>gi|26554137|ref|NP_758071.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454145|dbj|BAC44475.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (361 aa)
Score = 1379, Expect = 1.7e-150, Identities = 347/347 (100%), Positives = 347/347 (100%)
  Q:    15 TGAFGIVATVPVIVSSCSSTSDNNGNSDNNPGGQGDGGQQQTEVTPTIKTEVSLSGALSKIYDGKKTTSDLIAEDIKANPTNYFDNGDALKELIKDATVSVNGGFTESTFKGETYDVWSKDAKKGTYPQSAAQLNIKSINDLETQLGDSKAIQTLCESISSLKITNGSDYKVEKNALKLDGDLLHVNITAKEDGKTDRVKMDLAIPVSDLNLKIDDLKISVNGTGIKTSTDLTTKYTFNVGIDNTVKTITGAKGVLAENERKEFLKVMKALGYTDTAGTNLDNDKLSDALGLYNCSFEVTGVDPVTGSTSGEYTIKLKATPNKDYVWEDGTNTPKTDVSFVATLSNS 361
           TGAFGIVATVPVIVSSCSSTSDNNGNSDNNPGGQGDGGQQQTEVTPTIKTEVSLSGALSKIYDGKKTTSDLIAEDIKANPTNYFDNGDALKELIKDATVSVNGGFTESTFKGETYDVWSKDAKKGTYPQSAAQLNIKSINDLETQLGDSKAIQTLCESISSLKITNGSDYKVEKNALKLDGDLLHVNITAKEDGKTDRVKMDLAIPVSDLNLKIDDLKISVNGTGIKTSTDLTTKYTFNVGIDNTVKTITGAKGVLAENERKEFLKVMKALGYTDTAGTNLDNDKLSDALGLYNCSFEVTGVDPVTGSTSGEYTIKLKATPNKDYVWEDGTNTPKTDVSFVATLSNS
  S:    15 TGAFGIVATVPVIVSSCSSTSDNNGNSDNNPGGQGDGGQQQTEVTPTIKTEVSLSGALSKIYDGKKTTSDLIAEDIKANPTNYFDNGDALKELIKDATVSVNGGFTESTFKGETYDVWSKDAKKGTYPQSAAQLNIKSINDLETQLGDSKAIQTLCESISSLKITNGSDYKVEKNALKLDGDLLHVNITAKEDGKTDRVKMDLAIPVSDLNLKIDDLKISVNGTGIKTSTDLTTKYTFNVGIDNTVKTITGAKGVLAENERKEFLKVMKALGYTDTAGTNLDNDKLSDALGLYNCSFEVTGVDPVTGSTSGEYTIKLKATPNKDYVWEDGTNTPKTDVSFVATLSNS 361
>gi|26554138|ref|NP_758072.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454146|dbj|BAC44476.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (362 aa)
Score = 998, Expect = 2.4e-106, Identities = 254/345 (73%), Positives = 288/345 (83%)
  Q:    15 TGAFGIVATVPVIVSSCSSTSDNNGNSDNNPGGQGDGGQQQ--TEVTPTIKTEVSLSGALSKIYDGKKTTSDLIAEDIKANPTNYFDNGDALKELIKDATVSVNGGFTESTFKGETYDVWSKDA--KKGTYPQSAAQLNIKSINDLETQLGDSKAIQTLCESISSLKITNGSDYKVEKNALKLDGDLLHVNITAKEDGKTDRVKMDLAIPVSDLNLKIDDLKISVNGTGIKTSTDLTTKYTFNVGIDNTVKTITGAKGVLAENERKEFLKVMKALGYTDTAGTN-LDNDKLSDALGLYNCSFEVTGVDPVTGSTSGEYTIKLKATPNKDYVWEDGTNTPKTDVSFVATLS 359
           TGAFGIVATVPVIVSSCSSTSDNNG + NN       G  Q  TE+TPTIK EVSLSGALSKIYD  K+TSDLIAEDIKANPTNYFDNG+ALK+LIKDATVSVNGGFTESTFKG+TY+ WS     KKGTY Q++ QL+IKSINDLETQLGDS  I+ +C++I +LK+TNGSDYKVEKNALKLDGDLLHVNI+AKE+G T  V MDLAIPVSDLNLKID LKISV+GTGIK STDLTT Y FNVGIDNTVK IT A G +   +R++ + VMKALGYT +   + LDNDKLSDALGLYNC+FE     PV+G  + +YTI LKATPN+ YVWEDGTN PKTD++F ATL+
  S:    15 TGAFGIVATVPVIVSSCSSTSDNNGGNGNNNNNGNQDGNGQQQTEITPTIKKEVSLSGALSKIYDANKSTSDLIAEDIKANPTNYFDNGEALKDLIKDATVSVNGGFTESTFKGDTYETWSAKVGDKKGTYAQASKQLDIKSINDLETQLGDSNNIKIICDAIPTLKLTNGSDYKVEKNALKLDGDLLHVNISAKENGTT-AVSMDLAIPVSDLNLKIDALKISVSGTGIKESTDLTTNYKFNVGIDNTVKPITNATGTVTAGDREKVMTVMKALGYTVSGQDDKLDNDKLSDALGLYNCNFEAVSSKPVSGQ-ANKYTITLKATPNEGYVWEDGTNNPKTDITFEATLN 362
>gi|26554135|ref|NP_758069.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|27805656|sp|Q50367|P35_MYCPE Lipoprotein p35 precursor >gi|26454143|dbj|BAC44473.1| P35 lipoprotein [Mycoplasma penetrans HF-2] (362 aa)
Score = 855, Expect = 9.3e-90, Identities = 229/345 (66%), Positives = 269/345 (77%)
  Q:    15 TGAFGIVATVPVIVSSCSSTSDNNGNSDNNPGGQGDGGQQQTEVTPTIKTEVSLSGALSKIYDGK-----KTTSDLIAEDIKANPTNYFDNGDALKELIKDATVSVNGGFTESTFKGETYDVWSK--DAKKGTYPQSAAQLNIKSINDLETQLGDSKAIQTLCESISSLKITNGSDYKVEKNALKLDGDLLHVNITAKEDGKTDRVKMDLAIPVSDLNLKIDDLKISVNGTGIKTSTDLTTKYTFNVGIDNTVKTITGAKGVLAENERKEFLKVMKALGYTDTAGT--NLDNDKLSDALGLYNCSFEVTGVDPVTGSTSGEYTIKLKATPNKDYVWEDGTNTPKTDVSFVATLS 359
           TGAFGIVATVPVIVSSCSSTS+NNGN + N  G  DG  QQTEVTP IK+EVSL+GALSKIYD K     +TTS LI +DIKANP NYF NG+ALK++I  ATV+V+GGFTESTF GE Y VWS   D KKGTY Q++ QL+IKSINDL+T LGDS AI+ +C+ I +LK+ NG+DYKV  N L L  DLLH+N+TAK DG+TD V MDLAIPVSDLNLKID LKISV+GTGIKTS +LTT Y FN+GIDNTVKT+T A   LAE +R    KV++ LGY   +G+   LD DKL+DALGLYNC FE    +    + + +YT+ LKATPN  Y WEDGTN  K D+SFVAT S
  S:    15 TGAFGIVATVPVIVSSCSSTSENNGNGNGN--GGTDGNTQQTEVTPAIKSEVSLTGALSKIYDTKTGTDRETTSQLIVKDIKANPENYFTNGEALKDVIASATVTVDGGFTESTFTGEAYSVWSAKADVKKGTYSQASKQLDIKSINDLQTVLGDSAAIKGICDLIPNLKLNNGTDYKVTNNGLSLSEDLLHINVTAK-DGQTD-VSMDLAIPVSDLNLKIDGLKISVSGTGIKTS-ELTTNYKFNIGIDNTVKTLTPAAVTLAEADRTNAEKVLEKLGYATVSGSTYTLDQDKLADALGLYNCKFEAVKSEK-DSTNNNKYTVTLKATPNDGYFWEDGTNGAKEDISFVATFS 362
>gi|986921|gb|AAC16392.1| p35 lipoprotein [Mycoplasma penetrans] >gi|1583185|prf||2120285A lipoprotein (362 aa)
Score = 853, Expect = 1.9e-89, Identities = 228/345 (66%), Positives = 269/345 (77%)
  Q:    15 TGAFGIVATVPVIVSSCSSTSDNNGNSDNNPGGQGDGGQQQTEVTPTIKTEVSLSGALSKIYDGK-----KTTSDLIAEDIKANPTNYFDNGDALKELIKDATVSVNGGFTESTFKGETYDVWSK--DAKKGTYPQSAAQLNIKSINDLETQLGDSKAIQTLCESISSLKITNGSDYKVEKNALKLDGDLLHVNITAKEDGKTDRVKMDLAIPVSDLNLKIDDLKISVNGTGIKTSTDLTTKYTFNVGIDNTVKTITGAKGVLAENERKEFLKVMKALGYTDTAGT--NLDNDKLSDALGLYNCSFEVTGVDPVTGSTSGEYTIKLKATPNKDYVWEDGTNTPKTDVSFVATLS 359
           TGAFGIVATVPVIVSSCSSTS+NNGN + N  G  DG  QQTEVTP IK+EVSL+GALSKIYD K     +TTS LI +DIKANP NYF NG+ALK++I  ATV+V+GGFTESTF GE Y VWS   D KKGTY Q++ QL+IKSINDL+T LGDS AI+ +C+ I +LK+ NG+DYKV  N L L  DLLH+N+TAK DG+TD V MDLAIPVSDLNLKID LKISV+GTGIKTS +LTT Y FN+GIDNTVKT+T A   LAE +R    KV++ LGY   +G+   LD DKL+DALGLYNC FE    +    + + +YT+ LKATPN  Y WEDGTN  K ++SFVAT S
  S:    15 TGAFGIVATVPVIVSSCSSTSENNGNGNGN--GGTDGNTQQTEVTPAIKSEVSLTGALSKIYDTKTGTDRETTSQLIVKDIKANPENYFTNGEALKDVIASATVTVDGGFTESTFTGEAYSVWSAKADVKKGTYSQASKQLDIKSINDLQTVLGDSAAIKGICDLIPNLKLNNGTDYKVTNNGLSLSEDLLHINVTAK-DGQTD-VSMDLAIPVSDLNLKIDGLKISVSGTGIKTS-ELTTNYKFNIGIDNTVKTLTPAAVTLAEADRTNAEKVLEKLGYATVSGSTYTLDQDKLADALGLYNCKFEAVKSEK-DSTNNNKYTVTLKATPNDGYFWEDGTNGAKEEISFVATFS 362
>gi|26553722|ref|NP_757656.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26453729|dbj|BAC44060.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (368 aa)
Score = 623, Expect = 8.4e-63, Identities = 186/346 (53%), Positives = 245/346 (70%)
  Q:    15 TGAFGIVATVPVIVSSCSS---TSDNNGNSDNNPGGQGDGGQQQTEVTPTIKTEVSLSGALSKIYD--GKKTTSDLIAEDIKANPTNYFDNGDALKELIKDATVSVNGGF-TESTFKGETYDVWSKDA--KKGTYPQSAAQLNIKSINDLETQLGDSKAIQTLCESISSLKITNGSDYKVEKNALKLDGDLLHVNITAKEDGKTDRVKMDLAIPVSDLNLKIDDLKISVN------GTGIKTSTDLTTKYTFNVGIDNTVKTITGAKGVLAENERKEFLKVMKALGYTDTAGT--NLDNDKLSDALGLYNCSFEVTGVDPVTGSTSGEYTIKLKATPNKDYVWEDGTNTPKTDVSFVATLSN 360
