTNQQTQS-ITPKIKTESKLSGALSNIYDTANTGK--TNELIANEIKKNLSEVFENGEDLSK-VNDLQVSVTHTFP-ASTWTGLSFDAASGNWKHSTDSNQDVTITDANKLLYASKTQALDISSLSDLK--TQLDDTKLKAILTDTGVTPAADTTYSVANALGFTNKKKDDTNNRDLLHVNVVGTKTGSNPGTTNYDLQIPVSDLNLKLTDLSVTVK-GTNVAETTE-KTTLTYNIGINDVVEFVDPSAK-PTVAASVKTNKETMNALKALGYTATVSGQDQIDNDKVAAALGIYNCTFTLAA------ENPLVIDDATNK-FTFNLVATP-NSGYVWEDGTNTAKPVQF 377
           TGAFGIVATVPVIVS+CSSTSDNNG +NN G+ + Q Q+ +TP +K+   L G L+ IYDT  T +  T+ LI  ++K N    F NG ++ + +   +++V   F   S+W G ++D     WK           T A +++Y +    ++I+SL+DLK  T  D+T +    TD      A  + SV +  G     K    N DLLHVNV GTKT  +      DLQIPVS+LNLK T L V++K GTN+ E T+ +T+ +YNIGI+  + F       P V +S  +++             T    D IDNDK++AALGIYNC FT         E P      +NK +T  + ATP +S YVW+DG    K + F
  S:    15 TGAFGIVATVPVIVSSCSSTSDNNGGSNNNGNGDNQQQTELTPALKSNVNLQGKLTGIYDTNTTDRKNTSTLIVADMKANPDNYFTNGNEIKEGIQSSEITVDGGFSTTSSWDGDAYD----TWK-----------TGATQVMYPTAAPQINIASLNDLKETTFKDETAINKFFTD------ASLSESVKDVTGLNVANKLHLENGDLLHVNVKGTKT--DKSEVKIDLQIPVSNLNLK-TTLKVSIKGGTNIKEVTDLETSFSYNIGIDATLNFTQTKGTAPEVTSSDVSDEAAAAKAILKKLGYTTGSDDAIDNDKISAALGIYNCKFTAKTAKVNDKETPNAEVTGSNKVYTVTVTATPYDSTYVWDDGAEGGKDISF 371
>gi|26554132|ref|NP_758066.1| P35 lipoprotein homolog reported as gene for P38 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454140|dbj|BAC44470.1| P35 lipoprotein homolog reported as gene for P38 lipoprotein [Mycoplasma penetrans HF-2] (383 aa)
Score = 352, Expect = 2.3e-31, Identities = 144/370 (38%), Positives = 202/370 (54%)
  Q:    15 TGAFGIVATVPVIVSACSSTSDNNGNNNNGGDT------------NQQTQSITPKIKTESKLSGALSNIYDTANTGKTNELIANEIKKNLSEVFENGEDLSKV-NDLQVSVTHTFPASTWTGLSFDAASGNWKHSTDSNQDVTITDANKLLYASKTQALDISSLSDLKTQL--DDTKLKAILTDTGVTPAADTTYSVANALGFTNKKKDDTNNRDLLHVNVVGTKTGSNPGTTNYDLQIPVSDLNLKLTDLSVTVKGTNVAETTE-------KTTLTYNIGINDVVEFVDPSAKPTVAASVKTNKETMNALKALGYTATVSGQDQIDNDKVAAALGIYNCTFTLAA----ENPLVIDDATNKFTFNLVATP-NSGYVWEDGTNTAKPVQFATDFTVS 384
           TGAFGIVATVP+IVS+CSST +    NN GG+              Q+ +++ P++K   +L+G LS IY T ++  TNELI+ +IK N    F NG +L  V N   V+V   F AS WT              +D      +T   K+ Y +    +DI+SL+ LK +   DDT ++A LT   ++ +  ++++V N LG TN         DLLHVN+   +T +N G  N DLQIPVS++NLK T L V+V  TN +  T         T  +YNIGI+  + F      PT   +   N      LK LGY       + +DNDK++AALGIYNC FT  +    +           +T  + A P +S YVW+DG+   K   F    TV+
  S:    15 TGAFGIVATVPIIVSSCSSTDNGGSGNNTGGNGNQGDGGGSGNTDQQENKTVKPELKDNVELNGKLSTIYGT-DSKTTNELISEDIKANPENYFTNGSELKDVINQSTVTVDGGFSASQWT------------EGSDYTTWSAVTGVVKVTYPAAAPQIDIASLNALKQETFKDDTTIQAFLTAANLSFSNTSSFTVENKLGLTNG--------DLLHVNIKANRTAANGGNLNLDLQIPVSNINLK-TILKVSVSATNNSTGTNIEAVSDLTTNFSYNIGIDSTLNFTQTGTAPTATTAEANN--ATEVLKKLGYQTG----NNLDNDKISAALGIYNCKFTPKSATEKQGATAGLGGNKVYTVVVDAAPYDSNYVWDDGSTDTKEFSFDVSLTVN 383
