>gi|26553520|ref|NP_757454.1| ribose 5-phosphate and galactose-6-phosphate isomerase [Mycoplasma penetrans HF-2] >gi|26453526|dbj|BAC43858.1| ribose 5-phosphate and galactose-6-phosphate isomerase [Mycoplasma penetrans HF-2] (158 aa)
Score = 639, Expect = 1.7e-65, Identities = 158/158 (100%), Positives = 158/158 (100%)
  Q:     1 MSESKKQLKKIKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           MSESKKQLKKIKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK
  S:     1 MSESKKQLKKIKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
>gi|150021067|ref|YP_001306421.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Thermosipho melanesiensis BI429] >gi|149793588|gb|ABR31036.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Thermosipho melanesiensis BI429] (145 aa)
Score = 326, Expect = 3.9e-29, Identities = 71/146 (48%), Positives = 98/146 (67%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLE 156
           +K+ IGSDH GF++KEKI+  + + + +D +D GT    ESVDYPD+AEK+G ++   +  +GI ICGTGIG+ IA NKIKGI AA       A LAR+HNN N++ L GR    E    I+  F ++ FE GRHE+R+ KI++LE
  S:     1 MKIAIGSDHAGFELKEKIKK-YLMDKDIDVLDFGT-DNKESVDYPDFAEKVGTSVKNKEVEFGILICGTGIGMSIAANKIKGIRAALCTIPEMASLARKHNNANILVLPGRLIGFELATWILDAFLNATFEGGRHERRISKISRLE 144
>gi|189346775|ref|YP_001943304.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Chlorobium limicola DSM 245] >gi|189340922|gb|ACD90325.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Chlorobium limicola DSM 245] (144 aa)
Score = 321, Expect = 1.6e-28, Identities = 65/142 (45%), Positives = 96/142 (67%)
  Q:    11 IKVYIGSDHGGFDMKEKI-----RNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           +K+ +GSDH GF++K  +      N HE       VD+G ++ +ESVDYPDYA K+GE+++      G+ +CGTGIG+ I+ NK+KGI AA   +   A LAR+HNN N+I  S RFT  E   + ++ +F++ FE GRHE+R++KI
  S:     1 MKIAVGSDHAGFELKNYVVQWLQENGHEP------VDMGPFN-EESVDYPDYARKVGESIVDGTCQEGVLLCGTGIGVSISANKVKGIRAALACRPEFATLARQHNNANIICFSARFTDRETIAKSLENWFAADFEGGRHERRVNKI 140
>gi|134300994|ref|YP_001114490.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Desulfotomaculum reducens MI-1] >gi|134053694|gb|ABO51665.1| sugar-phosphate isomerases, RpiB/LacA/LacB family [Desulfotomaculum reducens MI-1] (152 aa)
Score = 320, Expect = 1.9e-28, Identities = 69/151 (45%), Positives = 98/151 (64%)
  Q:     8 LKKIKVYIGSDHGGFDMKEKIRNNHELLEILDFV--DLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           +K I + +GSDH GF+MKE+I+   E L+       D+G  +G ES DYPD+A  +GE +   +   GI ICGTG+G+ IA+NK+ G+ AANV     A+LAREHNN NV+T+  RF  +     I++KF ++ F   RH KR+DKI+ +E K
  S:     1 MKNISIVLGSDHAGFEMKEQIK---EYLQGQGHTVQDMGC-NGTESCDYPDFALAVGEKIRSGQCQQGILICGTGVGMAIAVNKVPGVRAANVFAPEIAQLAREHNNANVLTMGSRFIDLAQAKAIVEKFINTEFAGDRHAKRVDKISAIEKK 149
>gi|21673876|ref|NP_661941.1| ribose-5-phosphate isomerase [Chlorobium tepidum TLS] >gi|21647012|gb|AAM72283.1| ribose-5-phosphate isomerase [Chlorobium tepidum TLS] (144 aa)
Score = 317, Expect = 3.9e-28, Identities = 65/142 (45%), Positives = 91/142 (64%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           +K+ +GSDH G ++K+ + +  E     DF D+G YS  ESVDYPDY  K+ E + +     GI +CGTGIGI IA NK+KG+ AANV     A LAR+HN+ NV+    RF       +I++ +F+S FE GRH++R+DKI
  S:     1 MKIAVGSDHAGVELKKFVLSWLEK-HCYDFEDMGPYSA-ESVDYPDYGHKVAEAVARGDFDQGILMCGTGIGISIAANKVKGVRAANVCNPEYAALARQHNDANVLAFGARFNDDSSAAKILESWFASEFEGGRHQRRVDKI 140
>gi|19705179|ref|NP_602674.1| ribose 5-phosphate isomerase [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >gi|19713120|gb|AAL93973.1| Ribose 5-phosphate isomerase [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] (149 aa)
Score = 317, Expect = 4.9e-28, Identities = 65/142 (45%), Positives = 96/142 (67%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           +K+ +G+DHGG+++KEKI+ +    E ++ +D GT S  ESVDYP Y   + ++++  +  +GI +CGTGIGI IA NKIKGI AAN   T  A+L REHNN N++ L  R       ++I+ +F S+ FE GRH+KR+D+I
  S:     1 MKIALGADHGGYELKEKIKQHLAKKEGIEVIDFGTNS-TESVDYPKYGHLVAKSVVDKEVDFGILVCGTGIGISIAANKIKGIRAANCTNTTMAKLTREHNNANILALGARIVGDVLALDIVDEFLSASFEGGRHQKRVDQI 141
>gi|124516691|gb|EAY58199.1| Ribose 5-phosphate isomerase RpiB [Leptospirillum sp. Group II UBA] (158 aa)
Score = 316, Expect = 5.2e-28, Identities = 69/146 (47%), Positives = 93/146 (63%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLEN 157
           ++ IGSDH G+ +KE +R   E  +    +D+GT+S +ESVDYPDYAEK+   L   +G  GI +CGTGIG+ IA NKIKGI AA +     A LA  HNN NVI   GR  S +      + F S+ FE GRH++R+D+I+ LE+
  S:     8 RIVIGSDHAGYPLKESLRKRLEK-DGYPLLDVGTFS-EESVDYPDYAEKVARALHAGEGDIGILLCGTGIGVSIAANKIKGIRAALIYNDETASLAHRHNNANVICFGGREVSEDQAHTWTRLFLSASFEGGRHQRRIDEISALES 151
>gi|78043323|ref|YP_361351.1| ribose-5-phosphate isomerase B [Carboxydothermus hydrogenoformans Z-2901] >gi|77995438|gb|ABB14337.1| ribose 5-phosphate isomerase B [Carboxydothermus hydrogenoformans Z-2901] (159 aa)
Score = 315, Expect = 6.7e-28, Identities = 68/148 (45%), Positives = 96/148 (64%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           +K+ IG+DH GF++KE+I+ + E   I   +D GTYS  ESVDYPD+ E + E +++ +  +GI ICGTGIGI IA NK+ GI AA  + T  A  AREHN+ NV+ L  R   V   ++I+  F  + FE GRH +R++KI  +E K
  S:     1 MKIAIGADHAGFNLKEEIKKHLEKKGIA-VIDKGTYSA-ESVDYPDFGEAVAEAVVQKEVDFGIVICGTGIGISIAANKVPGIRAALCSDTFSAHSAREHNDANVLALGARVVGVGLALDIVDTFLGASFEGGRHARRVEKIAGIEEK 146
>gi|94968291|ref|YP_590339.1| ribose-5-phosphate isomerase [Acidobacteria bacterium Ellin345] >gi|94550341|gb|ABF40265.1| ribose-5-phosphate isomerase [Acidobacteria bacterium Ellin345] (152 aa)
Score = 315, Expect = 8.1e-28, Identities = 57/148 (38%), Positives = 97/148 (65%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           +K+ +G+DH GF++K +++  H   + +D  D GT + D SVDYPD+A+++ + +       G+ +CGTGIG+ ++ NK+ GI AAN +  +EAEL+R+HN+ N++TL  R    E    I+  +  + FE GRH++R+DKI ++E +
  S:     1 MKIALGADHAGFELKNQVKQ-HLTQQGIDVQDFGTNTPD-SVDYPDFAQRVADTVAVGGVERGVLVCGTGIGMAMSANKVPGIRAANCHTILEAELSRQHNDANILTLGARVLEPEAAFAIVDAWMKAQFEGGRHQRRVDKIHQIEQQ 146
>gi|119357143|ref|YP_911787.1| ribose-5-phosphate isomerase [Chlorobium phaeobacteroides DSM 266] >gi|119354492|gb|ABL65363.1| ribose-5-phosphate isomerase [Chlorobium phaeobacteroides DSM 266] (148 aa)
Score = 313, Expect = 1.2e-27, Identities = 63/142 (44%), Positives = 96/142 (67%)
  Q:    11 IKVYIGSDHGGFDMKEKI-----RNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           +K+ +GSDH G++MK  +      N +E+      VD+G ++ +ESVDYPD+A K+GE++ +     G+ +CGTGIG+ I+ NK+KGI AA       A LAR+HNN N+I  S RFT  E   + ++ +F++ FE GRHE+R++KI
  S:     1 MKIAVGSDHAGYEMKNHVIQWLQENRYEV------VDMGPFN-EESVDYPDFARKVGESVAEGSCQQGVLLCGTGIGVSISANKVKGIRAALACNPEFATLARQHNNANIICFSARFTDRETIAKSLQNWFAAEFEGGRHERRVNKI 140
>gi|13508334|ref|NP_110284.1| ribose-5-phosphate isomerase B [Mycoplasma pneumoniae M129] >gi|1723115|sp|P53527|RPIB_MYCPN Probable ribose-5-phosphate isomerase B (Phosphoriboisomerase B) >gi|1209769|gb|AAC43662.1| galactose-6-phosphate isomerase lacA subunit >gi|1673915|gb|AAB95895.1| galactose-6-phosphate isomerase/ribose 5-phosphate isomerase B [Mycoplasma pneumoniae M129] (152 aa)
Score = 312, Expect = 1.6e-27, Identities = 63/146 (43%), Positives = 90/146 (61%)
  Q:    13 VYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           +YI SDH G ++K  +  + E  + L  +DLG    D   DYPDYA  + + +  +  S GI ICGTG+G+C+A NK KGI AA V  +  A LAR+H++ NV+ LS RF   E+N++I+ +F  + FE GRH KR+ KI   E +
  S:     7 IYIASDHTGLELKSLVIKHLEQ-QKLQVIDLGPTELDPLDDYPDYAFLLAQTMQANPNSLGILICGTGVGVCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQFEGGRHSKRVGKIIAYERE 151
>gi|15643838|ref|NP_228886.1| sugar-phosphate isomerase [Thermotoga maritima MSB8] >gi|148270785|ref|YP_001245245.1| ribose 5-phosphate isomerase B [Thermotoga petrophila RKU-1] >gi|170289515|ref|YP_001739753.1| ribose 5-phosphate isomerase B [Thermotoga sp. RQ2] >gi|4981625|gb|AAD36157.1|AE001768_6 sugar-phosphate isomerase [Thermotoga maritima MSB8] >gi|147736329|gb|ABQ47669.1| ribose-5-phosphate isomerase [Thermotoga petrophila RKU-1] >gi|170177018|gb|ACB10070.1| ribose 5-phosphate isomerase B [Thermotoga sp. RQ2] (143 aa)
Score = 312, Expect = 1.8e-27, Identities = 64/145 (44%), Positives = 97/145 (66%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKL 155
           +K+ I SDH  F++KEK++N + L + ++  D GTYS +ESVDYPDYA+K+ +++L ++  +GI +CGTG+G+ IA N+ +GI AA       A LAR HNN N++ L GR    E    I+  F S+ F+ GRHE+R+ KI ++
  S:     1 MKIAIASDHAAFELKEKVKN-YLLGKGIEVEDHGTYS-EESVDYPDYAKKVVQSILSNEADFGILLCGTGLGMSIAANRYRGIRAALCLFPDMARLARSHNNANILVLPGRLIGAELAFWIVDTFLSTPFDGGRHERRIRKIDEV 143
>gi|118475668|ref|YP_892329.1| ribose 5-phosphate isomerase B [Campylobacter fetus subsp. fetus 82-40] >gi|118414894|gb|ABK83314.1| ribose 5-phosphate isomerase B [Campylobacter fetus subsp. fetus 82-40] (148 aa)
Score = 310, Expect = 3.1e-27, Identities = 67/145 (46%), Positives = 91/145 (62%)
  Q:     8 LKKIKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           +K  +++I SDH GFD KE +++     E  D VDLG YS D SVDYPD+A+K+ EN+  D   +GI ICGTGIGI IA N+   I  A  +    A+LAREHN+ NV+   GR        +++K FF++ F  GRHEKR+ K+
  S:     1 MKVAQIFIASDHAGFDTKEFVKSYLSNFE-FDVVDLGAYSKDMSVDYPDFADKMAENINNDF-KFGILICGTGIGISIAANRHPHIRCALCHDATTAKLAREHNDANVLCFGGRIVGTSIIQDMVKVFFTTEFAGGRHEKRVYKL 143
>gi|3282092|emb|CAA07515.1| hypothetical protein [Thermotoga neapolitana] (143 aa)
Score = 310, Expect = 3.1e-27, Identities = 65/145 (44%), Positives = 98/145 (67%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKL 155
           +K+ I SDH  F++KEK++N + L + ++ +D GT+S +ESVDYPDYA+K+ +++L ++  YGI +CGTG+G+ IA N+ +GI AA       A LAR HNN NV+ L GR    E    I+  F S+ F+ GRHE+R+ KI ++
  S:     1 MKIAIASDHAAFELKEKVKN-YLLNKGIEVLDHGTHS-EESVDYPDYAKKVVQSVLSNEVDYGILLCGTGLGMSIAANRYRGIRAALCLFPDMARLARSHNNANVLVLPGRLIGSELAFWIVDTFLSTPFDGGRHERRIRKIDEV 143
>gi|153956294|ref|YP_001397059.1| ribose-5-phosphate isomerase B [Clostridium kluyveri DSM 555] >gi|146349152|gb|EDK35688.1| Predicted sugar isomerase of the lacAB/rpiB family [Clostridium kluyveri DSM 555] (149 aa)
Score = 309, Expect = 3.9e-27, Identities = 66/148 (44%), Positives = 94/148 (63%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           +K+ +GSDH GF +K++I   H   + L+  D GT+S +ES DYPDYA K+GE ++     +GI +CGTGIGI IA NKI G+ AA    T  A   REHNN N++ +  R   V   ++I+  F  + F+ GRH+KR+DKI ++E K
  S:     1 MKIALGSDHAGFPLKKEIIE-HLKNKGLELEDFGTFS-EESCDYPDYALKVGEQVVSKNYDFGILVCGTGIGISIAANKIPGVRAALCGDTFSAHACREHNNANILAIGQRVVGVGLALDIVDNFLFTEFQGGRHQKRIDKIGEIEKK 146
>gi|83591208|ref|YP_431217.1| ribose-5-phosphate isomerase [Moorella thermoacetica ATCC 39073] >gi|83574122|gb|ABC20674.1| ribose-5-phosphate isomerase [Moorella thermoacetica ATCC 39073] (181 aa)
Score = 308, Expect = 4.6e-27, Identities = 64/149 (42%), Positives = 91/149 (61%)
  Q:    10 KIKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           K++V +GSDHGGF +K  I++      I +  D GTY+  ESVDYPDYA K+   +   +   GI  CGTGIG+CIA NK+ GI AA  + T  A  AREHN+ N++TL  R       +EI+  +  + F  GRH +R+ KI+ +E++
  S:    18 KLRVALGSDHGGFHLKMAIKDYLNRQGIANH-DFGTYNA-ESVDYPDYAHKVAAAVASGEYDRGILCCGTGIGVCIAANKVPGIRAALCHDTFSARAAREHNDANILTLGERVIGPGLALEIVDTWLKAEFSGGRHARRVQKISAIEDQ 164
>gi|157363208|ref|YP_001469975.1| ribose 5-phosphate isomerase B [Thermotoga lettingae TMO] >gi|157313812|gb|ABV32911.1| ribose 5-phosphate isomerase B [Thermotoga lettingae TMO] (145 aa)
Score = 307, Expect = 6.5e-27, Identities = 67/146 (45%), Positives = 93/146 (63%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLE 156
           +K+ IG DH GF +KE I+  + + +  + +D GTYS D SVDYPD+A K+  ++   +  +GI ICGTGIG+ IA N+IKGI AA       A+LAR HNN N++ L GRF +VE    I+  F    FE GRHE R+ KI +++
  S:     1 MKIAIGCDHAGFKLKEAIKG-YLVSKGFNILDEGTYSED-SVDYPDFAAKVALDIKNQRADFGILICGTGIGMSIAANRIKGIRAALCLFPEMAKLARSHNNANILVLPGRFIAVELAQWIVDAFIEEKFEGGRHENRVQKIEEMD 144
>gi|146296223|ref|YP_001179994.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145409799|gb|ABP66803.1| ribose-5-phosphate isomerase [Caldicellulosiruptor saccharolyticus DSM 8903] (150 aa)
Score = 306, Expect = 8.3e-27, Identities = 67/148 (45%), Positives = 94/148 (63%)
  Q:    10 KIKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLEN 157
           K+K+ IG+DH GF +KE ++ + +   I ++ D GTYS +ES DYPD A  +   +   +  +GI ICGTGIGI IA NKIKGI AA  + T  A+ AR HNN N++ +  R        EI+  F S+ FE GRH++R+DKI ++EN
  S:     2 KLKLAIGADHAGFRLKEAVKKHLDKRGI-EYKDFGTYS-EESCDYPDIARDVAIAVKNGEFDFGILICGTGIGISIAANKIKGIRAALCHDTFSAKAARAHNNANILAMGARVIGEGLACEIVDSFLSAQFEGGRHQRRVDKIHEIEN 147
>gi|123473739|ref|XP_001320056.1| ribose 5-phosphate isomerase B family protein [Trichomonas vaginalis G3] >gi|121902853|gb|EAY07833.1| ribose 5-phosphate isomerase B family protein [Trichomonas vaginalis G3] (144 aa)
Score = 306, Expect = 8.9e-27, Identities = 63/146 (43%), Positives = 92/146 (63%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLE 156
           +KV +G DHGGF +K+ + +  + L   + +D+GT S  ESVDYPDYA+K    +      +G+ ICGTGIGI IA NK KGI  A  ++ + AEL R+HNN N++ +  R    E  ++I+K F +++F   RHE+R+ KI  LE
  S:     1 MKVVVGCDHGGFALKQTVIDTIKSLG-HEVIDVGTNS-TESVDYPDYAQKAAHEIQSGNAQFGVLICGTGIGISIAANKCKGIRCALCHEHLTAELCRQHNNANIVAMGARIIGPETAIDIVKTFLTTNFLGDRHERRVCKIMSLE 144
>gi|167038486|ref|YP_001666064.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|167038771|ref|YP_001661756.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Thermoanaerobacter sp. X514] >gi|166853011|gb|ABY91420.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Thermoanaerobacter sp. X514] >gi|166857320|gb|ABY95728.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Thermoanaerobacter pseudethanolicus ATCC 33223] (148 aa)
Score = 305, Expect = 9.7e-27, Identities = 63/146 (43%), Positives = 97/146 (66%)
  Q:    13 VYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           + +G+DHGG+++KE I+   +   I  + D GT+ G ESVDYPDYA K+ E +   + S GI +CGTGIG+ IA NK+ GI AA+      A+ A+EHNN N++ L GR T     V +++++ ++ F+ GRH++R+DKI ++E K
  S:     2 IALGADHGGYELKEAIKKYLDEKGIA-YKDFGTF-GTESVDYPDYALKVAEAVASHECSEGILVCGTGIGMSIAANKVPGIRAAHAEDVFSAKAAKEHNNANILCLGGRITGPGLAVMMVEEWLNATFQGGRHQRRIDKIAEIEKK 145
>gi|194336446|ref|YP_002018240.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Pelodictyon phaeoclathratiforme BU-1] >gi|194308923|gb|ACF43623.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Pelodictyon phaeoclathratiforme BU-1] (144 aa)
Score = 305, Expect = 1.1e-26, Identities = 63/142 (44%), Positives = 91/142 (64%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           +K+ +GSDH GF  K+ + +  E  +  +F D+G Y+ +ESVDYPDYA K+ E +   +   GI +CGTGIG+ I+ NKIKGI AA       A LAR+HNN N+I  S RFT      + +  +F++ FE GRH++R++KI
  S:     1 MKIAVGSDHAGFTFKKTVTDWLERHD-YEFDDMGPYN-EESVDYPDYARKVAEAVAAQQCDSGILLCGTGIGVSISANKIKGIRAALACNPEFATLARQHNNANIICFSARFTDKATIEQSLHNWFTTDFEGGRHQRRVNKI 140
>gi|20806675|ref|NP_621846.1| ribose 5-phosphate isomerase RpiB [Thermoanaerobacter tengcongensis MB4] >gi|20515126|gb|AAM23450.1| Ribose 5-phosphate isomerase RpiB [Thermoanaerobacter tengcongensis MB4] (302 aa)
Score = 305, Expect = 1.2e-26, Identities = 66/158 (41%), Positives = 103/158 (65%)
  Q:     1 MSESKKQLKKIKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           +SE +K  + I   +GSDH G+++KE I+   E   I  + D GT++ +ESVDYPDYA K+ E +   + + GI +CGTGIG+ I  NK+ GI AA+V     A  A+EHNN N++ + GR T     + +++++ ++ F+ GRH+KR+DKIT++E K
  S:   146 LSEERKVDRMIA--LGSDHAGYELKEVIKKYLEEKGI-PYKDFGTFN-EESVDYPDYALKVAEAVASGECTEGILVCGTGIGMSITANKVPGIRAAHVEDVFSARAAKEHNNANILCMGGRVTGPGLAIMMVEEWLNATFQGGRHQKRIDKITEIEKK 299
>gi|150388178|ref|YP_001318227.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Alkaliphilus metalliredigens QYMF] >gi|149948040|gb|ABR46568.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Alkaliphilus metalliredigens QYMF] (149 aa)
Score = 303, Expect = 2.0e-26, Identities = 69/148 (46%), Positives = 94/148 (63%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           +K+ IGSDHGG+++K  I+  H L + L+ VD GT S D S DY DYA+ + E + K   + GI ICGTGIGI IA NK+ GI  A V     A+   EHN+ NV+ L GR       +EI+  + S+ F+ GRH+KR+DKIT +E+K
  S:     1 MKIAIGSDHGGYELKNLIKE-HLLNKKLEVVDFGTESTD-SCDYADYAQGVAEAVAKGDYARGILICGTGIGISIAANKVPGIRCALVGDCFSAKATTEHNDSNVLALGGRVVGPGLALEIVDIWLSATFQGGRHQKRIDKITDIESK 146
>gi|154249475|ref|YP_001410300.1| ribose 5-phosphate isomerase B [Fervidobacterium nodosum Rt17-B1] >gi|154153411|gb|ABS60643.1| ribose 5-phosphate isomerase B [Fervidobacterium nodosum Rt17-B1] (145 aa)
Score = 302, Expect = 2.3e-26, Identities = 69/146 (47%), Positives = 94/146 (64%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLE 156
           +KV IGSDH  F++KEK++  +   + ++ +D GTYS  ESVDYPDYA+K+ E +   +  +GI +CGTGIG+ IA NKIKGI AA       A  AR+HN+ NV+ L GR   +E     +  F  S FE GRHE+R+ KI +LE
  S:     1 MKVAIGSDHAAFELKEKVKE-YLRNKGIEVIDCGTYS-IESVDYPDYAKKVAEKVKSKECHFGILMCGTGIGMSIAANKIKGIRAALCLFPDMATYARKHNDANVLVLPGRLMGIELAKWTVDAFLDSSFEGGRHERRVKKIEELE 144
>gi|89897675|ref|YP_521162.1| hypothetical protein DSY4929 [Desulfitobacterium hafniense Y51] >gi|89337123|dbj|BAE86718.1| hypothetical protein [Desulfitobacterium hafniense Y51] (154 aa)
Score = 299, Expect = 5.6e-26, Identities = 65/146 (44%), Positives = 94/146 (64%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHEL--LEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLE 156
           +K+ +G+DHGG+++K +IR + E   +EILDF   GT + D SVDYP Y   +G+ + K K   GI +CGTG+GI IA NK+ G+ AA   +T  A +AREHNN N++ L GR T +   ++I+  F  + F  GRH  R+D I  +E
  S:     6 LKIALGADHGGYELKNEIRAHLEEQGIEILDF---GTNTKD-SVDYPRYGFYVGDAVTKGKADLGIVVCGTGLGISIAANKVPGVRAAVCTETYSARMAREHNNANILALGGRVTGLGLALDIVDMFVKTPFAGGRHACRVDLIDAIE 149
>gi|148378150|ref|YP_001252691.1| ribose 5-phosphate isomerase B [Clostridium botulinum A str. ATCC 3502] >gi|153931351|ref|YP_001382551.1| ribose-5-phosphate isomerase B [Clostridium botulinum A str. ATCC 19397] >gi|153935683|ref|YP_001386103.1| ribose-5-phosphate isomerase B [Clostridium botulinum A str. Hall] >gi|148287634|emb|CAL81699.1| ribose 5-phosphate isomerase [Clostridium botulinum A str. ATCC 3502] >gi|152927395|gb|ABS32895.1| ribose 5-phosphate isomerase B [Clostridium botulinum A str. ATCC 19397] >gi|152931597|gb|ABS37096.1| ribose 5-phosphate isomerase B [Clostridium botulinum A str. Hall] (145 aa)
Score = 299, Expect = 5.9e-26, Identities = 64/146 (43%), Positives = 96/146 (65%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHEL--LEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLE 156
           +K+ +GSDH G  +K +I  + E   +EI DF   GTY+ +ES DYPDYA+K+ E ++  +  +GI +CGTGIGI IA NK+KG+ AA  + T  A   REHNN N++ L  R   V   ++I+  F ++ F+ GRHE R++K+ ++E
  S:     1 MKIALGSDHAGLPLKNEIIKHLEGKGIEIKDF---GTYT-EESCDYPDYAQKVAEKVVAKEFDFGILVCGTGIGISIAANKVKGVRAALCSDTFSAHACREHNNANILALGQRVVGVGLALDIVDNFLNAEFQGGRHENRINKMMRIE 144
>gi|153951312|ref|YP_001398006.1| ribose 5-phosphate isomerase B [Campylobacter jejuni subsp. doylei 269.97] >gi|152938758|gb|ABS43499.1| ribose 5-phosphate isomerase B [Campylobacter jejuni subsp. doylei 269.97] (145 aa)
Score = 298, Expect = 6.9e-26, Identities = 68/141 (48%), Positives = 93/141 (65%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           K+YI SDH GF++KEKI    +   I+ F DLGT +   S DYPDYA  + E +  D+ S+GI ICG+GIGI IA N+ K I  A  ++++ AELAR HN+ NV+ L GR   +E  ++II+KF  + FE GRH +R+ KI
  S:     5 KIYIASDHAGFELKEKICALLKEKNII-FNDLGTNTC-ASCDYPDYAHLLAEKI--DERSFGILICGSGIGISIAANRHKNIRCALCHESLSAELARRHNDANVLALGGRLIGIELAIDIIEKFIQTPFEGGRHMQRIQKI 141
>gi|86152741|ref|ZP_01070946.1| ribose 5-phosphate isomerase B [Campylobacter jejuni subsp. jejuni HB93-13] >gi|121613326|ref|YP_001000599.1| ribose 5-phosphate isomerase B [Campylobacter jejuni subsp. jejuni 81-176] >gi|157415182|ref|YP_001482438.1| ribose 5-phosphate isomerase B [Campylobacter jejuni subsp. jejuni 81116] >gi|167005530|ref|ZP_02271288.1| putative ribose 5-phosphate isomerase [Campylobacter jejuni subsp. jejuni 81-176] >gi|85843626|gb|EAQ60836.1| ribose 5-phosphate isomerase B [Campylobacter jejuni subsp. jejuni HB93-13] >gi|87248897|gb|EAQ71860.1| ribose 5-phosphate isomerase B [Campylobacter jejuni subsp. jejuni 81-176] >gi|157386146|gb|ABV52461.1| putative ribose 5-phosphate isomerase [Campylobacter jejuni subsp. jejuni 81116] (145 aa)
Score = 298, Expect = 7.2e-26, Identities = 69/141 (48%), Positives = 93/141 (65%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           K+YI SDH GF++KEKI    +   I+ F DLGT +   S DYPDYA  + E +  D+ S+GI ICG+GIGI IA N+ K I  A  ++++ AELAR HN+ NV+ L GR   VE  ++II+KF  + FE GRH +R+ KI
  S:     5 KIYIASDHAGFELKEKICVFLKEKNII-FNDLGTNTC-ASCDYPDYAHLLAEKI--DERSFGILICGSGIGISIAANRHKNIRCALCHESLSAELARRHNDANVLALGGRLIGVELAIDIIEKFIQTPFEEGRHMQRIQKI 141
>gi|86150810|ref|ZP_01069026.1| ribose 5-phosphate isomerase B [Campylobacter jejuni subsp. jejuni 260.94] >gi|85841980|gb|EAQ59226.1| ribose 5-phosphate isomerase B [Campylobacter jejuni subsp. jejuni 260.94] (145 aa)
Score = 297, Expect = 8.3e-26, Identities = 69/141 (48%), Positives = 93/141 (65%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           K+YI SDH GF++KEKI    +   I+ F DLGT +   S DYPDYA  + E +  D+ S+GI ICG+GIGI IA N+ K I  A  ++++ AELAR HN+ NV+ L GR   VE  ++II+KF  + FE GRH +R+ KI
  S:     5 KIYIASDHAGFELKEKICVFLKEKNII-FNDLGTNTC-TSCDYPDYAHLLAEKI--DERSFGILICGSGIGISIAANRHKNIRCALCHESLSAELARRHNDANVLALGGRLIGVELAIDIIEKFIQTPFEEGRHMQRIQKI 141
>gi|18311180|ref|NP_563114.1| ribose-5-phosphate isomerase B [Clostridium perfringens str. 13] >gi|110800386|ref|YP_696877.1| ribose-5-phosphate isomerase B [Clostridium perfringens ATCC 13124] >gi|110802734|ref|YP_699473.1| ribose-5-phosphate isomerase B [Clostridium perfringens SM101] >gi|168210128|ref|ZP_02635753.1| ribose 5-phosphate isomerase B [Clostridium perfringens B str. ATCC 3626] >gi|168213698|ref|ZP_02639323.1| ribose 5-phosphate isomerase B [Clostridium perfringens CPE str. F4969] >gi|168215827|ref|ZP_02641452.1| ribose 5-phosphate isomerase B [Clostridium perfringens NCTC 8239] >gi|18145863|dbj|BAB81904.1| ribose 5-phosphate isomerase [Clostridium perfringens str. 13] >gi|110675033|gb|ABG84020.1| ribose 5-phosphate isomerase B [Clostridium perfringens ATCC 13124] >gi|110683235|gb|ABG86605.1| ribose 5-phosphate isomerase b [Clostridium perfringens SM101] >gi|170711788|gb|EDT23970.1| ribose 5-phosphate isomerase B [Clostridium perfringens B str. ATCC 3626] >gi|170714766|gb|EDT26948.1| ribose 5-phosphate isomerase B [Clostridium perfringens CPE str. F4969] >gi|182382193|gb|EDT79672.1| ribose 5-phosphate isomerase B [Clostridium perfringens NCTC 8239] (149 aa)
Score = 297, Expect = 9.3e-26, Identities = 66/148 (44%), Positives = 91/148 (61%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           +K+ IG DHGGF++K  +  + E   I +  D GTYS D S DYPD + ++ E + K +  YGI ICGTGIGI IA NK+ GI AA  + T  A   R+HNN N++ +  R       ++I+  F +S FE GRH+ R+DKIT +E K
  S:     1 MKIAIGCDHGGFNLKNTVIKHLEEKGI-EVKDFGTYSTD-SCDYPDISIQVAEAVAKKEFEYGILICGTGIGISIAANKVPGIRAALCSDTFSAHATRQHNNANILAMGERVVGPGLALDIVDTFLNSEFEGGRHQNRIDKITAIEEK 146
>gi|15792254|ref|NP_282077.1| ribose 5-phosphate isomerase B [Campylobacter jejuni subsp. jejuni NCTC 11168] >gi|57237753|ref|YP_179001.1| ribose 5-phosphate isomerase B [Campylobacter jejuni RM1221] >gi|86150642|ref|ZP_01068864.1| ribose 5-phosphate isomerase B [Campylobacter jejuni subsp. jejuni CF93-6] >gi|88596659|ref|ZP_01099896.1| ribose 5-phosphate isomerase B [Campylobacter jejuni subsp. jejuni 84-25] >gi|148926606|ref|ZP_01810288.1| putative ribose 5-phosphate isomerase [Campylobacter jejuni subsp. jejuni CG8486] >gi|57166557|gb|AAW35336.1| ribose 5-phosphate isomerase B [Campylobacter jejuni RM1221] >gi|85838903|gb|EAQ56170.1| ribose 5-phosphate isomerase B [Campylobacter jejuni subsp. jejuni CF93-6] >gi|88191500|gb|EAQ95472.1| ribose 5-phosphate isomerase B [Campylobacter jejuni subsp. jejuni 84-25] >gi|112360250|emb|CAL35045.1| ribose 5-phosphate isomerase [Campylobacter jejuni subsp. jejuni NCTC 11168] >gi|145845300|gb|EDK22394.1| putative ribose 5-phosphate isomerase [Campylobacter jejuni subsp. jejuni CG8486] (145 aa)
Score = 296, Expect = 1.0e-25, Identities = 69/141 (48%), Positives = 93/141 (65%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           K+YI SDH GF++KEKI    +   I+ F DLGT +   S DYPDYA  + E +  +K S+GI ICG+GIGI IA N+ K I  A  ++++ AELAR HN+ NV+ L GR   VE  ++II+KF  + FE GRH +R+ KI
  S:     5 KIYIASDHAGFELKEKICVFLKEKNII-FNDLGTNTC-ASCDYPDYAHLLAEKI--NKRSFGILICGSGIGISIAANRHKNIRCALCHESLSAELARRHNDANVLALGGRLIGVELAIDIIEKFIQTPFEEGRHMQRIQKI 141
>gi|118445012|ref|YP_879009.1| ribose-5-phosphate isomerase B [Clostridium novyi NT] >gi|118135468|gb|ABK62512.1| ribose 5-phosphate isomerase B [Clostridium novyi NT] (149 aa)
Score = 296, Expect = 1.1e-25, Identities = 62/148 (41%), Positives = 93/148 (62%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           +K+ IG DHGG ++K+ +   H   + ++  D GTY+ +ES DYP+Y +K+ E ++     +GI ICGTGIGI I+ NK+ G  AA  + T  A   REHNN N++ L  R T     ++I+  F  + FE GRHE+R+DKI+++E K
  S:     1 MKIAIGCDHGGVELKKTVIE-HLQEKGIEVKDFGTYT-EESCDYPEYGQKVAEEVVAKNYDFGIVICGTGIGISISANKVPGARAALCHDTFSAHATREHNNANILALGARVTGPGLALDIVDAFLGATFEGGRHERRIDKISEIEKK 146
>gi|145219703|ref|YP_001130412.1| ribose-5-phosphate isomerase [Prosthecochloris vibrioformis DSM 265] >gi|145205867|gb|ABP36910.1| ribose-5-phosphate isomerase [Prosthecochloris vibrioformis DSM 265] (144 aa)
Score = 296, Expect = 1.2e-25, Identities = 61/144 (42%), Positives = 92/144 (63%)
  Q:    11 IKVYIGSDHGGFDMKEKIR-----NNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITK 154
           +K+ IGSDH G + K++I      + HE        D+G Y+ +ESVDYPDYA K+   +   +   GI +CGTG+G+ I+ NK+ GI AA   +   A LAR+HNN NV+ +S RFT     V  ++ +F++ FE GRH++R++KI +
  S:     1 MKIAIGSDHAGVEFKKEIAAWLAAHGHEC------TDMGPYT-EESVDYPDYAHKVARAVAAGEYEQGILLCGTGLGVSISANKVPGIRAALACRPEFATLARQHNNANVLCMSARFTDSAAIVTTLEHWFAAEFEGGRHQRRVEKIEQ 142
>gi|15896134|ref|NP_349483.1| ribose-5-phosphate isomerase B [Clostridium acetobutylicum ATCC 824] >gi|15025927|gb|AAK80823.1|AE007785_8 Ribose 5-phosphate isomerase, RpiB [Clostridium acetobutylicum ATCC 824] (152 aa)
Score = 296, Expect = 1.2e-25, Identities = 64/148 (43%), Positives = 93/148 (62%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           +K+ IGSDH GF +K+++  + E   I +  D GT + DES DYPDYA K+ E + +    +GI ICGTGIGI I+ NK+ GI AA    T  A  +REHNN N++ +  R       ++I+  F +S F+  RH++R+DKIT++E K
  S:     1 MKIAIGSDHAGFSLKKEVIKHLESKNI-EVKDFGTLT-DESCDYPDYALKVAEEVAQKNFEFGILICGTGIGISISANKVPGIRAAVCTDTFCAHASREHNNANILAMGERVVGPGLAIDIVDTFLNSKFQGDRHQRRIDKITQIEKK 146
>gi|152990457|ref|YP_001356179.1| ribose 5-phosphate isomerase B [Nitratiruptor sp. SB155-2] >gi|151422318|dbj|BAF69822.1| ribose 5-phosphate isomerase B [Nitratiruptor sp. SB155-2] (146 aa)
Score = 295, Expect = 1.6e-25, Identities = 70/145 (48%), Positives = 90/145 (62%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLEI--LDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLE 156
           KVYIG DH GF +K  +    +LL+    +  DLGTYS  E VDYPDYAEK+   +  DK S+G+ ICGTGIG+ IA NKIKGI AA V+    A++AR HN+ N++    R         II  + ++ FE GRHE R+ KI  LE
  S:     3 KVYIGCDHAGFAIKGLVI---KLLQKRGYEVEDLGTYS-SERVDYPDYAEKVARAVAADKESFGVLICGTGIGMSIAANKIKGIRAAEVHDYYTAQMARAHNDANIVCFGERVVGPGVVESIIDAWCNTEFEGGRHENRVKKIMALE 145
>gi|153938808|ref|YP_001389507.1| ribose-5-phosphate isomerase B [Clostridium botulinum F str. Langeland] >gi|170757081|ref|YP_001779771.1| ribose 5-phosphate isomerase B [Clostridium botulinum B1 str. Okra] >gi|170759805|ref|YP_001785473.1| ribose 5-phosphate isomerase B [Clostridium botulinum A3 str. Loch Maree] >gi|152934704|gb|ABS40202.1| ribose 5-phosphate isomerase B [Clostridium botulinum F str. Langeland] >gi|169122293|gb|ACA46129.1| ribose 5-phosphate isomerase B [Clostridium botulinum B1 str. Okra] >gi|169406794|gb|ACA55205.1| ribose 5-phosphate isomerase B [Clostridium botulinum A3 str. Loch Maree] (145 aa)
Score = 294, Expect = 1.7e-25, Identities = 64/146 (43%), Positives = 95/146 (65%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHEL--LEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLE 156
           +K+ +GSDH G  +K +I  + E   +EI DF   GTY+ +ES DYPDYA+K+ E ++  +  +GI +CGTGIGI IA NK+KG+ AA  + T  A   REHNN N++ L  R   V   ++I+  F ++ F+ GRHE R++K+  +E
  S:     1 MKIALGSDHAGLPLKNEIIKHLEGKGIEIKDF---GTYT-EESCDYPDYAQKVAEKVVAKEFDFGILVCGTGIGISIAANKVKGVRAALCSDTFSAHACREHNNANILALGQRVVGVGLALDIVDNFLNAEFQGGRHENRINKMMGIE 144
>gi|160888946|ref|ZP_02069949.1| hypothetical protein BACUNI_01366 [Bacteroides uniformis ATCC 8492] >gi|156861413|gb|EDO54844.1| hypothetical protein BACUNI_01366 [Bacteroides uniformis ATCC 8492] (145 aa)
Score = 294, Expect = 2.0e-25, Identities = 64/138 (46%), Positives = 87/138 (63%)
  Q:    15 IGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           I SDH GF++KE +R   E  +   + D GTYS  ES DYPD+A  +   +   +   GI ICG+G GI I LNK +GI AA       A LAR+HN+ NV+ + GRF S E+   I+++FFS+ FE GRH++R+DKI
  S:     6 ICSDHAGFELKEYVRGWLEA-KGWAYKDFGTYS-TESCDYPDFAHPLALAVEAGECYPGIAICGSGEGISITLNKHQGIRAALCWTAEIAHLARQHNDANVLVMPGRFISTEEADMIMREFFSTPFEGGRHQRRVDKI 141
>gi|109648010|ref|ZP_01371913.1| sugar-phosphate isomerases, RpiB/LacA/LacB family [Desulfitobacterium hafniense DCB-2] >gi|109641100|gb|EAT50655.1| sugar-phosphate isomerases, RpiB/LacA/LacB family [Desulfitobacterium hafniense DCB-2] (149 aa)
Score = 294, Expect = 2.0e-25, Identities = 64/146 (43%), Positives = 94/146 (64%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHEL--LEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLE 156
           +K+ +G+DHGG+++K +IR + E   +EILDF   GT + D SV+YP Y   +G+ + K K   GI +CGTG+GI IA NK+ G+ AA   +T  A +AREHNN N++ L GR T +   ++I+  F  + F  GRH  R+D I  +E
  S:     1 MKIALGADHGGYELKNEIRAHLEEQGIEILDF---GTNTKD-SVEYPRYGFYVGDAVTKGKADLGIVVCGTGLGISIAANKVPGVRAAVCTETYSARMAREHNNANILALGGRVTGLGLALDIVDMFVKTPFAGGRHACRVDLIEAIE 144
>gi|158321593|ref|YP_001514100.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Alkaliphilus oremlandii OhILAs] >gi|158141792|gb|ABW20104.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Alkaliphilus oremlandii OhILAs] (149 aa)
Score = 293, Expect = 2.4e-25, Identities = 66/148 (44%), Positives = 90/148 (60%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           +K+ IGSDHGG+ +KE IR  H   +  D  D GT S   SVDYPD+A+ +GE ++  +   GI ICGTGIGI IA NKI G+  A V     A+  R+HN+ N++ L  R       +EI+  + S+ FE GRH+ R+DKI  +E K
  S:     1 MKIAIGSDHGGYGLKELIRK-HLQEKGFDIKDFGTDS-TASVDYPDFAKAVGEAVVAGEFQRGILICGTGIGISIAANKIPGVRCALVGDCFSAKATRQHNDANILALGERVVGPGLALEIVDIWLSAEFEGGRHQGRVDKIADIEKK 146
>gi|160943028|ref|ZP_02090266.1| hypothetical protein FAEPRAM212_00505 [Faecalibacterium prausnitzii M21/2] >gi|158445722|gb|EDP22725.1| hypothetical protein FAEPRAM212_00505 [Faecalibacterium prausnitzii M21/2] (148 aa)
Score = 293, Expect = 2.9e-25, Identities = 56/146 (38%), Positives = 90/146 (61%)
  Q:    13 VYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           + + +DHGGF++KE ++ + E L  L+++D GT+S D SVDYPD A    + ++  +    +  CGTG+GI +A NKIKGI A   + +   E  R HN+ N + + GR        +++  F ++ FE GRH++R+DK+T LEN+
  S:     5 IALAADHGGFELKEAVKAHLEELG-LEYIDFGTHSTD-SVDYPDMAVPACDAVVSGQCEKALLFCGTGVGISMAANKIKGIRACCCSDSFSCEYTRRHNDANALCMGGRVVGAGLACQLVDIFLNTEFEGGRHQRRIDKLTALENR 148
>gi|116626060|ref|YP_828216.1| ribose-5-phosphate isomerase [Solibacter usitatus Ellin6076] >gi|116229222|gb|ABJ87931.1| ribose-5-phosphate isomerase [Solibacter usitatus Ellin6076] (145 aa)
Score = 292, Expect = 3.0e-25, Identities = 60/146 (41%), Positives = 91/146 (62%)
  Q:    11 IKVYIGSDHGGFDMKEKIR-----NNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLE 156
           +K+ IG+DH GF +KEK+R     + HE+      VD GT S D S DYPD+A+ +  ++ + +   GI +C TGIG+ +A NKI G+ AA      E +  REHN+ NV+TL  ++   +  +E+I  F ++ F  GRH +R+ KI +LE
  S:     1 MKIAIGADHAGFSLKEKLRQKLAQDGHEV------VDFGTAS-DASCDYPDFAQPVARDVAQGRSDRGILVCSTGIGMAMAANKIDGVRAAPAQSDDEVKFTREHNDANVLTLGAKYLDEDRAIELIHIFLNTEFAGGRHARRVAKIAQLE 144
>gi|12045258|ref|NP_073069.1| ribose-5-phosphate isomerase B [Mycoplasma genitalium G37] >gi|66880533|ref|ZP_00405514.1| COG0698: Ribose 5-phosphate isomerase RpiB [Mycoplasma genitalium G-37] >gi|1723159|sp|P47636|RPIB_MYCGE Probable ribose-5-phosphate isomerase B (Phosphoriboisomerase B) >gi|3844988|gb|AAC71624.1| ribose 5-phosphate isomerase B [Mycoplasma genitalium G37] >gi|166078770|gb|ABY79388.1| ribose 5-phosphate isomerase B [synthetic Mycoplasma genitalium JCVI-1.0] (152 aa)
Score = 292, Expect = 3.4e-25, Identities = 65/146 (44%), Positives = 96/146 (65%)
  Q:    13 VYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYA----EKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           ++I SDH G  +K KI + H   +  + VDLG    D + DYPD+A    +K+ +N  KD    GI ICGTG+G+C+A NK+KG+ AA V     A LAR+H+N NV+ LS RF +  +N++I+  F  ++FE GRH++R+DKI + E +
  S:     5 IFIASDHTGLTLK-KIISEHLKTKQFNVVDLGPNYFDANDDYPDFAFLVADKVKKNSDKD---LGILICGTGVGVCMAANKVKGVLAALVVSEKTAALARQHDNANVLCLSSRFVTDSENIKIVDDFLKANFEGGRHQRRIDKIIRYEKE 150
>gi|28210068|ref|NP_781012.1| ribose-5-phosphate isomerase B [Clostridium tetani E88] >gi|28202503|gb|AAO34949.1| ribose 5-phosphate isomerase [Clostridium tetani E88] (149 aa)
Score = 291, Expect = 4.7e-25, Identities = 65/147 (44%), Positives = 91/147 (61%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLEN 157
           +K+ +GSDH G  +K++I  + E  +I +  D GT   +ES DYPDYA+++   +       GI ICGTGIGI IA NK+ GI AA  + T  A   REHNN N++ L  R   +   ++I+  F SS F+ GRH+KRLDKI+ +EN
  S:     1 MKIALGSDHAGLKLKKEIIKHLEGKDI-ELKDFGT-DAEESCDYPDYAKEVANQVADKNYDLGILICGTGIGISIAANKVPGIRAALCSDTFSAHSCREHNNANILALGERVVGLGLALDIVDTFLSSEFQGGRHQKRLDKISGIEN 145
>gi|123418985|ref|XP_001305454.1| ribose 5-phosphate isomerase B family protein [Trichomonas vaginalis G3] >gi|121886973|gb|EAX92524.1| ribose 5-phosphate isomerase B family protein [Trichomonas vaginalis G3] (144 aa)
Score = 290, Expect = 5.1e-25, Identities = 59/146 (40%), Positives = 91/146 (62%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLE 156
           +K+ +G DHGGF +K+ + +  + L   + +D+GT S  ESVDYPD+A+   + +       G+ ICGTGIGI IA NK KGI  A  ++ + A+L R+HNN N++ +  R    E  ++I+K F ++ F   RHE+R++KI  LE
  S:     1 MKIVVGCDHGGFALKQTVIDTVKSLG-HEVIDVGTNS-TESVDYPDFAQAAAKEIESGNAQLGVLICGTGIGISIAANKCKGIRCALCHEHLTAQLCRQHNNANIVAMGARIIGPETAIDIVKTFLTTDFLGDRHERRVNKIMALE 144
>gi|95929571|ref|ZP_01312313.1| sugar-phosphate isomerases, RpiB/LacA/LacB family [Desulfuromonas acetoxidans DSM 684] >gi|95134268|gb|EAT15925.1| sugar-phosphate isomerases, RpiB/LacA/LacB family [Desulfuromonas acetoxidans DSM 684] (150 aa)
Score = 289, Expect = 7.1e-25, Identities = 60/142 (42%), Positives = 88/142 (61%)
  Q:    15 IGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLE 156
           I SDHGG ++K+ I  ++   + +D  DLG ++ D SVDYPDYA  + E + K +   GI +CGTGIG+ IA NK  G+ AA  +    A++AREHNN N++ L GR    E    ++  ++   +E GRH+ RL+KI +LE
  S:     4 IASDHGGLELKQ-ILVDYLKQQGVDVKDLGVHAED-SVDYPDYAALVAEPISKQEADQGILVCGTGIGMSIAANKFPGVRAALAHDEFTAQMAREHNNANILVLGGRVLDPELACRMVSVWYDGAYEGGRHQNRLNKIIQLE 143
>gi|42523484|ref|NP_968864.1| ribose 5-phosphate isomerase B [Bdellovibrio bacteriovorus HD100] >gi|39575690|emb|CAE79857.1| ribose 5-phosphate isomerase B [Bdellovibrio bacteriovorus HD100] (158 aa)
Score = 289, Expect = 7.6e-25, Identities = 64/141 (45%), Positives = 94/141 (66%)
  Q:    13 VYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLK-------------DKG-SYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKIT 153
           VY+G DH G D+K K+      L  + + D+GT+S D SVDYPDYA+++   ++K              KG + G+ ICG+G G+ I  NK   I AA    T  A L+REHNN N++ LS RFTS +D V++++ F S+ F  GRH++R+DK++
  S:     3 VYVGCDHAGLDLKLKVM---AALPDIQWKDMGTHSAD-SVDYPDYADQVCREVVKVELQNQKNNLIDSQKGPALGLLICGSGQGMAIRANKFPQIRAALCWNTDIARLSREHNNANILCLSERFTSPDDAVKMLQTFLSTSFAGGRHQQRVDKLS 153
>gi|116874027|ref|YP_850808.1| ribose 5-phosphate isomerase B [Listeria welshimeri serovar 6b str. SLCC5334] >gi|116742905|emb|CAK22029.1| rpiB [Listeria welshimeri serovar 6b str. SLCC5334] (146 aa)
Score = 287, Expect = 1.3e-24, Identities = 64/148 (43%), Positives = 91/148 (61%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           +K+ IG DHGG  +K+ I   H   + +D VD+GTY+ DESVD+P YAE++   ++  +   GI  CGTGIG+ IA NK+ GI AA V+ T  A   REHNN N++ L  R       + ++  +  + F   RH++RLDKIT+LE K
  S:     1 MKLTIGCDHGGRRLKDAIVK-HLREKNIDVVDIGTYT-DESVDFPSYAEEVANQVVSGQSELGILCCGTGIGMSIAANKVDGIRAAVVSDTFSARATREHNNSNILCLGERVIGEGLALLLVDTWLEASFAGDRHKRRLDKITELERK 146
>gi|77919042|ref|YP_356857.1| ribose 5-phosphate isomerase B [Pelobacter carbinolicus DSM 2380] >gi|77545125|gb|ABA88687.1| ribose-5-phosphate isomerase [Pelobacter carbinolicus DSM 2380] (151 aa)
Score = 287, Expect = 1.4e-24, Identities = 60/142 (42%), Positives = 90/142 (63%)
  Q:    15 IGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLE 156
           I SDHGG ++KE+++   +   I +  DLGT +GD SVDYPD+ E++G  +   +   GI ICGTGIG+ I  NK  G+ AA +     A +++EHNN N+I + GR  S +   +++  +  + FE GRH+KRLDKI ++E
  S:     4 IASDHGGLELKEQVKAYLKQRNI-EVRDLGTDNGD-SVDYPDFGERVGRAISTGEAEKGILICGTGIGMSIVANKFPGVRAALIWDEFTARMSKEHNNANIIVMGGRMLSDDKASQMVGVWLDATFEGGRHQKRLDKIAQIE 143
>gi|47092284|ref|ZP_00230075.1| ribose 5-phosphate isomerase B [Listeria monocytogenes str. 4b H7858] >gi|153168826|ref|ZP_01928587.1| ribose 5-phosphate isomerase B [Listeria monocytogenes FSL N1-017] >gi|167015753|ref|ZP_02278286.1| ribose 5-phosphate isomerase B [Listeria monocytogenes FSL J1-194] >gi|167215323|ref|ZP_02285630.1| ribose 5-phosphate isomerase B [Listeria monocytogenes FSL R2-503] >gi|167218449|ref|ZP_02288085.1| ribose 5-phosphate isomerase B [Listeria monocytogenes FSL J1-175] >gi|167455124|ref|ZP_02321347.1| ribose 5-phosphate isomerase B [Listeria monocytogenes FSL J2-064] >gi|47019263|gb|EAL10005.1| ribose 5-phosphate isomerase B [Listeria monocytogenes str. 4b H7858] >gi|133726060|gb|EBA27758.1| ribose 5-phosphate isomerase B [Listeria monocytogenes FSL N1-017] (146 aa)
Score = 287, Expect = 1.4e-24, Identities = 65/148 (43%), Positives = 91/148 (61%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           +K+ IG DHGG  +K+ I   H   + ++ VD+GTY+ DESVD+P YAE++   ++  +   GI  CGTGIG+ IA NK+ GI AA V+ T  A   REHNN NV+ L  R       + I+  +  + F   RH++RLDKIT+LE K
  S:     1 MKLTIGCDHGGRRLKDAIVK-HLREKDIEVVDIGTYT-DESVDFPSYAEEVANQVVSGQSELGILCCGTGIGMSIAANKVDGIRAAVVSDTFSARATREHNNSNVLCLGERVIGEGLALLIVDTWLEASFAGDRHKRRLDKITELERK 146
>gi|157093011|gb|ABV22160.1| ribose/galactose isomerase [Perkinsus chesapeaki] (176 aa)
Score = 286, Expect = 1.7e-24, Identities = 67/148 (45%), Positives = 94/148 (63%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFV------------DLGTYSGDESVDYPDYAEKIGENLLKDKG----SYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           +K+  GSDH G D+K          E++DFV            D+GTY+ D SVDYPD+AEK  + LL        + G+ ICG+G+GI ++ NK KGI  A  +   +A  +R HNN NV+ + GR T VE   EI+  + ++ FE GRH+KR+DK+  LE K
  S:    22 LKLVFGSDHAGIDLKN---------EMIDFVKNTLKAPEGSITDVGTYTHD-SVDYPDFAEKTCKTLLSTSDDTSKALGVVICGSGLGISMSANKCKGIRCALCSSNYDARYSRLHNNANVLAMGGRTTGVEVAREILATYINTDFEGGRHQKRIDKMMALEQK 175
>gi|57504983|ref|ZP_00370935.1| sugar-phosphate isomerase [Campylobacter coli RM2228] >gi|57019255|gb|EAL55961.1| sugar-phosphate isomerase [Campylobacter coli RM2228] (145 aa)
Score = 286, Expect = 1.7e-24, Identities = 64/141 (45%), Positives = 89/141 (63%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           K+YI SDH GF +KEKI    E  +I  F DLGT     S DYPDYA  +   +  D+ S+GI ICG+GIGI IA N+ K I  A  N+++ A+LAR+HN+ NV+   GR   ++  +++I+ F  + F+ GRH KR+ KI
  S:     5 KIYIASDHAGFLLKEKICAFLEEKQI-PFDDLGT-KDPTSCDYPDYAHLLASKI--DEQSFGILICGSGIGISIAANRHKNIRCALCNESLSAKLARKHNDANVLAFGGRLIGIDAAIDMIENFIQTPFDQGRHVKRIQKI 141
>gi|110598193|ref|ZP_01386470.1| sugar-phosphate isomerases, RpiB/LacA/LacB family:ribose 5-phosphate isomerase B [Chlorobium ferrooxidans DSM 13031] >gi|110340207|gb|EAT58705.1| sugar-phosphate isomerases, RpiB/LacA/LacB family:ribose 5-phosphate isomerase B [Chlorobium ferrooxidans DSM 13031] (144 aa)
Score = 285, Expect = 2.2e-24, Identities = 60/142 (42%), Positives = 90/142 (63%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFV--DLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           +K+ + SDH GF+ K+ +      LE   +   D+G Y+ +ESVDYPD+A K+ + +   +   G+ +CGTGIG+ IA NK+KGI AA       A LAR+HNN N+I  S RF+      + ++ +FS+ FE GRHE+R++KI
  S:     1 MKIAVASDHAGFESKKTVV---AWLEKHGYACSDMGPYN-EESVDYPDFARKVAQGVAAGEFDQGVLLCGTGIGVSIAANKVKGIRAALACNPEFATLARQHNNANIICFSARFSDKATIEQSLQNWFSAEFEGGRHERRVEKI 140
>gi|78186879|ref|YP_374922.1| ribose/galactose isomerase [Pelodictyon luteolum DSM 273] >gi|78166781|gb|ABB23879.1| ribose-5-phosphate isomerase [Pelodictyon luteolum DSM 273] (144 aa)
Score = 285, Expect = 2.3e-24, Identities = 60/142 (42%), Positives = 87/142 (61%)
  Q:    11 IKVYIGSDHGGFDMKEKI-----RNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           + + + SDH G + K+ I      + H         D+G Y+ D SVDYPDYA K+G ++   +   GI +CGTGIG+ I+ NKI GI AA   +   A LAR+HN+ N++  S RFT +    E +  +FS+ FE GRH++R+DKI
  S:     1 MNIAVASDHAGVEFKKDIVAWLESHGHAC------TDMGPYTED-SVDYPDYAHKVGHSVASGESDQGILLCGTGIGVSISANKIPGIRAALCCRPEFATLARQHNDANILCFSARFTDLASIHESLDNWFSADFEGGRHQRRVDKI 140
>gi|46908841|ref|YP_015230.1| ribose 5-phosphate isomerase B [Listeria monocytogenes str. 4b F2365] >gi|153197691|ref|ZP_01941918.1| ribose 5-phosphate isomerase B [Listeria monocytogenes 10403S] >gi|153204311|ref|ZP_01945108.1| ribose 5-phosphate isomerase B [Listeria monocytogenes HPB2262] >gi|168266872|ref|ZP_02688837.1| ribose 5-phosphate isomerase B [Listeria monocytogenes FSL J2-071] >gi|46882114|gb|AAT05407.1| ribose 5-phosphate isomerase B [Listeria monocytogenes str. 4b F2365] >gi|127632864|gb|EBA22298.1| ribose 5-phosphate isomerase B [Listeria monocytogenes 10403S] >gi|133734091|gb|EBA35789.1| ribose 5-phosphate isomerase B [Listeria monocytogenes HPB2262] (146 aa)
Score = 284, Expect = 2.5e-24, Identities = 64/148 (43%), Positives = 91/148 (61%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           +K+ IG DHGG  +K+ I   H   + ++ VD+GTY+ DESVD+P YAE++   ++  +   GI  CGTGIG+ IA NK+ GI AA V+ T  A   REHNN NV+ L  R       + ++  +  + F   RH++RLDKIT+LE K
  S:     1 MKLTIGCDHGGRRLKDAIVK-HLREKDIEVVDIGTYT-DESVDFPSYAEEVANQVVSGQSELGILCCGTGIGMSIAANKVDGIRAAVVSDTFSARATREHNNSNVLCLGERVIGEGLALLLVDTWLEASFAGDRHKRRLDKITELERK 146
>gi|159119546|ref|XP_001709991.1| Ribose 5-phosphate isomerase [Giardia lamblia ATCC 50803] >gi|157438109|gb|EDO82317.1| Ribose 5-phosphate isomerase [Giardia lamblia ATCC 50803] (145 aa)
Score = 284, Expect = 2.7e-24, Identities = 63/146 (43%), Positives = 88/146 (60%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLE 156
           +KV   SDHGG D++  ++         + +DLGT S D SVDYPD+A+   E +   +    I +CGTGIGI IA NK+KGI  A  +   +AE+AR+HNN N + L GR T  E    I+ +F S++FE GRH  R+ KI+ +E
  S:     1 MKVAFASDHGGRDLRMFLQQRASA-HGYEVMDLGTES-DASVDYPDFAKIGCEAVTSGRADCCILVCGTGIGISIAANKMKGIRCALCSTEYDAEMARKHNNANALALGGRTTGPEVAASILSRFLSTNFEGGRHAARIAKISAME 144
>gi|60681153|ref|YP_211297.1| putative ribose 5-phosphate isomerase [Bacteroides fragilis NCTC 9343] >gi|60492587|emb|CAH07359.1| putative ribose 5-phosphate isomerase [Bacteroides fragilis NCTC 9343] (144 aa)
Score = 284, Expect = 2.8e-24, Identities = 62/141 (43%), Positives = 87/141 (61%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           K+ I  DH GF++KE +R   E  +  ++ D GTYS D S DYPD+A  +   +   +   GI ICG+G GI + LNK +GI AA       A +AR HN+ NV+ + GR+ S E+   I+ +FFS+ FE GRH+KR+DKI
  S:     3 KIGICCDHAGFELKEYVRGWLEA-KGWEYKDFGTYSTD-SCDYPDFAHPLALAVEASECYPGIAICGSGNGISMTLNKHQGIRAALCWTAEIAHMARLHNDANVLVMPGRYISTEEADMIMTEFFSTEFEGGRHQKRIDKI 141
>gi|89210215|ref|ZP_01188607.1| Ribose/galactose isomerase:Ribose 5-phosphate isomerase B [Halothermothrix orenii H 168] >gi|89160288|gb|EAR79944.1| Ribose/galactose isomerase:Ribose 5-phosphate isomerase B [Halothermothrix orenii H 168] (322 aa)
Score = 284, Expect = 3.0e-24, Identities = 64/146 (43%), Positives = 95/146 (65%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEIL--DFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLE 156
           +K+ IGSDH G++MK++I    +LL+ L  D  D+GT S DESVDYPD+A K+   +   +   G+ +CGTGIG+ IA NK++G+ AA  +    A  AR HNN NV+ L  R   +    EI+K +  + F+  RHE+R++KIT++E
  S:   175 MKIAIGSDHAGYEMKQEII---KLLDELGYDVSDMGTDS-DESVDYPDFAYKVASGVASGEYDRGLLVCGTGIGMSIAANKVEGVRAALCHDVFSARAARNHNNANVLALGSRVIGIGLAKEIVKTWLEAGFDGDRHERRVNKITRIE 318
>gi|51891215|ref|YP_073906.1| ribose 5-phosphate isomerase [Symbiobacterium thermophilum IAM 14863] >gi|51854904|dbj|BAD39062.1| ribose 5-phosphate isomerase [Symbiobacterium thermophilum IAM 14863] (146 aa)
Score = 284, Expect = 3.0e-24, Identities = 61/146 (41%), Positives = 88/146 (60%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLE 156
           +KV + SDHGG D+K  + +  + L   +  DLGT+    S DYPDYA+K+ E +   +   G+ ICGTGIG+ IA NK+ G+ AA  N+   A +AR HN+ NV+ L  R        EI++ FF++  E GRH +R++KI  LE
  S:     1 MKVAVASDHGGIDLKATVISVLKSLGC-EVADLGTHD-RSSCDYPDYAQKVAEGVAAGEYQRGVLICGTGIGMSIAANKVAGVRAALCNEIYSARMARAHNDANVLCLGARVVGSGVAEEIVRAFFTTEHEGGRHARRVEKIRLLE 144
>gi|16801872|ref|NP_472140.1| hypothetical protein lin2811 [Listeria innocua Clip11262] >gi|16415347|emb|CAC98037.1| lin2811 [Listeria innocua] (146 aa)
Score = 283, Expect = 3.4e-24, Identities = 64/148 (43%), Positives = 90/148 (60%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           +K+ IG DHGG  +K+ I   H   + ++ VD+GTY+ DESVD+P YAE++   ++  +   GI  CGTGIG+ IA NK+ GI AA V+ T  A   REHNN NV+ L  R       + ++  +    F   RH++RLDKIT+LE K
  S:     1 MKLTIGCDHGGRRLKDAIVK-HLREKDIEVVDIGTYT-DESVDFPSYAEEVANQVVSGQADLGILCCGTGIGMSIAANKVDGIRAAVVSDTFSARATREHNNSNVLCLGERVIGEGLALLLVDTWLEGSFAGDRHKRRLDKITELERK 146
>gi|150008300|ref|YP_001303043.1| ribose 5-phosphate isomerase B [Parabacteroides distasonis ATCC 8503] >gi|149936724|gb|ABR43421.1| ribose 5-phosphate isomerase B [Parabacteroides distasonis ATCC 8503] (143 aa)
Score = 283, Expect = 3.6e-24, Identities = 63/136 (46%), Positives = 90/136 (66%)
  Q:    17 SDHGGFDMKEKIRNNHELLEILD-----FVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           SDH GF++KE I+       ILD     + D GTYS D S DYPD+A  +G+ +   +   GI +CGTG GI + LNK +G+ AA   +   A+LAREHN+ NV+++ GRF S E+  +I++ F  + FE GRH++R+DKI
  S:     8 SDHAGFELKEYIKT------ILDERGLSYKDFGTYSSD-SCDYPDFAHLMGKAVEAGEVYPGIAVCGTGNGISMTLNKHRGVRAALCWREDIAKLAREHNDANVLSMPGRFISKEEAKKIVEIFLDTPFEGGRHQRRIDKI 141
>gi|16804699|ref|NP_466184.1| hypothetical protein lmo2662 [Listeria monocytogenes EGD-e] >gi|47095466|ref|ZP_00233075.1| ribose 5-phosphate isomerase B [Listeria monocytogenes str. 1/2a F6854] >gi|153175969|ref|ZP_01931228.1| ribose 5-phosphate isomerase B [Listeria monocytogenes FSL N3-165] >gi|153180826|ref|ZP_01933822.1| ribose 5-phosphate isomerase B [Listeria monocytogenes F6900] >gi|153185578|ref|ZP_01936128.1| ribose 5-phosphate isomerase B [Listeria monocytogenes J0161] >gi|153192421|ref|ZP_01939413.1| ribose 5-phosphate isomerase B [Listeria monocytogenes J2818] >gi|167213277|ref|ZP_02283584.1| hypothetical protein LmonL_23728 [Listeria monocytogenes LO28] >gi|167405462|ref|ZP_02310218.1| hypothetical protein LmonocytFSL_21963 [Listeria monocytogenes FSL J2-003] >gi|16412162|emb|CAD00875.1| lmo2662 [Listeria monocytogenes] >gi|47016076|gb|EAL07000.1| ribose 5-phosphate isomerase B [Listeria monocytogenes str. 1/2a F6854] >gi|126941714|gb|EBA19593.1| ribose 5-phosphate isomerase B [Listeria monocytogenes J0161] >gi|127763925|gb|EBA24743.1| ribose 5-phosphate isomerase B [Listeria monocytogenes J2818] >gi|133728682|gb|EBA30380.1| ribose 5-phosphate isomerase B [Listeria monocytogenes FSL N3-165] >gi|133731773|gb|EBA33471.1| ribose 5-phosphate isomerase B [Listeria monocytogenes F6900] (146 aa)
Score = 283, Expect = 4.1e-24, Identities = 63/148 (42%), Positives = 91/148 (61%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           +K+ IG DHGG  +K+ I   H   + ++ VD+GTY+ DESVD+P YAE++   ++  +   GI  CGTGIG+ IA NK+ GI AA V+ T  A   REHNN N++ L  R       + ++  +  + F   RH++RLDKIT+LE K
  S:     1 MKLTIGCDHGGRRLKDAIVK-HLREKDIEVVDIGTYT-DESVDFPSYAEEVANQVVSGQSELGILCCGTGIGMSIAANKVDGIRAAVVSDTFSARATREHNNSNILCLGERVIGEGLALLLVDTWLEASFAGDRHKRRLDKITELERK 146
>gi|53712941|ref|YP_098933.1| ribose 5-phosphate isomerase B [Bacteroides fragilis YCH46] >gi|52215806|dbj|BAD48399.1| ribose 5-phosphate isomerase B [Bacteroides fragilis YCH46] (144 aa)
Score = 283, Expect = 4.2e-24, Identities = 62/141 (43%), Positives = 87/141 (61%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           K+ I  DH GF++KE +R   E  +  ++ D GTYS D S DYPD+A  +   +   +   GI ICG+G GI + LNK +GI AA       A +AR HN+ NV+ + GR+ S E+   I+ +FFS+ FE GRH+KR+DKI
  S:     3 KIGICCDHAGFELKEYVRGWLEA-KGWEYKDFGTYSTD-SCDYPDFAHPLALAVEAGECYPGIAICGSGNGISMTLNKHQGIRAALCWTAEIAHMARLHNDANVLVMPGRYISTEEADMIMTEFFSTEFEGGRHQKRIDKI 141
>gi|86159167|ref|YP_465952.1| ribose-5-phosphate isomerase [Anaeromyxobacter dehalogenans 2CP-C] >gi|85775678|gb|ABC82515.1| ribose-5-phosphate isomerase [Anaeromyxobacter dehalogenans 2CP-C] (147 aa)
Score = 282, Expect = 4.3e-24, Identities = 58/145 (40%), Positives = 87/145 (60%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLEI-----LDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLE 156
           +V  GSDH G  ++       E +++      D  DLG ++G ESVDYPDYA ++ E +   +   GI +CGTGIG+ I+ NK+ GI AA+     +A +AR HN+ NV+ +  R   +     ++K F  + FE GRH++R+DKI  LE
  S:     4 RVIAGSDHAGLHLRA------EAVKVARAAGFDVEDLGPFTG-ESVDYPDYARQVAEAVAAGRARLGILVCGTGIGMSISANKVHGIRAAHCVTEFDARMARAHNDANVLCMGERVLGLGVAAAVVKAFLETPFEGGRHQRRVDKIGALE 146
>gi|154149471|ref|YP_001406600.1| ribose 5-phosphate isomerase B [Campylobacter hominis ATCC BAA-381] >gi|153805480|gb|ABS52487.1| ribose 5-phosphate isomerase B [Campylobacter hominis ATCC BAA-381] (148 aa)
Score = 282, Expect = 4.4e-24, Identities = 59/145 (40%), Positives = 89/145 (61%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLE 156
           K++I SDH GFD K+  +     +   + +DLGT    +SVDYPD+A  + + + KD+ +YGI ICGTGIGI IA N+   I  A  +  + A+LAREHN+ N++   GR     +   IIK FF++ F  GRH +R+ K+ +++
  S:     5 KIFIASDHAGFDAKQIAKKTLNQMN-FEVIDLGTNDSQKSVDYPDFAYALSKEIAKDEKNYGILICGTGIGISIAANRNPKIRCALCHDALTAKLAREHNDANILAFGGRILGSAEIESIIKIFFNTEFLGGRHARRIAKLGEIK 148
>gi|78188871|ref|YP_379209.1| ribose/galactose isomerase [Chlorobium chlorochromatii CaD3] >gi|78171070|gb|ABB28166.1| ribose-5-phosphate isomerase [Chlorobium chlorochromatii CaD3] (150 aa)
Score = 282, Expect = 5.0e-24, Identities = 58/142 (40%), Positives = 88/142 (61%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           +K+ +GSDH GF+ K+ +    E     +  D+G ++ +ESVDYPDYA  +G  +       G+ +CGTGIG+ +A NKIKG+ AA       A LAR+HNN N++ +  RFT+ E   + +  +F + FE GRHE+R++KI
  S:     3 MKIAVGSDHAGFEFKKTVVAWLEA-HGYEVEDMGPHN-EESVDYPDYAHHVGRAVAGGHCDSGVLLCGTGIGVSVAANKIKGVRAALACNPEFATLARQHNNANILCMPARFTNRETIEQCLHNWFEASFEGGRHERRVNKI 142