           TGAFGIVATVPVIVSSCSS         N++   G  G+   QQ  +TP +K +V+  GALSKIYD   K+ T+ LIA+DIKANP  YF+NG  LK  I+  TV+V+G F + ++++G+TYD WSK A  KKG Y Q++AQLNI S+ DL++QL  S+ I+ LCE  S+L  ++ ++YKV+      DGDLLHVN+TAK++  T  + MD+AIPVSDLNLKI  LK+SV+      G  +    DLTT +T+N+GI++TVK IT    VLA+ ++ +  KV+KALGY   A     LDNDKLSDALGLYNC FE   V     + + +YT+ LKATPN  YVWE+GT   K +VSFVATL++
  S:    15 TGAFGIVATVPVIVSSCSSTDNNGGTGNNNNQGGGNGGNTDTQQQTITPKLKADVTTQGALSKIYDTTAKEDTNTLIAKDIKANPETYFENGADLKS-IEGWTVTVDGNFDSAASWEGQTYDEWSKTANIKKGVYEQTSAQLNIASLKDLKSQLSTSEQIKKLCED-SNLTFSDATEYKVQNQLGFTDGDLLHVNVTAKQN--TTNLVMDVAIPVSDLNLKITGLKVSVSKTENQTGNNVAEVKDLTTNFTYNIGINDTVKEIT-PTAVLAQ-DKTDANKVLKALGYATEAANVYTLDNDKLSDALGLYNCKFE--AVSSKATNEANKYTVTLKATPNDGYVWENGTKDAK-EVSFVATLND 367
>gi|26554134|ref|NP_758068.1| P35 lipoprotein homolog reported as gene for P33 lipoprotein [Mycoplasma penetrans HF-2] >gi|27805657|sp|Q50368|P33_MYCPE Lipoprotein p33 precursor >gi|26454142|dbj|BAC44472.1| P35 lipoprotein homolog reported as gene for P33 lipoprotein [Mycoplasma penetrans HF-2] (376 aa)
Score = 598, Expect = 7.0e-60, Identities = 182/345 (52%), Positives = 234/345 (67%)
  Q:    15 TGAFGIVATVPVIVSSCSS--TSDNNGNSDNNPGGQGDGGQQQTEVTPTIKTEVSLSGALSKIY------DGKKTTSDLIAEDIKANPTNYFDNGDALKELIKDATVSVNGGF-TESTFKGETYDVWS--KDAKKGTYPQSAAQLNIKSINDLETQLGDSKAIQTLC-ESISSLKITNGSDYKVEKNALKLDGDLLHVNITAKEDGKTDRVKMDLAIPVSDLNLKIDDLKISV------NGTGIKTSTDLTTKYTFNVGIDNTVKTITGAKGVLAENERKEFLKVMKALGYTDTAG-TNLDNDKLSDALGLYNCSFEVTGVDPVTGSTSGEYTIKLKATPNKDYVWEDGTNTPKTDVSFVATLS 359
           TGAFGIVATVPVIVSSCSS   +   G+++   GG G   QQ T  TP IK++V+LSGALSKIY      D +K T+ LIAEDIKANP NYF NG+ LK+ ++  +V+V+G F + S + G+ Y  WS   D  KG Y  ++ QLNI S+ DL++QL  S  I+ +C ES       +   YK++       GDLLH+N+TA + GKT  + MDL IPVSDLNLKI DLK+SV       G  +   +DLTT +T+N+GI   V   T  K  LA+ ++ E +KV+KALGYT T   T LDNDK+S++LGLYNC F      PV GS   ++TIKLKA P  DYVWEDGTNT K ++SF AT +
  S:    15 TGAFGIVATVPVIVSSCSSTDNNGGTGDNNTGGGGSGTDQQQGTTYTPAIKSDVTLSGALSKIYDTTNTGDSRKNTNTLIAEDIKANPENYFTNGEDLKK-VEGWSVTVDGSFDSNSVWTGDAYSKWSAVADTHKGVYKSTSKQLNINSLKDLKSQLDTSAKIKAICDESNLVFSTADADSYKIQNELGFTGGDLLHINVTATQAGKT--LNMDLGIPVSDLNLKITDLKVSVTASNNSTGNNVAAVSDLTTNFTYNIGIKEEVTAPT-EKPNLAKTDKGEVMKVLKALGYTQTGDETKLDNDKVSNSLGLYNCEFTAVSATPVEGSED-KFTIKLKAKPLTDYVWEDGTNTEK-EISFEATFT 372
>gi|3850057|emb|CAA07195.1| putative lipoprotein [Mycoplasma penetrans] (360 aa)
Score = 578, Expect = 1.4e-57, Identities = 173/336 (51%), Positives = 233/336 (69%)
  Q:    14 LTGAFGIVATVPVIVSSCSSTSDNNGNSDNNPGGQGDGG----QQQTEVTPTIKTEVSLSGALSKIY-----DGKKTTSDLIAEDIKANPTNYFDNGDALKELIKDATVSVNGGF-TESTFKGETYDVWSKDAK-KGTYPQSAAQLNIKSINDLETQLGDSKAIQTLCESISSLKITN--GSDYKVEKNALKLDGDLLHVNITAKEDGKTDRVKMDLAIPVSDLNLKIDDLKISV------NGTGIKTSTDLTTKYTFNVGIDNTVK-TITGAKGVLAENERKEFLKVMKALGYTDTAGTNLDNDKLSDALGLYNCSFEVTGVDPVTGSTSGEYTIKLKATPNKDYVWEDGTNTPK 349
           LTGAFGIVATVPVIVSSCSSTSDNNGN +NN    G G     QQ T  TP IKTEVSLSG+LSKIY     D +K T+++IA+DI +NP +YF NG  LK  ++  +V+VNG F ++ST+ GE Y  WS +A   G Y  ++ QLNI S+NDL+TQL DS  ++ +C++I  L+ ++   S Y+V+        DLLH+N+TA +DG   R  M+L IPVSDLNLKI  LK+SV       G  +++  +LTT +T+N+GI +TV  T         E  +    + +KALGYT T G+ LDNDK++ A+G+YNC+F  + +     +T  ++TI LKATPN++YVWEDGT   K
  S:     1 LTGAFGIVATVPVIVSSCSSTSDNNGNGNNNNDNNGGGSGTDQQQGTTYTPAIKTEVSLSGSLSKIYDTTTGDSRKNTNEMIAQDILSNPEDYFTNGADLKN-VQGWSVTVNGNFDSQSTWTGEAYSAWSANATFSGVYAMASEQLNITSLNDLKTQLSDSTKLKAICDAIPGLRFSSATASSYQVQNQVGFTGDDLLHINVTA-QDGNNTR-NMNLGIPVSDLNLKITGLKVSVNGTNNETGNNVESVENLTTDFTYNIGIKDTVDFTQPTTTPTTTEANKNNVNEALKALGYTKTDGS-LDNDKIAAAVGIYNCTFVASSIQE-DSNTPNKFTITLKATPNENYVWEDGTREAK 351
>gi|26554136|ref|NP_758070.1| P35 lipoprotein homolog reported as IMP14 [Mycoplasma penetrans HF-2] >gi|26454144|dbj|BAC44474.1| P35 lipoprotein homolog reported as IMP14 [Mycoplasma penetrans HF-2] (375 aa)
Score = 564, Expect = 4.8e-56, Identities = 176/345 (51%), Positives = 238/345 (68%)
  Q:    15 TGAFGIVATVPVIVSSCSSTSDNNGNSDNNPGGQGDGG----QQQTEVTPTIKTEVSLSGALSKIY-----DGKKTTSDLIAEDIKANPTNYFDNGDALKELIKDATVSVNGGF-TESTFKGETYDVWSKDAK-KGTYPQSAAQLNIKSINDLETQLGDSKAIQTLCESISSLKITN--GSDYKVEKNALKLDGDLLHVNITAKEDGKTDRVKMDLAIPVSDLNLKIDDLKISV------NGTGIKTSTDLTTKYTFNVGIDNTVK-TITGAKGVLAENERKEFLKVMKALGYTDTAGTNLDNDKLSDALGLYNCSFEVTGVDPVTGSTSGEYTIKLKATPNKDYVWEDGTNTPKTDVSFVATLS 359
           TGAFGIVATVPVIVSSCSSTSDNNGN +NN    G G     QQ T  TP IKTEVSLSG+LSKIY     D +K T+++IA+DI +NP +YF NG  LK  ++  +V+V+G F ++ST+ GE Y  WS +A   G Y  ++ QLNI S+NDL+TQL DS  ++ +C++I  L+ ++   S Y+V+        DLLH+N+TA +DG   R  M+L IPVSDLNLKI  LK+SV       G  +++  +LTT +T+N+GI +TV  T         E  +    + +KALGYT T G+ LDNDK++ A+G+YNC+F  + +     +T  ++TI LKATPN++YVWEDGT   K DVSF  T +
  S:    15 TGAFGIVATVPVIVSSCSSTSDNNGNGNNNNDNNGGGSGTDQQQGTTYTPAIKTEVSLSGSLSKIYDTTTGDSRKNTNEMIAQDILSNPEDYFTNGADLKN-VQGWSVTVDGNFDSQSTWTGEAYSAWSANATFSGVYAIASEQLNITSLNDLKTQLSDSTKLKAICDAIPGLRFSSATASSYQVQNQVGFTGDDLLHINVTA-QDGNNTR-NMNLGIPVSDLNLKITGLKVSVNGTNNETGNNVESVENLTTDFTYNIGIKDTVDFTQPTTTPTTTEANKNNVNEALKALGYTKTDGS-LDNDKIAAAVGIYNCTFVASSIQE-DSNTPNKFTITLKATPNENYVWEDGTREAK-DVSFDVTFT 373
>gi|26554111|ref|NP_758045.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454119|dbj|BAC44449.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (374 aa)
Score = 510, Expect = 1.1e-49, Identities = 166/347 (47%), Positives = 225/347 (64%)
  Q:    15 TGAFGIVATVPVIVSSCSST--------SDNNGNSDNNPGGQGDGGQQQTEVTPTIKTEVSLSGALSKIYDG---KKTTSDLIAEDIKANPTNYFDNGDALKELIKDATVSVNGGFTESTFK-GETYDVWSKDAK--KGTYPQSAAQLNIKSINDLETQ-LGDSKAIQTLCESISSLKITNGSDYKVEKNALKLDGDLLHVNITAKEDGKTDRVKMDLAIPVSDLNLKIDDLKISVN------GTGIKTSTDLTTKYTFNVGIDNTVK-TITGAKGVLAENERKEFLKVMKALGYTDTAGTNLDNDKLSDALGLYNCSFEVTGVDPVTGSTSGEYTIKLKATP-NKDYVWEDGTNTPKTDVSFVATLSNS 361
           TGAFGIVATVPVIVSSCSST        +  NGN  +  G  G G Q+   V P +  +VSL G+LS IY      KTT++LI+ED+K NP  YF NG  LK++IK   V+V+GGF+ S ++ G+ Y  WS      K TYP +A Q++I S+NDL+ +   D  AIQT   + ++L  T  ++Y VE       GDLLHVN+   + G    + +DL IPVS++NLK   LKISV+      GT I+  TDLTT +++N+GID+TV  T TGA     E E K+  KV++ LGY  +    LDNDK+S ALG+YNC F     +P  G   G+Y + L ATP + +Y+W+DGT+ PK D+ F  +L+ S