>gi|26554103|ref|NP_758037.1| putative P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|22901855|gb|AAN10106.1| putative lipoprotein mp8 [Mycoplasma penetrans] >gi|26454111|dbj|BAC44441.1| P35 lipoprotein homolog fragment [Mycoplasma penetrans HF-2] (329 aa)
Score = 346, Expect = 1.2e-30, Identities = 129/315 (40%), Positives = 183/315 (58%)
  Q:    14 MTGAFGIVATVPVIVSACSSTS---DNNGNNNNGGDTNQQTQSITPKIKTESKLSGALSNIYDTANTGK--TNELIANEIKKNLSEVFENGEDLSK-VNDLQVSVTHTFPASTWTGLSFDAASGNWKHSTDSNQDVTITDANKLLYASKTQALDISSLSDLKTQL--DDTKLKAILTDTGVTPAADTTYSVANALGFTNKKKDDTNNRDLLHVNVVGTKTGSNPGTTNYDLQIPVSDLNLKLT-----DLSVTVKGTNVAETTEKTT-LTYNIGINDVVEFVDPSAKPTVAASVKTNKETMNALKALGYTATVSGQDQIDNDKVAAALG 328
           MTGAFGIVATVPVIVS+CSSTS    N  NN   G   Q   +I P IK++ +LSG L+NIYD + T +  TN LI+++IK N  + F NG D+   + D +V+V   F AS W       A    + S D N +++     K+LY ++   +DI+SL++LKT+   D   +   +TD+ +T A     ++AN   F  + K   ++ DLLHVN+      +N    N DL+IPVS++NLK T     D +    G  +   +  TT  +YNIGI+  V+F DP   PTV        ET+  L+ LGY    SG   +DNDK++AA+G
  S:    14 MTGAFGIVATVPVIVSSCSSTSDNNGNGNNNGGQGGDQQTQTTIKPAIKSDVQLSGKLNNIYDASTTDRKDTNTLISDDIKANPDKYFTNGADIKDAIKDAKVTVNGNFSASEWND---QGAKEYSEWSKDGNNNIS-----KILYPTEAAQIDIASLNELKTKTFKDSETINKFITDSKITIA-----NLANMQNFRVENKLYLSDEDLLHVNLKADNKTANQSGLNLDLEIPVSNINLKTTLTVSVDATTNTTGNKIEAVSGLTTNFSYNIGIDSTVKFTDPKTYPTVTTDEAKKAETV--LEKLGYATNTSGNITLDNDKISAAIG 327
>gi|26554122|ref|NP_758056.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454130|dbj|BAC44460.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (383 aa)
Score = 343, Expect = 2.6e-30, Identities = 142/370 (38%), Positives = 202/370 (54%)
  Q:    15 TGAFGIVATVPVIVSACSSTS-DNNGNNNNGGDTNQQTQSITPKIKTESKLSGALSNIYDTA--NTGKTNELIANEIKKNLSEVFENGEDLSK-VNDLQVSVTHTFPASTWTGLSFDAASGNWKHSTDSNQDVTITDANKLLYASKTQALDISSLSDLKTQLDDTKLKAILTDTGVTPAADTTYSVANALGFTNKKKDDTNNRDLLHVNVVGTKTGSNPGTTNYDLQIPVSDLNLKLTDLSVTVKGTN-------VAETTEKTTLTYNIGINDVVEFVDPSAKPTVAASVKTNKETMNALKALGYTATVSGQDQIDNDKVAAALGIYNCTFT-LAAENPLVIDDATNK--FTFNLVATP-NSGYVWEDGTNTAKPVQFATDFTVS 384
           TGAFGIVATVPVIVS+CSSTS +N   N   G   Q   S+ P +K+E  LSG L+ +YDT+  N   TN LI+++IK N  + F N  D+   + D +V+V   F AS W   +   A    + S D++Q +       + Y +  + +DI+SL++LKT    T   +    T +T +  T    +    F  + K   ++ DLLHVN+      +     N DLQIPVS++NLK T L+V+V  T         A +  KT  +YNIGI+  V F DP    ++  +     +    LK LGY  T      IDNDKV+AA+G+YNC FT ++++    +   T K  +   L A P +S YVW+DG   AK V F    TV+