>gi|58584455|ref|YP_198028.1| 3-demethylubiquinone-9 3-methyltransferase [Wolbachia endosymbiont strain TRS of Brugia malayi] >gi|58418771|gb|AAW70786.1| 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Wolbachia endosymbiont strain TRS of Brugia malayi] (402 aa)
Score = 280, Expect = 8.2e-24, Identities = 60/143 (41%), Positives = 90/143 (62%)
  Q:    13 VYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHF-ESGRHEKRLDKITKL 155
           + I SDH G+++K +I++  E L     +D G  +  + VDYPDYA KI E+++  K  YGI ICGTG+G+ I  N+ KGI+A   N     +LAREH N NV+ L  RFT+     +I+K+F  + F +  RH++RLDK++ +
  S:    16 ISIASDHAGYELKSEIKSYLETLGC-KVLDRGCTAEQKCVDYPDYAVKIAEDIINKKADYGILICGTGLGMSIVANRFKGIHAVLCNSVEITKLAREHGNANVLCLGARFTASGLAKDIVKQFLETEFSKESRHKRRLDKLSNI 158
>gi|154174574|ref|YP_001407936.1| ribose 5-phosphate isomerase B [Campylobacter curvus 525.92] >gi|112802134|gb|EAT99478.1| ribose 5-phosphate isomerase B [Campylobacter curvus 525.92] (149 aa)
Score = 280, Expect = 8.4e-24, Identities = 63/141 (44%), Positives = 86/141 (60%)
  Q:    12 KVYIGSDHGGFDMKEKIRN-----NHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           K++I SDH GF++K +++       HE+      +DLGT  G  SVDYPD+A  + +NL      YG+ ICGTGIGI IA N+ + I  A  +    A LAREHN+ NVI    R        E++K FFS+ F+ GRHE+R+ KI
  S:     5 KIFIASDHAGFELKNELKTILSNLGHEV------IDLGTNDGKTSVDYPDFAHSMAKNLASK--CYGVLICGTGIGISIAANRHQNIRCALCHDEFTARLAREHNDANVIAFGARVIGAGVAGEMLKVFFSTEFQGGRHERRVGKI 142
>gi|167456163|ref|ZP_02322383.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Anaeromyxobacter dehalogenans 2CP-1] >gi|167417771|gb|EDR84474.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Anaeromyxobacter dehalogenans 2CP-1] (147 aa)
Score = 280, Expect = 9.2e-24, Identities = 57/145 (39%), Positives = 88/145 (60%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLEI-----LDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLE 156
           +V  GSDH G +++       E +++      +  DLG +SG ESVDYPDYA ++ E +   +   GI +CGTGIG+ I+ NK+ G+ AA+     +A +AR HN+ NV+ +  R   +     ++K F  + FE GRH++R+DKI  LE
  S:     4 RVIAGSDHAGLNLRA------EAVKVARAAGFEVEDLGPFSG-ESVDYPDYARQVAEAVAAGRARLGILVCGTGIGMSISANKVHGVRAAHCVTEFDARMARAHNDANVLCIGERVLGLGLGAAVVKAFLETPFEGGRHQRRVDKIGALE 146
>gi|118580167|ref|YP_901417.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Pelobacter propionicus DSM 2379] >gi|118502877|gb|ABK99359.1| ribose-5-phosphate isomerase [Pelobacter propionicus DSM 2379] (148 aa)
Score = 279, Expect = 9.5e-24, Identities = 58/146 (39%), Positives = 86/146 (58%)
  Q:    13 VYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           + IGSDHGG D+K+ +   +     +   D+GT +GD SVDYP +  K+ E +       GI +CGTGIG+ IA NK+ GI AA         +A+EHNN N++ L GR    ++  +I+  +  + FE GRH+ RLD+I ++E K
  S:     2 IVIGSDHGGLDLKQAL-TRYLADRAIKVSDIGTDNGD-SVDYPRFGLKVAEMVASGSADRGILVCGTGIGMSIAANKVPGIRAALATDVFMGRMAKEHNNANILVLGGRVLDEQEACDIVGVWLDATFEGGRHQGRLDQIAEIEKK 145
>gi|154687807|ref|YP_001422968.1| ribose-5-phosphate isomerase B [Bacillus amyloliquefaciens FZB42] >gi|154353658|gb|ABS75737.1| YwlF [Bacillus amyloliquefaciens FZB42] (149 aa)
Score = 278, Expect = 1.6e-23, Identities = 61/148 (41%), Positives = 90/148 (60%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           +KV I SDHGG  ++E+I++  + L+I +++D+G   G  SVDY DYA  + E ++  +   GI ICGTGIG+ I+ NK+KGI  A  + T  A+  REHN+ NV+ +  R        EI K + ++ F  GRHE+R+ KI   E K
  S:     1 MKVAIASDHGGVHIREEIKSLLDELQI-EYIDMGCECGAGSVDYSDYAFPVAEKVVNGEADRGILICGTGIGMSISANKVKGIRCALAHDTFSAKATREHNDTNVLAMGERVIGPGLAREIAKVWLTTEFTGGRHERRIGKIADYEEK 147
>gi|195952747|ref|YP_002121037.1| ribose 5-phosphate isomerase B [Hydrogenobaculum sp. Y04AAS1] >gi|195932359|gb|ACG57059.1| ribose 5-phosphate isomerase B [Hydrogenobaculum sp. Y04AAS1] (148 aa)
Score = 277, Expect = 1.7e-23, Identities = 62/148 (41%), Positives = 92/148 (62%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           +++ IGSDH GFD+KE ++  H + +  + +D GT+S  ES DYP YA+++  ++   K   GI ICG+G+G+ I+ NKIKGI AA       A ++ + NN NV+ L GR   VE    I+  +F +HFE GRHE+RL  I+  E +
  S:     1 MRIAIGSDHAGFDLKEALKE-HIISKGHELIDCGTHS-KESTDYPLYAKEVALHIKNQKADRGILICGSGLGMSISANKIKGIRAALCLNEYMARMSVKDNNANVLCLGGRVIGVELAKSIVDAWFDAHFEGGRHERRLRIISSFEEE 146
>gi|37521257|ref|NP_924634.1| ribose 5-phosphate epimerase [Gloeobacter violaceus PCC 7421] >gi|35212253|dbj|BAC89629.1| ribose 5-phosphate epimerase [Gloeobacter violaceus PCC 7421] (154 aa)
Score = 277, Expect = 1.8e-23, Identities = 59/146 (40%), Positives = 90/146 (61%)
  Q:    11 IKVYIGSDHGGFDMKEKIRN---NHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLE 156
           +K+ IGSDHG +++KE+++     HE      F D+GTY+G E  DYP  A+ + E + + +   GI +CGTGIGI IA NK  GI AA  +    A ++REHN+ NV+ + GR    E   ++++ + S+ F   RH++RLD+I   E
  S:     1 MKLVIGSDHGAYELKEELKTWLGEHEYA----FEDVGTYNG-ERCDYPLVAQSVAEKIQRGEADRGILLCGTGIGISIAANKFDGIRAALAHDHYTARMSREHNDANVLAMGGRVLGPEVAKDVLETWLSTEFGGERHQRRLDQIQSFE 144
>gi|154492677|ref|ZP_02032303.1| hypothetical protein PARMER_02314 [Parabacteroides merdae ATCC 43184] >gi|154086982|gb|EDN86027.1| hypothetical protein PARMER_02314 [Parabacteroides merdae ATCC 43184] (143 aa)
Score = 277, Expect = 2.0e-23, Identities = 61/136 (44%), Positives = 86/136 (63%)
  Q:    17 SDHGGFDMKEKIRNNHELLEILD-----FVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           SDH G+++KE ++      +ILD     + D GT S  ES DYPDYA  + + +   +   GI ICG+G GI + LNK +GI AA   +   A LAREHNN N++ + GRF S E+    ++ F S+ FE GRH++R+DKI
  S:     8 SDHAGYELKEFVK------QILDSKGLAYKDFGTDS-TESCDYPDYAHPLAKAVEAGEVYPGIAICGSGNGIAMTLNKHQGIRAALCWQEEIARLAREHNNANILVMPGRFISQEEATHTVEAFLSTPFEGGRHQRRIDKI 141
>gi|147679160|ref|YP_001213375.1| ribose 5-phosphate isomerase RpiB [Pelotomaculum thermopropionicum SI] >gi|146275257|dbj|BAF61006.1| ribose 5-phosphate isomerase RpiB [Pelotomaculum thermopropionicum SI] (153 aa)
Score = 277, Expect = 2.0e-23, Identities = 60/148 (40%), Positives = 86/148 (58%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           +KV + SDHGGF +KE++      L I  + D GTYS D  VDYPD A  + E + K +   G+  CGTGIG+ I  NK+ GI AA  + T  A  AREHN+ N++T+  R        +I+  +  + F+ GRH +R+DKI  +E +
  S:     1 MKVAVASDHGGFRLKEEVIGLLRELGIA-YRDFGTYSED-PVDYPDMALAVAEAVRKGEYDRGVLCCGTGIGVAICANKVPGIRAALCHDTFSARAAREHNDANILTMGQRVIGPGLARDIVATWLQAEFQGGRHARRVDKIRCIEQE 146
>gi|58696984|ref|ZP_00372466.1| 3-demethylubiquinone-9 3-methyltransferase/sugar-phosphate isomerase family protein [Wolbachia endosymbiont of Drosophila simulans] >gi|58698677|ref|ZP_00373568.1| 3-demethylubiquinone-9 3-methyltransferase/sugar-phosphate isomerase family protein [Wolbachia endosymbiont of Drosophila ananassae] >gi|58534808|gb|EAL58916.1| 3-demethylubiquinone-9 3-methyltransferase/sugar-phosphate isomerase family protein [Wolbachia endosymbiont of Drosophila ananassae] >gi|58536770|gb|EAL60016.1| 3-demethylubiquinone-9 3-methyltransferase/sugar-phosphate isomerase family protein [Wolbachia endosymbiont of Drosophila simulans] (391 aa)
Score = 277, Expect = 2.1e-23, Identities = 63/143 (44%), Positives = 91/143 (63%)
  Q:    13 VYIGSDHGGFDMKEKIRNNHELLEILDF--VDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHF-ESGRHEKRLDKITKL 155
           V I SDH G+++K +I+     LE L +  VD G  +  + VDYPDYA K+ E++   K +YGI ICGTG+G+    N+ +GIYAA  N    A+LAREH N NV+ L   FT+     +I+K+F  + F +  RH+KRLDK++ +
  S:     5 VSIASDHSGYELKSEIK---PYLEALGYRVVDQGCTAQQKCVDYPDYAVKVVEDITSKKANYGILICGTGLGMSTVANRFEGIYAALCNSVEIAKLAREHGNANVLCLGAGFTASGLAKDIVKQFLETEFSKESRHKKRLDKLSNI 147
>gi|160946570|ref|ZP_02093773.1| hypothetical protein PEPMIC_00528 [Peptostreptococcus micros ATCC 33270] >gi|158446954|gb|EDP23949.1| hypothetical protein PEPMIC_00528 [Peptostreptococcus micros ATCC 33270] (143 aa)
Score = 276, Expect = 2.3e-23, Identities = 62/142 (43%), Positives = 93/142 (65%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILD-----FVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           +K+ IG+DH   +MK      +EL++ L+      +++GT  G ESVDYP + + + + +L++K S GI ICGTGIGI IA NK+KGI A   +++  A + R+HNN NV+ L  R T +E   +I+K F    FE GRH+KR+D +
  S:     1 MKIIIGNDHSAVEMK------NELVKFLEEMGHEVINVGT-DGTESVDYPLFGQAVCKKVLENKNSLGIAICGTGIGISIACNKVKGIRAGLCSESFSARMTRKHNNANVLCLGARVTGIELAKDIVKTFIEEDFEGGRHQKRIDML 140
>gi|153005594|ref|YP_001379919.1| ribose 5-phosphate isomerase B [Anaeromyxobacter sp. Fw109-5] >gi|152029167|gb|ABS26935.1| ribose 5-phosphate isomerase B [Anaeromyxobacter sp. Fw109-5] (147 aa)
Score = 276, Expect = 2.3e-23, Identities = 58/145 (40%), Positives = 86/145 (59%)
  Q:    12 KVYIGSDHGGFDMK-EKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLE 156
           +V  GSDH G  ++ E ++   E     +  D+G +SG ESVDYPDYA ++ E +   +   G+ +CGTGIG+ IA NK+KG  AA+     EA +AR HN+ NV+ +  R   +     I+K F  + FE GRHE+R+ K+  +E
  S:     4 RVIAGSDHAGLSLRAEAVKVARE--AGFEVEDVGPFSG-ESVDYPDYARQVAEAVASGRARLGLLVCGTGIGMSIAANKVKGARAAHCASEYEARMARLHNDANVLCIGERVVGLGLGAAIVKAFLETRFEGGRHERRVQKLKDME 146
>gi|31544344|ref|NP_852922.1| ribose-5-phosphate isomerase B [Mycoplasma gallisepticum R] >gi|31541188|gb|AAP56490.1| RpiB [Mycoplasma gallisepticum R] (159 aa)
Score = 276, Expect = 2.5e-23, Identities = 65/151 (43%), Positives = 96/151 (63%)
  Q:     8 LKKIKVYIGSDHGGFDMKEKIRN--NHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIG--ICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           + K K+   +DH G  +K+++ +    E     + +DLG+     + DYPD+A  + E+  KD+ +  IG  ICGTG+GICIA NKIK + A  V     AELA +H+N NV+ L  R TS++ N EI++KF S+ FE GRH++R+DKI+  E K
  S:     4 MDKRKIIFVADHTGVFLKQELISMLKTEYHNQYEVIDLGSDDEKSADDYPDFAFML-EDYFKDENTRNIGVAICGTGVGICIAANKIKNVRAGLVTDVQYAELAIQHDNCNVLVLGARTTSIDVNKEILRKFLSAQFEGGRHQRRVDKISNYEKK 157
>gi|29345756|ref|NP_809259.1| ribose 5-phosphate isomerase B [Bacteroides thetaiotaomicron VPI-5482] >gi|29337649|gb|AAO75453.1| ribose 5-phosphate isomerase B [Bacteroides thetaiotaomicron VPI-5482] (144 aa)
Score = 276, Expect = 2.5e-23, Identities = 60/138 (43%), Positives = 84/138 (60%)
  Q:    15 IGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           +  DH GF++KE +R   E+ +   + D GT S   SVDYPDYA  +   +   +   GI ICG+G GI + LNK +GI AA       A LAR+HN+ N++ + GRF S E+   I+ +FFS+ FE GRH+ R+DKI
  S:     6 LACDHAGFELKEYVRGWLEV-KGWAYKDFGTNSA-ASVDYPDYAHPLALAVESGECYPGIAICGSGNGINMTLNKHQGIRAALCWNAEIAHLARQHNDANILVMPGRFISTEEADMILTEFFSTQFEGGRHQNRIDKI 141
>gi|94987051|ref|YP_594984.1| ribose 5-phosphate isomerase RpiB [Lawsonia intracellularis PHE/MN1-00] >gi|94731300|emb|CAJ54663.1| Ribose 5-phosphate isomerase RpiB [Lawsonia intracellularis PHE/MN1-00] (142 aa)
Score = 275, Expect = 3.1e-23, Identities = 59/139 (42%), Positives = 85/139 (61%)
  Q:    11 IKVYIGSDHGGFDMK----EKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRL 149
           +KVYI SDH GF +K    E++++N  ++      DLG  +  E  DYP YA+ + E +L + GS+GI ICGTGIG+ +A N+IKGI AA      +A   R HNN N++ L  R       +EI+  F ++ FE GRH +R+
  S:     2 LKVYIASDHAGFSLKNTLIEQLQDNDYIVR-----DLGPMT-SEPCDYPLYAQYVCEQVLDEIGSFGILICGTGIGMSMAANRIKGIRAALCTSEFQARATRLHNNANILCLGERVIGKSIAIEIVNIFLTTPFEGGRHLQRI 138
>gi|85858032|ref|YP_460234.1| ribose 5-phosphate isomerase [Syntrophus aciditrophicus SB] >gi|85721123|gb|ABC76066.1| ribose 5-phosphate isomerase [Syntrophus aciditrophicus SB] (152 aa)
Score = 274, Expect = 3.6e-23, Identities = 64/147 (43%), Positives = 91/147 (61%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLEILDFV--DLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           K+ IG+DH GF +KE +++    LE   +V  D+GT S +E+VDYPD+ EK+   +     S GI +CG+G+G+ I  NK  GI AA    T  A L+R HN+ N++ L+GR T  E   +I+  +  + FE GRH  RLDKI  LEN+
  S:     4 KIIIGADHAGFQLKETVKS---FLEEKGWVVSDIGTDS-EEAVDYPDFGEKVAGAVSAGVFSRGILVCGSGVGMAIVANKFDGIRAAVCLDTETARLSRLHNDTNILILAGRRTLPETARQIVDVWLETPFEGGRHRGRLDKIRALENE 148
>gi|163767560|ref|ZP_02174571.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Anaeromyxobacter sp. K] >gi|196173088|gb|ACG74061.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Anaeromyxobacter sp. K] (147 aa)
Score = 274, Expect = 4.1e-23, Identities = 56/145 (38%), Positives = 87/145 (60%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLEI-----LDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLE 156
           +V  GSDH G +++       E +++      +  DLG +S  ESVDYPDYA ++ E +   +   GI +CGTGIG+ I+ NK+ G+ AA+     +A +AR HN+ NV+ +  R   +     ++K F  + FE GRH++R+DKI  LE
  S:     4 RVIAGSDHAGLNLRA------EAVKVARAAGFEVEDLGPFS-SESVDYPDYARQVAEAVAAGRARLGILVCGTGIGMSISANKVHGVRAAHCVTEFDARMARAHNDANVLCIGERVLGLGVAAAVVKAFLETPFEGGRHQRRVDKIGALE 146
>gi|162447075|ref|YP_001620207.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Acholeplasma laidlawii PG-8A] >gi|161985182|gb|ABX80831.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Acholeplasma laidlawii PG-8A] (146 aa)
Score = 274, Expect = 4.4e-23, Identities = 66/147 (44%), Positives = 95/147 (64%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEIL-----DFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLEN 157
           +K+ IG+DH GF+ K       E++E L     D VD G +S D  VDYPDYA+ + E ++  +   G+ +CGTGIG+ IA NK+KGI AA+V   + A LAREHN+ NVI   GR  +  ++  I+  + ++H ES RH+ R+DKI  +EN
  S:     1 MKIGIGADHAGFNRKT------EIIEYLTKKGYDVVDFGAHSVDR-VDYPDYAKTVSEAVVNKEVEVGLLVCGTGIGMSIAANKVKGIRAAHVFDELTARLAREHNHANVIAFGGRNQTTSESKIIVDAYLNAHEES-RHQHRVDKIAAIEN 144
>gi|16080745|ref|NP_391573.1| ribose-5-phosphate isomerase B [Bacillus subtilis subsp. subtilis str. 168] >gi|732387|sp|P39156|YWLF_BACSU Putative sugar phosphate isomerase ywlF >gi|556884|emb|CAA86108.1| Similar to Escherichia coli yjcA gene product [Bacillus subtilis] >gi|2636217|emb|CAB15709.1| ywlF [Bacillus subtilis subsp. subtilis str. 168] >gi|1095422|prf||2108403G ipc-32d gene (149 aa)
Score = 273, Expect = 4.9e-23, Identities = 59/148 (39%), Positives = 89/148 (60%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           +KV I SDHGG  ++ +I+   + L+I +++D+G   G  SVDYPDYA  + E ++  +   GI ICGTGIG+ I+ NK+KGI  A  + T  A+  REHN+ N++ +  R        EI K + ++ F  GRH+ R+ KI+  E K
  S:     1 MKVAIASDHGGVHIRNEIKELMDELQI-EYIDMGCDCGSGSVDYPDYAFPVAEKVVSGEVDRGILICGTGIGMSISANKVKGIRCALAHDTFSAKATREHNDTNILAMGERVIGPGLAREIAKIWLTTEFTGGRHQTRIGKISDYEEK 147
>gi|145619443|ref|ZP_01775492.1| sugar-phosphate isomerase, RpiB/LacA/LacB family protein [Geobacter bemidjiensis Bem] >gi|144944180|gb|EDJ79256.1| sugar-phosphate isomerase, RpiB/LacA/LacB family protein [Geobacter bemidjiensis Bem] >gi|197088834|gb|ACH40105.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Geobacter bemidjiensis Bem] (151 aa)
Score = 272, Expect = 6.4e-23, Identities = 58/146 (39%), Positives = 87/146 (59%)
  Q:    13 VYIGSDHGGFDMKEKIRNNHELLEI--LDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           + +GSDHGG ++K +I+N   LL+   +   DLGT++GD SVDYPD+   +   + +     GI +C TGIG+ I  NK  G+ AA       A +A+EHNN N++ L GR    E   E++  +  + F +GRH+ RLDKI  +E +
  S:     2 IVLGSDHGGLELKNEIKN---LLDQRGIPCEDLGTHNGD-SVDYPDFGVAVSRRVSEGSAEKGILVCSTGIGMSIVANKFPGVRAALATDVFMATMAKEHNNANILVLGGRVLKTELAREMVAAWLDTAFAAGRHQGRLDKIAAVERQ 145
>gi|42520230|ref|NP_966145.1| 3-demethylubiquinone-9 3-methyltransferase [Wolbachia endosymbiont of Drosophila melanogaster] >gi|42409968|gb|AAS14079.1| 3-demethylubiquinone-9 3-methyltransferase/sugar-phosphate isomerase family protein [Wolbachia endosymbiont of Drosophila melanogaster] (391 aa)
Score = 272, Expect = 6.4e-23, Identities = 62/143 (43%), Positives = 91/143 (63%)
  Q:    13 VYIGSDHGGFDMKEKIRNNHELLEILDF--VDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHF-ESGRHEKRLDKITKL 155
           V I SDH G+++K +I+     LE L +  VD G  +  + VDYP+YA K+ E++   K +YGI ICGTG+G+    N+ +GIYAA  N    A+LAREH N NV+ L   FT+     +I+K+F  + F +  RH+KRLDK++ +
  S:     5 VSIASDHAGYELKSEIK---PYLEALGYRVVDQGCTAKQKCVDYPNYAVKVVEDITSKKANYGILICGTGLGMSTVANRFEGIYAALCNSVEIAKLAREHGNANVLCLGAGFTASGLAKDIVKQFLETEFSKESRHKKRLDKLSNI 147
>gi|125975080|ref|YP_001038990.1| ribose-5-phosphate isomerase [Clostridium thermocellum ATCC 27405] >gi|196251796|ref|ZP_03150462.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Clostridium thermocellum DSM 4150] >gi|125715305|gb|ABN53797.1| ribose-5-phosphate isomerase [Clostridium thermocellum ATCC 27405] >gi|196198736|gb|EDX93567.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Clostridium thermocellum DSM 4150] (149 aa)
Score = 272, Expect = 7.8e-23, Identities = 60/148 (40%), Positives = 94/148 (63%)
  Q:    11 IKVYIGSDHGGFDMKEKIRN--NHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           +K+ IGSDHGG+++K +I +       E++DF   GT+ G+ESVDYPD+  K+ E +   +   GI ICGTG+GI IA NK+ GI AA    +  A ++REHN+ N++ L  R   ++  ++I+  +  + F+ GRH  R+ KI ++E K
  S:     1 MKIGIGSDHGGYNLKREIADFLKKRGYEVIDF---GTH-GNESVDYPDFGLKVAEAVKSGECDRGIVICGTGLGISIAANKVPGIRAAVCTNSYMARMSREHNDANILALGERVVGLDLALDIVDTWLKAEFQGGRHATRVGKIGEIEKK 146
>gi|149277471|ref|ZP_01883612.1| ribose 5-phosphate isomerase B [Pedobacter sp. BAL39] >gi|149231704|gb|EDM37082.1| ribose 5-phosphate isomerase B [Pedobacter sp. BAL39] (146 aa)
Score = 271, Expect = 1.0e-22, Identities = 62/144 (43%), Positives = 85/144 (59%)
  Q:    10 KIKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKIT 153
           K+K+ IG+DH GF+ KE I+      EI DF   GT+S D SVDYPD+A  + E +     ++GI +CG+  G+ I  NK + I AA       AELAR HN+ N+I +  RF S E   E+I  F ++ FE GRH  R+ KI+
  S:     6 KVKIAIGADHAGFEYKELIKEWFAEHEIKDF---GTFSAD-SVDYPDFAHPVAEAVESKAFTFGILVCGSANGVAITANKHQHIRAAICWLKEIAELARLHNDANIICIPARFVSPELAKEMINTFLTTAFEGGRHAGRVGKIS 145
>gi|117923486|ref|YP_864103.1| ribose-5-phosphate isomerase [Magnetococcus sp. MC-1] >gi|117607242|gb|ABK42697.1| ribose-5-phosphate isomerase [Magnetococcus sp. MC-1] (148 aa)
Score = 270, Expect = 1.1e-22, Identities = 55/142 (38%), Positives = 82/142 (57%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           ++++   DHG  ++K+ +       + ++ VDLG   G  SVDYPDYA  + + +L   G  G+ +CGTGIGI IA N+  GI AA  +    A L REHN+ NV+ L GR T      E++  +  + +  GRH++RLDKI
  S:     1 MRIFFACDHGASELKQHLMAYLAKRDRVELVDLGC-DGTTSVDYPDYAATLCKAVLASAGDRGVLLCGTGIGISIAANRFAGIRAALCHDAYTARLCREHNDANVLVLGGRTTGPAVAEEMLDLWLDTPYAGGRHQRRLDKI 141
>gi|145596026|ref|YP_001160323.1| ribose-5-phosphate isomerase B [Salinispora tropica CNB-440] >gi|145305363|gb|ABP55945.1| ribose 5-phosphate isomerase [Salinispora tropica CNB-440] (155 aa)
Score = 270, Expect = 1.1e-22, Identities = 57/146 (39%), Positives = 89/146 (60%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHF-ESGRHEKRLDKITKLE 156
           ++VY+GSDH GF++K  + N H   E  D +D+G ++ D   DYP +    G+ ++ D+GS G+ I G+G G  IA NKI G+ AA       A LAREHNN NV+ + GR  ++++   I++ F ++ F E  RH +R+D++   E
  S:     1 MRVYLGSDHAGFELKAHLAN-HLAKEGYDVIDVGPHAYDPDDDYPAFCLHTGDRVVADQGSLGVVIGGSGNGEQIAANKIDGVRAALAWSIDTAHLAREHNNANVVAVGGRQHTLDEATAIVEAFLTTPFSEKQRHVRRIDQVADYE 146
>gi|150015119|ref|YP_001307373.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Clostridium beijerinckii NCIMB 8052] >gi|149901584|gb|ABR32417.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Clostridium beijerinckii NCIMB 8052] (149 aa)
Score = 270, Expect = 1.1e-22, Identities = 62/151 (41%), Positives = 94/151 (62%)
  Q:     8 LKKIKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           +K++K+ +G DHGG ++K  I+  H + + ++  D GT S  ESV+YP+YA K+ + ++  +   GI  CGTGIG+ IA NK KGI AA V     A++ REHNN NV+ L  R T     + I+  + +S F+ GRH +RL  + ++ENK
  S:     1 MKRMKIALGCDHGGINLKGAIKK-HLISKNIEVEDFGTNS-SESVNYPEYAIKVSKAVISKECDLGILCCGTGIGMSIAANKHKGIRAAVVGDCFSAKMTREHNNTNVLCLGERVTGEGLALTIVDTWINSKFQGGRHSERLALVEEIENK 149
>gi|110599123|ref|ZP_01387364.1| sugar-phosphate isomerases, RpiB/LacA/LacB family:ribose 5-phosphate isomerase B [Geobacter sp. FRC-32] >gi|110550118|gb|EAT63303.1| sugar-phosphate isomerases, RpiB/LacA/LacB family:ribose 5-phosphate isomerase B [Geobacter sp. FRC-32] (148 aa)
Score = 269, Expect = 1.5e-22, Identities = 62/146 (42%), Positives = 89/146 (60%)
  Q:    13 VYIGSDHGGFDMKEKIRNNHELLEI-LDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           + +GSDHGG  +K +I+    LLE  + F D GT +GD SVDYPD+ EK+   + K +   GI +CGTGIG+ I  NK   + AA V  +  A +A+EHNN N++ L GR    +   E++  +  + FE GRH+ RLDKI  +E +
  S:     2 IALGSDHGGLALKVEIKK--LLLERGIPFEDCGTDNGD-SVDYPDFGEKVARKVSKGEVEKGILVCGTGIGMSIVANKFPHVRAAIVTDSFMARMAKEHNNANILVLGGRVLDNDGAREMVSTWLDAAFEGGRHQGRLDKIALIEKE 145
>gi|148323537|gb|EDK88787.1| ribose-5-phosphate isomerase [Fusobacterium nucleatum subsp. polymorphum ATCC 10953] (149 aa)
Score = 269, Expect = 1.8e-22, Identities = 57/142 (40%), Positives = 87/142 (61%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           +K+ +G+DH GF++KEKI+        ++ +D GT +  ESVDYP Y   +   ++  +  +GI +C TG+GI IA NKIKG+ AA    T  A+L REHN+ N++ L          ++I+  F S+ FE GRH+KR+D+I
  S:     1 MKIALGADHAGFELKEKIKEYLLKKGGIEVIDKGT-NNKESVDYPKYGHAVANAVVSKEVDFGILVCTTGVGISIAANKIKGVRAALCTDTTTAKLTREHNDANILALGSGIVGQFVALDIVDTFLSTSFEGGRHQKRVDQI 141
>gi|157694088|ref|YP_001488550.1| ribose-5-phosphate isomerase B [Bacillus pumilus SAFR-032] >gi|157682846|gb|ABV63990.1| ribose-5-phosphate isomerase B [Bacillus pumilus SAFR-032] (149 aa)
Score = 268, Expect = 1.9e-22, Identities = 59/148 (39%), Positives = 89/148 (60%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           +KV I SDHGG +++E+I+   + L+I +++D+G   G  SVDYPDYA  +   ++  +   GI ICGTGIG+ I+ NK+KGI  A  + T  A+  REHN+ NV+ +  R        EI   + ++ F +GRH  R+ KI + E K
  S:     1 MKVAIASDHGGTNIREEIKQLMDELKI-EYIDMGCECGSGSVDYPDYAFPVANMVVNGEVDRGILICGTGIGMSISANKVKGIRCALAHDTFSAKATREHNDTNVLAMGERVIGPGLAREIAHIWLTTEFTAGRHAVRIGKIAEYEEK 147
>gi|57241152|ref|ZP_00369099.1| sugar-phosphate isomerase [Campylobacter lari RM2100] >gi|57018073|gb|EAL54848.1| sugar-phosphate isomerase [Campylobacter lari RM2100] (145 aa)
Score = 268, Expect = 2.1e-22, Identities = 60/141 (42%), Positives = 86/141 (60%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           K+YI SDH GF +K++I N  +   I  F DLG +S D   DYPDYA  +   +  ++ S+GI +CG+GIG+ IA N+   I  A  N+ + A+L+REHN+ NV+ L  R T ++   EII  F ++ F  GRH  R+ KI
  S:     5 KIYIASDHAGFILKQEIINFLQEKNI-SFEDLGPFSNDR-CDYPDYAHLLSSKI--NETSFGILVCGSGIGMSIAANRHTNIRCALCNEPLSAKLSREHNDANVLALGSRLTGIDMAFEIINNFINTSFSGGRHCARISKI 141
>gi|152992257|ref|YP_001357978.1| ribose-5-phosphate isomerase B [Sulfurovum sp. NBC37-1] >gi|151424118|dbj|BAF71621.1| ribose 5-phosphate isomerase B [Sulfurovum sp. NBC37-1] (153 aa)
Score = 267, Expect = 2.8e-22, Identities = 62/141 (43%), Positives = 86/141 (60%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLEIL--DFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           K YI +DH G+ +K  ++   EL+  L  + +DLG  S D  VDYPD+A+K  E ++ + GS+GI ICGTGIG+ IA NK+ GI AA  +    A+L R+HN+ NV+    R        +II  F S+ FE GRH  R+ KI
  S:     4 KFYIATDHAGYAVKAYVK---ELVTNLGHEIIDLGPDSADR-VDYPDFAKKCTEAVIANPGSFGILICGTGIGMSIAANKVSGIRAALCHDHYTAQLTRQHNDANVLCFGERVVGKGVIEDIIDAFASTEFEGGRHATRIGKI 142
>gi|47459205|ref|YP_016067.1| ribose-5-phosphate isomerase B [Mycoplasma mobile 163K] >gi|47458534|gb|AAT27856.1| ribose 5-phosphate isomerase [Mycoplasma mobile 163K] (148 aa)
Score = 267, Expect = 2.8e-22, Identities = 59/151 (39%), Positives = 98/151 (64%)
  Q:     8 LKKIKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           +KK K  + SDH G+ +KE+I+  + + + L + DLGT S  ESV Y ++ +K+G+ + ++   YGIGICGTG+G+  A+N+ K +  A ++   +A LA++HNN NV+   GR   +ED  ++I +F ++ FE GRH   LD+I  L+++
  S:     1 MKKSKFILASDHAGYKLKEEIKK-YLIEKGLPYTDLGTNSETESVSYSEFGKKLGKYVHENPNDYGIGICGTGLGMSYAVNRFKNVRGARIHSVEDAHLAKQHNNANVLIFGGRQQKIEDIKKMIDEFINTEFEKGRH---LDRIKDLDDE 147
>gi|160883733|ref|ZP_02064736.1| hypothetical protein BACOVA_01705 [Bacteroides ovatus ATCC 8483] >gi|156110818|gb|EDO12563.1| hypothetical protein BACOVA_01705 [Bacteroides ovatus ATCC 8483] (144 aa)
Score = 267, Expect = 2.9e-22, Identities = 59/138 (42%), Positives = 83/138 (60%)
  Q:    15 IGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           +  DH GF++KE +R   E  +   + D GT S   SVDYPDYA  +   +   +   GI ICG+G GI + LNK +G+ AA       A LAR+HN+ NV+ + GRF S E+   I+ +FFS+ F+ GRH+ R+DKI
  S:     6 LACDHAGFELKEYVRGWLEA-KGWAYKDFGTNS-TASVDYPDYAHPLALAVESGECYPGIAICGSGNGINMTLNKHQGVRAALCWNAEIAHLARQHNDANVLVMPGRFISTEEADMILTEFFSTKFDGGRHQNRIDKI 141
>gi|160902694|ref|YP_001568275.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Petrotoga mobilis SJ95] >gi|160360338|gb|ABX31952.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Petrotoga mobilis SJ95] (144 aa)
Score = 267, Expect = 2.9e-22, Identities = 68/146 (46%), Positives = 104/146 (71%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLE 156
           +K+ I SDH G++MKE+++ N+ L +  + +DLGT S + SVDYPDYA+K+GE + K +  +GIGICGTGIG+ IA+NK+KG+  A       AE AR+HN+ NV+ L+GR   ++  +  + KF S+ FE GRH++R+DKI +++
  S:     1 MKIAIASDHAGYEMKEQLK-NYLLEKKFNIIDLGTNS-NASVDYPDYAKKLGEKVTKGEADFGIGICGTGIGMSIAVNKVKGVRGALCLYPSMAEYARKHNDANVLVLAGRLMGIDLAIWTVVKFLSTDFEGGRHKRRVDKIDEIK 144
>gi|153173351|ref|ZP_01929131.1| ribose 5-phosphate isomerase B [Listeria monocytogenes FSL N3-165] >gi|133731059|gb|EBA32757.1| ribose 5-phosphate isomerase B [Listeria monocytogenes FSL N3-165] (149 aa)
Score = 267, Expect = 2.9e-22, Identities = 62/148 (41%), Positives = 88/148 (59%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           +++ I +DHGGF +KEKIR  H +       D G YS  ESVD+P+YA K+G + +  + S G+  CGTGIG+ +A NKIKG+ AA V+    A + R HNN NV+ L  R       + ++  +  + FE GRH  RL K+ KLE +
  S:     1 MEIAIAADHGGFQLKEKIRA-HLIESGYTVKDFGCYS-LESVDFPEYAAKVG-HFVATENSLGVLCCGTGIGMSMAANKIKGVRAAVVSDAFSAMMTRRHNNSNVLCLGERVLGDSLALLLLDTWLVAEFEGGRHNTRLQKLAKLEER 145
>gi|149194498|ref|ZP_01871594.1| ribose-5-phosphate isomerase B [Caminibacter mediatlanticus TB-2] >gi|149135242|gb|EDM23722.1| ribose-5-phosphate isomerase B [Caminibacter mediatlanticus TB-2] (142 aa)
Score = 266, Expect = 3.1e-22, Identities = 60/142 (42%), Positives = 92/142 (64%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           +K +IG+DH GF++K+ + +  +   I +  DLG YS  ESVDYPD A K+   +L+++GS GI ICG+GIG+ +A NK KGI AA  +    A +AR+HNN N++    R     +   I++ + +S FE GRH++R++KI
  S:     1 MKYFIGTDHAGFEVKDFVIDYLQKKGI-EVEDLGCYS-TESVDYPDLAHKVANAVLENEGSKGILICGSGIGMSLAANKHKGIRAALCHDYYTASMARKHNNANILCFGARIVGKGEIESILEGWLNSEFEGGRHQRRVEKI 140
>gi|116748815|ref|YP_845502.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Syntrophobacter fumaroxidans MPOB] >gi|116697879|gb|ABK17067.1| ribose-5-phosphate isomerase [Syntrophobacter fumaroxidans MPOB] (146 aa)
Score = 266, Expect = 3.4e-22, Identities = 56/145 (38%), Positives = 90/145 (62%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKL 155
           +K+ +G DHGGF++KEKI  +   L   + VD GT S  ESVDYP YA K+   + + +   GI +CG+GIG+ +  N++ GI A    +   A ++R HN+ NV+ + GRFT ++  ++I+  +    FE GRH++R++ I +L
  S:     1 MKIMVGCDHGGFELKEKIVAHLGTLG-HEVVDAGTNS-LESVDYPHYAMKVARAVARGEADRGILVCGSGIGMNMTANRVSGIRAVLAYEPYGAIMSRRHNDSNVLCMGGRFTGLDMALQIVDVWLREPFEGGRHQRRIELIDRL 143
>gi|153808012|ref|ZP_01960680.1| hypothetical protein BACCAC_02298 [Bacteroides caccae ATCC 43185] >gi|149129621|gb|EDM20835.1| hypothetical protein BACCAC_02298 [Bacteroides caccae ATCC 43185] (144 aa)
Score = 266, Expect = 3.9e-22, Identities = 58/138 (42%), Positives = 83/138 (60%)
  Q:    15 IGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           +  DH GF++KE +R   E  +   + D GT S   SVDYPDYA  +   +   +   GI ICG+G GI + LNK +G+ AA       A LAR+HN+ N++ + GRF S E+   I+ +FFS+ FE GRH+ R++KI
  S:     6 LACDHAGFELKEYVRGWLEA-KGWAYKDFGTNS-TASVDYPDYAHPLALAVESGECYPGIAICGSGNGINMTLNKHQGVRAALCWNAEIAHLARQHNDANILVMPGRFISTEEADMILTEFFSTQFEGGRHQNRINKI 141
>gi|52082223|ref|YP_081014.1| ribose-5-phosphate isomerase B [Bacillus licheniformis ATCC 14580] >gi|52787615|ref|YP_093444.1| ribose-5-phosphate isomerase B [Bacillus licheniformis ATCC 14580] >gi|52005434|gb|AAU25376.1| Ribose/galactose isomerase [Bacillus licheniformis ATCC 14580] >gi|52350117|gb|AAU42751.1| YwlF [Bacillus licheniformis DSM 13] (149 aa)
Score = 265, Expect = 4.0e-22, Identities = 59/148 (39%), Positives = 87/148 (58%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           +KV I SDHGG +++++I    + L I ++ D G   G  SVDYPDYA  + + +   +   GI ICGTGIG+ I+ NK+KGI  A V+    A++ REHN+ NV+ +  R        EI K + ++ F +GRH  R+ KI   E+K
  S:     1 MKVIIASDHGGINIRKEIMALMDELNI-EYEDYGCECGSGSVDYPDYAFPVAQKVANGEADRGILICGTGIGMSISANKVKGIRCALVHDVFSAKMTREHNDTNVLAMGERVIGPGLAREIAKVWLTTEFSAGRHAVRIGKIADYEDK 147
>gi|34764832|ref|ZP_00145210.1| Ribose 5-phosphate isomerase [Fusobacterium nucleatum subsp. vincentii ATCC 49256] >gi|27885826|gb|EAA23192.1| Ribose 5-phosphate isomerase [Fusobacterium nucleatum subsp. vincentii ATCC 49256] (149 aa)
Score = 265, Expect = 5.1e-22, Identities = 57/142 (40%), Positives = 86/142 (60%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           +K+ +G+DH GF++KEKI+        ++ +D GT S  ESVDYP Y   +   ++  +  +GI +C TG+GI IA NKIKG+ AA    T  A+L REHN+ N++ L          ++I+  F S+ FE GRH+ R+D+I
  S:     1 MKIALGADHAGFELKEKIKEYLLKKGGIEIIDKGTNS-KESVDYPKYGHAVANAVVSKEVDFGILVCTTGVGISIAANKIKGVRAALCTDTTTAKLTREHNDANILALGSGIVGQFVALDIVDTFLSTAFEGGRHKTRVDQI 141
>gi|57241939|ref|ZP_00369879.1| sugar-phosphate isomerase [Campylobacter upsaliensis RM3195] >gi|57017131|gb|EAL53912.1| sugar-phosphate isomerase [Campylobacter upsaliensis RM3195] (144 aa)
Score = 264, Expect = 5.2e-22, Identities = 58/141 (41%), Positives = 91/141 (64%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           ++YI SDH G+++K K+    + ++I  F+DLGT + ++S DY D+A  +   +  D+ S+GI ICG+GIGI IA N+ K I  A  N+++ A LAR+HN+ NV+   GR    +  V++I+ F  + F+ GRH KR+ KI
  S:     5 RLYIASDHAGYELKTKLCAFFKEVQI-PFIDLGT-NDEKSCDYSDFAHLLTSKI--DEKSFGILICGSGIGISIAANRHKNIRCALCNESLSARLARKHNDANVLAFGGRLVGFDLAVDMIENFIKTPFDEGRHMKRIQKI 141
>gi|159897020|ref|YP_001543267.1| ribose-5-phosphate isomerase B [Herpetosiphon aurantiacus ATCC 23779] >gi|159890059|gb|ABX03139.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Herpetosiphon aurantiacus ATCC 23779] (149 aa)
Score = 264, Expect = 5.4e-22, Identities = 59/148 (39%), Positives = 90/148 (60%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELL--EILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFES-GRHEKRLDKITKLENK 158
           +K+ +G+DHGG  +K+ +    + L  E+LDF   GT S   SVDYPD+A  +G  ++  +   GI ICG+G+G+ +A NKIKG+ A   + T  A    EH+++NV+ L GR        EI++ F S+ F +  R  +RLDK+  LEN+
  S:     3 MKIAVGTDHGGLILKQAVIEEVQRLGHEVLDF---GTDS-PASVDYPDFAAAVGNAVVSGQAERGIAICGSGVGVTVAANKIKGVRACLCHDTYSAHQGVEHDDLNVLCLGGRVIGPALAGEIVQAFLSATFHNEARFTRRLDKVIALENQ 149
>gi|147669260|ref|YP_001214078.1| ribose-5-phosphate isomerase B [Dehalococcoides sp. BAV1] >gi|146270208|gb|ABQ17200.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Dehalococcoides sp. BAV1] (152 aa)
Score = 264, Expect = 5.5e-22, Identities = 61/151 (40%), Positives = 90/151 (59%)
  Q:     8 LKKIKVYIGSDHGGFDMKEKIRN--NHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFE-SGRHEKRLDKITKLENK 158
           +  I + IG+DHGG+D+K  I    NH  L++LD   LG  + + S DYPD+A+ +  N+   K   GI ICG+G+G CI  NKIKGI A   +    A    EH+++NV+ L  R   +E   EII  F ++ F    RH++RL+K+ K+E +
  S:     1 MSNISIAIGADHGGYDLKTDILPFLNHLGLKVLD---LGACTYNSSDDYPDFAQTVARNVACGKTDRGIIICGSGVGACITANKIKGIRAGLCHDVYSAHQGVEHDDMNVLCLGARVIGIEVAKEIISAFLNARFTGEERHKRRLEKLLKVEKE 151
>gi|167403604|ref|ZP_02308429.1| hypothetical protein LmonocytFSL_03441 [Listeria monocytogenes FSL J2-003] (149 aa)
Score = 264, Expect = 5.7e-22, Identities = 61/148 (41%), Positives = 88/148 (59%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           +++ I +DHGGF +KEKIR  H +       D G YS  ESVD+P+YA K+G + +  + S G+  CGTGIG+ +A NKIKG+ AA V+    A + R HNN NV+ L  R       + ++  +  + FE GRH  RL+K+  LE +
  S:     1 MEIAIAADHGGFQLKEKIRA-HLIESGYTVKDFGCYS-LESVDFPEYAAKVG-HFVATENSLGVLCCGTGIGMSMAANKIKGVRAAVVSDAFSAMMTRRHNNSNVLCLGERVLGDSLALLLLDTWLVAEFEGGRHNTRLEKLAALEEQ 145
>gi|148377379|ref|YP_001256255.1| ribose-5-phosphate isomerase B [Mycoplasma agalactiae PG2] >gi|148291425|emb|CAL58809.1| Ribose-5-phosphate isomerase [Mycoplasma agalactiae PG2] (148 aa)
Score = 264, Expect = 5.9e-22, Identities = 61/148 (41%), Positives = 92/148 (62%)
  Q:     8 LKKIKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKG-SYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKL 155
           +KK KV + SDHGG D+K +I++    L   + VDLG     +S+ Y +   K+   LL +K  S+GIG+CGTG+GI  ALN+  GI AA V    +A LA+ HNN NV+ + GR  ++E    +I ++ ++ +E GRH+ R+D+I K 
  S:     1 MKKGKVVLASDHGGCDLKNEIKDYVSNLG-YETVDLGPEDSSKSISYAEQGHKLANYLLDNKDVSFGIGLCGTGLGISYALNRHNGIRAARVTSVEDANLAKLHNNANVLVMGGRQVNIEQAKAMIDEYINTAYEGGRHQARIDQIDKF 148
>gi|163793210|ref|ZP_02187186.1| sugar-phosphate isomerase, RpiB/LacA/LacB family protein [alpha proteobacterium BAL199] >gi|159181856|gb|EDP66368.1| sugar-phosphate isomerase, RpiB/LacA/LacB family protein [alpha proteobacterium BAL199] (153 aa)
Score = 264, Expect = 6.3e-22, Identities = 56/140 (40%), Positives = 78/140 (55%)
  Q:    13 VYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           + + SDH G  +K  + +  + L  +  VDLGT+SG  SVDYPDY  +I   L   K   G+ ICG+GIGICIA N+   + A N +    A L+REHN+ NVI    R   VE   E ++ F  + F   RH  R++K+
  S:     6 IALASDHAGLALKTTLIDELKRLGHV-VVDLGTHSG-ASVDYPDYGYRIAAALADGKADRGVAICGSGIGICIAANRFAWVRAVNCHDVTSARLSREHNDANVIAFGERVIGVEVAKEALRVFLQTPFAGDRHVARVNKL 143
>gi|29726866|pdb|1O1X|A Chain A, Crystal Structure Of Ribose-5-Phosphate Isomerase Rpib (Tm1080) From Thermotoga Maritima At 1.90 A Resolution (155 aa)
Score = 264, Expect = 6.3e-22, Identities = 63/145 (43%), Positives = 95/145 (65%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKL 155
           +K+ I SDH  F++KEK++N + L + ++  D GTYS +ESVDYPDYA+K+ +++L ++  +GI + GTG+G  IA N+ +GI AA       A LAR HNN N++ L GR    E    I+  F S+ F+ GRHE+R+ KI ++
  S:    13 VKIAIASDHAAFELKEKVKN-YLLGKGIEVEDHGTYS-EESVDYPDYAKKVVQSILSNEADFGILLXGTGLGXSIAANRYRGIRAALCLFPDXARLARSHNNANILVLPGRLIGAELAFWIVDTFLSTPFDGGRHERRIRKIDEV 155
>gi|166031409|ref|ZP_02234238.1| hypothetical protein DORFOR_01098 [Dorea formicigenerans ATCC 27755] >gi|166028814|gb|EDR47571.1| hypothetical protein DORFOR_01098 [Dorea formicigenerans ATCC 27755] (154 aa)
Score = 264, Expect = 6.7e-22, Identities = 60/148 (40%), Positives = 91/148 (61%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEI--LDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           +K+ IG+DH   DMK ++    E LE    + V+ GT +  ES +YP+Y EK+G  +       GI ICGTG+GI +A NK+KG+ A   ++   A+L+R+HNN N++    R   +E    II ++ ++ FE GRH+ R+D IT +ENK
  S:     9 MKIGIGNDHAAVDMKNQVV---EYLEGKGYEVVNFGTDTY-ESCNYPEYGEKVGRAVAAGDVDLGILICGTGVGISLAANKVKGVRAVVCSEPYSAKLSRQHNNTNILAFGARVIGIELAKMIIDEWLNAEFEGGRHQTRVDMITAIENK 154
>gi|56965623|ref|YP_177357.1| ribose-5-phosphate isomerase B [Bacillus clausii KSM-K16] >gi|56911869|dbj|BAD66396.1| ribose 5-phosphate isomerase B [Bacillus clausii KSM-K16] (149 aa)
Score = 264, Expect = 6.8e-22, Identities = 61/148 (41%), Positives = 85/148 (57%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           +K+ I SDHGG  ++ +I    E +  L + D G    + SVDYPDYA  + E + + +   GI ICGTGIG+ IA NK+KGI  A V+ T  A+  R+HN+ N+I L  R       VEI++ +    FE GRH+ R+ KI   E K
  S:     1 MKIAIASDHGGTRLRAEITAMLEEMG-LSYKDFGC-DCEGSVDYPDYALPVAEKVAQGEFDRGILICGTGIGMSIAANKVKGIRCALVHDTFSAKATRQHNDTNMIALGERVIGPGLAVEIVQTWLGEAFEGGRHQTRIGKIAAYEEK 146
>gi|50843092|ref|YP_056319.1| ribose-5-phosphate isomerase B [Propionibacterium acnes KPA171202] >gi|50840694|gb|AAT83361.1| sugar isomerase [Propionibacterium acnes KPA171202] (157 aa)
Score = 263, Expect = 7.2e-22, Identities = 62/151 (41%), Positives = 89/151 (58%)
  Q:     8 LKKIKVYIGSDHGGFDMKEKIRNNHELLEI-LDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFE-SGRHEKRLDKITKLENK 158
            K   V+IG+DH  F++KE +    +L E     VD G  S D   DYPDY     + ++ D GS GI + G+G G  IA NK+KGI AA       AELAR HNN NV++L GR  + E+  +I++ F ++ F    RH++R+DK+ + E+K
  S:     3 FKPSHVHIGTDHAAFELKEYLVG--KLTEAGYQVVDHGAASYDSQDDYPDYCIPCAQAVMADPGSLGIVLGGSGNGEQIAANKVKGIRAALAYTVEIAELARLHNNANVVSLGGRMQTQEEAWQIVETFLTTDFSPEDRHQRRIDKLIRWEDK 153
>gi|164688898|ref|ZP_02212926.1| hypothetical protein CLOBAR_02546 [Clostridium bartlettii DSM 16795] >gi|164602102|gb|EDQ95567.1| hypothetical protein CLOBAR_02546 [Clostridium bartlettii DSM 16795] (150 aa)
Score = 263, Expect = 7.8e-22, Identities = 55/148 (37%), Positives = 96/148 (64%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           +K+ +G DHGG+++K +I+  +   + ++ VD GT +  ESVDYP Y +K+ E ++  +  YGI  CGTGIGI +A NK+ GI  A V+ T  A++++ HNN N+++L  R       +EI++ + ++ FE  RH +R++ ++++E K
  S:     1 MKIGLGCDHGGYNLKLEIKK-YLGTKGIECVDFGTNNDTESVDYPIYGQKVAEAVVAKEVDYGIVCCGTGIGISLAANKVPGIRCAVVSDTFSAKMSKAHNNANMLSLGERVLGKGLALEIVEAWLNTEFEGDRHLRRVNLLSEIEKK 147
>gi|46579991|ref|YP_010799.1| ribose 5-phosphate isomerase, putative [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] >gi|120602597|ref|YP_966997.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Desulfovibrio vulgaris subsp. vulgaris DP4] >gi|46449407|gb|AAS96058.1| ribose 5-phosphate isomerase, putative [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] >gi|120562826|gb|ABM28570.1| ribose-5-phosphate isomerase [Desulfovibrio vulgaris subsp. vulgaris DP4] (147 aa)
Score = 263, Expect = 7.9e-22, Identities = 60/139 (43%), Positives = 83/139 (59%)
  Q:    12 KVYIGSDHGGFDMKEKI----RNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLD 150
           KV++GSDH GF +K+ I    RN        D  DLG  S   S DYP YA+K+ + +L ++ + GI ICGTGIG+ +A N+I GI AA       A   R+HNN NV+ L  R T     +E+ + F  + FE GRH++R+D
  S:     4 KVFVGSDHAGFALKQSIVDSLRNAGH-----DVEDLGPESA-VSCDYPHYAQKVCDRVLAEE-ALGILICGTGIGMSMAANRIPGIRAALCTCEFHARATRQHNNANVLCLGERVTGPGVALELARLFLDTDFEGGRHQRRID 139
>gi|16802541|ref|NP_464026.1| hypothetical protein lmo0498 [Listeria monocytogenes EGD-e] >gi|47094724|ref|ZP_00232339.1| ribose 5-phosphate isomerase B [Listeria monocytogenes str. 1/2a F6854] >gi|153186319|ref|ZP_01936660.1| ribose 5-phosphate isomerase B [Listeria monocytogenes J0161] >gi|153189859|ref|ZP_01937334.1| ribose 5-phosphate isomerase B [Listeria monocytogenes J2818] >gi|153195132|ref|ZP_01939930.1| ribose 5-phosphate isomerase B [Listeria monocytogenes 10403S] >gi|167052669|ref|ZP_02279067.1| hypothetical protein LmonF_05381 [Listeria monocytogenes FSL F2-515] >gi|16409874|emb|CAC98577.1| lmo0498 [Listeria monocytogenes] >gi|47016864|gb|EAL07782.1| ribose 5-phosphate isomerase B [Listeria monocytogenes str. 1/2a F6854] >gi|126941201|gb|EBA19094.1| ribose 5-phosphate isomerase B [Listeria monocytogenes J0161] >gi|127634735|gb|EBA24115.1| ribose 5-phosphate isomerase B [Listeria monocytogenes 10403S] >gi|127766507|gb|EBA26844.1| ribose 5-phosphate isomerase B [Listeria monocytogenes J2818] (149 aa)
Score = 263, Expect = 8.1e-22, Identities = 61/148 (41%), Positives = 88/148 (59%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           +++ I +DHGGF +KEKIR  H +       D G YS  ESVD+P+YA K+G + +  + S G+  CGTGIG+ +A NKIKG+ AA V+    A + R HNN NV+ L  R       + ++  +  + FE GRH  RL K+ +LE +
  S:     1 MEIAIAADHGGFQLKEKIRA-HLIESGYTVKDFGCYS-LESVDFPEYAAKVG-HFVATENSLGVLCCGTGIGMSMAANKIKGVRAAVVSDAFSAMMTRRHNNSNVLCLGERVLGDSLALLLLDTWLVAEFEGGRHNTRLQKLAELEER 145
>gi|124523801|ref|ZP_01697713.1| sugar-phosphate isomerases, RpiB/LacA/LacB family [Bacillus coagulans 36D1] >gi|124495327|gb|EAY43046.1| sugar-phosphate isomerases, RpiB/LacA/LacB family [Bacillus coagulans 36D1] (146 aa)
Score = 263, Expect = 8.6e-22, Identities = 59/148 (39%), Positives = 87/148 (58%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           +KV + SDHGG  +K++I    + L +  + D G    + SVDYPDYA  + E + K +    I ICGTGIG+CI+ NK+KGI  A V+    A+  R HN+ NV+ +  R        EI+K++  + FE GRH +R++KI + E K
  S:     1 MKVALASDHGGKHLKQEIAGLLQDLGVA-YEDFGC-DCEGSVDYPDYALPVAEKVAKGEFDRAILICGTGIGMCISANKVKGIRCALVHDVFSAKATRAHNDSNVLAMGERVIGPGLACEIVKEWLGTPFEGGRHARRIEKIAQYEQK 146
>gi|152977504|ref|YP_001377021.1| ribose-5-phosphate isomerase B [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|152026256|gb|ABS24026.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Bacillus cereus subsp. cytotoxis NVH 391-98] (147 aa)
Score = 262, Expect = 9.2e-22, Identities = 61/148 (41%), Positives = 87/148 (58%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           +KV + SDHGG +++++I N  E L I +++DLG      SVDYPD+A    E + K +   GI ICGTGIG+ IA NK+ GI  A V+ T  A   REHN+ N++ +  R        +I K + ++ +E GRHE R+ KI   E K
  S:     1 MKVVVASDHGGINIRKEIVNLLEELNI-EYIDLGCECEAGSVDYPDFAFPAAEMVAKGEVDRGILICGTGIGMSIAANKVHGIRCALVHDTFSARATREHNDSNMLAMGERVIGAGLARDIAKIWLTTDYEGGRHENRVGKIKTYEEK 147
>gi|126653454|ref|ZP_01725550.1| ribose-5-phosphate isomerase B [Bacillus sp. B14905] >gi|126589810|gb|EAZ83943.1| ribose-5-phosphate isomerase B [Bacillus sp. B14905] (145 aa)
Score = 262, Expect = 1.0e-21, Identities = 59/146 (40%), Positives = 87/146 (59%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLE 156
           +++ I SDHGG +++ +I    + L I  + D G  S D SVDYPDYA+ + + +   K   GI ICGTGIG+ IA NK+ GI  A V+    A+  R HN+ NV+ +  R        EI++ +  + FE GRH +R++KIT+LE
  S:     1 MRIAISSDHGGNNLRREIMQLLDELHI-SYEDFGPQSAD-SVDYPDYAKPVSDGVANGKFDKGILICGTGIGMSIAANKVNGIRCALVHDVFSAKATRCHNDSNVLAMGERVIGPGLAREIVQTWLETEFEGGRHTRRIEKITELE 144
>gi|73748479|ref|YP_307718.1| ribose-5-phosphate isomerase B [Dehalococcoides sp. CBDB1] >gi|73660195|emb|CAI82802.1| putative ribose-5-phosphate isomerase [Dehalococcoides sp. CBDB1] (152 aa)
Score = 262, Expect = 1.1e-21, Identities = 60/151 (39%), Positives = 90/151 (59%)
  Q:     8 LKKIKVYIGSDHGGFDMKEKIRN--NHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFE-SGRHEKRLDKITKLENK 158
           +  I + IG+DHGG+D+K  I    NH  L++LD   LG  + + + DYPD+A+ +  N+   K   GI ICG+G+G CI  NKIKGI A   +    A    EH+++NV+ L  R   +E   EII  F ++ F    RH++RL+K+ K+E +
  S:     1 MSNISIAIGADHGGYDLKTGILPFLNHLGLKVLD---LGACTYNSADDYPDFAQTVARNVACGKTDRGIIICGSGVGACITANKIKGIRAGLCHDVYSAHQGVEHDDMNVLCLGARVIGIEVAKEIISAFLNARFTGEERHKRRLEKLLKVEKE 151
>gi|56421906|ref|YP_149224.1| ribose-5-phosphate isomerase B [Geobacillus kaustophilus HTA426] >gi|56381748|dbj|BAD77656.1| ribose 5-phosphate isomerase [Geobacillus kaustophilus HTA426] (148 aa)
Score = 262, Expect = 1.1e-21, Identities = 59/148 (39%), Positives = 87/148 (58%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           +KV I SDHGG  ++E+I+   + + I ++ D G    + SVDYPDYA  + E + + +   GI ICGTGIG+ IA NK+KG+  A  +    A+L R HN+ N++ +  R        EI K +  + FE GRH +R+ KI + ENK
  S:     1 MKVAIASDHGGIRIREEIKALLDEMGI-EYTDFGC-DCETSVDYPDYALPVAEKVARGEFDRGILICGTGIGMTIAANKVKGVRCALCHDVYSAKLTRMHNDSNILAMGERVIGPGLAREIAKAWLETEFEGGRHARRIGKIAEYENK 146
>gi|189500263|ref|YP_001959733.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Chlorobium phaeobacteroides BS1] >gi|189495704|gb|ACE04252.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Chlorobium phaeobacteroides BS1] (142 aa)
Score = 261, Expect = 1.3e-21, Identities = 56/142 (39%), Positives = 90/142 (63%)
  Q:    11 IKVYIGSDHGGFDMKEKI-----RNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           +K+ IGSDH G+ +K+ +     ++ +E+       D+G +S +ESVDYPD+A K+ E + +     G+ +CG+GIG+ I  NK+KGI AA       A LAR+HNN NV+    R++      + ++ +F++ FE GRHE+R+ KI
  S:     1 MKIAIGSDHAGYALKKIVYSWLDKHGYEV------DDMGPWS-EESVDYPDFARKVAEAVSRGDADQGVLLCGSGIGVSIVANKVKGIRAALAFNPEIASLARQHNNANVLCFPARYSDSGTIEQSLENWFNAEFEGGRHERRVLKI 140
>gi|160936520|ref|ZP_02083887.1| hypothetical protein CLOBOL_01410 [Clostridium bolteae ATCC BAA-613] >gi|158440311|gb|EDP18056.1| hypothetical protein CLOBOL_01410 [Clostridium bolteae ATCC BAA-613] (146 aa)
Score = 261, Expect = 1.4e-21, Identities = 60/148 (40%), Positives = 89/148 (60%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEI--LDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           +K+ IG+DH   ++K  I+   E +E    + +DLGT S  ES DYP Y EK+G  +   +   GI ICGTG+GI +A NK+KGI A   ++   A+L+R HNN NV+    R    E    I + +  + FE GRHE+R++ I ++EN+
  S:     1 MKIAIGNDHTAIELKNIIK---EFVEEKGYEVIDLGTNS-TESCDYPIYGEKVGRAVADGQADLGIAICGTGVGISLAANKVKGIRACVCSEPYTAKLSRVHNNSNVLAFGARVVGSELAKMITEAWLDAEFEGGRHERRVNMIMEIENR 146
>gi|32474019|ref|NP_867013.1| ribose-5-phosphate isomerase B [Rhodopirellula baltica SH 1] >gi|32444556|emb|CAD74555.1| ribose 5-phosphate epimerase (pentose phosphate) [Rhodopirellula baltica SH 1] (172 aa)
Score = 260, Expect = 1.5e-21, Identities = 55/156 (35%), Positives = 89/156 (57%)
  Q:     1 MSESKKQLKKIKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFE-SGRHEKRLDKITKLE 156
           MS++   +  I++ +G DH GF +K+ +       ++   +D GT   + S DYPD+A ++ E +   +   G+ ICG+G+G+ +A NKI GI AA  + T  A    EH+++NV+ + GR    E   EII  F ++ +    RH++RLDKI  LE
  S:    16 MSQNADSVSPIRLAVGGDHAGFALKQLVVERFGS-QVTSLIDCGT-DDETSCDYPDFAVEVAERINSGEADRGLLICGSGVGVSVAANKITGIRAAICHDTYSARQGVEHDDMNVLCIGGRIIGSELAFEIISSFLNAKYTPEERHQRRLDKILALE 170
>gi|108562978|ref|YP_627294.1| ribose-5-phosphate isomerase B [Helicobacter pylori HPAG1] >gi|107836751|gb|ABF84620.1| ribose 5-phosphate isomerase [Helicobacter pylori HPAG1] (153 aa)
Score = 260, Expect = 1.7e-21, Identities = 57/150 (38%), Positives = 87/150 (57%)
  Q:     6 KQLKKIKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKL 155
           K L   +V+IGSDH G  + E +++    LE  DF  +  +     VDYPDYA+ + + +L++  SYGI +C TGIG+ +  N+ KGI AA       A++ R HNN NV+ L  + + +     I++ FFS+ FE GRH  R+ K+ +L
  S:     3 KPLNIAQVFIGSDHAGLHLAEFVKH---FLEDKDF-KIQAFLPTMRVDYPDYAKLVCQKVLENPQSYGILVCATGIGMSMGANRFKGIRAALCLDAYMAKMTRLHNNANVLCLGEKISGIGVTESILEAFFSTEFEQGRHVLRIQKLDEL 148
>gi|83311437|ref|YP_421701.1| ribose 5-phosphate isomerase RpiB [Magnetospirillum magneticum AMB-1] >gi|82946278|dbj|BAE51142.1| Ribose 5-phosphate isomerase RpiB [Magnetospirillum magneticum AMB-1] (150 aa)
Score = 260, Expect = 1.7e-21, Identities = 55/139 (39%), Positives = 81/139 (58%)
  Q:    15 IGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKIT 153
           I  DHGG ++KE +  +         +DLGT +G ESVDYPD+A  + + L   K   G+ +CGTGIGI IA N+   + AA V+    A + R+HN+ NV+ + GR T  E   + +K F  + FE GRH +R+ K++
  S:     9 IACDHGGIELKELLAKDLAA-SGWSVLDLGT-NGPESVDYPDFAVTLADALKSGKAERGVLLCGTGIGISIAANRFPHVRAALVHDAFGARMCRQHNDANVLVMGGRTTGPEVARDCLKIFIETEFEGGRHARRVSKLS 145
>gi|148261115|ref|YP_001235242.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Acidiphilium cryptum JF-5] >gi|146402796|gb|ABQ31323.1| ribose-5-phosphate isomerase [Acidiphilium cryptum JF-5] (150 aa)
Score = 260, Expect = 1.9e-21, Identities = 51/145 (35%), Positives = 82/145 (56%)
  Q:     9 KKIKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKIT 153
           + + + +G+DH GF++K+++            +D GT S   SVDYPD A ++   +      +G+ +CG+GIG+ IA N+  G+  A  +   EA L+R HNN N++ L  R T     ++ +  F ++ FE GRHEKRL K+T
  S:     3 ENMTLVVGADHAGFELKDRLAEAARAAG-WAVIDCGTNSA-ASVDYPDIAHEVSMRIEAGSARFGLLVCGSGIGMAIAANRHTGVRCAQAHDATEARLSRMHNNANILALGARLTGEMVALDALNAFLTTEFEGGRHEKRLAKLT 145
>gi|78357163|ref|YP_388612.1| ribose-5-phosphate isomerase [Desulfovibrio desulfuricans subsp. desulfuricans str. G20] >gi|78219568|gb|ABB38917.1| ribose-5-phosphate isomerase [Desulfovibrio desulfuricans G20] (146 aa)
Score = 259, Expect = 2.0e-21, Identities = 60/139 (43%), Positives = 83/139 (59%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLEI-LDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLD 150
           +V IGSDH GF +KE + +  EL +   D  D+G  +  ES DYP +A+K+ E +L+ K   GI ICGTGIG+ +A N+I GI AA       A   R HNN NV+ L  R T     +E+ + F  + FE GRH++R+D
  S:     4 QVIIGSDHAGFSLKELLVS--ELTKSGYDVHDMGPATA-ESCDYPLFAQKVCERVLQQKAQ-GILICGTGIGMSMAANRIDGIRAALCTTEFHARATRLHNNANVLCLGERVTGPGVALELARLFLETEFEGGRHQRRID 139
>gi|154498793|ref|ZP_02037171.1| hypothetical protein BACCAP_02784 [Bacteroides capillosus ATCC 29799] >gi|150272183|gb|EDM99387.1| hypothetical protein BACCAP_02784 [Bacteroides capillosus ATCC 29799] (144 aa)
Score = 259, Expect = 2.1e-21, Identities = 58/145 (40%), Positives = 84/145 (57%)
  Q:    13 VYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLEN 157
           + +GSDHGGF +K+ I+   +   I  + D G  S  ES DYPD+     + +   +   GI +C TGIGI I  NK+KGI  A     + AEL R+HNN N++ L+G FT   +   I+  F  + FE GRHE+R++K+  LE+
  S:     2 IALGSDHGGFALKQHIKTYLDSRGIA-WKDFGCDS-TESCDYPDFGAAAAKAVASGECEKGIVVCTTGIGISITANKVKGIRCALCRDVLSAELTRKHNNANMLALAGGFTGPFEAEHIVSAFLDTEFEGGRHERRVNKMMALED 144
>gi|148263937|ref|YP_001230643.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Geobacter uraniireducens Rf4] >gi|146397437|gb|ABQ26070.1| ribose-5-phosphate isomerase [Geobacter uraniireducens Rf4] (149 aa)
Score = 259, Expect = 2.1e-21, Identities = 59/146 (40%), Positives = 86/146 (58%)
  Q:    13 VYIGSDHGGFDMKEKIRNNHELL--EILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           + IGSDHGG  +KE ++   +LL    + F D GT +GD SVDYPD+  K+   +   +   GI +CGTGIG+ I  NK   + AA V  +  A++A+EHNN N++ L GR         ++  +  + FE GRH+ RLDKI  +E +
  S:     2 IAIGSDHGGLSLKEALK---KLLAERGISFEDCGTDNGD-SVDYPDFGVKVARKVSSGEVEKGILVCGTGIGMSIVANKFPRVRAALVTDSFMAQMAKEHNNANILVLGGRVLDENAARTMVATWLDATFEGGRHQARLDKIEDIEKE 145
>gi|83593163|ref|YP_426915.1| ribose-5-phosphate isomerase [Rhodospirillum rubrum ATCC 11170] >gi|83576077|gb|ABC22628.1| ribose-5-phosphate isomerase [Rhodospirillum rubrum ATCC 11170] (162 aa)
Score = 259, Expect = 2.2e-21, Identities = 58/140 (41%), Positives = 81/140 (57%)
  Q:    13 VYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           + + SDHGG ++K  +  +H      D +DLGT  G ESVDYPD A  + + L   +   G+ ICGTGIGI IA+N+   +  A V+    A LAR+HN+ NV+ L GR T  E   +    F S+ FE GRH +R+ K+
  S:    20 IALASDHGGVELK-ALLVDHLRATGHDVLDLGT-QGPESVDYPDIANTLAQALRAGRAGRGVLICGTGIGISIAINRHADMRGALVHDAFGARLARQHNDANVLVLGGRTTGPEIAKDCADIFLSTPFEGGRHARRVAKL 157
>gi|30023349|ref|NP_834980.1| ribose-5-phosphate isomerase B [Bacillus cereus ATCC 14579] >gi|29898910|gb|AAP12181.1| Ribose 5-phosphate isomerase [Bacillus cereus ATCC 14579] (147 aa)
Score = 259, Expect = 2.2e-21, Identities = 59/148 (39%), Positives = 87/148 (58%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           +KV I SDHGG ++++++ N  E L I +++DLG      SVDYPD+A    E +   +   GI +CGTGIG+ IA NK+ GI  A V+ T  A+  REHN+ N++ +  R        +I K + ++ +E GRHE R+ KI   E K
  S:     1 MKVVIASDHGGMNIRKELVNLLEELNI-EYIDLGCECEAGSVDYPDFAFPAAEMVANGEVDRGILVCGTGIGMSIAANKVNGIRCALVHDTFSAKATREHNDTNMLAMGERVIGAGLARDIAKIWLTTDYEGGRHENRVGKIKTYETK 147
>gi|71893927|ref|YP_279373.1| ribose-5-phosphate isomerase B [Mycoplasma hyopneumoniae J] >gi|71852054|gb|AAZ44662.1| ribose 5-phosphate isomerase B [Mycoplasma hyopneumoniae J] (144 aa)
Score = 259, Expect = 2.3e-21, Identities = 66/143 (46%), Positives = 88/143 (61%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLEILDFV--DLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITK 154
           K  I SDH GF  KE+I    E L+   F   DLG    +ESV Y  Y  K+   LL++    GI ICGTG+G+  ALN+ K I AA V    +A LA+ HNN NVI LSGRF S ++++  IKKF  + +E GRH++R+D++ K
  S:     4 KFAITSDHAGFKRKEEII---EYLKNQGFEVNDLGP-KNEESVSYAVYGNKLANFLLENPEQIGIAICGTGLGMSYALNRFKKIRAARVTCENDAYLAKLHNNANVIALSGRFNSKDESISFIKKFLETEYEGGRHQERIDELDK 144