  S:    15 TGAFGIVATVPVIVSSCSSTDNGGSGNNTGGNGNQGDGGGSGGTGQQENKTVKPELLKDVSLGGSLSTIYSSGSDSKTTNELISEDVKTNPEKYFTNGTELKDVIKQTKVTVDGGFSASEWQNGDPYSTWSTSNGIVKVTYPAAAPQIDIASLNDLKQKTFKDDAAIQTFLTA-ANLTFTGVTNYTVENQLSLSSGDLLHVNLKGTKSGGN--LNVDLQIPVSNINLKA-TLKISVDATNNESGTNIEAVTDLTTNFSYNIGIDSTVNFTQTGATPTATEAEAKDAQKVLEKLGYVSSGA--LDNDKISAALGVYNCKFVAKSSEPGEG---GKYNVTLTATPFDSNYIWDDGTSGPK-DLQFPVSLTVS 374
>gi|26554104|ref|NP_758038.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454112|dbj|BAC44442.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (394 aa)
Score = 490, Expect = 2.3e-47, Identities = 158/346 (45%), Positives = 211/346 (60%)
  Q:    14 LTGAFGIVATVPVIVSSCSSTSDNNGNSDNNPGGQGDGGQQQTEVTPTIKTEVSLSGALSKIYD------GKKTTSDLIAEDIKANPTNYFDNG--DALKELIKDATVSVNGGFTES--------------TFKGETYDVWSKDAKKGTYPQSAAQLNIKSINDLETQLGDSKAIQTLCESISSLKITNGSDYKVEKNALKLDGDLLHVNITAKEDGKTDRVKMDLAIPVSDLNLKIDDLKISVNGTGIKTSTDLTTKYTFNVGIDNTVKTIT-GAKGVLAENERKEFLKVMKALGY-----TDTAGTNLDNDKLSDALGLYNCSFEVTGV-----DPVTGSTSGEYTIKLKATP--NKDYVWEDGTNTPKTDVSFVATLS 359
           +TGAFGIVATVPVIVS+CSSTSDNN   +      G   Q + +VTPT+K EV LSG+LSKI+D       +KTT+ LI++DIK NP NYF NG  + +KE +K+A V+VNG F+ S               +K  T  V  + A K  Y  S  Q+NI S+NDL+TQL     ++ + E   +  I  G+   +E       GDLLHVN+ AK     +    DL IPVSD+NL +  L I V G  I+ S   TTKY FN+GID  V     G+K   A +   +  +V++ L +      D    NLDN+ L  ALG+YN +F   G         T +T   +T+ LKATP  NK+YVW D  N+ + D++F  TLS
  S:    14 MTGAFGIVATVPVIVSACSSTSDNNTGGNGGTDQGGGSTQTE-KVTPTLKDEVDLSGSLSKIFDTTSEASNRKTTATLISDDIKENPENYFTNGNDEKVKEAVKNANVTVNGNFSNSEWTKEGLLPFGEDGNWKDSTTTVTIEAANKLVYATSLDQINISSLNDLKTQLTKDNGLKNILEKSGASTIAEGTTLSIENRLGFTGGDLLHVNVKAKPT-TGNETNYDLQIPVSDINLSVPSLSIEVTGDNIEASNKTTTKYDFNIGIDPVVNNYNQGSKPTAATDSDVKVNQVLQDLKFGTIDTQDNTKINLDNEALIKALGIYNVTFSAEGASINKKSTTTRATDTVFTVTLKATPTANKNYVWADNGNSEERDITFDVTLS 392
>gi|26553723|ref|NP_757657.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26453730|dbj|BAC44061.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (383 aa)
Score = 478, Expect = 5.0e-46, Identities = 167/347 (48%), Positives = 222/347 (63%)
  Q:    15 TGAFGIVATVPVIVSSCSS-TSDNNGNSDNNPGGQGDGGQQQTEVTPTIKTEVSLSGALSKIYDG----KKTTSDLIAEDIKANPTNYFDNGDALKELIKDATVSVNGGF-TESTFKGETYDVWSKDAKKGTYPQSAAQLNIKSINDL-ETQLGDSKAIQTLCESISSLKITNGSDYKVEKNALKLDGDLLHVNITAKEDGKTDRVKMDLAIPVSDLNLKIDDLKISVN------GTGIKTSTDLTTKYTFNVGIDNTVK--TITGAKGVLAENERKEFLKVMK----ALGYTDTAGTNLDNDKLSDALGLYNCSF------EVTGVDPVTGSTSGE--YTIKLKATP-NKDYVWEDGTNTPKTDVSFVATLSNS 361
           TGAFGIVATVPVIVSSCSS  + NN        GQG   QQQ+ V P IKT+V LSG LS IYD     +K T+ LI  D+K NP NYF NGD +K+ IKDATV+V+GGF  ES++ G  Y  WS       YP +A Q+NI S+NDL +T+L DS AI+T  +  +++  T  S + V+      DGDLLH+NI AK++ +   + +DL IPVS++NL+   LKIS++      G  I+   DL TK+++N+GID T+K     G       NE  +     K     LGY  ++G  L +DK+S ALG+YNC F      E T   P    T+    YT+ + ATP N+ YVW+DG+  PK D+SF  +L  S
  S:    15 TGAFGIVATVPVIVSSCSSTDNGNNNQGGTGGNGQGGDTQQQSTVKPEIKTDVKLSGKLSGIYDASETDRKDTNTLITNDVKTNPENYFTNGDQIKDAIKDATVTVDGGFKKESSWSGNPYSTWSTGTTATLYPSAAPQINIASLNDLKDTKLKDSTAIETFLKD-ANISFTGASGFSVQNQPGLTDGDLLHINIKAKQNSQD--LNLDLQIPVSNINLET-TLKISIDATTNTTGNKIEAVKDLETKFSYNIGIDATLKFEQQKGEAPAATTNEVSDAATAAKNILVKLGYV-SSGDTLSDDKISAALGIYNCKFTPKSATENTNAKPNAEVTNSNKVYTVTVTATPYNETYVWDDGSTGPK-DISFDVSLKVS 383
>gi|26554113|ref|NP_758047.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454121|dbj|BAC44451.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (365 aa)
Score = 474, Expect = 1.6e-45, Identities = 151/350 (43%), Positives = 216/350 (61%)
  Q:     1 MKIKKIKLLKALALTGAFGIVATVPVIVSSCSSTSDNNGNSDNNPGGQGDGGQQQTEVTPTIKTEVSLSGALSKIYD-----GKKTTSDLIAEDIKANPTNYFDNGDALKELIKDATVSVNGGFTE-STFKGETYDVWSKDAK---KGTYPQSAAQLNIKSINDLETQ-LGDSKAIQTLCESISSLKITNGSDYKVEKNALKLDGDLLHVNITAKEDGKTDR-VKMDLAIPVSDLNLKIDDLKIS------VNGTGIKTSTDLTTKYTFNVGIDNTV--KTITGAKGVLAENERKEFLKVMKALGYTDTAGTNLDNDKLSDALGLYNCSFEVTGVDPVTGSTSGEYTIKLKATPNKD-YVWEDGTNTPKT 350
           MK KKIKLLK LA  G+F IV+TVP I+S+CSST+D                 Q T +TP IK+EVSL G L+ IYD      +K T+ LIAEDIKAN   YF N D LK++I+ +T++V+GGF+E ST++GE ++ WS DA+   K  YP +A +++I S+N L+ + L D  +IQ   +  +    +N S++++       +GDLLHVNI A  +   +  + +DL IPVS+ NLK   LK+S      V+G  I    +LTT + +++GID  V  K +  A  V  + E  +  +++K   YTD +G NLDNDK++ A+G++N  F       V GS    Y I L A P  D Y W+DG+   KT
  S:     1 MKNKKIKLLKTLATVGSFVIVSTVPAIISACSSTAD-----------------QYTGITPVIKSEVSLQGKLTGIYDTSTGSDRKDTNTLIAEDIKANLDKYFVNVDELKDVIQTSTITVDGGFSEKSTWEGENFETWSTDARGVTKAPYPSAAPKIDITSLNALKDEILKDDASIQKFLKDANLPFTSNASNFRLLNKPGLENGDLLHVNIKANRNRNNNSDLNLDLQIPVSNFNLKT-TLKVSVSASNNVDGQNIGKDFNLTTHFNYSIGIDPAVNYKALKTALEVTPQ-ESVDATEILKLSDYTDFSG-NLDNDKIASAVGVFNSKFTPVSSVKVEGSQD-MYNITLTAEPFSDLYFWDDGSTGSKT 349
>gi|26554121|ref|NP_758055.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454129|dbj|BAC44459.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (378 aa)
Score = 468, Expect = 8.3e-45, Identities = 168/345 (48%), Positives = 221/345 (64%)
  Q:    15 TGAFGIVATVPVIVSSCSSTSDNNGNSDNNPGGQGDGGQQQTEVTPTIKTEVSLSGALSKIYD----GKKTTSDLIAEDIKANPTNYFDNGDALKELIKDATVSVNGGF-TESTFKGETYDVWSKDAKKGTYPQSAAQLNIKSINDL-ETQLGDSKAIQTLCESIS-SLKITNGSDYKVEKNALKLDGDLLHVNITAKEDGKTDRVKMDLAIPVSDLNLKIDDLKISVN-GTGIKTSTDLTTKYTFNVGIDNTVKTITGAKGVLAE-------NERKEFLKVMKALGYTDTAGTNLDNDKLSDALGLYNCSFEV---------TGVDPVTGSTSGEYTIKLKATP-NKDYVWEDGTNTPKTDVSFVATLS 359
           TGAFGIVATVPVIVSSCSSTSDNNG S+NN        QQQTE+TP +K+ V+L G L+ IYD     +K TS LI  D+KANP NYF NG+ +KE I+ + ++V+GGF T S++ G+ YD W   A +  YP +A Q+NI S+NDL ET   D  AI       S S  + + +   V       +GDLLHVN+   +  K++ VK+DL IPVS+LNLK   LK+S+  GT IK  TDL T +++N+GID T+   T  KG   E       +E      ++K LGYT  +   +DNDK+S ALG+YNC F           T    VTGS    YT+ + ATP +  YVW+DG    K D+SF  +L+