  S:    15 TGAFGIVATVPVIVSSCSSTSDNNVNGNGGQGGDQQTQTSVKPDLKSEVNLSGKLTGVYDTSADNRKDTNTLISDDIKANPDKYFNNAADIKDAIKDAKVTVNGNFSASEW---NTQGAKDYAEWSKDNSQAIP-----TVTYPTAAKQIDIASLNELKTV---TFKDSDTISTFITESKITIDKFSEMEKFRVENKLHLSSGDLLHVNLKADNKTTGQAGLNLDLQIPVSNINLK-TSLTVSVDATTNTTGNKIEAVSDLKTNFSYNIGIDSTVNFTDPKISQSLTKT--EADDATEVLKKLGYAGT---DGTIDNDKVSAAIGVYNCKFTAVSSKEDTTVSAKTGKKAYKVTLSAEPFDSNYVWDDGQIGAKQVDFTVQLTVN 382
>gi|26553723|ref|NP_757657.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26453730|dbj|BAC44061.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (383 aa)
Score = 321, Expect = 9.1e-28, Identities = 137/370 (37%), Positives = 195/370 (52%)
  Q:    15 TGAFGIVATVPVIVSACSS-----TSDNNGNNNNGGDTNQQTQSITPKIKTESKLSGALSNIYDTANTGK--TNELIANEIKKNLSEVFENGEDLSK-VNDLQVSVTHTFPA-STWTGLSFDAASGNWKHSTDSNQDVTITDANKLLYASKTQALDISSLSDLK-TQL-DDTKLKAILTDTGVTPAADTTYSVANALGFTNKKKDDTNNRDLLHVNVVGTKTGSNPGTTNYDLQIPVSDLNLKLT-----DLSVTVKGTNVAETTE-KTTLTYNIGINDVVEFVDPSAKPTVAASVKTNKETMNALKALGYTATVSGQDQIDNDKVAAALGIYNCTFT--LAAENPLV-----IDDATNKFTFNLVATP-NSGYVWEDGTNTAKPVQFATDFTVS 384
           TGAFGIVATVPVIVS+CSS      +      N  G   QQ  ++ P+IKT+ KLSG LS IYD + T +  TN LI N++K N    F NG+ +   + D  V+V   F   S+W+G  +   S               T     LY S    ++I+SL+DLK T+L D T ++  L D  ++    + +SV N  G T+         DLLH+N+   K   N    N DLQIPVS++NL+ T     D +    G  +    + +T  +YNIGI+  ++F     +   A + + +     A   L     VS  D + +DK++AALGIYNC FT   A EN        + ++   +T  + ATP N  YVW+DG+   K + F     VS
  S:    15 TGAFGIVATVPVIVSSCSSTDNGNNNQGGTGGNGQGGDTQQQSTVKPEIKTDVKLSGKLSGIYDASETDRKDTNTLITNDVKTNPENYFTNGDQIKDAIKDATVTVDGGFKKESSWSGNPYSTWS---------------TGTTATLYPSAAPQINIASLNDLKDTKLKDSTAIETFLKDANISFTGASGFSVQNQPGLTDG--------DLLHINI---KAKQNSQDLNLDLQIPVSNINLETTLKISIDATTNTTGNKIEAVKDLETKFSYNIGIDATLKFEQQKGEAPAATTNEVSDAATAAKNILVKLGYVSSGDTLSDDKISAALGIYNCKFTPKSATENTNAKPNAEVTNSNKVYTVTVTATPYNETYVWDDGSTGPKDISFDVSLKVS 383
>gi|7839543|gb|AAF70318.1|AF260642_1 P38 [Mycoplasma penetrans] (352 aa)
Score = 300, Expect = 2.2e-25, Identities = 122/336 (36%), Positives = 176/336 (52%)
  Q:    49 QQTQSITPKIKTESKLSGALSNIYDTANTGKTNELIANEIKKNLSEVFENGEDLSKV-NDLQVSVTHTFPASTWTGLSFDAASGNWKHSTDSNQDVTITDANKLLYASKTQALDISSLSDLKTQL--DDTKLKAILTDTGVTPAADTTYSVANALGFTNKKKDDTNNRDLLHVNVVGTKTGSNPGTTNYDLQIPVSDLNLKLTDLSVTVKGTNVAETTE-------KTTLTYNIGINDVVEFVDPSAKPTVAASVKTNKETMNALKALGYTATVSGQDQIDNDKVAAALGIYNCTFTLAA----ENPLVIDDATNKFTFNLVATP-NSGYVWEDGTNTAKPVQFATDFTVS 384