>gi|159039418|ref|YP_001538671.1| ribose-5-phosphate isomerase B [Salinispora arenicola CNS-205] >gi|157918253|gb|ABV99680.1| ribose 5-phosphate isomerase [Salinispora arenicola CNS-205] (155 aa)
Score = 259, Expect = 2.3e-21, Identities = 57/146 (39%), Positives = 85/146 (58%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESG-RHEKRLDKITKLE 156
           ++VY+GSDH GF++K  + N H   E  D VD+G  + D   DYP +    G+ ++ D GS G+ I G+G G  IA NKI GI AA       A LAREHNN NV+ +  R  ++++   I++ F ++ F    RH +R+D++   E
  S:     1 MRVYLGSDHAGFELKAHLAN-HLAKEGYDVVDVGPQAYDPDDDYPAFCLHTGDRVVADGGSLGVVIGGSGNGEQIAANKIDGIRAALAWNIDTAHLAREHNNANVVAIGARQHTLDEATAIVEAFLTTPFSGKQRHSRRIDQVADYE 146
>gi|116872125|ref|YP_848906.1| ribose-5-phosphate isomerase B [Listeria welshimeri serovar 6b str. SLCC5334] >gi|116741003|emb|CAK20123.1| rpiB [Listeria welshimeri serovar 6b str. SLCC5334] (146 aa)
Score = 258, Expect = 2.8e-21, Identities = 59/148 (39%), Positives = 89/148 (60%)
  Q:    11 IKVYIGSDHGGFDMKEKI-RNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           +K+ IG+DH G ++K  I R   EL   ++  D G ++ +E  DYP+Y +K+ EN+   K   GI ICGTG+GI IA NK+KGI A   ++   A+L+REHNN N++    R    E    I++ +  + FE GRH+ R+  I  +EN+
  S:     1 MKIAIGNDHVGIELKPIIIRFLKELGHEVE--DFGAFT-NERTDYPEYGKKVAENVAAGKADLGILICGTGVGISIAANKVKGIRAVVCSEPYSAKLSREHNNTNILAFGSRVIGSEMAKMIVQNWLEAEFEGGRHQNRVTMIAGIENE 146
>gi|30265341|ref|NP_847718.1| ribose-5-phosphate isomerase B [Bacillus anthracis str. Ames] >gi|47530880|ref|YP_022229.1| ribose-5-phosphate isomerase B [Bacillus anthracis str. 'Ames Ancestor'] >gi|49188153|ref|YP_031406.1| ribose-5-phosphate isomerase B [Bacillus anthracis str. Sterne] >gi|52140245|ref|YP_086586.1| ribose-5-phosphate isomerase B [Bacillus cereus E33L] >gi|118480354|ref|YP_897505.1| ribose-5-phosphate isomerase B [Bacillus thuringiensis str. Al Hakam] >gi|30260019|gb|AAP29204.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Bacillus anthracis str. Ames] >gi|47506028|gb|AAT34704.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Bacillus anthracis str. 'Ames Ancestor'] >gi|49182080|gb|AAT57456.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Bacillus anthracis str. Sterne] >gi|51973714|gb|AAU15264.1| ribose 5-phosphate isomerase (ribose 5-phosphate epimerase) [Bacillus cereus E33L] >gi|118419579|gb|ABK87998.1| ribose-5-phosphate isomerase [Bacillus thuringiensis str. Al Hakam] (147 aa)
Score = 258, Expect = 2.9e-21, Identities = 59/148 (39%), Positives = 86/148 (58%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           +KV I SDHGG ++++++ +  E L I +++DLG      SVDYPD+A    E +   +   GI +CGTGIG+ IA NK+ GI  A V+ T  A   REHN+ N++ +  R        +I K + ++ FE GRHE R+ KI   E K
  S:     1 MKVVIASDHGGMNIRKELVSLLEELNI-EYIDLGCECEAGSVDYPDFAFPAAEMVANGEVDRGILVCGTGIGMSIAANKVNGIRCALVHDTFSARATREHNDTNMLAMGERVIGAGLARDIAKIWLTTEFEGGRHENRVGKIKTYEAK 147
>gi|167378300|ref|XP_001734751.1| ribose-5-phosphate isomerase B, putative [Entamoeba dispar SAW760] >gi|165903600|gb|EDR29074.1| ribose-5-phosphate isomerase B, putative [Entamoeba dispar SAW760] (146 aa)
Score = 257, Expect = 3.7e-21, Identities = 59/146 (40%), Positives = 87/146 (59%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLE 156
           ++V IGSDH GF +KE ++  + + + +   D+GTYS  E  DYPD+AEK+   +LK  G  GI +CG+GIGI IA NKI GI  A  +    A + R HN+ N+I    R    +   +++  F S+ F+  +H  R++KI KLE
  S:     1 MEVIIGSDHAGFPLKEIVKK-YLIEKGIKVDDMGTYS-TERCDYPDFAEKVAREVLK-TGKKGILVCGSGIGISIAANKINGIRCALCHDHYTAVMCRRHNDANIIAFGARVIGSDIATDMVDAFLSTPFDGMQHTARVEKIHKLE 143
>gi|154340579|ref|XP_001566246.1| ribose 5-phosphate isomerase, putative [Leishmania braziliensis MHOM/BR/75/M2904] >gi|134063565|emb|CAM39747.1| ribose 5-phosphate isomerase, putative [Leishmania braziliensis] (156 aa)
Score = 257, Expect = 3.7e-21, Identities = 58/147 (39%), Positives = 85/147 (57%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSH-FESGRHEKRLDKITKLENK 158
           +V +G DH  +D+ ++I +      ++  V     S   SVDYPDYA ++ E +LK +   GI +CGTGIG+ IA NK  GI AA  N  + A+L R+HNN NV+ L  R    E   +II  F ++   + GRH  R+ KIT++E +
  S:     4 RVALGCDHAAYDIHQEIMDMITTTGVVSKVIYMGPSSASSVDYPDYAAQVCEAILKGEADTGILVCGTGIGMSIAANKFSGIRAALCNDHVTAQLCRQHNNANVLCLGARTCGREILRDIIITFLTAEPSKEGRHGSRIAKITEIERE 151
>gi|154503781|ref|ZP_02040841.1| hypothetical protein RUMGNA_01605 [Ruminococcus gnavus ATCC 29149] >gi|153795881|gb|EDN78301.1| hypothetical protein RUMGNA_01605 [Ruminococcus gnavus ATCC 29149] (173 aa)
Score = 257, Expect = 3.8e-21, Identities = 56/148 (37%), Positives = 88/148 (59%)
  Q:    11 IKVYIGSDHGGFDMKEKI-----RNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           +++ IG+DH   ++K +I        HE+      VD GT S  ES DYP Y E +G  ++  +   GI ICGTG+GI +A NK+KG+ AA  ++   A+++R HNN NV+    R    E    I+  + ++ FE GRH++R+D I ++E +
  S:    28 MRIGIGNDHSALELKAEIIEFLKEKGHEV------VDFGTDS-SESCDYPKYGEAVGRAVVAKEVDCGILICGTGLGISLAANKVKGVRAAVCSEPFTAKMSRAHNNCNVLAFGARVVGAELAKMIVDVWLNTEFEGGRHQRRVDMIMEIEER 173
>gi|54020254|ref|YP_116102.1| ribose-5-phosphate isomerase B [Mycoplasma hyopneumoniae 232] >gi|53987427|gb|AAV27628.1| conserved hypothetical protein [Mycoplasma hyopneumoniae 232] (144 aa)
Score = 257, Expect = 3.9e-21, Identities = 65/143 (45%), Positives = 87/143 (60%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLEILDFV--DLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITK 154
           K  I SDH GF  KE+I    E L+   F   DLG    +ESV Y  Y  K+   LL++    GI ICGTG+G+  ALN+ K I AA V    +A  A+ HNN NVI LSGRF S ++++  IKKF  + +E GRH++R+D++ K
  S:     4 KFAITSDHAGFKRKEEII---EYLKNQGFEVNDLGP-KNEESVSYAVYGNKLANFLLENPEQIGIAICGTGLGMSYALNRFKKIRAARVTSENDAYFAKLHNNANVIALSGRFNSKDESISFIKKFLETEYEGGRHQERIDELDK 144
>gi|49481302|ref|YP_039309.1| ribose-5-phosphate isomerase B [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|49332858|gb|AAT63504.1| ribose 5-phosphate isomerase (ribose 5-phosphate epimerase) [Bacillus thuringiensis serovar konkukian str. 97-27] (147 aa)
Score = 257, Expect = 4.3e-21, Identities = 58/148 (39%), Positives = 86/148 (58%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           +KV I SDHGG ++++++ +  E L + +++DLG      SVDYPD+A    E +   +   GI +CGTGIG+ IA NK+ GI  A V+ T  A   REHN+ N++ +  R        +I K + ++ FE GRHE R+ KI   E K
  S:     1 MKVVIASDHGGMNIRKELVSLLEELNV-EYIDLGCECEAGSVDYPDFAFPAAEMVANGEVDRGILVCGTGIGMSIAANKVNGIRCALVHDTFSARATREHNDTNMLAMGERVIGAGLARDIAKIWLTTEFEGGRHENRVGKIKTYEAK 147
>gi|42784488|ref|NP_981735.1| ribose-5-phosphate isomerase B [Bacillus cereus ATCC 10987] >gi|42740420|gb|AAS44343.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Bacillus cereus ATCC 10987] (147 aa)
Score = 257, Expect = 4.3e-21, Identities = 58/148 (39%), Positives = 86/148 (58%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           +KV + SDHGG ++++++ +  E L I +++DLG      SVDYPD+A    E +   +   GI +CGTGIG+ IA NK+ GI  A V+ T  A   REHN+ N++ +  R        +I K + ++ FE GRHE R+ KI   E K
  S:     1 MKVVVASDHGGMNIRKELVSLLEELNI-EYIDLGCECEAGSVDYPDFAFPAAEMVANGEVDRGILVCGTGIGMSIAANKVNGIRCALVHDTFSARATREHNDTNMLAMGERVIGAGLARDIAKIWLTTEFEGGRHENRVGKIKTYEAK 147
>gi|126699938|ref|YP_001088835.1| ribose-5-phosphate isomerase 1 [Clostridium difficile 630] >gi|145952727|ref|ZP_01801735.1| hypothetical protein CdifQ_04002684 [Clostridium difficile QCD-32g58] >gi|168696923|ref|ZP_02729200.1| ribose-5-phosphate isomerase 1 [Clostridium difficile QCD-37x79] >gi|168713185|ref|ZP_02745462.1| ribose-5-phosphate isomerase 1 [Clostridium difficile QCD-63q42] >gi|168725423|ref|ZP_02757700.1| ribose-5-phosphate isomerase 1 [Clostridium difficile QCD-76w55] >gi|168729941|ref|ZP_02762218.1| ribose-5-phosphate isomerase 1 [Clostridium difficile QCD-97b34] >gi|196127567|ref|ZP_03119316.1| ribose-5-phosphate isomerase 1 [Clostridium difficile ATCC 43255] >gi|196159269|ref|ZP_03119830.1| ribose-5-phosphate isomerase 1 [Clostridium difficile CIP 107932] >gi|115251375|emb|CAJ69207.1| ribose-5-phosphate isomerase 1 [Clostridium difficile 630] (148 aa)
Score = 256, Expect = 4.7e-21, Identities = 61/148 (41%), Positives = 91/148 (61%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           +K+ IG DHGG+++KE I+ N  + + ++  D+GT S  ESVD+P YA+K+ +N+   K   GI  CGTGIG+ IA NK KGI AA V+    A+  REHNN NV+ L  R       + I++++ +S +   RH +RL  I  +E +
  S:     1 MKISIGCDHGGYELKEYIKENL-INKGIEVEDVGTNS-KESVDFPIYAKKVSQNVQSKKSDLGILCCGTGIGMSIAANKFKGIRAAVVSDCFSAKATREHNNTNVLCLGERVIGKGLAMRIVEEWLNSSYNGERHARRLQMIDDIEKE 146
>gi|72080905|ref|YP_287963.1| ribose-5-phosphate isomerase B [Mycoplasma hyopneumoniae 7448] >gi|71914029|gb|AAZ53940.1| ribose 5-phosphate isomerase B [Mycoplasma hyopneumoniae 7448] (144 aa)
Score = 256, Expect = 4.7e-21, Identities = 64/143 (44%), Positives = 87/143 (60%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLEILDFV--DLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITK 154
           K  I SDH GF  KE+I    E L+   F   DLG    +ESV Y  Y  K+   LL++    GI ICGTG+G+  ALN+ K I AA +    +A  A+ HNN NVI LSGRF S ++++  IKKF  + +E GRH++R+D++ K
  S:     4 KFAITSDHAGFKRKEEIV---EYLKNQGFEVNDLGP-KNEESVSYAVYGNKLANFLLENPEQIGIAICGTGLGMSYALNRFKKIRAARITSENDAYFAKLHNNANVIALSGRFNSKDESISFIKKFLETEYEGGRHQERIDELDK 144
>gi|144897821|emb|CAM74685.1| Ribose/galactose isomerase [Magnetospirillum gryphiswaldense MSR-1] (149 aa)
Score = 255, Expect = 7.1e-21, Identities = 57/147 (38%), Positives = 88/147 (59%)
  Q:     8 LKKIKVYIGSDHGGFDMKEKIRNNHELLEILDF--VDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITK 154
           + K  + + SDHGG +MK  +     LL+   F  +DLG + G +SVDYPD+A  + + L   + + G+ +CG+GIGI IA N+   + AA V+ +  A + R HN+ NV+ L GR T  E   E I+ F ++ FE GRH +R+ K+ +
  S:     1 MTKDIIALASDHGGLEMKAMVA---ALLQEKGFGVLDLGAHDG-QSVDYPDFAVAMAQALKDGRATRGVLMCGSGIGISIAANRFAHVRAALVHDSYGARMCRLHNDANVLVLGGRTTGPEVAKECIEIFLATPFEGGRHARRVAKLAE 145
>gi|118726902|ref|ZP_01575517.1| sugar-phosphate isomerases, RpiB/LacA/LacB family [Clostridium cellulolyticum H10] >gi|118663717|gb|EAV70363.1| sugar-phosphate isomerases, RpiB/LacA/LacB family [Clostridium cellulolyticum H10] (149 aa)
Score = 254, Expect = 8.4e-21, Identities = 61/146 (41%), Positives = 84/146 (57%)
  Q:    13 VYIGSDHGGFDMKEKIRNNHEL--LEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           + IGSDH G+ +K  I    E   LE+ DF   GT   D SVDYPDY   + E +   +   GI ICGTGIGI IA NK+ G+ AA    +  A++ R+HN+ N+I +  R        +II+ +  + F  GRH+ RLDKI+ +E K
  S:     2 IAIGSDHAGYLLKADIIKFLESKGLEVKDF---GTNCPD-SVDYPDYGRAVAEAVASKECEKGILICGTGIGISIAANKVPGVRAALCTDSYMAKMCRQHNDANIIAIGERVVGPGLAFDIIETWLETEFLGGRHQNRLDKISDIEKK 145
>gi|149184441|ref|ZP_01862759.1| ribose 5-phosphate isomerase [Erythrobacter sp. SD-21] >gi|148831761|gb|EDL50194.1| ribose 5-phosphate isomerase [Erythrobacter sp. SD-21] (149 aa)
Score = 254, Expect = 8.7e-21, Identities = 51/142 (35%), Positives = 84/142 (59%)
  Q:    11 IKVYIGSDHGGFDMKEKIRN-----NHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           +++ + SDH   ++K  +R+      HE+       DLG  + +ESVDYPD+  K+   +       GI +CG+GIGI +++N+  G+  A V++ + A LAREHN+ N I L  R T+V+     +  F  + F  GRH++R+DK+
  S:     5 MRIALASDHAAIELKAALRDWLIEQGHEV------ADLGPET-NESVDYPDFGYKLAGVVADGTAERGIALCGSGIGISMSVNRNPGVRCALVSEPLSAALAREHNDANCIALGARLTAVDMAKACVTAFLETEFAGGRHQRRVDKL 144
>gi|153815702|ref|ZP_01968370.1| hypothetical protein RUMTOR_01939 [Ruminococcus torques ATCC 27756] >gi|145846943|gb|EDK23861.1| hypothetical protein RUMTOR_01939 [Ruminococcus torques ATCC 27756] (146 aa)
Score = 254, Expect = 9.0e-21, Identities = 59/148 (39%), Positives = 86/148 (58%)
  Q:    11 IKVYIGSDHGGFDMKEKI-----RNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           +K+ IG+DH   ++K +I        HE+      VD GT S  ES DYP Y E +   +   +   GI ICGTG+GI +A NK+KGI AA  ++   A++AR HNN N++    R    E    I++ +  + FE GRH++R+D IT +E K
  S:     1 MKIGIGNDHSALELKAEIISFLKEKGHEV------VDYGTNS-SESCDYPVYGEIVARAVAAGEVEQGILICGTGLGISLAANKVKGIRAAVCSEPFTAKMARVHNNCNILAFGARVVGAELAKMIVETWLDAEFEGGRHQRRVDLITAIEEK 146
>gi|15606395|ref|NP_213775.1| ribose 5-phosphate isomerase B [Aquifex aeolicus VF5] >gi|2983605|gb|AAC07175.1| ribose 5-phosphate isomerase B [Aquifex aeolicus VF5] (154 aa)
Score = 254, Expect = 9.0e-21, Identities = 61/139 (43%), Positives = 83/139 (59%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELL--EILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRL 149
           +K+ IGSDH GF +KEKI+   E L  E    +D+GT++  ES  YP YA+++   +   K   GI ICGTGIG+ I  NK +GI AA       A ++R HN+ NV+ L  R   VE  + I+K +  + FE GRH KRL
  S:     1 MKIAIGSDHAGFPLKEKIK---EFLKGEGHKVIDVGTHA-QESTHYPIYAKEVVRAIRSGKAERGILICGTGIGMSITANKFRGIRAALCTNEYMARMSRLHNDANVLCLGERVLGVELALSIVKVWLETPFEGGRHLKRL 137
>gi|118468978|ref|YP_888945.1| ribose-5-phosphate isomerase B [Mycobacterium smegmatis str. MC2 155] >gi|118170265|gb|ABK71161.1| ribose 5-phosphate isomerase [Mycobacterium smegmatis str. MC2 155] (159 aa)
Score = 254, Expect = 9.6e-21, Identities = 56/146 (38%), Positives = 85/146 (58%)
  Q:    11 IKVYIGSDHGGFDMKEKI-----RNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHF-ESGRHEKRLDKITKLE 156
           ++VY+G+DH GF+ K+ I     +N HE       +D G Y  D   DYP +     E  + D GS GI + G+G G  IA NK+ G  AA       A+LAREHNN N+I + GR  + E+ + I+  F ++ + E+ RH++R+D + + E
  S:     1 MRVYVGADHAGFEFKKTIIAHLEKNGHEP------IDCGAYEYDADDDYPAFCIAAAEKTVADPGSLGIVLGGSGNGEQIAANKVPGARAALAWSVETAQLAREHNNANLIGIGGRMHTTEEALAIVDAFLTTPWSEAERHQRRIDILAEYE 146
>gi|125623797|ref|YP_001032280.1| ribose-5-phosphate isomerase B [Lactococcus lactis subsp. cremoris MG1363] >gi|124492605|emb|CAL97550.1| ribose 5-phosphate isomerase B [Lactococcus lactis subsp. cremoris MG1363] (149 aa)
Score = 253, Expect = 1.0e-20, Identities = 58/148 (39%), Positives = 88/148 (59%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELL--EILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           +K+ IGSDH GF++K  I +  E L  E+ DF    T    E  DYP Y +K+ E +       G+ ICGTG+GI I+ NK++GI A   ++   A+L++EHNN N++    R    E    I+K++  + +E GRH KR++ IT+LE +
  S:     1 MKLAIGSDHVGFELKPLIIDYREELGHEVTDFGPFST----ERTDYPIYGKKVAEEVAAGHFDGGVLICGTGVGISISANKVRGIRAVVCSEPYSAKLSKEHNNTNIMAFGSRVVGSELAKMIVKEWLEAIYEGGRHAKRIEMITELETE 146
>gi|57239139|ref|YP_180275.1| ribose-5-phosphate isomerase [Ehrlichia ruminantium str. Welgevonden] >gi|57161218|emb|CAH58133.1| ribose 5-phosphate isomerase B [Ehrlichia ruminantium str. Welgevonden] (146 aa)
Score = 253, Expect = 1.0e-20, Identities = 57/141 (40%), Positives = 81/141 (57%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLEILDFV--DLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           K++I SDH G +++  I+     LE L +   D G    D  VDYPDY + +   +  +   +GI ICGTGIG+ IA N+ K + AA    T  A  AREHNN NV+ L  R+ + E    I+ KF ++ F  GRH +R++KI
  S:     3 KIFISSDHAGVELRLFIK---LYLESLSYTVEDYGCVISDVIVDYPDYVQDVVHCVTSNDSGFGILICGTGIGMSIAANRYKKVRAALCYTTELARFAREHNNANVLCLGARYITYEKAKLIVYKFLNTKFAEGRHTQRIEKI 142
>gi|16802778|ref|NP_464263.1| ribose-5-phosphate isomerase B [Listeria monocytogenes EGD-e] >gi|47095301|ref|ZP_00232912.1| sugar-phosphate isomerases, RpiB/LacA/LacB family subfamily [Listeria monocytogenes str. 1/2a F6854] >gi|153173657|ref|ZP_01929371.1| hypothetical protein LMIG_02031 [Listeria monocytogenes FSL N3-165] >gi|153178830|ref|ZP_01932117.1| hypothetical protein LMMG_01369 [Listeria monocytogenes F6900] >gi|153184167|ref|ZP_01934950.1| hypothetical protein LMOG_00847 [Listeria monocytogenes J0161] >gi|153190119|ref|ZP_01937564.1| hypothetical protein LMPG_00493 [Listeria monocytogenes J2818] >gi|153195372|ref|ZP_01940170.1| hypothetical protein LMRG_00424 [Listeria monocytogenes 10403S] >gi|167211705|ref|ZP_02282012.1| ribose-5-phosphate isomerase B [Listeria monocytogenes LO28] >gi|167403815|ref|ZP_02308635.1| ribose-5-phosphate isomerase B [Listeria monocytogenes FSL J2-003] >gi|16410125|emb|CAC98814.1| lmo0736 [Listeria monocytogenes] >gi|47016372|gb|EAL07294.1| sugar-phosphate isomerases, RpiB/LacA/LacB family subfamily [Listeria monocytogenes str. 1/2a F6854] >gi|126943231|gb|EBA20960.1| hypothetical protein LMOG_00847 [Listeria monocytogenes J0161] >gi|127634975|gb|EBA24355.1| hypothetical protein LMRG_00424 [Listeria monocytogenes 10403S] >gi|127766437|gb|EBA26775.1| hypothetical protein LMPG_00493 [Listeria monocytogenes J2818] >gi|133730737|gb|EBA32435.1| hypothetical protein LMIG_02031 [Listeria monocytogenes FSL N3-165] >gi|133733518|gb|EBA35216.1| hypothetical protein LMMG_01369 [Listeria monocytogenes F6900] (148 aa)
Score = 253, Expect = 1.1e-20, Identities = 57/148 (38%), Positives = 90/148 (60%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELL--EILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           +K+ IG+DH G ++K  I    + L  E+ DF   G +S +E  DYP+Y +K+ E++   K   GI ICG+G+GI IA NK+ GI A   ++   A+L+REHNN N++    R    E    I++ +  + FE GRH KR++ I ++E++
  S:     1 MKIAIGNDHVGIELKPVIVAYLQDLGHEVDDF---GAFS-NERTDYPEYGKKVAESVAAGKSDLGILICGSGVGISIAANKVNGIRAVVCSEPYSAKLSREHNNTNILAFGSRVVGAELAKMIVQNWLDAEFEGGRHAKRVEMIARIEDE 146
>gi|46906743|ref|YP_013132.1| ribose 5-phosphate isomerase B [Listeria monocytogenes str. 4b F2365] >gi|47093122|ref|ZP_00230898.1| ribose 5-phosphate isomerase B [Listeria monocytogenes str. 4b H7858] >gi|153200999|ref|ZP_01943045.1| ribose 5-phosphate isomerase B [Listeria monocytogenes HPB2262] >gi|167013924|ref|ZP_02276457.1| hypothetical protein LmonFS_02704 [Listeria monocytogenes FSL J1-194] >gi|167216734|ref|ZP_02286370.1| hypothetical protein LmonocFSL_03909 [Listeria monocytogenes FSL J1-175] >gi|167453207|ref|ZP_02319430.1| hypothetical protein LmonocytoFSL_03491 [Listeria monocytogenes FSL J2-064] >gi|46880008|gb|AAT03309.1| ribose 5-phosphate isomerase B [Listeria monocytogenes str. 4b F2365] >gi|47018495|gb|EAL09252.1| ribose 5-phosphate isomerase B [Listeria monocytogenes str. 4b H7858] >gi|133736270|gb|EBA37968.1| ribose 5-phosphate isomerase B [Listeria monocytogenes HPB2262] (149 aa)
Score = 253, Expect = 1.1e-20, Identities = 61/146 (41%), Positives = 88/146 (60%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLE 156
           +++ I +DHGGF +KEKIR  H +       D G YS  ESVD+P+YA K+G + +  + S G+  CGTGIG+ +A NKIKG+ AA V+    A + R HNN NV+ L  R       + ++  + ++ FE GRH  RL K+ +LE
  S:     1 MEIAIAADHGGFQLKEKIRA-HLIESGYTVKDFGCYSL-ESVDFPEYAAKVG-HFVATENSLGVLCCGTGIGMSMAANKIKGVRAAVVSDAFSAMMTRRHNNSNVLCLGERVLGDSLALLLLDTWLAAEFEGGRHNTRLAKLAELE 143
>gi|148554052|ref|YP_001261634.1| ribose-5-phosphate isomerase [Sphingomonas wittichii RW1] >gi|148499242|gb|ABQ67496.1| ribose-5-phosphate isomerase [Sphingomonas wittichii RW1] (152 aa)
Score = 253, Expect = 1.1e-20, Identities = 58/141 (41%), Positives = 82/141 (58%)
  Q:    13 VYIGSDHGGFDMK----EKIR-NNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKIT 153
           + I SDH  FDMK    E +R   HE+L      DLG  S   SVDYPDY  ++ E +   + + GI +CG+GIGI I++N+      A VN+ + A L REHN+ NVI L  R   +E     +  F S+ F   RH++R+DK++
  S:     5 IAIASDHAAFDMKAALTEWLRAEGHEVL------DLGPDSA-ASVDYPDYGYRLAEAIAAGEAARGIALCGSGIGISISVNRHPAARCALVNEVLSARLCREHNDANVIALGARLIGIEQAKACVSAFLSTGFAGDRHQRRVDKLS 143
>gi|15829083|ref|NP_326443.1| ribose-5-phosphate isomerase B [Mycoplasma pulmonis UAB CTIP] >gi|14090027|emb|CAC13785.1| RIBOSE-5-PHOSPHATE ISOMERASE [Mycoplasma pulmonis] (155 aa)
Score = 253, Expect = 1.2e-20, Identities = 63/141 (44%), Positives = 90/141 (63%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLK--DKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           K+ I SDH G+ +KE I+ +++  +  + +DLGT S +ES  Y +Y  K+ E +    +K  +GIGICGTG+GI  ALN+ +GI AA V    +A LA+ HNN NV+ L  R  S+E  V+II K+  S FE GRH  R++ I
  S:     3 KIAIASDHAGYSLKESIKKHYKD-QNYEVIDLGTNS-EESTSYSEYGHKLAEYMQNKDNKVDFGIGICGTGLGISYALNRHEGIIAARVTSEEDAYLAKAHNNANVLALGSRQISLEKAVKIIDKYQQSSFEGGRHIPRIEGI 143
>gi|15645199|ref|NP_207369.1| ribose-5-phosphate isomerase B [Helicobacter pylori 26695] >gi|2313693|gb|AAD07641.1| galactosidase acetyltransferase (lacA) [Helicobacter pylori 26695] (151 aa)
Score = 253, Expect = 1.3e-20, Identities = 57/147 (38%), Positives = 85/147 (57%)
  Q:     6 KQLKKIKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           K LK  +V+IGSDH G  + E ++     LE  DF  +  +     VDYPDYA+ + + +L++  SYGI +C TGIG+ +  N+ KGI AA       A++ R HNN NV+ L  + + +     I++ FFS+ FE GRH  R+ K+
  S:     3 KLLKFSQVFIGSDHAGLHLAEFVQ---RFLEDKDF-KIQAFLPTMRVDYPDYAKLVCQKVLENAQSYGILVCATGIGMSMGANRFKGIRAALCLDAYMAKMTRLHNNANVLCLGEKISGIGVVESILEAFFSTEFEQGRHVLRIQKL 145
>gi|58579090|ref|YP_197302.1| ribose-5-phosphate isomerase [Ehrlichia ruminantium str. Welgevonden] >gi|58617147|ref|YP_196346.1| ribose-5-phosphate isomerase [Ehrlichia ruminantium str. Gardel] >gi|58416759|emb|CAI27872.1| Ribose-5-phosphate isomerase [Ehrlichia ruminantium str. Gardel] >gi|58417716|emb|CAI26920.1| Ribose-5-phosphate isomerase [Ehrlichia ruminantium str. Welgevonden] (148 aa)
Score = 253, Expect = 1.3e-20, Identities = 57/141 (40%), Positives = 81/141 (57%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLEILDFV--DLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           K++I SDH G +++  I+     LE L +   D G    D  VDYPDY + +   +  +   +GI ICGTGIG+ IA N+ K + AA    T  A  AREHNN NV+ L  R+ + E    I+ KF ++ F  GRH +R++KI
  S:     5 KIFISSDHAGVELRLFIK---LYLESLSYTVEDYGCVISDVIVDYPDYVQDVVHCVTSNDSGFGILICGTGIGMSIAANRYKKVRAALCYTTELARFAREHNNANVLCLGARYITYEKAKLIVYKFLNTKFAEGRHTQRIEKI 144
>gi|46201724|ref|ZP_00208223.1| COG0698: Ribose 5-phosphate isomerase RpiB [Magnetospirillum magnetotacticum MS-1] (142 aa)
Score = 253, Expect = 1.3e-20, Identities = 56/139 (40%), Positives = 80/139 (57%)
  Q:    15 IGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKIT 153
           I  DHGG D+K+ +  +         +DLGT  G ESVDYPD+A K+ + L   K   G+ +CGTGIGI IA N+   I AA V+    A + R+HN+ NV+ + GR    E   + +K F  + FE GRH +R+ K++
  S:     3 IACDHGGVDLKDVLIKDLAA-SGWTVLDLGT-DGPESVDYPDFAVKLAQALKDGKAERGVLLCGTGIGISIAANRFDHIRAALVHDAFGARMCRQHNDANVLVMGGRTIGPEVARDCLKIFTETEFEGGRHARRVSKLS 139
>gi|116512341|ref|YP_809557.1| ribose-5-phosphate isomerase B [Lactococcus lactis subsp. cremoris SK11] >gi|116107995|gb|ABJ73135.1| ribose-5-phosphate isomerase [Lactococcus lactis subsp. cremoris SK11] (149 aa)
Score = 253, Expect = 1.3e-20, Identities = 58/148 (39%), Positives = 88/148 (59%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELL--EILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           +K+ IGSDH GF++K  I +  E L  E+ DF    T    E  DYP Y +K+ E +       G+ ICGTG+GI I+ NK++GI A   ++   A+L++EHNN N++    R    E    I+K++  + +E GRH KR++ IT+LE +
  S:     1 MKLAIGSDHVGFELKPLIIDYLEELGHEVTDFGPFST----ERTDYPIYGKKVAEEVAAGHFDGGVLICGTGVGISISANKVRGIRAVVCSEPYSAKLSKEHNNTNIVAFGSRVVGSELAKMIVKEWLEAIYEGGRHAKRIEMITELETE 146
>gi|78777314|ref|YP_393629.1| ribose-5-phosphate isomerase B [Sulfurimonas denitrificans DSM 1251] >gi|78497854|gb|ABB44394.1| ribose-5-phosphate isomerase [Sulfurimonas denitrificans DSM 1251] (145 aa)
Score = 252, Expect = 1.3e-20, Identities = 60/142 (42%), Positives = 83/142 (58%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEIL--DFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           +K YI +DH G D+K+      ELL+    + VDLG +  D  VDYPDYA K+ E +LKD  ++GI ICG+GIG+ +A N+   I AA  +    A +AR HN+ NV+    R         II  + +  FE GRHE+R+ KI
  S:     1 MKFYIATDHAGLDLKDY---TVELLKDKGHEVVDLGPFCKDR-VDYPDYATKVCEAVLKDNSAFGILICGSGIGMSMAANRYSNIRAALCHDAYTASVARGHNDANVLCFGERIIGKGVAESIIDAWIAGSFEGGRHEQRVAKI 140
>gi|150004854|ref|YP_001299598.1| ribose 5-phosphate isomerase B [Bacteroides vulgatus ATCC 8482] >gi|149933278|gb|ABR39976.1| ribose 5-phosphate isomerase B [Bacteroides vulgatus ATCC 8482] (144 aa)
Score = 252, Expect = 1.4e-20, Identities = 61/141 (43%), Positives = 85/141 (60%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLEI-LDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           KV + SDH GF++KE ++    L E      D GTYS  ES DY DYA  +   +   +   G+ ICG+G GI + LNK +GI AA       A L+R+HN+ NV+ + GRF   E   +I+ +FF+S FE GRH+KR++KI
  S:     3 KVGLASDHAGFELKEFVKT--WLTEKGYPCKDFGTYS-TESCDYADYAHPLALAIEAGECGPGVAICGSGEGISMTLNKHQGIRAALCWMPEIAHLSRQHNDANVLVMPGRFIDHEMAEKILDEFFNSGFEGGRHQKRIEKI 141
>gi|110639997|ref|YP_680207.1| ribose 5-phosphate isomerase B [Cytophaga hutchinsonii ATCC 33406] >gi|110282678|gb|ABG60864.1| ribose 5-phosphate isomerase B [Cytophaga hutchinsonii ATCC 33406] (145 aa)
Score = 252, Expect = 1.4e-20, Identities = 53/140 (37%), Positives = 81/140 (57%)
  Q:    13 VYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           + +G DH G+  K++I    E  +    +D G +S + SVDYPD++  + E +   K ++GI ICG+G G+C+  NK + I A        A L R+HNN NV+ L  RF  +E+ +  +K F  + FE GRHE R++KI
  S:     5 IALGGDHAGYTYKKEIIAYLET-QGHKTIDCGPFS-EASVDYPDFSHPVAEAVETGKATFGILICGSGNGVCMTANKHQHIRAGLCWTPEIAMLTRQHNNANVLCLPARFIPIEEAIACVKMFVETAFEGGRHEGRVNKI 142
>gi|116327140|ref|YP_796860.1| ribose-5-phosphate isomerase [Leptospira borgpetersenii serovar Hardjo-bovis L550] >gi|116332203|ref|YP_801921.1| ribose-5-phosphate isomerase [Leptospira borgpetersenii serovar Hardjo-bovis JB197] >gi|116119884|gb|ABJ77927.1| Ribose-5-phosphate isomerase [Leptospira borgpetersenii serovar Hardjo-bovis L550] >gi|116125892|gb|ABJ77163.1| Ribose-5-phosphate isomerase [Leptospira borgpetersenii serovar Hardjo-bovis JB197] (145 aa)
Score = 252, Expect = 1.4e-20, Identities = 57/146 (39%), Positives = 90/146 (61%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLEN 157
           K+ I SDHGGF++KE +R++  L   L+ +D GT   + SVDYP    +  + +L  +    I +CGTGIG  IA N++KGI AA  +    AE+++ HNN NV+ L GR    E  + I++ + ++ FE GRHE+R++++  L +
  S:     3 KIGIASDHGGFELKEFLRDS--LSRELEIIDYGT-KNETSVDYPIVISEACKKVLSKEVEGLIALCGTGIGASIAANRMKGIRAALCHDQFTAEMSKRHNNANVLVLGGRIVGKELALNIVRTWVNTVFEGGRHERRVNQLESLNS 145
>gi|108758725|ref|YP_632929.1| ribose 5-phosphate isomerase B [Myxococcus xanthus DK 1622] >gi|108462605|gb|ABF87790.1| ribose 5-phosphate isomerase B [Myxococcus xanthus DK 1622] (147 aa)
Score = 252, Expect = 1.5e-20, Identities = 56/148 (37%), Positives = 85/148 (57%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILD-----FVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           +KV + SDH G ++++      EL+  L        D+G  + D SVDYPD+A ++   +   + + G+ +CGTGIG+ I  NK KGI AA      EA +AR HN+ NV+ L  R         I++ F S+ FE GRHE+R+  I + E++
  S:     1 MKVILASDHAGLELRQ------ELVAALTARGVAHEDVGPVTRD-SVDYPDFAARVSRAVTSGEATLGVLVCGTGIGMSIVANKHKGIRAALCTTEFEARMARAHNDANVLCLGQRVVGAGVGRAILEAFLSTAFEGGRHERRVQMIREAESQ 146
>gi|160934460|ref|ZP_02081847.1| hypothetical protein CLOLEP_03333 [Clostridium leptum DSM 753] >gi|156867133|gb|EDO60505.1| hypothetical protein CLOLEP_03333 [Clostridium leptum DSM 753] (148 aa)
Score = 251, Expect = 1.7e-20, Identities = 55/145 (37%), Positives = 88/145 (60%)
  Q:    13 VYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLEN 157
           + +G+DHGG+ +KE ++   E   I  + D GT S +ESV+Y  YA ++ ++++  +   G+  CGTGIGI IA NK+KGI AA       AE+ R HN+ N++ + GR    +  V++   F ++ FE GRH +R+ +I  +EN
  S:     2 IALGADHGGYRLKEAVKAYLEEKGI-PYKDFGTDS-EESVNYGPYAYRVAQSIVSGECEKGVLCCGTGIGISIAANKVKGIRAAVCTNEFCAEMTRRHNDANILAMGGRVIDEKTAVKLADIFLNTPFEGGRHLERIQQIAAIEN 144
>gi|16799573|ref|NP_469841.1| hypothetical protein lin0498 [Listeria innocua Clip11262] >gi|16412938|emb|CAC95730.1| lin0498 [Listeria innocua] (149 aa)
Score = 251, Expect = 1.8e-20, Identities = 60/142 (42%), Positives = 86/142 (60%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           +++ I +DHGGF +KEK+R  H +       D G YS  ESVD+P+YA K+G + +  + S G+  CGTGIG+ IA NKIKG+ AA V+ T  A + R HNN NV+ L  R       + ++  + ++ FE GRH  RL K+
  S:     1 MEIAIAADHGGFQLKEKVRA-HLIESGYKVKDFGCYS-LESVDFPEYAAKVG-HFVATENSLGVLCCGTGIGMSIAANKIKGVRAAVVSDTFSAMMTRRHNNSNVLCLGERVLGDSLALLLLDTWLAAEFEGGRHMTRLAKL 139
>gi|53716279|ref|YP_106366.1| ribose 5-phosphate isomerase [Burkholderia mallei ATCC 23344] >gi|53721288|ref|YP_110273.1| ribose 5-phosphate isomerase [Burkholderia pseudomallei K96243] >gi|76818470|ref|YP_336948.1| ribose 5-phosphate isomerase B [Burkholderia pseudomallei 1710b] >gi|121598130|ref|YP_990413.1| ribose 5-phosphate isomerase [Burkholderia mallei SAVP1] >gi|124382139|ref|YP_001024907.1| ribose 5-phosphate isomerase [Burkholderia mallei NCTC 10229] >gi|126442535|ref|YP_001061460.1| ribose 5-phosphate isomerase B [Burkholderia pseudomallei 668] >gi|126446178|ref|YP_001079249.1| ribose 5-phosphate isomerase [Burkholderia mallei NCTC 10247] >gi|126458171|ref|YP_001074402.1| ribose 5-phosphate isomerase B [Burkholderia pseudomallei 1106a] >gi|134280673|ref|ZP_01767383.1| ribose 5-phosphate isomerase B [Burkholderia pseudomallei 305] >gi|161360228|ref|ZP_02106092.1| ribose 5-phosphate isomerase B [Burkholderia pseudomallei 1106b] >gi|167002059|ref|ZP_02267849.1| ribose 5-phosphate isomerase B [Burkholderia mallei PRL-20] >gi|167722246|ref|ZP_02405482.1| ribose 5-phosphate isomerase B [Burkholderia pseudomallei DM98] >gi|167741244|ref|ZP_02414018.1| ribose 5-phosphate isomerase B [Burkholderia pseudomallei 14] >gi|167818421|ref|ZP_02450101.1| ribose 5-phosphate isomerase B [Burkholderia pseudomallei 91] >gi|167826807|ref|ZP_02458278.1| ribose 5-phosphate isomerase B [Burkholderia pseudomallei 9] >gi|167896873|ref|ZP_02484275.1| ribose 5-phosphate isomerase B [Burkholderia pseudomallei 7894] >gi|167905259|ref|ZP_02492464.1| ribose 5-phosphate isomerase B [Burkholderia pseudomallei NCTC 13177] >gi|167913562|ref|ZP_02500653.1| ribose 5-phosphate isomerase B [Burkholderia pseudomallei 112] >gi|167921501|ref|ZP_02508592.1| ribose 5-phosphate isomerase B [Burkholderia pseudomallei BCC215] >gi|194315271|ref|YP_002011493.1| ribose 5-phosphate isomerase [Burkholderia mallei ATCC 10399] >gi|194503177|ref|YP_002032753.1| ribose 5-phosphate isomerase B [Burkholderia pseudomallei 1655] >gi|194509555|ref|YP_002022086.1| ribose 5-phosphate isomerase B [Burkholderia pseudomallei Pasteur 52237] >gi|194517295|ref|YP_002053005.1| ribose 5-phosphate isomerase B [Burkholderia pseudomallei S13] >gi|194521580|ref|YP_002057115.1| ribose 5-phosphate isomerase [Burkholderia mallei FMH] >gi|194530806|ref|YP_002066326.1| ribose 5-phosphate isomerase [Burkholderia mallei JHU] >gi|194568844|ref|YP_002103848.1| ribose 5-phosphate isomerase B [Burkholderia pseudomallei 406e] >gi|194577327|ref|YP_002112207.1| ribose 5-phosphate isomerase [Burkholderia mallei 2002721280] >gi|52211702|emb|CAH37700.1| putative ribose 5-phosphate isomerase [Burkholderia pseudomallei K96243] >gi|52422249|gb|AAU45819.1| ribose 5-phosphate isomerase [Burkholderia mallei ATCC 23344] >gi|76582943|gb|ABA52417.1| ribose 5-phosphate isomerase B [Burkholderia pseudomallei 1710b] >gi|121225928|gb|ABM49459.1| ribose 5-phosphate isomerase [Burkholderia mallei SAVP1] >gi|124290159|gb|ABM99428.1| ribose 5-phosphate isomerase [Burkholderia mallei NCTC 10229] >gi|126222026|gb|ABN85531.1| ribose 5-phosphate isomerase B [Burkholderia pseudomallei 668] >gi|126231939|gb|ABN95352.1| ribose 5-phosphate isomerase B [Burkholderia pseudomallei 1106a] >gi|126239032|gb|ABO02144.1| ribose 5-phosphate isomerase [Burkholderia mallei NCTC 10247] >gi|134247695|gb|EBA47779.1| ribose 5-phosphate isomerase B [Burkholderia pseudomallei 305] >gi|147745590|gb|EDK52669.1| ribose 5-phosphate isomerase [Burkholderia mallei FMH] >gi|147754816|gb|EDK61880.1| ribose 5-phosphate isomerase [Burkholderia mallei JHU] >gi|148025024|gb|EDK83193.1| ribose 5-phosphate isomerase [Burkholderia mallei 2002721280] >gi|157809315|gb|EDO86485.1| ribose 5-phosphate isomerase B [Burkholderia pseudomallei 406e] >gi|157937123|gb|EDO92793.1| ribose 5-phosphate isomerase B [Burkholderia pseudomallei Pasteur 52237] >gi|160696987|gb|EDP86957.1| ribose 5-phosphate isomerase [Burkholderia mallei ATCC 10399] >gi|169652095|gb|EDS84788.1| ribose 5-phosphate isomerase B [Burkholderia pseudomallei S13] >gi|184213245|gb|EDU10288.1| ribose 5-phosphate isomerase B [Burkholderia pseudomallei 1655] (164 aa)
Score = 251, Expect = 1.9e-20, Identities = 53/148 (35%), Positives = 83/148 (56%)
  Q:    11 IKVYIGSDHGGFDMKEKI----RNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           +KV IG D   + +KE I    R  H  LE++DF   GT+S DE+V YPD A ++ + +   +    I +CGTGIG+ I+ NK+ GI AA  + T  AE AR  N+  ++T+  R    E    I+  +  + F+ GR + ++ +I   E +
  S:     1 MKVAIGCDEAAYALKESIKRHLRATHPELELVDF---GTHSADEAVLYPDIAIEVAQRVAAGEFPRAILLCGTGIGVAISANKVPGIRAAQCHDTYSAERARRSNDAQIVTMGARVIGTELANSIVDAWLRAEFDGGRSQPKVQRIADYERR 149
>gi|67471315|ref|XP_651609.1| ribose 5-phosphate isomerase, putative [Entamoeba histolytica HM-1:IMSS] >gi|56468369|gb|EAL46223.1| ribose 5-phosphate isomerase, putative [Entamoeba histolytica HM-1:IMSS] (146 aa)
Score = 251, Expect = 2.0e-20, Identities = 57/146 (39%), Positives = 87/146 (59%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLE 156
           ++V IGSDH GF +KE ++  + + + +   D+GTYS  E  DYPD+AEK+   ++K  G  GI +CG+GIGI IA NKI G+  A  +    A + R HN+ N+I    R    +   +++  F S+ F+  +H  R++KI KLE
  S:     1 MEVIIGSDHAGFPLKEIVKK-YLIEKGIKVNDMGTYS-TERCDYPDFAEKVAREVVK-TGKKGILVCGSGIGISIAANKINGVRCALCHDHYTAVMCRRHNDANIIAFGARVIGSDIATDMVDVFLSTPFDGMQHTARVEKIHKLE 143
>gi|157736886|ref|YP_001489569.1| ribose-5-phosphate isomerase B [Arcobacter butzleri RM4018] >gi|157698740|gb|ABV66900.1| ribose 5-phosphate isomerase [Arcobacter butzleri RM4018] (151 aa)
Score = 250, Expect = 2.6e-20, Identities = 59/145 (40%), Positives = 88/145 (60%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKL 155
           +K +IG+DH G ++K  +++  E        DLG ++ D  VDYPDYA K+ + +L+++G+ GI ICG+G+G+ +A NK  GI AA  +    A +AR+HN+ NVI L  R +       IIK +  + FE GRHE R+ KI  L
  S:     1 MKYFIGADHAGIEIKAFVKDLFEQ-RGHQVEDLGPFNKDR-VDYPDYASKVCKKVLENEGTMGILICGSGLGMSMAANKFDGIRAALCHNEYSARMARKHNDANVICLGERVSGEGMIEAIIKAWDKAEFEGGRHEGRVAKINAL 143
>gi|76556233|emb|CAD48942.1| ribose-5-phosphate isomerase 3 [Propionibacterium freudenreichii subsp. shermanii] (160 aa)
Score = 250, Expect = 2.6e-20, Identities = 55/147 (37%), Positives = 87/147 (59%)
  Q:    11 IKVYIGSDHGGFDMKEKIR-----NNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLEN 157
           +++ +GSDH GFD+KE ++       HE+      +D+GT+S  ESVDYP Y       +   + +  I +CGTG+GI I+ NK+ GI  A  +    A ++R HN+ N + L GR  +     EI+  + ++ FE GRH +R+ +IT LE+
  S:     1 MRIAMGSDHAGFDLKEHLKEYLQGKGHEV------IDVGTHS-TESVDYPIYGAAAARKVADGEAATAIVVCGTGVGIGISANKVHGIRCAITSDVYAARMSRAHNDANALALGGRVVADGLAEEIVDVWLATDFEGGRHARRVGEITALED 145
>gi|163943006|ref|YP_001647890.1| ribose-5-phosphate isomerase B [Bacillus weihenstephanensis KBAB4] >gi|163865203|gb|ABY46262.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Bacillus weihenstephanensis KBAB4] (147 aa)
Score = 250, Expect = 2.8e-20, Identities = 57/148 (38%), Positives = 86/148 (58%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           +KV + SDHGG ++++++ +  E L I +++DLG      SVDYPD+A    E +   +   GI +CGTGIG+ IA NK+ GI  A V+ T  A+  REHN+ N++ +  R        +I K +  + +E GRHE R+ KI   E K
  S:     1 MKVVVASDHGGMNIRKELVSLLEELNI-EYIDLGCECEAGSVDYPDFAFPAAEMVANGEVDRGILVCGTGIGMSIAANKVNGIRCALVHDTFSAKATREHNDTNMLAMGERVIGAGLARDIAKIWLITDYEGGRHENRVGKIKTYETK 147
>gi|32476635|ref|NP_869629.1| ribose 5-phosphate epimerase (pentose phosphate) [Rhodopirellula baltica SH 1] >gi|32447181|emb|CAD77007.1| ribose 5-phosphate epimerase (pentose phosphate) [Rhodopirellula baltica SH 1] (157 aa)
Score = 250, Expect = 2.8e-20, Identities = 56/147 (38%), Positives = 84/147 (57%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLEN 157
           IKV + SDH G  +K ++    +  E  +  D GT S D  VDYPD+A ++ E +   +   GI ICGTGIG+ I  NK  G+ AA+    +  E++R HN+VNV+ L G         E++  +  + FE GRH +R+DKIT +++
  S:     3 IKVGLASDHRGVHIKARLLQTLQR-EGFEVCDEGTDSTD-PVDYPDFAIRVAEQIRDGRLDRGILICGTGIGMAIVANKFHGVRAASCYDEVIVEMSRRHNDVNVLCLPGDLIGERPVDELVLMWLRTDFECGRHAQRVDKITAIDS 147
>gi|34557704|ref|NP_907519.1| ribose-5-phosphate isomerase B [Wolinella succinogenes DSM 1740] >gi|34483421|emb|CAE10419.1| RIBOSE 5-PHOSPHATE ISOMERASE [Wolinella succinogenes] (143 aa)
Score = 250, Expect = 2.8e-20, Identities = 57/141 (40%), Positives = 84/141 (59%)
  Q:    14 YIGSDHGGFDMKEKIR-----NNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITK 154
           +I +DH GF +K+ ++       HE+      +DLG  S D  VDYPDYA ++ + +L+++ S GI ICGTGIG+ I  N+ KGI AA  +    A L R HN+ NV+ +  R   +     I++ F S+ FE GRH  R+ KI +
  S:     4 FIATDHAGFSIKDHVKEFIRQKGHEV------IDLGPASADR-VDYPDYAHELCQKVLENRESAGILICGTGIGMSITANRHKGIRAALCHDAYTATLTRMHNDANVLCMGERVVGLGVVDSILEAFLSTPFEGGRHACRIGKIEQ 142
>gi|88711639|ref|ZP_01105727.1| ribose 5-phosphate isomerase B, putative [Flavobacteriales bacterium HTCC2170] >gi|88710580|gb|EAR02812.1| ribose 5-phosphate isomerase B, putative [Flavobacteriales bacterium HTCC2170] (156 aa)
Score = 250, Expect = 2.8e-20, Identities = 60/148 (40%), Positives = 93/148 (62%)
  Q:     5 KKQLKKIKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANV-NKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           K  L K+K+ IG+DH G + K  I    + + I +  + GT  G +SVDYPD+   + +++ + K +YGI ICG+G G  +  NK + I  A   NK I  +LAREHN+ N+++L  RF S+   +E++K F ++ FE GRHE+R++KI
  S:     8 KLTLTKMKISIGNDHAGTEYKLAIIGLLKSMNI-EVSNYGT-DGTDSVDYPDFVHPVAKDVEEGKVNYGIIICGSGNGASMTANKHQKIRCALCWNKEI-VQLAREHNDANILSLPARFLSLAQALEMVKVFLNTKFEGGRHERRIEKI 153
>gi|150026516|ref|YP_001297342.1| ribose 5-phosphate isomerase [Flavobacterium psychrophilum JIP02/86] >gi|149773057|emb|CAL44541.1| Ribose 5-phosphate isomerase [Flavobacterium psychrophilum JIP02/86] (142 aa)
Score = 249, Expect = 2.9e-20, Identities = 58/143 (40%), Positives = 89/143 (62%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFV--DLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKIT 153
           +K+ IG+DH G D K+ I    + LE    +  + GT S D SVDYPD+  K+  ++   K  +GI ICG+G GI ++ NK +GI AA       A LAR+HN+ N+I++  R+TS++  +E++  F ++ FE GRH  R+ KI+
  S:     1 MKISIGNDHAGPDYKKAIV---QFLEQKGHIITNHGTDSFD-SVDYPDFGHKVAIDVTNRKADFGIIICGSGNGIAMSANKHQGIRAALCWTKEIASLARQHNDANIISIPARYTSIQQAIEMVDTFLNTTFEGGRHATRVGKIS 141
>gi|15611588|ref|NP_223239.1| ribose-5-phosphate isomerase B [Helicobacter pylori J99] >gi|4155066|gb|AAD06102.1| RIBOSE 5-PHOSPHATE ISOMERASE [Helicobacter pylori J99] (151 aa)
Score = 249, Expect = 2.9e-20, Identities = 55/147 (37%), Positives = 84/147 (57%)
  Q:     6 KQLKKIKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           K L   +V+IGSDH G  + E +++    LE   F  +  +     VDYPDYA+ + + +L++  SYGI +C TGIG+ +  N+ KGI AA       A++ R HNN NV+ L  + + +     I++ FFS+ FE GRH  R+ K+
  S:     3 KPLNTAQVFIGSDHAGLHLAEFVKH---FLEDKRF-KIQAFLPTTRVDYPDYAKLVCQKVLENAQSYGILVCATGIGMSMGANRFKGIRAALCLDAYMAKMTRLHNNANVLCLGEKISGIGVAESILEAFFSTEFEQGRHVLRIQKL 145
>gi|71083739|ref|YP_266459.1| ribose-5-phosphate isomerase [Candidatus Pelagibacter ubique HTCC1062] >gi|91763225|ref|ZP_01265189.1| ribose-5-phosphate isomerase [Candidatus Pelagibacter ubique HTCC1002] >gi|71062852|gb|AAZ21855.1| ribose-5-phosphate isomerase [Candidatus Pelagibacter ubique HTCC1062] >gi|91717638|gb|EAS84289.1| ribose-5-phosphate isomerase [Candidatus Pelagibacter ubique HTCC1002] (141 aa)
Score = 249, Expect = 2.9e-20, Identities = 55/141 (39%), Positives = 87/141 (61%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           K+++ SDH G+ +KE I+ + +  +I ++ DLG ++  ESVDYPDYA K+ + +  +    GI +CG+G+G+ IA N+ K I AA        +L+R HNN N+ITL  R  + +  +  +  F ++ FE GRH KR+ KI
  S:     3 KIFLSSDHAGYKLKELIKLHLDKKKI-NYTDLGPFN-SESVDYPDYAHKVAKKVKTNNNHAGILVCGSGMGMNIAANRHKNIRAAQCFNLKSTKLSRLHNNANIITLGSRLLTKKTAINCVSVFLNTKFEGGRHAKRIKKI 141
>gi|91202679|emb|CAJ72318.1| strongly similar to ribose 5-phosphate isomerase B, also acts on allose (allose 6-phosphate isomerase) [Candidatus Kuenenia stuttgartiensis] (169 aa)
Score = 249, Expect = 3.0e-20, Identities = 56/147 (38%), Positives = 84/147 (57%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLEN 157
           +K+ I SDH G+D KE+I+   + L      D GT S  ESVDYPD+  K   ++   +   GI ICGTGIG+ +  NK++G+ A   +     E++R HN+ NV+ +       E   + +K +  + FE GRH +RL+KI +LEN
  S:    20 MKIAIASDHRGYDFKERIKVTLKELG-HSVTDFGTSSKSESVDYPDFGMKAALSVGHGECDRGILICGTGIGMSLVANKVRGVRATLCHNLYTVEMSRRHNDANVLCIGADIIDEELLEQKVKLWLETPFEGGRHARRLEKIVELEN 165
>gi|78222814|ref|YP_384561.1| ribose-5-phosphate isomerase [Geobacter metallireducens GS-15] >gi|78194069|gb|ABB31836.1| ribose-5-phosphate isomerase [Geobacter metallireducens GS-15] (148 aa)
Score = 249, Expect = 3.0e-20, Identities = 58/146 (39%), Positives = 82/146 (56%)
  Q:    13 VYIGSDHGGFDMKEKIRNNHELLEI---LDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           + +GSDHGG ++KE I+    LL     +   D GT +G+ SVDYPD+  K+   +   +   GI  CGTGIG+ I  NK   + AA       A +A+EHNN N++ L GR        E++  +  + FE GRH+ RLDKI  LE +
  S:     2 ILVGSDHGGLELKEAIK----LLLTERGITVEDCGTDNGN-SVDYPDFGIKVARKISAGEAEKGILFCGTGIGMSIVANKFPNVRAALATDPFMARMAKEHNNANILVLGGRVLDEATAREMVCVWLDATFEGGRHQGRLDKIAALEKE 145
>gi|51893475|ref|YP_076166.1| ribose-5-phosphate isomerase B [Symbiobacterium thermophilum IAM 14863] >gi|51857164|dbj|BAD41322.1| ribose 5-phosphate isomerase [Symbiobacterium thermophilum IAM 14863] (154 aa)
Score = 249, Expect = 3.6e-20, Identities = 54/148 (36%), Positives = 89/148 (60%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELL--EILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           +++ IG+DH G +MK  I  + E L  E+++F   GT S  E  DYP Y E++   +   +   GI ICGTG+GI +A NK++GI A   ++   A L+++HNN N++    R   V+    I+ ++ ++ FE GRH++R+D I  +E +
  S:     1 MRIAIGNDHVGTEMKRAIAAHLESLGHEVVNF---GTDS-TERTDYPIYGERVARAVAAGEVDCGILICGTGVGISLAANKVRGIRAVVCSEPYTARLSKQHNNTNILAFGARVVGVDLAKMIVDEWLNASFEGGRHQRRVDMIADIERR 146
>gi|26250907|ref|NP_756947.1| ribose-5-phosphate isomerase B [Escherichia coli CFT073] >gi|26111339|gb|AAN83521.1|AE016771_32 Ribose 5-phosphate isomerase B [Escherichia coli CFT073] (149 aa)
Score = 249, Expect = 3.7e-20, Identities = 53/147 (36%), Positives = 84/147 (57%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           K+  G DH GF +K +I   H +   ++ +D GT+S  E  DYP YA ++   +   +   GI ICGTG+GI IA NK  GI A   ++   A+L+R+HN+ NV+    R   +E    I+  +  + +E GRH++R++ IT +E +
  S:     3 KIAFGCDHVGFILKHEIVA-HLVERGVEVIDKGTWS-SERTDYPHYASQVALAVAGGEADGGILICGTGVGISIAANKFAGIRAVVCSEPYSAQLSRQHNDTNVLAFGSRVVGLELAKMIVDAWLGAQYEGGRHQQRVEAITAIEQQ 147
>gi|34810961|pdb|1NN4|A Chain A, Structural Genomics, RpibALSB >gi|34810962|pdb|1NN4|B Chain B, Structural Genomics, RpibALSB >gi|34810963|pdb|1NN4|C Chain C, Structural Genomics, RpibALSB >gi|34810964|pdb|1NN4|D Chain D, Structural Genomics, RpibALSB (162 aa)
Score = 248, Expect = 4.4e-20, Identities = 56/152 (36%), Positives = 87/152 (57%)
  Q:     7 QLKKIKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           Q+KKI    G DH GF +K +I   H +   ++ +D GT+S  E  DYP YA ++   +   +   GI ICGTG+GI IA NK  GI A   ++   A+L+R+HN+ NV+    R   +E    I+  +  + +E GRH++R++ IT +E +
  S:    13 QMKKIA--FGCDHVGFILKHEIVA-HLVERGVEVIDKGTWS-SERTDYPHYASQVALAVAGGEVDGGILICGTGVGISIAANKFAGIRAVVCSEPYSAQLSRQHNDTNVLAFGSRVVGLELAKMIVDAWLGAQYEGGRHQQRVEAITAIEQR 160
>gi|24213069|ref|NP_710550.1| ribose 5-phosphate isomerase B [Leptospira interrogans serovar Lai str. 56601] >gi|45656221|ref|YP_000307.1| ribose 5-phosphate isomerase B [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] >gi|24193764|gb|AAN47568.1|AE011224_7 Ribose 5-phosphate isomerase B [Leptospira interrogans serovar Lai str. 56601] >gi|45599455|gb|AAS68944.1| ribose 5-phosphate isomerase B [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] (145 aa)
Score = 248, Expect = 4.4e-20, Identities = 57/146 (39%), Positives = 87/146 (59%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLEN 157
           K+ I SDHGGF++KE +R +  L   L+ VD GT   + SVDYP       + +L  +    I +CGTGIG  IA N++ GI AA  +    AE+++ HNN NV+ L GR    E  + I++ + ++ FE GRHE+R++++  L +
  S:     3 KIGIASDHGGFELKEFLRKS--LAGELEIVDYGT-KDESSVDYPIVISAACKKVLSKEVEGLIALCGTGIGASIAANRMSGIRAALCHDQFTAEMSKRHNNANVLVLGGRIIGKELALNIVRTWINTSFEGGRHERRVNQLETLNS 145
>gi|103486284|ref|YP_615845.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Sphingopyxis alaskensis RB2256] >gi|98976361|gb|ABF52512.1| ribose-5-phosphate isomerase [Sphingopyxis alaskensis RB2256] (150 aa)
Score = 248, Expect = 4.5e-20, Identities = 49/143 (34%), Positives = 86/143 (60%)
  Q:    11 IKVYIGSDHGGFDMKEKIRN-----NHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKIT 153
           +++ I +DH  +++K  + +      HE+       DLGT +G +SVDYPDY  ++G  +   +   G+ +CG+GIGI I++N+      A V++ + A+LAREHN+ NVI +  R T ++     +  F ++ F   RH +R+DK++
  S:     1 MRIAIAADHAAYELKALLADWLREKGHEV------EDLGT-NGPDSVDYPDYGYRLGGAIADGRADRGVALCGSGIGISISVNRNPAARCALVSEPLSAKLAREHNDANVIAMGARLTGIDMAKACLDAFLTTDFAGDRHARRVDKLS 141
>gi|56552096|ref|YP_162935.1| ribose 5-phosphate isomerase [Zymomonas mobilis subsp. mobilis ZM4] >gi|56543670|gb|AAV89824.1| ribose 5-phosphate isomerase [Zymomonas mobilis subsp. mobilis ZM4] (157 aa)
Score = 247, Expect = 4.9e-20, Identities = 55/153 (35%), Positives = 83/153 (54%)
  Q:     1 MSESKKQLKKIKVYIGSDHGGFDMKEKIRN-----NHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKIT 153
           M+ +     K K+ I SDH  F++K  +        HE+       DLG +  + SVDYPDY  K+   + +    +GI +CG+GIGI IA+N+      A +   + A LAREHNN NVI +  R   +E   + I  F ++ F   RH +R+DK++
  S:     1 MTSAVPSNTKKKLVIASDHAAFELKSTLITWLKELGHEV------EDLGPHE-NHSVDYPDYGYKLAVAIAEKTADFGIALCGSGIGISIAVNRHPAARCALITDNLTARLAREHNNANVIAMGARLIGIETAKDCISAFLATPFGGERHVRRIDKLS 151
>gi|126701103|ref|YP_001090000.1| ribose-5-phosphate isomerase 2 [Clostridium difficile 630] >gi|145952634|ref|ZP_01801643.1| hypothetical protein CdifQ_04004010 [Clostridium difficile QCD-32g58] >gi|168697769|ref|ZP_02730046.1| ribose-5-phosphate isomerase 2 [Clostridium difficile QCD-37x79] >gi|168714960|ref|ZP_02747237.1| ribose-5-phosphate isomerase 2 [Clostridium difficile QCD-63q42] >gi|168726404|ref|ZP_02758681.1| ribose-5-phosphate isomerase 2 [Clostridium difficile QCD-76w55] >gi|168730150|ref|ZP_02762427.1| ribose-5-phosphate isomerase 2 [Clostridium difficile QCD-97b34] >gi|196124987|ref|ZP_03116736.1| ribose-5-phosphate isomerase 2 [Clostridium difficile ATCC 43255] >gi|196162313|ref|ZP_03122874.1| ribose-5-phosphate isomerase 2 [Clostridium difficile CIP 107932] >gi|115252540|emb|CAJ70383.1| ribose-5-phosphate isomerase 2 [Clostridium difficile 630] (150 aa)
Score = 247, Expect = 5.1e-20, Identities = 54/148 (36%), Positives = 92/148 (62%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           +K+ +G DHGG+++K++I +  E   I + VD GT +  +SVDYP Y E +  +++  +  YGI  CGTGIGI +A NK+ GI  A V+    A++++ HN+ N+++L  R       +EI++ + ++ FE  RH +R++ I  +E K
  S:     1 MKIGLGCDHGGYNLKKEIISYLESKGI-ECVDYGTNNATDSVDYPVYGEIVANSVINKEVDYGILCCGTGIGISLAANKVPGIRCAVVSDVFSAKMSKAHNDANMLSLGERVLGKGLALEIVEAWINTDFEGDRHARRVNMIKSIEEK 147
>gi|170718713|ref|YP_001783903.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Haemophilus somnus 2336] >gi|168826842|gb|ACA32213.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Haemophilus somnus 2336] (157 aa)
Score = 247, Expect = 6.1e-20, Identities = 60/144 (41%), Positives = 82/144 (56%)
  Q:    13 VYIGSDHGGFDMK----EKI-RNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLE 156
           + IGSDH G  +K    EK+ +  H LL      DLG  S  E  DYP YAEK+   + ++    GI ICGTG+GI IA NKI GI  A  +  + A + REHNN N+I       S E  + +   + ++ ++ GRH+KRLD +  LE
  S:     4 IAIGSDHIGLALKTFLIEKLEKQGHNLL------DLGAVS-QERTDYPIYAEKVAYAVKRNVADVGILICGTGVGISIAANKISGIRCALCSDELTALMCREHNNCNIIAFGANIISSEKAISLATLWLNTPYDGGRHQKRLDMMEMLE 145
>gi|153165768|ref|ZP_01926459.1| ribose 5-phosphate isomerase B [Listeria monocytogenes FSL N1-017] >gi|133728126|gb|EBA29824.1| ribose 5-phosphate isomerase B [Listeria monocytogenes FSL N1-017] (149 aa)
Score = 247, Expect = 6.3e-20, Identities = 60/146 (41%), Positives = 87/146 (59%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLE 156
           +++ I +DHGGF +KEKIR  H +       D G YS  ESVD+P+YA K+G + +  + S G+  CGTGIG+ +A NKIKG+ AA V+    A + R  NN NV+ L  R       + ++  + ++ FE GRH  RL K+ +LE
  S:     1 MEIAIAADHGGFQLKEKIRA-HLIESGYTVKDFGCYS-LESVDFPEYAAKVG-HFVATENSLGVLCCGTGIGMSMAANKIKGVRAAVVSDAFSAMMTRRQNNSNVLCLGERVLGDSLALLLLDTWLAAEFEGGRHNTRLAKLAELE 143
>gi|146092218|ref|XP_001470236.1| ribose 5-phosphate isomerase [Leishmania infantum] >gi|134085030|emb|CAM69431.1| ribose 5-phosphate isomerase, putative [Leishmania infantum] (172 aa)
Score = 246, Expect = 6.5e-20, Identities = 55/147 (37%), Positives = 85/147 (57%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSH-FESGRHEKRLDKITKLENK 158
           +V +G DH  +   ++I +          V     S D SVDYPDYA ++ E +LK +   GI +CGTGIG+ IA NK +GI AA     + A+L+R+HNN +++ +  R + +E   +II+ F ++     GRH  R+DKIT +E +
  S:     4 RVALGCDHAAYATHQEIMDMVNASGAASKVMYMGPSSDTSVDYPDYAAQVCEAILKGEADTGILVCGTGIGMSIAANKFRGIRAALCYDHVTAQLSRQHNNAHILCIGVRTSGMEVIRDIIETFLTTEPLAEGRHGNRVDKITVIEEE 151
>gi|110644448|ref|YP_672178.1| ribose-5-phosphate isomerase B [Escherichia coli 536] >gi|191171978|ref|ZP_03033523.1| ribose 5-phosphate isomerase B [Escherichia coli F11] >gi|110346040|gb|ABG72277.1| ribose 5-phosphate isomerase B [Escherichia coli 536] >gi|190907743|gb|EDV67337.1| ribose 5-phosphate isomerase B [Escherichia coli F11] (149 aa)
Score = 246, Expect = 6.6e-20, Identities = 53/147 (36%), Positives = 83/147 (56%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           K+  G DH GF +K +I   H +   ++ +D GT+S  E  DYP YA  +   +   +   GI ICGTG+GI IA NK  GI A   ++   A+L+R+HN+ NV+    R   +E    I+  +  + +E GRH++R++ IT +E +
  S:     3 KIAFGCDHVGFILKHEIVA-HLVERGVEVIDKGTWS-SERTDYPHYASHVALAVAGGEADGGILICGTGVGISIAANKFAGIRAVVCSEPYSAQLSRQHNDTNVLAFGSRVVGLELAKMIVDAWLGAQYEGGRHQQRVEAITAIEQR 147
>gi|83319834|ref|YP_424069.1| ribose 5-phosphate isomerase B, putative [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|83283720|gb|ABC01652.1| ribose 5-phosphate isomerase B, putative [Mycoplasma capricolum subsp. capricolum ATCC 27343] (165 aa)
Score = 246, Expect = 6.7e-20, Identities = 57/146 (39%), Positives = 87/146 (59%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLEN 157
           ++YIG+DH   +MK+ I N H   +  + +DLG   G +S +Y    + + E ++KD  S GI ICGTGIGI IA NK+K   AA V +    ELAR HN+ N+I L  R  ++   + ++  F ++ FE GRH +R+D + + +N
  S:    22 RIYIGNDHSAVEMKQAIVN-HLKSKNYEVIDLGNNDG-KSCNYAKIGQTVAEYVVKDTNSRGIVICGTGIGISIAANKVKNARAALVYEKETTELARIHNDANIIALGARMIAIPKAINLVDIFLNTPFEGGRHIERVDTLNEYKN 165
>gi|115522599|ref|YP_779510.1| ribose 5-phosphate isomerase B [Rhodopseudomonas palustris BisA53] >gi|115516546|gb|ABJ04530.1| ribose-5-phosphate isomerase [Rhodopseudomonas palustris BisA53] (120 aa)
Score = 246, Expect = 7.0e-20, Identities = 44/116 (37%), Positives = 71/116 (61%)
  Q:    41 VDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLE 156
           +D G  +G+   DYP YA ++G+ +  ++GS+G   CG+G+GI IA NK+ G+     ++   A +AR HNN N++ L  R   VE  + I+  F ++ FE GRH++RL  I+ +E
  S:     1 MDFGVAAGERG-DYPTYASRVGQAVASNEGSFGFLFCGSGVGISIAANKVPGVRCVVCSEPYSALMARRHNNANILALGQRVVGVELALLIVDTFLNAEFEEGRHQRRLAMISAIE 115