  S:    15 TGAFGIVATVPVIVSSCSSTSDNNGGSNNN---GNGDNQQQTELTPALKSNVNLQGKLTGIYDTNTTDRKNTSTLIVADMKANPDNYFTNGNEIKEGIQSSEITVDGGFSTTSSWDGDAYDTWKTGATQVMYPTAAPQINIASLNDLKETTFKDETAINKFFTDASLSESVKDVTGLNVANKLHLENGDLLHVNVKGTKTDKSE-VKIDLQIPVSNLNLKT-TLKVSIKGGTNIKEVTDLETSFSYNIGIDATL-NFTQTKGTAPEVTSSDVSDEAAAAKAILKKLGYTTGSDDAIDNDKISAALGIYNCKFTAKTAKVNDKETPNAEVTGSNK-VYTVTVTATPYDSTYVWDDGAEGGK-DISFDVSLN 376
>gi|26554156|ref|NP_758090.1| signal-peptide-less P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454165|dbj|BAC44494.1| signal-peptide-less P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (697 aa)
Score = 461, Expect = 5.4e-44, Identities = 130/305 (42%), Positives = 194/305 (63%)
  Q:    57 EVTPTIKTEVSLSGALSKIYDG-----KKTTSDLIAEDIKANPTNYFDNGDALKELIKDATVSVNGGFTESTFKGETYDVW-SKDAKKGTYPQSAAQLNIKSINDLETQLGDSKAIQTLCESISSLKITNGSDYKVEKNALKLDGDLLHVNITAKEDGKTDRVKMDLAIPVSDLNLKIDDLKISVNGTGIKTSTDLTTKYTFNVGIDNTVKTITGAKGV--LAENERKEFLKVMKALGYTDTAGTN--LDNDKLSDALGLYNCSFEVTGVDPVTGSTSGEYTIKLKATPNKDYVWEDGTNTPKTDVSFVATLSNS 361
           E+TP++ + + L G+LS+I+D      +K T+ +IAEDIK+N  NYF NG+ LK  ++D  V+VNG F  ST+ G  YD W S  +  G Y   +AQ++I S+NDL+T+L        L  +   LK + GS + ++       GDLLHVNI    +  T+   +DLAIPVSD+NLK+ +L +SV+G+ +K  ++ +  YT+NVGID+TV  +    GV  L+   +    + + +LG+   +GTN  L+ DK+S ALG++NC+FE   +     ST+  +TI LKATPN +Y WEDGTN PK ++SF   L+ S
  S:   389 EITPSLNSTLDLKGSLSRIFDTSGSGTRKDTNTVIAEDIKSNLNNYFSNGNDLKT-VEDLDVTVNGNFPTSTWTGVAYDTWKSSTSYTGIYSSESAQIDITSLNDLKTKLTTKGLYGILLAA--GLKFS-GSSFAIQNEIGLSGGDLLHVNIRITSEWTTNPFTVDLAIPVSDINLKVSNLGVSVSGSNVKALSNGSVNYTYNVGIDDTVNFVKPTTGVTALSSANKTNVNEALVSLGFATKSGTNYTLNKDKISAALGVFNCTFEGISIQE-DASTANNFTITLKATPNTNYYWEDGTNVPK-ELSFKVDLTVS 697
Score = 346, Expect = 1.2e-30, Identities = 135/359 (37%), Positives = 213/359 (59%)
  Q:     1 MKIKKIKLLKALALTGAFGIVATVP-------VIVSSCSSTSDNNGNSDNNPGGQGDGGQQQTEVTPTIKTEVSLSGALSKIYDGKKTTSD----LIAEDIKANPTNYFDNGDALKELIKDATVSVNGGFTES-TFKGETYDV---WSKD--AKKGTYPQSAAQLNIKSINDLETQLGDSKAIQTLCESISSLKITNGSDYKVEKNA-LKLDGD-LLHVNITAKEDGKTDRVKMDLAIPVSDLNLKIDDLKISVNGTGIKTSTDLTTKYTFNVGI-DNTVKTITGAKGVLAENERKEFLKVMKALGYTDTAGTN---LDNDKLSDALGLYNCSFEVTGVD-----PVTGSTSGEYTIKLKA--TPNKDYVWEDGTNTPKTDVSFVATLS 359
           MK ++ KLLK L++TG F   A VP       VI +S +++ + N   +NN  G GD   Q   + P +K+ ++LSG+L KI+D K ++S     LIA++IK N    FDN   L E + + ++SV+GGF+   T+  + YD    W K+    +  Y  S  Q NI S++D ++QL +   ++ +     + K  + + Y +   + L L GD L+HVN+  + D  ++   +DL IP+S++NL + ++ +SV+G  ++T T+ TT +++NVGI D +  T      V + +E K   K++  LGY + A  N   L+ D L + LG+YN +F             T  T+G Y I L A  TPNKD+VWEDGT+  K  VSF   +S
  S:     1 MKSQRKKLLKILSITGIFVATAAVPITLLSKYVISASLTNSKNQNNQDNNNQDGGGDTTPQAQTIVPKLKSSINLSGSLDKIFDAKNSSSSNTNSLIAQEIKNNLDKSFDNASDL-EKVNNLSISVDGGFSGGVTWGNKQYDQNIGWGKETVGNEILYGSSLDQFNISSLDDFKSQLNNDTKLKDIISKSDASKFDSTATYSIASGSNLGLVGDNLVHVNVI-ETDASSNTKSIDLQIPISNINLNVSNMIVSVSGDNVETQTNKTTNFSYNVGISDQSQFTNPVDAPVASASEVKSANKILVKLGYAEVAANNQITLNQDLLKEELGIYNVTFSNANASIAPNGSTTDGTTGSYKISLDATPTPNKDFVWEDGTSDTKP-VSFNVNVS 386
>gi|26554119|ref|NP_758053.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454127|dbj|BAC44457.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (386 aa)
Score = 453, Expect = 3.6e-43, Identities = 151/337 (44%), Positives = 210/337 (62%)
  Q:    14 LTGAFGIVATVPVIVSSCSSTSDNNGNSDNNPGGQGDGGQQQTEVTPTIKTEVSLSGALSKIYD-----GKKTTSDLIAEDIKANPTNYFDNG--DALKELIKDATVSVNGGFT----ESTFKGETYDVWSKDAKKG---------------TYPQSAAQLNIKSINDLETQLGDSKAIQTLCESISSLKITNGSDYKVEKNALKLDGDLLHVNITAKEDGKTDRVKMDLAIPVSDLNLKIDDLKISVNGTGIKTSTDLTTKYTFNVGIDNTVKTITGAKGVLAENERKEFL-KVMKALGYTDTAGTNLDNDKLSDALGLYNCSFEVTGVDPVTGSTS---GEYTIKLKATPNKD-YVWEDGTNTPKT 350
           +TGAFGIVATVPVIVSSCSSTSDNN   +NN        QQ  +VTP +K  VSLSG+LSKIYD      +KTT+DLI EDIK NP NYF NG   A+KE +K+ATV+V G FT    ES +K   Y   S+ ++                 TY  ++ Q+ IKS++DL T+L   + ++   +  + +  T+ + + ++  A   +GDL+HVN+   + G   + + DL IP SD+NL + DL I V GT I+TS   TT Y FN+GI+       G+  V A N+    + KV++ L     A   L+N+ L  ALG+YN +F    + P  G+T+     YTI L A P  + YVW DG+++  T
  S:    14 MTGAFGIVATVPVIVSSCSSTSDNNTGGENN-------NQQTQKVTPVLKDSVSLSGSLSKIYDTTTGENRKTTNDLITEDIKENPENYFTNGSESAVKEAVKNATVTVEGNFTTAGSESPWKELPYLDSSETSENATAAKSWKATTGLQEVTYATNSDQIEIKSLDDLHTKLSVEQTLKDAMKG-AGVADTDTTTFTIKNRAGFTNGDLIHVNVEGDKSGT--KTQYDLQIPTSDINLSVTDLTIKVEGTNIETSQKTTTNYDFNIGIEPETHYDQGSTTVTAANDAAVTVNKVLQDLSLATDANGTLNNEALIKALGVYNVNFSNPTIAPKEGATTRAEKTYTITLDAKPQSEKYVWSDGSDSNTT 371
>gi|26554123|ref|NP_758057.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454131|dbj|BAC44461.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (388 aa)
Score = 447, Expect = 2.0e-42, Identities = 156/344 (45%), Positives = 212/344 (61%)
  Q:    15 TGAFGIVATVPVIVSSCSSTSDNNGNSDNNPGGQGDGGQQQTEVTPTIKTEVSLSGALSKIYD-------GKKTTSDLIAEDIKANPTNYFDNGDA--LKELIKDATVSVNGGFTESTFKGETYDVWS--------KDAKKGTYPQSAAQLNIKSINDLETQL----GDSKAIQTLCESISSLKITNGSDYKVEKNALKLDGDLLHVNITAKEDGKTDRVKMDLAIPVSDLNLKIDDLKISVNGTGIKTSTDLTTKYTFNVGIDNTVKTITGAKGVLAENERKEFLKVMKA-------LGY-TDTAGTNLDNDKLSDALGLYNCSF------EVTGVDPVTGSTSGE--YTIKLKATP-NKDYVWEDGTNTPKTDVSFVATL 358
           TGAFGIVATVP+IVSSCSST      SDNN GG  D GQQ  +VTP +K EV L G+LSKI+D        +K+T+ LI+EDIKANP NYF NG+   +KE I+ AT+ V G F+ +++ G  Y+  S        +DA K  Y  S+AQL  K ++ L+T+L     D+K +       +   I   +   ++       GDL+H+N+ A + G   + + DL IP S+LNL +  L I V+G  I T+   TT + +N+GID+T+     AKG   E           A       LGY T T G++L NDK+S ALG+YNC+F      E  G  P  G T     YT+ + ATP N  YVW+DG++  K D SF  +L
  S:    15 TGAFGIVATVPIIVSSCSST------SDNNTGGNQD-GQQTQKVTPVLKDEVDLKGSLSKIFDTTATDASSRKSTNTLISEDIKANPENYFTNGNETNVKEAIEKATIDVEGNFSNASWTGNAYNTTSNGWDGVTIEDANKLIYTTSSAQLTFKDLDGLKTELEKNGTDNKTVLQNALEAAGATIEADTTLTIKNRVGFTSGDLIHINVEADKSGT--QTQYDLQIPTSNLNLSVTGLTIKVSGDNINTNEKTTTNFKYNIGIDSTLG-FEQAKGAAPEETANNLSDAATAAKNILVKLGYVTTTGGSDLSNDKISAALGIYNCNFTPKSATEKQGATPDAGVTDANKVYTVTVTATPFNDTYVWDDGSSGEK-DFSFDVSL 385
>gi|26554132|ref|NP_758066.1| P35 lipoprotein homolog reported as gene for P38 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454140|dbj|BAC44470.1| P35 lipoprotein homolog reported as gene for P38 lipoprotein [Mycoplasma penetrans HF-2] (383 aa)