           Q+ +++ P++K   +L+G LS IY T ++  TNELI+ +IK N    F NG +L  V N   V+V   F AS WT              +D      +T   K+ Y +    +DI+SL+ LK +   DDT ++A LT   ++ +  ++++V N LG TN         DLLHVN+   +T +N G  N DLQIPVS++NLK T L V+V  TN +  T         T  +YNIGI+  + F      PT   +   N      LK LGY       + +DNDK++AALGIYNC FT  +    +           +T  + A P +S YVW+DG+   K   F    TV+
  S:    30 QENKTVKPELKDNVELNGKLSTIYGT-DSKTTNELISEDIKANPENYFTNGSELKDVINQSTVTVDGGFSASQWT------------EGSDYTTWSAVTGVVKVTYPAAAPQIDIASLNALKQETFKDDTTIQAFLTAANLSFSNTSSFTVENKLGLTNG--------DLLHVNIKANRTAANGGNLNLDLQIPVSNINLK-TILKVSVSATNNSTGTNIEAVSDLTTNFSYNIGIDSTLNFTQTGTAPTATTAEANN--ATEVLKKLGYQTG----NNLDNDKISAALGIYNCKFTPKSATEKQGATAGLGGNKVYTVVVDAAPYDSNYVWDDGSTDTKEFSFDVSLTVN 352
>gi|26554158|ref|NP_758092.1| signal-peptide-less P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454167|dbj|BAC44496.1| signal-peptide-less P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (204 aa)
Score = 250, Expect = 1.6e-19, Identities = 80/206 (38%), Positives = 117/206 (56%)
  Q:     1 MKIKKIKLLKALAMTGAFGIVATVPV-----IVSACSSTSDNNGNNNNGGDTNQQTQSITPKIKTESKLSGALSNIYDTANTGKTNELIANEIKKNLSEVFENGEDLSKVNDLQVSVTHTF-PASTWTGLSFDAASGNWKHSTDSNQDVTITDANKLLYASKTQALDISSLSDLKTQLDDTKLKAILTDTGVTPAADTT-YSVANALGFTNKK 206
           MK    KLLK  ++ G F      P+      V +  S SD+NGN++N   TN +  SI PK+K+   LSG L  IY++ N  + N+ IA EIK NL   FEN E+L  V DL + +   F  +S+W G  +D  +G W          ++T  N++LY++  + L++SSL+DLK QL D+K+K IL +   +    T  YSV N  GFT ++
  S:     1 MKSNVAKLLKISSVVGIFAASTAAPISLVSMYVFSNKSLSDSNGNDSN---TNPEDGSIIPKLKSSINLSGPLDKIYNSQNASEANDWIAQEIKTNLDLAFENSEELKSVTDLNILINGDFLDSSSWDGNPYDGNNG-WS---------SLTKENQILYSASLEQLNVSSLTDLKNQLTDSKIKEILNEYDSSKLNWTAEYSVKNKPGFTRQQ 200
>gi|26554194|ref|NP_758128.1| putative P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454203|dbj|BAC44532.1| P35 lipoprotein homolog fragment [Mycoplasma penetrans HF-2] (381 aa)
Score = 249, Expect = 1.9e-19, Identities = 90/240 (37%), Positives = 130/240 (54%)
  Q:   143 VTITDANKLLYASKTQALDISSLSDLKTQLDD-TKLKAILTDTGVTPAADTTYSVANALGFTNKKKDDTNNRDLLHVNVVGTKTGSNPGTTNYDLQIPVSDLNLKLTDLSVTVKGTNVAETTEKTTLTYNIGINDVVEFVDPSAKPTVAASVKTNKETMNALKALGYTATVSGQDQID----------NDKVAAALGIYNCTFTLAAENPLVIDDATNK---------FTFNLVATPNSGYVWEDGTNTAKPVQFATDFT 382
           V+I + NKL Y+  +  +DI SL DLKTQL D TKLK  L + G T     TY++ N  G T+         DL+HVNV  +K  +    TNYDLQIP SD+NL ++DL+V V G +V E  EK  L YNI I D   +  P+    + A+   +    + ++ LG+ AT   +   D          ++K+   LG++N  F+    NP++  D+TN          +   +  TP  GY +E G  T+K   F    T
  S:    11 VSIDETNKLHYSYNSPQIDIKSLDDLKTQLSDQTKLKDALKEAGATVDETATYTIKNQPGLTDD--------DLIHVNVESSKASAT--ATNYDLQIPASDINLVISDLNVKVSGADVTEVNEKVNLNYNIAIKDETSYTGPADIKKMNATPTED----SVMQELGFKATTRTKRSTDATPAATVALNSEKIGETLGVFNTEFS----NPVLELDSTNNPSSTNNFFTYKITVTGTPKEGYHFEGG-ETSKQFSFLVKIT 251