>gi|91213638|ref|YP_543624.1| ribose-5-phosphate isomerase B [Escherichia coli UTI89] >gi|117626378|ref|YP_859701.1| ribose-5-phosphate isomerase B [Escherichia coli APEC O1] >gi|91075212|gb|ABE10093.1| ribose 5-phosphate isomerase B [Escherichia coli UTI89] >gi|115515502|gb|ABJ03577.1| ribose 5-phosphate isomerase B [Escherichia coli APEC O1] (149 aa)
Score = 246, Expect = 7.1e-20, Identities = 53/147 (36%), Positives = 84/147 (57%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           K+  G DH GF +K +I   H +   ++ +D GT+S  E  DYP YA ++   +   +   GI ICGTG+GI IA NK  GI A   ++   A+L+R+HN+ NV+    R   +E    I+  +  + +E GRH++R++ IT +E +
  S:     3 KIAFGCDHVGFILKHEIVA-HLVERDVEVIDKGTWS-LERTDYPHYASQVALAVAGGEADGGILICGTGVGISIAANKFAGIRAVVCSEPYSAQLSRQHNDTNVLAFGSRVVGLELAKMIVDAWLGAQYEGGRHQQRVEAITAIEQQ 147
>gi|34541372|ref|NP_905851.1| ribose 5-phosphate isomerase B, putative [Porphyromonas gingivalis W83] >gi|188995552|ref|YP_001929804.1| putative ribose 5-phosphate isomerase B [Porphyromonas gingivalis ATCC 33277] >gi|34397689|gb|AAQ66750.1| ribose 5-phosphate isomerase B, putative [Porphyromonas gingivalis W83] >gi|188595232|dbj|BAG34207.1| putative ribose 5-phosphate isomerase B [Porphyromonas gingivalis ATCC 33277] (145 aa)
Score = 246, Expect = 7.1e-20, Identities = 56/138 (40%), Positives = 84/138 (60%)
  Q:    15 IGSDHGGFDMKEKIRN--NHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           I SDH G+++KE+++     + +   DF   G +S  ESVDYPD+A  +G  + + + + GI ICG+G GI + +NK   + AA       A LAR+HN+ NV++L  RF S E    I+K +  + FE GRH+ R+DKI
  S:     6 ICSDHAGYELKERVKAWLAEQGITTKDF---GCHS-SESVDYPDFAHPLGSAIERGELNRGISICGSGNGISMVMNKYPHVRAALCWTEEIARLARQHNDANVLSLPARFISDEQAKAILKIYLETPFEGGRHKARIDKI 141
>gi|157871860|ref|XP_001684479.1| ribose 5-phosphate isomerase, putative [Leishmania major] >gi|68127548|emb|CAJ05599.1| ribose 5-phosphate isomerase, putative [Leishmania major] (172 aa)
Score = 246, Expect = 7.8e-20, Identities = 55/147 (37%), Positives = 84/147 (57%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSH-FESGRHEKRLDKITKLENK 158
           +V +G DH  +    +I +       +  V     S D SVDYPDYA ++ E +LK +   GI +CGTGIG+ IA NK +GI AA     + A+L+R+HNN +++ +  R + +E   +II  F ++     GRH  R+DKIT +E +
  S:     4 RVALGCDHAAYAAHREIMDMISASGAVSKVMYMGPSSDTSVDYPDYAAQVCEAILKGEADAGILVCGTGIGMSIAANKFRGIRAALCYDHVTAQLSRQHNNAHILCIGVRTSGMEIIRDIITTFLTTEPLAEGRHSNRVDKITVIEEE 151
>gi|16131916|ref|NP_418514.1| ribose 5-phosphate isomerase B/allose 6-phosphate isomerase [Escherichia coli str. K-12 substr. MG1655] >gi|89110812|ref|AP_004592.1| ribose 5-phosphate isomerase B/allose 6-phosphate isomerase [Escherichia coli W3110] >gi|170021910|ref|YP_001726864.1| ribose 5-phosphate isomerase B [Escherichia coli ATCC 8739] >gi|170083544|ref|YP_001732864.1| ribose 5-phosphate isomerase B/allose 6-phosphate isomerase [Escherichia coli str. K12 substr. DH10B] >gi|188493675|ref|ZP_03000945.1| ribose 5-phosphate isomerase B [Escherichia coli 53638] >gi|191168772|ref|ZP_03030549.1| ribose 5-phosphate isomerase B [Escherichia coli B7A] >gi|194437203|ref|ZP_03069301.1| ribose 5-phosphate isomerase B [Escherichia coli 101-1] >gi|731980|sp|P37351|RPIB_ECOLI Ribose-5-phosphate isomerase B (Phosphoriboisomerase B) >gi|536934|gb|AAA96989.1| yjcA [Escherichia coli] >gi|1197467|emb|CAA57688.1| ribose phosphate isomerase B [Escherichia coli] >gi|1790528|gb|AAC77051.1| ribose 5-phosphate isomerase B/allose 6-phosphate isomerase [Escherichia coli str. K-12 substr. MG1655] >gi|85676843|dbj|BAE78093.1| ribose 5-phosphate isomerase B/allose 6-phosphate isomerase [Escherichia coli W3110] >gi|169756838|gb|ACA79537.1| ribose 5-phosphate isomerase B [Escherichia coli ATCC 8739] >gi|169891379|gb|ACB05086.1| ribose 5-phosphate isomerase B/allose 6-phosphate isomerase [Escherichia coli str. K12 substr. DH10B] >gi|188488874|gb|EDU63977.1| ribose 5-phosphate isomerase B [Escherichia coli 53638] >gi|190901199|gb|EDV60971.1| ribose 5-phosphate isomerase B [Escherichia coli B7A] >gi|194423759|gb|EDX39748.1| ribose 5-phosphate isomerase B [Escherichia coli 101-1] (149 aa)
Score = 246, Expect = 8.0e-20, Identities = 53/147 (36%), Positives = 84/147 (57%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           K+  G DH GF +K +I   H +   ++ +D GT+S  E  DYP YA ++   +   +   GI ICGTG+GI IA NK  GI A   ++   A+L+R+HN+ NV+    R   +E    I+  +  + +E GRH++R++ IT +E +
  S:     3 KIAFGCDHVGFILKHEIVA-HLVERGVEVIDKGTWS-SERTDYPHYASQVALAVAGGEVDGGILICGTGVGISIAANKFAGIRAVVCSEPYSAQLSRQHNDTNVLAFGSRVVGLELAKMIVDAWLGAQYEGGRHQQRVEAITAIEQR 147
>gi|149178884|ref|ZP_01857463.1| ribose 5-phosphate epimerase (pentose phosphate) [Planctomyces maris DSM 8797] >gi|148842296|gb|EDL56680.1| ribose 5-phosphate epimerase (pentose phosphate) [Planctomyces maris DSM 8797] (151 aa)
Score = 245, Expect = 8.4e-20, Identities = 60/148 (40%), Positives = 84/148 (56%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFV--DLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           +K+ + SDH GF  K KI     LL  L  V  D G   G ESVDYPDYA K+ + + +     GI ICGTG+G+CI  NK  G+ A   +  I A+++R HN+ NV+ LS           +I+ +    FE GRH +RL+K+ K+E +
  S:     1 MKIAVASDHRGFATKAKILT---LLNQLGHVAFDYGPEDG-ESVDYPDYAVKVAKAIGEKAIDRGILICGTGMGMCIVANKFPGVRATPCHDDITAQMSRLHNDSNVLCLSADLLGDRLVNRMIEIWLKEEFEGGRHARRLEKLHKVEEE 146
>gi|85708545|ref|ZP_01039611.1| ribose 5-phosphate isomerase [Erythrobacter sp. NAP1] >gi|85690079|gb|EAQ30082.1| ribose 5-phosphate isomerase [Erythrobacter sp. NAP1] (159 aa)
Score = 245, Expect = 8.9e-20, Identities = 54/142 (38%), Positives = 81/142 (57%)
  Q:    11 IKVYIGSDHGGFDMKEKIRN-----NHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFE-----SGRHEKRLDKI 152
           +++ I SDH   D+K  +        HE+       DLG   G ESVDYPDY  K+ E +      +GI +CG+GIGI I++N+   +  A V++ + A LAREHNN N I L  R   +E     +  F ++ F      +GRH++R+ K+
  S:     1 MRIAIASDHAATDLKASLAEWLMDEGHEV------ADLGPEEG-ESVDYPDYGYKLAEVVADGTAQFGIALCGSGIGISISVNRHPALRCALVSEPLSAALAREHNNANCIALGARLIGIEMAKSCVATFLNTEFADEGDPAGRHQRRVAKL 145
>gi|149277682|ref|ZP_01883822.1| ribose-5-phosphate isomerase B [Pedobacter sp. BAL39] >gi|149231370|gb|EDM36749.1| ribose-5-phosphate isomerase B [Pedobacter sp. BAL39] (179 aa)
Score = 245, Expect = 8.9e-20, Identities = 62/150 (41%), Positives = 89/150 (59%)
  Q:     9 KKIKVYIGSDHGGFDMKEKIRNNHELL--EILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFES-GRHEKRLDKITKLENK 158
           K +KV +GSDH G+  K+      ELL  E  + +DLG ++ +E+ DYPD+AE +   L + KG  GI +CG+ +G+ IA NK KGI A   + T  A  A EH++VNV+ L  R        EI+  F  + F +  RH KRL KIT +E++
  S:    30 KLMKVILGSDHAGYRYKQMFS---ELLTTEGYEVLDLGAFN-EEASDYPDHAEDVAVALQEGKGDRGILVCGSAVGVSIAANKFKGIRAGVCHDTYSAHQAVEHDDVNVLCLGERVVGPALAKEIVLSFLKASFTNETRHVKRLAKITAIEDQ 178
>gi|193063020|ref|ZP_03044112.1| ribose 5-phosphate isomerase B [Escherichia coli E22] >gi|192931279|gb|EDV83881.1| ribose 5-phosphate isomerase B [Escherichia coli E22] (149 aa)
Score = 245, Expect = 9.1e-20, Identities = 53/145 (36%), Positives = 83/145 (57%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLE 156
           K+  G DH GF +K +I   H +   ++ +D GT+S  E  DYP YA ++   +   +   GI ICGTG+GI IA NK  GI A   ++   A+L+R+HN+ NV+    R   +E    I+  +  + +E GRH++R++ IT +E
  S:     3 KIAFGCDHVGFILKHEIVA-HLVERGVEVIDKGTWS-SERTDYPHYASQVALAVAGGEVDGGILICGTGVGISIAANKFAGIRAVVCSEPYSAQLSRQHNDTNVLAFGSRVVGLELAKMIVDAWLGAQYEGGRHQQRVEAITAIE 145
>gi|87200253|ref|YP_497510.1| ribose-5-phosphate isomerase [Novosphingobium aromaticivorans DSM 12444] >gi|87135934|gb|ABD26676.1| ribose-5-phosphate isomerase [Novosphingobium aromaticivorans DSM 12444] (145 aa)
Score = 245, Expect = 9.2e-20, Identities = 52/143 (36%), Positives = 80/143 (55%)
  Q:    11 IKVYIGSDHGGFDMKEKIRN-----NHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKIT 153
           +++ I SDH   D+K  +R       HE+       DLG  + D  VDYPDY  K+   + +    +G+ +CG+GIGI IA+N+      A V++ + A LAREHN+ NVI +  R T  +     +  F S+ F  GRH  R++K++
  S:     1 MRIAIASDHAAVDLKSTLREYLIDLGHEV------ADLGPETADR-VDYPDYGYKLASVVAEGIADFGVALCGSGIGISIAVNRNPACRCALVSEPLSAALAREHNDANVIAMGARLTGEDMAKACLDAFLSTEFGGGRHAGRVEKLS 141
>gi|116619956|ref|YP_822112.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Solibacter usitatus Ellin6076] >gi|116223118|gb|ABJ81827.1| sugar-phosphate isomerases, RpiB/LacA/LacB family [Solibacter usitatus Ellin6076] (150 aa)
Score = 245, Expect = 9.6e-20, Identities = 57/146 (39%), Positives = 82/146 (56%)
  Q:    11 IKVYIGSDHGGFDMKEKI-----RNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFES-GRHEKRLDKITKLE 156
           +K+ + SDH G  +K ++     ++ HE        DLGT + D  VDYPDYA  +G  +L  +    I ICG+G G C+A NK+KGI AA  + +  A    E +NVNV  L  R    E  VE+++ +  + F    RH++RL KI  LE
  S:     1 MKLALASDHAGVALKARVIEELRKDGHET------ADLGTCTTD-PVDYPDYAMAVGLAVLTGQAERAILICGSGAGACVAANKLKGIRAATCHDSFSARQCVEDDNVNVFCLGARVIGTELAVELVRIYLKAQFSGLERHKRRLAKIAALE 145
>gi|126645804|ref|ZP_01718321.1| ribose 5-phosphate isomerase B [Algoriphagus sp. PR1] >gi|126577436|gb|EAZ81656.1| ribose 5-phosphate isomerase B [Algoriphagus sp. PR1] (145 aa)
Score = 245, Expect = 9.9e-20, Identities = 57/141 (40%), Positives = 81/141 (57%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           K+ IG DH GF+ K K+ +  E  +  +  D G +S D SVDYPDY   +   +   +   GI ICG+G G+ I  NK +GI AA       A L+R+HNN NV+ L  RF S E   ++ + F ++ FE GRH+ R++KI
  S:     4 KIAIGGDHAGFEYKAKMISKLES-QGYEVKDFGPFS-DASVDYPDYVHPLSTAIEAGEYELGIVICGSGNGVAITANKHQGIRAALCWNEDLAALSRQHNNANVLALPARFISYELAEKLAETFLTTDFEGGRHQNRVNKI 142
>gi|73667026|ref|YP_303042.1| ribose/galactose isomerase [Ehrlichia canis str. Jake] >gi|72394167|gb|AAZ68444.1| Ribose/galactose isomerase [Ehrlichia canis str. Jake] (149 aa)
Score = 245, Expect = 1.0e-19, Identities = 56/141 (39%), Positives = 80/141 (56%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLEILDFV--DLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           KV+I SDH G +++  I+     L  L ++  D G       VDYPDY + + + ++ D  ++GI ICGTGIG+ I  N+ + I AA       A LAREHN+ NV+ L  R  S ED   I+  F ++ F  GRH +R+ KI
  S:     6 KVFISSDHAGVELRLVIK---LYLNNLGYIVEDYGCVESGVPVDYPDYVQNVVDCVINDSLAFGILICGTGIGMSIVANRHRKIRAALCYNVEVARLAREHNDANVLCLGARHISYEDAQSIVYNFLTTKFSEGRHVQRIIKI 145
>gi|39996706|ref|NP_952657.1| ribose 5-phosphate isomerase B, putative [Geobacter sulfurreducens PCA] >gi|39983587|gb|AAR34980.1| ribose 5-phosphate isomerase B, putative [Geobacter sulfurreducens PCA] (148 aa)
Score = 245, Expect = 1.0e-19, Identities = 57/146 (39%), Positives = 83/146 (56%)
  Q:    13 VYIGSDHGGFDMKEKIRNNHELLEILD-FVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           + +GSDHGG ++KE ++    L E  + F D GT +G+ SVDYPD+  K+   +   +   GI +CGTGIG+ I  NK   + AA       A +A+EHNN N++ L GR        E++  +    +E GRH+ RLDKI  LE +
  S:     2 IVVGSDHGGLELKEAVK--RLLAERGETFEDCGTDNGN-SVDYPDFGIKVARRVSNGEAGKGILLCGTGIGMSIVANKFPRVRAALATDAFMARMAKEHNNANILVLGGRVLEEAVAREMVIAWLDGVYEGGRHQGRLDKIAALERE 145
>gi|86131088|ref|ZP_01049687.1| ribose 5-phosphate isomerase B [Cellulophaga sp. MED134] >gi|85818499|gb|EAQ39659.1| ribose 5-phosphate isomerase B [Dokdonia donghaensis MED134] (143 aa)
Score = 245, Expect = 1.0e-19, Identities = 60/142 (42%), Positives = 86/142 (60%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFV-DLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           +K+ IG+DH G   K  I     L E    V + GT + D SVDYPD+   +  ++ + K  +GI ICG+G GI + +NK +G+ AA       A LAREHNN NVI +  R+TS    +E++K F ++ FE GRH++R+DKI
  S:     1 MKISIGNDHAGPSYKNVIVKF--LKEAGHTVSNYGTDTPD-SVDYPDFGHPVATDVEEGKADFGIVICGSGNGIAMTVNKHQGVRAALCWIKEIAILAREHNNANVIAIPARYTSEMQALEMVKAFITTEFEGGRHQRRVDKI 140
>gi|124006451|ref|ZP_01691284.1| ribose 5-phosphate isomerase B [Microscilla marina ATCC 23134] >gi|123987864|gb|EAY27544.1| ribose 5-phosphate isomerase B [Microscilla marina ATCC 23134] (142 aa)
Score = 244, Expect = 1.1e-19, Identities = 53/143 (37%), Positives = 84/143 (58%)
  Q:    11 IKVYIGSDHGGFDMKEKI----RNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKIT 153
           +K+ IG DH GF  KE +    ++    +E     D G +S +ESVDYPD+   + + +   +   GI ICG+G G+ +  NK + + AA   +T  A LAR+HNN NV+ +  RF  +     +++ F +  FE GRHE+R++KI+
  S:     1 MKIAIGGDHAGFAYKEAVVALLKDKGVAVE-----DFGPFS-EESVDYPDFVHPVAKKVDAKEADLGILICGSGNGVAMTANKYQSVRAALCWQTELAALARQHNNANVLCIPARFVDLALAKNMVETFLNESFEGGRHERRVNKIS 141
>gi|89095613|ref|ZP_01168507.1| ribose-5-phosphate isomerase B [Bacillus sp. NRRL B-14911] >gi|89089359|gb|EAR68466.1| ribose-5-phosphate isomerase B [Bacillus sp. NRRL B-14911] (146 aa)
Score = 244, Expect = 1.2e-19, Identities = 57/147 (38%), Positives = 85/147 (57%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLEN 157
           +KV I SDHGG +++E++++  E + I ++ D G   G  S DYPDYA  + E +   +   GI ICGTGIG+ I+ NK+KGI  A V+    A+  R+HN+ N++ +  R        EI K +  + FE GRH  R+ KI   E+
  S:     1 MKVAIASDHGGVNIREEMKHLMEEMGI-EYEDFGCECG-VSFDYPDYALPVAEKVASGEFDKGILICGTGIGMSISANKVKGIRCALVHDVFSAKATRQHNDSNILAMGERVIGPGLAREIAKTWLETEFEGGRHANRIGKIKTYED 145
>gi|87306380|ref|ZP_01088527.1| ribose 5-phosphate epimerase (pentose phosphate) [Blastopirellula marina DSM 3645] >gi|87290559|gb|EAQ82446.1| ribose 5-phosphate epimerase (pentose phosphate) [Blastopirellula marina DSM 3645] (153 aa)
Score = 244, Expect = 1.3e-19, Identities = 54/148 (36%), Positives = 89/148 (60%)
  Q:    11 IKVYIGSDHGGFDMKEKI-----RNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           +++ IGSDH G  ++  I     R  HE+ ++  F D G      SVDYPD A  + +++  ++   GI ICG+GIG+ I  NK+ G+ AA  +  + AE++R HNNVNV+ LS           +++ + ++ FE GRH +R++KI++ E +
  S:     1 MRIAIGSDHRGVGVRHSIIELLKRLGHEVQDVGAF-DCG------SVDYPDIAATVSQSVAAEEVDRGILICGSGIGMAIVANKVPGVRAATCHDDLTAEMSRRHNNVNVLCLSADMLGERLIDRMVEIWLTTEFEGGRHARRIEKISEFEKR 146
>gi|157147975|ref|YP_001455294.1| ribose-5-phosphate isomerase B [Citrobacter koseri ATCC BAA-895] >gi|157085180|gb|ABV14858.1| hypothetical protein CKO_03782 [Citrobacter koseri ATCC BAA-895] (151 aa)
Score = 244, Expect = 1.3e-19, Identities = 51/147 (34%), Positives = 82/147 (55%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           K+  G DH GF +K+ I   H     +  +D GT+S  E  DYP YA ++ + ++  +   GI +CGTG+GI I  NK  G+ A   ++   A+L+R+HN+ NV+    R   +E    I+  +  + FE GRH+KR++ I  +E +
  S:     5 KIAFGCDHVGFILKQDILT-HLTQRGITVIDKGTWS-PERTDYPHYASEVAQAVVSGEVDGGILVCGTGVGISITANKFAGVRAVVCSEPYSAQLSRQHNDTNVLAFGSRVVGLELAKMIVDAWLDAGFEGGRHQKRVEAIMAIEQQ 149
>gi|163762333|ref|ZP_02169398.1| Galactose-6-phosphate isomerase [Bacillus selenitireducens MLS10] >gi|160357072|gb|EDP83720.1| Galactose-6-phosphate isomerase [Bacillus selenitireducens MLS10] (150 aa)
Score = 243, Expect = 1.4e-19, Identities = 60/147 (40%), Positives = 86/147 (58%)
  Q:    11 IKVYIGSDHGGFDMKEKIRN-----NHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLEN 157
           +K+ IGSDH G+ +K  I +      HE+      VD+GT S D SVDY D+  +  E +   +   GI ICGTGIG+ I+ NK+KGI  A V+    A+  REHN+ NV+ +  R        EI K + ++ FE GRHE+R+ K+   E+
  S:     1 MKIVIGSDHAGYHLKGAIIDVVKELGHEI------VDVGTDSPD-SVDYADFGLQAAEMVANKEADRGIVICGTGIGMSISANKVKGIRCALVHDLFTAKATREHNDTNVLAMGERVIGPGLAQEIAKTWLTTEFEGGRHERRIMKVMNYED 145
>gi|157163956|ref|YP_001466477.1| ribose 5-phosphate isomerase B [Campylobacter concisus 13826] >gi|157101381|gb|EAT97956.2| ribose 5-phosphate isomerase B [Campylobacter concisus 13826] (147 aa)
Score = 243, Expect = 1.5e-19, Identities = 57/145 (39%), Positives = 82/145 (56%)
  Q:     8 LKKIKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           +K  KV++ SDH GF++K +++   + L   + VDLGT +   SVDYPDYA  +   L  +   YG+ +CGTGIGI IA N+ + +  A  +    A LAREHN+ NVI    R       +   + F  + F  GRHE+R+ KI
  S:     1 MKIDKVFLASDHAGFELKNELKEAIKGLG-YEVVDLGT-NDKNSVDYPDYAHLLASKL--EPNCYGVLVCGTGIGISIAANRHENVRCALCHDEFTARLAREHNDANVIAFGARVIGAGVAISAAEAFLKTEFAGGRHERRVQKI 141
>gi|67642816|ref|ZP_00441568.1| COG0698: Ribose 5-phosphate isomerase RpiB [Burkholderia mallei GB8 horse 4] >gi|161374197|ref|ZP_02113746.1| ribose 5-phosphate isomerase B [Burkholderia pseudomallei 1710a] >gi|167848322|ref|ZP_02473830.1| ribose 5-phosphate isomerase B [Burkholderia pseudomallei B7210] (162 aa)
Score = 243, Expect = 1.7e-19, Identities = 51/144 (35%), Positives = 80/144 (55%)
  Q:    15 IGSDHGGFDMKEKI----RNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           IG D   + +KE I    R  H  LE++DF   GT+S DE+V YPD A ++ + +   +    I +CGTGIG+ I+ NK+ GI AA  + T  AE AR  N+  ++T+  R    E    I+  +  + F+ GR + ++ +I   E +
  S:     3 IGCDEAAYALKESIKRHLRATHPELELVDF---GTHSADEAVLYPDIAIEVAQRVAAGEFPRAILLCGTGIGVAISANKVPGIRAAQCHDTYSAERARRSNDAQIVTMGARVIGTELANSIVDAWLRAEFDGGRSQPKVQRIADYERR 147
>gi|189218214|ref|YP_001938856.1| Ribose 5-phosphate isomerase RpiB [Methylokorus infernorum V4] >gi|161075833|gb|ABX56664.1| ribose 5-phosphate isomerase B [Verrucomicrobiae bacterium V4] >gi|189185072|gb|ACD82257.1| Ribose 5-phosphate isomerase RpiB [Methylacidiphilum infernorum V4] (148 aa)
Score = 242, Expect = 2.0e-19, Identities = 54/147 (36%), Positives = 80/147 (54%)
  Q:    11 IKVYIGSDHGGFDMKEKIRN--NHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLEN 157
           +K+ +GSDH GF+ KEK++N      LE+   +D GT++ D  VDYPDY       + + +    I   G+G G  +  NK+KGI  A       A L R HN+ N I++  R    E  ++I+K F  + FE GRH  R+ K+ + EN
  S:     1 MKIALGSDHAGFNYKEKVKNFLKESCLEV---IDCGTFAPDPPVDYPDYVRPAALLVAQGQADRAIVFGGSGNGEAMVANKVKGIRCAYCFNEESARLGRLHNDANAISIGQRLIPEEMALKIVKIFLETPFEGGRHIPRIKKMMEYEN 146
>gi|16801882|ref|NP_472150.1| ribose-5-phosphate isomerase B [Listeria innocua Clip11262] >gi|16415357|emb|CAC98047.1| lin2821 [Listeria innocua] (151 aa)
Score = 242, Expect = 2.0e-19, Identities = 57/146 (39%), Positives = 83/146 (56%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLEN 157
           KV I SDHGG ++++ I +  E + I  + + G     ESVDYP  A  + E ++ ++   GI +CGTGIG+ IA NK+KGI  A V  T  A   REHN+ NV+ L  R        +I+K +  + +E GRH  R+ +IT  E+
  S:     5 KVAIASDHGGIELRKSIISYLESVGI-SYEEFGP-EAPESVDYPGLAITVSEKVVNNEVDRGILVCGTGIGMSIAANKVKGIRCALVGDTFSAHATREHNDTNVLALGARVIGPGLAEDIVKIWLETAYEGGRHANRVGQITAYED 148
>gi|46908853|ref|YP_015242.1| ribose-5-phosphate isomerase B [Listeria monocytogenes str. 4b F2365] >gi|47092296|ref|ZP_00230087.1| ribose 5-phosphate isomerase B [Listeria monocytogenes str. 4b H7858] >gi|116874039|ref|YP_850820.1| ribose-5-phosphate isomerase B [Listeria welshimeri serovar 6b str. SLCC5334] >gi|153168838|ref|ZP_01928599.1| ribose 5-phosphate isomerase B [Listeria monocytogenes FSL N1-017] >gi|167455135|ref|ZP_02321358.1| ribose-5-phosphate isomerase B [Listeria monocytogenes FSL J2-064] >gi|46882126|gb|AAT05419.1| ribose 5-phosphate isomerase B [Listeria monocytogenes str. 4b F2365] >gi|47019275|gb|EAL10017.1| ribose 5-phosphate isomerase B [Listeria monocytogenes str. 4b H7858] >gi|116742917|emb|CAK22041.1| rpiB [Listeria welshimeri serovar 6b str. SLCC5334] >gi|133726072|gb|EBA27770.1| ribose 5-phosphate isomerase B [Listeria monocytogenes FSL N1-017] (151 aa)
Score = 242, Expect = 2.0e-19, Identities = 57/146 (39%), Positives = 82/146 (56%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLEN 157
           KV I SDHGG ++++ I +  E + I  + + G     ESVDYP  A  + E ++  +   GI +CGTGIG+ IA NK+KGI  A V  T  A   REHN+ NV+ L  R        +I+K +  + +E GRH  R+ +IT  E+
  S:     5 KVAIASDHGGIELRKSIISYLESVGI-SYEEFGP-EAPESVDYPGLAITVSEKVVNQEVDRGILVCGTGIGMSIAANKVKGIRCALVGDTFSAHATREHNDTNVLALGARVIGPGLAEDIVKIWLETAYEGGRHANRVGQITAYED 148
>gi|153204323|ref|ZP_01945120.1| ribose 5-phosphate isomerase B [Listeria monocytogenes HPB2262] >gi|167405471|ref|ZP_02310227.1| ribose-5-phosphate isomerase B [Listeria monocytogenes FSL J2-003] >gi|168266881|ref|ZP_02688846.1| ribose-5-phosphate isomerase B [Listeria monocytogenes FSL J2-071] >gi|133734103|gb|EBA35801.1| ribose 5-phosphate isomerase B [Listeria monocytogenes HPB2262] (151 aa)
Score = 241, Expect = 2.6e-19, Identities = 57/146 (39%), Positives = 82/146 (56%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLEN 157
           KV I SDHGG ++++ I +  E + I  + + G     ESVDYP  A  + E ++  +   GI +CGTGIG+ IA NK+KGI  A V  T  A   REHN+ NV+ L  R        +I+K +  + +E GRH  R+ +IT  E+
  S:     5 KVAIASDHGGIELRKSIISYLESVGI-SYEEFGP-EAPESVDYPGLAITVSEKVVNQEVDRGILVCGTGIGMSIAANKVKGIRCALVGDTFSAHATREHNDTNVLALGARVIGPGLAEDIVKIWLETAYEGGRHANRVGQITAYED 148
>gi|16804711|ref|NP_466196.1| ribose-5-phosphate isomerase B [Listeria monocytogenes EGD-e] >gi|16412174|emb|CAD00887.1| lmo2674 [Listeria monocytogenes] (151 aa)
Score = 241, Expect = 2.6e-19, Identities = 57/146 (39%), Positives = 83/146 (56%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLEN 157
           KV I SDHGG ++++ I +  E + I  + + G  +  ESVDYP  A  + E ++  +   GI +CGTGIG+ IA NK+KGI  A V  T  A   REHN+ NV+ L  R        +I+K +  + +E GRH  R+ +IT  E+
  S:     5 KVAIASDHGGIELRKSIISYLESVGI-SYEEFGPET-PESVDYPRLAITVSEKVVNQEVDRGILVCGTGIGMSIAANKVKGIRCALVGDTFSAHATREHNDTNVLALGARVIGPGLAEDIVKIWLETEYEGGRHANRVGQITAYED 148
>gi|154483321|ref|ZP_02025769.1| hypothetical protein EUBVEN_01024 [Eubacterium ventriosum ATCC 27560] >gi|149735831|gb|EDM51717.1| hypothetical protein EUBVEN_01024 [Eubacterium ventriosum ATCC 27560] (154 aa)
Score = 241, Expect = 2.7e-19, Identities = 57/146 (39%), Positives = 88/146 (60%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEIL-----DFVDLGT-YSGDESV---DYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLE 156
           +K+  G DH   D+K      +EL+E +     + VD GT Y  +  +   DYP+   ++GE +++    YG+ +CGTGIGI +A NK+ G+ AA  ++   A+L ++HNN NVI    R   VE    I+ +FF + FE GRH+ R+D I  +E
  S:     1 MKIGFGCDHAAIDLK------NELIEYMTEKGYECVDYGTGYDENGEIIKCDYPNKGREVGEAVVRKDVDYGVLMCGTGIGISVAANKVPGVIAAVCSEPYSAKLTKQHNNANVIAFGARVVGVELAKMILDEFFGAEFEGGRHQARVDMIHGIE 149
>gi|15616329|ref|NP_244634.1| ribose-5-phosphate isomerase B [Bacillus halodurans C-125] >gi|10176391|dbj|BAB07486.1| ribose 5-phosphate epimerase (pentose phosphate) [Bacillus halodurans C-125] (145 aa)
Score = 241, Expect = 2.9e-19, Identities = 59/146 (40%), Positives = 82/146 (56%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLE 156
           +KV IGSDHGG ++K +I    E L  + + D G      SVDY DYA  + E +   +   GI ICGTGIG+ IA NK+KGI  A  +    A+  REHN+ NV+ +  R        EI + + ++ FE GRH +R+ KI + E
  S:     1 MKVAIGSDHGGVNIKNEIIQLMEELG-MQYEDFGC-DCTTSVDYSDYAIPVAEKVAAGEFDRGILICGTGIGMSIAANKVKGIRCALCHDVFSAKATREHNDSNVLAMGERVIGPGLAREIAQTWLTTEFEGGRHARRIGKIAEYE 144
>gi|91201531|emb|CAJ74591.1| strongly similar to ribose-5-phosphate isomerase [Candidatus Kuenenia stuttgartiensis] (155 aa)
Score = 241, Expect = 3.0e-19, Identities = 55/149 (36%), Positives = 85/149 (57%)
  Q:    10 KIKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFE-SGRHEKRLDKITKLENK 158
           K+K+ IGSDH G  +K+    + +  E    +D+GTYS  E VDYPDYAE +G  LL      GI IC +G+G  +A NKI GI A   + T  A    EH+++N++ L      ++  +E+++ F  + F    RH++R+ KI  +E +
  S:     5 KMKIAIGSDHAGLWLKKSFIAHFDKPE-YQLIDVGTYS-TEPVDYPDYAEAVGRKLLDGSADRGILICCSGVGASVAANKIPGIRAGLCHDTYSAHQGVEHDDMNILVLGACIVGLKLAIELVQSFLGATFNGEERHKRRVGKIQFIEKR 152
>gi|68535613|ref|YP_250318.1| ribose-5-phosphate isomerase B [Corynebacterium jeikeium K411] >gi|68263212|emb|CAI36700.1| ribose 5-phosphate isomerase [Corynebacterium jeikeium K411] (157 aa)
Score = 241, Expect = 3.0e-19, Identities = 53/146 (36%), Positives = 89/146 (60%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHF-ESGRHEKRLDKITKLE 156
           +++Y+G+DH GF+MK  I++ H   +  + VD G ++ D + DYP +     +++++D+GS GI + G+G G  IA NK+ G   A       A+LAREHNN  +I L GR  S E+ + I+  F +  + E+ RH++R+D + + E
  S:     1 MRIYLGADHAGFEMKNVIKD-HLTSKGFEVVDCGAHTYDANDDYPAFCIAAAKSVVEDEGSLGIVLGGSGNGEQIAANKVPGARCALAWSVETAKLAREHNNAQLIGLGGRMHSEEEALAIVDAFVTQPWSEAERHQRRIDILAEYE 146
>gi|153197703|ref|ZP_01941930.1| ribose 5-phosphate isomerase B [Listeria monocytogenes 10403S] >gi|127632876|gb|EBA22310.1| ribose 5-phosphate isomerase B [Listeria monocytogenes 10403S] (151 aa)
Score = 241, Expect = 3.1e-19, Identities = 57/146 (39%), Positives = 84/146 (57%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLEN 157
           KV I SDHGG ++++ I +  E + I  + + G  +  ESVDYP  A  + E ++  +   GI +CGTGIG+ IA NK+KGI  A V  T  A   REHN+ NV+ L  R        +I+K + ++ +E GRH  R+ +IT  E+
  S:     5 KVAIASDHGGIELRKSIISYLESVGI-SYEEFGPET-PESVDYPGLAITVSEKVVNQEVDRGILVCGTGIGMSIAANKVKGIRCALVGDTFSAHATREHNDTNVLALGARVIGPGLAEDIVKIWLNTDYEGGRHANRVGQITAYED 148
>gi|47095478|ref|ZP_00233087.1| ribose 5-phosphate isomerase B [Listeria monocytogenes str. 1/2a F6854] >gi|153175981|ref|ZP_01931240.1| ribose 5-phosphate isomerase B [Listeria monocytogenes FSL N3-165] >gi|153180838|ref|ZP_01933834.1| ribose 5-phosphate isomerase B [Listeria monocytogenes F6900] >gi|153185566|ref|ZP_01936116.1| ribose 5-phosphate isomerase B [Listeria monocytogenes J0161] >gi|153192433|ref|ZP_01939425.1| ribose 5-phosphate isomerase B [Listeria monocytogenes J2818] >gi|47016088|gb|EAL07012.1| ribose 5-phosphate isomerase B [Listeria monocytogenes str. 1/2a F6854] >gi|126941702|gb|EBA19581.1| ribose 5-phosphate isomerase B [Listeria monocytogenes J0161] >gi|127763937|gb|EBA24755.1| ribose 5-phosphate isomerase B [Listeria monocytogenes J2818] >gi|133728694|gb|EBA30392.1| ribose 5-phosphate isomerase B [Listeria monocytogenes FSL N3-165] >gi|133731785|gb|EBA33483.1| ribose 5-phosphate isomerase B [Listeria monocytogenes F6900] (151 aa)
Score = 240, Expect = 3.2e-19, Identities = 57/146 (39%), Positives = 83/146 (56%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLEN 157
           KV I SDHGG ++++ I +  E + I  + + G  +  ESVDYP  A  + E ++  +   GI +CGTGIG+ IA NK+KGI  A V  T  A   REHN+ NV+ L  R        +I+K +  + +E GRH  R+ +IT  E+
  S:     5 KVAIASDHGGIELRKSIISYLESVGI-SYEEFGPET-PESVDYPGLAITVSEKVVNQEVDRGILVCGTGIGMSIAANKVKGIRCALVGDTFSAHATREHNDTNVLALGARVIGPGLAEDIVKIWLETEYEGGRHANRVGQITAYED 148
>gi|85373958|ref|YP_458020.1| ribose 5-phosphate isomerase [Erythrobacter litoralis HTCC2594] >gi|84787041|gb|ABC63223.1| ribose 5-phosphate isomerase [Erythrobacter litoralis HTCC2594] (148 aa)
Score = 240, Expect = 3.5e-19, Identities = 49/144 (34%), Positives = 83/144 (57%)
  Q:    10 KIKVYIGSDHGGFDMKEKIRN-----NHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKIT 153
           ++K+ I SDH   ++K ++R+      HE+       DLG  + D SVDYPD+  K+   +       G+ +CG+GIGI +++N+   +  A V + + A L+REHN+ NVI +  R T  +     +  F  + F  GRH++R+DK++
  S:     4 RMKIAIASDHAAVELKAELRDWLIEQGHEV------ADLGPDTTD-SVDYPDFGYKLAGVVADGTAERGVALCGSGIGISMSVNRNPAVRCALVGEPLSAALSREHNDANVIAMGARLTGSDMAKACLTAFLETEFGGGRHQRRVDKLS 145
>gi|88608285|ref|YP_506112.1| ribose 5-phosphate isomerase B [Neorickettsia sennetsu str. Miyayama] >gi|88600454|gb|ABD45922.1| ribose 5-phosphate isomerase B [Neorickettsia sennetsu str. Miyayama] (152 aa)
Score = 240, Expect = 3.5e-19, Identities = 57/142 (40%), Positives = 86/142 (60%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFE-SGRHEKRLDKI 152
           ++V IG+DH GF +K  + +       L  VD G Y  D S DYPD+A+ +  ++   +  +GI ICG+GIG+ I  N+ K + AA       A++AREHN+ NV+ L+GR  +V   +EI++ F SS F    RH+KR++KI
  S:     3 VRVSIGADHAGFALKAVLIDFFRARGCLP-VDRGAYCLDVS-DYPDFAKSVSLDVSDGRVDFGILICGSGIGMSITANRYKKVRAALCYDVRAAKMAREHNDANVLCLAGRDLTVSRCLEIVEAFVSSKFSCEERHKKRIEKI 143
>gi|109947937|ref|YP_665165.1| ribose-5-phosphate isomerase B [Helicobacter acinonychis str. Sheeba] >gi|109715158|emb|CAK00166.1| ribose 5-phosphate isomerase B [Helicobacter acinonychis str. Sheeba] (153 aa)
Score = 240, Expect = 3.7e-19, Identities = 54/147 (36%), Positives = 83/147 (56%)
  Q:     6 KQLKKIKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           K L   +V+IGSDH G  + E +++    LE   F  +  +     VDYPDYA+ + + +L++  SYGI +C TGIG+ +  N+ KGI AA       A++ R HNN NV+ L  + + +     I++ FFS+ FE  RH  R+ K+
  S:     3 KPLNIAQVFIGSDHAGLHLAEFVQH---FLEDKQF-KIQAFLPTARVDYPDYAKLVCQKVLENAQSYGILVCATGIGMSMGANRFKGIRAALCLDAYMAKMTRLHNNANVLCLGEKISGIGVVESILEAFFSTEFEQDRHVLRIQKL 145
>gi|77979015|ref|ZP_00834437.1| COG0698: Ribose 5-phosphate isomerase RpiB [Yersinia intermedia ATCC 29909] (151 aa)
Score = 240, Expect = 3.8e-19, Identities = 53/146 (36%), Positives = 80/146 (54%)
  Q:    13 VYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           + +G DH GF +K  I   H     +  +D G +S  E  DYP YA ++ E +   +   G+ ICGTG+GI I  NK  GI A   ++   A+L+R+HNN NV+    R   +E    I+  +  + FE GRH+ R+D IT++E +
  S:     4 IALGCDHVGFILKADIVA-HLQTRGIKVIDKGWWS-TERTDYPRYANEVAEAVTSGEVDGGVLICGTGVGISITANKHPGIRAVVCSEPYSAQLSRQHNNTNVLAFGSRVVGLELAKMIVDAWLDAEFEGGRHQTRVDAITEVEAR 147
>gi|83856108|ref|ZP_00949637.1| ribose 5-phosphate isomerase B, putative [Croceibacter atlanticus HTCC2559] >gi|83849908|gb|EAP87776.1| ribose 5-phosphate isomerase B, putative [Croceibacter atlanticus HTCC2559] (143 aa)
Score = 240, Expect = 3.9e-19, Identities = 54/142 (38%), Positives = 87/142 (61%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           +K+ IG+DH G   K  I   +   E ++ ++ GT S D SVDYPD+   +  ++  +  + GI ICG+G G  +  NK +G+ +A        +LAREHN+ N++++  RFTSV+  +E++K F ++ FE GRH+ R+DKI
  S:     1 MKIAIGNDHAGTFYKNTIVE-YLKSENIEVINYGTNSED-SVDYPDFVHPVAADVESNSVNLGIIICGSGNGASMTANKHQGVRSALCWTKEITKLAREHNDANILSIPARFTSVQQALEMVKVFLNTEFEGGRHQTRVDKI 140
>gi|153852643|ref|ZP_01994080.1| hypothetical protein DORLON_00053 [Dorea longicatena DSM 13814] >gi|149754285|gb|EDM64216.1| hypothetical protein DORLON_00053 [Dorea longicatena DSM 13814] (159 aa)
Score = 240, Expect = 3.9e-19, Identities = 60/156 (38%), Positives = 89/156 (57%)
  Q:     3 ESKKQLKKIKVYIGSDHGGFDMKEKIRNNHELLEIL--DFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           + K + + +K+ I +DH   DMK +I    E LE L  + V+ GT S  ES +YP++ EKIG  +   +   GI ICGTG GI +A NK+ GI A   +    A +A+EHN+ NVI    R   +E    I+ ++ ++ FE GRH  R+D I  +E +
  S:     2 KDKGRNRNMKIGIANDHSAVDMKNEIV---EYLESLGHEVVNYGTDSY-ESCNYPEFGEKIGNAVASGEVEQGIAICGTGAGISLAANKVNGIRAVVCSDPYTARMAKEHNDANVIAFGARVIGIETAKCIVDEWLNAKFEGGRHATRVDMIMDVEKR 155
>gi|120437637|ref|YP_863323.1| ribose/galactose isomerase family protein [Gramella forsetii KT0803] >gi|117579787|emb|CAL68256.1| ribose/galactose isomerase family protein [Gramella forsetii KT0803] (146 aa)
Score = 239, Expect = 4.9e-19, Identities = 51/142 (35%), Positives = 88/142 (61%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           +K+ IG+DH G D K+ I+   E +      + GT + ++SVDYPD+   + +++   K   GI ICG+G G  +  NK +G+ +A    T  A+L+REHN+ N++++  RF S +   ++++ F ++ FE GRH++R+DKI
  S:     1 MKISIGNDHAGTDYKQMIQEKLESMG-HTVTNYGT-NAEDSVDYPDFVHPVAQDVENKKADLGIIICGSGNGANMTANKHQGVRSALCWNTEIAKLSREHNDANILSIPARFVSKDLATQMMETFVNTEFEGGRHQRRVDKI 140
>gi|94497534|ref|ZP_01304103.1| sugar-phosphate isomerases, RpiB/LacA/LacB family protein [Sphingomonas sp. SKA58] >gi|94422951|gb|EAT07983.1| sugar-phosphate isomerases, RpiB/LacA/LacB family protein [Sphingomonas sp. SKA58] (145 aa)
Score = 239, Expect = 5.1e-19, Identities = 51/144 (35%), Positives = 79/144 (54%)
  Q:    11 IKVYIGSDHGGFDMKEKI----RNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITK 154
           + + I SDH   ++K ++    R    L+E     DLG  + D  VDYPDY  K+   +       GI +CG+GIGI IA+N+      A V + + A L+REHN+ NV+ +  R T V+     +  F ++ F  GRH  R+DK+++
  S:     1 MNIAIASDHAAVELKAELAQWLRAEGHLVE-----DLGPATADR-VDYPDYGYKLATAIASGAADRGIALCGSGIGISIAVNRNPACRCALVGEPLSAALSREHNDANVLAMGARLTGVDMAKACVTAFLTTEFGGGRHAGRVDKLSQ 142
>gi|167015764|ref|ZP_02278297.1| ribose-5-phosphate isomerase B [Listeria monocytogenes FSL J1-194] (165 aa)
Score = 239, Expect = 5.1e-19, Identities = 57/146 (39%), Positives = 82/146 (56%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLEN 157
           KV I SDHGG ++++ I +  E + I  + + G     ESVDYP  A  + E ++  +   GI +CGTGIG+ IA NK+KGI  A V  T  A   REHN+ NV+ L  R        +I+K +  + +E GRH  R+ +IT  E+
  S:    19 KVAIASDHGGIELRKSIISYLESVGI-SYEEFGP-EAPESVDYPGLAITVSEKVVNQEVDRGILVCGTGIGMSIAANKVKGIRCALVGDTFSAHATREHNDTNVLALGARVIGPGLAEDIVKIWLETAYEGGRHANRVGQITAYED 162
>gi|194426832|ref|ZP_03059385.1| ribose 5-phosphate isomerase B [Escherichia coli B171] >gi|194415168|gb|EDX31437.1| ribose 5-phosphate isomerase B [Escherichia coli B171] (149 aa)
Score = 239, Expect = 5.1e-19, Identities = 52/145 (35%), Positives = 82/145 (56%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLE 156
           K+  G DH GF +K +I   H +   ++ +D GT+S  E  DYP YA ++   +   +   GI ICGTG+GI IA  K  GI A   ++   A+L+R+HN+ NV+    R   +E    I+  +  + +E GRH++R++ IT +E
  S:     3 KIAFGCDHVGFILKHEIVA-HLVERGVEVIDKGTWS-SERTDYPHYASQVALAVAGGEVDGGILICGTGVGISIAAKKFAGIRAVVCSEPYSAQLSRQHNDTNVLAFGSRVVGLELAKMIVDAWLGAQYEGGRHQQRVEAITAIE 145
>gi|134097936|ref|YP_001103597.1| ribose-5-phosphate isomerase B [Saccharopolyspora erythraea NRRL 2338] >gi|133910559|emb|CAM00672.1| ribose 5-phosphate isomerase RpiB [Saccharopolyspora erythraea NRRL 2338] (156 aa)
Score = 238, Expect = 6.0e-19, Identities = 52/146 (35%), Positives = 82/146 (56%)
  Q:    11 IKVYIGSDHGGFDMKEKI-----RNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLE 156
           ++VY+GSDH GF++K  +        HE+       D+G    D   DYP +  +    ++ D+GS G+ + G+G G  IA NK+ G  AA       A+LAR+HNN  +  +  R  +VE+   I++ F  + FE GRH++R+D +T  E
  S:     1 MRVYLGSDHAGFELKNHLVKWLTEQGHEV------TDVGPAEYDAQDDYPPFCVETARRVVADEGSLGLVLGGSGNGEQIAANKVPGARAALTWNVDTAKLARQHNNALLAGIGARMHTVEEVQAIVEAFLGTDFEGGRHQRRIDLLTDYE 145
>gi|167213289|ref|ZP_02283596.1| ribose-5-phosphate isomerase B [Listeria monocytogenes LO28] (165 aa)
Score = 238, Expect = 6.7e-19, Identities = 57/146 (39%), Positives = 83/146 (56%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLEN 157
           KV I SDHGG ++++ I +  E + I  + + G  +  ESVDYP  A  + E ++  +   GI +CGTGIG+ IA NK+KGI  A V  T  A   REHN+ NV+ L  R        +I+K +  + +E GRH  R+ +IT  E+
  S:    19 KVAIASDHGGIELRKSIISYLESVGI-SYEEFGPET-PESVDYPRLAITVSEKVVNQEVDRGILVCGTGIGMSIAANKVKGIRCALVGDTFSAHATREHNDTNVLALGARVIGPGLAEDIVKIWLETEYEGGRHANRVGQITAYED 162
>gi|160914943|ref|ZP_02077157.1| hypothetical protein EUBDOL_00951 [Eubacterium dolichum DSM 3991] >gi|158433483|gb|EDP11772.1| hypothetical protein EUBDOL_00951 [Eubacterium dolichum DSM 3991] (149 aa)
Score = 237, Expect = 8.4e-19, Identities = 58/148 (39%), Positives = 89/148 (60%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFV-DLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHF-ESGRHEKRLDKITKLENK 158
           +K+ +  DHGG+D KE +++   LLE+   V D G  S  +SVDY D+A    + +   +   GI ICGTGIG+ I  NK+KGI  A  +  + A+L R HN+ N++ +  R   VE   EI++ +  + F E  RH +R+ KI++LEN+
  S:     3 MKIAVACDHGGYDYKEIVKD--LLLEMGHEVKDFGCPS-TQSVDYTDFAAPCAKAVASKEYDRGIVICGTGIGVSITANKVKGIRCALCSDPVSAQLTRLHNDSNMLAMGARIIGVEMMKEIVRVWVETPFSEDERHIRRIKKISELENE 149
>gi|167058737|ref|ZP_02280994.1| ribose-5-phosphate isomerase B [Listeria monocytogenes FSL F2-515] (168 aa)
Score = 237, Expect = 8.7e-19, Identities = 57/146 (39%), Positives = 82/146 (56%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLEN 157
           KV I SDHGG ++++ I +  E + I  + + G     ESVDYP  A  + E ++  +   GI +CGTGIG+ IA NK+KGI  A V  T  A   REHN+ NV+ L  R        +I+K +  + +E GRH  R+ +IT  E+
  S:    19 KVAIASDHGGIELRKSIISYLESVGI-SYEEFGP-EAPESVDYPGLAITVSEKVVNQEVDRGILVCGTGIGMSIAANKVKGIRCALVGDTFSAHATREHNDTNVLALGARVIGPGLAEDIVKIWLETEYEGGRHANRVGQITAYED 162
>gi|167215332|ref|ZP_02285639.1| ribose-5-phosphate isomerase B [Listeria monocytogenes FSL R2-503] (168 aa)
Score = 237, Expect = 8.7e-19, Identities = 57/146 (39%), Positives = 82/146 (56%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLEN 157
           KV I SDHGG ++++ I +  E + I  + + G     ESVDYP  A  + E ++  +   GI +CGTGIG+ IA NK+KGI  A V  T  A   REHN+ NV+ L  R        +I+K +  + +E GRH  R+ +IT  E+
  S:    19 KVAIASDHGGIELRKSIISYLESVGI-SYEEFGP-EAPESVDYPGLAITVSEKVVNQEVDRGILVCGTGIGMSIAANKVKGIRCALVGDTFSAHATREHNDTNVLALGARVIGPGLAEDIVKIWLETAYEGGRHANRVGQITAYED 162
>gi|110004112|emb|CAK98451.1| hypothetical laca/rpib family transmembrane protein [Spiroplasma citri] (143 aa)
Score = 237, Expect = 8.7e-19, Identities = 68/145 (46%), Positives = 99/145 (68%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKL 155
           +K+ IG+DH G DMK+ I   H + +  + ++LGT S  E+VDY D  + +GE ++K+K S GI ICGTGIGI IA NK+KGI AA  N+T+ A+LAREHNN NV+ L  R  + ++ + I+  F ++ F+SGRH  R++K+  L
  S:     1 MKIVIGNDHTGIDMKKAIV-KHLIEQKHEIINLGTDS-IEAVDYSDIGQAVGERVIKEKNSVGIIICGTGIGISIAANKVKGIRAALCNETVLAKLAREHNNANVLALGARVIANQNAIWIVDMFLNTTFDSGRHALRVEKLNNL 143
>gi|50364920|ref|YP_053345.1| ribose 5-phosphate isomerase [Mesoplasma florum L1] >gi|50363476|gb|AAT75461.1| ribose 5-phosphate isomerase [Mesoplasma florum L1] (146 aa)
Score = 236, Expect = 1.1e-18, Identities = 52/138 (37%), Positives = 84/138 (60%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRL 149
           K+YI +DH   +MK  I+N+ E  +  + +DLG   G+ S +Y +    + E ++ D+ + GI +CGTGIGI IA NK+KG  A  V +   AEL R+HNN N++    R  +V+  + ++  F ++ FE GRH++R+
  S:     3 KIYIANDHTAIEMKNAIKNHLEK-KGYEVIDLGNNDGN-SCNYANIGITLAEAVVADENNKGIALCGTGIGISIAANKVKGARAGLVYEVQTAELTRQHNNANILATGARLIAVDKALLLVDTFLNTEFEGGRHQERV 138
>gi|163783332|ref|ZP_02178325.1| ribose 5-phosphate isomerase B [Hydrogenivirga sp. 128-5-R1-1] >gi|159881440|gb|EDP74951.1| ribose 5-phosphate isomerase B [Hydrogenivirga sp. 128-5-R1-1] (148 aa)
Score = 236, Expect = 1.1e-18, Identities = 54/148 (36%), Positives = 84/148 (56%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           +K+ +GSDH GF +KE+I+    L E  + +D GT S +ES  YP +A  +   +   +   GI +CGTGIG+ I  NK +GI AA       A ++R HN+ NV+ L  R    +  + I++ +  + FE GRH KR++ I  +E +
  S:     1 MKIAVGSDHAGFPLKERIKE-FLLEEGHEVIDFGTTS-EESTHYPLFARDVSLAVQSGEADRGILVCGTGIGMSITANKFRGIRAALCFNEYMARMSRLHNDANVLCLGDRVIGEDLALAIVEVWLKTPFEGGRHAKRVELIANIERE 146
>gi|145223168|ref|YP_001133846.1| ribose-5-phosphate isomerase B [Mycobacterium gilvum PYR-GCK] >gi|145215654|gb|ABP45058.1| ribose 5-phosphate isomerase [Mycobacterium gilvum PYR-GCK] (157 aa)
Score = 235, Expect = 1.4e-18, Identities = 51/146 (34%), Positives = 83/146 (56%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHF-ESGRHEKRLDKITKLE 156
           ++VY+G+DH G+++K+ I   H      + VD G ++ D   DYP +     E  + D GS GI + G+G G  IA NK+ G   A    T  A LAREHNN  ++ + GR  S ++ + I+  F ++ + E+ RH++R+D + + E
  S:     1 MRVYVGADHAGYELKQAIVE-HLAATGHEPVDCGAFAYDAEDDYPAFCIAAAEKTVADPGSLGIVLGGSGNGEQIAANKVPGARCALAWSTETATLAREHNNAQLVGIGGRMHSTDEALAIVDAFLAAKWSEAPRHQRRIDILAEFE 146
>gi|146298780|ref|YP_001193371.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Flavobacterium johnsoniae UW101] >gi|146153198|gb|ABQ04052.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Flavobacterium johnsoniae UW101] (143 aa)
Score = 235, Expect = 1.4e-18, Identities = 53/142 (37%), Positives = 84/142 (59%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEI--LDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           +K+ IG+DH G + K+ I     +LE    +  + GT + D SVDYPD+   +  ++ + K  +GI ICG+G GI + +NK   + A        A L R HN+ N++++  RFTS+   VEI++ F  + FE GRH+ R++KI
  S:     1 MKISIGNDHAGPEYKKSIV---AMLEARGYEVTNYGTDT-DASVDYPDFGHPVANDVSEGKADFGIVICGSGNGIAMTVNKHPKVRAGLCWTKEIAYLTRLHNDANIVSIPARFTSIHQAVEIVETFLDTAFEGGRHQNRVNKI 140
>gi|88804562|ref|ZP_01120082.1| ribose 5-phosphate isomerase B, putative [Robiginitalea biformata HTCC2501] >gi|88785441|gb|EAR16610.1| ribose 5-phosphate isomerase B, putative [Robiginitalea biformata HTCC2501] (143 aa)
Score = 234, Expect = 1.6e-18, Identities = 52/142 (36%), Positives = 85/142 (59%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANV-NKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           +K+ IG+DH G + K  I    + ++I + ++ GT  G + VDY D+   +  ++   +   GI +CG+G G C+  NK + I AA   NK I   LAREHNN N++ L  RF ++   +E+++ F  + FE GRH++R++KI
  S:     1 MKIAIGNDHAGTEYKLAIVGLLKSMDI-EVINHGT-DGTDGVDYADFIHPVATDVASGEADLGIVVCGSGNGACMTANKHQEIRAALCWNKEI-VSLAREHNNANILGLPARFLAIPQALEMVRTFLDTPFEGGRHQRRIEKI 140
>gi|77973185|ref|ZP_00828736.1| COG0698: Ribose 5-phosphate isomerase RpiB [Yersinia frederiksenii ATCC 33641] (148 aa)
Score = 234, Expect = 1.7e-18, Identities = 52/148 (35%), Positives = 82/148 (55%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           +K+ IG DH G  +K  I   H +   +  +D G +  D   DYP Y + + E ++  + + GI  CG+GIGI IA NK+KGI A   ++   A+L+REHNN NV++   R    +    I+  +  + FE  RH+KR++ I  +E +
  S:     1 MKIAIGCDHVGIILKPAI-TEHLIARGITVIDKGAHE-DTRTDYPIYGKAVAEAVVSGEANLGIVFCGSGIGISIAANKVKGIRAVVCSEPYSAKLSREHNNTNVLSFGSRVIGSDLAKMIVDAWLDAKFEGERHQKRVEMIAAIEEE 146
>gi|116621323|ref|YP_823479.1| ribose-5-phosphate isomerase [Solibacter usitatus Ellin6076] >gi|116224485|gb|ABJ83194.1| ribose-5-phosphate isomerase [Solibacter usitatus Ellin6076] (166 aa)
Score = 234, Expect = 1.8e-18, Identities = 53/146 (36%), Positives = 81/146 (55%)
  Q:    13 VYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           + IGSDHGGF +KE ++   E L  L   D+G  + ++  DYPD A  + + +     + G+ I G GIG C+A NK+ GI AA       A+  REHN+ NV+TL  R  +     E+++ +  + F  GRH+ R+ KI  +E +
  S:    16 IAIGSDHGGFRLKEALKPLLEGLG-LQVRDVGV-NEEKPADYPDIAHAVAKLVAGGTAARGVIIDGAGIGSCMAANKVPGIRAALCYDKASAKNGREHNDSNVLTLGARLLTQTQAEEVLRTWLETPFAGGRHQARVQKIMDVEQQ 159
>gi|56965373|ref|YP_177105.1| ribose 5-phosphate isomerase B [Bacillus clausii KSM-K16] >gi|56911617|dbj|BAD66144.1| ribose 5-phosphate isomerase B [Bacillus clausii KSM-K16] (153 aa)
Score = 234, Expect = 1.8e-18, Identities = 51/146 (34%), Positives = 87/146 (59%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLE 156
           +K+ IGSDH  F++KE+++  + + E  D VD G +S  E+VDYPD + ++G +++K +   GI ICGTGIG+ IA  K+ GI AA  + T  AE A+  NN  ++T+  +    E   +++  +  + F  G   +++ +I + E
  S:     1 MKIAIGSDHNAFELKEELKT-YMIDEGYDVVDYGCHSC-EAVDYPDVSFRVGNDIMKGEIDRGILICGTGIGVAIAAGKVPGIRAALCHDTYSAERAQLSNNAQILTMGAKVIGPEAAKKVLNAYLGASFAGGPSARKIQQIAEQE 144
>gi|57234553|ref|YP_181419.1| ribose-5-phosphate isomerase B [Dehalococcoides ethenogenes 195] >gi|57234618|ref|YP_181385.1| ribose-5-phosphate isomerase B [Dehalococcoides ethenogenes 195] >gi|57225001|gb|AAW40058.1| ribose-5-phosphate isomerase, putative [Dehalococcoides ethenogenes 195] >gi|57225066|gb|AAW40123.1| ribose-5-phosphate isomerase, putative [Dehalococcoides ethenogenes 195] (152 aa)
Score = 234, Expect = 1.9e-18, Identities = 54/151 (35%), Positives = 83/151 (54%)
  Q:     8 LKKIKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFE-SGRHEKRLDKITKLENK 158
           +  I V IG+DHGG+ +K  +      L I   +DLG  + D + DYPD+A  +   +   +   GI ICG+G+G CI  NKIKG+ A   +    A    EH+++NV+ L  R   +E   EII  F ++ F    RH++RL+K+ + E +
  S:     1 MSNISVAIGADHGGYGLKTDLLPFLNQLGI-KVLDLGACTYDSADDYPDFALAVARKVACGQTDRGIIICGSGVGACITANKIKGVRAGLCHDVYSAHQGVEHDDMNVLCLGARVIGIEVAKEIITAFLNARFTGEERHKRRLEKLLQAEKE 151
>gi|13357562|ref|NP_077836.1| galactoside O-acetyltransferase [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|167971165|ref|ZP_02553442.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|168282015|ref|ZP_02689682.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|168308162|ref|ZP_02690837.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|170762378|ref|YP_001752086.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|11279026|pir||E82945 galactoside O-acetyltransferase UU006 [imported] - Ureaplasma urealyticum >gi|6898950|gb|AAF30411.1|AE002100_4 galactoside O-acetyltransferase [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168827955|gb|ACA33217.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171902742|gb|EDT49031.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|182676015|gb|EDT87920.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186701070|gb|EDU19352.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Ureaplasma parvum serovar 6 str. ATCC 27818] (154 aa)
Score = 233, Expect = 2.1e-18, Identities = 58/147 (39%), Positives = 87/147 (59%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGI--CGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           K+Y G+DH  +++K++I   H   +    +D G  +   SVDY  YA K+  +++ D  +  IGI  CGTGIG+ IA +K+ G   A V     A+LA+EHNN N+IT+  R  S+   +++I  F +S F   RH+KRLD I K E +
  S:     4 KIYFGNDHAAYEIKDQIIT-HLKQKGYQIIDEGAQAALGSVDYSTYALKVANDVVNDTKNDSIGILLCGTGIGMNIAASKVHGTRVALVYNESSAKLAKEHNNANIITIGARENSLNQILKMIDDFLTSKFLGERHQKRLDIIAKYEKE 151
>gi|38234367|ref|NP_940134.1| ribose-5-phosphate isomerase B [Corynebacterium diphtheriae NCTC 13129] >gi|38200630|emb|CAE50326.1| Putative ribose/galactose isomerase [Corynebacterium diphtheriae] (157 aa)
Score = 233, Expect = 2.1e-18, Identities = 55/146 (37%), Positives = 82/146 (56%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHF-ESGRHEKRLDKITKLE 156
           ++VY+G+DH GFDMK  I + H   +  + +D G ++ D   DYP Y  +    ++ D GS GI + G+G G  IA NK+KG   A       A LAREHNN  +I L GR  S E+ + I+  F    + +  RH++R+D + + E
  S:     1 MRVYLGADHAGFDMKNIIAD-HLKAKGHEVIDCGAHTYDALDDYPAYCIEAASRVVNDPGSLGIVLGGSGNGEQIAANKVKGARCALAWSVETARLAREHNNAQLIGLGGRMHSEEEALAIVDAFLDQEWSKEERHQRRIDILCEYE 146
>gi|72162601|ref|YP_290258.1| ribose-5-phosphate isomerase B [Thermobifida fusca YX] >gi|71916333|gb|AAZ56235.1| ribose/galactose isomerase:Ribose 5-phosphate isomerase, actinobacteria [Thermobifida fusca YX] (166 aa)
Score = 233, Expect = 2.6e-18, Identities = 50/146 (34%), Positives = 84/146 (57%)
  Q:    11 IKVYIGSDHGGFDMKEKI-----RNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFE-SGRHEKRLDKITKLE 156
           +++YIGSDH G+++K+ +     +  H      D +D G    D + DYP +  +  E + KD  + GI + G+G G  IA NK+KG+ AA V     A+LAREHNN NVI++  R  ++++    +  F ++ +    RH +R+  ++  E
  S:    12 VRIYIGSDHAGYELKQHLVSWLQKQGH------DVIDAGPAVYDAADDYPPFVLRAAEGVAKDPEALGIVLGGSGNGEQIAANKVKGVRAALVWSNETAKLAREHNNANVISIGARMHTIDEATGFVDTFLTTPYSGEERHSRRIRMLSDYE 157
>gi|150015438|ref|YP_001307692.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Clostridium beijerinckii NCIMB 8052] >gi|149901903|gb|ABR32736.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Clostridium beijerinckii NCIMB 8052] (147 aa)
Score = 232, Expect = 2.7e-18, Identities = 56/146 (38%), Positives = 84/146 (57%)
  Q:    13 VYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           + IG+DHGG+ +KE I+   +   + +++D+GT+S D S+DYP  A  +   +       GI  CGTGIG+ I  NKIKG+ AA V     A+  REHN+ NV+ L GR    E  + I+  + S+ F    H  RL++I ++E K
  S:     2 IAIGADHGGYKLKEFIKGYLDKNSV-EYIDVGTFSED-SIDYPQIAMDVANRVSIGDCEKGILCCGTGIGMSIVANKIKGVRAALVGDCFTAKATREHNDSNVLCLGGRVIGEELALMIVDIWLSTEFIGKHHVNRLNQIKEIEEK 145
>gi|89889726|ref|ZP_01201237.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Flavobacteria bacterium BBFL7] >gi|89517999|gb|EAS20655.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Flavobacteria bacterium BBFL7] (143 aa)
Score = 232, Expect = 2.9e-18, Identities = 52/142 (36%), Positives = 82/142 (57%)
  Q:    11 IKVYIGSDHGGFDMKEKI-----RNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           + + IG+DH G D K+ I     +  H++       + GT + D SVDYPD+A K+G+++       GI ICG+  G+ + +NK + +  A       A LAREHNN N+I +  RFTS+   + +++ F  + F  GRH  R++KI
  S:     1 MNISIGNDHAGPDYKQAIVDMLKKRGHQV------TNHGTDTLD-SVDYPDFAHKVGQDVDSHTVDLGIVICGSAQGVSMTVNKYQNVRGAVCWSKEIAGLAREHNNANIICIPARFTSIPQAIAMVETFLDTEFAGGRHANRVNKI 140
>gi|71756095|ref|XP_828962.1| ribose 5-phosphate isomerase [Trypanosoma brucei TREU927] >gi|70834348|gb|EAN79850.1| ribose 5-phosphate isomerase, putative [Trypanosoma brucei] (155 aa)
Score = 232, Expect = 2.9e-18, Identities = 60/146 (41%), Positives = 82/146 (56%)
  Q:    12 KVYIGSDHGGFDMKEKI-RNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFE-SGRHEKRLDKITKLEN 157
           KV IG+DH GF + E I R   E  E  + V +G +S  E VDYPDYA  +   + + +   GI +CG+GIG+ IA NK+ GI AA       A +AR+HN+ NV+ L  R T      EII  F  + +    RH +RL+KI   E+
  S:     4 KVAIGADHIGFPIHESIVRYVREAGEEFEPVYIGPHS-LERVDYPDYALNVARMVARGEADVGILVCGSGIGMSIAANKVPGIRAALCFDHYTAVMARQHNDANVVCLGERTTGPAVLREIIMTFLQTPYSGEDRHTQRLEKIKAAES 150
>gi|160900016|ref|YP_001565598.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Delftia acidovorans SPH-1] >gi|160365600|gb|ABX37213.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Delftia acidovorans SPH-1] (157 aa)
Score = 232, Expect = 3.0e-18, Identities = 52/146 (35%), Positives = 79/146 (54%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLE 156
           +K+ IG D    D+K  ++  H L +  +  D GT+ G E V YPD    + + +++ +   G+ +CGTGIG+ IA NK+ GI AA  + T  AE A   N+  +ITL  R   VE    I+ +F +S F+ G    ++D IT  E
  S:     1 MKLAIGCDEAACDLKNAVKQ-HLLAQGHEVADFGTHDG-EPVLYPDIGIAVAQAIVQGRHERGVLLCGTGIGMAIAANKVAGIRAAQAHDTYSAERASRSNDAQIITLGSRVIGVELAKAIVDRFLASRFDGGSSALKVDAITGFE 144
>gi|25028874|ref|NP_738928.1| ribose-5-phosphate isomerase B [Corynebacterium efficiens YS-314] >gi|23494161|dbj|BAC19128.1| putative sugar phosphate isomerase [Corynebacterium efficiens YS-314] (157 aa)
Score = 232, Expect = 3.4e-18, Identities = 53/146 (36%), Positives = 80/146 (54%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESG-RHEKRLDKITKLE 156
           ++VY+G+DH GF+ K  I   H      + +D G ++ D   DYP +  +     + D GS GI + G+G G  IA NK+KG   A       A LAREHNN N+I + GR  S E+ +EI+  F    + +  RH++R+D ++  E
  S:     1 MRVYLGADHAGFETKNAIAE-HLKAHGHEVIDCGAHTYDPDDDYPAFCIEAANRTVNDPGSLGIVLGGSGNGEQIAANKVKGARCALAWSVETARLAREHNNANLIGIGGRMHSTEEALEIVDAFLDQEWSNAERHQRRIDILSDYE 146
>gi|167344766|ref|ZP_02290607.1| ribose-5-phosphate isomerase B [Listeria monocytogenes FSL J1-208] (165 aa)
Score = 231, Expect = 3.6e-18, Identities = 56/146 (38%), Positives = 82/146 (56%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLEN 157
           KV I SDHGG ++++ I +  E + I  + + G  +  ESVDYP  A  + E ++  +   GI +CGTGIG+ IA NK+KGI  A V  T  A   REHN+ NV+ L  R        +I+K +  + +E GRH  R+ +I   E+
  S:    19 KVAIASDHGGIELRKSIISYLESVGI-SYEEFGPET-PESVDYPGLAITVSEKVVNREVDRGILVCGTGIGMSIAANKVKGIRCALVGDTFSAHATREHNDTNVLALGARVIGPGLAEDIVKIWLETAYEGGRHANRVGQIAAYED 162
>gi|15604168|ref|NP_220683.1| ribose-5-phosphate isomerase B [Rickettsia prowazekii str. Madrid E] >gi|51473495|ref|YP_067252.1| ribose-5-phosphate isomerase B [Rickettsia typhi str. Wilmington] >gi|81554875|sp|Q9ZDM8|Y299_RICPR Putative sugar phosphate isomerase RP299 >gi|81826320|sp|Q68X72|Y290_RICTY Putative sugar phosphate isomerase RT0290 >gi|3860860|emb|CAA14760.1| GALACTOSE-6-PHOSPHATE ISOMERASE LACB SUBUNIT (lacA) [Rickettsia prowazekii] >gi|51459807|gb|AAU03770.1| ribose 5-phosphate epimerase; 5-phosphoribose isomerase.; D-ribose-5-phosphate ketol-isomerase.; Phosphopentoseisomerase.; Phosphoriboisomerase.; Ribose 5-phosphate isomerase.; Ribose phosphate isomerase. [Rickettsia typhi str. Wilmington] (144 aa)
Score = 231, Expect = 3.6e-18, Identities = 57/145 (39%), Positives = 83/145 (57%)
  Q:     8 LKKIKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           +K   + I SDH G+++K KI N  E  + L+  D GT    ++VDYPDYA+K+ + +++     GI I  TGIG+ IA N+   I AA  N  + AE A+ HN+ N++ L  +    +    II KF ++ FE GRH  RL KI
  S:     1 MKTYNIVIASDHSGYELKSKIINYLEQ-KCLNIYDCGT-QDTQTVDYPDYAKKVVDIIIEKAAPIGILISDTGIGMSIAANRSSEIRAALCNDILTAENAKAHNDANILILGAKSVDNKIVFNIIDKFLTTKFEGGRHSTRLSKI 143
>gi|126662737|ref|ZP_01733736.1| ribose 5-phosphate isomerase B [Flavobacteria bacterium BAL38] >gi|126626116|gb|EAZ96805.1| ribose 5-phosphate isomerase B [Flavobacteria bacterium BAL38] (143 aa)