Score = 447, Expect = 2.1e-42, Identities = 155/345 (44%), Positives = 214/345 (62%)
  Q:    15 TGAFGIVATVPVIVSSCSSTSDNNGNSDNNPGGQGDGG--------QQQTEVTPTIKTEVSLSGALSKIY-DGKKTTSDLIAEDIKANPTNYFDNGDALKELIKDATVSVNGGFTESTF-KGETYDVWS--KDAKKGTYPQSAAQLNIKSINDLETQ-LGDSKAIQTLCESISSLKITNGSDYKVEKNALKLDGDLLHVNITAKEDGKT-DRVKMDLAIPVSDLNLKIDDLKISVN------GTGIKTSTDLTTKYTFNVGIDNTVK-TITGAKGVLAENERKEFLKVMKALGYTDTAGTNLDNDKLSDALGLYNCSFEVTGVDPVTGSTSG-----EYTIKLKATP-NKDYVWEDGTNTPKTDVSFVATLS 359
           TGAFGIVATVP+IVSSCSST +    ++    G    G        Q+   V P +K  V L+G LS IY    KTT++LI+EDIKANP NYF NG  LK++I  +TV+V+GGF+ S + +G  Y  WS      K TYP +A Q++I S+N L+ +   D   IQ    + ++L  +N S + VE      +GDLLHVNI A         + +DL IPVS++NLK   LK+SV+      GT I+  +DLTT +++N+GID+T+  T TG        E     +V+K LGY    G NLDNDK+S ALG+YNC F         G+T+G      YT+ + A P + +YVW+DG+   K + SF  +L+
  S:    15 TGAFGIVATVPIIVSSCSSTDNGGSGNNTGGNGNQGDGGGSGNTDQQENKTVKPELKDNVELNGKLSTIYGTDSKTTNELISEDIKANPENYFTNGSELKDVINQSTVTVDGGFSASQWTEGSDYTTWSAVTGVVKVTYPAAAPQIDIASLNALKQETFKDDTTIQAFLTA-ANLSFSNTSSFTVENKLGLTNGDLLHVNIKANRTAANGGNLNLDLQIPVSNINLKT-ILKVSVSATNNSTGTNIEAVSDLTTNFSYNIGIDSTLNFTQTGTAPTATTAEANNATEVLKKLGY--QTGNNLDNDKISAALGIYNCKFTPKSATEKQGATAGLGGNKVYTVVVDAAPYDSNYVWDDGSTDTK-EFSFDVSLT 381
>gi|26554196|ref|NP_758130.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454205|dbj|BAC44534.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (382 aa)
Score = 446, Expect = 2.9e-42, Identities = 144/332 (43%), Positives = 208/332 (62%)
  Q:    15 TGAFGIVATVPVIVSSCSSTSDNNGNSDNNPGGQGDGGQQQTEVTPTIKTEVSLSGALSKIYD----GKKTTSDLIAEDIKANPTNYFDNGDALKELIKDATVSVNGGFTEST-------------FKGETYDVWSKDAKKGTYPQSAAQLNIKSINDLETQLGDSKAIQTLCESISSLKITNGSDYKVEKNALKLDGDLLHVNITAKEDGKTDRVKMDLAIPVSDLNLKIDDLKISVNGTGIKTSTDLTTKYTFNVGIDNTVKTITGAKGVLA-ENERKEFLKVMKALGYTDTAGT--NLDNDKLSDALGLYNCSFEVTGVDPVTGSTSG----EYTIKLKATP-NKDYVWEDGTN 346
           TGAFGIVATVPVIVSSCSSTS+NN  + N       G  Q  +VTP +K +VSL GAL+KIYD     +K T+ LIA+DIKANP NYF NG  LK +I DATV+V+G F+ ++             +K +T  V  +D+ K  Y  S+ Q+NI S++ L+T+L  +  ++   E+  +  I +G+   VE      + DL+H+N+ A      +    DL IP SD+NL + DL ++V G  I+ +T  TT +T+N+GID+ V    GA    A E++ K+  KV++ L Y  T G+  +LDN+ +   LG+YN +F    +   T S+       YTI L A P + +YVW DG++
  S:    15 TGAFGIVATVPVIVSSCSSTSENNNGNGNG------GADQTQKVTPVLKDDVSLEGALNKIYDTSTTDRKNTNTLIADDIKANPENYFTNGAELKNVISDATVTVDGKFSNASWASGLSYDATTGNWKDDTTTVTIQDSNKLVYASSSKQINITSLDGLKTELEKTDVLKNALEAAGATTIASGTTLTVENKLGFTNDDLIHINVKATPTSGAE-TNYDLQIPTSDINLSVTDLSVTVTGNNIEAATKTTTNFTYNIGIDSEVHFNQGANLTAASEDDAKDVNKVLEQLKYGSTTGSTFSLDNNAIIKGLGIYNVNFSNPSIQEKTVSSRATSEKTYTITLDAKPQSSEYVWADGSD 364
>gi|26554128|ref|NP_758062.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454136|dbj|BAC44466.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (353 aa)
Score = 442, Expect = 6.8e-42, Identities = 146/327 (44%), Positives = 201/327 (61%)
  Q:    14 LTGAFGIVATVPVIVSSCSSTSDNNGNSDNNPGGQGDGGQQQTEVTPTIKTEVSLSGALSKIYD-------GKKTTSDLIAEDIKANPTNYFDNG--DALKELIKDATVSVNGGFTESTFKGETYD----VWS----KDAKKGTYPQSAAQLNIKSINDLETQL-----GDSKAIQTLCESISSLKITNGSDYKVEKNALKLDGDLLHVNITAKEDGKTDRVKMDLAIPVSDLNLKIDDLKISVNGTGIKTSTDLTTKYTFNVGIDNTVKTITGAKGVLAENERKEFLKVMKALGYTDTAGTNLDNDKLSDALGLYNCSFEVTGVDPVTGSTSGEYTIKLKATPNKDYV 340
           +TGAFGIVATVPVIVSSCSSTSDNNGN + N      G  +  +VTP +K  V L G+LSKI+D        +K+T+ LI+EDIKANP +YF NG    ++  I+ AT+ V G F+ +++ G  YD     WS    +DA K  Y  ++AQL  K ++ L+ +L      DSK +  +    +     +G+   +E      + DL+HVN+ A      + V  DL IP SDLNL +  L I V G  I      TT +T+N+GI   V   T  K  LA  ++   +KVM+ALGYT+TAG  LD++K+S  LGLYNC F +      T + +G +TIK+ ATPN+ YV
  S:    14 MTGAFGIVATVPVIVSSCSSTSDNNGNGNTN------GNTETQKVTPVLKDSVDLKGSLSKIFDTTATDAASRKSTNTLISEDIKANPEDYFTNGSDSNVQSAIQSATIDVEGNFSNASWTGNAYDTNTNTWSGVTIEDANKLVYTSNSAQLTFKDLDGLKAELEKTTGTDSKTVAQVALEAAGATFASGTTITIENRLGFTNDDLIHVNVKAAPS-SGNPVNYDLQIPTSDLNLSVTGLSIKVTGENITEGEKTTTNFTYNIGIKEGVIVPTD-KPNLATADKGTQMKVMEALGYTNTAGDALDDNKISVKLGLYNCKFTLVSATEDT-NNAGTFTIKISATPNEGYV 353
>gi|986922|gb|AAC16393.1| p33 lipoprotein [Mycoplasma penetrans] >gi|1583186|prf||2120285B lipoprotein (318 aa)
Score = 440, Expect = 1.3e-41, Identities = 137/271 (50%), Positives = 181/271 (66%)
  Q:    15 TGAFGIVATVPVIVSSCSS--TSDNNGNSDNNPGGQGDGGQQQTEVTPTIKTEVSLSGALSKIY------DGKKTTSDLIAEDIKANPTNYFDNGDALKELIKDATVSVNGGF-TESTFKGETYDVWS--KDAKKGTYPQSAAQLNIKSINDLETQLGDSKAIQTLC-ESISSLKITNGSDYKVEKNALKLDGDLLHVNITAKEDGKTDRVKMDLAIPVSDLNLKIDDLKISV------NGTGIKTSTDLTTKYTFNVGIDNTVKTITGAKGVLAENERKEFLKVMKAL 285
           TGAFGIVATVPVIV SCSS   +   G+++   GG G   QQ T  TP IK++V+LSGALSKIY      D +K T+ LIAEDIKANP NYF NG+ LK+ ++  +V+V+G F + S + G+ Y  WS   D  KG Y  ++ QLNI S+ DL++QL  S  I+ +C ES       +   YK++       GDLLH+N+TA + GKT  + MDL IPVSDLNLKI DLK+SV       G  +   +DLTT +T+N+GI   V   T  K  LA+ ++ E +KV+KAL
  S:    15 TGAFGIVATVPVIVYSCSSTDNNGGTGDNNTGGGGSGTDQQQGTTYTPAIKSDVTLSGALSKIYDTTNTGDSRKNTNTLIAEDIKANPENYFTNGEDLKK-VEGWSVTVDGSFDSNSVWTGDAYSKWSAVADTHKGVYKSTSKQLNINSLKDLKSQLDTSAKIKAICDESNLVFSTADADSYKIQNELGFTGGDLLHINVTATQAGKT--LNMDLGIPVSDLNLKITDLKVSVTASNNSTGNNVAAVSDLTTNFTYNIGIKEEVTAPT-EKPNLAKTDKGEVMKVLKAL 299
>gi|26554127|ref|NP_758061.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454135|dbj|BAC44465.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (384 aa)
Score = 440, Expect = 1.4e-41, Identities = 154/336 (45%), Positives = 212/336 (63%)
  Q:    14 LTGAFGIVATVPVIVSSCSSTSDNNGNSDNNPGGQGDGGQQQTEVTPTIKTEVSLSGALSKIYDGKKT--TSDLIAEDIKANPTNYFDNGDALKELIKDATVSVNGGFTESTFKGETYDVWS---------------KDAKKGTYPQSAAQLNIKSINDLETQLGDSKAIQTLCES------ISSLKITNGSDYKVEKNALKLDGDLLHVNITAKEDGKT-DRVKMDLAIPVSDLNLKIDDLKISVNGTGIKTSTDLTTKYTFNVGIDNTVKTI-TGAKGVLAENER--KEFLKVMKALGYTDTAG--TNLDNDKLSDALGLYNCSFEVTGVDP-VTGSTSGEYTIKLKATPNKDYVWEDGTNTPK 349
           +TGAFGIVATVPVIVS+CSSTSDNNGN++N         QQ   +TP IKTE  LSGALS IYD   T  T++LIA +IK N +  F+NG+ L + + D  VSV   F  ST+ G ++D  S                DA K  Y      L+I S++DL+TQL D+K    L ++       ++  + N   +  +K     + DLLHVN+   + G        DL IPVSDLNLK+ DL ++V GT +  +T+ TT  T+N+GI++ V+ +   AK  +A + +  KE +  +KALGYT T      +DNDK++ ALG+YNC+F +   +P V    + ++T  L ATPN  YVWEDGTNT K