>gi|26554105|ref|NP_758039.1| putative P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454113|dbj|BAC44443.1| P35 lipoprotein homolog fragment [Mycoplasma penetrans HF-2] (159 aa)
Score = 231, Expect = 2.5e-17, Identities = 69/142 (48%), Positives = 90/142 (63%)
  Q:   236 LQIPVSDLNLKLTDLSVTVKGTNVAETTEKTTLTYNIGINDVVEFVDPSAKPTVAASVKTNKETMNALKALGYTATVSGQD---QIDNDKVAAALGIYNCTFTLAAENPLVIDDATN-----KFTFNLVATPNSGYVWEDGTNTAKPVQF 377
           +QIPVSDLNL +++LSVTVKGTNV ETT +T  TYNIGIN    + +P+ KP++  +     +    L+ LGY    SG      ++ND +  ALG+YN TFT          DA N      +T  L ATPN G+VWED TNT+KP+ F
  S:     1 MQIPVSDLNLVISNLSVTVKGTNVTETTLETNFTYNIGINSASNYEEPTNKPSITQAQSQTLDANVILEKLGYVTASSGTPTTYTVNNDTIVKALGVYNVTFTNTGATVTEKTDANNAANQKTYTITLNATPNDGHVWEDATNTSKPITF 150
>gi|26554195|ref|NP_758129.1| putative P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454204|dbj|BAC44533.1| P35 lipoprotein homolog fragment [Mycoplasma penetrans HF-2] (144 aa)
Score = 202, Expect = 4.9e-14, Identities = 60/119 (50%), Positives = 79/119 (66%)
  Q:     9 LKALAMTGAFGIVATVPVIVSACSSTSD-----------NNGNNNNGGDTNQQTQSITPKIKTESKLSGALSNIYDTANTGKTNELIANEIKKNLSEVFENGEDLSKVNDLQVSVTHTFPASTWTGLSFD 127
           +KALA+TGAFGI+ATVPVIVS+CSSTS+           +N      G     TQ +TPK+K+   L GAL +IY+ A+   T +L+A EIK N S  FE+ E L+  N   VSV  TF  S+WT  ++D
  S:     1 MKALALTGAFGIIATVPVIVSSCSSTSENNGGSGNGGTGDNQGGGGSGGGTTDTQKVTPKLKSSINLVGALKDIYNPASGKTTKDLLAQEIKNNPSLAFEDSEKLNGKN-FDVSVEATFSRSSWTDKTYD 129
>gi|3850053|emb|CAA07193.1| putative lipoprotein [Mycoplasma penetrans] (120 aa)
Score = 195, Expect = 3.6e-13, Identities = 54/91 (59%), Positives = 70/91 (76%)
  Q:     8 LLKALAMTGAFGIVATVPVIVSACSSTSDNNGNNNNGGDTN-----QQTQSITPKIKTESKLSGALSNIYDTANTGKTNELIANEIKKNLSEVFEN 98
           LLKALA+TGAFGIVATVPVIVS+CSSTSDNN  N N  +        Q++ ITP++  +  L+G+L +IYD+  T K+NELIA EIK N+ +V E+
  S:     1 LLKALALTGAFGIVATVPVIVSSCSSTSDNNNGNGNNNNGGGSDGNTQSEKITPELNDKVSLAGSLKDIYDSTGTKKSNELIAEEIKNNIKDVIES 96
>gi|26554102|ref|NP_758036.1| putative P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454110|dbj|BAC44440.1| P35 lipoprotein homolog fragment [Mycoplasma penetrans HF-2] (69 aa)
Score = 98, Expect = 7.3e-02, Identities = 26/58 (44%), Positives = 33/58 (56%)
  Q:   327 LGIYNCTFTLAAENP---LVIDDATNKFTFNLVATP-NSGYVWEDGTNTAKPVQFATDFTVS 384
           LG+YNC FT  + +P   +  D     +   L A P +S YVW+DGT  AK V F    TVS
  S:     8 LGVYNCKFTAVSSDPDTSVTADAGKTAYKVVLSAEPYDSNYVWDDGTTDAKQVSFTVQLTVS 69