Score = 231, Expect = 4.3e-18, Identities = 53/142 (37%), Positives = 86/142 (60%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILD-----FVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           +K+ IG+DH G D K+ I      ++ L+       + GT + D SVDYPD+   +  ++   K  +GI ICG+G GI + +NK + I AA       A LAR+HN+ N++++  R+TS++  +E++  F ++ FE GRH  R+ KI
  S:     1 MKISIGNDHAGPDYKKAI------VQFLEEKGHTIYNHGTDTFD-SVDYPDFGHPVAYDVESKKADFGIVICGSGNGIAMTVNKHQDIRAALCWTKEIAALARQHNDANILSIPARYTSIQQAIEMVDTFLNTSFEGGRHANRVKKI 140
>gi|163786941|ref|ZP_02181389.1| ribose 5-phosphate isomerase B [Flavobacteriales bacterium ALC-1] >gi|159878801|gb|EDP72857.1| ribose 5-phosphate isomerase B [Flavobacteriales bacterium ALC-1] (144 aa)
Score = 231, Expect = 4.5e-18, Identities = 49/142 (34%), Positives = 80/142 (56%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           +K+ IG+DH G D K+ +  + E  +     + GT + D SVDYPD+   + +++       GI ICG+  G+ +  NK + + A     +   EL R HNN N+I +  RFTS+   ++++  F ++ FE GRH+ R+DKI
  S:     1 MKISIGNDHAGPDYKQAVVKHLET-KGYTITNYGTDTLD-SVDYPDFVHPVAKDVNDGNADLGILICGSANGVAMTANKYQNVRAGVCWTSEITELTRLHNNANIICIPARFTSIPQAIKMVDTFLNTAFEGGRHQNRVDKI 140
>gi|67159081|ref|ZP_00419815.1| Ribose/galactose isomerase [Azotobacter vinelandii AvOP] >gi|67084328|gb|EAM03814.1| Ribose/galactose isomerase [Azotobacter vinelandii AvOP] (157 aa)
Score = 231, Expect = 4.6e-18, Identities = 54/144 (37%), Positives = 80/144 (55%)
  Q:    13 VYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLE 156
           V IG D  GF++KE ++ + E L      D G YS D  V YPD A  +   +   +   G+ ICGTGIG+ I+ NKI+GI AA  + T  AE AR+ N+  ++++  R    E    I+K F  S FE+GR   ++++I  +E
  S:     7 VAIGCDEAGFELKELLKRHIEDLG-YRLKDFGCYSTD-PVLYPDIATAVATAISAGQHRLGVLICGTGIGMAISANKIQGIRAAQAHDTYSAERARKSNDAQIVSIGARVIGPELAKNIVKSFLESEFEAGRSGPKVERIKAVE 148
>gi|157964374|ref|YP_001499198.1| ribose-5-phosphate isomerase B [Rickettsia massiliae MTU5] >gi|157844150|gb|ABV84651.1| Ribose-5-phosphate isomerase [Rickettsia massiliae MTU5] (149 aa)
Score = 230, Expect = 4.8e-18, Identities = 57/148 (38%), Positives = 85/148 (57%)
  Q:     5 KKQLKKIKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           K  +K   + I SDH G+++K +I N  E  + L   D GT +  ++VDYPDYA+K+ + +++     GI I  TGIG+ IA N+   I AA  N  + AE A+ HN+ N++ L  +    +   +II KF ++ FE GRH  RL KI
  S:     3 KLTMKTYNIVIASDHSGYELKSEIINYLEQ-KSLKIYDCGT-NNTQTVDYPDYAKKVVDIIIEKSAPIGILISDTGIGMSIAANRSSEIRAALCNDILTAENAKAHNDANILILGAKTIGQKIVFDIIDKFLTTQFEGGRHSTRLSKI 148
>gi|34580661|ref|ZP_00142141.1| ribose-5-phosphate isomerase [Rickettsia sibirica 246] >gi|28262046|gb|EAA25550.1| ribose-5-phosphate isomerase [Rickettsia sibirica 246] (144 aa)
Score = 230, Expect = 5.2e-18, Identities = 56/145 (38%), Positives = 84/145 (57%)
  Q:     8 LKKIKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           +K   + I SDH G+++K +I N  E  + L   D GT +  ++VDYPDYA+K+ + +++     GI I  TGIG+ IA N+   I AA  N  + AE A+ HN+ N++ L  +    +   +II KF ++ FE GRH  RL KI
  S:     1 MKTYNIVIASDHSGYELKSEIINYLEQ-KSLKIYDCGT-NNTQTVDYPDYAKKVVDIIIEKSAPIGILISDTGIGMSIAANRNSEIRAALCNNILTAENAKAHNDANILILGAKTIDPKIVCDIIDKFLTTQFEGGRHSTRLSKI 143
>gi|120405007|ref|YP_954836.1| ribose-5-phosphate isomerase B [Mycobacterium vanbaalenii PYR-1] >gi|119957825|gb|ABM14830.1| ribose 5-phosphate isomerase [Mycobacterium vanbaalenii PYR-1] (157 aa)
Score = 230, Expect = 5.3e-18, Identities = 51/146 (34%), Positives = 82/146 (56%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHF-ESGRHEKRLDKITKLE 156
           ++VY+G+DH G+++K+ I   H      + VD G ++ D   DYP +     +  + D GS GI + G+G G  IA NK+ G   A       A LAREHNN  +I + GR  S E+ + I+  F ++ + E+ RH++R+D + + E
  S:     1 MRVYVGADHAGYELKQTIVE-HLKATGHEPVDCGAFTYDAEDDYPAFCIAAAQKTVADPGSLGIVLGGSGNGEQIAANKVPGARCALAWSPETASLAREHNNAQLIGIGGRMHSTEEALAIVDAFLTTKWSEAPRHQRRIDILAEYE 146
>gi|111018386|ref|YP_701358.1| ribose-5-phosphate isomerase B [Rhodococcus sp. RHA1] >gi|110817916|gb|ABG93200.1| probable ribose 5-phosphate isomerase [Rhodococcus sp. RHA1] (157 aa)
Score = 230, Expect = 5.4e-18, Identities = 52/146 (35%), Positives = 86/146 (58%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFES-GRHEKRLDKITKLE 156
           ++VY+G+DH GF+ K +I   H      + VD G +  D   DYP +  +    ++ D+GS GI + G+G G  IA NK+KG   A       A+LAR+HNN  +I L GR  S+E+++ I+  F ++ + +  RH++R+D +++ E
  S:     1 MRVYLGADHAGFERKNEIIE-HLTAAGHETVDCGAHVYDALDDYPAFCIETARRVVADEGSLGIVLGGSGNGEQIAANKVKGARCALAWSVETAQLARQHNNAQLIGLGGRMHSLEESLAIVDAFLAAEWSNEERHQRRIDILSEFE 146
>gi|42561413|ref|NP_975864.1| ribose 5-phosphate isomerase, RpiB [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|42492911|emb|CAE77506.1| ribose 5-phosphate isomerase, RpiB [Mycoplasma mycoides subsp. mycoides SC str. PG1] (165 aa)
Score = 230, Expect = 5.7e-18, Identities = 53/146 (36%), Positives = 86/146 (58%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLEN 157
           ++YIG+DH   +MK+ I   H   +  + +DLG   G +S +Y    + + E+++ D  S GI ICGTGIGI IA NK+K   AA V +    ELAR HN+ N++ L  R  ++   + ++  F ++ FE GRH +R++ + + +N
  S:    22 RIYIGNDHSAVEMKQAIVK-HLQEKNYEVIDLGNNDG-KSCNYAKIGQVVAEHVVNDTNSRGIVICGTGIGISIAANKVKTARAALVYEKETVELARIHNDANILALGARIIAISKAINLVDVFLNTPFEGGRHIERVNTLNEYKN 165
>gi|163811865|ref|ZP_02203547.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Dehalococcoides sp. VS] >gi|157404521|gb|EDO70559.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Dehalococcoides sp. VS] (152 aa)
Score = 229, Expect = 6.0e-18, Identities = 54/151 (35%), Positives = 85/151 (56%)
  Q:     8 LKKIKVYIGSDHGGFDMKEKIRNNHELLEIL-----DFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFE-SGRHEKRLDKITKLENK 158
           +  I V IG+DHGG+ +K       +LL  L     D +DLG  + + + DYPD+A  +   +   +   GI ICG+G+G CI  NKIKG+ A   +    A    EH+++NV+ L  R   +E   EII  F ++ F    RH++R++K+ + E +
  S:     1 MSNISVAIGADHGGYGLKI------DLLPFLNQLGADVLDLGACAYNSTDDYPDFALAVARKVACGQTDRGIIICGSGVGACITANKIKGVRAGLCHDVYSAHQGVEHDDMNVLCLGARVIGIEVAKEIITAFLNARFTGEERHKRRMEKLLQAEKE 151
>gi|15892325|ref|NP_360039.1| ribose-5-phosphate isomerase B [Rickettsia conorii str. Malish 7] >gi|81528380|sp|Q92IL8|Y402_RICCN Putative sugar phosphate isomerase RC0402 >gi|15619469|gb|AAL02940.1| ribose-5-phosphate isomerase [EC:5.3.1.6] [Rickettsia conorii str. Malish 7] (144 aa)
Score = 229, Expect = 6.4e-18, Identities = 56/145 (38%), Positives = 84/145 (57%)
  Q:     8 LKKIKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           +K   + I SDH G+++K +I N  E  + L   D GT +  ++VDYPDYA+K+ + +++     GI I  TGIG+ IA N+   I AA  N  + AE A+ HN+ N++ L  +    +   +II KF ++ FE GRH  RL KI
  S:     1 MKTYNIVIASDHSGYELKSEIINYLEQ-KSLKIYDCGT-NNTQTVDYPDYAKKVVDIIIEKSAPIGILISDTGIGMSIAANRSSEIRAALCNNILTAENAKAHNDANILILGAKTIDQKIVFDIIDKFLTTQFEGGRHSTRLSKI 143
>gi|51246639|ref|YP_066523.1| ribose 5-phosphate isomerase B [Desulfotalea psychrophila LSv54] >gi|50877676|emb|CAG37516.1| probable ribose 5-phosphate isomerase B [Desulfotalea psychrophila LSv54] (142 aa)
Score = 229, Expect = 6.4e-18, Identities = 51/145 (35%), Positives = 86/145 (59%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKL 155
           + + I SDHGG+++KE ++     L      D+G  S D SVDYPDYA++  + L+ + G  G+ ICGTGIG+ IA N+ + + AA  +    A ++REHN+ N++ +  R  S E   +++  + ++ F  GRH +R+ K + +
  S:     1 MNIIIASDHGGYELKELLKKKIVALG-HTIEDVGCDSLD-SVDYPDYAQRAVDALV-EHGDRGVLICGTGIGMSIAANRNRSVRAALCHDEYTAAMSREHNDANILCMGARVLSPERAQQVLHTWLTTEFVGGRHLQRITKFSDI 142
>gi|157828278|ref|YP_001494520.1| ribose-5-phosphate isomerase B [Rickettsia rickettsii str. 'Sheila Smith'] >gi|165932982|ref|YP_001649771.1| ribose-5-phosphate isomerase B [Rickettsia rickettsii str. Iowa] >gi|157800759|gb|ABV76012.1| ribose-5-phosphate isomerase B [Rickettsia rickettsii str. 'Sheila Smith'] >gi|165908069|gb|ABY72365.1| ribose 5-phosphate isomerase [Rickettsia rickettsii str. Iowa] (144 aa)
Score = 229, Expect = 6.8e-18, Identities = 56/145 (38%), Positives = 83/145 (57%)
  Q:     8 LKKIKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           +K   + I SDH G+++K +I N  E  + L   D GT +  ++VDYPDYA+K+ + +++     GI I  TGIG+ IA N+   I AA  N    AE A+ HN+ N++ L  +    +   +II KF ++ FE GRH  RL KI
  S:     1 MKTYNIVIASDHSGYELKSEIINYLEQ-KSLKIYDCGT-NNTQTVDYPDYAKKVVDIIIEKSAPIGILISDTGIGMSIAANRSSEIRAALCNNIFTAENAKAHNDANILILGAKTIDPKIVFDIIDKFLTTQFEGGRHSTRLSKI 143
>gi|71894407|ref|YP_278515.1| ribose-5-phosphate isomerase B [Mycoplasma synoviae 53] >gi|71851195|gb|AAZ43804.1| ribose 5-phosphate isomerase B [Mycoplasma synoviae 53] (147 aa)
Score = 229, Expect = 7.4e-18, Identities = 53/140 (37%), Positives = 81/140 (57%)
  Q:    15 IGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSG-DESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITK 154
           + SDH GF++KE++  + + L     VDLG  S  D   +Y      +   +L++K  +GIGICGTG+GI  ALN+   I AA V    +A LA+ HN+ NV+    R  S +   E+I+ + ++ FE GRH KR++ I +
  S:     7 LASDHAGFELKERLEKHFQALG-YKIVDLGAKSNLDSDNNYALAGHDLAHYMLENKCEFGIGICGTGLGISYALNRHNHIRAARVTSNEDAHLAKLHNDANVLVFGARQVSFDQAKEMIENYINTTFEGGRHLKRINDIDR 146
>gi|149921256|ref|ZP_01909712.1| ribose 5-phosphate isomerase B [Plesiocystis pacifica SIR-1] >gi|149817916|gb|EDM77378.1| ribose 5-phosphate isomerase B [Plesiocystis pacifica SIR-1] (155 aa)
Score = 229, Expect = 7.5e-18, Identities = 43/139 (30%), Positives = 80/139 (57%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGS------YGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRL 149
           ++ ++GSDHGG ++++ +       EI    + G  +  E  DYP+ A ++ + +L+D+G       +G+ +CGTG G+ +  NK+ G+ A  V+    A++ R HN+  V+ L  R    E   ++++ F  + FE GRH +R+
  S:     1 MRFHVGSDHGGVELRKVLVAALAEWEIPVLAEYGPAAPGEKADYPNVARELAQAVLRDRGQGGGEDVFGLLVCGTGQGVAMTANKVPGVRAGVVSDVFSAKMIRAHNDAQVLCLGERVLGTELAKQLLRAFIDAPFEGGRHARRV 145
>gi|167649028|ref|YP_001686691.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Caulobacter sp. K31] >gi|167351458|gb|ABZ74193.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Caulobacter sp. K31] (148 aa)
Score = 229, Expect = 7.5e-18, Identities = 52/142 (36%), Positives = 74/142 (52%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEIL-----DFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           +++ I SDH   ++K       EL E L     D  DLG+  G   VDYPDY  ++   +       GI +CG+GIGI IA+N+      A VN  + A L R HN+ NVI L  R   ++     + KF  + F  GRH  R++K+
  S:     1 MRIAIASDHAAIELKA------ELAEWLTGEGHDVADLGS-DGAARVDYPDYGYELAAYIAAGWAERGIALCGSGIGISIAVNRNPACRCALVNDPVSATLGRAHNDANVIALGARLVGLDVAKACVAKFLETEFAGGRHGPRVEKL 140
>gi|88658472|ref|YP_507448.1| ribose 5-phosphate isomerase B [Ehrlichia chaffeensis str. Arkansas] >gi|88599929|gb|ABD45398.1| ribose 5-phosphate isomerase B [Ehrlichia chaffeensis str. Arkansas] (148 aa)
Score = 229, Expect = 7.6e-18, Identities = 54/141 (38%), Positives = 82/141 (58%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLEILDFV--DLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           K++I SDH G +++  I+     L  L +V  D G      +VDYPDY + + + ++   G +GI ICGTGIG+ I  N+ + I AA       A+LAREHNN NV+ L  R+ +  +   I+ +F ++ F  GRH +R+ KI
  S:     6 KIFISSDHAGIELRLVIK---LYLSNLGYVVEDYGCMESSIAVDYPDYVQNVVDCVINTLG-FGILICGTGIGMSIVANRHRKIRAALCYNVEVAKLAREHNNANVLCLGARYINHGEAQSIVYQFITTKFSEGRHVQRIAKI 144
>gi|167040551|ref|YP_001663536.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Thermoanaerobacter sp. X514] >gi|166854791|gb|ABY93200.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Thermoanaerobacter sp. X514] (153 aa)
Score = 229, Expect = 7.6e-18, Identities = 53/148 (35%), Positives = 84/148 (56%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           +K+ +GSDH GFD+KE I+  H   + +  VD+G Y  +  VDYPD A  + E +   +   GI ICGTGIG+ I  NK+ G+ AA  +    AE AR+ N+  ++T+ G     E   +++  +  S F+ GR   +++KI  ++ K
  S:     2 MKIILGSDHFGFDLKEVIKE-HLQSKGIAVVDIGVYDKN-PVDYPDIAVALAERVASGEFERGILICGTGIGMAIVANKVPGVRAAVCHDVYSAERARKSNDAQIMTMGGVIVGPELAKKLVDVWLESEFQGGRSLPKVEKIKMIDAK 147
>gi|167211503|ref|ZP_02281810.1| hypothetical protein LmonL_04289 [Listeria monocytogenes LO28] (130 aa)
Score = 228, Expect = 8.0e-18, Identities = 54/133 (40%), Positives = 78/133 (58%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESG 143
           +++ I +DHGGF +KEKIR  H +       D G YS  ESVD+P+YA K+G + +  + S G+  CGTGIG+ +A NKIKG+ AA V+    A + R HNN NV+ L  R       + ++  +  + FE G
  S:     1 MEIAIAADHGGFQLKEKIRA-HLIESGYTVKDFGCYSL-ESVDFPEYAAKVG-HFVATENSLGVLCCGTGIGMSMAANKIKGVRAAVVSDAFSAMMTRRHNNSNVLCLGERVLGDSLALLLLDTWLVAEFEGG 130
>gi|158521074|ref|YP_001528944.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Desulfococcus oleovorans Hxd3] >gi|158509900|gb|ABW66867.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Desulfococcus oleovorans Hxd3] (148 aa)
Score = 228, Expect = 8.1e-18, Identities = 50/138 (36%), Positives = 79/138 (57%)
  Q:    11 IKVYIGSDHGGF----DMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHF-ESGRHEKR 148
           + + I SDH GF    D+ + +R NH   E+    DLG    D  VDYP YA  +   +       GI ICG+GIG+ +  N+ +G+ AA       AEL+R+HN  NV+ L+GR   +E+N++I+  + ++ + +  RH +R
  S:     1 MNIIIASDHAGFRTKRDIIDYLRRNHATWEV---TDLGP-EDDAPVDYPIYAHMVASAVAAGDYRRGILICGSGIGMSMMANRFQGVRAALCVTPQMAELSRQHNRSNVLCLAGRLVELEENIQIVNTWLNTDYTDEARHTRR 139
>gi|121534887|ref|ZP_01666706.1| sugar-phosphate isomerases, RpiB/LacA/LacB family [Thermosinus carboxydivorans Nor1] >gi|121306486|gb|EAX47409.1| sugar-phosphate isomerases, RpiB/LacA/LacB family [Thermosinus carboxydivorans Nor1] (146 aa)
Score = 228, Expect = 8.3e-18, Identities = 63/146 (43%), Positives = 90/146 (61%)
  Q:    13 VYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           V IGSDHGGF +KE+I+   E  E + + D GTYS D SVDYPD +  + + +   +   GI ICGTGIG+ IA NKIKGI AA  +    A+++REHN+ N++T+  R         I+ K+ ++ F  GRH +R+ +I  LE +
  S:     3 VAIGSDHGGFRLKEEIKRFLEE-EKIAYRDFGTYSTD-SVDYPDISRSVAQAVATGECDRGIIICGTGIGVSIAANKIKGIRAALCHDVYSAQMSREHNDANILTMGERVIGPGLARAIVAKWLATEFAGGRHARRVCQIASLEEE 146
>gi|163741454|ref|ZP_02148845.1| ribose 5-phosphate isomerase B [Phaeobacter gallaeciensis 2.10] >gi|161385188|gb|EDQ09566.1| ribose 5-phosphate isomerase B [Phaeobacter gallaeciensis 2.10] (151 aa)
Score = 228, Expect = 8.7e-18, Identities = 48/146 (32%), Positives = 78/146 (53%)
  Q:     7 QLKKIKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           Q K  +V + SDH   ++++ I + H      + VD+G  +  ES  YP +     E +       GI +CGTG GI +A NK+KG+     ++T  A++ R+HNN N++++  R       +EI+  F ++ FE GRH  R+D I
  S:     3 QKKPTRVVLSSDHAAIELRQAIAD-HIAANGWEVVDIGP-TTPESTHYPKHGAAAAERVASGDCDLGIILCGTGQGIMMAANKVKGVRCGVCSETFSAKMIRQHNNANMLSIGARVVGDSLAIEIVDAFLNAEFEGGRHATRVDMI 146
>gi|163738834|ref|ZP_02146248.1| ribose 5-phosphate isomerase B [Phaeobacter gallaeciensis BS107] >gi|161388162|gb|EDQ12517.1| ribose 5-phosphate isomerase B [Phaeobacter gallaeciensis BS107] (151 aa)
Score = 228, Expect = 9.8e-18, Identities = 49/146 (33%), Positives = 77/146 (52%)
  Q:     7 QLKKIKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           Q K  +V + SDH   ++++ I + H      + VD+G  +  ES  YP +     E +       GI +CGTG GI +A NK+KGI     + T  A++ R+HNN N++++  R       +EI+  F ++ FE GRH  R+D I
  S:     3 QKKPTRVVLSSDHAAIELRQAIAD-HITANGWEVVDIGP-TTPESTHYPKHGAAAAERVASGDCDLGIILCGTGQGIMMAANKVKGIRCGVCSDTFSAKMIRQHNNANMLSIGARVVGDSLAIEIVDAFLNAEFEGGRHATRVDMI 146
>gi|87310177|ref|ZP_01092309.1| ribose 5-phosphate isomerase B [Blastopirellula marina DSM 3645] >gi|87287167|gb|EAQ79069.1| ribose 5-phosphate isomerase B [Blastopirellula marina DSM 3645] (145 aa)
Score = 227, Expect = 1.2e-17, Identities = 53/146 (36%), Positives = 80/146 (54%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEIL--DFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLE 156
           +K+ + SDH GF  K+ I    E L+ L  +  D GT+S  ES DYPD+     + +   K   GI + G+G G  IA N+I+G+  A       A+L R HNN NVI +  R   +   +EI+  + +  FE GRH++R++K+   E
  S:     1 MKIVVASDHAGFHYKQAIL---EYLQKLGHEAADYGTFSA-ESCDYPDFIMPAAQAVADGKFERGIVLGGSGNGEAIAANRIRGVRCAYCWSVETAQLGRRHNNANVIAMGERLIELPLALEIVDAWLAGEFEGGRHQRRIEKLDVFE 144
>gi|154509456|ref|ZP_02045098.1| hypothetical protein ACTODO_01987 [Actinomyces odontolyticus ATCC 17982] >gi|153799090|gb|EDN81510.1| hypothetical protein ACTODO_01987 [Actinomyces odontolyticus ATCC 17982] (169 aa)
Score = 227, Expect = 1.3e-17, Identities = 54/150 (36%), Positives = 85/150 (56%)
  Q:     7 QLKKIKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESG-RHEKRLDKITKLE 156
           Q   ++V+IG+DH GF++KEK+   H      D VD G ++ D   DYP +  +  + ++ + GS GI I G+G G  +A N ++G+ AA V     A LAREHN+ NV+ +  R  S E+ + +I  F  + F    RH++R+D +   E
  S:    15 QEDPMRVHIGTDHAGFELKEKVVA-HLREAGHDVVDHGAHTYDALDDYPPFCIEAAQAVVDEPGSLGIVIGGSGNGEQMAANCVEGVRAALVWSDATARLAREHNDANVVAVGARQHSEEEALALIDAFLETPFSGDERHQRRIDLMKDYE 164
>gi|21221084|ref|NP_626863.1| ribose-5-phosphate isomerase B [Streptomyces coelicolor A3(2)] >gi|6900897|emb|CAB71802.1| putative sugar-phosphate isomerase [Streptomyces coelicolor A3(2)] (159 aa)
Score = 226, Expect = 1.4e-17, Identities = 55/144 (38%), Positives = 81/144 (56%)
  Q:    13 VYIGSDHGGFDMKEKIRNNHELLEIL-----DFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESG-RHEKRLDKITKLE 156
           +Y+GSDH GF++K     NH L+E L     + VD G +  D   DYP +  +  E    D+G+ GI I G+G G  IA NK+KG+ AA       A L R+HNN NV+ +  R  + E+  + ++ F  + F    RH +R+D +T  E
  S:     1 MYLGSDHAGFELK-----NH-LVEWLAAAGHEPVDCGPHIYDAQDDYPPFCLRAAERTAADQGALGIVIGGSGNGEQIAANKVKGVRAALAWSEETASLGRQHNNANVVAVGARMHTQEEATKFVETFLGTPFSGDERHIRRIDMLTSYE 144
>gi|91200385|emb|CAJ73431.1| fusion protein similar to hydrolase/phosphatase (n-terminal) and ribose-5-phosphate isomerase (C-terminal) [Candidatus Kuenenia stuttgartiensis] (376 aa)
Score = 226, Expect = 1.4e-17, Identities = 52/148 (35%), Positives = 87/148 (58%)
  Q:     9 KKIKVYIGSDHGGFDMKEKIRNNHELLEILDF--VDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFES-GRHEKRLDKITKLE 156
           K +++ + SDHGGFD+K K+     LL+   +   D G Y  +   DYPD+   + E +   + S G+ ICG+G+G CIA NKI G+ +A +  +  A    E +N+N++ L GR T      E+++ F ++ F++  R  +RL+K++ LE
  S:   225 KMMRIGVASDHGGFDLKVKLV---ALLKTAGYEVKDFGAYQLNTDDDYPDFVIPMSEAVANGEISRGVAICGSGVGACIAANKIAGVRSALITDSFSARQGVEDDNMNIMCLGGRITGSALAGELVQIFINARFKNEERFLRRLNKVSVLE 372
>gi|94969836|ref|YP_591884.1| ribose-5-phosphate isomerase B [Acidobacteria bacterium Ellin345] >gi|94551886|gb|ABF41810.1| sugar-phosphate isomerases, RpiB/LacA/LacB family [Acidobacteria bacterium Ellin345] (149 aa)
Score = 225, Expect = 1.8e-17, Identities = 56/146 (38%), Positives = 81/146 (55%)
  Q:    11 IKVYIGSDHGGFDMKEKI-----RNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFES-GRHEKRLDKITKLE 156
           +KV + +DH G  M E +     +  HE+L      DLGT+  +   DYPD A  I   +L      GI ICG+G+G  +A NKIKGI A   +    A    EH+N+NV+ L GR    E  +++++ F S+ F +  RH +RL KI  +E
  S:     1 MKVAVSADHAGVPMNEVVIAELRKLGHEVL------DLGTHDPNSGDDYPDRAADITAAVLNQGCERGILICGSGVGASVAANKIKGIRAGLCHDHYSAHQGVEHDNMNVLCLGGRVIGTETALDLVRAFVSAKFTNEERHLRRLHKIAVME 146
>gi|163754546|ref|ZP_02161668.1| ribose 5-phosphate isomerase B [Kordia algicida OT-1] >gi|161325487|gb|EDP96814.1| ribose 5-phosphate isomerase B [Kordia algicida OT-1] (144 aa)
Score = 225, Expect = 1.8e-17, Identities = 50/140 (35%), Positives = 78/140 (55%)
  Q:    13 VYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           + IG+DH G D K  I   H   +     + GT S D+SVDYPD+   +  ++   K  +GI ICG+G G  +  NK + + AA         LAR+HN+ N++++  RFTS+   + ++  F  + FE GRH++R+ KI
  S:     4 IAIGNDHAGTDYKNAI-TAHLEAKGYTIQNYGTNS-DDSVDYPDFIHPVATDVESGKVPFGIIICGSGNGAAMTANKHQKVRAALCWTKEIVALARQHNDANILSIPARFTSLPQAIAMVDTFLETEFEGGRHQRRVAKI 141
>gi|76556229|emb|CAD48940.1| ribose-5-phosphate isomerase 1 [Propionibacterium freudenreichii subsp. shermanii] (148 aa)
Score = 225, Expect = 2.0e-17, Identities = 50/142 (35%), Positives = 80/142 (56%)
  Q:    11 IKVYIGSDHGGFDMKEKIR-----NNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           +++ +GSDH GF++KE ++       H      D +D+GT+S  ESVDYP Y       +   +    I +CGTG+GI +A  K+ GI  A V++   A+++R HN+ N + L  R        EI+  + ++ F  GRH +R+D I
  S:     1 MRIAMGSDHAGFELKEHLKGYLQGKGH------DVIDVGTHS-TESVDYPVYGAGAARKVAAGEADRAIVVCGTGLGIGMAAGKVPGIRCAIVSEVYSAQMSRLHNDANALALGARVIGTGVAEEIVDVWTTTDFLGGRHGRRVDMI 140
>gi|118618997|ref|YP_907329.1| ribose-5-phosphate isomerase B [Mycobacterium ulcerans Agy99] >gi|118571107|gb|ABL05858.1| ribose/galactose isomerase RpiB [Mycobacterium ulcerans Agy99] (159 aa)
Score = 225, Expect = 2.1e-17, Identities = 51/146 (34%), Positives = 82/146 (56%)
  Q:    11 IKVYIGSDHGGFDMKEKI-----RNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESG-RHEKRLDKITKLE 156
           ++VY+G+DH G ++K++I        HE       +D G ++ D   DYP +     +  + D GS GI + G+G G  IA NK+ G   A V     A LAREHNN  +I + GR  +V + + I+  F S+ +    RH++R+D +++ E
  S:     1 MRVYLGADHAGLELKQQIIEHLKATGHEP------IDCGAFTYDAEDDYPAFCIAAAQRTVADPGSLGIVLGGSGNGEQIAANKVPGARCALVWSEQTASLAREHNNAQLIGIGGRMHTVAEALAIVDAFLSTPWSKAERHQRRIDILSEYE 146
>gi|32266867|ref|NP_860899.1| ribose-5-phosphate isomerase B [Helicobacter hepaticus ATCC 51449] >gi|32262919|gb|AAP77965.1| ribose 5-phosphate isomerase RpiB [Helicobacter hepaticus ATCC 51449] (147 aa)
Score = 225, Expect = 2.1e-17, Identities = 54/141 (38%), Positives = 82/141 (58%)
  Q:    15 IGSDHGGFDMKEKIRN--NHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKL 155
           IG+DH GF +KE   +    +  EI+D         ++ VDYPDYA+K+ E + ++    GI ICG+GIG+ IA N+ K I AA       A++AR HN+ NV+ +  R + + +   I++ F SS FE  RH  R++K+  L
  S:     5 IGTDHAGFKLKEFTISFLQKKGFEIIDLAP----QTNQRVDYPDYAKKVCEAVGEEVNRRGILICGSGIGMSIAANRFKHIRAALCVDAYMAKMARAHNDANVLCMGERISGLGEVESILEAFVSSEFEGERHLVRVEKLGNL 143
>gi|126736597|ref|ZP_01752337.1| ribose 5-phosphate isomerase B [Roseobacter sp. CCS2] >gi|126713910|gb|EBA10781.1| ribose 5-phosphate isomerase B [Roseobacter sp. CCS2] (148 aa)
Score = 224, Expect = 2.4e-17, Identities = 47/146 (32%), Positives = 78/146 (53%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLEN 157
           +V + SDH   +M+++I + H   +  + VD+G  +  ES  YP + E     +     ++GI +CGTG GI +A NK+KGI     +    A++ REHN+ N++ +  R       ++I+  F  + F  GRH  R+D I  LE+
  S:     5 RVVLSSDHAAIEMRQQIAD-HITAKGWEAVDIGP-TTPESTPYPAHGEAAARRVASSDCTFGIILCGTGQGIMMAANKVKGIRCGVCSDVFSAQMIREHNDANMLAMGARVIDNATALKIVDAFLFTDFGGGRHATRVDMIKALED 148
>gi|154483812|ref|ZP_02026260.1| hypothetical protein EUBVEN_01516 [Eubacterium ventriosum ATCC 27560] >gi|149735303|gb|EDM51189.1| hypothetical protein EUBVEN_01516 [Eubacterium ventriosum ATCC 27560] (150 aa)
Score = 223, Expect = 3.2e-17, Identities = 52/148 (35%), Positives = 85/148 (57%)
  Q:    11 IKVYIGSDHGGFDMKEKIR-----NNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           +K+ IG+DH   +MK +I+       HE+      VD GT S  E  +YP Y E +   ++  +   G+ ICGTG+GI ++ NK+ GI A   ++   A L+++HNN N+I    R   +E    I+ ++ ++ +E GRH+ R+D I  +E K
  S:     1 MKIGIGNDHVAVEMKNEIKAYLEEKGHEV------VDFGTNS-SERCNYPVYGEAVANAIVNGEVDCGVLICGTGVGISLSANKVNGIRACVCSEPYSARLSKQHNNTNIIAFGARVIGIELAKMIVDEWLNAEYEGGRHQVRIDMIKDIEEK 146
>gi|138896947|ref|YP_001127400.1| ribose 5-phosphate epimerase (pentose phosphate) [Geobacillus thermodenitrificans NG80-2] >gi|134268460|gb|ABO68655.1| Ribose 5-phosphate epimerase (pentose phosphate) [Geobacillus thermodenitrificans NG80-2] (124 aa)
Score = 223, Expect = 3.3e-17, Identities = 47/121 (38%), Positives = 69/121 (57%)
  Q:    38 LDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           +++ D G    + SVDYPDYA  + E + + +   GI ICGTGIG+ IA NK+KG+  A  +    A+L R HN+ N++ +  R        EI K +  + FE GRH +R+ KI   EN+
  S:     3 IEYTDFGC-DCETSVDYPDYALPVAEKVARGEFDRGILICGTGIGMTIAANKVKGVRCALCHDVYSAKLTRMHNDSNILAMGERVIGPGLAREIAKAWLETEFEGGRHARRIGKIADYENE 122
>gi|172058700|ref|YP_001815160.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Exiguobacterium sibiricum 255-15] >gi|171991221|gb|ACB62143.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Exiguobacterium sibiricum 255-15] (146 aa)
Score = 222, Expect = 4.2e-17, Identities = 70/148 (47%), Positives = 94/148 (63%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEIL--DFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           +KV IG+DHGGF +K ++   +ELL+ L  D+ D GTYS  ES+DYPD A  + E +   +   GI ICGTGIGI IA NK+KGI AA V+ T  A+  R+HNN N++T+  R        +I K +  + FE GRHE R+ KI+  E K
  S:     1 MKVAIGADHGGFKLKAEL---NELLQELGIDYTDFGTYS-SESIDYPDVAIPVAEAVANGEFDRGILICGTGIGIGIAANKVKGIRAALVHDTFSAKATRQHNNSNILTMGERVIGPGLARDIAKIWLETEFEGGRHENRVCKISDYEVK 146
>gi|115376051|ref|ZP_01463297.1| ribose 5-phosphate isomerase B [Stigmatella aurantiaca DW4/3-1] >gi|115366966|gb|EAU65955.1| ribose 5-phosphate isomerase B [Stigmatella aurantiaca DW4/3-1] (160 aa)
Score = 222, Expect = 4.2e-17, Identities = 53/148 (35%), Positives = 83/148 (56%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILD-----FVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFE-SGRHEKRLDKITKLENK 158
           +++ + +DH GF++K      + LL  L+      VD GTYS  E VDYPD A+ +GE L        I ICG+G+G  IA+NK+ G+     + T  A    EH+++NV+ L  R   +    E+ + F ++ F    RH++RL K+  LE +
  S:     1 MRIALAADHAGFELK------NWLLRALEGAGHTLVDKGTYS-TEPVDYPDCAQAVGEALRGGDVDRAILICGSGVGASIAVNKMPGVRGGLCHDTYSAHQGVEHDDMNVLVLGARVIGLALAEELARAFLAARFSGEERHKRRLSKVHALEAR 147
>gi|160894644|ref|ZP_02075419.1| hypothetical protein CLOL250_02195 [Clostridium sp. L2-50] >gi|156863578|gb|EDO57009.1| hypothetical protein CLOL250_02195 [Clostridium sp. L2-50] (170 aa)
Score = 222, Expect = 4.3e-17, Identities = 57/150 (38%), Positives = 86/150 (57%)
  Q:     3 ESKKQLKKIKVYIGSDHGGFD-MKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESG-RHEKRLDKI 152
           E+KK   K  + +G DHGG+  M++ I++  E    L++ + G YS +ESVDYP YA+K+   +   +   GI ICGTGIGI I  NK+ GI AA       A+  REHN+ N++ +  R T     ++I+  F  + F +  RH +R+  I
  S:    20 ENKKGRTKNMIALGCDHGGYGLMQDVIKHLEE--RGLEYKNYGCYS-EESVDYPVYAKKVAHAVADGECERGILICGTGIGISITANKVPGIRAALCGDCFSAQATREHNDANILAMGARVTGPGLALKIVDTFLDTPFSNDERHIRRIKMI 168
>gi|19553619|ref|NP_601621.1| ribose-5-phosphate isomerase B [Corynebacterium glutamicum ATCC 13032] >gi|62391263|ref|YP_226665.1| ribose-5-phosphate isomerase B [Corynebacterium glutamicum ATCC 13032] >gi|145296404|ref|YP_001139225.1| ribose-5-phosphate isomerase B [Corynebacterium glutamicum R] >gi|21325194|dbj|BAB99816.1| Ribose 5-phosphate isomerase RpiB [Corynebacterium glutamicum ATCC 13032] >gi|41326603|emb|CAF21085.1| POSSIBLE PHOSPHOPENTOSE ISOMERASE [Corynebacterium glutamicum ATCC 13032] >gi|140846324|dbj|BAF55323.1| hypothetical protein [Corynebacterium glutamicum R] (157 aa)
Score = 222, Expect = 4.6e-17, Identities = 52/146 (35%), Positives = 78/146 (53%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESG-RHEKRLDKITKLE 156
           ++VY+G+DH GF+ K  I   H      + +D G ++ D   DYP +  +     + D GS GI + G+G G  IA NK+KG   A       A LAREHNN N+I + GR  S E+ + I+  F    + +  RH++R+D +   E
  S:     1 MRVYLGADHAGFETKNAIAE-HLKAHGHEVIDCGAHTYDAEDDYPAFCIEAASRTVNDPGSLGIVLGGSGNGEQIAANKVKGARCALAWSVETARLAREHNNANLIGIGGRMHSEEEALAIVDAFLEQEWSNAERHQRRIDILADYE 146
>gi|115377127|ref|ZP_01464341.1| ribose 5-phosphate isomerase B [Stigmatella aurantiaca DW4/3-1] >gi|115365836|gb|EAU64857.1| ribose 5-phosphate isomerase B [Stigmatella aurantiaca DW4/3-1] (108 aa)
Score = 221, Expect = 5.2e-17, Identities = 43/105 (40%), Positives = 62/105 (59%)
  Q:    52 VDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLE 156
           +DYPD+A K+   +   + + G+ +CGTGIG+ IA NK +G+ AA  +   EA +AR HN+ NV+ L  R         I+  F ++ FE GRHEKR+ KI   E
  S:     1 MDYPDFALKVARAVASGEYALGVLVCGTGIGMSIAANKQRGVRAALCSTEFEARMARAHNDANVLCLGQRVVGAGVARSILDAFLATPFEGGRHEKRVQKIRDAE 105
>gi|157825537|ref|YP_001493257.1| ribose-5-phosphate isomerase B [Rickettsia akari str. Hartford] >gi|157799495|gb|ABV74749.1| ribose-5-phosphate isomerase B [Rickettsia akari str. Hartford] (144 aa)
Score = 220, Expect = 6.9e-17, Identities = 55/145 (37%), Positives = 84/145 (57%)
  Q:     8 LKKIKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           ++   + I SDH G+++K +I N  E  + L   D GT +  ++VDYPDYA+K+ + +++     GI I  TGIG+ IA N+   I AA  N  + AE A+ HN+ N++ L  +    +   +II KF ++ FE GRH  RL KI
  S:     1 MQTYNIVIASDHSGYELKSEIINYLEQ-KSLKVCDCGT-NNTQTVDYPDYAKKVVDIIIEKSAPIGILISDTGIGMSIAANRSSEIRAALCNNMLTAENAKAHNDANILILGAKTIDHKIVFDIIDKFLTTKFEGGRHNVRLLKI 143
>gi|187251524|ref|YP_001876006.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Elusimicrobium minutum Pei191] >gi|186971684|gb|ACC98669.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Elusimicrobium minutum Pei191] (150 aa)
Score = 219, Expect = 9.4e-17, Identities = 52/147 (35%), Positives = 88/147 (59%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELL--EILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFES-GRHEKRLDKITKLEN 157
           +K+ + SDH GF ++E + N  + L  E++DF   GT+    SVD+ D+A K  + ++  +   G+ ICG+G+G+CI+ NK+KG  A+  + T  A    EH ++N++ L  R        EI++KF ++ F+   R  +RL+KI  +EN
  S:     1 MKIALASDHAGFSLRETVINKIKDLGHEVIDF---GTFEC-SSVDFSDFAVKGAQAVVSKQAEKGVFICGSGVGMCISANKVKGTRASVAHDTYSAAQGVEHEDMNILCLGARVIGPSIAEEIVEKFLNAKFQGLERQVRRLNKIIDIEN 146
>gi|41408383|ref|NP_961219.1| ribose-5-phosphate isomerase B [Mycobacterium avium subsp. paratuberculosis K-10] >gi|118466601|ref|YP_880936.1| ribose-5-phosphate isomerase B [Mycobacterium avium 104] >gi|81413869|sp|Q73XM4|RPIB_MYCPA Ribose-5-phosphate isomerase B (Phosphoriboisomerase B) >gi|41396739|gb|AAS04602.1| Rpi [Mycobacterium avium subsp. paratuberculosis K-10] >gi|118167888|gb|ABK68785.1| ribose 5-phosphate isomerase [Mycobacterium avium 104] (159 aa)
Score = 219, Expect = 1.0e-16, Identities = 50/146 (34%), Positives = 82/146 (56%)
  Q:    11 IKVYIGSDHGGFDMKEKI-----RNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESG-RHEKRLDKITKLE 156
           ++VY+GSDH GF++K++I     ++ H+       +D G +S D   DYP +        + D  S GI + G+G G  IA NK+ G   A       A+LAREHNN  +I + GR  +V + + I+  F ++ +    RH++R+D + + E
  S:     1 MRVYLGSDHAGFELKQQIIAHLEQSGHQP------IDCGAFSYDADDDYPAFCIAAATRTVADPDSLGIVLGGSGNGEQIAANKVPGARCALAWSVETAQLAREHNNAQLIGIGGRMHTVAEALAIVDAFVTTPWSKAPRHQRRIDILAEYE 146
>gi|163746618|ref|ZP_02153976.1| sugar-phosphate isomerase, RpiB/LacA/LacB family protein [Oceanibulbus indolifex HEL-45] >gi|161380503|gb|EDQ04914.1| sugar-phosphate isomerase, RpiB/LacA/LacB family protein [Oceanibulbus indolifex HEL-45] (149 aa)
Score = 219, Expect = 1.1e-16, Identities = 50/148 (33%), Positives = 77/148 (52%)
  Q:    10 KIKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLEN 157
           K ++ I SDH    +++ I   H      +  D+G  +  ES DYP + E     +   +   GI ICGTG GI +A NK+KGI       T  A++ R HN+ N++++  R       +EI+  F  + FE GRH +R+D IT +E+
  S:     4 KPRIIISSDHADIALRQDIAR-HVADRGYEVEDIGPTTA-ESTDYPKHGEAAARRIAAGEFDLGILICGTGQGIMMAANKVKGIRCGVCADTFSAKMIRAHNDANMLSMGARVIGGGLALEIVDAFLDTEFEGGRHGRRVDMITAIED 149
>gi|149369338|ref|ZP_01889190.1| ribose 5-phosphate isomerase B [unidentified eubacterium SCB49] >gi|149356765|gb|EDM45320.1| ribose 5-phosphate isomerase B [unidentified eubacterium SCB49] (142 aa)
Score = 218, Expect = 1.2e-16, Identities = 52/142 (36%), Positives = 79/142 (55%)
  Q:    11 IKVYIGSDHGGFDMKEKI-----RNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           +K+ IG+DH G D K  I        HE+      V+ GT + D SVDYPD+A  + + +   +  YGI ICG+  G+ +  NK   + A          L R+HN+ NVI +  R+TS+   V +++ F ++ FE GRH+ R+ KI
  S:     1 MKIAIGNDHAGPDYKFAIVKYLEDQGHEV------VNFGTDTLD-SVDYPDFANPVSKAVNDGEVPYGILICGSANGVAMTANKYPKVRAGICWTKEITSLTRQHNDANVICIPARYTSIPQAVGMVETFLNTAFEGGRHQNRVAKI 140
>gi|83592670|ref|YP_426422.1| ribose-5-phosphate isomerase [Rhodospirillum rubrum ATCC 11170] >gi|83575584|gb|ABC22135.1| ribose-5-phosphate isomerase [Rhodospirillum rubrum ATCC 11170] (148 aa)
Score = 218, Expect = 1.2e-16, Identities = 51/147 (34%), Positives = 78/147 (53%)
  Q:    11 IKVYIGSDHGGFDMKEKIRN-----NHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLEN 157
           +K+ IG D   +D+KE + +      HE+       D GT+   + V YPD A  +   +       G+ +CGTGIG+ I  NK+KGI AA  + T  AE AR  N+  +IT+  R    E    I++ F S+ F +G    ++++IT  EN
  S:     1 MKIAIGCDEAAYDLKETLTSFITAQGHEV------TDFGTFD-RKPVLYPDIAHALATEVAAGTQDRGVLLCGTGIGMAITANKVKGIRAAQCHDTYSAERARLSNDAQIITMGARVIGPELAKAIVRTFLSNEFVNGSSTPKIERITAYEN 145
>gi|153812521|ref|ZP_01965189.1| hypothetical protein RUMOBE_02920 [Ruminococcus obeum ATCC 29174] >gi|149831446|gb|EDM86534.1| hypothetical protein RUMOBE_02920 [Ruminococcus obeum ATCC 29174] (153 aa)
Score = 218, Expect = 1.2e-16, Identities = 55/140 (39%), Positives = 79/140 (56%)
  Q:    13 VYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHF-ESGRHEKRLDKI 152
           + +G DHGG+++K++I    E   I ++ D G  S D S DYP YA+++   +       GI ICGTGIGI I  NK KGI AA  +    AE  R HNN N++ + GR       V+I+  F ++ F E  RH +R+ +I
  S:     2 IALGCDHGGYELKQEIIKYLEENNI-EYKDFGCDSTD-STDYPIYAKRVAIAIQNGDCEKGILICGTGIGISITANKFKGIRAALCSDCFSAEATRLHNNANILAMGGRVVGPGLAVKIVDTFLNTPFSEEERHIRRIKQI 140
>gi|99082154|ref|YP_614308.1| ribose-5-phosphate isomerase [Silicibacter sp. TM1040] >gi|99038434|gb|ABF65046.1| ribose-5-phosphate isomerase [Silicibacter sp. TM1040] (149 aa)
Score = 218, Expect = 1.3e-16, Identities = 48/145 (33%), Positives = 76/145 (52%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLE 156
           ++ + SDH    ++  I  + E L      DLG  +  ES  YP + E    ++   +   GI +CGTG GI +A NK+KGI     + T  A++ R HN+ N++++  R       +EI+  F  + FE GRH  R+D IT++E
  S:     6 RIVLSSDHAAIALRRTIAKHIEALG-YTVTDLGP-TTPESTHYPKHGEAAARHVAAGESDLGILLCGTGQGIMMAANKVKGIRCGVCSDTFSAQMIRAHNDANMLSIGARVVGEGLALEIVDAFLKTEFEGGRHGTRVDMITEIE 148
>gi|116748378|ref|YP_845065.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Syntrophobacter fumaroxidans MPOB] >gi|116697442|gb|ABK16630.1| sugar-phosphate isomerases, RpiB/LacA/LacB family [Syntrophobacter fumaroxidans MPOB] (161 aa)
Score = 218, Expect = 1.4e-16, Identities = 49/148 (33%), Positives = 82/148 (55%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEIL-----DFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESG-RHEKRLDKITKLENK 158
           ++V I +DHGGF++K       +L+E L     D VD G    D + D+PDY   +   +++     G+ +CG+G+G  IA NK+ G  AA +     A    E +++N++ L GR   VE   E+++ F  + +    R E+RL K+  LE++
  S:     1 MRVGIAADHGGFELKR------QLVEELAATGHDVVDFGARRFDPADDFPDYVVPLARAVVERTVERGLAVCGSGVGASIAANKVPGARAALITDVYSARQGVEDDDMNMMCLGGRVVGVELAKELLRAFLKARYRPAERFERRLAKVAALEDE 148
>gi|88607843|ref|YP_505227.1| ribose 5-phosphate isomerase B [Anaplasma phagocytophilum HZ] >gi|88598906|gb|ABD44376.1| ribose 5-phosphate isomerase B [Anaplasma phagocytophilum HZ] (143 aa)
Score = 217, Expect = 1.5e-16, Identities = 49/141 (34%), Positives = 77/141 (54%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           +V++ SDH G +++  +      L    F D G    + SVDYPDY   +   +     S+G+ ICGTGIG+ IA N+ K I AA  + T+ A+L+REHN+ NV+    R+   +    ++  F ++ F  GRH  R+ K+
  S:     4 RVFLSSDHAGVELRLFLSAYLRDLGCEVF-DCGCDPKEHSVDYPDYVHDVVREV--SDTSFGVLICGTGIGMSIAANRHKNIRAALCSSTMLAKLSREHNDANVLCFGSRYIDPDTAQSVLYTFMTTAFLGGRHAVRVQKL 141
>gi|71403000|ref|XP_804346.1| ribose 5-phosphate isomerase, putative [Trypanosoma cruzi strain CL Brener] >gi|70867270|gb|EAN82495.1| ribose 5-phosphate isomerase, putative [Trypanosoma cruzi] >gi|110984574|gb|ABH03202.1| ribose 5-phosphate isomerase [Trypanosoma cruzi strain CL Brener] (159 aa)
Score = 217, Expect = 1.5e-16, Identities = 53/145 (36%), Positives = 85/145 (58%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLEILDFVD--LGTYSGD---ESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFE-SGRHEKRLDKITKLE 156
           +V IG+DH  F + E +     +L + +  D  +  Y G    ESVDYPD+A ++ E + + +  +G+  CG+GIG+ IA NK+ G+ AA  +    A ++R HN+ N++ +  R T VE   EII  F  + F    RH +R++KI  +E
  S:     4 RVAIGTDHPAFAIHENL-----ILYVKEAGDEFVPVYCGPKTAESVDYPDFASRVAEMVARKEVEFGVLACGSGIGMSIAANKVPGVRAALCHDHYTAAMSRIHNDANIVCVGERTTGVEVIREIIITFLQTPFSGEERHVRRIEKIRAIE 149
>gi|163784627|ref|ZP_02179462.1| ribose-5-phosphate isomerase B [Hydrogenivirga sp. 128-5-R1-1] >gi|159880102|gb|EDP73771.1| ribose-5-phosphate isomerase B [Hydrogenivirga sp. 128-5-R1-1] (106 aa)
Score = 217, Expect = 1.5e-16, Identities = 52/108 (48%), Positives = 67/108 (62%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITL 118
           +KV IGSDH G+D+KE I+N+ E  +  + +D G +S  E VDYP Y E + E +   K   GI ICGTGIGI I+ NK+KGI AA       A +A  HNN NV+ L
  S:     1 MKVAIGSDHAGYDLKEVIKNHLEK-KGFEVIDKGAFS-KERVDYPVYGEAVAEAVASGKAEKGIVICGTGIGISISANKVKGIRAALCTNEYMARMAIRHNNANVLAL 106
>gi|73661836|ref|YP_300617.1| putative ribose 5-phosphate isomerase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|72494351|dbj|BAE17672.1| putative ribose 5-phosphate isomerase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (148 aa)
Score = 217, Expect = 1.7e-16, Identities = 54/148 (36%), Positives = 89/148 (60%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEK--RLDKITKLENK 158
           +K+ IG+DH G+D+KE ++ + E L  +   D G +   E+ DYPD A ++G+++ + +   GI ICGTGIG+ I  NKIKGI AA  +    AE A+  NN  ++T+  +   VE   + ++ + +  +E G   K  ++DK+ + ENK
  S:     1 MKIAIGADHNGYDLKEAVKAHVEHLGHV-VEDFGCHQCAET-DYPDVAAEVGKSIQQGENERGILICGTGIGVAITANKIKGIRAALAHDYYSAERAQLSNNAQILTMGAQIIGVEVAKKNVEAYLNVSWEGGSQRKVDKIDKVEESENK 148
>gi|66045808|ref|YP_235649.1| ribose/galactose isomerase [Pseudomonas syringae pv. syringae B728a] >gi|63256515|gb|AAY37611.1| Ribose/galactose isomerase [Pseudomonas syringae pv. syringae B728a] (153 aa)
Score = 217, Expect = 1.8e-16, Identities = 49/144 (34%), Positives = 78/144 (54%)
  Q:    13 VYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLE 156
           V IG D  G+++KE ++ + E L      D GT+S    V YPD A  +   +   +   G+ +CGTGIG+ I+ NK+ GI AA  + T  AE AR+ N+  ++++  R    E    I+K F  S FE+ R   ++++I  +E
  S:     7 VAIGCDEAGYELKELLKRHIESLG-YPVTDFGTHSA-APVLYPDIALAVATAINAGQQRLGVLVCGTGIGMAISANKVFGIRAAQAHDTYSAERARKSNDAQILSIGARVIGTELAKSIVKSFLESEFEAARSGAKVERINAIE 148
>gi|139437097|ref|ZP_01771257.1| Hypothetical protein COLAER_00235 [Collinsella aerofaciens ATCC 25986] >gi|133776744|gb|EBA40564.1| Hypothetical protein COLAER_00235 [Collinsella aerofaciens ATCC 25986] (155 aa)
Score = 216, Expect = 1.9e-16, Identities = 50/147 (34%), Positives = 84/147 (57%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLEN 157
           +K+ IG+DH   ++K  I + H      + V+ GT +  ES DYP    K+G+ +       GI ICGTG+GI +A NK++G+ A   ++   A+L+R HNN NV+    R    E    I+ ++  + FE GRHE+R++ + ++++
  S:     1 MKIGIGNDHAAVELKNII-SEHLKERGCEVVNFGTDT-SESFDYPIAGYKVGKAVANGDVDLGILICGTGVGISLAANKVEGVRAVVCSEPFSAKLSRMHNNTNVLAFGARVVGSELAKMIVDEWLDAEFEGGRHERRVNLLNEIDH 145
>gi|150015297|ref|YP_001307551.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Clostridium beijerinckii NCIMB 8052] >gi|149901762|gb|ABR32595.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Clostridium beijerinckii NCIMB 8052] (164 aa)
Score = 216, Expect = 2.2e-16, Identities = 68/148 (45%), Positives = 90/148 (60%)
  Q:    11 IKVYIGSDHGGFDMKEKIRN--NHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           +K+ IG DHGG ++K +I      E  EI DF   GTYS   S DYPD A  + E +   +  +GI ICGTGIGI IA NK+ GI AA  + T  A   REHNN N++T+  R       ++I+K F S+ FE  RH+KR+DKI+ +E K
  S:    16 MKIAIGCDHGGLELKNEIIKFLESEKHEIKDF---GTYSTG-SCDYPDIALPVAEAVAAKEYEFGILICGTGIGIGIAANKVPGIRAALCSDTFSAHATREHNNANILTMGQRVVGAGLALDIVKTFISAKFEGDRHQKRIDKISDIEKK 161
>gi|54023294|ref|YP_117536.1| ribose-5-phosphate isomerase B [Nocardia farcinica IFM 10152] >gi|54014802|dbj|BAD56172.1| putative ribose 5-phosphate isomerase [Nocardia farcinica IFM 10152] (157 aa)
Score = 216, Expect = 2.4e-16, Identities = 49/146 (33%), Positives = 80/146 (54%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFES-GRHEKRLDKITKLE 156
           ++VY+G+DH GF++K  ++ + E     + VD G    D   DYP +  +     + D GS G+   G+G G  IA NK+ G   A       A+LAREHNN  +I + GR  S E+ + I+  F ++ + +  RH++R+D + + E
  S:     1 MRVYLGADHAGFELKNHVKAHLEQAG-HEVVDCGALEYDALDDYPAFCIEAARRTVADPGSLGLVFGGSGNGEQIAANKVPGARCALAWSVETAKLAREHNNAQLIGIGGRMHSTEEALAIVDAFLATPWSNEERHQRRIDILAEYE 146
>gi|89095785|ref|ZP_01168679.1| ribose-5-phosphate isomerase B [Bacillus sp. NRRL B-14911] >gi|89089531|gb|EAR68638.1| ribose-5-phosphate isomerase B [Bacillus sp. NRRL B-14911] (155 aa)
Score = 216, Expect = 2.4e-16, Identities = 54/146 (36%), Positives = 83/146 (56%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRH-EKRLDKITKLE 156
           + + IGSDH GF+MK  +    + +   D VD G YSG E+VD+PD + ++ + +   K   GI  CGTG+G  IA NKI GI AA  +    A  + EH+NVNV+ +  +        ++IK F ++ F    H  +R++K+ +LE
  S:     1 MHIAIGSDHCGFEMKNALLPFFKTIGC-DVVDYGCYSG-ETVDFPDISREVCDAVRSGKSERGILFCGTGVGAAIASNKINGIRAAVCHDIHSAHQSVEHDNVNVMCIGAQIIGPWLAEDLIKSFVNAIFSPEEHLLRRVEKLEQLE 145
>gi|86137131|ref|ZP_01055709.1| ribose 5-phosphate isomerase B [Roseobacter sp. MED193] >gi|85826455|gb|EAQ46652.1| ribose 5-phosphate isomerase B [Roseobacter sp. MED193] (149 aa)
Score = 216, Expect = 2.5e-16, Identities = 47/146 (32%), Positives = 76/146 (52%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLEN 157
           +V + SDH    +++ I   H   +  + +DLG  +  ES DYP +  +  E +       GI +CGTG GI +A NK+KGI       T  A + R+HN+ N++++  R       ++I+  F S+ FE GRH  R++ I   E+
  S:     6 RVVLSSDHADIQLRQTIAE-HIANQGWEVLDLGP-TTSESTDYPKHGREAAERVAAGDCDLGIIVCGTGQGIMMAANKVKGIRCGVCADTFSARMIRQHNDANMLSIGARVVGKGLALDIVDAFLSAEFEGGRHATRMEMIEPAED 149
>gi|153893344|ref|ZP_02014088.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Opitutaceae bacterium TAV2] >gi|151580585|gb|EDN44394.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Opitutaceae bacterium TAV2] (146 aa)
Score = 215, Expect = 2.8e-16, Identities = 54/145 (37%), Positives = 78/145 (53%)
  Q:     8 LKKIKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           +K   + IGSDH GF  KEKI+    L E     D GTYS   S DYPD+     E + + +   GI + G+G G  I  N+IKGI          A   R HN+ NV++L  R  ++E+ ++I++ + ++ FE GRH  R+ KI
  S:     1 MKTFSIAIGSDHAGFAYKEKIKEAL-LSEGHTVRDFGTYS-PASCDYPDFIRPTAEAVARGEFERGIVLGGSGNGEAIVANRIKGIRCGLCWNEQVAVWNRSHNDGNVLSLGERTVTLEEALKIVRVWLATEFEGGRHLPRIQKI 143
>gi|71421473|ref|XP_811811.1| ribose 5-phosphate isomerase, putative [Trypanosoma cruzi strain CL Brener] >gi|70876518|gb|EAN89960.1| ribose 5-phosphate isomerase, putative [Trypanosoma cruzi] (159 aa)
Score = 215, Expect = 2.9e-16, Identities = 53/145 (36%), Positives = 84/145 (57%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLEILDFVD--LGTYSGD---ESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFE-SGRHEKRLDKITKLE 156
           +V IG+DH  F + E +     +L + +  D  +  Y G    ESVDYPD+A ++ E + + +  +G+  CG+GIG+ IA NK+ G+ AA       A ++R HN+ N++ +  R T VE   EII  F  + F    RH +R++KI  +E
  S:     4 RVAIGTDHPAFAIHENL-----ILYVKEAGDEFVPVYCGPKTAESVDYPDFASRVAEMVARKEVEFGVLACGSGIGMSIAANKVPGVRAALCYDHYTAAISRIHNDANIVCVGERTTGVEVIREIIITFLQTPFSGEERHARRIEKIRAIE 149
>gi|148284395|ref|YP_001248485.1| ribose-5-phosphate isomerase [Orientia tsutsugamushi str. Boryong] >gi|146739834|emb|CAM79750.1| ribose-5-phosphate isomerase [Orientia tsutsugamushi Boryong] (160 aa)
Score = 215, Expect = 2.9e-16, Identities = 49/140 (35%), Positives = 79/140 (56%)
  Q:    13 VYIGSDHGGFDMKEKI---RNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           + I SD   +++K KI    +  E       +DLG  + ++ VDYPD A  + + ++ ++  YGI IC TGIG+ IA N+   I AA       AE +R HNN N++ +  + ++    + +I KF ++ FE GRH  RL+K+
  S:    18 IAIASDQKEYELKTKICQHLSEQERFISFSVLDLGG-NNNQQVDYPDIANLLCDTIINNRARYGILICTTGIGMSIAANRHSDIRAALCFNEYMAEQSRLHNNANILIIGAKVSNFRSVINMISKFITTKFEGGRHLTRLEKL 159
>gi|149173848|ref|ZP_01852477.1| ribose 5-phosphate isomerase B [Planctomyces maris DSM 8797] >gi|148847378|gb|EDL61712.1| ribose 5-phosphate isomerase B [Planctomyces maris DSM 8797] (153 aa)
Score = 215, Expect = 3.1e-16, Identities = 54/140 (38%), Positives = 77/140 (55%)
  Q:    13 VYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           + I SDH G+  K +I   +   E     D+GT S  ESVDYPD+       + + K + GI + G+G G  IA N+IKG+  A       A LA  HNN N+I++  R  S+ D  EII  + S+ FE GRH +R++K+
  S:    14 IVIASDHAGYRYKRRIIE-YLTKEGYQVEDMGTDS-TESVDYPDFIMPAARAVAEGKYTRGIVLGGSGNGEAIAANRIKGVRCAVCWNEKSARLASMHNNANMISIGERMVSLHDVYEIIDIWLSTPFEGGRHARRIEKL 151
>gi|126738195|ref|ZP_01753916.1| ribose 5-phosphate isomerase B [Roseobacter sp. SK209-2-6] >gi|126720692|gb|EBA17397.1| ribose 5-phosphate isomerase B [Roseobacter sp. SK209-2-6] (149 aa)
Score = 215, Expect = 3.1e-16, Identities = 46/146 (31%), Positives = 76/146 (52%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLEN 157
           ++ I SDH    +++ I   H   +  +  D+G  +  ES  YP + ++  E +   +  +GI +CGTG GI +A NK+KGI     + T  A + REHN+ N++++  R        +I+  F  + FE GRH  R+D I   E+
  S:     6 RIVISSDHADIPLRQAIAE-HVAAKGWEVTDIGPVTA-ESTHYPKHGKEAAERVASGECQFGIIVCGTGQGIMMAANKVKGIRCGVCSDTFSARMIREHNDANMLSIGARVVGKGLAFDIVDAFLDAKFEGGRHATRVDMIEPAED 149
>gi|15827780|ref|NP_302043.1| ribose-5-phosphate isomerase B [Mycobacterium leprae TN] >gi|81537014|sp|Q9CBY1|RPIB_MYCLE Ribose-5-phosphate isomerase B (Phosphoriboisomerase B) >gi|13093332|emb|CAC30434.1| possible phosphopentose isomerase [Mycobacterium leprae] (162 aa)
Score = 215, Expect = 3.2e-16, Identities = 49/149 (32%), Positives = 84/149 (56%)
  Q:     8 LKKIKVYIGSDHGGFDMKEKI-----RNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHF-ESGRHEKRLDKITKLE 156
           +  ++VY+G+DH G+++K +I     ++ H+       +D G +S D   +YP +        + D GS GI + G+G G  IA NK+ G   A       A LAREHNN  +I + GR  +V + + I+  F ++ + E+ RH++R+D + + E
  S:     1 MSGMRVYLGADHAGYELKRQIIEHLKQSGHQP------IDCGAFSYDVDDEYPAFCITAATRTVADPGSLGIVLGGSGNGEQIAANKVVGARCALAWSVETARLAREHNNAQLIGIGGRMHTVAEALTIVDAFVTTPWSEAQRHQRRIDILAEFE 149
>gi|83592695|ref|YP_426447.1| ribose-5-phosphate isomerase [Rhodospirillum rubrum ATCC 11170] >gi|83575609|gb|ABC22160.1| ribose-5-phosphate isomerase [Rhodospirillum rubrum ATCC 11170] (158 aa)
Score = 214, Expect = 3.3e-16, Identities = 46/147 (31%), Positives = 78/147 (53%)
  Q:    10 KIKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLE 156
           K K+ +G+DH G ++K+ +R+ H   +  +  D+GT + D  VDYPD A  + + + K     GI +CGTG G+C++ NK+ G+ A  V+    AE AR  NN  +IT             +   F ++ F+ G   K++ K+  ++
  S:     6 KPKIVVGADHLGRELKDLLRD-HLTAQGYEVCDMGTATSD-PVDYPDVALPVAQAIAKGDFDRGILVCGTGAGVCVSANKVPGVIAVQVSDPYTAERARASNNAQIITFGALTIGPATAKALTDIFMAAEFQGGGSAKKVQKMLDID 150
>gi|118726922|ref|ZP_01575536.1| sugar-phosphate isomerases, RpiB/LacA/LacB family [Clostridium cellulolyticum H10] >gi|118663651|gb|EAV70298.1| sugar-phosphate isomerases, RpiB/LacA/LacB family [Clostridium cellulolyticum H10] (152 aa)
Score = 214, Expect = 3.6e-16, Identities = 55/148 (37%), Positives = 81/148 (54%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEI-LDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           + + IG D  GF  KE I+N   LLE  LD  D G Y+ D  V YPD A  + +++ + K   GI ICGTGIG+ IA NK+ GI AA  + +   E +R+ NN  ++ L  R   +E    ++  +    F  G  E +++KI + EN+
  S:     1 MSIAIGCDEAGFQFKEVIKN--LLLEKGLDVEDFGVYNTD-PVLYPDIAVAVAKSISEGKHERGILICGTGIGMAIAANKVPGIRAAVCHDSFSTERSRKSNNAQIMALGARVIGIELAKLLVDLWLECEFGGGGSEAKVNKIMEYENE 146
>gi|84494311|ref|ZP_00993430.1| ribose-5-phosphate isomerase B [Janibacter sp. HTCC2649] >gi|84383804|gb|EAP99684.1| ribose-5-phosphate isomerase B [Janibacter sp. HTCC2649] (155 aa)
Score = 214, Expect = 4.1e-16, Identities = 47/147 (31%), Positives = 85/147 (57%)
  Q:    11 IKVYIGSDHGGFDMKEKI-----RNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFE-SGRHEKRLDKITKLEN 157
           ++V+IG DH  +++++ +        HE+       + G +  D   DYP +  +  E +  D+GS G+ + G+G G  +A NK+ G+ AA       A+LAREHNN  VI++ GR  +VE+   +++ F ++ F    RH++R+D ++  E+
  S:     1 MRVHIGGDHAAYELQQDLIAFLGTEGHEV------TNHGPFDLDPLDDYPVFVLRAAEAVATDEGSLGVVLGGSGNGEQMAANKVAGVRAALCYNDELAQLAREHNNAQVISIGGRMNTVEEARSMVRTFLATPFSGEERHQRRIDMVSAYED 147
>gi|89209942|ref|ZP_01188336.1| Ribose/galactose isomerase:Ribose 5-phosphate isomerase B [Halothermothrix orenii H 168] >gi|89160594|gb|EAR80248.1| Ribose/galactose isomerase:Ribose 5-phosphate isomerase B [Halothermothrix orenii H 168] (158 aa)
Score = 212, Expect = 5.8e-16, Identities = 60/153 (39%), Positives = 86/153 (56%)
  Q:     6 KQLKKIKVYIGSDHGGFDMKEKIRNNHELLEI--LDFVDLGTYSGDESVDYPDYAEKIGENLLKDK-GSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           K +K  +  IGSD+ G+ +KE I+   ELLE   L++ D+G  S  +   YP+ AE++   + K      GI ICGTGIG+ I  NK   IYAA  +    AE AR  N+ NVIT+  R        +II+++ S  F+ GR   +L +I K EN+
  S:     2 KVIKNKQYVIGSDNAGYPLKEIIK---ELLESEGLEYEDVGVDSDQDKTIYPEIAERVVNRIKKSNYEKEGILICGTGIGMAITANKFSRIYAAVCHDVYSAERARLSNDTNVITMGARVIGPVLAKKIIREWLSLEFKPGRSTPKLKQIKKYENQ 154
>gi|58177643|pdb|2BES|A Chain A, Structure Of Mycobacterium Tuberculosis Ribose-5-Phosphate Isomerase, Rpib, Rv2465c, In Complex With 4-Phospho-D- Erythronohydroxamic Acid. >gi|58177644|pdb|2BES|B Chain B, Structure Of Mycobacterium Tuberculosis Ribose-5-Phosphate Isomerase, Rpib, Rv2465c, In Complex With 4-Phospho-D- Erythronohydroxamic Acid. >gi|58177645|pdb|2BES|C Chain C, Structure Of Mycobacterium Tuberculosis Ribose-5-Phosphate Isomerase, Rpib, Rv2465c, In Complex With 4-Phospho-D- Erythronohydroxamic Acid. >gi|58177646|pdb|2BES|D Chain D, Structure Of Mycobacterium Tuberculosis Ribose-5-Phosphate Isomerase, Rpib, Rv2465c, In Complex With 4-Phospho-D- Erythronohydroxamic Acid. >gi|58177647|pdb|2BES|E Chain E, Structure Of Mycobacterium Tuberculosis Ribose-5-Phosphate Isomerase, Rpib, Rv2465c, In Complex With 4-Phospho-D- Erythronohydroxamic Acid. >gi|58177648|pdb|2BET|A Chain A, Structure Of Mycobacterium Tuberculosis Ribose-5-Phosphate Isomerase, Rpib, Rv2465c, In Complex With 4-Phospho-D- Erythronate. >gi|58177649|pdb|2BET|B Chain B, Structure Of Mycobacterium Tuberculosis Ribose-5-Phosphate Isomerase, Rpib, Rv2465c, In Complex With 4-Phospho-D- Erythronate. >gi|58177650|pdb|2BET|C Chain C, Structure Of Mycobacterium Tuberculosis Ribose-5-Phosphate Isomerase, Rpib, Rv2465c, In Complex With 4-Phospho-D- Erythronate. >gi|58177651|pdb|2BET|D Chain D, Structure Of Mycobacterium Tuberculosis Ribose-5-Phosphate Isomerase, Rpib, Rv2465c, In Complex With 4-Phospho-D- Erythronate. >gi|58177652|pdb|2BET|E Chain E, Structure Of Mycobacterium Tuberculosis Ribose-5-Phosphate Isomerase, Rpib, Rv2465c, In Complex With 4-Phospho-D- Erythronate. (172 aa)
Score = 212, Expect = 6.3e-16, Identities = 49/149 (32%), Positives = 82/149 (55%)
  Q:     8 LKKIKVYIGSDHGGFDMKEKI-----RNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHF-ESGRHEKRLDKITKLE 156
           +  ++VY+G+DH G+++K++I     +  HE       +D G    D   DYP +        + D GS GI + G+G G  IA NK+ G   A       A LAREHNN  +I + GR  +V + + I+  F ++ + ++ RH++R+D + + E
  S:    11 MSGMRVYLGADHAGYELKQRIIEHLKQTGHEP------IDCGALRYDADDDYPAFCIAAATRTVADPGSLGIVLGGSGNGEQIAANKVPGARCALAWSVQTAALAREHNNAQLIGIGGRMHTVAEALAIVDAFVTTPWSKAQRHQRRIDILAEYE 159