  S:    14 MTGAFGIVATVPVIVSACSSTSDNNGNNNNGGDTN----QQTQSITPKIKTESKLSGALSNIYDTANTGKTNELIANEIKKNLSEVFENGEDLSK-VNDLQVSVTHTFPASTWTGLSFDAASGNWKHSTDSNQDVTITDANKLLYASKTQALDISSLSDLKTQLDDTKLKAILTDTGVTPAADTTYSVANALGFTNKKKDDTNNRDLLHVNVVGTKTGSNPGTTNYDLQIPVSDLNLKLTDLSVTVKGTNVAETTEKTT-LTYNIGINDVVEFVDPSAKPTVAASVKTNKETMNALKALGYTATVSGQDQIDNDKVAAALGIYNCTFTLAAENPLVIDDATNKFTFNLVATPNSGYVWEDGTNTAK 373
>gi|26554122|ref|NP_758056.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454130|dbj|BAC44460.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (383 aa)
Score = 422, Expect = 1.6e-39, Identities = 156/330 (47%), Positives = 210/330 (63%)
  Q:    15 TGAFGIVATVPVIVSSCSSTSDNNGNSDNNPGGQGDGGQQQTEVTPTIKTEVSLSGALSKIY----DGKKTTSDLIAEDIKANPTNYFDNGDALKELIKDATVSVNGGFTESTFK---GETYDVWSKDAKKG----TYPQSAAQLNIKSINDLET-QLGDSKAIQTLC--ESISSLKITNGSDYKVEKNALKLDGDLLHVNITAKEDGKTD---RVKMDLAIPVSDLNLKID-----DLKISVNGTGIKTSTDLTTKYTFNVGIDNTVK-TITGAKGVLAENERKEFLKVMKALGYTDTAGTNLDNDKLSDALGLYNCSF------EVTGVDPVTGSTSGEYTIKLKATP-NKDYVWEDG 344
           TGAFGIVATVPVIVSSCSSTSDNN N +     QG   Q QT V P +K+EV+LSG L+ +Y    D +K T+ LI++DIKANP  YF+N   +K+ IKDA V+VNG F+ S +     + Y  WSKD  +     TYP +A Q++I S+N+L+T    DS  I T      I+  K +    ++VE       GDLLHVN+  K D KT     + +DL IPVS++NLK       D   +  G  I+  +DL T +++N+GID+TV  T       L + E  +  +V+K LGY  T GT +DNDK+S A+G+YNC F      E T V   TG  +  Y + L A P + +YVW+DG
  S:    15 TGAFGIVATVPVIVSSCSSTSDNNVNGNGG---QGGDQQTQTSVKPDLKSEVNLSGKLTGVYDTSADNRKDTNTLISDDIKANPDKYFNNAADIKDAIKDAKVTVNGNFSASEWNTQGAKDYAEWSKDNSQAIPTVTYPTAAKQIDIASLNELKTVTFKDSDTISTFITESKITIDKFSEMEKFRVENKLHLSSGDLLHVNL--KADNKTTGQAGLNLDLQIPVSNINLKTSLTVSVDATTNTTGNKIEAVSDLKTNFSYNIGIDSTVNFTDPKISQSLTKTEADDATEVLKKLGYAGTDGT-IDNDKVSAAIGVYNCKFTAVSSKEDTTVSAKTGKKA--YKVTLSAEPFDSNYVWDDG 366
>gi|26554109|ref|NP_758043.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454117|dbj|BAC44447.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (353 aa)
Score = 413, Expect = 1.8e-38, Identities = 135/326 (41%), Positives = 195/326 (59%)
  Q:    15 TGAFGIVATVPVIVSSCSSTSDNNGNSDNNPGGQGDGGQQQTEVTPTIKTEVSLSGALSKIYD--GKKTTSDLIAEDIKANPT-NYFDNGDALKELIKDATVSVNGGFTESTFKGETY---------------DVWSKDAKKGTYPQSAAQLNIKSINDLETQLGDSKAIQTLCESISSLKITNGSDYKVEKNALKLDGDLLHVNITAKEDGKTDRV-KMDLAIPVSDLNLKIDDLKISVNGTGIKTSTDLTTKYTFNVGIDNTVKTITGAKGVLAENER---KEFLKVMKALGYTDTAGT--NLDNDKLSDALGLYNCSFEVTGVDPVTGSTSGEYTIKLKATPNKDYV 340
           TGAFGIVATVPVIVSSCSSTSDNN   D+N         Q   +TP ++  V+LSGAL+ IYD  G +  +  IA DIK N   + F NG+AL + + D TV+VNG F+  ++ G T+               ++   +A K  Y   + Q++I+S+NDL  +L     ++T  E+    +I   +   +  N    +GDLLHVN++A   G    +   DL IPVS+LNL + +L I+V+GT +  +   TT + FN+GI++TV   T  KG LA + R   +  + +  A   TD+  T   +DND +S  +G+YNC+F    +  V  S +G YTI L+ATP   YV
  S:    15 TGAFGIVATVPVIVSSCSSTSDNNTGGDSN--------TQTQTITPELRETVNLSGALTDIYDSTGAQNANQKIAADIKENHLGDVFTNGEALSQ-VSDLTVTVNGNFSRDSWAGLTFNGETGNWEDSANNQNNITIAEANKLVYTSESEQIDIESLNDLHEKLSVRDTLKTALENAGVAQIPETTTLAINNNLGFTNGDLLHVNVSATPTGSNPTITNYDLQIPVSNLNLVVPNLTITVSGTNVGEANRTTTNFNFNIGINDTVSE-TDEKGELAADNRSANEALVALGLATSSTDSGNTTYTIDNDAVSAVVGVYNCNFASPTIQAVDES-AGTYTITLQATPLDGYV 353
>gi|26554126|ref|NP_758060.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454134|dbj|BAC44464.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (388 aa)
Score = 409, Expect = 5.7e-38, Identities = 155/345 (44%), Positives = 212/345 (61%)
  Q:    14 LTGAFGIVATVPVIVSSCSSTSDNNGNSDNNPGGQGDGGQQQTEVTPTIKTEVSLSGALSKIYD--GKKTTSDLIAEDIKANP-TNYFDNGDALKELIKDATVSVNGGFTESTFKGETYDV----WSKD--------AKKGTYPQSAAQLNIKSINDLETQLGDSKAIQTLCESISSLKITNGSDYKVEKNALKLDGDLLHVNITAKEDGKTDR----VKMDLAIPVSDLNLKIDDLKISVNGTGIKTSTDLTTKYTFNVGIDNTV---KTITGAKGVLAENERKEFL---KVMKALGYTDTAGTNLDNDKLSDALGLYNCSF------EVTGVDPVTGSTSGE--YTIKLKATP-NKDYVWEDGTNTPKTDVSFVATL 358
           +TGAFGIVATVPVIVSSCSSTSDNN   D N      GG Q   +TP +K  VSLSG LS I+D  G +  ++ IA DIK N  ++ FDNGDALK+ + D  V+V G F   ++ G TYD     W  D        A K  Y   + QLNI S+NDL+TQL     ++   E      I + +   V  N + L  DLLH+N+++     + +       DL IPVS++NL +++L I+V GT +  +T  TT + FNVGID T+   +T T       E+E ++      +++ LGY  ++G  L +DK+S ALG+YNC F      E T V P +G T     Y + + ATP + +YVW+DGT  PK D+SF   L
  S:    14 MTGAFGIVATVPVIVSSCSSTSDNNTGGDGN-----GGGTQTQTITPQLKDSVSLSGPLSDIFDSTGTQNANEKIAADIKDNHLSDVFDNGDALKQ-VSDLKVTVAGDFKRDSWSGGTYDAASGGWKSDSGDVTISAANKLVYASESPQLNISSLNDLKTQLSVKATLKEALEKAGVSTIADTTTLAVNNN-IGLTDDLLHINVSSTPQVASGQTATTTNYDLQIPVSNINLVVNNLTITVAGTNVGEATKTTTNFKFNVGIDATLSFKQTGTAPDVSKTESEAEQATLASTILQKLGYV-SSGNTLSDDKISAALGIYNCKFTPKSATENTEVQPDSGITGSNKVYKVTVTATPYDTNYVWDDGTTGPK-DISFDVNL 383
>gi|26554107|ref|NP_758041.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454115|dbj|BAC44445.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (386 aa)
Score = 408, Expect = 6.4e-38, Identities = 139/335 (41%), Positives = 202/335 (60%)
  Q:    15 TGAFGIVATVPVIVSSCSSTSDNNGNSDNNPGGQGDGGQQQTEVTPTIKTEVSLSGALSKIYD--GKKTTSDLIAEDIKANPTN-YFDNGDALKELIKDATVSVNGGFTESTFKGETYDVWS------------------KDAKKGTYPQSAAQLNIKSINDLETQLGDSKAIQTLCESISSLKITNGSDYKVEKNALKLDGDLLHVNITAKEDGKTDRV-KMDLAIPVSDLNLKIDDLKISVNGTGIKTSTDLTTKYTFNVGIDNTVKTITGAKGVLAENERKEFLKVMKALGY--TDTAGTN----LDNDKLSDALGLYNCSFEVTG--VDPVTGSTSGEYTIKLKATPNKDYVWEDGTNTPK 349
           TGAFGIVATVPVIVS+CSSTSDNN   +         G Q   + P ++  V+LSGALS I+D  G +  +  IA DI+ N  N  F NG  L + ++D TVSV G F+ S++ G T++  S                  ++A K  Y   + Q +I S++D +T+L     ++T  E+  +  I N +   V  N    D DLLH+N+TA   G +  V   DL IPVS+LN+ + +L I+V GT I  +   TT ++FN+GID+TV   +     LA   R +  + + ALG   + T G N    +DND +S  +G+YNC F++    + PV G ++  +TI L+ATP + YVW+DG+N  K
  S:    15 TGAFGIVATVPVIVSACSSTSDNNTGGNTG-----GDGTQNQTINPELRESVNLSGALSDIFDSTGAQNANQKIAADIQQNHLNDVFVNGQELSQ-VEDLTVSVTGNFSRSSWDGLTFNGESGNWGSVGEDGNITDSVNIEEANKLIYTSESEQFDISSLDDFKTKLSTGDKLKTALEAAGAGTIDNTTTLAVANNIGFTDDDLLHINVTATPAGDSPTVTNYDLQIPVSNLNIVVPNLTITVAGTNIGEANRTTTNFSFNIGIDDTVSE-SNESASLATANRNDAKQALVALGLASSSTEGGNTTYTIDNDAVSAVVGVYNCRFDIDSATIAPV-GESNDNFTITLQATPLEGYVWDDGSNGSK 371
>gi|26554101|ref|NP_758035.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454109|dbj|BAC44439.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (394 aa)
Score = 404, Expect = 2.2e-37, Identities = 154/344 (44%), Positives = 218/344 (63%)
  Q:    15 TGAFGIVATVPVIVSSCSSTSDNNGNSDNNPGGQGDGGQQQT--EVTPTIKTEVSLSGALSKIYDG----KKTTSDLIAEDIKANPTNYFDNGDA--LKELIKDATVSVNGGF----TESTFKGETY-------------DVWS--KDAKKGTYPQSAAQLNIKSINDLETQLGDSKAIQTLCESISSLKITNG--SDYKVEKNALKLDGDLLHVNITAKEDGKTDRVKMDLAIPVSDLNLKIDDLKISVNGTGIKTSTDLTTKYTFNVGIDNTVKTITGAKGVLAENERKEFLK---VMKALGYTDTAG--TNLDNDKLSDALGLYNCSFEVTGVDPVTGSTSGE----YTIKLKATPNKD-YVWEDGTNTPKTDVSFVATL 358
           TGAFGIVATVP+IVSSCSST DNNG S +N  G   G   Q   +VTP +K+EVSLSG+L KIYD     +KTT+ LIA+D+KA+P NYF NGD   +KE IK+ATV+V+G F    TES +K   Y               WS  KD K   +P ++ Q++IKS++DL ++L ++K    L E  ++ KI N   + + V+      + DL+HVN+     G   + + DL IP SD+NL + DL I V GT I+     +TK+ FN+GID+      G+  +      K+ +K   V++ LG+    G  T LDND +   LG+YN +F    +   T +T  +    YT+ LKA P  + YVW D + + +  +SF  T+
  S:    15 TGAFGIVATVPIIVSSCSSTGDNNGGSGDNNNGNQGGQDGQQTEKVTPELKSEVSLSGSLDKIYDSSTKDRKTTNQLIADDVKAHPENYFTNGDKTEVKETIKNATVTVDGKFTTEETESPWKDVAYLDESSDANKTDANKSWSATKDLKPVLFPTTSDQIDIKSLDDLHSKLNEAK----LKEVFTNAKIANADKTTFTVKNKLGFTNSDLIHVNVEGDNSGT--KTQYDLQIPTSDINLSVSDLSIKVEGTNIEAQEKTSTKFDFNIGIDSKENFNQGSTEIAYNT--KDLVKVDEVLEKLGFAKKNGSSTELDNDAIIKGLGIYNVNFSGQEIKEKTVTTREQKDTTYTVSLKAKPTSNKYVWADDSTSDEKTISFDVTI 389
>gi|26554108|ref|NP_758042.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454116|dbj|BAC44446.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (378 aa)
Score = 394, Expect = 2.5e-36, Identities = 143/346 (41%), Positives = 207/346 (59%)
  Q:    14 LTGAFGIVATVPVIVSSCSSTSDNNGNSDNNPGGQGDGGQQQTEVTPTIKTEVSLSGALSKIYD--GKKTTSDLIAEDIKANPTNYFDNGDALKELIKDATVSVNGGF-TESTFKGETYDVWSK--DAKKG----TYPQSAAQLNIKSINDLETQLGDSKAIQTLCESISS------LKITNGSDYKVEKNALKLDG----DLLHVNITAKEDGKTDRVKMDLAIPVSDLNLKIDDLKISVNGTGIKTSTDLTTKYTFNVGIDNTVKTI--TGAKGVLAENERKEFLKVMKALGYTDTAGTN--LDNDKLSDALGLYNCSFEVTGVDPVTGSTSGEYTIKLKATPNKDYVWEDGTNTPKTDVSFVATLS 359
           +TGAFGIVATVPVIVSSCSSTSDNN   DNN    G G  Q   ++  +++ V+LSGALS IY+      T+ L+A  IK+N  + F+NG+AL   + D  ++VNG F T S + G T    +   +A +G     Y  + A LNI S+NDL+TQL   K    + E+ S+        +   S   +  NA  +D     DLLH+++T  E   T     DL IPVSDLNL + DL ++V GT ++ +   TT +T+N+GI+ T   +  T A  + + +   +  K + ALGY + +  N  L+N+ +S  +G+YN  F    +    G +S ++TI L ATP + YVWEDGT   K+ +SF  T +
  S:    14 MTGAFGIVATVPVIVSSCSSTSDNNTGGDNN----GGGNTQNQTISTQLRSSVTLSGALSNIYNPTSGSNTNTLLAAQIKSNLNSVFENGEALAN-VDDLEITVNGNFPTTSEWTGTTAFAGNNGWNATQGLTDVLYDWNTAALNISSLNDLKTQLTSEKITSIITEASSAPASGTVFTVVENSALGLTNNADSIDANASRDLLHIHVTGTEGSNT--TNYDLQIPVSDLNLVVSDLTVTVTGTNVEQTGSTTTNFTYNIGINETANFVQPTQAPSINSADTNGDGNKALVALGYANESDGNYTLNNEAISAGIGVYNSEFSNPTIAATQGGSSNQFTITLSATPKEGYVWEDGTRDAKS-ISFPVTFT 374
>gi|26554112|ref|NP_758046.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454120|dbj|BAC44450.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (399 aa)
Score = 394, Expect = 3.1e-36, Identities = 147/340 (43%), Positives = 202/340 (59%)
  Q:    15 TGAFGIVATVPVIVSSCSSTSDNNGNSDNNPGGQGDGGQQQTEVTPTIKTEVSLSGALSKIYD--GKKTTSDLIAEDIKANPTNYFDNGDALKELIKDATVSVNGGFTESTFKGETY---------------DVWSKDAKKGTYPQSAAQLNIKSINDLETQLGDSKAIQTLCESISS-------LKITNGSDYKVEKNALKLDGDLLHVNITAKE-----DGKTDRVKMDLAIPVSDLNLKIDDLKISVNGTGIKTSTDLTTKYTFNVGIDNTVKTIT-GAKGVLAENERKEFLKVMKALGYTDTAG-----TNLDNDKLSDALGLYNCSFEVTGVDPVTGSTSGE----------YTIKLKATPNKDYVWEDGTNTPKTDVSF 354
           TGAFGIVATVPVIVS+CSSTSDNN        G GD  Q +T +TP IK+  +LSGALS IY+      T+ LIA++IK N T  FDNGDAL   + D  ++V   F EST+ G T+               +V  ++A K  YP    +LNI S++DL+ QL D   ++ + +   +         + NG  +   KN+   + DLLHVN+   +        T     DL IPVSDL+L+I +L ++V G+ +  +T  T   T+N+GI++    +    K    E E  +   V+  LGY   A      T L+ND +   LG+YN +F  T  + V G    E          YTI L ATPN+ YVWEDGT+  K D+SF
  S:    15 TGAFGIVATVPVIVSACSSTSDNN-------TGGGDNTQTKT-ITPQIKSTSTLSGALSSIYNPANSSNTNALIADEIKKNLTEVFDNGDALNN-VNDLEITVTHSFPESTWTGLTFNSDTGNWGNSTNAQDNVEIQEANKLLYPTQTTELNISSLSDLKEQLNDDAKLEKILDDAGATVDADTVYSVNNGLGF-TNKNSGSENRDLLHVNVVGTKTTAGQTPTTTTTNYDLQIPVSDLDLEISNLSVTVKGSNVTETTATTNF-TYNIGINDAENYVDPSTKPTATEEEAGKLDDVLVKLGYATAATGGATETTLNNDAIIQGLGIYNVTFARTTTEGVQGIVPKEDASNNGNEKTYTITLSATPNQGYVWEDGTSNAK-DISF 387
>gi|26554129|ref|NP_758063.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454137|dbj|BAC44467.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (384 aa)
Score = 393, Expect = 3.6e-36, Identities = 144/336 (42%), Positives = 200/336 (59%)
  Q:    14 LTGAFGIVATVPVIVSSCSSTSDNNGNSDNNPGGQGDGGQQQTEVTPTIKTEVSLSGALSKIYD--GKKTTSDLIAEDIKANP-TNYFDNGDALKELIKDATVSVNGGFTES-----TFKGET----------YDVWSKDAKKGTYPQSAAQLNIKSINDLETQLGDSKAIQTLCESISSLKITNGSDYKVEKNALKLDGDLLHVNITAKEDGKT-DRVKMDLAIPVSDLNLKIDDLKISVNGTGIKTSTDLTTKYTFNVGIDNTVKTITGAKGVLAENER----KEFLKVMKALGYTDTAG-TNLDNDKLSDALGLYNCSFEVTGVDPVTGSTSGE-----YTIKLKATP-NKDYVWEDGTNTPK 349
           +TGAFGIVATVPVIVSSCSSTSDNNGN++       +G QQ   +TP +   V+LSG+LS IYD  G    +  IA DIK N  ++ F NG AL E + D +V+V+G F+ +     TF GET           ++   DA K  Y   + Q+NI+S++DL  +L   + ++T  E+     I   +   V  N    +GDLLHVN+TA   G +      DL IPVS+LNL + +L I+V GT +  +   TT + FNVGID T+          A  +          +++ LGYT   G T+L NDK+S ALG+YNC F  T     T +T+       YT+ + A P +  YVW+DG++  K
  S:    14 MTGAFGIVATVPVIVSSCSSTSDNNGNNNGG-----NGNQQTQTITPELNETVNLSGSLSDIYDSTGTLNANQKIAADIKDNHLSDVFANGQALSE-VSDLSVTVSGEFSRALWTGLTFNGETGNWEDSEDNSNNITIADANKLVYTSESDQINIESLDDLHNKLSVRETLKTALENAGVASIPETTTLAVSNNLGFTNGDLLHVNVTATPTGASATATNYDLQIPVSNLNLVVPNLTITVAGTNVGEANRTTTNFNFNVGIDPTLNFSQTGNAPSATTDEVTGDDAASTILQKLGYTTATGSTDLSNDKISAALGIYNCKFTPTNATENTSATATNNGNKVYTVTVTAEPYDTSYVWDDGSSGSK 373
>gi|26554162|ref|NP_758096.1| signal-peptide-less P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454171|dbj|BAC44500.1| signal-peptide-less P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (685 aa)