>gi|40889814|pdb|1USL|A Chain A, Structure Of Mycobacterium Tuberculosis Ribose-5-Phosphate Isomerase, Rpib, Rv2465c, Complexed With Phosphate. >gi|40889815|pdb|1USL|B Chain B, Structure Of Mycobacterium Tuberculosis Ribose-5-Phosphate Isomerase, Rpib, Rv2465c, Complexed With Phosphate. >gi|40889816|pdb|1USL|C Chain C, Structure Of Mycobacterium Tuberculosis Ribose-5-Phosphate Isomerase, Rpib, Rv2465c, Complexed With Phosphate. >gi|40889817|pdb|1USL|D Chain D, Structure Of Mycobacterium Tuberculosis Ribose-5-Phosphate Isomerase, Rpib, Rv2465c, Complexed With Phosphate. >gi|40889818|pdb|1USL|E Chain E, Structure Of Mycobacterium Tuberculosis Ribose-5-Phosphate Isomerase, Rpib, Rv2465c, Complexed With Phosphate. (170 aa)
Score = 212, Expect = 6.3e-16, Identities = 49/149 (32%), Positives = 82/149 (55%)
  Q:     8 LKKIKVYIGSDHGGFDMKEKI-----RNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHF-ESGRHEKRLDKITKLE 156
           +  ++VY+G+DH G+++K++I     +  HE       +D G    D   DYP +        + D GS GI + G+G G  IA NK+ G   A       A LAREHNN  +I + GR  +V + + I+  F ++ + ++ RH++R+D + + E
  S:     9 MSGMRVYLGADHAGYELKQRIIEHLKQTGHEP------IDCGALRYDADDDYPAFCIAAATRTVADPGSLGIVLGGSGNGEQIAANKVPGARCALAWSVQTAALAREHNNAQLIGIGGRMHTVAEALAIVDAFVTTPWSKAQRHQRRIDILAEYE 157
>gi|31793646|ref|NP_856139.1| ribose-5-phosphate isomerase B [Mycobacterium bovis AF2122/97] >gi|57116993|ref|YP_177884.1| ribose-5-phosphate isomerase B [Mycobacterium tuberculosis H37Rv] >gi|121638348|ref|YP_978572.1| ribose-5-phosphate isomerase B [Mycobacterium bovis BCG str. Pasteur 1173P2] >gi|148662300|ref|YP_001283823.1| ribose-5-phosphate isomerase B [Mycobacterium tuberculosis H37Ra] >gi|148823665|ref|YP_001288419.1| ribose-5-phosphate isomerase B [Mycobacterium tuberculosis F11] >gi|167969789|ref|ZP_02552066.1| ribose-5-phosphate isomerase B [Mycobacterium tuberculosis H37Ra] >gi|194544651|ref|YP_002079680.1| hypothetical protein TBCG_02406 [Mycobacterium tuberculosis C] >gi|81421932|sp|Q7TYI9|RPIB_MYCBO Ribose-5-phosphate isomerase B (Phosphoriboisomerase B) >gi|81704009|sp|Q79FD7|RPIB_MYCTU Ribose-5-phosphate isomerase B (Phosphoriboisomerase B) >gi|7446848|pir||H70865 probable isomerase - Mycobacterium tuberculosis (strain H37RV) >gi|193506599|pdb|2VVO|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis Ribose-5- Phosphate Isomerase B In Complex With Alpha D-Allose 6- Phosphate >gi|193506600|pdb|2VVO|B Chain B, Crystal Structure Of Mycobacterium Tuberculosis Ribose-5- Phosphate Isomerase B In Complex With Alpha D-Allose 6- Phosphate >gi|193506601|pdb|2VVO|C Chain C, Crystal Structure Of Mycobacterium Tuberculosis Ribose-5- Phosphate Isomerase B In Complex With Alpha D-Allose 6- Phosphate >gi|193506602|pdb|2VVO|D Chain D, Crystal Structure Of Mycobacterium Tuberculosis Ribose-5- Phosphate Isomerase B In Complex With Alpha D-Allose 6- Phosphate >gi|193506603|pdb|2VVO|E Chain E, Crystal Structure Of Mycobacterium Tuberculosis Ribose-5- Phosphate Isomerase B In Complex With Alpha D-Allose 6- Phosphate >gi|193506604|pdb|2VVP|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis Ribose-5- Phosphate Isomerase B In Complex With Its Substrates Ribose 5-Phosphate And Ribulose 5-Phosphate >gi|193506605|pdb|2VVP|B Chain B, Crystal Structure Of Mycobacterium Tuberculosis Ribose-5- Phosphate Isomerase B In Complex With Its Substrates Ribose 5-Phosphate And Ribulose 5-Phosphate >gi|193506606|pdb|2VVP|C Chain C, Crystal Structure Of Mycobacterium Tuberculosis Ribose-5- Phosphate Isomerase B In Complex With Its Substrates Ribose 5-Phosphate And Ribulose 5-Phosphate >gi|193506607|pdb|2VVP|D Chain D, Crystal Structure Of Mycobacterium Tuberculosis Ribose-5- Phosphate Isomerase B In Complex With Its Substrates Ribose 5-Phosphate And Ribulose 5-Phosphate >gi|193506608|pdb|2VVP|E Chain E, Crystal Structure Of Mycobacterium Tuberculosis Ribose-5- Phosphate Isomerase B In Complex With Its Substrates Ribose 5-Phosphate And Ribulose 5-Phosphate >gi|193506609|pdb|2VVQ|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis Ribose-5- Phosphate Isomerase B In Complex With The Inhibitor 5- Deoxy-5-Phospho-D-Ribonate >gi|193506610|pdb|2VVQ|B Chain B, Crystal Structure Of Mycobacterium Tuberculosis Ribose-5- Phosphate Isomerase B In Complex With The Inhibitor 5- Deoxy-5-Phospho-D-Ribonate >gi|193506611|pdb|2VVQ|C Chain C, Crystal Structure Of Mycobacterium Tuberculosis Ribose-5- Phosphate Isomerase B In Complex With The Inhibitor 5- Deoxy-5-Phospho-D-Ribonate >gi|193506612|pdb|2VVQ|D Chain D, Crystal Structure Of Mycobacterium Tuberculosis Ribose-5- Phosphate Isomerase B In Complex With The Inhibitor 5- Deoxy-5-Phospho-D-Ribonate >gi|193506613|pdb|2VVQ|E Chain E, Crystal Structure Of Mycobacterium Tuberculosis Ribose-5- Phosphate Isomerase B In Complex With The Inhibitor 5- Deoxy-5-Phospho-D-Ribonate >gi|31619239|emb|CAD97353.1| PROBABLE ISOMERASE [Mycobacterium bovis AF2122/97] >gi|41353707|emb|CAE55493.1| PROBABLE ISOMERASE [Mycobacterium tuberculosis H37Rv] >gi|121493996|emb|CAL72473.1| Ribose-5-phosphate isomerase [Mycobacterium bovis BCG str. Pasteur 1173P2] >gi|124601658|gb|EAY60668.1| hypothetical protein TBCG_02406 [Mycobacterium tuberculosis C] >gi|134150755|gb|EBA42800.1| hypothetical isomerase [Mycobacterium tuberculosis str. Haarlem] >gi|148506452|gb|ABQ74261.1| ribose-5-phosphate isomerase B [Mycobacterium tuberculosis H37Ra] >gi|148722192|gb|ABR06817.1| hypothetical isomerase [Mycobacterium tuberculosis F11] (162 aa)
Score = 212, Expect = 6.3e-16, Identities = 49/149 (32%), Positives = 82/149 (55%)
  Q:     8 LKKIKVYIGSDHGGFDMKEKI-----RNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHF-ESGRHEKRLDKITKLE 156
           +  ++VY+G+DH G+++K++I     +  HE       +D G    D   DYP +        + D GS GI + G+G G  IA NK+ G   A       A LAREHNN  +I + GR  +V + + I+  F ++ + ++ RH++R+D + + E
  S:     1 MSGMRVYLGADHAGYELKQRIIEHLKQTGHEP------IDCGALRYDADDDYPAFCIAAATRTVADPGSLGIVLGGSGNGEQIAANKVPGARCALAWSVQTAALAREHNNAQLIGIGGRMHTVAEALAIVDAFVTTPWSKAQRHQRRIDILAEYE 149
>gi|56698012|ref|YP_168383.1| ribose 5-phosphate isomerase B [Silicibacter pomeroyi DSS-3] >gi|56679749|gb|AAV96415.1| ribose 5-phosphate isomerase B [Silicibacter pomeroyi DSS-3] (149 aa)
Score = 212, Expect = 6.4e-16, Identities = 47/145 (32%), Positives = 73/145 (50%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLE 156
           ++ + SDH   D++  + + H   +  + VD+G  +  ES  YP +     E +     S GI +CGTG GI +A NK+ GI       T  A + R HN+ N+++L  R       ++I+  F S+ FE GRH  R+D I   E
  S:     6 RIVLSSDHAAIDLRRAVAD-HISAQGWEVVDIGPQT-TESTHYPKHGRAAAERVASGDCSLGIILCGTGQGIMMAANKVAGIRCGVCFDTFSARMIRMHNDANMLSLGARVVGEGLALDIVDAFLSAEFEGGRHATRVDMIETPE 148
>gi|15841989|ref|NP_337026.1| ribose-5-phosphate isomerase B [Mycobacterium tuberculosis CDC1551] >gi|13882264|gb|AAK46840.1| carbohydrate-phosphate isomerase, putative [Mycobacterium tuberculosis CDC1551] (159 aa)
Score = 212, Expect = 6.9e-16, Identities = 49/146 (33%), Positives = 81/146 (55%)
  Q:    11 IKVYIGSDHGGFDMKEKI-----RNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHF-ESGRHEKRLDKITKLE 156
           ++VY+G+DH G+++K++I     +  HE       +D G    D   DYP +        + D GS GI + G+G G  IA NK+ G   A       A LAREHNN  +I + GR  +V + + I+  F ++ + ++ RH++R+D + + E
  S:     1 MRVYLGADHAGYELKQRIIEHLKQTGHEP------IDCGALRYDADDDYPAFCIAAATRTVADPGSLGIVLGGSGNGEQIAANKVPGARCALAWSVQTAALAREHNNAQLIGIGGRMHTVAEALAIVDAFVTTPWSKAQRHQRRIDILAEYE 146
>gi|91215347|ref|ZP_01252318.1| ribose 5-phosphate isomerase B [Psychroflexus torquis ATCC 700755] >gi|91186299|gb|EAS72671.1| ribose 5-phosphate isomerase B [Psychroflexus torquis ATCC 700755] (143 aa)
Score = 211, Expect = 8.2e-16, Identities = 52/140 (37%), Positives = 80/140 (57%)
  Q:    13 VYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           + IG+DH G   K KI +  +   I +  + GT S D SVDYPD+   +  ++     S GI ICG+G G  +  NK +GI +A    +    LA++HNN NV+++  RF S+E+ ++ +  F  + F+ GRH  R+DKI
  S:     3 ISIGNDHAGTFYKNKIVDYLKSQNI-EVHNHGTNSED-SVDYPDFVHPVAIDVEDGTSSLGIIICGSGNGANMTANKHQGIRSALCWTSELVALAKQHNNANVLSIPSRFVSLEEALDFVTVFLKTPFDGGRHHHRVDKI 140
>gi|91205093|ref|YP_537448.1| ribose-5-phosphate isomerase B [Rickettsia bellii RML369-C] >gi|157827571|ref|YP_001496635.1| ribose-5-phosphate isomerase B [Rickettsia bellii OSU 85-389] >gi|119368374|sp|Q1RJV5|Y278_RICBR Putative sugar phosphate isomerase RBE_0278 >gi|91068637|gb|ABE04359.1| Ribose-5-phosphate isomerase [Rickettsia bellii RML369-C] >gi|157802875|gb|ABV79598.1| ribose-5-phosphate isomerase B [Rickettsia bellii OSU 85-389] (144 aa)
Score = 211, Expect = 8.9e-16, Identities = 55/145 (37%), Positives = 81/145 (55%)
  Q:     8 LKKIKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           +K   + I SDH G+++K  I    +  + L   D GT++  +SVDYPDYA+K+  N+++     GI I  TGIG+ IA N+   I AA       AE A+ HN+ N++ L  +    +   +II KF ++ FE GRH  RL KI
  S:     1 MKTYDIVIASDHSGYELKSIIIEYLQK-KSLSVYDCGTHN-TQSVDYPDYAKKVVNNIIEKLARIGILIGDTGIGMSIAANRSSEIRAALCVNVSTAESAKAHNDANILVLGAKTVDHKTVFDIIDKFLATKFEGGRHSVRLLKI 143
>gi|110634856|ref|YP_675064.1| ribose-5-phosphate isomerase B [Mesorhizobium sp. BNC1] >gi|110285840|gb|ABG63899.1| sugar-phosphate isomerases, RpiB/LacA/LacB family [Mesorhizobium sp. BNC1] (148 aa)
Score = 210, Expect = 1.0e-15, Identities = 48/148 (32%), Positives = 86/148 (58%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRH-EKRLDKITKLENK 158
           +K+ IGSDH G+ +K  I ++ E L   + +D+G +S D  VD+PD A+ + + LLK +G  G+ +CGTG+G  IA NK  GI AA  +    A    EH++VNV+ +  +        +++  + S+ F +     +R++K+ +++ +
  S:     1 MKIIIGSDHAGYPLKADIISHIESLG-HEVIDVGCHSTD-PVDFPDIAQDLTDKLLKGEGDRGLMVCGTGVGAAIAANKRAGIRAAVGHDVYSAHQCVEHDDVNVLCIGAQIVGAWLARDLVSAYLSAEFSTSEEFRRRVEKLNEMDGR 147
>gi|29831969|ref|NP_826603.1| ribose-5-phosphate isomerase B [Streptomyces avermitilis MA-4680] >gi|29609086|dbj|BAC73138.1| putative ribose-5-phosphate isomerase [Streptomyces avermitilis MA-4680] (159 aa)
Score = 210, Expect = 1.1e-15, Identities = 52/144 (36%), Positives = 80/144 (55%)
  Q:    13 VYIGSDHGGFDMKEKIRNNHELLEIL-----DFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFE-SGRHEKRLDKITKLE 156
           +Y+GSDH GF++K     NH L+E L     + VD G +  D   DYP +  +  E    D  + GI I G+G G  IA NK+KG+ AA       A L R+HN+ NV+ +  R  + E+  + ++ F ++ F    RH +R+D ++  E
  S:     1 MYLGSDHAGFELK-----NH-LVEWLKAAGHEPVDCGPHIYDAQDDYPPFCLRAAEGAAADPDALGIVIGGSGNGEQIAANKVKGVRAALAWSEETASLGRQHNDANVVAVGARMHTQEEATKFVETFLNTPFSGDARHIRRIDMLSAYE 144
>gi|163789220|ref|ZP_02183662.1| ribose 5-phosphate isomerase B [Flavobacteriales bacterium ALC-1] >gi|159875435|gb|EDP69497.1| ribose 5-phosphate isomerase B [Flavobacteriales bacterium ALC-1] (136 aa)
Score = 209, Expect = 1.6e-15, Identities = 45/136 (33%), Positives = 75/136 (55%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHE 146
           +K+ IG+DH G D K+ +  + E  +     + GT + D SVDYPD+   + +++       GI ICG+  G+ +  NK + + A     +   EL R HNN N+I +  RFTS+   ++++  F ++ FE GRH+
  S:     1 MKISIGNDHAGPDYKQAVVKHLET-KGYTITNYGTDTLD-SVDYPDFVHPVAKDVNDGNADLGILICGSANGVAMTANKYQNVRAGVCWTSEITELTRLHNNANIICIPARFTSIPQAIKMVDTFLNTAFEGGRHQ 134
>gi|160881863|ref|YP_001560831.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Clostridium phytofermentans ISDg] >gi|160430529|gb|ABX44092.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Clostridium phytofermentans ISDg] (142 aa)
Score = 208, Expect = 1.9e-15, Identities = 47/145 (32%), Positives = 83/145 (57%)
  Q:    13 VYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLEN 157
           + +G DHGG+D+ +++    E  ++  + + GT S   S DYP + + +   +   +  +GI ICGTGIGI +A NK+ G+ AA  +    AE  R+HNN NV+ + GR       ++I++ F ++ F +   ++ + +I+ LEN
  S:     2 IALGCDHGGYDLMQEVIAYLEEKKV-PYKNFGTDS-KASCDYPVFGKNVAMAVANKECEFGILICGTGIGISMAANKVAGVRAALCHDCFSAEATRQHNNANVLCMGGRVVGPGLALKIVEIFLNTEFSN--DDRHIRRISMLEN 142
>gi|78223818|ref|YP_385565.1| ribose/galactose isomerase [Geobacter metallireducens GS-15] >gi|78195073|gb|ABB32840.1| Ribose/galactose isomerase [Geobacter metallireducens GS-15] (150 aa)
Score = 207, Expect = 2.3e-15, Identities = 47/146 (32%), Positives = 76/146 (52%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEI-LDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESG-RHEKRLDKITKLE 156
           +++ I +DHGGF MKE++     L E   +  D G    D   DYPD+   + + + + K   GI  C +G+G  IA NK+ G  AA ++    A    EH+++N+I L         + E+++ F ++ F    RH +RL K+  LE
  S:     1 MRIGIAADHGGFTMKERMAA--ALREAGYELTDFGAERLDPDDDYPDFVIPLAQAVGEGKLDRGIAFCSSGVGASIAANKVPGARAALIHDDYSAHQGVEHDDMNIICLGSLVVGYAQSWELVRAFLAATFSGAERHRRRLAKVAALE 146
>gi|88805083|ref|ZP_01120603.1| ribose-5-phosphate isomerase B [Robiginitalea biformata HTCC2501] >gi|88785962|gb|EAR17131.1| ribose-5-phosphate isomerase B [Robiginitalea biformata HTCC2501] (169 aa)
Score = 207, Expect = 2.7e-15, Identities = 49/158 (31%), Positives = 83/158 (52%)
  Q:     1 MSESKKQLKKIKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIE--AELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHF-ESGRHEKRLDKITKLENK 158
           M ++    K+  +YI SDH GF++K  +   H      D  DLG Y+ D   DYPD+     E +  + GS G+ + G+G G  +A NK++G+ AA           L+R HN  N+++L  RF   E+ + +++ +  + +    RH +R++K+   E K
  S:     1 MKQTIDFFKRQMIYIASDHAGFELKNAL-CRHLAASGRDVEDLGPYAYDPEDDYPDFILPAAEAVAANPGSLGVVLGGSGQGEALAANKVEGVRAALYYGGPRDIVSLSRTHNQANILSLGARFLDEEEAIAVLELWLETPYGREERHVRRINKVRAYEQK 160
>gi|92112490|ref|YP_572418.1| ribose-5-phosphate isomerase [Chromohalobacter salexigens DSM 3043] >gi|91795580|gb|ABE57719.1| ribose-5-phosphate isomerase [Chromohalobacter salexigens DSM 3043] (166 aa)
Score = 206, Expect = 2.9e-15, Identities = 52/158 (32%), Positives = 82/158 (51%)
  Q:     1 MSESK--KQLKKIKVYIGSDHGGFDMK----EKIRN-NHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           MS+S+       ++V +G D   +++K    E +R   HE       VD GTY   E V YPD A K+   +   +   G+ +CGTGIG+ I+ NK++GI AA  + T  A  AR  N+  ++TL  R    E    I+  F ++ F  G   +++ +I   E +
  S:     1 MSDSRTASHTAPMRVALGGDEAAYELKALLIEHVRALGHEA------VDFGTYDA-EPVLYPDVAVKVARAIEAGEVERGVLVCGTGIGVAISANKVRGIRAAQAHDTYSAAKARSSNDAQIVTLGARVVGPELAKTIVTTFLATEFAGGGSREKVARILAYERE 158
>gi|67458878|ref|YP_246502.1| ribose-5-phosphate isomerase B [Rickettsia felis URRWXCal2] >gi|75536681|sp|Q4UM83|Y486_RICFE Putative sugar phosphate isomerase RF_0486 >gi|67004411|gb|AAY61337.1| Ribose-5-phosphate isomerase [Rickettsia felis URRWXCal2] (145 aa)
Score = 206, Expect = 2.9e-15, Identities = 55/145 (37%), Positives = 84/145 (57%)
  Q:     8 LKKIKVYIGSD-HGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           +K   + I SD H G+++K +I N  E  + L   D GT +  ++VDYPDYA+K+ + +++     GI I  TGIG+ IA N+   I AA  +  + AE A+ HN+ N++ L  +    +   +II KF ++ FE GRH  RL KI
  S:     1 MKTYNIVIASDDHSGYELKSEIINYLEQ-KSLKVYDCGT-NNTQTVDYPDYAKKVVDIIIEKSAPIGILISDTGIGMSIAANRSSEIRAALCHNMLTAENAKAHNDANILILGAKTIDYKIVFDIIDKFLTTKFEGGRHNVRLLKI 144
>gi|88801779|ref|ZP_01117307.1| ribose 5-phosphate isomerase B [Polaribacter irgensii 23-P] >gi|88782437|gb|EAR13614.1| ribose 5-phosphate isomerase B [Polaribacter irgensii 23-P] (145 aa)
Score = 205, Expect = 4.0e-15, Identities = 50/142 (35%), Positives = 79/142 (55%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHEL--LEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           +++ IG+DH G   K +I  + E    E+L+F   GT + D S+DYPD        +     ++GI +CG+G G  +  NK +GI AA         L R+HNN N++T+  RF S++  +  +  F ++ FE GRH  R++KI
  S:     1 MRIAIGNDHAGTIYKFEIIKHLESKGYEVLNF---GTDT-DASMDYPDAIHPTATAVENGTAAFGIILCGSGNGAQMTANKHQGIRAALCWNNELVALTRQHNNANILTIPARFVSLQQAIGFVDIFLTTDFEGGRHGDRVEKI 140
>gi|84686941|ref|ZP_01014825.1| ribose 5-phosphate isomerase B [Rhodobacterales bacterium HTCC2654] >gi|84665138|gb|EAQ11618.1| ribose 5-phosphate isomerase B [Rhodobacterales bacterium HTCC2654] (146 aa)
Score = 204, Expect = 5.1e-15, Identities = 43/141 (30%), Positives = 77/141 (54%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           ++ + SDH   ++++ I  + E  E  + VD+G  +  ES  YP + +   + +   + + GI +CGTG GI +A NK+ GI     + T  A + R+HN+ N+++L  R       ++I+  F ++ FE GRH  R++ I
  S:     6 RIVLSSDHAAIELRQTIAKHIEA-EGWEAVDIGP-TTPESTHYPLHGQAAAQKVASGECALGIILCGTGQGIMMAANKVAGIRCGVCSDTFSARMIRQHNDANILSLGARVVGEGLALDIVDAFLNAEFEGGRHATRVEMI 144
>gi|83951650|ref|ZP_00960382.1| ribose 5-phosphate isomerase B [Roseovarius nubinhibens ISM] >gi|83836656|gb|EAP75953.1| ribose 5-phosphate isomerase B [Roseovarius nubinhibens ISM] (149 aa)
Score = 204, Expect = 5.3e-15, Identities = 44/145 (30%), Positives = 78/145 (53%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLE 156
           ++ + SDH   ++++ +  + + L   +  D+G  S  ES  YP + +     +     + GI +CGTG GI +A NK+KGI     + T  A++ R+HN+ N++++  R       +EI++ F  + FE GRH  R+D I  +E
  S:     6 RIVLSSDHAAIELRQAVAEHAKSLG-WEVEDIGPIS-PESTHYPKHGKAAARKVASGDCALGIILCGTGQGIMMAANKVKGIRCGVASDTFSAKMIRQHNDANMLSIGARVVGEGLALEIVEAFLGAEFEGGRHGTRVDMIKAIE 148
>gi|117928805|ref|YP_873356.1| ribose-5-phosphate isomerase B [Acidothermus cellulolyticus 11B] >gi|117649268|gb|ABK53370.1| ribose 5-phosphate isomerase [Acidothermus cellulolyticus 11B] (160 aa)
Score = 204, Expect = 5.3e-15, Identities = 50/146 (34%), Positives = 78/146 (53%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEIL-----DFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFE-SGRHEKRLDKITKLE 156
           ++VY+ SDH GF++K +      L+E L     + VD G        DYP Y          D+ S+G+ I G+G G  IA NK++GI AA +     A LAR HN+ NV ++  R  ++ D + ++  F  + F    RH +R+  I++ E
  S:     1 MRVYVASDHAGFELKTR------LIEWLAEQGYEPVDCGPVVFQPDDDYPPYVIDAARRTAADRDSFGVVIGGSGNGEQIAANKVRGIRAALIWNDETAALARAHNDANVASIGARQHTIRDAIRLVDIFLRTPFSGEPRHARRIGMISEFE 146
>gi|94265532|ref|ZP_01289280.1| Ribose 5-phosphate isomerase B [delta proteobacterium MLMS-1] >gi|93453973|gb|EAT04319.1| Ribose 5-phosphate isomerase B [delta proteobacterium MLMS-1] (141 aa)
Score = 204, Expect = 5.6e-15, Identities = 47/139 (33%), Positives = 70/139 (50%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRL 149
           +KV +G DHGGF +KE +          +  D G      +VDYPD A ++   +       GI ICGTGIG+ +A N+   I AA  ++   A ++REHN+ NV+ L  R         I+  + +  F  GRH +R+
  S:     1 MKVALGCDHGGFALKETVAQRLRAASC-EIEDCGVMEA-TAVDYPDIASRLCRLVADGVCQRGILICGTGIGMSMAANRYTAIRAALCHEPFSARMSREHNDANVLCLGARVIGPGLAAAIVDAWLAGEFAGGRHLQRI 137
>gi|167403476|ref|ZP_02308304.1| hypothetical protein LmonocytFSL_02471 [Listeria monocytogenes FSL J2-003] (148 aa)
Score = 204, Expect = 5.7e-15, Identities = 48/148 (32%), Positives = 82/148 (55%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           +K+ IG D  G+++K+ +    +   I +F D G++  DE V YP  AEK+   +  +    GI ICGTGIG+ I  NKI GI AA ++ +  AE AR+ N+ +++T+          V ++  +  S F  GR + ++D + +++ K
  S:     1 MKIAIGCDEMGYELKQTLITRLKEKNI-EFTDFGSFE-DEKVLYPSIAEKVALEVKNNDFDRGILICGTGIGMAITANKIHGIRAAQIHDSYSAERARKSNDAHIMTMGALVIGPSLAVSLLDTWLDSDFSGGRSQAKVDLMEEIDQK 146
>gi|16802390|ref|NP_463875.1| hypothetical protein lmo0345 [Listeria monocytogenes EGD-e] >gi|153173155|ref|ZP_01928988.1| ribose 5-phosphate isomerase B [Listeria monocytogenes FSL N3-165] >gi|153194992|ref|ZP_01939790.1| ribose 5-phosphate isomerase B [Listeria monocytogenes 10403S] >gi|167013787|ref|ZP_02276320.1| hypothetical protein LmonFS_01839 [Listeria monocytogenes FSL J1-194] >gi|167216611|ref|ZP_02286247.1| hypothetical protein LmonocFSL_02809 [Listeria monocytogenes FSL J1-175] >gi|16409723|emb|CAC98424.1| lmo0345 [Listeria monocytogenes] >gi|127634595|gb|EBA23975.1| ribose 5-phosphate isomerase B [Listeria monocytogenes 10403S] >gi|133731112|gb|EBA32810.1| ribose 5-phosphate isomerase B [Listeria monocytogenes FSL N3-165] (148 aa)
Score = 204, Expect = 5.7e-15, Identities = 48/148 (32%), Positives = 82/148 (55%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           +K+ IG D  G+++K+ +    +   I +F D G++  DE V YP  AEK+   +  +    GI ICGTGIG+ I  NKI GI AA ++ +  AE AR+ N+ +++T+          V ++  +  S F  GR + ++D + +++ K
  S:     1 MKIAIGCDEMGYELKQTLITRLKEKNI-EFTDFGSFE-DEKVLYPSIAEKVALEVKNNDYDRGILICGTGIGMAITANKIHGIRAAQIHDSYSAERARKSNDAHIMTMGALVIGPSLAVSLLDTWLDSDFSGGRSQAKVDLMEEIDQK 146
>gi|47096676|ref|ZP_00234262.1| ribose 5-phosphate isomerase B [Listeria monocytogenes str. 1/2a F6854] >gi|153178371|ref|ZP_01931775.1| ribose 5-phosphate isomerase B [Listeria monocytogenes F6900] >gi|153185191|ref|ZP_01935797.1| ribose 5-phosphate isomerase B [Listeria monocytogenes J0161] >gi|153189682|ref|ZP_01937199.1| ribose 5-phosphate isomerase B [Listeria monocytogenes J2818] >gi|47014930|gb|EAL05877.1| ribose 5-phosphate isomerase B [Listeria monocytogenes str. 1/2a F6854] >gi|126942122|gb|EBA19867.1| ribose 5-phosphate isomerase B [Listeria monocytogenes J0161] >gi|127766583|gb|EBA26916.1| ribose 5-phosphate isomerase B [Listeria monocytogenes J2818] >gi|133733672|gb|EBA35370.1| ribose 5-phosphate isomerase B [Listeria monocytogenes F6900] (148 aa)
Score = 203, Expect = 7.5e-15, Identities = 48/148 (32%), Positives = 82/148 (55%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           +K+ IG D  G+++K+ +    +   I +F D G++  DE V YP  AEK+   +  +    GI ICGTGIG+ I  NKI GI AA ++ +  AE AR+ N+ +++T+          V ++  +  S F  GR + ++D + +++ K
  S:     1 MKIAIGCDEMGYELKQTLIARLKEKNI-EFTDFGSFE-DEKVLYPSIAEKVALEVKNNDFDRGILICGTGIGMAITANKIHGIRAAQIHDSYSAERARKSNDAHIMTMGALVIGPSLAVSLLDTWLDSDFSGGRSQAKVDLMEEIDQK 146
>gi|91787354|ref|YP_548306.1| ribose-5-phosphate isomerase [Polaromonas sp. JS666] >gi|91696579|gb|ABE43408.1| ribose-5-phosphate isomerase [Polaromonas sp. JS666] (149 aa)
Score = 203, Expect = 7.7e-15, Identities = 46/146 (31%), Positives = 75/146 (51%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLE 156
           +K+ IG D   +D+K+ ++  H +    +  D GT+   + V YPD A  + E +        + +CGTGIG+ I+ NK+KG+ AA  + T  AE A   N+  +IT+  R    E    I+  +  S F+ GR + ++D I   E
  S:     1 MKLAIGCDEAAYDLKQTLKK-HMIDAGHEVTDFGTHDA-QPVLYPDVAFAVAEQVAGGAYERALLLCGTGIGMAISANKVKGVRAAQCHDTYSAERASRSNDAQIITIGARVVGPELAKSIVDAWLRSGFDGGRSQPKVDLIQAYE 144
>gi|94264508|ref|ZP_01288295.1| Ribose 5-phosphate isomerase B [delta proteobacterium MLMS-1] >gi|93455067|gb|EAT05294.1| Ribose 5-phosphate isomerase B [delta proteobacterium MLMS-1] (141 aa)
Score = 202, Expect = 8.7e-15, Identities = 47/139 (33%), Positives = 70/139 (50%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRL 149
           +KV +G DHGGF +KE +          +  D G      +VDYPD A ++   +       GI ICGTGIG+ +A N+   I AA  ++   A ++REHN+ NV+ L  R         I+  + +  F  GRH +R+
  S:     1 MKVALGCDHGGFALKETVAQRLRAASC-EIEDCGVMEA-TAVDYPDIASRLCRLVADGVCQRGILICGTGIGMSMAANRYTAIRAALCHEPFSARMSREHNDANVLCLGARVIGPGLAAAIVDVWLAGEFAGGRHLQRI 137
>gi|116871721|ref|YP_848502.1| ribose 5-phosphate isomerase B [Listeria welshimeri serovar 6b str. SLCC5334] >gi|116740599|emb|CAK19719.1| rpiB [Listeria welshimeri serovar 6b str. SLCC5334] (148 aa)
Score = 201, Expect = 1.1e-14, Identities = 48/148 (32%), Positives = 81/148 (54%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           +K+ IG D  G+++K+ +    +   I  F D G++  DE V YP  AEK+   +  +    GI ICGTGIG+ I  NKI GI AA ++ +  AE AR+ N+ +++T+          V ++  +  S F  GR + ++D + +++ K
  S:     1 MKIAIGCDEMGYELKQTLITRLKEKNIA-FTDFGSFE-DEKVLYPSIAEKVALEVKNNDYDRGILICGTGIGMAITANKIHGIRAAQIHDSYSAERARKSNDAHIMTMGALVIGPSLAVSLLDTWLDSDFSGGRSQAKVDLMEEIDQK 146
>gi|56416762|ref|YP_153836.1| ribose 5-phosphate isomerase [Anaplasma marginale str. St. Maries] >gi|56387994|gb|AAV86581.1| ribose 5-phosphate isomerase [Anaplasma marginale str. St. Maries] (146 aa)
Score = 201, Expect = 1.3e-14, Identities = 47/141 (33%), Positives = 74/141 (52%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           +V++ SDH G  ++  +      L   +  D G   GD++ DYPD    + + +     S+G+ ICGTGIG+ IA N+ K I AA  +    A LAREHN+ NV+    R+   +    ++  F ++ F  GRH  R+ K+
  S:     6 RVFVASDHAGVQLRLLLGAYLGDLGC-EVADCGCDVGDDAADYPDCVPGVVDCV--SDTSFGVLICGTGIGMSIAANRNKWIRAALCHDPTFARLAREHNDANVLCFGARYVEPDVAKSVLYTFLTTKFLGGRHAARVKKL 143
>gi|153004888|ref|YP_001379213.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Anaeromyxobacter sp. Fw109-5] >gi|152028461|gb|ABS26229.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Anaeromyxobacter sp. Fw109-5] (161 aa)
Score = 200, Expect = 1.5e-14, Identities = 48/148 (32%), Positives = 75/148 (50%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESG--RHEKRLDKITKLENK 158
           ++V I +DH G  +   +R    +L   + VDL         DYPD+A  +GE +   +   G+ +CG+G+G+ IA NK+ GIYA   + T  A    EH+ +NV+ L  R        EI+  F  +   SG  RH +R+ K   +E +
  S:     1 MRVAIAADHAGVALAAMLRAELAVLG-HEVVDLTPRDQGPEDDYPDHAVSVGEAIRSGRAERGVLVCGSGVGVAIAANKLPGIYAGACHDTYSAHQGVEHDAMNVLALGARVVGEALAREILGAFLGAR-PSGEERHRRRISKTRGIEAR 148
>gi|158317059|ref|YP_001509567.1| ribose-5-phosphate isomerase B [Frankia sp. EAN1pec] >gi|158112464|gb|ABW14661.1| ribose 5-phosphate isomerase [Frankia sp. EAN1pec] (161 aa)
Score = 200, Expect = 1.5e-14, Identities = 53/146 (36%), Positives = 79/146 (54%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDF-VDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFE-SGRHEKRLDKITKLE 156
           ++V++GSDH GF +K+ +     L E+    VD G    D   DYP +          +  S GI I G+G G  IA NK+ G+ AA V     A LAR+HN+ NVI++  R  S+ + VE+++ F ++ F    RH +RL  I+  E
  S:     1 MRVHLGSDHAGFHLKKALVA--RLAELGHAPVDHGPVEYDPDDDYPPFVMAAAAAAAAEPDSLGIVIGGSGNGEVIAANKVDGVRAALVWSEQTATLARQHNDANVISVGARMHSLPEAVELVEIFLATPFSGEQRHLRRLRMISAYE 146
>gi|166157046|emb|CAO79503.1| putative ribose-5-phosphate isomerase B (Phosphoriboisomerase B) [uncultured candidate division WWE3 bacterium EJ0ADIGA11YD11] (149 aa)
Score = 200, Expect = 1.5e-14, Identities = 48/144 (33%), Positives = 84/144 (58%)
  Q:    13 VYIGSDHGGFDMKEKIRNNHELLEILD----FVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFE-SGRHEKRLDKITKLE 156
           +YI SDH G+++K     N+ + E+       +DLG ++ ++  DYPDYA+ + + + ++  + GI IC  G+G+ IA NK KG+ A+    +  A  +R  +  N++ L   F + E+ +EI + + S+ F    RH +R+ KIT  E
  S:     2 IYISSDHRGYELK-----NYLIKELTPKGTIVMDLGPFNFNQDDDYPDYAKLVAKKIQENPHNMGILICANGVGMSIAANKFKGVRASISWNSKHAATSRNDDKTNILVLPSDFITKEEALEITQTWLSTDFSGEERHLRRIMKITSFE 145
>gi|88799496|ref|ZP_01115073.1| ribose 5-phosphate isomerase B [Reinekea sp. MED297] >gi|88777806|gb|EAR09004.1| ribose 5-phosphate isomerase B [Reinekea sp. MED297] (141 aa)
Score = 200, Expect = 1.5e-14, Identities = 51/140 (36%), Positives = 75/140 (53%)
  Q:    13 VYIGSDHGGFDMKEKIRNNHELLEI-LDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           V +  DH GF  KE IR    LLE  +   D G +S +E VDYPD      E + ++    GI + G+G    +A N+I+GI  A V     AEL+  H N N+I +  R  +  D + I+  + ++ F  GRH++R+DKI
  S:     3 VALACDHAGFYYKESIRK--ALLERGVSVQDFGAHS-EEPVDYPDIVRPAAEAVARNDCQRGIIVGGSGNEAIVA-NRIRGIRCAVVWNLRTAELSMAHGNCNMIAIGQRMMTETDALAIVDHWLAATFAGGRHQRRIDKI 139
>gi|108800565|ref|YP_640762.1| ribose-5-phosphate isomerase B [Mycobacterium sp. MCS] >gi|119869704|ref|YP_939656.1| ribose-5-phosphate isomerase B [Mycobacterium sp. KMS] >gi|126436181|ref|YP_001071872.1| ribose-5-phosphate isomerase B [Mycobacterium sp. JLS] >gi|108770984|gb|ABG09706.1| ribose 5-phosphate isomerase [Mycobacterium sp. MCS] >gi|119695793|gb|ABL92866.1| ribose 5-phosphate isomerase [Mycobacterium sp. KMS] >gi|126235981|gb|ABN99381.1| ribose 5-phosphate isomerase [Mycobacterium sp. JLS] (162 aa)
Score = 200, Expect = 1.6e-14, Identities = 53/149 (35%), Positives = 81/149 (54%)
  Q:     8 LKKIKVYIGSDHGGFDMKEKI-----RNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESG-RHEKRLDKITKLE 156
           +  ++VY+G+DH G+++K+ I        HE       VD G +  D   DYP +     E  + D GS GI + G+G G  IA NK+ G   A       A+LAREHNN  +I L GR  S  D + I+  F ++ +    RH++R+D +++ E
  S:     1 MAAMRVYLGADHAGYELKQVIIEHLRSTGHEP------VDCGAFDYDADDDYPAFCIAAAEKTVADPGSLGIVLGGSGNGEQIAANKVPGARCALAWSVETAKLAREHNNAQLIGLGGRMHSEADALAIVDAFLATPWSKAERHQRRIDILSEYE 149
>gi|167218462|ref|ZP_02288098.1| ribose-5-phosphate isomerase B [Listeria monocytogenes FSL J1-175] (112 aa)
Score = 199, Expect = 2.1e-14, Identities = 42/106 (39%), Positives = 60/106 (56%)
  Q:    52 VDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLEN 157
           +DYP  A  + E ++  +   GI +CGTGIG+ IA NK+KGI  A V  T  A   REHN+ NV+ L  R        +I+K +  + +E GRH  R+ +IT  E+
  S:     1 MDYPGLAITVSEKVVNQEVDRGILVCGTGIGMSIAANKVKGIRCALVGDTFSAHATREHNDTNVLALGARVIGPGLAEDIVKIWLETAYEGGRHANRVGQITAYED 106
>gi|16799440|ref|NP_469708.1| hypothetical protein lin0363 [Listeria innocua Clip11262] >gi|46906585|ref|YP_012974.1| ribose 5-phosphate isomerase B [Listeria monocytogenes str. 4b F2365] >gi|47091483|ref|ZP_00229280.1| ribose 5-phosphate isomerase B [Listeria monocytogenes str. 4b H7858] >gi|153165499|ref|ZP_01926318.1| ribose 5-phosphate isomerase B [Listeria monocytogenes FSL N1-017] >gi|153200815|ref|ZP_01942885.1| ribose 5-phosphate isomerase B [Listeria monocytogenes HPB2262] >gi|167213691|ref|ZP_02283998.1| ribose 5-phosphate isomerase B [Listeria monocytogenes FSL R2-503] >gi|167453057|ref|ZP_02319280.1| ribose 5-phosphate isomerase B [Listeria monocytogenes FSL J2-064] >gi|16412792|emb|CAC95596.1| lin0363 [Listeria innocua] >gi|46879850|gb|AAT03151.1| ribose 5-phosphate isomerase B [Listeria monocytogenes str. 4b F2365] >gi|47020160|gb|EAL10896.1| ribose 5-phosphate isomerase B [Listeria monocytogenes str. 4b H7858] >gi|133728280|gb|EBA29978.1| ribose 5-phosphate isomerase B [Listeria monocytogenes FSL N1-017] >gi|133736415|gb|EBA38113.1| ribose 5-phosphate isomerase B [Listeria monocytogenes HPB2262] (148 aa)
Score = 199, Expect = 2.2e-14, Identities = 47/148 (31%), Positives = 82/148 (55%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           +K+ IG D  G+++K+ +    +   I +F D G++  +E V YP  AEK+   +  +    GI ICGTGIG+ I  NKI GI AA ++ +  AE AR+ N+ +++T+          V ++  +  S F  GR + ++D + +++ K
  S:     1 MKIAIGCDEMGYELKQTLITRLKEKNI-EFTDFGSFE-NEKVLYPSIAEKVALEVKNNDYDRGILICGTGIGMAITANKIHGIRAAQIHDSYSAERARKSNDAHIMTMGALVIGPSLAVSLLDTWLDSDFSGGRSQAKVDLMEEIDQK 146
>gi|92112886|ref|YP_572814.1| ribose-5-phosphate isomerase B [Chromohalobacter salexigens DSM 3043] >gi|91795976|gb|ABE58115.1| sugar-phosphate isomerases, RpiB/LacA/LacB family [Chromohalobacter salexigens DSM 3043] (148 aa)
Score = 198, Expect = 2.4e-14, Identities = 47/147 (31%), Positives = 85/147 (57%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEIL--DFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRH-EKRLDKITKLEN 157
           +K+ IGSDH G+ +K  +    E +E L  + +D+G++  D  VD+PD A+++   +   + + G+ +CGTG+G  IA NKI+GI AA  +    A    EH++VNV+ +  +        ++IK +  + F +     +R++K+  +EN
  S:     1 MKIVIGSDHAGYRLKASVV---EYVESLGHEVIDVGSHD-DTPVDFPDIAKQMAGKVTSGEAARGLMVCGTGVGASIAANKIRGIRAAVCHDIHSAHQCVEHDDVNVMCIGAQIVGPWLANDLIKAYLEAEFSTSEEFRRRVEKLHAMEN 146
>gi|167363518|ref|ZP_02297904.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Rhizobium leguminosarum bv. trifolii WSM1325] >gi|167069632|gb|EDR73722.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Rhizobium leguminosarum bv. trifolii WSM1325] (149 aa)
Score = 198, Expect = 2.6e-14, Identities = 45/145 (31%), Positives = 73/145 (50%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLE 156
           ++ + SDH    +++ I   H   +    VD+G  +  ES  YP + E     +      +GI +CGTG GI +A NK+KGI       T  A + R+HN+ N++++  R       ++I+  F ++ FE GRH  R+  I  LE
  S:     6 RIALSSDHAAIQLRQAIAG-HIAAQGWVAVDIGP-TTPESTHYPKHGEAAARLVASGDCRFGIILCGTGQGIMMAANKVKGIRCGVCVDTFSARMIRQHNDANMLSIGVRVVGEGLALDIVDAFLTAQFEGGRHATRVGMIEALE 148
>gi|50119805|ref|YP_048972.1| ribose-5-phosphate isomerase B [Pectobacterium atrosepticum SCRI1043] >gi|49610331|emb|CAG73775.1| ribose 5-phosphate isomerase [Erwinia carotovora subsp. atroseptica SCRI1043] (152 aa)
Score = 197, Expect = 3.7e-14, Identities = 50/148 (33%), Positives = 73/148 (49%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           + + IG+D    D+K  I  ++   + L   D       E+  YPD A  +   +   K   GI +CGTGIG+CI  NK+ GI AA  + T  A+ AR+ NN  VI L  R    E   EII  +  + FE G    +++KI   E++
  S:     2 LSIAIGADSAAIDLKNTI-TDYLQQKGLTVTDYSYDPTGENPIYPDVAYTLAHAIKDGKHQRGILLCGTGIGMCIVANKVNGIRAAQCHDTYSAQRARKSNNAQVIALGARVIGPELAKEIIGAWLDAEFEGGGSAPKVEKIGYYEHQ 148
>gi|75764688|ref|ZP_00744108.1| Ribose 5-phosphate isomerase [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|74487825|gb|EAO51621.1| Ribose 5-phosphate isomerase [Bacillus thuringiensis serovar israelensis ATCC 35646] (104 aa)
Score = 196, Expect = 4.9e-14, Identities = 44/102 (43%), Positives = 64/102 (62%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNN 112
           +KV I SDHGG ++++++ +  E L I +++DLG      SVDYPD+A    E +   +   GI +CGTGIG+ IA NK+ GI  A V+ T  A+  REHN+
  S:     1 MKVVIASDHGGMNIRKELVSLLEELNI-EYIDLGCECEAGSVDYPDFAFPAAEMVANGEVDRGILVCGTGIGMSIAANKVNGIRCALVHDTFSAKATREHND 101
>gi|42525868|ref|NP_970966.1| ribose 5-phosphate isomerase B [Treponema denticola ATCC 35405] >gi|41815918|gb|AAS10847.1| ribose 5-phosphate isomerase B [Treponema denticola ATCC 35405] (150 aa)
Score = 196, Expect = 5.2e-14, Identities = 44/148 (29%), Positives = 79/148 (53%)
  Q:    11 IKVYIGSDHGGFDMK----EKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           +K+  GSDH G  +K    E +RN        + VD G        +Y ++  K+ E +   +   G+ +CG+G+GI +A NK+ G+ AA  ++   A+LA EH+++N + +       E+   I+  F  + FE G + +R+D ++ +E K
  S:     1 MKIGFGSDHSGVALKHILMEHVRNKG-----YECVDYGAADSKVPANYAEFGLKVAEAIKSQEVEKGVMVCGSGVGISLAANKVPGVRAAACSEPCTAKLAVEHSDINAVAMGVCIVGPEEAKMIVDAFLDARFEGGVYTERVDTLSAIERK 147
>gi|163841998|ref|YP_001626403.1| ribose-5-phosphate isomerase B [Renibacterium salmoninarum ATCC 33209] >gi|162955474|gb|ABY24989.1| ribose 5-phosphate isomerase [Renibacterium salmoninarum ATCC 33209] (178 aa)
Score = 196, Expect = 5.2e-14, Identities = 52/156 (33%), Positives = 85/156 (54%)
  Q:     1 MSESKKQLKKIKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDK--GSYGIGIC--GTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESG-RHEKRLDKITKLE 156
           ++  ++ +   +V+I +DH G ++   + + H      + +D G  S D   DYP +     +  + D   G + +GI   G+G G  IA NK++GI AA V     A+LAREHN+ NV+ + GR  SV++   +I+ F +  F  G RH +R+ KI   E
  S:    12 ITNPRRTMSTPRVHIATDHAGLELSAHLIS-HLGDRGYEVIDHGPSSYDPEDDYPAFCIHAAQAAMADTKAGVFALGIVLGGSGNGEQIAANKVEGIRAALVWNLETAKLAREHNDANVVAVGGRQHSVDEATGLIEAFLAEPFSDGERHVRRIGKIAHFE 171
>gi|53802779|ref|YP_112583.1| ribose 5-phosphate isomerase B [Methylococcus capsulatus str. Bath] >gi|53756540|gb|AAU90831.1| ribose 5-phosphate isomerase B [Methylococcus capsulatus str. Bath] (142 aa)
Score = 194, Expect = 7.1e-14, Identities = 49/142 (34%), Positives = 73/142 (51%)
  Q:    11 IKVYIGSDHGGFDMKEKIRN-----NHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           +K+ I SDH GFD KE++R       HE+      VD G +S DE  DYP +     + +   +   GI + G+G G  I  N++KG           A L R HN+ N I +  R  +++   +I++ F S+ FE GRH  R+  I
  S:     1 MKIGIASDHAGFDYKERLRAWLASLGHEV------VDYGCFS-DERTDYPTWIRPCAQAVAAGEVERGIVLGGSGNGEAIVANRVKGCRCGYCFNEETAYLTRWHNDANCIAIGQRIVTLDMAKKIVETFLSTGFEGGRHIPRIVAI 140
>gi|86134789|ref|ZP_01053371.1| ribose 5-phosphate isomerase B [Tenacibaculum sp. MED152] >gi|85821652|gb|EAQ42799.1| ribose 5-phosphate isomerase B [Polaribacter dokdonensis MED152] (144 aa)
Score = 194, Expect = 7.1e-14, Identities = 49/143 (34%), Positives = 79/143 (55%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHEL--LEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKIT 153
           + + IG+DH G + K +I  + E     +L+F   GT + + S+DYPD      + L   K   GI +CG+G G  +  NK +GI AA         L R+HN+ N++T+  RF S++  +  +  F ++ FE GRH  R++KI+
  S:     1 MTIAIGNDHAGTEYKFEIIKHLEEKGYTVLNF---GTDT-NNSMDYPDAIHPTADALESGKAELGIILCGSGNGAQMTANKHQGIRAALCWNNELVALTRQHNDANILTIPARFVSLQQALGFVDVFLNTEFEGGRHANRVNKIS 141
>gi|152967465|ref|YP_001363249.1| ribose-5-phosphate isomerase B [Kineococcus radiotolerans SRS30216] >gi|151361982|gb|ABS04985.1| ribose 5-phosphate isomerase [Kineococcus radiotolerans SRS30216] (162 aa)
Score = 194, Expect = 8.0e-14, Identities = 47/142 (33%), Positives = 76/142 (53%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESG-RHEKRLDKI 152
           ++V++G+DH GF++KE +   H   +  D VD G    D + DYP +  +    +  D GS GI I G+G G  IA N + GI  A       A LAREHN+  V+ +  R  ++E+   +   F ++ F +  RH +R++ +
  S:     1 MRVHVGTDHAGFELKEHLVA-HLREQGHDVVDHGAPVYDAADDYPPFVLRAAAGVAGDPGSLGIVIGGSGNGEQIAANVVPGIRCALAWSVDTARLAREHNDAQVVGIGARMHTLEEATLLADTFLATPFSNDPRHVRRIEML 142
>gi|116252293|ref|YP_768131.1| ribose-5-phosphate isomerase B [Rhizobium leguminosarum bv. viciae 3841] >gi|115256941|emb|CAK08035.1| ribose-5-phosphate isomerase B [Rhizobium leguminosarum bv. viciae 3841] (149 aa)
Score = 194, Expect = 8.2e-14, Identities = 43/145 (29%), Positives = 73/145 (50%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLE 156
           ++ + SDH    +++ I   H + +    VD+G  +  ES  YP + E     +      +GI +CGTG GI +A NK++GI          A + R+HN+ N++++  R       ++I+  F ++ FE GRH  R+  I  LE
  S:     6 RIALSSDHAAIQLRQAIAG-HVVAQGWIAVDIGP-TTPESTHYPQHGEAAARLVASGDCRFGIILCGTGQGIMMAANKVRGIRCGVCADPFSARMIRQHNDANMLSIGVRVVGEGLALDIVDAFLTARFEGGRHATRVGMIEALE 148
>gi|16264105|ref|NP_436897.1| ribose-5-phosphate isomerase B [Sinorhizobium meliloti 1021] >gi|15140230|emb|CAC48757.1| putative ribose-5-phosphate isomerase [Sinorhizobium meliloti 1021] (148 aa)
Score = 193, Expect = 9.3e-14, Identities = 44/148 (29%), Positives = 85/148 (57%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNN-----HELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRH-EKRLDKITKLENK 158
           +++ IGSDH GF +K  I ++     HE+       D G+Y  +  VD+PD A+ +  ++++ K   G+ +CGTG+G  IA NK+KGI AA  +    A  + EH++VNV+ +  +        +++  + ++ F +     +R+ K+ +++ +
  S:     1 MRIVIGSDHAGFHLKATIIDHVTSLGHEVY------DAGSYDAN-PVDFPDIAKMVTSSIIEGKADRGLMVCGTGVGASIAANKVKGIRAAVCHDVHSAHQSVEHDDVNVMCIGAQIVGAWLARDLVAAYLAAEFSTDEDFRRRVRKLAEMDEQ 147
>gi|70699885|gb|AAZ06854.1| ribose 5-phosphate isomerase [Microbacterium arborescens] (181 aa)
Score = 193, Expect = 1.1e-13, Identities = 49/146 (33%), Positives = 82/146 (56%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEI-LDFVDLGTYSGDESVDYPDYAEKIGENLLKDK--GSYGIGIC--GTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFE-SGRHEKRLDKITKLE 156
           ++++I +DH G +   +++  H L E   D VD G    D   DYP +  +  + +++D+  G   +G+   G+G G  IA NK+ G+ AA V     AELAREHN+ NVI +  R  + ++ V  I +F ++ F    RH +R+ ++   E
  S:     1 MRIHIATDHAGLEFSTQLQ--HHLAEAGHDVVDHGPIEYDPLDDYPAFCIRAAQAVVRDQQAGVEALGVVFGGSGNGEQIAANKVHGVRAALVWNIPTAELAREHNDANVIAIGARQHTFDEAVTFIDRFIATPFSGEERHARRIGQLAAYE 150
>gi|86739870|ref|YP_480270.1| ribose-5-phosphate isomerase B [Frankia sp. CcI3] >gi|86566732|gb|ABD10541.1| ribose 5-phosphate isomerase [Frankia sp. CcI3] (162 aa)
Score = 192, Expect = 1.4e-13, Identities = 51/146 (34%), Positives = 76/146 (52%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDF-VDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFE-SGRHEKRLDKITKLE 156
           ++V++GSDH GF +KE +     L+E+    VD G    D   DYP +          + GS GI I G+G G  IA NK+ G+ AA       A LAR+HN+ NV++L  R  +V   +   + F ++ F    RH +RL  ++  E
  S:     1 MRVHLGSDHAGFHLKEALA--ERLVELGHAPVDHGPVEYDPDDDYPPFVLAAAAATAVEPGSMGIVIGGSGNGEAIAANKVAGVRAALAWSEQTATLARQHNDANVLSLGARMYTVTAALTFAEVFLTTPFSGEQRHVRRLRMLSAYE 146
>gi|167342685|ref|ZP_02288615.1| hypothetical protein LmonocyFSL_02673 [Listeria monocytogenes FSL J1-208] (136 aa)
Score = 191, Expect = 1.6e-13, Identities = 46/138 (33%), Positives = 76/138 (55%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKR 148
           +K+ IG D  G+++K+ +   H   + ++F D G++  DE V YP  AEK+   +  +    GI ICGTGIG+ I  NKI GI AA ++ +  AE AR+ N+ +++T+          V ++  +  S F  GR + +
  S:     1 MKIAIGCDEMGYELKQTLIA-HLKEKNIEFTDFGSFE-DEKVLYPSIAEKVALEVKNNDFDRGILICGTGIGMAITANKIHGIRAAQIHDSYSAERARKSNDAHIMTMGALVIGPSLAVSLLDIWLDSDFSGGRSQAK 136
>gi|152979240|ref|YP_001344869.1| ribose 5-phosphate isomerase B [Actinobacillus succinogenes 130Z] >gi|150840963|gb|ABR74934.1| ribose 5-phosphate isomerase B [Actinobacillus succinogenes 130Z] (150 aa)
Score = 191, Expect = 1.9e-13, Identities = 49/148 (33%), Positives = 78/148 (52%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           +K+ IG D   +++K ++    E L I +  D G  +GD ++ YPD AEK+   + + K   GI  CGTGIG+CI  NK+ G+ AA  +    AE +R+ N+  +I    R   VE    ++K +    F  G    +L KI +++ K
  S:     1 MKIAIGCDDAAYNLKIELIKYLETLGI-ECDDFGAGAGDLTL-YPDVAEKVALAVSEGKYERGILTCGTGIGMCITANKVPGVRAAVCHDVFSAERSRKSNDAQIICFGERVIGVELAKSLLKVWLECDFAGGGSTPKLAKIKEIDAK 146
>gi|15603510|ref|NP_246584.1| hypothetical protein PM1645 [Pasteurella multocida subsp. multocida str. Pm70] >gi|12722048|gb|AAK03729.1| RpiA [Pasteurella multocida subsp. multocida str. Pm70] (151 aa)
Score = 190, Expect = 2.3e-13, Identities = 49/148 (33%), Positives = 80/148 (54%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFV-----DLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           +K+ IG D   +++K       EL++ L  +     D G  +GD ++ YP+ AEK+   + K +   GI  CGTGIG+CI  NKI GI AA  +    AE AR+ N+  +I    R   VE    ++K + +  F  G    ++ +I ++++K
  S:     1 MKIAIGCDDAAYNLKV------ELIKFLTSLGIECDDFGAGAGDTTL-YPNVAEKVAIAVAKGEYDRGILTCGTGIGMCITANKIPGIRAAVCHDVFSAERARKSNDAQIICFGERVIGVELAKALLKTWLACDFAGGGSTPKVAQINEIDSK 146
>gi|152969679|ref|YP_001334788.1| ribose-5-phosphate isomerase B [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] >gi|150954528|gb|ABR76558.1| ribose-5-phosphate isomerase B [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] (152 aa)
Score = 190, Expect = 2.3e-13, Identities = 48/146 (32%), Positives = 77/146 (52%)
  Q:    13 VYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDE---SVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           + IG+D   +  ++ I      L I    ++  YS D+   S  YPD A  +  ++ + +   GI ICGTGIG+ I  NK+ G+ AA  + T  AE AR+ NN  +ITL  R    E   +II+ +  S +E G    ++++I   E++
  S:     4 IAIGADDAAYAFRDSIVAYLNGLGI----NVADYSSDKRQGSTVYPDVAHAVAMSIKQGEHERGILICGTGIGMSIVANKVPGVRAAQCHDTFSAERARKSNNAQIITLGARVIGAELGKKIIQAWLESEYEGGGSAPKVERIDYYEHQ 148
>gi|149190854|ref|ZP_01869118.1| ribose-5-phosphate isomerase B [Vibrio shilonii AK1] >gi|148835314|gb|EDL52287.1| ribose-5-phosphate isomerase B [Vibrio shilonii AK1] (148 aa)
Score = 190, Expect = 2.5e-13, Identities = 47/146 (32%), Positives = 78/146 (53%)
  Q:    13 VYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           + IG D    D+KE ++  H   + +++VD G    + S+ YPD A+++   +   K   GI +CGTGIG+ I  NK+ GI AA  + T  AE AR+ N+  +IT+  R    E    I+  +  S F  G    ++++I ++E +
  S:     2 IAIGCDDAAVDLKECLKA-HLAAKGIEYVDYGIDPENASL-YPDIAKEVSLAVSAGKHERGIILCGTGIGVSIVANKVPGIRAALCHDTFSAERARKSNDAQIITMGSRVIGSELAKAILDTWLDSEFSDGPSTPKVNRIKEIEKE 145
>gi|150375896|ref|YP_001312492.1| ribose-5-phosphate isomerase B [Sinorhizobium medicae WSM419] >gi|150030443|gb|ABR62559.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Sinorhizobium medicae WSM419] (148 aa)
Score = 189, Expect = 2.8e-13, Identities = 44/148 (29%), Positives = 83/148 (56%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNN-----HELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRH-EKRLDKITKLENK 158
           +++ IGSDH GF +K  I ++     HE+       D G+Y     VD+PD A+ +  +++  K   G+ +CGTG+G  IA NK+KGI AA  +    A  + EH++VNV+ +  +        +++  + ++ F +     +R+ K+ +++ +
  S:     1 MRIVIGSDHAGFPLKATIIDHIVSLGHEVH------DAGSYD-PSPVDFPDIAKTVTSSIIDGKADRGLMVCGTGVGASIAANKVKGIRAAVCHDVHSAHQSVEHDDVNVMCIGAQIVGAWLAKDLVAAYLAAEFSTDEDFRRRVRKLAEMDEQ 147
>gi|18309308|ref|NP_561242.1| galactose-6-phosphate isomerase subunit LacA [Clostridium perfringens str. 13] >gi|81768111|sp|Q8XNK7|LACA_CLOPE Galactose-6-phosphate isomerase subunit lacA >gi|18143984|dbj|BAB80032.1| galactose-6-phosphate isomerase [Clostridium perfringens str. 13] (142 aa)
Score = 189, Expect = 2.9e-13, Identities = 49/145 (33%), Positives = 83/145 (57%)
  Q:    11 IKVYIGSDHGGFDMKEKIR-----NNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKL 155
           ++V IG+D  G ++K  I+     NN E+++          S + S D+ +    I +++L++KGS GI   G G G  +   KIKGI AA V+    A + REHNN ++IT+  +    E  + I+K+F  + ++ GRH+ R+D + K+
  S:     1 MRVVIGADKEGMELKNMIKCYLLENNFEVID---------KSEEASEDFVESTVAITKDVLENKGSLGIAFDGYGAGSFMVATKIKGIIAAEVSDERSAYMTREHNNSSIITIGSKIVGSELALNIVKEFLEASYDGGRHQIRVDMLNKM 141
>gi|116670954|ref|YP_831887.1| ribose-5-phosphate isomerase B [Arthrobacter sp. FB24] >gi|116611063|gb|ABK03787.1| ribose 5-phosphate isomerase [Arthrobacter sp. FB24] (164 aa)
Score = 189, Expect = 3.1e-13, Identities = 52/146 (35%), Positives = 77/146 (52%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGS----YGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESG-RHEKRLDKITKLEN 157
           +V+I +DH G ++   +   H   +    VD G    D   DYP +       ++ D+ +     GI + G+G G  IA NK+KG+ AA       A LAREHN+ NV+ + GR  SV++  EII+ F    F +  RH +R+ KI   EN
  S:     9 RVHIATDHAGMELSAHLVT-HLTAKGYTVVDHGPKVYDALDDYPSFCINAALAVVADQAAGINALGIVLGGSGNGEQIAANKVKGVRAALAWNLSTATLAREHNDANVVAVGGRQHSVDEATEIIEAFLREPFSNDERHVRRIGKIAAYEN 158
>gi|149197613|ref|ZP_01874663.1| ribose 5-phosphate isomerase B, putative [Lentisphaera araneosa HTCC2155] >gi|149139183|gb|EDM27586.1| ribose 5-phosphate isomerase B, putative [Lentisphaera araneosa HTCC2155] (145 aa)
Score = 188, Expect = 4.3e-13, Identities = 46/146 (31%), Positives = 76/146 (52%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELL--EILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLE 156
           +K+ I SDH GF+  +K+++  E    E+  F       G +S DYPD+     + +   +    I +C  GIG+ +  NK+ GI AA V     A + R+H+  NV+ L     S ++ +  IK +  + FE GRH +R+ K+  L+
  S:     1 MKISIASDHAGFEFNKKLKDYLESQGHEVQSF----GCEGLDSCDYPDFGIPAAKTVSTGEADRAILVCNNGIGMSMLANKLDGILAALVYSEETARMTRQHHGSNVLCLGAAQFSEDELLAFIKAWMETEFEGGRHGRRIGKVQDLD 144
>gi|121609003|ref|YP_996810.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Verminephrobacter eiseniae EF01-2] >gi|121553643|gb|ABM57792.1| ribose-5-phosphate isomerase [Verminephrobacter eiseniae EF01-2] (159 aa)
Score = 187, Expect = 4.4e-13, Identities = 45/148 (30%), Positives = 78/148 (52%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESG-RHEKRLDKITKLENK 158
           +K+ IG D     MK+ ++    L +     D GT+   + V YPD    + + + + +   G+ +CGTGIG+ IA NK+ GI AA  + T  AE A   N+ ++IT+  R   +E    I++ F ++ + +G R + +LD +   E +
  S:     5 MKIAIGCDEAANAMKDCLKAAL-LAQGHQVTDFGTHD-HQPVLYPDIGIAVAQAIARGQAERGLLLCGTGIGMAIAANKVPGIRAAQAHDTYSAERAALSNDAHIITIGARVIGIELAKSIVQTFLAAQYVAGPRSQPKLDALAAHEQR 151
>gi|77956589|ref|ZP_00820678.1| COG0698: Ribose 5-phosphate isomerase RpiB [Yersinia bercovieri ATCC 43970] (151 aa)
Score = 186, Expect = 6.5e-13, Identities = 46/148 (31%), Positives = 73/148 (49%)
  Q:    11 IKVYIGSDHGGFDMKEKI----RNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           + + IG D    DMK +I    +N +     +  VD       E   YPD A ++ + +   K   GI ICGTGIG+ I  NK+ GI AA  +    A+ AR+ NN  +I L  R   VE    ++  +    F+ G   +++++I+  E +
  S:     2 LSIAIGCDDAAIDMKNQILAFLQNKN-----ITVVDYSCDQQREPTIYPDIAVQVAQAIKDGKHERGILICGTGIGMSITANKVLGIRAAQCHDPFSAQRARKSNNAQIICLGARVIGVELAKTLVDTWLECDFDGGSSTEKVERISYYEQR 148
>gi|139438380|ref|ZP_01771896.1| Hypothetical protein COLAER_00886 [Collinsella aerofaciens ATCC 25986] >gi|133775919|gb|EBA39739.1| Hypothetical protein COLAER_00886 [Collinsella aerofaciens ATCC 25986] (142 aa)
Score = 185, Expect = 8.3e-13, Identities = 47/145 (32%), Positives = 77/145 (53%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKL 155
           ++V I SD  G  MKE I+   E+L I D  ++  YS   + D+ D A  + ++LL+ K S G      G+G  +A  KIKG+  AN++    A + REHN   ++T+       E   +I ++F  + +  GRH+ R+D + K+
  S:     1 MRVVIASDADGMSMKESIK---EML-IADGHEVVDYSETPAADFVDSATAVAKDLLEHKDSQGFAFDKYGVGSYMAAVKIKGMVVANISDERSAYMTREHNGSRMVTMGPGVVGTEVAKKIAREFLRAQYAGGRHQIRVDMLNKM 141
>gi|119960820|ref|YP_948119.1| ribose-5-phosphate isomerase B [Arthrobacter aurescens TC1] >gi|119947679|gb|ABM06590.1| ribose 5-phosphate isomerase [Arthrobacter aurescens TC1] (160 aa)
Score = 184, Expect = 1.1e-12, Identities = 51/145 (35%), Positives = 80/145 (55%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDK--GSYGIGIC--GTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESG-RHEKRLDKITKLE 156
           +V+I +DH G ++   + + H   +  + VD G    D   DYP +    G  ++ D+  G + +GI   G+G G  IA NK+ G+ AA       A+LAREHN+ NV+ + GR  +VE+  E+I+ F    F +  RH +R+ KI   E
  S:     5 RVHIATDHAGMELSAHLVS-HLTAKGYEVVDHGPKEYDALDDYPSFCINAGLAVVADQKAGVHALGIVLGGSGNGEQIAANKVNGVRAALAWNLSTAKLAREHNDANVVAVGGRQHTVEEATELIEAFLQEPFSNDERHVRRIGKIAVYE 153
>gi|148272639|ref|YP_001222200.1| ribose-5-phosphate isomerase B [Clavibacter michiganensis subsp. michiganensis NCPPB 382] >gi|147830569|emb|CAN01504.1| putative ribose 5-phosphate isomerase [Clavibacter michiganensis subsp. michiganensis NCPPB 382] (162 aa)
Score = 184, Expect = 1.2e-12, Identities = 48/146 (32%), Positives = 79/146 (54%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDK--GSYGIGIC--GTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFES-GRHEKRLDKITKLE 156
           ++++I +DH G D    +   H      D VD G  S D   DYP +  +    ++ D+  G+  +G+   G+G G  IA NK++G+ AA V     A LAR+HN+ NVI++  R  +VE+    I  F +  F +  RH +R+ ++ + E
  S:     1 MRIHIATDHAGLDFSRYL-TGHLTDAGHDVVDHGPTSYDALDDYPSFCIRAARAVVADQRDGATALGVVFGGSGNGEQIAANKVEGVRAALVWNLSTAVLARQHNDANVISIGARQHTVEEATAFIDAFIAEPFSAEERHARRIAQLAEYE 150
>gi|77962834|ref|ZP_00826650.1| COG0698: Ribose 5-phosphate isomerase RpiB [Yersinia mollaretii ATCC 43969] (151 aa)
Score = 183, Expect = 1.5e-12, Identities = 46/148 (31%), Positives = 73/148 (49%)
  Q:    11 IKVYIGSDHGGFDMKEKI----RNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           + + IG D    DMK +I    +N       +  VD       ES  YPD A ++ + +   K   GI ICGTGIG+ I  NK+ GI AA  +    A+ AR+ NN  +I L  R   +E    ++  +    F+ G   +++++I+  E +
  S:     2 LSIAIGCDDAAIDMKNQILAFLQNRG-----MTVVDYSCDQQRESTLYPDIAIQVAQAIKDGKHERGILICGTGIGMSITANKVLGIRAAQCHDPFSAQRARKSNNAQIICLGARVIGIELAKTLVDTWLDCDFDGGGSTEKVERISYYEQQ 148
>gi|99034645|ref|ZP_01314593.1| hypothetical protein Wendoof_01000590 [Wolbachia endosymbiont of Drosophila willistoni TSC#14030-0811.24] (330 aa)
Score = 182, Expect = 1.9e-12, Identities = 39/85 (45%), Positives = 56/85 (65%)
  Q:    71 SYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHF-ESGRHEKRLDKITKL 155
           +YGI ICGTG+G+    N+ +GIYAA  N    A+LAREH N NV+ L   FT+     +I+K+F  + F +  RH+KRLDK++ +
  S:     1 NYGILICGTGLGMSTVANRFEGIYAALCNSVEIAKLAREHGNANVLCLGAGFTASGLAKDIVKQFLETEFSKESRHKKRLDKLSNI 86
>gi|158339337|ref|YP_001520514.1| ribose 5-phosphate isomerase B [Acaryochloris marina MBIC11017] >gi|158309578|gb|ABW31195.1| ribose 5-phosphate isomerase B [Acaryochloris marina MBIC11017] (161 aa)
Score = 181, Expect = 2.3e-12, Identities = 44/114 (38%), Positives = 63/114 (55%)
  Q:    11 IKVYIGSDHGGFDMKEKIR-----NNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTS 124
           + + IG+D  GFD+KE I+       HEL       D+G  +GD    Y + A  +   +   +   G+ ICGTG+G+ I  NK  G+YAA    T  A+ +R  NN NV+TL G FT+
  S:     1 MNIAIGADCYGFDLKEAIKVYLLSQKHELQ------DVGISAGDSKTPYYETASLVANLVGTQQVERGVLICGTGMGMAIVANKFPGVYAAVCENTHAAKKSRSINNSNVLTLGGMFTT 113
>gi|119947156|ref|YP_944836.1| sugar-phosphate isomerases, RpiB/LacA/LacB family protein [Psychromonas ingrahamii 37] >gi|119865760|gb|ABM05237.1| sugar-phosphate isomerases, RpiB/LacA/LacB family protein [Psychromonas ingrahamii 37] (153 aa)
Score = 181, Expect = 2.5e-12, Identities = 48/148 (32%), Positives = 79/148 (53%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEIL--DFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESG--RHEKRLDKITKLENK 158
           +K+ +  DH GF +KE+++    LLE      +D G  +  E+ D  D+       + K +   GI I G G G  +  NKI G+YAA       A+LAR H+N N++ +  +        EI+  + ++ F SG  +++KR+DKI ++ NK
  S:     1 MKIAMACDHSGFSLKEEVK---MLLENAGHTIIDFGA-NNQEACDLSDHIYPAALAVAKGEAERGIFIDGVGYGSALIANKISGLYAAVCQDPFCAQLARSHSNTNILCIGAKIIGSGIAAEIVNTWMTTEFLSGDAKYKKRVDKIVEIANK 148
>gi|170741319|ref|YP_001769974.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Methylobacterium sp. 4-46] >gi|168195593|gb|ACA17540.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Methylobacterium sp. 4-46] (148 aa)
Score = 180, Expect = 3.3e-12, Identities = 43/146 (29%), Positives = 83/146 (56%)
  Q:    11 IKVYIGSDHGGFDMK----EKIRN-NHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFES-GRHEKRLDKITKLE 156
           +++ IGSDH G+ +K    + +R+  HEL      +D+G++  +  VD+PD A ++   +   +   G+ +CGTG+G  IA NK+KGI AA  +    A    EH++VNV+ +  +        ++I  + ++ F +     +R++K+  ++
  S:     1 MRLVIGSDHAGWMLKGAVIDHVRSLGHEL------IDVGSFD-EHPVDFPDIAREVARKVTSGEADRGLMVCGTGVGASIAANKMKGIRAAVCHDVHSAHQCVEHDDVNVMCIGAQIVGPWLAKDLIAAYLTAEFSTDADFRRRVEKLHAMD 145
>gi|29376375|ref|NP_815529.1| galactose-6-phosphate isomerase subunit LacB [Enterococcus faecalis V583] >gi|81436880|sp|Q833U4|LACB_ENTFA Galactose-6-phosphate isomerase subunit lacB >gi|29343838|gb|AAO81599.1| galactose-6-phosphate isomerase, LacB subunit [Enterococcus faecalis V583] (171 aa)
Score = 180, Expect = 3.3e-12, Identities = 51/148 (34%), Positives = 82/148 (55%)
  Q:    11 IKVYIGSDHGGFDMKEKIRN--NHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFE-SGRHEKRLDKITKLENK 158
           +K+ IG DH   D K  + +    +  EILD   +GTY    +  YP + +K+GE ++ ++   GI ICGTG+GI  A+NK+ GI +A V     A  A+E  N NVI   G+ T      +I   F  +H+  +  +E+ ++KI ++E +
  S:     1 MKIAIGCDHIVTDTKIAVSDFLKAKGYEILD---VGTYDFTRT-HYPIFGKKVGEAVMSNQADLGICICGTGVGITNAVNKVPGIRSALVRDMTTALYAKEELNANVIGFGGKITGEFLICDIAAAFIEAHYHPTEDNEQLIEKINQVEKQ 147
>gi|62423980|ref|ZP_00379133.1| COG0698: Ribose 5-phosphate isomerase RpiB [Brevibacterium linens BL2] (157 aa)
Score = 180, Expect = 3.3e-12, Identities = 48/146 (32%), Positives = 80/146 (54%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGS----YGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFE-SGRHEKRLDKITKLE 156
           +KV++G+DH GF+ KE ++  H      + +D G    D   DYP +     + ++ D+ +     G+ I G+G G  IA NK+KG   A    T  A+LAREHNN  ++++  R  +  +++ I+  F S  F    RHE+R+  + + E
  S:     1 MKVHLGTDHAGFEFKEVLKA-HLGDSGYEVIDHGALEYDALDDYPAFCIAAAQAVVDDQAAGVEALGVVIGGSGNGEQIAANKVKGARTALAWNTDTAKLAREHNNAQIVSVGARQHTEAESIAIVDAFLSEPFSGEERHERRIRIMDEYE 150
>gi|29376376|ref|NP_815530.1| galactose-6-phosphate isomerase subunit LacA [Enterococcus faecalis V583] >gi|81436879|sp|Q833U3|LACA_ENTFA Galactose-6-phosphate isomerase subunit lacA >gi|29343839|gb|AAO81600.1| galactose-6-phosphate isomerase, LacA subunit [Enterococcus faecalis V583] (142 aa)
Score = 179, Expect = 4.8e-12, Identities = 47/145 (32%), Positives = 77/145 (53%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKL 155
           ++V +GSD  G  +K +++  + L E ++ +D    S   S D+ +    +   +LKD  S GI   G G G  +   KIKG+  A ++    A +AREHNN  +IT+  +    E    IIK+F + H+  GRH+ R+D + K+
  S:     1 MRVILGSDLDGIKLKAEMKQ-YLLQEKVEVID---KSESASEDFIEATLAVAHEVLKDTESLGIVFDGYGAGSFMTAAKIKGMIVAELSDERSAYMAREHNNARMITVGAKIVGTELAKNIIKEFLTGHYAGGRHQIRVDMLNKM 141
>gi|28572526|ref|NP_789306.1| ribose-5-phosphate isomerase B [Tropheryma whipplei TW08/27] >gi|28410658|emb|CAD67044.1| ribose 5-phosphate isomerase B [Tropheryma whipplei TW08/27] (155 aa)
Score = 176, Expect = 8.7e-12, Identities = 48/145 (33%), Positives = 73/145 (50%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKG----SYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHF-ESGRHEKRLDKITKLE 156
           +V++ +DH G++  + + N     E    V  G  + D   DYP +     E +++D      S G+ I G+G G  IA NK+KG  AA       A LAR HNN NV+ +  R  + ++   I+  F    F E  RH +R+D I+  E
  S:     4 RVHLATDHAGYEFSKGLLN-FLADEHYQVVHHGAVNCDPEDDYPSFCIAAAEAVVRDITDGIPSLGVVIGGSGNGEQIAANKVKGARAALAWNECTARLARAHNNANVVAIGARMHAHDEGFRIVLAFLREPFSEDSRHIRRIDAISSYE 152
>gi|160933963|ref|ZP_02081350.1| hypothetical protein CLOLEP_02825 [Clostridium leptum DSM 753] >gi|156866636|gb|EDO60008.1| hypothetical protein CLOLEP_02825 [Clostridium leptum DSM 753] (163 aa)
Score = 175, Expect = 1.1e-11, Identities = 40/132 (30%), Positives = 66/132 (50%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESG 143
           ++ IG+D  GF +KE ++  H L    D  D+GT S DE V Y +   ++ + +   K   G+  CGTG+G+ +  NK  G+Y         A+  R  NN NV+ + G     +  +E+ + F ++ F  G
  S:     4 RIIIGADDSGFTLKEAVKE-HLLKNGYDVTDVGTLSLDEPVVYYEVGRRVAKEVADKKFERGLLFCGTGMGVNLVANKFPGVYCGLCESVFAAKKCRIINNCNVLAMGGFIVGPKMGIEMAEAFLNTDFSYG 134
>gi|118406893|gb|AAO39418.2| ribose-5-phosphate isomerase [Mycoplasma hominis] (155 aa)
Score = 175, Expect = 1.4e-11, Identities = 52/146 (35%), Positives = 78/146 (53%)
  Q:    10 KIKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKD------KGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKL 155
           K  V I SDH G+D K  +    E  E  +    G+ + + S  Y D A ++   + KD      K    +  CG+GIGI + LNK KGI AA V    E+ LA+ HNN NV+ + GR     +  +I   + ++ FE GRH +R+ K++ +
  S:     2 KTTVKITSDHAGYDAKINLAKRLEN-EGYNVELFGSKTNNNSDSYADAAIELVNEIHKDGNPDENKNVKYVAFCGSGIGIEMTLNKFKGIRAARVTNENESHLAKLHNNANVLCMGGRLLEGNEVEKIFHSWENTEFEGGRHLERIKKLSSI 152
>gi|28493364|ref|NP_787525.1| ribose-5-phosphate isomerase B [Tropheryma whipplei str. Twist] >gi|28476405|gb|AAO44494.1| ribose 5-phosphate isomerase B [Tropheryma whipplei str. Twist] (155 aa)
Score = 174, Expect = 1.6e-11, Identities = 48/145 (33%), Positives = 73/145 (50%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKG----SYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHF-ESGRHEKRLDKITKLE 156
           +V++ +DH G++  + + N     E    V  G  + D   DYP +     E +++D      S G+ I G+G G  IA NK+KG  AA       A LAR HNN NV+ +  R  + ++   I+  F    F E  RH +R+D I+  E
  S:     4 RVHLATDHAGYEFSKGLLN-FLADEHYQVVHHGAVNCDPEDDYPSFCIAAAEAVVRDITDGIPSLGVVIGGSGNGEQIAANKVKGARAALAWNECTARLARAHNNANVVAIGARMHAHDEGFRIVLAFLREPFSEDSRHIRRIDAISLYE 152
>gi|150397350|ref|YP_001327817.1| ribose-5-phosphate isomerase B [Sinorhizobium medicae WSM419] >gi|150028865|gb|ABR60982.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Sinorhizobium medicae WSM419] (145 aa)
Score = 174, Expect = 1.7e-11, Identities = 49/146 (33%), Positives = 75/146 (51%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVD------YPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFE-SGRHEKRLDKITKLE 156
           +K+ IG+D  G            LL+++    L T SG E  D      Y D +  + + +   +   GI ICGTGIG+CI+ NK+ GI AA  + T  AE A + NN  +IT+  R    E    I+  + +S F+ +G     +D I +L+
  S:     1 MKIAIGADSAG----------KPLLDVIA-AHLATKSGLEVKDLSQSGYYADLSRDLAQTITAGENERGILICGTGIGVCISANKVPGIRAALTHDTYSAERAAKSNNAQIITMGARVIGPELAKSIVDTWLASEFDPNGPSAANVDAIDRLD 142
>gi|160933921|ref|ZP_02081308.1| hypothetical protein CLOLEP_02783 [Clostridium leptum DSM 753] >gi|156866594|gb|EDO59966.1| hypothetical protein CLOLEP_02783 [Clostridium leptum DSM 753] (149 aa)
Score = 173, Expect = 2.2e-11, Identities = 47/148 (31%), Positives = 77/148 (52%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELL--EILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           +K+ IG D  G  +K  I    +LL  E ++  D G    DE V YP+ AE++   +   +   GI ICGTGIG+ +A NK+KGI AA  +     E +R+ N+  ++ +  R    E    ++K + +  F  G    +++ I ++E K
  S:     1 MKIAIGCDEAGCGLKHIII---DLLQKEGIEVTDEGCRD-DEVVLYPNIAERVANIVADGEADRGILICGTGIGMAMAANKVKGIRAAVCHDPFSTERSRKSNDAQIMCMGARVIGPELAKMLVKLWLTCDFAGGGSAPKVEAINQMEEK 146
>gi|119717705|ref|YP_924670.1| ribose-5-phosphate isomerase B [Nocardioides sp. JS614] >gi|119538366|gb|ABL82983.1| ribose 5-phosphate isomerase [Nocardioides sp. JS614] (162 aa)
Score = 173, Expect = 2.4e-11, Identities = 48/147 (32%), Positives = 80/147 (54%)
  Q:    11 IKVYIGSDHGGFDMKEKIR---NNHELLEILDFVDLGTYSGDESVDYPDYA----EKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFE-SGRHEKRLDKITKLEN 157
           ++V++G DH G D+K+ +     +H      + VD G ++ D   DYP +       + E     + S G+ I G+G G  +A NK+ GI  A V     A LAR+HN+ NV+++ GR  S+ED    ++ F +  F    RH +R+ ++   E+
  S:     1 MRVHLGCDHAGLDLKDHLSRWLTDHGY----EPVDHGPFAYDALDDYPVFCLRAAAAVAEERAAGRDSLGVVIGGSGNGEQMAANKVHGIRCALVWSEETAVLARQHNDANVVSVGGRMHSLEDMTRFVEIFLAEPFSGEERHVRRIGQLAAYES 151
>gi|16123503|ref|NP_406816.1| ribose-5-phosphate isomerase B [Yersinia pestis CO92] >gi|22124748|ref|NP_668171.1| ribose-5-phosphate isomerase B [Yersinia pestis KIM] >gi|45440191|ref|NP_991730.1| ribose-5-phosphate isomerase B [Yersinia pestis biovar Microtus str. 91001] >gi|51595129|ref|YP_069320.1| ribose-5-phosphate isomerase B [Yersinia pseudotuberculosis IP 32953] >gi|108808782|ref|YP_652698.1| ribose-5-phosphate isomerase B [Yersinia pestis Antiqua] >gi|108810906|ref|YP_646673.1| ribose-5-phosphate isomerase B [Yersinia pestis Nepal516] >gi|145600265|ref|YP_001164341.1| ribose-5-phosphate isomerase B [Yersinia pestis Pestoides F] >gi|153950679|ref|YP_001402246.1| ribose-5-phosphate isomerase B [Yersinia pseudotuberculosis IP 31758] >gi|153997603|ref|ZP_02022703.1| ribose 5-phosphate isomerase B [Yersinia pestis CA88-4125] >gi|162420741|ref|YP_001605516.1| ribose-5-phosphate isomerase B [Yersinia pestis Angola] >gi|165925839|ref|ZP_02221671.1| ribose 5-phosphate isomerase B [Yersinia pestis biovar Orientalis str. F1991016] >gi|165936740|ref|ZP_02225307.1| ribose 5-phosphate isomerase B [Yersinia pestis biovar Orientalis str. IP275] >gi|166010133|ref|ZP_02231031.1| ribose 5-phosphate isomerase B [Yersinia pestis biovar Antiqua str. E1979001] >gi|166212918|ref|ZP_02238953.1| ribose 5-phosphate isomerase B [Yersinia pestis biovar Antiqua str. B42003004] >gi|167399243|ref|ZP_02304767.1| ribose 5-phosphate isomerase B [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167421636|ref|ZP_02313389.1| ribose 5-phosphate isomerase B [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167423807|ref|ZP_02315560.1| ribose 5-phosphate isomerase B [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167469367|ref|ZP_02334071.1| ribose 5-phosphate isomerase B [Yersinia pestis FV-1] >gi|170025637|ref|YP_001722142.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Yersinia pseudotuberculosis YPIII] >gi|186894142|ref|YP_001871254.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Yersinia pseudotuberculosis PB1/+] >gi|21957567|gb|AAM84422.1|AE013686_5 ribose 5-phosphate isomerase B [Yersinia pestis KIM] >gi|45435047|gb|AAS60607.1| ribose 5-phosphate isomerase B [Yersinia pestis biovar Microtus str. 91001] >gi|51588411|emb|CAH20019.1| ribose 5-phosphate isomerase B, also acts on allose (allose 6-phosphate isomerase) [Yersinia pseudotuberculosis IP 32953] >gi|108774554|gb|ABG17073.1| ribose-5-phosphate isomerase [Yersinia pestis Nepal516] >gi|108780695|gb|ABG14753.1| ribose-5-phosphate isomerase [Yersinia pestis Antiqua] >gi|115348982|emb|CAL21942.1| ribose 5-phosphate isomerase B [Yersinia pestis CO92] >gi|145211961|gb|ABP41368.1| ribose-5-phosphate isomerase [Yersinia pestis Pestoides F] >gi|149289240|gb|EDM39320.1| ribose 5-phosphate isomerase B [Yersinia pestis CA88-4125] >gi|152962174|gb|ABS49635.1| ribose 5-phosphate isomerase B [Yersinia pseudotuberculosis IP 31758] >gi|162353556|gb|ABX87504.1| ribose 5-phosphate isomerase B [Yersinia pestis Angola] >gi|165915389|gb|EDR33999.1| ribose 5-phosphate isomerase B [Yersinia pestis biovar Orientalis str. IP275] >gi|165922451|gb|EDR39628.1| ribose 5-phosphate isomerase B [Yersinia pestis biovar Orientalis str. F1991016] >gi|165991040|gb|EDR43341.1| ribose 5-phosphate isomerase B [Yersinia pestis biovar Antiqua str. E1979001] >gi|166205705|gb|EDR50185.1| ribose 5-phosphate isomerase B [Yersinia pestis biovar Antiqua str. B42003004] >gi|166960555|gb|EDR56576.1| ribose 5-phosphate isomerase B [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167051747|gb|EDR63155.1| ribose 5-phosphate isomerase B [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167057977|gb|EDR67723.1| ribose 5-phosphate isomerase B [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|169752171|gb|ACA69689.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Yersinia pseudotuberculosis YPIII] >gi|186697168|gb|ACC87797.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Yersinia pseudotuberculosis PB1/+] (151 aa)
Score = 173, Expect = 2.4e-11, Identities = 45/146 (30%), Positives = 71/146 (48%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLE 156
           + + IG D    +MK +I    +   I   VD       E   YPD A ++   +   K   GI ICGTGIG+ I+ NK+ G+ AA  + T  A+ AR+ NN  +I L  R    E    +I+ +  + F+ G   +++++I   E
  S:     2 LSIAIGCDDAAIEMKNQIVIFLQSKNI-TVVDYSCDQHQEPTMYPDIAIQVALAIKAGKHERGILICGTGIGMSISANKVFGVRAAQCHDTFSAQRARKSNNAQIICLGARVIGPELAKTLIEAWLDAEFDGGGSTEKVERIRYYE 146
>gi|146318696|ref|YP_001198408.1| galactose-6-phosphate isomerase subunit LacB [Streptococcus suis 05ZYH33] >gi|146320904|ref|YP_001200615.1| galactose-6-phosphate isomerase subunit LacB [Streptococcus suis 98HAH33] >gi|166987728|sp|A4W1H6|LACB_STRS2 Galactose-6-phosphate isomerase subunit lacB >gi|166987730|sp|A4VV69|LACB_STRSY Galactose-6-phosphate isomerase subunit lacB >gi|145689502|gb|ABP90008.1| Ribose 5-phosphate isomerase RpiB [Streptococcus suis 05ZYH33] >gi|145691710|gb|ABP92215.1| Ribose 5-phosphate isomerase RpiB [Streptococcus suis 98HAH33] (171 aa)
Score = 172, Expect = 2.5e-11, Identities = 53/146 (36%), Positives = 79/146 (54%)
  Q:    11 IKVYIGSDHGGFDMKEKIRN----NHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRL-DKITKLE 156
           +K+ IG DH      EKI       ++  E+LDF   GTY  +    YP + +K+GE ++  +   GI ICGTG+GI  A+NK+ G+ +A V     A  A+E  N NVI   G+ T      +II+ F  + ++     KRL +KI  +E
  S:     1 MKIAIGCDH--IVTYEKIAVVDYLKNQGYEVLDF---GTYD-NVRTHYPIFGKKVGEAVVSGQADLGICICGTGVGINNAVNKVPGVRSALVRDMTSALYAKEELNANVIGFGGKITGELLMCDIIEAFIKAEYKPTEENKRLIEKIAAVE 145
>gi|82751792|ref|YP_417533.1| galactose-6-phosphate isomerase subunit LacB [Staphylococcus aureus RF122] >gi|123549303|sp|Q2YYJ4|LACB_STAAB Galactose-6-phosphate isomerase subunit lacB >gi|82657323|emb|CAI81764.1| galactose-6-phosphate isomerase subunit [Staphylococcus aureus RF122] (171 aa)
Score = 172, Expect = 2.6e-11, Identities = 49/148 (33%), Positives = 77/148 (52%)
  Q:    11 IKVYIGSDHGGFDMKEKIR-----NNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRL-DKITKLENK 158
           +K+ +G DH   D K ++        HE+      +D+GTY    +  YP + +K+GE ++      G+ ICGTG+GI  A+NK+ G+ +A V     A  A+E  N NVI   GR        +II  F ++ ++     K+L  KI  LE +
  S:     1 MKIALGCDHIVTDTKMRVSEFLKSKGHEV------IDVGTYDFTRT-HYPIFGKKVGEQVVSGNADLGVCICGTGVGINNAVNKVPGVRSALVRDMTSALYAKEELNANVIGFGGRIIGELLMCDIIDAFINAEYKPTEENKKLIAKIKHLETR 147
>gi|94991027|ref|YP_599127.1| galactose-6-phosphate isomerase subunit LacB [Streptococcus pyogenes MGAS10270] >gi|94544535|gb|ABF34583.1| Galactose-6-phosphate isomerase lacB subunit [Streptococcus pyogenes MGAS10270] (172 aa)
Score = 172, Expect = 2.7e-11, Identities = 50/147 (34%), Positives = 80/147 (54%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHF-ESGRHEKRLDKITKLEN 157
           +K+ IG DH   + K  + +  +  +  D +D GTY    +  YP + +K+GE ++  +   G+ ICGTG+GI  A+NK+ GI +A V     A  A+E  N NVI  SG+ T      +II  F  + + E+  ++K + KI  LE+
  S:     2 MKIAIGCDHIVTNEKMAVSDFLKS-KGYDVIDCGTYDHTRT-HYPIFGKKVGEAVVNGQADLGVCICGTGVGINNAVNKVPGIRSALVRDMTTALYAKEELNANVIGFSGKITGELLMCDIIDAFIKAEYKETEENKKLIAKIAHLES 147
>gi|157149736|ref|YP_001450804.1| galactose-6-phosphate isomerase subunit LacB [Streptococcus gordonii str. Challis substr. CH1] >gi|157074530|gb|ABV09213.1| galactose-6-phosphate isomerase, LacB subunit [Streptococcus gordonii str. Challis substr. CH1] (171 aa)
Score = 171, Expect = 3.5e-11, Identities = 49/147 (33%), Positives = 80/147 (54%)
  Q:    11 IKVYIGSDHGGFDMKEKIRN--NHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLEN 157
           +K+ IG DH   + K  + +    +  E+LDF   GTY    +  YP + +K+GE ++  +   G+ ICGTG+GI  A+NK+ G+ +A V     A  A+E  N NVI   G+ T      +II+ F ++ ++     K+L  I K+E+
  S:     1 MKIAIGCDHIVTNEKMAVSDFLKSKGYEVLDF---GTYDHTRT-HYPIFGKKVGEAVVSGQADLGVCICGTGVGINNAVNKVPGVRSALVRDMTTALYAKEELNANVIGFGGKITGELLMCDIIEAFINAEYKPSEENKKL--IAKIEH 143
>gi|19746612|ref|NP_607748.1| galactose-6-phosphate isomerase subunit LacB [Streptococcus pyogenes MGAS8232] >gi|81632550|sp|Q8NZV7|LACB1_STRP8 Galactose-6-phosphate isomerase subunit lacB 1 >gi|19748830|gb|AAL98247.1| putative galactose-6-phosphate isomerase [Streptococcus pyogenes MGAS8232] (171 aa)
Score = 171, Expect = 3.7e-11, Identities = 49/147 (33%), Positives = 80/147 (54%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHF-ESGRHEKRLDKITKLEN 157
           +K+ IG DH   + K  + +  +  +  D +D GTY    +  YP + +K+GE ++ ++   G+ ICGTG+GI  A+NK+ GI +A V     A  A+E  N NVI   G+ T      +II  F  + + E+  ++K + KI  LE+
  S:     1 MKIAIGCDHIVTNEKMAVSDFLKS-KGYDVIDCGTYDHTRT-HYPIFGKKVGEAVVNEQADLGVCICGTGVGINNAVNKVPGIRSALVRDMTTALYAKEELNANVIGFGGKITGELLMCDIIDAFIKAEYKETEENKKLIAKIAHLES 146
>gi|81096097|ref|ZP_00874447.1| Ribose/galactose isomerase:Galactose-6-phosphate isomerase LacB subunit [Streptococcus suis 89/1591] >gi|80977876|gb|EAP41409.1| Ribose/galactose isomerase:Galactose-6-phosphate isomerase LacB subunit [Streptococcus suis 89/1591] (171 aa)
Score = 171, Expect = 4.0e-11, Identities = 53/146 (36%), Positives = 78/146 (53%)
  Q:    11 IKVYIGSDHGGFDMKEKIRN----NHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRL-DKITKLE 156
           +K+ IG DH      EKI       ++  E+LDF   GTY  +    YP + +K+GE +   +   GI ICGTG+GI  A+NK+ G+ +A V     A  A+E  N NVI   G+ T      +II+ F  + ++     KRL +KI  +E
  S:     1 MKIAIGCDH--IVTYEKIAVVDYLKNQGYEVLDF---GTYD-NVRTHYPIFGKKVGEAVASGQADLGICICGTGVGINNAVNKVPGVRSALVRDMTSALYAKEELNANVIGFGGKITGELLMCDIIEAFIKAEYKPTEANKRLIEKIAAVE 145
>gi|15925184|ref|NP_372718.1| galactose-6-phosphate isomerase subunit LacB [Staphylococcus aureus subsp. aureus Mu50] >gi|15927774|ref|NP_375307.1| galactose-6-phosphate isomerase subunit LacB [Staphylococcus aureus subsp. aureus N315] >gi|148268639|ref|YP_001247582.1| galactose-6-phosphate isomerase subunit LacB [Staphylococcus aureus subsp. aureus JH9] >gi|150394704|ref|YP_001317379.1| galactose-6-phosphate isomerase subunit LacB [Staphylococcus aureus subsp. aureus JH1] >gi|156980509|ref|YP_001442768.1| galactose-6-phosphate isomerase subunit LacB [Staphylococcus aureus subsp. aureus Mu3] >gi|166987724|sp|A7X578|LACB_STAA1 Galactose-6-phosphate isomerase subunit lacB >gi|189046411|sp|A6U3S4|LACB_STAA2 Galactose-6-phosphate isomerase subunit lacB >gi|189046412|sp|A5IUY3|LACB_STAA9 Galactose-6-phosphate isomerase subunit lacB >gi|54037706|sp|P65647|LACB_STAAN Galactose-6-phosphate isomerase subunit lacB >gi|54041526|sp|P65646|LACB_STAAM Galactose-6-phosphate isomerase subunit lacB >gi|13701994|dbj|BAB43286.1| galactose-6-phosphate isomerase LacB subunit [Staphylococcus aureus subsp. aureus N315] >gi|14247967|dbj|BAB58356.1| galactose-6-phosphate isomerase LacB subunit [Staphylococcus aureus subsp. aureus Mu50] >gi|147741708|gb|ABQ50006.1| galactose-6-phosphate isomerase lacB subunit [Staphylococcus aureus subsp. aureus JH9] >gi|149947156|gb|ABR53092.1| galactose-6-phosphate isomerase, LacB subunit [Staphylococcus aureus subsp. aureus JH1] >gi|156722644|dbj|BAF79061.1| galactose-6-phosphate isomerase LacB subunit [Staphylococcus aureus subsp. aureus Mu3] (171 aa)
Score = 171, Expect = 4.0e-11, Identities = 49/146 (33%), Positives = 77/146 (52%)
  Q:    11 IKVYIGSDHGGFDMKEKIR-----NNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRL-DKITKLE 156
           +K+ +G DH   D K ++        HE+      +D+GTY    +  YP + +K+GE ++      G+ ICGTG+GI  A+NK+ G+ +A V     A  A+E  N NVI   GR        +II  F ++ +++    K+L  KI  LE
  S:     1 MKIALGCDHIVTDTKMRVSEFLKSKGHEV------IDVGTYDFTRT-HYPIFGKKVGEQVVSGNADLGVCICGTGVGINNAVNKVPGVRSALVRDMTSALYAKEELNANVIGFGGRIIGELLMCDIIDAFINAEYKATEENKKLIAKIKHLE 145
>gi|21283849|ref|NP_646937.1| galactose-6-phosphate isomerase subunit LacB [Staphylococcus aureus subsp. aureus MW2] >gi|49484414|ref|YP_041638.1| galactose-6-phosphate isomerase subunit LacB [Staphylococcus aureus subsp. aureus MRSA252] >gi|49486983|ref|YP_044204.1| galactose-6-phosphate isomerase subunit LacB [Staphylococcus aureus subsp. aureus MSSA476] >gi|57650781|ref|YP_186996.1| galactose-6-phosphate isomerase subunit LacB [Staphylococcus aureus subsp. aureus COL] >gi|87161725|ref|YP_494790.1| galactose-6-phosphate isomerase subunit LacB [Staphylococcus aureus subsp. aureus USA300] >gi|88196106|ref|YP_500921.1| galactose-6-phosphate isomerase subunit LacB [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|151222310|ref|YP_001333132.1| galactose-6-phosphate isomerase subunit LacB [Staphylococcus aureus subsp. aureus str. Newman] >gi|161510401|ref|YP_001576060.1| galactose-6-phosphate isomerase subunit LacB [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|168726977|ref|ZP_02759254.1| galactose-6-phosphate isomerase LacB subunit [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|123484839|sp|Q2FET8|LACB_STAA3 Galactose-6-phosphate isomerase subunit lacB >gi|172048999|sp|A6QJ38|LACB_STAAE Galactose-6-phosphate isomerase subunit lacB >gi|189046413|sp|A8YYG1|LACB_STAAT Galactose-6-phosphate isomerase subunit lacB >gi|56748951|sp|Q6G7C0|LACB_STAAS Galactose-6-phosphate isomerase subunit lacB >gi|56749005|sp|Q6GEN5|LACB_STAAR Galactose-6-phosphate isomerase subunit lacB >gi|56749987|sp|P68797|LACB_STAAW Galactose-6-phosphate isomerase subunit lacB >gi|81693995|sp|Q5HE11|LACB_STAAC Galactose-6-phosphate isomerase subunit lacB >gi|110810403|sp|Q2G2R0|LACB_STAA8 Galactose-6-phosphate isomerase subunit lacB >gi|110810404|sp|P0C1R6|LACB_STAAU Galactose-6-phosphate isomerase subunit lacB >gi|153033|gb|AAA26641.1| tagatose 6-phosphate isomerase >gi|21205291|dbj|BAB95985.1| galactose-6-phosphate isomerase LacB subunit [Staphylococcus aureus subsp. aureus MW2] >gi|49242543|emb|CAG41263.1| galactose-6-phosphate isomerase LacB subunit [Staphylococcus aureus subsp. aureus MRSA252] >gi|49245426|emb|CAG43903.1| galactose-6-phosphate isomerase LacB subunit [Staphylococcus aureus subsp. aureus MSSA476] >gi|57284967|gb|AAW37061.1| galactose-6-phosphate isomerase, LacB subunit [Staphylococcus aureus subsp. aureus COL] >gi|87127699|gb|ABD22213.1| galactose-6-phosphate isomerase [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|87203664|gb|ABD31474.1| galactose-6-phosphate isomerase, LacB subunit [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|150375110|dbj|BAF68370.1| galactose-6-phosphate isomerase LacB subunit [Staphylococcus aureus subsp. aureus str. Newman] >gi|160369210|gb|ABX30181.1| galactose-6-phosphate isomerase LacB subunit [Staphylococcus aureus subsp. aureus USA300_TCH1516] (171 aa)
Score = 170, Expect = 5.1e-11, Identities = 49/146 (33%), Positives = 76/146 (52%)
  Q:    11 IKVYIGSDHGGFDMKEKIR-----NNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRL-DKITKLE 156
           +K+ +G DH   D K ++        HE+      +D+GTY    +  YP + +K+GE ++      G+ ICGTG+GI  A+NK+ G+ +A V     A  A+E  N NVI   GR        +II  F ++ ++     K+L  KI  LE
  S:     1 MKIALGCDHIVTDTKMRVSEFLKSKGHEV------IDVGTYDFTRT-HYPIFGKKVGEQVVSGNADLGVCICGTGVGINNAVNKVPGVRSALVRDMTSALYAKEELNANVIGFGGRIIGELLMCDIIDAFINAEYKPTEENKKLIAKIKHLE 145
>gi|149026438|ref|ZP_01836575.1| galactose-6-phosphate isomerase subunit LacB [Streptococcus pneumoniae SP23-BS72] >gi|168486514|ref|ZP_02711022.1| galactose-6-phosphate isomerase, LacB subunit [Streptococcus pneumoniae CDC1087-00] >gi|147929269|gb|EDK80270.1| galactose-6-phosphate isomerase subunit LacB [Streptococcus pneumoniae SP23-BS72] >gi|183570461|gb|EDT90989.1| galactose-6-phosphate isomerase, LacB subunit [Streptococcus pneumoniae CDC1087-00] (171 aa)
Score = 170, Expect = 5.3e-11, Identities = 50/147 (34%), Positives = 77/147 (52%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEI--LDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRL-DKITKLEN 157
           +++ IG DH   D K  +    E L+    + +D GTY    +  YP + +K+GE +   +   G+ ICGTG+GI  A+NK+ GI +A V     A  A+E  N NVI   G+ T      +II+ F  + ++     K+L  KI  LE+
  S:     1 MRIAIGCDHIVTDEKMAVS---EFLKSKGYEVIDFGTYDHTRT-HYPIFGKKVGEAVTSGQADLGVCICGTGVGINNAVNKVPGIRSALVRDMTTALYAKEQLNANVIGFGGKITGELLMCDIIEAFIHAEYKPSEENKKLIAKIEHLES 146
>gi|15894013|ref|NP_347362.1| ribose 5-phosphate isomerase RpiB [Clostridium acetobutylicum ATCC 824] >gi|15023606|gb|AAK78702.1|AE007587_10 Ribose 5-phosphate isomerase RpiB [Clostridium acetobutylicum ATCC 824] (156 aa)
Score = 169, Expect = 6.2e-11, Identities = 48/148 (32%), Positives = 79/148 (53%)
  Q:    11 IKVYIGSDHGGFDMKEKIRN-----NHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHF--ESGRHEKRLDKITKLENK 158
           +K+ + SDH GF +KE+++       HE+L      D GT++ + S    DY      +L + K   GI I G G G  +  NKI G+YAA       A+LAR H+N N + +  +       +E I  + ++ F  +  +++ R+DK+TK+  K
  S:     1 MKIVVASDHAGFSLKEEVKKFLEDGGHEIL------DFGTHNTNPS-HLSDYIYPAALSLSEGKAERGIFIDGVGYGSALIANKIYGVYAAVCQDPFCAKLARSHSNTNALCIGAKIIGSAIALETINTWMNTDFLGDIEKYKIRVDKVTKISEK 148
>gi|18309309|ref|NP_561243.1| galactose-6-phosphate isomerase subunit LacB [Clostridium perfringens str. 13] >gi|81768110|sp|Q8XNK6|LACB_CLOPE Galactose-6-phosphate isomerase subunit lacB >gi|18143985|dbj|BAB80033.1| galactose-6-phosphate isomerase [Clostridium perfringens str. 13] (171 aa)
Score = 169, Expect = 6.5e-11, Identities = 50/146 (34%), Positives = 80/146 (54%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHF-ESGRHEKRLDKITKLE 156
           +K+ IG DH   D K  + +  +  +  D +D+GTY    +  YP + +K+GE +   +   G+ ICGTG+GI  A+NK+ GI +A V     A  A+E  N NVI   G+ T      +II+ F  + + E+  ++K ++KI  LE
  S:     1 MKIAIGCDHIVTDTKIAVSDFLKA-KGYDVLDVGTYDFTRT-HYPIFGKKVGEAVASGEADLGVCICGTGVGINNAVNKVPGIRSALVRDMTTAIYAKEQLNANVIGFGGKITGEFLMCDIIEAFIKADYIENEENKKIINKINSLE 145
>gi|50409363|ref|XP_456866.1| hypothetical protein DEHA0A12771g [Debaryomyces hansenii CBS767] >gi|49652530|emb|CAG84841.1| unnamed protein product [Debaryomyces hansenii CBS767] (156 aa)
Score = 169, Expect = 6.7e-11, Identities = 41/148 (27%), Positives = 74/148 (50%)
  Q:    10 KIKVYIGSDHGGFDMKEKIRNNHEL-LEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLEN 157
           K+++ +G D  G++ KE+I+ + E    +   +D+G  S      YP       E + K +    I ICGTG+G+ I+ NK+KGI A   + +   E +   NN  V+ +  R   +E    ++K++ +  F+      +  K+T +EN
  S:     5 KLRIVVGCDQAGYEYKEQIKKDLESNTNVEKVIDVGVDSNGSKTAYPLIGIDAAEKIAKGEAHRAILICGTGLGVAISANKVKGIRAVTAHDSFSVERSILSNNCQVLCMGQRVIGLELARRLVKEWLTYAFDQTSASAK--KVTAIEN 151
>gi|15903118|ref|NP_358668.1| galactose-6-phosphate isomerase subunit LacB [Streptococcus pneumoniae R6] >gi|116517129|ref|YP_816526.1| galactose-6-phosphate isomerase subunit LacB [Streptococcus pneumoniae D39] >gi|149004143|ref|ZP_01828946.1| galactose-6-phosphate isomerase subunit LacB [Streptococcus pneumoniae SP14-BS69] >gi|149008148|ref|ZP_01831667.1| galactose-6-phosphate isomerase, LacB subunit [Streptococcus pneumoniae SP18-BS74] >gi|149013330|ref|ZP_01834061.1| galactose-6-phosphate isomerase, LacB subunit [Streptococcus pneumoniae SP19-BS75] >gi|168491113|ref|ZP_02715256.1| galactose-6-phosphate isomerase, LacB subunit [Streptococcus pneumoniae CDC0288-04] >gi|169834106|ref|YP_001694631.1| galactose-6-phosphate isomerase, LacB subunit [Streptococcus pneumoniae Hungary19A-6] >gi|182684076|ref|YP_001835823.1| galactose-6-phosphate isomerase [Streptococcus pneumoniae CGSP14] >gi|122278588|sp|Q04KC2|LACB_STRP2 Galactose-6-phosphate isomerase subunit lacB >gi|81449668|sp|Q8DPP0|LACB_STRR6 Galactose-6-phosphate isomerase subunit lacB >gi|15458697|gb|AAK99878.1| Galactose-6-phosphate isomerase LacB subunit [Streptococcus pneumoniae R6] >gi|116077705|gb|ABJ55425.1| galactose-6-phosphate isomerase, LacB subunit [Streptococcus pneumoniae D39] >gi|147757876|gb|EDK64886.1| galactose-6-phosphate isomerase subunit LacB [Streptococcus pneumoniae SP14-BS69] >gi|147760387|gb|EDK67366.1| galactose-6-phosphate isomerase, LacB subunit [Streptococcus pneumoniae SP18-BS74] >gi|147762920|gb|EDK69867.1| galactose-6-phosphate isomerase, LacB subunit [Streptococcus pneumoniae SP19-BS75] >gi|168996608|gb|ACA37220.1| galactose-6-phosphate isomerase, LacB subunit [Streptococcus pneumoniae Hungary19A-6] >gi|182629410|gb|ACB90358.1| galactose-6-phosphate isomerase [Streptococcus pneumoniae CGSP14] >gi|183574400|gb|EDT94928.1| galactose-6-phosphate isomerase, LacB subunit [Streptococcus pneumoniae CDC0288-04] (171 aa)
Score = 169, Expect = 7.0e-11, Identities = 49/147 (33%), Positives = 77/147 (52%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEI--LDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRL-DKITKLEN 157
           +++ IG DH   D K  +    E L+    + +D GTY    +  YP + +K+GE +   +   G+ ICGTG+GI  A+NK+ G+ +A V     A  A+E  N NVI   G+ T      +II+ F  + ++     K+L  KI  LE+
  S:     1 MRIAIGCDHIVTDEKMAVS---EFLKSKGYEVIDFGTYDHTRT-HYPIFGKKVGEAVTSGQADLGVCICGTGVGINNAVNKVPGVRSALVRDMTTALYAKEQLNANVIGFGGKITGELLMCDIIEAFIHAEYKPSEENKKLIAKIEHLES 146
>gi|157149701|ref|YP_001450797.1| galactose-6-phosphate isomerase subunit LacB [Streptococcus gordonii str. Challis substr. CH1] >gi|157074495|gb|ABV09178.1| galactose-6-phosphate isomerase, LacB subunit [Streptococcus gordonii str. Challis substr. CH1] (171 aa)
Score = 168, Expect = 7.1e-11, Identities = 49/147 (33%), Positives = 79/147 (53%)
  Q:    11 IKVYIGSDHGGFDMKEKIRN--NHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLEN 157
           +K+ IG DH   + K  + +    +  E+LDF   GTY    +  YP + +K+GE +   +   G+ ICGTG+GI  A+NK+ G+ +A V     A  A+E  N NVI   G+ T      +II+ F ++ ++     K+L  I K+E+
  S:     1 MKIAIGCDHIVTNEKMAVSDFLKSKGYEVLDF---GTYDHTRT-HYPIFGKKVGEAVTSGQADLGVCICGTGVGINNAVNKVPGVRSALVRDMTSALYAKEELNANVIGFGGKITGELLMCDIIEAFINAEYKPTEENKKL--IAKIEH 143
>gi|148985798|ref|ZP_01818926.1| galactose-6-phosphate isomerase subunit LacB [Streptococcus pneumoniae SP3-BS71] >gi|147922102|gb|EDK73225.1| galactose-6-phosphate isomerase subunit LacB [Streptococcus pneumoniae SP3-BS71] (171 aa)
Score = 168, Expect = 7.2e-11, Identities = 48/147 (32%), Positives = 77/147 (52%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEI--LDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLEN 157
           +++ IG DH   D K  +    E L+    + +D GTY    +  YP + +K+GE +   +   G+ ICGTG+GI  A+NK+ G+ +A V     A  A+E  N NVI   G+ T      +II+ F  + ++     K+L  I K+E+
  S:     1 MRIAIGCDHIVTDEKMAVS---EFLKSKGYEVIDFGTYDHTRT-HYPIFGKKVGEAVTSGQADLGVCICGTGVGINNAVNKVPGVRSALVRDMTTALYAKEQLNANVIGFGGKITGELLMCDIIEAFIHAEYKPSEENKKL--IAKIEH 143
>gi|116326614|ref|YP_796534.1| galactose-6-phosphate isomerase subunit LacB [Lactococcus lactis subsp. cremoris SK11] >gi|125915|sp|P23495|LACB_LACLA Galactose-6-phosphate isomerase subunit lacB >gi|149394|gb|AAA25169.1| lacB >gi|149407|gb|AAA25178.1| galactose 6-P isomerase [Lactococcus lactis] >gi|76574898|gb|ABA47368.1| galactose-6-phosphate isomerase lacB subunit [Lactococcus lactis] >gi|116108982|gb|ABJ74103.1| galactose-6-phosphate isomerase lacB subunit [Lactococcus lactis subsp. cremoris SK11] (171 aa)
Score = 168, Expect = 7.3e-11, Identities = 50/147 (34%), Positives = 78/147 (53%)
  Q:    11 IKVYIGSDHGGFDMKEKIRN--NHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLEN 157
           +++ IG DH   D+K  +      +  E+LDF   GTY    +  YP Y +K+GE ++  +   G+ ICGTG+GI  A+NK+ G+ +A V     A  A+E  N NVI   G  T      +II+ F  + ++     K+L  I K+E+
  S:     1 MRIAIGCDHIVTDVKMAVSEFLKSKGYEVLDF---GTYDHVRT-HYPIYGKKVGEAVVSGQADLGVCICGTGVGINNAVNKVPGVRSALVRDMTSALYAKEELNANVIGFGGMITGGLLMNDIIEAFIEAEYKPTEENKKL--IAKIEH 143
>gi|150383798|ref|ZP_01922512.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Victivallis vadensis ATCC BAA-548] >gi|150259775|gb|EDM97004.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Victivallis vadensis ATCC BAA-548] (572 aa)
Score = 168, Expect = 7.8e-11, Identities = 44/144 (30%), Positives = 71/144 (49%)
  Q:     9 KKIKVYIGSDHGGFDMKEKIRNNHELLEILD-----FVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESG-RHEKRLDKI 152
           K +KV I +DHGGF  K       EL   L+      +D G +  ++  DYPD+       + + +    I +C +G+G+ I  N+  G+ AA       A+ +R HN  NV+ L G          +++ +FS+ F    RH +RL K+
  S:    10 KSLKVAIATDHGGFAQKP------ELAAFLEAKGCKVIDCGPFELNQGDDYPDFGAPAARAVARGEADCAILVCRSGVGMGIVANRFHGVRAAIARDAEVAKKSRVHNCSNVLVLPGDDLDFAAMKPVVEAWFSTPFSGDERHVRRLAKV 153
>gi|148999053|ref|ZP_01826485.1| galactose-6-phosphate isomerase subunit LacB [Streptococcus pneumoniae SP11-BS70] >gi|168577261|ref|ZP_02723055.1| galactose-6-phosphate isomerase, LacB subunit [Streptococcus pneumoniae MLV-016] >gi|147755123|gb|EDK62178.1| galactose-6-phosphate isomerase subunit LacB [Streptococcus pneumoniae SP11-BS70] >gi|183577177|gb|EDT97705.1| galactose-6-phosphate isomerase, LacB subunit [Streptococcus pneumoniae MLV-016] (171 aa)
Score = 168, Expect = 7.8e-11, Identities = 48/147 (32%), Positives = 77/147 (52%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEI--LDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLEN 157
           +++ IG DH   D K  +    E L+    + +D GTY    +  YP + +K+GE +   +   G+ ICGTG+GI  A+NK+ G+ +A V     A  A+E  N NVI   G+ T      +II+ F  + ++     K+L  I K+E+
  S:     1 MRIAIGCDHIVTDEKMAVS---EFLKSKGYEVIDFGTYDHTRT-HYPIFGKKVGEAVTSGQADLGVCICGTGVGINNAVNKVPGVRSALVRDMTTALYAKEQLNANVIGFGGKITGELLMCDIIEAFIHAEYKPSEENKKL--IAKIEH 143
>gi|50914792|ref|YP_060764.1| galactose-6-phosphate isomerase subunit LacB [Streptococcus pyogenes MGAS10394] >gi|71904102|ref|YP_280905.1| galactose-6-phosphate isomerase subunit LacB [Streptococcus pyogenes MGAS6180] >gi|50903866|gb|AAT87581.1| Galactose-6-phosphate isomerase lacB subunit [Streptococcus pyogenes MGAS10394] >gi|71803197|gb|AAX72550.1| galactose-6-phosphate isomerase LacB subunit [Streptococcus pyogenes MGAS6180] (172 aa)
Score = 168, Expect = 8.8e-11, Identities = 49/147 (33%), Positives = 79/147 (53%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHF-ESGRHEKRLDKITKLEN 157
           +K+ IG DH   + K  + +  +  +  D +D GTY    +  YP + +K+GE ++  +   G+ ICGTG+GI  A+NK+ GI +A V     A  A+E  N NVI   G+ T      +II  F  + + E+  ++K + KI  LE+
  S:     2 MKIAIGCDHIVTNEKMAVSDFLKS-KGYDVIDCGTYDHTRT-HYPIFGKKVGEAVVNGQADLGVCICGTGVGINNAVNKVPGIRSALVRDMTTALYAKEELNANVIGFGGKITGELLMCDIIDAFIKAEYKETEENKKLIAKIAHLES 147
>gi|110680781|ref|YP_683788.1| ribose-5-phosphate isomerase B [Roseobacter denitrificans OCh 114] >gi|109456897|gb|ABG33102.1| ribose-5-phosphate isomerase B, putative [Roseobacter denitrificans OCh 114] (151 aa)
Score = 168, Expect = 9.1e-11, Identities = 37/118 (31%), Positives = 59/118 (50%)
  Q:    39 DFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFE-SGRHEKRLDKITKLE 156
           D V++          Y D + ++   ++  +    I +CGTGIG+C++ NK+ GI AA  + T  A  A   NN  +ITL  R    E   +I+  + SSHF+  GR    +  I +L+
  S:    27 DVVEMSRTQDGPDAFYADLSNRVARAVIAGEVERAILVCGTGIGVCLSANKVPGIRAAQCHDTYSAGKAATSNNAQIITLGARVVGAELAKDIVDAYLSSHFDPEGRSAGNVQAIDRLD 145
>gi|94994906|ref|YP_603004.1| galactose-6-phosphate isomerase subunit LacB [Streptococcus pyogenes MGAS10750] >gi|94548414|gb|ABF38460.1| Galactose-6-phosphate isomerase lacB subunit [Streptococcus pyogenes MGAS10750] (172 aa)
Score = 168, Expect = 9.2e-11, Identities = 49/146 (33%), Positives = 78/146 (53%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHF-ESGRHEKRLDKITKLE 156
           +K+ IG DH   + K  + +  +  +  D +D GTY    +  YP + +K+GE ++  +   G+ ICGTG+GI  A+NK+ GI +A V     A  A+E  N NVI   G+ T      +II  F  + + E+  ++K + KI  LE
  S:     2 MKIAIGCDHIVTNEKMAVSDFLKS-KGYDVIDCGTYDHTRT-HYPIFGKKVGEAVVSGQADLGVCICGTGVGINNAVNKVPGIRSALVRDMTTALYAKEELNANVIGFGGKITGELLMCDIIDAFIKAEYKETEENKKLIAKIAHLE 146
>gi|125718498|ref|YP_001035631.1| galactose-6-phosphate isomerase subunit LacB [Streptococcus sanguinis SK36] >gi|166987729|sp|A3CPH6|LACB_STRSV Galactose-6-phosphate isomerase subunit lacB >gi|125498415|gb|ABN45081.1| Galactose-6-phosphate isomerase, LacB subunit, putative [Streptococcus sanguinis SK36] (171 aa)
Score = 167, Expect = 9.7e-11, Identities = 49/147 (33%), Positives = 79/147 (53%)
  Q:    11 IKVYIGSDHGGFDMKEKIRN--NHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLEN 157
           +K+ IG DH   + K  + +    +  E+LDF   GTY    +  YP + +K+GE ++  +   G+ ICGTG+GI  A+NK+ G+ +A V     A  A+E  N NVI   G+ T      +II+ F  + ++     K+L  I K+E+
  S:     1 MKIAIGCDHIVTNEKMAVSDFLKSKGYEVLDF---GTYDHTRT-HYPIFGKKVGEAVVSGQADLGVCICGTGVGINNAVNKVPGVRSALVRDMTSALYAKEELNANVIGFGGKITGELLICDIIEAFIHAEYKPTEENKKL--IAKIEH 143
>gi|56807634|ref|ZP_00365531.1| COG0698: Ribose 5-phosphate isomerase RpiB [Streptococcus pyogenes M49 591] (171 aa)
Score = 167, Expect = 9.7e-11, Identities = 49/146 (33%), Positives = 78/146 (53%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHF-ESGRHEKRLDKITKLE 156
           +K+ IG DH   + K  + +  +  +  D +D GTY    +  YP + +K+GE ++  +   G+ ICGTG+GI  A+NK+ GI +A V     A  A+E  N NVI   G+ T      +II  F  + + E+  ++K + KI  LE
  S:     1 MKIAIGCDHIVTNEKMAVSDFLKS-KGYDVIDCGTYDHTRT-HYPIFGKKVGEAVVSGQADLGVCICGTGVGINNAVNKVPGIRSALVRDMTTALYAKEELNANVIGFGGKITGELLMCDIIDAFIKAEYKETEENKKLIAKIAHLE 145
>gi|21911020|ref|NP_665288.1| galactose-6-phosphate isomerase subunit LacB [Streptococcus pyogenes MGAS315] >gi|28895295|ref|NP_801645.1| galactose-6-phosphate isomerase subunit LacB [Streptococcus pyogenes SSI-1] >gi|81758935|sp|Q8K652|LACB1_STRP3 Galactose-6-phosphate isomerase subunit lacB 1 >gi|21905228|gb|AAM80091.1| putative galactose-6-phosphate isomerase [Streptococcus pyogenes MGAS315] >gi|28810541|dbj|BAC63478.1| putative galactose-6-phosphate isomerase [Streptococcus pyogenes SSI-1] (171 aa)
Score = 167, Expect = 9.8e-11, Identities = 49/147 (33%), Positives = 79/147 (53%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHF-ESGRHEKRLDKITKLEN 157
           +K+ IG DH   + K  + +  +  +  D +D GTY    +  YP + +K+GE ++  +   G+ ICGTG+GI  A+NK+ GI +A V     A  A+E  N NVI   G+ T      +II  F  + + E+  ++K + KI  LE+
  S:     1 MKIAIGCDHIVTNEKMAVSDFLKS-KGYDVIDYGTYDHTRT-HYPIFGKKVGEAVVSGQADLGVCICGTGVGINNAVNKVPGIRSALVRDMTTALYAKEELNANVIGFGGKITGELLMCDIIDAFIKAEYKETEENKKLIAKIAHLES 146
>gi|15675560|ref|NP_269734.1| galactose-6-phosphate isomerase subunit LacB [Streptococcus pyogenes M1 GAS] >gi|71911210|ref|YP_282760.1| galactose-6-phosphate isomerase subunit LacB [Streptococcus pyogenes MGAS5005] >gi|81533438|sp|Q99YH2|LACB1_STRP1 Galactose-6-phosphate isomerase subunit lacB 1 >gi|85540619|sp|Q5XAI2|LACB1_STRP6 Galactose-6-phosphate isomerase subunit lacB 1 >gi|85540620|sp|Q48RW0|LACB1_STRPM Galactose-6-phosphate isomerase subunit lacB 1 >gi|13622763|gb|AAK34455.1| putative galactose-6-phosphate isomerase [Streptococcus pyogenes M1 GAS] >gi|71853992|gb|AAZ52015.1| galactose-6-phosphate isomerase lacB subunit [Streptococcus pyogenes MGAS5005] (171 aa)
Score = 167, Expect = 9.8e-11, Identities = 49/147 (33%), Positives = 79/147 (53%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHF-ESGRHEKRLDKITKLEN 157
           +K+ IG DH   + K  + +  +  +  D +D GTY    +  YP + +K+GE ++  +   G+ ICGTG+GI  A+NK+ GI +A V     A  A+E  N NVI   G+ T      +II  F  + + E+  ++K + KI  LE+
  S:     1 MKIAIGCDHIVTNEKMAVSDFLKS-KGYDVIDCGTYDHTRT-HYPIFGKKVGEAVVNGQADLGVCICGTGVGINNAVNKVPGIRSALVRDMTTALYAKEELNANVIGFGGKITGELLMCDIIDAFIKAEYKETEENKKLIAKIAHLES 146
>gi|15901057|ref|NP_345661.1| galactose-6-phosphate isomerase subunit LacB [Streptococcus pneumoniae TIGR4] >gi|111657525|ref|ZP_01408267.1| hypothetical protein SpneT_02001270 [Streptococcus pneumoniae TIGR4] >gi|148990447|ref|ZP_01821605.1| galactose-6-phosphate isomerase subunit LacB [Streptococcus pneumoniae SP6-BS73] >gi|148995095|ref|ZP_01824002.1| galactose-6-phosphate isomerase [Streptococcus pneumoniae SP9-BS68] >gi|168483252|ref|ZP_02708204.1| galactose-6-phosphate isomerase, LacB subunit [Streptococcus pneumoniae CDC1873-00] >gi|168489019|ref|ZP_02713218.1| galactose-6-phosphate isomerase, LacB subunit [Streptococcus pneumoniae SP195] >gi|168493114|ref|ZP_02717257.1| galactose-6-phosphate isomerase, LacB subunit [Streptococcus pneumoniae CDC3059-06] >gi|194397017|ref|YP_002037797.1| galactose-6-phosphate isomerase, LacB subunit [Streptococcus pneumoniae G54] >gi|81531915|sp|Q97QL1|LACB_STRPN Galactose-6-phosphate isomerase subunit lacB >gi|14972674|gb|AAK75301.1| galactose-6-phosphate isomerase, LacB subunit [Streptococcus pneumoniae TIGR4] >gi|147924299|gb|EDK75393.1| galactose-6-phosphate isomerase subunit LacB [Streptococcus pneumoniae SP6-BS73] >gi|147926863|gb|EDK77914.1| galactose-6-phosphate isomerase [Streptococcus pneumoniae SP9-BS68] >gi|172043510|gb|EDT51556.1| galactose-6-phosphate isomerase, LacB subunit [Streptococcus pneumoniae CDC1873-00] >gi|183572479|gb|EDT93007.1| galactose-6-phosphate isomerase, LacB subunit [Streptococcus pneumoniae SP195] >gi|183576512|gb|EDT97040.1| galactose-6-phosphate isomerase, LacB subunit [Streptococcus pneumoniae CDC3059-06] >gi|194356684|gb|ACF55132.1| galactose-6-phosphate isomerase, LacB subunit [Streptococcus pneumoniae G54] (171 aa)
Score = 167, Expect = 1.0e-10, Identities = 48/147 (32%), Positives = 77/147 (52%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEI--LDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLEN 157
           +++ IG DH   D K  +    E L+    + +D GTY    +  YP + +K+GE +   +   G+ ICGTG+GI  A+NK+ G+ +A V     A  A+E  N NVI   G+ T      +II+ F  + ++     K+L  I K+E+
  S:     1 MRIAIGCDHIVTDEKMAVS---EFLKSKGYEVIDFGTYDHTRT-HYPIFGKKVGEAVTSGQADLGVCICGTGVGINNAVNKVPGVRSALVRDMTTALYAKEQLNANVIGFGGKITGELLMCDIIEAFIHAEYKPTEENKKL--IAKIEH 143
>gi|145533705|ref|XP_001452597.1| hypothetical protein GSPATT00002600001 [Paramecium tetraurelia strain d4-2] >gi|124420296|emb|CAK85200.1| unnamed protein product [Paramecium tetraurelia] (150 aa)
Score = 167, Expect = 1.0e-10, Identities = 47/139 (33%), Positives = 75/139 (53%)
  Q:     8 LKKIKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHE 146
           + +IK++IG+DH   D K  +   +   +  D  DLGT++ ++S DY DYA  + + ++K   + GI ICG+G+GI I  NK+KGI    VN   ++ L       NVI+   R   +E   +I+  F S+   +  HE
  S:     1 MNQIKIFIGNDHAALDYKNTLLE-YSKKKGYDIEDLGTHT-NQSCDYNDYALNVCKEVIKSN-AIGILICGSGVGISIMANKVKGIRCGQVND-YDSTLKALEIGCNVISFGARTVGIEIAKQIVDTFLSNQNRAKNHE 135
>gi|27468704|ref|NP_765341.1| galactose-6-phosphate isomerase subunit LacB [Staphylococcus epidermidis ATCC 12228] >gi|57867733|ref|YP_189357.1| galactose-6-phosphate isomerase subunit LacB [Staphylococcus epidermidis RP62A] >gi|38604839|sp|Q8CRJ3|LACB_STAES Galactose-6-phosphate isomerase subunit lacB >gi|81673667|sp|Q5HM36|LACB_STAEQ Galactose-6-phosphate isomerase subunit lacB >gi|27316252|gb|AAO05427.1|AE016750_32 galactose-6-phosphate isomerase LacB subunit [Staphylococcus epidermidis ATCC 12228] >gi|57638391|gb|AAW55179.1| galactose-6-phosphate isomerase, LacB subunit [Staphylococcus epidermidis RP62A] (171 aa)
Score = 167, Expect = 1.1e-10, Identities = 46/146 (31%), Positives = 75/146 (51%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRL-DKITKLE 156
           +K+ IG DH   D K ++ + H   +  + +D+GTY    +  YP Y +K+GE +   +   G+ ICGTG+GI  A NK+ G+  A V     A  ++E  N NV++  G+        +I+  F  + ++     K+L  KI  LE
  S:     1 MKIAIGCDHIVTDTKMEV-SQHLKSQGHEVIDVGTYDFTRT-HYPIYGKKVGEKVASGEADLGVCICGTGVGISNAANKVPGVRTALVRDMTSALYSKEELNANVVSFGGKVAGELFIFDIVDAFIEAEYKPTEENKKLIAKINHLE 145
>gi|139473268|ref|YP_001127983.1| galactose-6-phosphate isomerase subunit LacB [Streptococcus pyogenes str. Manfredo] >gi|166987727|sp|A2RD12|LACB_STRPG Galactose-6-phosphate isomerase subunit lacB >gi|134271514|emb|CAM29736.1| galactose-6-phosphate isomerase LacB subunit 1 [Streptococcus pyogenes str. Manfredo] (171 aa)
Score = 167, Expect = 1.1e-10, Identities = 49/146 (33%), Positives = 78/146 (53%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHF-ESGRHEKRLDKITKLE 156
           +K+ IG DH   + K  + +  +  +  D +D GTY    +  YP + +K+GE ++  +   G+ ICGTG+GI  A+NK+ GI +A V     A  A+E  N NVI   G+ T      +II  F  + + E+  ++K + KI  LE
  S:     1 MKIAIGCDHIVTNEKMAVSDFLKS-KGYDVIDCGTYDHTRT-HYPIFGKKVGEAVVNGQADLGVCICGTGVGINNAVNKVPGIRSALVRDMTTALYAKEELNANVIGFGGKITGELLMCDIIDAFIKAEYKETEENKKLIAKIAHLE 145
>gi|15965978|ref|NP_386331.1| ribose-5-phosphate isomerase B [Sinorhizobium meliloti 1021] >gi|15075248|emb|CAC46804.1| Putative ribose 5-phosphate isomerase B [Sinorhizobium meliloti 1021] (145 aa)
Score = 167, Expect = 1.2e-10, Identities = 45/146 (30%), Positives = 74/146 (50%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNN---HELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFE-SGRHEKRLDKITKLE 156
           +K+ IG+D  G  + + I  +      LE+ D    G Y+        D +  + + +   +   GI ICGTGIG+CI+ NK+ GI AA  + T  AE A + NN  +IT+  R    E    I+  + +S F+ +G     ++ I +L+
  S:     1 MKIAIGADSAGKPLLDVIAAHLAKRSDLEVKDLSQTGYYA--------DLSRDLAQTITAGENERGILICGTGIGVCISANKVPGIRAALTHDTYSAERAAKSNNAQIITMGARVIGPELAKSIVDTWLASEFDPNGPSAANVEAIDRLD 142
>gi|25011377|ref|NP_735772.1| galactose-6-phosphate isomerase subunit LacB [Streptococcus agalactiae NEM316] >gi|81456534|sp|Q8E4R6|LACB1_STRA3 Galactose-6-phosphate isomerase subunit lacB 1 >gi|24412915|emb|CAD46994.1| Unknown [Streptococcus agalactiae NEM316] (171 aa)
Score = 166, Expect = 1.3e-10, Identities = 54/148 (36%), Positives = 78/148 (52%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFV--------DLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRL-DKITKLENK 158
           +K+ IG DH        I  N E + ++DF+        D GTY    +  YP Y +K+GE +   K   GI ICGTG+GI  A+NK+ GI +A V     A  A+E  N NVI   G+ T      +II+    + ++     K+L  KI  +E+K
  S:     1 MKIAIGCDH--------IVTN-EKMAVVDFLKSKGYEVQDYGTYDHVRT-HYPIYGKKVGEAVASGKAELGICICGTGVGINNAVNKVPGIRSALVRDMTSALYAKEELNANVIGFGGKITGELLMCDIIEALLHAEYKPSEENKKLIAKIAHVESK 147
>gi|86360773|ref|YP_472660.1| ribose-5-phosphate isomerase B [Rhizobium etli CFN 42] >gi|86284875|gb|ABC93933.1| ribose 5-phosphate isomerase protein [Rhizobium etli CFN 42] (148 aa)
Score = 166, Expect = 1.4e-10, Identities = 40/131 (30%), Positives = 68/131 (51%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFE 141
           +K+ IG+D  G  + + I  +     +    DL  +   +S  Y D ++++ + ++  +   GI  CGTGIG+CI+ NK+ GI AA  + T  AE A + NN  +IT+  R    E    I+  + +S F+
  S:     1 MKIAIGADSAGKPLLDVIAAH-----LAGKADLEVHDLSQSGFYADLSQRLAQTIVDGEHERGILFCGTGIGVCISANKVPGIRAALTHDTYSAERAAKSNNAQIITMGARVIGPELAKSIVDVWLASEFD 126
>gi|24379889|ref|NP_721844.1| galactose-6-phosphate isomerase subunit LacA [Streptococcus mutans UA159] >gi|125909|sp|P26423|LACA_STRMU Galactose-6-phosphate isomerase subunit lacA >gi|24377865|gb|AAN59150.1|AE014981_7 galactose-6-phosphate isomerase, subunit LacA [Streptococcus mutans UA159] >gi|153673|gb|AAA26904.1| galactosidase acetyltransferase (142 aa)
Score = 166, Expect = 1.4e-10, Identities = 46/145 (31%), Positives = 74/145 (51%)
  Q:    11 IKVYIGSDHGGFDMKEKIR-----NNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKL 155
           + + IGSD  G  +K+ I+     NNHE+L++ +  DL         D+ D    +   + K+  + GI I   G G  +   K+KG+ AA V+    A + R HNN  +ITL       E    I+K F  + ++ GRH+ R+D + K+
  S:     1 MAIIIGSDAAGKRLKDVIKTFLKDNNHEVLDVTERKDL---------DFVDSTLAVVHEVQKNDKNLGIAIDAYGAGSFMVATKVKGMIAAEVSDERSAYMTRGHNNARIITLGAEIVGDELAKNIVKDFVEAKYDGGRHQIRVDMLNKM 141
>gi|126134219|ref|XP_001383634.1| Ribose-5-phosphate isomerase B (Phosphoriboisomerase B) (LACB) (RPIB) [Pichia stipitis CBS 6054] >gi|126095783|gb|ABN65605.1| Ribose-5-phosphate isomerase B (Phosphoriboisomerase B) (LACB) (RPIB) [Pichia stipitis CBS 6054] (156 aa)
Score = 165, Expect = 1.9e-10, Identities = 35/131 (26%), Positives = 72/131 (54%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEIL-DFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFE 141
           +++ IG D  GF+ K+K++ + E  +++ + +D+G  +  + + YP    K GE +   K    + ICGTG+G+ I+ NK+ GI A   + +   E +   NN +V+ +  R   +E    ++ ++ + +F+
  S:     6 LRIVIGCDEAGFEYKQKLQQDLEKNDLVSEVIDIGINTKGDHLAYPHVGIKAGELIRDGKADRALLICGTGLGVAISANKVAGIRAVTAHDSFSVERSILSNNCHVLCMGQRVIGIELARRLVAEWLTYNFD 137
>gi|145535586|ref|XP_001453526.1| hypothetical protein GSPATT00019822001 [Paramecium tetraurelia strain d4-2] >gi|124421248|emb|CAK86129.1| unnamed protein product [Paramecium tetraurelia] (163 aa)
Score = 165, Expect = 2.0e-10, Identities = 47/128 (36%), Positives = 74/128 (57%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSH 139
           K+YIG+DH G + K  I ++ +  E  D ++ GT +  +S DY + A ++  ++L+DKG  GI ICG+G+G+ I  NK+KGI    +N    A+ A E    NVI L  R   +E   ++I  F +S+
  S:    19 KIYIGNDHAGLEYKNIIIDHLKQQE-YDIINRGTNT-KQSCDYNEIATELCSDVLRDKG-LGILICGSGVGMSIMSNKVKGIRCGQINDYNSAKQAAE-IGCNVIALGSRILGIEVAKQVIDAFLNSY 142
>gi|70725844|ref|YP_252758.1| galactose-6-phosphate isomerase subunit LacB [Staphylococcus haemolyticus JCSC1435] >gi|85540622|sp|Q4L873|LACB_STAHJ Galactose-6-phosphate isomerase subunit lacB >gi|68446568|dbj|BAE04152.1| galactose-6-phosphate isomerase LacB subunit [Staphylococcus haemolyticus JCSC1435] (171 aa)
Score = 164, Expect = 2.1e-10, Identities = 45/146 (30%), Positives = 75/146 (51%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRL-DKITKLE 156
           +K+ IG DH   D K ++ + H   +  + +D+GTY    +  YP + +K+GE +   +   G+ ICGTG+GI  A NK+ G+  A V     A  ++E  N NV++  G+        +I+  F  + ++     K+L  KI  LE
  S:     1 MKIAIGCDHIVTDTKMEV-SQHLKAQGHEVIDVGTYDFTRT-HYPIFGKKVGEKVASGEADLGVCICGTGVGISNAANKVPGVRTALVRDMTSALYSKEELNANVVSFGGKVAGELFIFDIVDAFIKAEYKPTEENKKLIAKINHLE 145
>gi|22538068|ref|NP_688919.1| galactose-6-phosphate isomerase subunit LacB [Streptococcus agalactiae 2603V/R] >gi|25011956|ref|NP_736351.1| galactose-6-phosphate isomerase subunit LacB [Streptococcus agalactiae NEM316] >gi|76788090|ref|YP_330484.1| galactose-6-phosphate isomerase subunit LacB [Streptococcus agalactiae A909] >gi|76799771|ref|ZP_00781850.1| galactose-6-phosphate isomerase, LacB subunit [Streptococcus agalactiae 18RS21] >gi|77405081|ref|ZP_00782181.1| galactose-6-phosphate isomerase, LacB subunit [Streptococcus agalactiae H36B] >gi|77407879|ref|ZP_00784631.1| galactose-6-phosphate isomerase, LacB subunit [Streptococcus agalactiae COH1] >gi|77412183|ref|ZP_00788504.1| galactose-6-phosphate isomerase, LacB subunit [Streptococcus agalactiae CJB111] >gi|81453047|sp|Q8DXC1|LACB_STRA5 Galactose-6-phosphate isomerase subunit lacB >gi|81455814|sp|Q8E345|LACB2_STRA3 Galactose-6-phosphate isomerase subunit lacB 2 >gi|85540623|sp|Q3JZ19|LACB_STRA1 Galactose-6-phosphate isomerase subunit lacB >gi|22534972|gb|AAN00792.1|AE014278_19 galactose-6-phosphate isomerase, LacB subunit [Streptococcus agalactiae 2603V/R] >gi|24413498|emb|CAD47576.1| Unknown [Streptococcus agalactiae NEM316] >gi|76563147|gb|ABA45731.1| galactose-6-phosphate isomerase, LacB subunit [Streptococcus agalactiae A909] >gi|76584874|gb|EAO61553.1| galactose-6-phosphate isomerase, LacB subunit [Streptococcus agalactiae 18RS21] >gi|77161760|gb|EAO72750.1| galactose-6-phosphate isomerase, LacB subunit [Streptococcus agalactiae CJB111] >gi|77173524|gb|EAO76641.1| galactose-6-phosphate isomerase, LacB subunit [Streptococcus agalactiae COH1] >gi|77176375|gb|EAO79144.1| galactose-6-phosphate isomerase, LacB subunit [Streptococcus agalactiae H36B] (171 aa)
Score = 164, Expect = 2.3e-10, Identities = 43/118 (36%), Positives = 65/118 (55%)
  Q:    39 DFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRL-DKITKLE 156
           + +D GTY    +  YP Y +K+GE +   K   G+ ICGTG+GI  A+NK+ GI +A V     A  A+E  N NVI   G+ T      +II+ F  + ++  +  K L +KI ++E
  S:    28 EVIDCGTYDNIRT-HYPIYGKKVGEAVASGKADLGVCICGTGVGINNAVNKVPGIRSALVRDLTSAIYAKEELNANVIGFGGKITGGLLMTDIIEAFIRAKYKPTKENKVLIEKIAEVE 145
>gi|163734896|ref|ZP_02142333.1| ribose-5-phosphate isomerase B [Roseobacter litoralis Och 149] >gi|161391678|gb|EDQ16010.1| ribose-5-phosphate isomerase B [Roseobacter litoralis Och 149] (151 aa)
Score = 163, Expect = 3.3e-10, Identities = 34/107 (31%), Positives = 53/107 (49%)
  Q:    39 DFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRH 145
           D V++          Y D + ++   ++  +    I +CGTGIG+C++ NK+ GI AA  + T  A  A   NN  +ITL  R    E   +I+  + SSHF+   H
  S:    27 DVVEMSRTQDGPDAFYADLSNRVAHAVIAGEVERAILVCGTGIGVCLSANKVPGIRAAQCHDTYSAGKAATSNNAQIITLGARVVGAELAKDIVDAYLSSHFDPEGH 133
>gi|23005395|ref|ZP_00048235.1| COG0698: Ribose 5-phosphate isomerase RpiB [Magnetospirillum magnetotacticum MS-1] (131 aa)
Score = 162, Expect = 3.5e-10, Identities = 41/111 (36%), Positives = 61/111 (54%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEIL-----DFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGR 121
           ++V+I +DH G+++K        L+E L     D VD G ++ D   DYP +    GE +  + GS G+ I G+G G  IA NK+ G+ AA       A L R+HN+ NV+    R
  S:     1 MRVHIAADHAGYELKT------HLVEHLGAAGHDVVDHGAHTYDAQDDYPSFCFAAGEAVAAEPGSLGVVIGGSGNGEQIAANKVVGVRAALAWNLETARLGRQHNDANVVRXWAR 110
>gi|52424438|ref|YP_087575.1| RpiB protein [Mannheimia succiniciproducens MBEL55E] >gi|52306490|gb|AAU36990.1| RpiB protein [Mannheimia succiniciproducens MBEL55E] (150 aa)
Score = 162, Expect = 4.2e-10, Identities = 47/148 (31%), Positives = 74/148 (50%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           +K+ IG D   + +K +I  + + L I ++ D G   GD  V YPD AE +   + + K    I  CGTGIG+CI  NK+ GI AA        E +R+ N+  ++ L  R   VE    +I  +F   F  G    ++ +I +++ K
  S:     1 MKIAIGCDEAAYRLKVEIMKHLDELGI-EYDDFGAGEGD-VVLYPDVAEAVAVAVAEGKYQRAILTCGTGIGMCITANKVPGIRAAVCYDVFSTERSRKSNDAQIMCLGERVIGVELAKSLIDVWFKCEFAGGGSAPKVKRINEIDAK 146
>gi|36958662|gb|AAQ87130.1| Ribose 5-phosphate isomerase [Rhizobium sp. NGR234] (145 aa)
Score = 162, Expect = 4.2e-10, Identities = 41/131 (31%), Positives = 67/131 (51%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNN---HELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFE 141
           +K+ IG+D  G  + + I  +      +E+ D    G Y+        D +E + + +   +   GI ICGTGIG+CI+ NK+ GI AA  + T  AE A + NN  +IT+  R    E    I+  + ++ F+
  S:     1 MKIAIGADSAGKPLLDVIAAHLAGRSDVEVKDLSQAGFYA--------DLSEHLAKTITAGENDRGILICGTGIGVCISANKVPGIRAALTHDTYSAERAAKSNNAQIITMGARVIGPELAKSIVDTWLAAEFD 126
>gi|168059478|ref|XP_001781729.1| predicted protein [Physcomitrella patens subsp. patens] >gi|162666813|gb|EDQ53458.1| predicted protein [Physcomitrella patens subsp. patens] (318 aa)
Score = 161, Expect = 4.9e-10, Identities = 48/142 (33%), Positives = 76/142 (53%)
  Q:     1 MSESKKQLKKIKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVD-YPDYAEKIGENLLKDKG-------SYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFES 142
           M++     K  +V  G+D  G ++K+ +    +  +I + VDLG       VD Y   A K+   L K+K        S G+ +CGTG+G+ I  NK  G+YAA  N   EA  AR  NN NV+T+  +  S E+  +I+  +  + F++
  S:     1 MADEAASEKPRRVVAGADAFGSELKDTLVQYLKEKDI-EVVDLG-------VDKYYSVAVKVASELAKEKKLSSEGPLSRGLLVCGTGVGVSIFANKFAGVYAAPCNSVDEAMNARSINNTNVLTIGAKIASTEEGKKILDAWLETSFKA 142
>gi|77414256|ref|ZP_00790417.1| galactose-6-phosphate isomerase, LacB subunit [Streptococcus agalactiae 515] >gi|77159708|gb|EAO70858.1| galactose-6-phosphate isomerase, LacB subunit [Streptococcus agalactiae 515] (171 aa)
Score = 160, Expect = 6.6e-10, Identities = 43/118 (36%), Positives = 64/118 (54%)
  Q:    39 DFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRL-DKITKLE 156
           + +D GTY    +  YP Y +K+GE +   K   G+ ICGTG GI  A+NK+ GI +A V     A  A+E  N NVI   G+ T      +II+ F  + ++  +  K L +KI ++E
  S:    28 EVIDCGTYDNIRT-HYPIYGKKVGEAVASGKADLGVCICGTGXGINNAVNKVPGIRSALVRDLTSAIYAKEELNANVIGFGGKITGGLLMTDIIEAFIRAKYKPTKENKVLIEKIAEVE 145
>gi|153674|gb|AAA26905.1| galactose 6-P isomerase (171 aa)
Score = 160, Expect = 6.8e-10, Identities = 45/146 (30%), Positives = 75/146 (51%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRL-DKITKLE 156
           +K+ IG DH   D+K ++ + H   E  + +D+GTY    +  YP + +K+GE +   +   G+ +CGTG+GI  A NK+ G+  A V     A  ++E  N NV++  G         +I+  F  + ++     K+L  KI  LE
  S:     1 MKIAIGCDHIWTDVKMEL-SKHIKEEGYEVLDVGTYDFTRT-HYPIFGKKVGEAVSSGEADLGVCMCGTGVGISNAANKVPGVRTALVRDMTSALYSKEELNANVVSFGGAIIGKLLLFDIVDAFIKAQYKPTEENKKLIAKIKHLE 145
>gi|152979257|ref|YP_001344886.1| ribose 5-phosphate isomerase B [Actinobacillus succinogenes 130Z] >gi|150840980|gb|ABR74951.1| ribose 5-phosphate isomerase B [Actinobacillus succinogenes 130Z] (149 aa)
Score = 160, Expect = 7.4e-10, Identities = 44/148 (29%), Positives = 75/148 (50%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKLENK 158
           +K+ IG D   + +K +I  + + + + ++ D G   GD  V YPD AE +   + + K    I  CGTGIG+CI  NK+ G+ AA  +     E +R+ N+  ++ L  R   VE    +I  +F   F  G    ++ +I +++ K
  S:     1 MKIAIGCDEAAYRLKVEIMKHLDAIGV-EYDDFGAGEGD-VVLYPDVAEAVAVAVAEGKYERAILTCGTGIGMCITANKVPGVRAAVCHDVFSTERSRKSNDAQIMCLGERVIGVELAKSLIDVWFKCDFAGGGSAPKVARINEIDAK 146
>gi|118469259|ref|YP_890995.1| ribose 5-phosphate isomerase [Mycobacterium smegmatis str. MC2 155] >gi|118170546|gb|ABK71442.1| ribose 5-phosphate isomerase [Mycobacterium smegmatis str. MC2 155] (152 aa)
Score = 159, Expect = 9.4e-10, Identities = 38/131 (29%), Positives = 68/131 (51%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLE-ILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFE 141
           +K+ IG D+ GF+ KE +R + E  + +    D+G    D++  YP+ A    E + + +    + ICGTG+G+ IA NK+KGI A   +     + +   NN  V+ +  R   +E    ++K++    F+
  S:     3 LKIVIGGDNAGFNYKEALRKDLEADDRVASVEDVGVGGVDDTTSYPNVAVAAAEKVARGEADRALLICGTGLGVAIAANKVKGIRAVTAHDVYSVQRSVLSNNAQVLCMGERVVGLELARALVKEWLGLEFD 134
>gi|24379888|ref|NP_721843.1| galactose-6-phosphate isomerase subunit LacB [Streptococcus mutans UA159] >gi|26006993|sp|P26424|LACB_STRMU Galactose-6-phosphate isomerase subunit lacB >gi|24377864|gb|AAN59149.1|AE014981_6 galactose-6-phosphate isomerase, subunit LacB [Streptococcus mutans UA159] (171 aa)
Score = 159, Expect = 9.6e-10, Identities = 45/146 (30%), Positives = 75/146 (51%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRL-DKITKLE 156
           +K+ IG DH   D+K ++ + H   E  + +D+GTY    +  YP + +K+GE +   +   G+ +CGTG+GI  A NK+ G+  A V     A  ++E  N NV++  G         +I+  F  + ++     K+L  KI  LE
  S:     1 MKIAIGCDHIVTDVKMEL-SKHLKEEGYEVLDVGTYDFTRT-HYPIFGKKVGEAVSSGEADLGVCMCGTGVGISNAANKVPGVRTALVRDMTSALYSKEELNANVVSFGGAIIGKLLLFDIVDAFIKAQYKPTEENKKLIAKIKHLE 145
>gi|119963540|ref|YP_949803.1| ribose 5-phosphate isomerase [Arthrobacter aurescens TC1] >gi|119950399|gb|ABM09310.1| ribose 5-phosphate isomerase [Arthrobacter aurescens TC1] (152 aa)
Score = 158, Expect = 1.1e-09, Identities = 40/131 (30%), Positives = 64/131 (48%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHEL-LEILDFVDLGTYSGDESVD--YPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFE 141
           +++ +G+D  G D K++I  + E    I + +D+G    DE     YP      GE +   K    I  CGTGIG+ IA NK+ GI A   + +   E +   N+  V+T+  R   VE    + K++    F+
  S:     1 MRIIVGADEAGVDYKDRIMADLEADSRITEVIDIGVNRADEDFTRPYPYVGIAAGEMIRDGKADRAILFCGTGIGVAIAANKVPGIRATAAHDSFSVERSIRSNDCQVLTMGQRVVGVELARRLAKEWIGYAFD 134
>gi|88855147|ref|ZP_01129812.1| ribose-5-phosphate isomerase B [marine actinobacterium PHSC20C1] >gi|88815675|gb|EAR25532.1| ribose-5-phosphate isomerase B [marine actinobacterium PHSC20C1] (162 aa)
Score = 158, Expect = 1.2e-09, Identities = 44/146 (30%), Positives = 75/146 (51%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNN-----HELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGS----YGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFE-SGRHEKRLDKITKLE 156
           ++++I +DH G +    ++ +     HE+      +D G    D   DYP +       +  D+ +     G+   G+G G  IA NK+ GI AA V     A LAR+HN+ NVI++  R  +V++    I  F +  F    RH +R+ ++ + E
  S:     1 MRIHIATDHAGLEFSATLQQHLTDAGHEV------IDHGPVEYDALDDYPGFCIAAARGVAADQTAGIQALGVVFGGSGNGEQIAANKVTGIRAALVWNDSTAALARQHNDANVISIGARQHTVDEATRFIDLFIAEPFSGEERHARRIAQLAEYE 150
>gi|139438381|ref|ZP_01771897.1| Hypothetical protein COLAER_00887 [Collinsella aerofaciens ATCC 25986] >gi|133775920|gb|EBA39740.1| Hypothetical protein COLAER_00887 [Collinsella aerofaciens ATCC 25986] (174 aa)
Score = 158, Expect = 1.3e-09, Identities = 46/143 (32%), Positives = 68/143 (47%)
  Q:    10 KIKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFE-SGRHEKRLDKI 152
           K  + IG DH   D K  + +  E       +D GTYS   +  YP Y + +GE +   K  +G+ +CGTGIGI  A+NK+ G   A V     A  AR   N N++   G+ T      +I+  F    +E +  H+  + KI
  S:     2 KKTIAIGCDHIVTDEKIYLADRLEQAG-YKVLDCGTYSHTRT-HYPIYGKAVGEAVASGKADFGVALCGTGIGITNAVNKVPGARCALVRDMTSALYARRELNANIVGFGGKITGEFLMADIMLAFLEEPYEKTPEHDALIAKI 143
>gi|50415917|ref|XP_457506.1| hypothetical protein DEHA0B12958g [Debaryomyces hansenii CBS767] >gi|49653171|emb|CAG85512.1| unnamed protein product [Debaryomyces hansenii CBS767] (163 aa)
Score = 157, Expect = 1.5e-09, Identities = 37/118 (31%), Positives = 62/118 (52%)
  Q:     9 KKIKVYIGSDHGGFDMKEKIR---NNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVE 126
           ++I++ +G D  G++ KE I+    N+ L+E +   D+G  S  +S  YP    K GE +   +    I ICGTG+G+ I+ NK+  I A   + +   E +   NN  V+ +  R   +E
  S:     3 QRIRIVVGCDQAGYEYKEAIKKDLQNNPLVESIK--DIGVPSNTDSTSYPLIGIKAGEMIQTGEADRAILICGTGLGVAISANKVSEIRAVTAHDSFSVERSILSNNCQVLCMGQRVVGLE 121
>gi|116494227|ref|YP_805961.1| galactose-6-phosphate isomerase subunit LacB [Lactobacillus casei ATCC 334] >gi|116104377|gb|ABJ69519.1| galactose-6-phosphate isomerase lacB subunit [Lactobacillus casei ATCC 334] (172 aa)
Score = 156, Expect = 2.1e-09, Identities = 47/143 (32%), Positives = 77/143 (53%)
  Q:    13 VYIGSDHGGFDMKEKIRNNHELLEILDF--VDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHF-ESGRHEKRLDKITKL 155
           + IG+DH     K +I N   +L+ + +  +D GTY    +  YP Y +K+ E++   +   GI +CGTGIGI  A +K  GI AA  +    A  ARE  N NV+ + G    +    +I+K +  + + E+  ++K +DKI  +
  S:     3 IAIGNDHIVTMQKIEISN---MLKDMGYTVIDEGTYDTHRT-HYPIYGKKVAEDVADGRADLGIVMCGTGIGISTAADKNDGIRAAMCDDVTSAVYAREQLNANVLGIGGATVGIHMIQDIVKAYLDATYKETPENKKIIDKIDNI 144
>gi|50954589|ref|YP_061877.1| ribose-5-phosphate isomerase B [Leifsonia xyli subsp. xyli str. CTCB07] >gi|50951071|gb|AAT88772.1| ribose 5-phosphate isomerase [Leifsonia xyli subsp. xyli str. CTCB07] (162 aa)
Score = 155, Expect = 2.3e-09, Identities = 43/146 (29%), Positives = 76/146 (52%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGS----YGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFE-SGRHEKRLDKITKLE 156
           ++++I +DH G D  + ++  H      + +D G    D   DYP +     + +++D+ +     G+   G+G G  IA NK+ G  AA V     A LAR+HN+ NVI++  R  +V +    I+ F +  F    RH +R+ ++ + E
  S:     1 MRIHIATDHAGLDFSKHLQA-HLAQAGHEVIDHGPAEYDPIDDYPAFCVNAAKGVVRDQQAGIEALGVVFGGSGNGEQIAANKVIGARAALVWNESTALLARQHNDANVISIGARQHTVAEATRFIELFIAEPFSLEERHLRRIAQLAEFE 150
>gi|27468705|ref|NP_765342.1| galactose-6-phosphate isomerase subunit LacA [Staphylococcus epidermidis ATCC 12228] >gi|57867734|ref|YP_189358.1| galactose-6-phosphate isomerase subunit LacA [Staphylococcus epidermidis RP62A] >gi|38604838|sp|Q8CRJ2|LACA_STAES Galactose-6-phosphate isomerase subunit lacA >gi|81673664|sp|Q5HM35|LACA_STAEQ Galactose-6-phosphate isomerase subunit lacA >gi|27316253|gb|AAO05428.1|AE016750_33 galactose-6-phosphate isomerase LacA subunit [Staphylococcus epidermidis ATCC 12228] >gi|57638392|gb|AAW55180.1| galactose-6-phosphate isomerase, LacA subunit [Staphylococcus epidermidis RP62A] (142 aa)
Score = 155, Expect = 2.4e-09, Identities = 44/145 (30%), Positives = 74/145 (51%)
  Q:    11 IKVYIGSDHGGFDMKEKIR-----NNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKL 155
           + + IGSD  G  +KE I+     N++++L++ +  DL         D+ D    + + + K   + GI I   G G  I   KIKG+ AA V+    A + R HNN  +IT+            + K+F + H++ GRH+ R+D + K+
  S:     1 MTIIIGSDVDGKRLKELIKDYLEDNDYDVLDVTEGKDL---------DFVDSTVSVAKEVQKSDDNLGIAIDAYGAGSFIVATKIKGMIAAEVSDERSAYMTRSHNNARMITMGAEIVGDTLAKNVAKEFVNGHYDGGRHQIRVDMLNKM 141
>gi|70725843|ref|YP_252757.1| galactose-6-phosphate isomerase subunit LacA [Staphylococcus haemolyticus JCSC1435] >gi|84029329|sp|Q4L874|LACA_STAHJ Galactose-6-phosphate isomerase subunit lacA >gi|68446567|dbj|BAE04151.1| galactose-6-phosphate isomerase LacA subunit [Staphylococcus haemolyticus JCSC1435] (142 aa)
Score = 155, Expect = 2.4e-09, Identities = 40/145 (27%), Positives = 75/145 (51%)
  Q:    11 IKVYIGSDHGGFDMKEKIR-----NNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKL 155
           + ++IGSD  G  +K+ ++     NNH+++++ +          + +D+ D    +   + K+  + GI +   G G  I   K+KG+ AA V+    A + R HNN  +IT+            I K+F + H++ GRH+ R+D + K+
  S:     1 MTIFIGSDVAGQRLKDVVKTFLKENNHDVVDVTE---------GKELDFVDSTLAVVHEVQKNDDNLGIAVDAYGAGSFIVATKVKGMIAAEVSDERSAYMTRSHNNACMITMGSEIVGDTLAKNIAKEFVNGHYDGGRHQIRVDMLNKM 141
>gi|17988769|ref|NP_541402.1| ribose-5-phosphate isomerase B [Brucella melitensis 16M] >gi|17984585|gb|AAL53666.1| RIBOSE 5-PHOSPHATE ISOMERASE [Brucella melitensis 16M] (164 aa)
Score = 154, Expect = 3.0e-09, Identities = 45/155 (29%), Positives = 75/155 (48%)
  Q:     4 SKKQLKKIKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHF-ESGRHEKRLDKITKLENK 158
           S+ + K +KV +  D  G  +  K+  +H L +  +  ++          Y + ++++   +L       I +CGTGIG+CIA NK+ GI AA  + T  AE A   NN  +IT+  R    E    I   F +  F E+GR    ++ I +++ K
  S:     7 SELRSKIMKVAVAGDSAGEGLA-KVLADH-LKDRFEVSEISRTDAGADAFYANLSDRVASAVLDGTYDRAILVCGTGIGVCIAANKVPGIRAALTHDTYSAERAALSNNAQIITMGARVIGAEVAKTIADAFLAQTFDENGRSAGNVNAINEVDAK 160
>gi|134101296|ref|YP_001106957.1| putative ribose 5-phosphate isomerase [Saccharopolyspora erythraea NRRL 2338] >gi|133913919|emb|CAM04032.1| putative ribose 5-phosphate isomerase [Saccharopolyspora erythraea NRRL 2338] (149 aa)
Score = 154, Expect = 3.0e-09, Identities = 36/131 (27%), Positives = 67/131 (51%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNN-HELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFE 141
           ++V +GSD  G   K+ ++ +  E   +   VD+G  +GD+   YP+ A    E + + +    + +CGTG+G+ I+ NK+KGI A   + +   E +   NN  V+T   R   +E    + +++    F+
  S:     1 MRVVVGSDDAGLQYKDVLKGDLAEDPRVGSVVDVGV-NGDDVTAYPNIAIAAAEMVARGEADRALLVCGTGLGVAISANKVKGIRAVTAHDSFSVERSVLSNNAQVLTFGQRVIGLELARRLAREWLGYRFD 131
>gi|94989030|ref|YP_597131.1| galactose-6-phosphate isomerase subunit LacA [Streptococcus pyogenes MGAS9429] >gi|94992920|ref|YP_601019.1| galactose-6-phosphate isomerase subunit LacA [Streptococcus pyogenes MGAS2096] >gi|139473267|ref|YP_001127982.1| galactose-6-phosphate isomerase subunit LacA [Streptococcus pyogenes str. Manfredo] >gi|94542538|gb|ABF32587.1| galactose-6-phosphate isomerase lacA subunit [Streptococcus pyogenes MGAS9429] >gi|94546428|gb|ABF36475.1| Galactose-6-phosphate isomerase lacA subunit [Streptococcus pyogenes MGAS2096] >gi|134271513|emb|CAM29735.1| galactose-6-phosphate isomerase LacA subunit 1 [Streptococcus pyogenes str. Manfredo] (141 aa)
Score = 154, Expect = 3.2e-09, Identities = 41/145 (28%), Positives = 73/145 (50%)
  Q:    11 IKVYIGSDHGGFDMKEKIRN--NHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKL 155
           + + +G+D  G  +KE I++    E  +I+D  D+ +       D+ D    + + + + +G  GI +   G G  +   K+KG+ AA V+    A + R HNN  +IT+       E    I K F + H++ GRH+ R+D + K+
  S:     1 MAIILGADAHGNALKELIKSFLQEESYDIIDVTDINS-------DFIDNTLAVAKAVNEAEGRLGIMVDAYGAGPFMVATKLKGMVAAEVSDERSAYMTRGHNNARMITMGAEIVGPELAKNIAKGFVTGHYDGGRHQIRVDMLNKM 140
>gi|111221302|ref|YP_712096.1| ribose-5-phosphate isomerase B [Frankia alni ACN14a] >gi|111148834|emb|CAJ60512.1| Ribose/galactose isomerase [Frankia alni ACN14a] (140 aa)
Score = 154, Expect = 3.2e-09, Identities = 40/116 (34%), Positives = 58/116 (50%)
  Q:    41 VDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFE-SGRHEKRLDKITKLE 156
           VD G    D   DYP +          +  S GI I G+G G  IA NK+ G+ AA V     A LAR+HN+ NV++L  R  +V + +   + F ++ F    RH +RL  ++  E
  S:     8 VDHGPVEYDPDDDYPPFVLAAARATAAEPDSLGIVIGGSGNGEAIAANKVVGVRAALVWSEQTATLARQHNDANVLSLGARMHTVSEALAFAEVFLTTPFSGEQRHVRRLRMLSAYE 124
>gi|148927499|ref|ZP_01810995.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [candidate division TM7 genomosp. GTL1] >gi|147887153|gb|EDK72625.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [candidate division TM7 genomosp. GTL1] (151 aa)
Score = 154, Expect = 3.4e-09, Identities = 47/143 (32%), Positives = 88/143 (61%)
  Q:    11 IKVYIGSDHGGFDMKEKI-----RNNHELLEILDFVDLGTYSGDESVDYPDYAEK-----IGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVE----IIKKFFSSHFESG----RHEKRLDKIT 153
           +K+++GSDH GF +KEK+     ++N+      D  D+G    D + D+P++A+      IGE+   D  +  I +CG G G+ +A N+ +GI A+ ++   EA++ R  N+ N++ L      +ED+ E    II+ + ++ F       R  ++LD+++
  S:     1 MKIFLGSDHRGFHLKEKVFAYLSKHNY------DVEDIGDKVLDPNDDFPEFAQAATLKVIGEDEKNDPRA--ILLCGGGQGMAMAANRFRGIRASVIHDANEAKMTRNDNDSNILCLPA--DQLEDDEEALYGIIETWLNTPFAKAARYVRRNRQLDELS 151
>gi|58040645|ref|YP_192609.1| ribose-5-phosphate isomerase B [Gluconobacter oxydans 621H] >gi|58003059|gb|AAW61953.1| Ribose 5-phosphate isomerase [Gluconobacter oxydans 621H] (160 aa)
Score = 154, Expect = 3.7e-09, Identities = 43/144 (29%), Positives = 71/144 (49%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFE----SGRHEKRLDKITK 154
           +++ IG D  G  +   +  +   L     VD+     + +  Y + +E++   +L  +   GI  CGTGIG+CI+ NKI GI AA  + T  AE A   NN ++IT+  R    E    I + + +  F+    S R+   +D + K
  S:     1 MRIAIGGDSAGEGLARLLVEHLSTLGRHVVVDMSHPEDERAELYSELSERVALAVLHGEFDRGILCCGTGIGVCISANKIPGIRAALTHDTYSAERAALSNNAHIITMGSRVIGSEVAKSIAEAWLACTFDPRSASARNVAGIDALGK 148
>gi|114762333|ref|ZP_01441791.1| ribose-5-phosphate isomerase B [Roseovarius sp. HTCC2601] >gi|114544951|gb|EAU47955.1| ribose-5-phosphate isomerase B [Roseovarius sp. HTCC2601] (153 aa)
Score = 153, Expect = 4.6e-09, Identities = 32/88 (36%), Positives = 47/88 (53%)
  Q:    54 YPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFE 141
           Y + ++++   +L       I  CGTGIG+C+A NK+ GI AA  + T  A  A   NN ++IT+  R   VE   +I   F SS F+
  S:    44 YANLSDRVATQVLDGTYDKAILCCGTGIGVCLAANKVPGIRAAQTHDTYSAGKAATSNNAHIITMGARVVGVELAKDIADAFLSSSFD 131
>gi|116248880|ref|YP_764721.1| ribose-5-phosphate isomerase B [Rhizobium leguminosarum bv. viciae 3841] >gi|167362332|ref|ZP_02296868.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Rhizobium leguminosarum bv. trifolii WSM1325] >gi|115253530|emb|CAK11922.1| putative ribose-5-phosphate isomerase [Rhizobium leguminosarum bv. viciae 3841] >gi|167070813|gb|EDR74753.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Rhizobium leguminosarum bv. trifolii WSM1325] (151 aa)
Score = 153, Expect = 4.8e-09, Identities = 44/148 (29%), Positives = 70/148 (47%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHF-ESGRHEKRLDKITKLENK 158
           +K+ I  D  G  +  K+  +H L E  D  ++   S      Y + ++++   ++       I +CGTGIG+CI+ NK+ GI AA  + T  AE A   NN  +IT+  R    E    I   F +  F E+GR    +  +  L+ K
  S:     1 MKLAIAGDSAGEGLA-KVLADH-LKERFDVYEVSRTSAGADPFYANLSDRVASGVIDGTYDKAILVCGTGIGVCISANKVPGIRAALTHDTYSAERAALSNNAQIITMGARVIGTELAKSIADAFLAQTFDENGRSAGNVKAMDDLDAK 147
>gi|23500598|ref|NP_700038.1| ribose-5-phosphate isomerase B [Brucella suis 1330] >gi|62317301|ref|YP_223154.1| ribose-5-phosphate isomerase B [Brucella abortus bv. 1 str. 9-941] >gi|148558262|ref|YP_001257801.1| ribose-5-phosphate isomerase B [Brucella ovis ATCC 25840] >gi|161620924|ref|YP_001594810.1| ribose-5-phosphate isomerase B [Brucella canis ATCC 23365] >gi|163844989|ref|YP_001622644.1| ribose-5-phosphate isomerase B [Brucella suis ATCC 23445] >gi|23464238|gb|AAN34043.1| sugar-phosphate isomerases, RpiB/LacA/LacB family [Brucella suis 1330] >gi|62197494|gb|AAX75793.1| sugar-phosphate isomerases, RpiB/LacA/LacB family [Brucella abortus biovar 1 str. 9-941] >gi|148369547|gb|ABQ62419.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Brucella ovis ATCC 25840] >gi|161337735|gb|ABX64039.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Brucella canis ATCC 23365] >gi|163675712|gb|ABY39822.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Brucella suis ATCC 23445] (151 aa)
Score = 153, Expect = 4.8e-09, Identities = 36/105 (34%), Positives = 55/105 (52%)
  Q:    54 YPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHF-ESGRHEKRLDKITKLENK 158
           Y + ++++   +L       I +CGTGIG+CIA NK+ GI AA  + T  AE A   NN  +IT+  R    E    I   F +  F E+GR    ++ I +++ K
  S:    42 YANLSDRVASAVLDGTYDRAILVCGTGIGVCIAANKVPGIRAALTHDTYSAERAALSNNAQIITMGARVIGAEVAKTIADAFLAQTFDENGRSAGNVNAINEVDAK 147
>gi|83269282|ref|YP_418573.1| ribose-5-phosphate isomerase B [Brucella melitensis biovar Abortus 2308] >gi|189022558|ref|YP_001932299.1| Ribose/galactose isomerase [Brucella abortus S19] >gi|82939556|emb|CAJ12532.1| Ribose/galactose isomerase [Brucella melitensis biovar Abortus 2308] >gi|189021132|gb|ACD73853.1| Ribose/galactose isomerase [Brucella abortus S19] (151 aa)
Score = 152, Expect = 5.2e-09, Identities = 36/105 (34%), Positives = 55/105 (52%)
  Q:    54 YPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHF-ESGRHEKRLDKITKLENK 158
           Y + ++++   +L       I +CGTGIG+CIA NK+ GI AA  + T  AE A   NN  +IT+  R    E    I   F +  F E+GR    ++ I +++ K
  S:    42 YANLSDRVASAVLDGTYDRAILVCGTGIGVCIAANKVPGIRAALTHDTYSAERAALSNNAQIITMGARVIGAEVAKTIADAFLAQTFDENGRSAGNVNAINEVDAK 147
>gi|22538069|ref|NP_688920.1| galactose-6-phosphate isomerase subunit LacA [Streptococcus agalactiae 2603V/R] >gi|25011957|ref|NP_736352.1| galactose-6-phosphate isomerase subunit LacA [Streptococcus agalactiae NEM316] >gi|76786951|ref|YP_330485.1| galactose-6-phosphate isomerase subunit LacA [Streptococcus agalactiae A909] >gi|77405046|ref|ZP_00782146.1| galactose-6-phosphate isomerase, LacA subunit [Streptococcus agalactiae H36B] >gi|77412191|ref|ZP_00788512.1| galactose-6-phosphate isomerase, LacA subunit [Streptococcus agalactiae CJB111] >gi|77414255|ref|ZP_00790416.1| galactose-6-phosphate isomerase, LacA subunit [Streptococcus agalactiae 515] >gi|81453045|sp|Q8DXC0|LACA_STRA5 Galactose-6-phosphate isomerase subunit lacA >gi|81455812|sp|Q8E344|LACA2_STRA3 Galactose-6-phosphate isomerase subunit lacA 2 >gi|84029330|sp|Q3JZ18|LACA_STRA1 Galactose-6-phosphate isomerase subunit lacA >gi|22534973|gb|AAN00793.1|AE014278_20 galactose-6-phosphate isomerase, LacA subunit [Streptococcus agalactiae 2603V/R] >gi|24413499|emb|CAD47577.1| Unknown [Streptococcus agalactiae NEM316] >gi|76562008|gb|ABA44592.1| galactose-6-phosphate isomerase, LacA subunit [Streptococcus agalactiae A909] >gi|77159707|gb|EAO70857.1| galactose-6-phosphate isomerase, LacA subunit [Streptococcus agalactiae 515] >gi|77161768|gb|EAO72758.1| galactose-6-phosphate isomerase, LacA subunit [Streptococcus agalactiae CJB111] >gi|77176340|gb|EAO79109.1| galactose-6-phosphate isomerase, LacA subunit [Streptococcus agalactiae H36B] (141 aa)
Score = 151, Expect = 7.1e-09, Identities = 43/145 (29%), Positives = 72/145 (49%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELL--EILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKL 155
           + + IG+D  G ++KE IR +   L  EI+D  D        S D+ D    I   + + + + GI +   G+G  +   K+KG+ AA V+    A + R HNN  +ITL            I++ F    +++GRH+ R+D + K+
  S:     1 MTIIIGADAHGVELKEVIRQHLTSLGKEIIDLTD-------TSKDFVDNTLAIVAKVNQKEDNLGIMVDAYGVGPFMVATKVKGMIAAEVSDERSAYMTRAHNNARMITLGSEIVGPGVAKHIVEGFVDGTYDAGRHQIRVDMLNKM 140
>gi|50554921|ref|XP_504869.1| hypothetical protein [Yarrowia lipolytica] >gi|49650739|emb|CAG77671.1| unnamed protein product [Yarrowia lipolytica CLIB122] (156 aa)
Score = 151, Expect = 7.2e-09, Identities = 32/129 (24%), Positives = 64/129 (49%)
  Q:    13 VYIGSDHGGFDMKEKIRNNHELLEILD-FVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFE 141
           + +G D  G D K +I+ + E    +D  +D+G  + ++   YP+ A    E +   +    I ICGTG+G+ I+ NK+ G+ A   + +   E +   NN  ++ +  R   +E    ++ ++ +  F+
  S:     5 IVVGCDEAGVDYKNRIKADLEKSPRVDKVIDVGVKASEDKTAYPNIAIAAAEKVASGEADRAILICGTGLGVAISANKVAGVRAVTAHDSFSVERSILSNNAQILCMGQRVVGIELARRLVAEWLTYEFD 134
>gi|90420812|ref|ZP_01228718.1| ribose/galactose isomerase [Aurantimonas sp. SI85-9A1] >gi|90335103|gb|EAS48864.1| ribose/galactose isomerase [Aurantimonas sp. SI85-9A1] (153 aa)
Score = 151, Expect = 7.6e-09, Identities = 34/105 (32%), Positives = 53/105 (50%)
  Q:    54 YPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFE-SGRHEKRLDKITKLENK 158
           Y D ++++   +L       I  CGTGIG+C++ NK+ GI AA  + T  AE A   NN  +IT+  R    E    I + + +  F+ +GR    +  I  L+ K
  S:    44 YADLSDRVASGILDGTYHRAILCCGTGIGVCLSANKVPGIRAAQTHDTYSAERAALSNNAQIITMGARVVGSELAKSIAEAYLACEFDPNGRSADNVKAIDALDAK 149
>gi|118048286|ref|ZP_01516898.1| sugar-phosphate isomerases, RpiB/LacA/LacB family [Chloroflexus aggregans DSM 9485] >gi|117995191|gb|EAV09420.1| sugar-phosphate isomerases, RpiB/LacA/LacB family [Chloroflexus aggregans DSM 9485] (153 aa)
Score = 151, Expect = 7.7e-09, Identities = 43/133 (32%), Positives = 67/133 (50%)
  Q:     6 KQLKKIKVYIGSDHGGFDMKEKI----RNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSS 138
           +Q   +++ +GSD   +     I    R  HEL      +  G  +G     +PD    +GE +   +   GI  C TG G+ IA NK+ GI AA  + +  A  AR+ N+ NV+ LS R T+ E   EI+  +F++
  S:     2 RQGGTMRIAVGSDEKNYLTDALIADLERRGHEL------ILFGPLTGTND-PWPDVGRAVGEAVASGQADQGIVCCYTGTGVSIAANKVPGIRAALCHDSQTAAGARKWNDANVLALSLRLTTPELAREILDAWFAT 131
>gi|108799528|ref|YP_639725.1| ribose 5-phosphate isomerase [Mycobacterium sp. MCS] >gi|119868641|ref|YP_938593.1| ribose 5-phosphate isomerase [Mycobacterium sp. KMS] >gi|126435182|ref|YP_001070873.1| ribose 5-phosphate isomerase [Mycobacterium sp. JLS] >gi|108769947|gb|ABG08669.1| ribose 5-phosphate isomerase [Mycobacterium sp. MCS] >gi|119694730|gb|ABL91803.1| ribose 5-phosphate isomerase [Mycobacterium sp. KMS] >gi|126234982|gb|ABN98382.1| ribose 5-phosphate isomerase [Mycobacterium sp. JLS] (159 aa)
Score = 151, Expect = 7.7e-09, Identities = 39/149 (26%), Positives = 73/149 (48%)
  Q:     4 SKKQLKKIKVYIGSDHGGFDMKEKIRNN----HELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKI 152
           + +Q  K+++ +GSD  G++ KE ++ +      + E+ D V +GT   DE   YP  A      +   K    + +CGTG+G+ I+ NK+ GI A   + +   E +   N+  V+    R   +E    + +++ +  F+     K  DK+
  S:     2 TAQQTSKLRIVVGSDDAGYEYKEALKGDLKADDRVAEVTD-VGVGT---DEDTAYPHIAVAAARMVADGKADRALLVCGTGLGVAISANKVPGIRAVTAHDSFSVERSVLSNDAQVLCFGQRVIGLELARRLAREWLNYEFDPA--SKSADKV 148
>gi|147812118|emb|CAN65782.1| hypothetical protein [Vitis vinifera] (316 aa)
Score = 151, Expect = 8.0e-09, Identities = 43/133 (32%), Positives = 71/133 (53%)
  Q:    10 KIKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKD-KGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFES 142
           + K+  G+D  G  +KE + ++ + L I +  D+GT S      Y   A +IG  +    + + G+  CGTG+G+ +  NK  G++AA      +A  AR  NN NV+ +SG  T+ E  VEI+  +  + F+S
  S:     9 RFKIVTGADSFGCSLKEALVSHLKSLNI-EVEDVGTDS------YYSVAAEIGRRVSSSPEDTRGLLACGTGVGVAMFANKFPGVFAATCLSAADALNARSINNSNVLAVSGMSTAPESAVEILDTWLKTPFKS 135
>gi|19746841|ref|NP_607977.1| galactose-6-phosphate isomerase subunit LacA [Streptococcus pyogenes MGAS8232] >gi|21911195|ref|NP_665463.1| galactose-6-phosphate isomerase subunit LacA [Streptococcus pyogenes MGAS315] >gi|28896569|ref|NP_802919.1| galactose-6-phosphate isomerase subunit LacA [Streptococcus pyogenes SSI-1] >gi|50914993|ref|YP_060965.1| galactose-6-phosphate isomerase subunit LacA [Streptococcus pyogenes MGAS10394] >gi|71904290|ref|YP_281093.1| galactose-6-phosphate isomerase subunit LacA [Streptococcus pyogenes MGAS6180] >gi|94989271|ref|YP_597372.1| galactose-6-phosphate isomerase subunit LacA [Streptococcus pyogenes MGAS9429] >gi|94993160|ref|YP_601259.1| galactose-6-phosphate isomerase subunit LacA [Streptococcus pyogenes MGAS2096] >gi|139474418|ref|YP_001129134.1| galactose-6-phosphate isomerase subunit LacA [Streptococcus pyogenes str. Manfredo] >gi|81371602|sp|Q5X9Y1|LACA2_STRP6 Galactose-6-phosphate isomerase subunit lacA 2 >gi|81652992|sp|Q7CMS1|LACA2_STRP8 Galactose-6-phosphate isomerase subunit lacA 2 >gi|81763111|sp|Q8NZD7|LACA2_STRP3 Galactose-6-phosphate isomerase subunit lacA 2 >gi|84029328|sp|Q48RC2|LACA2_STRPM Galactose-6-phosphate isomerase subunit lacA 2 >gi|19749080|gb|AAL98476.1| galactosidase acetyltransferase [Streptococcus pyogenes MGAS8232] >gi|21905407|gb|AAM80266.1| putative galactosidase acetyltransferase [Streptococcus pyogenes MGAS315] >gi|28811823|dbj|BAC64752.1| putative galactosidase acetyltransferase [Streptococcus pyogenes SSI-1] >gi|50904067|gb|AAT87782.1| Galactose-6-phosphate isomerase lacA subunit [Streptococcus pyogenes MGAS10394] >gi|71803385|gb|AAX72738.1| galactose-6-phosphate isomerase LacA subunit [Streptococcus pyogenes MGAS6180] >gi|94542779|gb|ABF32828.1| galactose-6-phosphate isomerase lacA subunit [Streptococcus pyogenes MGAS9429] >gi|94546668|gb|ABF36715.1| Galactose-6-phosphate isomerase lacA subunit [Streptococcus pyogenes MGAS2096] >gi|134272665|emb|CAM30934.1| galactose-6-phosphate isomerase LacA subunit 2 [Streptococcus pyogenes str. Manfredo] (142 aa)
Score = 150, Expect = 8.9e-09, Identities = 44/145 (30%), Positives = 73/145 (50%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTY-----SGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKL 155
           + + IG+D  G ++KE I+         D++  G Y     S +E  D+ D    + + +   + + GI I   G+G  +   KIKG+ AA V+    A + R HNN  +ITL    ++      IIK F    ++ GRH+ R+D + K+
  S:     1 MAIIIGADKAGQELKEVIK---------DYLKEGKYEVVDVSENEVRDFVDTTLAVAKEVNASEDNLGIVIDAYGVGSFMVATKIKGMVAAEVSDERSAYMTRGHNNARIITLGSEISAPGIAKNIIKGFVEGKYDGGRHQVRVDMLNKM 141
>gi|15901058|ref|NP_345662.1| galactose-6-phosphate isomerase subunit LacA [Streptococcus pneumoniae TIGR4] >gi|111657524|ref|ZP_01408266.1| hypothetical protein SpneT_02001269 [Streptococcus pneumoniae TIGR4] >gi|81531914|sp|Q97QL0|LACA_STRPN Galactose-6-phosphate isomerase subunit lacA >gi|14972675|gb|AAK75302.1| galactose-6-phosphate isomerase, LacA subunit [Streptococcus pneumoniae TIGR4] (141 aa)
Score = 150, Expect = 9.6e-09, Identities = 44/145 (30%), Positives = 71/145 (48%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKL 155
           + + IG+D  G  +KE +++  E  E    VD+      E  D+ D    +   + K++ + GI I   G G  I   KIKG+ AA V+    A + R HNN  +IT+  +    E    I K F +  ++ GRH+ R+D + K+
  S:     1 MSIVIGADAAGLRLKEVVKDFLEK-ENFHLVDVTA----EGQDFVDVTLAVAAEVNKEEQNLGIVIDAYGAGPFIVATKIKGMVAAEVSDERSAYMTRGHNNSRMITMGAQLVGDELAKNIAKGFVNGKYDGGRHQIRVDMLNKM 140
>gi|157352030|emb|CAO43020.1| unnamed protein product [Vitis vinifera] (301 aa)
Score = 150, Expect = 9.9e-09, Identities = 43/133 (32%), Positives = 71/133 (53%)
  Q:    10 KIKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKD-KGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFES 142
           + K+  G+D  G  +KE + ++ + L I +  D+GT S      Y   A +IG  +    + + G+  CGTG+G+ +  NK  G++AA      +A  AR  NN NV+ +SG  T+ E  VEI+  +  + F+S
  S:     9 RFKIVTGADSFGCSLKEALVSHLKSLNI-EVEDVGTDS------YYSVAAEIGRRVSSSPEDTRGLLACGTGVGVAMFANKFPGVFAATCLSAADALNARSINNSNVLAVSGMSTAPESAVEILDTWLKTPFKS 135
>gi|153010228|ref|YP_001371442.1| ribose-5-phosphate isomerase B [Ochrobactrum anthropi ATCC 49188] >gi|151562116|gb|ABS15613.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Ochrobactrum anthropi ATCC 49188] (152 aa)
Score = 149, Expect = 1.3e-08, Identities = 36/105 (34%), Positives = 55/105 (52%)
  Q:    54 YPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHF-ESGRHEKRLDKITKLENK 158
           Y + ++++   +L       I +CGTGIG+CIA NK+ GI AA  + T  AE A   NN  +IT+  R    E    I   F +  F E+GR    ++ I +++ K
  S:    43 YANLSDRVASAVLDGTYDRAILVCGTGIGVCIAANKVPGIRAALTHDTYSAERAALSNNAQIITMGARVIGSEVAKTIADAFLAETFDENGRSAGNVNAINEVDAK 148
>gi|4204902|gb|AAD11525.1| unknown [Brucella melitensis biovar Abortus] (151 aa)
Score = 149, Expect = 1.3e-08, Identities = 36/105 (34%), Positives = 54/105 (51%)
  Q:    54 YPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHF-ESGRHEKRLDKITKLENK 158
           Y + ++++   +L       I +CGTGIG+CIA NK+ GI AA  + T  AE A   NN  +IT+  R    E    I   F +  F E+GR    ++ I ++  K
  S:    42 YANLSDRVASAVLDGTYDRAILVCGTGIGVCIAANKVPGIRAALTHDTYSAERAALSNNAQIITMGARVIGAEVAKTIADAFLAQTFDENGRSAGNVNAINEVYAK 147
>gi|21911021|ref|NP_665289.1| galactose-6-phosphate isomerase subunit LacA [Streptococcus pyogenes MGAS315] >gi|28895294|ref|NP_801644.1| galactose-6-phosphate isomerase subunit LacA [Streptococcus pyogenes SSI-1] >gi|94994907|ref|YP_603005.1| galactose-6-phosphate isomerase subunit LacA [Streptococcus pyogenes MGAS10750] >gi|81758934|sp|Q8K651|LACA1_STRP3 Galactose-6-phosphate isomerase subunit lacA 1 >gi|21905229|gb|AAM80092.1| putative galactose-6-phosphate isomerase [Streptococcus pyogenes MGAS315] >gi|28810540|dbj|BAC63477.1| putative galactose-6-phosphate isomerase [Streptococcus pyogenes SSI-1] >gi|94548415|gb|ABF38461.1| Galactose-6-phosphate isomerase lacA subunit [Streptococcus pyogenes MGAS10750] (141 aa)
Score = 149, Expect = 1.3e-08, Identities = 40/145 (27%), Positives = 73/145 (50%)
  Q:    11 IKVYIGSDHGGFDMKEKIRN--NHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKL 155
           + + +G+D  G  +KE I++    E  +I+D  D+ +       D+ D    + + + + +G  GI +   G G  +   K+KG+ AA V+    A + R HNN  +IT+       E    I+K F +  ++ GRH+ R+D + K+
  S:     1 MAIILGADAHGNALKELIKSFLQEESYDIIDVTDINS-------DFIDNTLAVAKAVNEAEGRLGIMVDAYGAGPFMVATKLKGMVAAEVSDERSAYMTRGHNNARMITIGAEIVGPELAKNIVKGFVTGPYDGGRHQIRVDMLNKM 140
>gi|160941674|ref|ZP_02089001.1| hypothetical protein CLOBOL_06570 [Clostridium bolteae ATCC BAA-613] >gi|158435171|gb|EDP12938.1| hypothetical protein CLOBOL_06570 [Clostridium bolteae ATCC BAA-613] (149 aa)
Score = 149, Expect = 1.5e-08, Identities = 41/143 (28%), Positives = 72/143 (50%)
  Q:    13 VYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKL 155
           + +GSDH G+ +K K+    E L     +D G    ++ V +P+ A  +   +L+     GI  CGTG+G  +A NKI GI A+ V+    A    EH++VNV+ +  +        +++K F  +   +G  ++R   + +L
  S:     3 ISVGSDHAGYGLKVKMIPYLESLG-HTIIDNGNNGAEDVVFFPEVARAVCRPVLEGTAERGIMFCGTGVGASVACNKIPGIRASIVHDYQCAHQCVEHDHVNVMCIGEKVVGEWLAKDLLKAFLEA---AGDTDERTAHVIQL 141
>gi|94991216|ref|YP_599316.1| galactose-6-phosphate isomerase subunit LacA [Streptococcus pyogenes MGAS10270] >gi|94995131|ref|YP_603229.1| galactose-6-phosphate isomerase subunit LacA [Streptococcus pyogenes MGAS10750] >gi|94544724|gb|ABF34772.1| Galactose-6-phosphate isomerase lacA subunit [Streptococcus pyogenes MGAS10270] >gi|94548639|gb|ABF38685.1| Galactose-6-phosphate isomerase lacA subunit [Streptococcus pyogenes MGAS10750] (142 aa)
Score = 148, Expect = 1.5e-08, Identities = 44/145 (30%), Positives = 73/145 (50%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTY-----SGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKL 155
           + + IG+D  G ++KE I+         D++  G Y     S +E  D+ D    + + +   + + GI I   G+G  +   KIKG+ AA V+    A + R HNN  +ITL    ++      IIK F    ++ GRH+ R+D + K+
  S:     1 MAIIIGADKAGQELKEVIK---------DYLKEGKYEVVDVSENEVRDFVDTTLAVAKEVNASEDNLGIVIDAYGVGSFMVATKIKGMVAAEVSDERSAYMTRGHNNSRIITLGSEISAPGIAKNIIKGFVEGKYDGGRHQVRVDMLNKM 141
>gi|153852973|ref|ZP_01994410.1| hypothetical protein DORLON_00395 [Dorea longicatena DSM 13814] >gi|149754615|gb|EDM64546.1| hypothetical protein DORLON_00395 [Dorea longicatena DSM 13814] (148 aa)
Score = 148, Expect = 1.5e-08, Identities = 42/133 (31%), Positives = 67/133 (50%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHE---LLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESG 143
           +K+ IG D    + K++I    E     E+ DF       G E   Y + A  + E++   +   G+ ICGTG+G+ IA NK+KG YAA V+    A  AR  N+ N++ +    T  +    ++  FF++ F  G
  S:     3 MKIAIGCDPNAEEAKQEIIAYIEKKGYGEVTDF-------GSEDPIYANVAIDVAEHVASGEYDRGVLICGTGLGVSIAANKVKGAYAALVSDVYSATRARLSNDANIVCMGAFTTGAKVREMLVDAFFTNEFVPG 131
>gi|84468444|dbj|BAE71305.1| putative DNA-damage-repair/toleration protein DRT102 [Trifolium pratense] (302 aa)
Score = 148, Expect = 1.7e-08, Identities = 44/132 (33%), Positives = 70/132 (53%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSY-----GIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFES 142
           IK+  G+D  G  +K+ + ++   L I    DLGT S      Y     ++G  + +   S      G+  CGTG G+ I  NK  G++AA      +A  AR  NN NV+ +SG++TS E  +EI+  + ++ F+S
  S:     8 IKIIAGADDFGTPLKDALVSHLRSLNI-QVEDLGTSS------YYSAGAEVGRRVSQSISSSSPEVRGLVACGTGAGVSIFANKFPGVFAATCLTPSDAVNARSINNSNVLAVSGKYTSTESAIEIVNTWLNTPFKS 137
>gi|50914793|ref|YP_060765.1| galactose-6-phosphate isomerase subunit LacA [Streptococcus pyogenes MGAS10394] >gi|81371711|sp|Q5XAI1|LACA1_STRP6 Galactose-6-phosphate isomerase subunit lacA 1 >gi|50903867|gb|AAT87582.1| Galactose-6-phosphate isomerase lacA subunit [Streptococcus pyogenes MGAS10394] (141 aa)
Score = 148, Expect = 1.8e-08, Identities = 40/145 (27%), Positives = 73/145 (50%)
  Q:    11 IKVYIGSDHGGFDMKEKIRN--NHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKL 155
           + + +G+D  G  +KE I++    E  +I+D  D+ +       D+ D    + + + + +G  GI +   G G  +   K+KG+ AA V+    A + R HNN  +IT+       E    I+K F +  ++ GRH+ R+D + K+
  S:     1 MAIILGADAHGNALKELIKSFLQEEGYDIIDVTDINS-------DFIDNTLAVAKAINEAEGRLGIMVDAYGAGPFMVATKLKGMVAAEVSDERSAYMTRGHNNARMITIGAEIVGPELAKNIVKGFVTGPYDGGRHQIRVDMLNKM 140
>gi|15675561|ref|NP_269735.1| galactose-6-phosphate isomerase subunit LacA [Streptococcus pyogenes M1 GAS] >gi|71904103|ref|YP_280906.1| galactose-6-phosphate isomerase subunit LacA [Streptococcus pyogenes MGAS6180] >gi|71911211|ref|YP_282761.1| galactose-6-phosphate isomerase subunit LacA [Streptococcus pyogenes MGAS5005] >gi|94991028|ref|YP_599128.1| galactose-6-phosphate isomerase subunit LacA [Streptococcus pyogenes MGAS10270] >gi|81533437|sp|Q99YH1|LACA1_STRP1 Galactose-6-phosphate isomerase subunit lacA 1 >gi|84029327|sp|Q48RV9|LACA1_STRPM Galactose-6-phosphate isomerase subunit lacA 1 >gi|13622764|gb|AAK34456.1| putative galactose-6-phosphate isomerase [Streptococcus pyogenes M1 GAS] >gi|71803198|gb|AAX72551.1| galactose-6-phosphate isomerase LacA subunit [Streptococcus pyogenes MGAS6180] >gi|71853993|gb|AAZ52016.1| galactose-6-phosphate isomerase lacA subunit [Streptococcus pyogenes MGAS5005] >gi|94544536|gb|ABF34584.1| Galactose-6-phosphate isomerase lacA subunit [Streptococcus pyogenes MGAS10270] (141 aa)
Score = 148, Expect = 1.8e-08, Identities = 40/145 (27%), Positives = 73/145 (50%)
  Q:    11 IKVYIGSDHGGFDMKEKIRN--NHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKL 155
           + + +G+D  G  +KE I++    E  +I+D  D+ +       D+ D    + + + + +G  GI +   G G  +   K+KG+ AA V+    A + R HNN  +IT+       E    I+K F +  ++ GRH+ R+D + K+
  S:     1 MAIILGADAHGNALKELIKSFLQEEGYDIIDVTDINS-------DFIDNTLAVAKAVNEAEGRLGIMVDAYGAGPFMVATKLKGMVAAEVSDERSAYMTRGHNNARMITIGAEIVGPELAKNIVKGFVTGPYDGGRHQIRVDMLNKM 140
>gi|21219112|ref|NP_624891.1| ribose 5-phosphate isomerase [Streptomyces coelicolor A3(2)] >gi|6448714|emb|CAB61273.1| putative ribose 5-phosphate isomerase [Streptomyces coelicolor A3(2)] (170 aa)
Score = 148, Expect = 1.9e-08, Identities = 35/132 (26%), Positives = 64/132 (48%)
  Q:    10 KIKVYIGSDHGGFDMKEKIRNNHELLEIL-DFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFE 141
           K+++ +GSD  G   KE ++ +     ++ +  D+G    D    YP  A    E + + +    + +CGTG+G+ IA NK++GI A   + +   E A   NN  V+T   R   +E    +  ++ +  F+
  S:     4 KLRIVVGSDDAGHQYKEALKQDLRGSALVAEVTDVGV-DADGHTAYPKVAIAAAEMVARGEADRALLVCGTGLGVAIAANKVRGIRAVTAHDSFSVERAILSNNAQVLTFGQRVVGLELARRLAAEWLTYRFD 135
>gi|116669450|ref|YP_830383.1| ribose 5-phosphate isomerase [Arthrobacter sp. FB24] >gi|116609559|gb|ABK02283.1| ribose 5-phosphate isomerase [Arthrobacter sp. FB24] (163 aa)
Score = 147, Expect = 2.0e-08, Identities = 42/145 (28%), Positives = 71/145 (48%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLE----ILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHF-ESGRHEKRLDKITKLE 156
           ++ IG+D  G + KE ++    LLE    +   VD+G  + D S  YP  A      + + +    + ICGTG+G+ IA NK+ GI A   +     E +   NN  V+T+  R   +E   +++ ++    F E+     ++D I   E
  S:    11 RIVIGNDEAGVEYKEALK---ALLEADSRVASVVDVGVGAND-STAYPHVAVDAARKVAEGEADRALLICGTGLGVAIAANKVPGIRAVTAHDGYSVERSVLSNNAQVLTMGQRVIGLELAKKLVGEWLDYRFDETSSSAAKVDAICSYE 156
>gi|15903119|ref|NP_358669.1| galactose-6-phosphate isomerase subunit LacA [Streptococcus pneumoniae R6] >gi|116515890|ref|YP_816527.1| galactose-6-phosphate isomerase subunit LacA [Streptococcus pneumoniae D39] >gi|148985799|ref|ZP_01818927.1| galactose-6-phosphate isomerase, LacA subunit [Streptococcus pneumoniae SP3-BS71] >gi|148990448|ref|ZP_01821606.1| galactose-6-phosphate isomerase, LacA subunit [Streptococcus pneumoniae SP6-BS73] >gi|148995094|ref|ZP_01824001.1| galactose-6-phosphate isomerase subunit LacA [Streptococcus pneumoniae SP9-BS68] >gi|148999054|ref|ZP_01826486.1| galactose-6-phosphate isomerase, LacA subunit [Streptococcus pneumoniae SP11-BS70] >gi|149004144|ref|ZP_01828947.1| galactose-6-phosphate isomerase, LacA subunit [Streptococcus pneumoniae SP14-BS69] >gi|149008147|ref|ZP_01831666.1| galactose-6-phosphate isomerase subunit LacA [Streptococcus pneumoniae SP18-BS74] >gi|149013329|ref|ZP_01834060.1| galactose-6-phosphate isomerase subunit LacA [Streptococcus pneumoniae SP19-BS75] >gi|149026439|ref|ZP_01836576.1| galactose-6-phosphate isomerase, LacA subunit [Streptococcus pneumoniae SP23-BS72] >gi|168483253|ref|ZP_02708205.1| galactose-6-phosphate isomerase, LacA subunit [Streptococcus pneumoniae CDC1873-00] >gi|168486515|ref|ZP_02711023.1| galactose-6-phosphate isomerase, LacA subunit [Streptococcus pneumoniae CDC1087-00] >gi|168489020|ref|ZP_02713219.1| galactose-6-phosphate isomerase, LacA subunit [Streptococcus pneumoniae SP195] >gi|168491114|ref|ZP_02715257.1| galactose-6-phosphate isomerase, LacA subunit [Streptococcus pneumoniae CDC0288-04] >gi|168493115|ref|ZP_02717258.1| galactose-6-phosphate isomerase, LacA subunit [Streptococcus pneumoniae CDC3059-06] >gi|168577260|ref|ZP_02723054.1| galactose-6-phosphate isomerase, LacA subunit [Streptococcus pneumoniae MLV-016] >gi|169832910|ref|YP_001694632.1| galactose-6-phosphate isomerase, LacA subunit [Streptococcus pneumoniae Hungary19A-6] >gi|182684075|ref|YP_001835822.1| galactose-6-phosphate isomerase [Streptococcus pneumoniae CGSP14] >gi|194398390|ref|YP_002037798.1| galactose-6-phosphate isomerase, LacA subunit [Streptococcus pneumoniae G54] >gi|122278587|sp|Q04KC1|LACA_STRP2 Galactose-6-phosphate isomerase subunit lacA >gi|81449667|sp|Q8DPN9|LACA_STRR6 Galactose-6-phosphate isomerase subunit lacA >gi|15458698|gb|AAK99879.1| Galactose-6-phosphate isomerase LacA subunit [Streptococcus pneumoniae R6] >gi|116076466|gb|ABJ54186.1| galactose-6-phosphate isomerase, LacA subunit [Streptococcus pneumoniae D39] >gi|147755124|gb|EDK62179.1| galactose-6-phosphate isomerase, LacA subunit [Streptococcus pneumoniae SP11-BS70] >gi|147757877|gb|EDK64887.1| galactose-6-phosphate isomerase, LacA subunit [Streptococcus pneumoniae SP14-BS69] >gi|147760386|gb|EDK67365.1| galactose-6-phosphate isomerase subunit LacA [Streptococcus pneumoniae SP18-BS74] >gi|147762919|gb|EDK69866.1| galactose-6-phosphate isomerase subunit LacA [Streptococcus pneumoniae SP19-BS75] >gi|147922103|gb|EDK73226.1| galactose-6-phosphate isomerase, LacA subunit [Streptococcus pneumoniae SP3-BS71] >gi|147924300|gb|EDK75394.1| galactose-6-phosphate isomerase, LacA subunit [Streptococcus pneumoniae SP6-BS73] >gi|147926862|gb|EDK77913.1| galactose-6-phosphate isomerase subunit LacA [Streptococcus pneumoniae SP9-BS68] >gi|147929270|gb|EDK80271.1| galactose-6-phosphate isomerase, LacA subunit [Streptococcus pneumoniae SP23-BS72] >gi|168995412|gb|ACA36024.1| galactose-6-phosphate isomerase, LacA subunit [Streptococcus pneumoniae Hungary19A-6] >gi|172043428|gb|EDT51474.1| galactose-6-phosphate isomerase, LacA subunit [Streptococcus pneumoniae CDC1873-00] >gi|182629409|gb|ACB90357.1| galactose-6-phosphate isomerase [Streptococcus pneumoniae CGSP14] >gi|183570453|gb|EDT90981.1| galactose-6-phosphate isomerase, LacA subunit [Streptococcus pneumoniae CDC1087-00] >gi|183572445|gb|EDT92973.1| galactose-6-phosphate isomerase, LacA subunit [Streptococcus pneumoniae SP195] >gi|183574475|gb|EDT95003.1| galactose-6-phosphate isomerase, LacA subunit [Streptococcus pneumoniae CDC0288-04] >gi|183576725|gb|EDT97253.1| galactose-6-phosphate isomerase, LacA subunit [Streptococcus pneumoniae CDC3059-06] >gi|183577167|gb|EDT97695.1| galactose-6-phosphate isomerase, LacA subunit [Streptococcus pneumoniae MLV-016] >gi|194358057|gb|ACF56505.1| galactose-6-phosphate isomerase, LacA subunit [Streptococcus pneumoniae G54] (141 aa)
Score = 147, Expect = 2.1e-08, Identities = 43/145 (29%), Positives = 71/145 (48%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKL 155
           + + IG+D  G  +KE +++  E  E    VD+      E  D+ D    +   + K++ + GI I   G G  +   KIKG+ AA V+    A + R HNN  +IT+  +    E    I K F +  ++ GRH+ R+D + K+
  S:     1 MSIVIGADAAGLRLKEVVKDFLEK-ENFHLVDVTA----EGQDFVDVTLAVAAEVNKEEQNLGIVIDAYGAGPFMVATKIKGMVAAEVSDERSAYMTRGHNNSRMITMGAQLVGDELAKNIAKGFVNGKYDGGRHQIRVDMLNKM 140
>gi|116672494|ref|YP_833427.1| ribose-5-phosphate isomerase [Arthrobacter sp. FB24] >gi|116612603|gb|ABK05327.1| ribose-5-phosphate isomerase [Arthrobacter sp. FB24] (163 aa)
Score = 147, Expect = 2.2e-08, Identities = 42/135 (31%), Positives = 67/135 (49%)
  Q:     7 QLKKIKVYIGSDHGGFDMKEKI----RNNHELLEILDFVDLGTYSGDE----SVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFE 141
           Q   I++ +G+D  G D KE+I    R +  + EI   +D+G    D     +  YP      GE +        I  CGTGIG+ IA NK++GI AA  + +   E +   N+  V+T+  R   VE    + +++    F+
  S:     6 QAVGIRLILGADEAGVDYKERIMEDLRKDPRVSEI---IDIGVNRSDAPEKFTTPYPYVGIAAGEMIKDGLADRAILFCGTGIGVAIAANKVEGIRAATAHDSFSVERSVLSNDCQVLTMGQRVVGVELARRLAREWLGYTFD 145
>gi|46127335|ref|XP_388221.1| hypothetical protein FG08045.1 [Gibberella zeae PH-1] (162 aa)
Score = 147, Expect = 2.4e-08, Identities = 36/131 (27%), Positives = 63/131 (48%)
  Q:    11 IKVYIGSDHGGFDMKEKIRN---NHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFE 141
           +++ IG D  GF  K  I     N   +E +  +D G  +  +   Y  +A    E + + +    + ICGTG+G+ IA NK++GI A   + +   E +   NN  V+ L  R   +E    ++K++    F+
  S:     4 LRIVIGGDDAGFPYKSIIAEALLNDPRVETV--IDAGPSTESDKTAYSTFAIAAAEKVARGEADRALLICGTGLGVAIAANKVRGIRAVTAHDSFSVERSVLSNNAQVLCLGQRVVGIELAKRLVKEWLGYTFD 135
>gi|152997122|ref|YP_001341957.1| ribose-5-phosphate isomerase B [Marinomonas sp. MWYL1] >gi|150838046|gb|ABR72022.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Marinomonas sp. MWYL1] (153 aa)
Score = 146, Expect = 2.6e-08, Identities = 39/114 (34%), Positives = 56/114 (49%)
  Q:    45 TYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHF-ESGRHEKRLDKITKLENK 158
           T SG+    Y + ++++   +L  K    I  CGTGIG+CIA +K+ GI AA  + T  AE A   NN  +IT+  R    E    I   F    F E+GR    +  I  ++ K
  S:    34 TDSGEVEPFYANLSDRVANAVLDGKYDRAILCCGTGIGVCIAASKVPGIRAALTHDTYSAERAALSNNAQIITMGARVIGQELAKSIADAFLVQVFDENGRSADNVKAINSIDEK 148
>gi|110810402|sp|P0C1R5|LACA_STAAU Galactose-6-phosphate isomerase subunit lacA (142 aa)
Score = 146, Expect = 2.7e-08, Identities = 42/145 (28%), Positives = 72/145 (49%)
  Q:    11 IKVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKL 155
           + + IGSD  G  +KE I++ + L    D VD+   +  + VD+ D    + +++   +G+ GI I   G G  +   KIKG+ AA V+      + R HNN  +IT+            ++K F    ++ GRH+ R+D + K+
  S:     1 MAIIIGSDEAGKRLKEVIKS-YLLDNKYDVVDV---TEGQEVDFVDATLAVAKDVQSQEGNLGIVIDAFGTGSFMVATKIKGMIAAEVSDERSGYMTRGHNNSRMITMGSEIVGDTLAKNVVKGFVEGKYDGGRHQIRVDMLNKM 141
>gi|118375392|ref|XP_001020881.1| sugar-phosphate isomerases, RpiB/LacA/LacB family protein [Tetrahymena thermophila SB210] >gi|89302648|gb|EAS00636.1| sugar-phosphate isomerases, RpiB/LacA/LacB family protein [Tetrahymena thermophila SB210] (157 aa)
Score = 146, Expect = 2.8e-08, Identities = 35/130 (26%), Positives = 75/130 (57%)
  Q:    12 KVYIGSDHGGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKD-KGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFE 141
           ++ IGSDH GF +K ++    +    L+  D G+ + +   DYPD++ K+ + +L++ + + GI +CG+G+GI +  NK+KGI     +    A+ ++E  N N++++  R   ++   +++  F  + ++
  S:     5 RICIGSDHAGFGLKSELIKYIKNDLKLEIEDCGSENANR-CDYPDFSVKVCQKVLENTQENLGIVVCGSGVGISLGCNKVKGIRCGLSHDYYTAKYSKEVLNCNIMSMGERIIGLDVAKQMVDVFIKTQYK 134
>gi|119720147|ref|YP_920642.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Thermofilum pendens Hrk 5] >gi|119525267|gb|ABL78639.1| ribose-5-phosphate isomerase [Thermofilum pendens Hrk 5] (147 aa)
Score = 146, Expect = 3.1e-08, Identities = 49/140 (35%), Positives = 72/140 (51%)
  Q:    11 IKVYIGSDH----GGFDMKEKIRNNHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFS------SHFESGRHEKRLD 150
           +KV  G+D       F ++E  R  HE+      V +G+    +   +P  A ++ E +   K   GI +C TG G+ IA NK+KG+ AA       A  AR  N+ NV+ LS R  S E   EI+ ++FS      S  E+    K+LD
  S:     1 MKVAFGADDNYSIARFVVEELKRRGHEV------VLVGSPLTGKPYPWPKVAVEVAELVASGKVDTGIVMCYTGTGVSIAANKVKGVRAALCTDAKNARGARLWNDANVLALSARLLSEEVAKEILDEWFSVEKPDPSELENIEFVKKLD 144
>gi|19746613|ref|NP_607749.1| galactose-6-phosphate isomerase subunit LacA [Streptococcus pyogenes MGAS8232] >gi|81632549|sp|Q8NZV6|LACA1_STRP8 Galactose-6-phosphate isomerase subunit lacA 1 >gi|19748831|gb|AAL98248.1| putative galactose-6-phosphate isomerase [Streptococcus pyogenes MGAS8232] (141 aa)
Score = 146, Expect = 3.1e-08, Identities = 40/145 (27%), Positives = 72/145 (49%)
  Q:    11 IKVYIGSDHGGFDMKEKIRN--NHELLEILDFVDLGTYSGDESVDYPDYAEKIGENLLKDKGSYGIGICGTGIGICIALNKIKGIYAANVNKTIEAELAREHNNVNVITLSGRFTSVEDNVEIIKKFFSSHFESGRHEKRLDKITKL 155
           + + +G+D  G  +KE I++    E  +I+D  D+ +       D+ D    + + + + +G  GI +   G G  +   K+KG+ AA V+    A + R HNN  +IT+       E    I K F +  ++ GRH+ R+D + K+
  S:     1 MAIILGADAHGNALKELIKSFLQEESYDIIDVTDINS-------DFIDNTLAVAKAVNEAEGRLGIMVDAYGAGPFMVATKLKGMVAAEVSDERSAYMTRGHNNARMITMGAEIVGPELAKNIAKGFVTGPYDGGRHQIRVDMLNKM 140