Score = 392, Expect = 5.3e-36, Identities = 114/305 (37%), Positives = 185/305 (60%)
  Q:    57 EVTPTIKTEVSLSGALSKIY-------DGKKTTSDLIAEDIKANPTNYFDNGDALKELIKDATVSVNGGFTE-STFKGETYDVWSKDAK-KGTYPQSAAQLNIKSINDLETQLGDSKAIQTLCESISSLKITNGSDYKVEKNALKLDGDLLHVNITAKEDGKTDRVKMDLAIPVSDLNLKIDDLKISVNGTGIKTSTDLTTKYTFNVGIDNTVKTITGAKGV--LAENERKEFLKVMKALGY------TDTAGTNLDNDKLSDALGLYNCSFEVTGVDPVTGSTSGEYTIKLKATPNKDYVWEDGTNTPKTDVSFVATLSNS 361
           E+TPT+ + ++++G  SKI+       + +  T+D+IA+DIK+N + YF NG+ LK  +++  + V G F E S + GE Y+VWSK  + KG Y  S+ ++NI S+NDL+T+L      + L +S  +L   + S + +        GDL+HVNI            +D+ IP SD+NL I +LKI+  G  + T   +   +T+N+GI+++V  I    GV  L++  +    + + +LG+      ++     L+ DK+S ALG++NC+FE   +  V+  +S  +TI L ATPN +Y WEDGTNT K ++SF   L+ S
  S:   370 EITPTVNSTLNITGPFSKIFAANTGTGNNRVRTNDVIADDIKSNLSKYFSNGNDLKT-VENLNIRVEGNFPETSVWTGEPYEVWSKTTRFKGIYSSSSQKINITSLNDLKTKLNSIGLGKFLLDS--NLLFRDAS-FTILNQLGFTGGDLIHVNILVNSPYTQGTFTVDVGIPTSDINLIISNLKIASFGDNV-TLQSVPVNFTYNIGINDSVDFIKPTTGVTPLSDANKNNVNEALVSLGFATRNIDSNPGTYTLNPDKISAALGVFNCTFEGISIKDVSNGSSRSFTISLIATPNNNYYWEDGTNTSK-ELSFTVNLTAS 685
Score = 315, Expect = 4.3e-27, Identities = 118/344 (34%), Positives = 177/344 (51%)
  Q:     7 KLLKALALTGAFGIVATVPVIVSSCSSTSDNNGNSDNNPGGQGDGGQQQTEVTPTIKTEVSLSGALSKIYDGKKTT--SDLIAEDIKANPTNYFDNGDALKELIKDATVSVNGGFT-ESTFKGETY--DVWSKDAKKGT---YPQSAAQLNIKSINDLETQLGDSKAIQTLCESISSLKITNGSDYKVEKNALKLDGDLLHVNITAKEDGKTDRVKMDLAIPVSDLNLKIDDLKISVNGTGIKTSTDLTTKYTFNVGIDNTVKTITGAKG-VLAENERKEFLKVMKALGYTDTAGTN---LDNDKLSDALGLYNCSFEVTGVDP---VTGSTSGEYTIKLKATP--NKDYVWEDGTNTPKT 350
           K +K   LTG F   A +PV++ S       N +S NN   + D  Q    +TP +K+ +SLSG + KIYD +K T  + L+A++I  N    F+N   L++ + +  ++V G FT  S++ G  Y  D   K   KG    Y     QLNI S+NDL+TQL +   I+ +     S K+   + Y ++      + +LLHVN+ A     T     DL IP S +NL I ++ ISV+G  +K  T     + +NV +      +  A   V + +E     K++  LG  +    N   L    + + LG+YN  F    + P    T   SG Y I L+ATP  N D+VW+DG NT +T
  S:     6 KKIKTWGLTGIFAASAAIPVVLIS-RYVLFRNSSSINNQNSESDNSQF---ITPKLKSSISLSGTIDKIYDSQKATVTNTLVAQEIHNNLDQVFENSQDLQK-VNNLKIAVEGDFTNSSSWSGVDYEGDNGWKGLTKGNVILYSSKFGQLNISSLNDLKTQLDNDAKIKEIIREFDSSKLNQNAIYSIQNKPAVTNDNLLHVNVIAILGSNTKY--FDLQIPTSSINLNISNMSISVSGNNVKPLTSAVASFNYNVSLAPKSYFMNPASTPVASASEVTNANKILVKLGLAEVTTRNQIVLTQKAIQEQLGIYNVEFSNASIAPSGTTTNGKSGLYQISLQATPIANGDFVWDDGQNTVRT 359
>gi|7839543|gb|AAF70318.1|AF260642_1 P38 [Mycoplasma penetrans] (352 aa)
Score = 391, Expect = 6.8e-36, Identities = 134/307 (43%), Positives = 189/307 (61%)
  Q:    53 QQQTEVTPTIKTEVSLSGALSKIY-DGKKTTSDLIAEDIKANPTNYFDNGDALKELIKDATVSVNGGFTESTF-KGETYDVWS--KDAKKGTYPQSAAQLNIKSINDLETQ-LGDSKAIQTLCESISSLKITNGSDYKVEKNALKLDGDLLHVNITAKEDGKT-DRVKMDLAIPVSDLNLKIDDLKISVN------GTGIKTSTDLTTKYTFNVGIDNTVK-TITGAKGVLAENERKEFLKVMKALGYTDTAGTNLDNDKLSDALGLYNCSFEVTGVDPVTGSTSG-----EYTIKLKATP-NKDYVWEDGTNTPKTDVSFVATLS 359
           Q+   V P +K  V L+G LS IY    KTT++LI+EDIKANP NYF NG  LK++I  +TV+V+GGF+ S + +G  Y  WS      K TYP +A Q++I S+N L+ +   D   IQ    + ++L  +N S + VE      +GDLLHVNI A         + +DL IPVS++NLK   LK+SV+      GT I+  +DLTT +++N+GID+T+  T TG        E     +V+K LGY    G NLDNDK+S ALG+YNC F         G+T+G      YT+ + A P + +YVW+DG+   K + SF  +L+
  S:    30 QENKTVKPELKDNVELNGKLSTIYGTDSKTTNELISEDIKANPENYFTNGSELKDVINQSTVTVDGGFSASQWTEGSDYTTWSAVTGVVKVTYPAAAPQIDIASLNALKQETFKDDTTIQAFLTA-ANLSFSNTSSFTVENKLGLTNGDLLHVNIKANRTAANGGNLNLDLQIPVSNINLKT-ILKVSVSATNNSTGTNIEAVSDLTTNFSYNIGIDSTLNFTQTGTAPTATTAEANNATEVLKKLGY--QTGNNLDNDKISAALGIYNCKFTPKSATEKQGATAGLGGNKVYTVVVDAAPYDSNYVWDDGSTDTK-EFSFDVSLT 350
>gi|26554110|ref|NP_758044.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454118|dbj|BAC44448.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (391 aa)
Score = 389, Expect = 1.0e-35, Identities = 147/346 (42%), Positives = 201/346 (58%)
  Q:    14 LTGAFGIVATVPVIVSSCSSTSDNNGNSDNNPGGQGDGGQQQTEVTPTIKTEVSLSGALSKIYD-------GKKTTSDLIAEDIKANP----TNYFDNGDALKELIKDATVSVNGGFTESTFKGETYDV----WSKD--------AKKGTYPQSAAQLNIKSINDLETQL----GDSKAIQTLCESISSLKITNGSDYKVEKNALKLDGDLLHVNITAKEDGKTDRVKMDLAIPVSDLNLKIDDLKISVNGTGIKTSTDLTTKYTFNVGIDNTVKTITGAKGVLAENERK-EFLKVMKALGYTDTAGTNLDNDKLSDALGLYNCSFEVTGVDPVTGSTSG----EYTIKLKATP--NKDYVWEDGTNTPKTDVSFVATLS 359
           +TGAFGIVATVPVIVSSCSSTSDNN    NN      G  Q  +V+  +K  V L G+LSKI+D        +K+T+ LI+EDIKANP    T      + +KE I++ATV V G F+ S+++G+ Y+     W  D        A K  YP +  QL  K ++ L+T+L     ++K +       +   I  G+   +E      + DLLHVN+   +    D+   DL IPVSDLNL + DL I V    I+T    TTKY +N+GID T   + G     A +E   +  KV++ L     A   LDN+ L  ALG+YN  F    +     +T       YTI LKATP  NK+YVW D  N+ + D++F  TL+
  S:    14 MTGAFGIVATVPVIVSSCSSTSDNNTGGGNN-----GGDTQTQKVSLQLKDSVDLKGSLSKIFDTEATNASSRKSTNTLISEDIKANPGTYFTFTETTEETVKETIQNATVEVEGNFSSSSWEGQAYNQESGNWGADSSVVTIDPANKYLYPTNLDQLTFKDLDGLKTELEKTGTNNKTVLQNALETAGATIDAGAQLSIENRLGLTNDDLLHVNVKETKANTADK-NYDLQIPVSDLNLSVSDLSIKVTSDNIETGEKTTTKYDYNIGIDPTTHYVQGTTKPSANDEASVDVNKVLEDLSLATDANGTLDNEALIKALGVYNVQFSNPTIAKKATTTRAIEDTVYTITLKATPTANKNYVWSDNGNSEERDITFDVTLA 387
>gi|26554193|ref|NP_758127.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454202|dbj|BAC44531.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (365 aa)
Score = 387, Expect = 1.6e-35, Identities = 131/335 (39%), Positives = 196/335 (58%)
  Q:    15 TGAFGIVATVPVIVSSCSSTSDNNGNSDNNPGGQGDGGQ--QQTEVTPTIKTEVSLSGALSKIYDG-----KKTTSDLIAEDIKANPTNYFDNGDALKELIKDATVSVNGGF-TESTFKGETYD---VWSKDAKKGT-YPQSAAQLNIKSINDLETQLGDSKAIQTLCESISSLKITNGSDYKVEKNALKLDGDLLHVNITAKEDGKTDRVKMDLAIPVSDLNLKIDDLKISVNGTGIKTSTDLTTKYTFNVGIDNTVKTITGAKGVLAENERKEFLKVMKALGYTDTAG--TNLDNDKLSDALGLYNCSFEVTGVDPVTGSTSGEYTIKLKATPNKDYVWEDGTNTPK 349
           TGAFGIV+ VP+IVSSCSST ++  N++NN        +  Q  +VTP +K+ ++ SG L KIYD      +KTT  L+ E+   NP   F N   L++  KD  + V+GGF T + + G  Y     W     +   Y +S + ++I S+NDL+T+L ++   + +  + +SL+ +N + Y V+      +GDLLHVN+       +    +DL IP+SDLNL I +L ISV+GT ++          FN+GI+       GA   L ++   +  K + ALGY  T+   T L+N K+S A+G+YNC+F  + V  +  + +  YTI L A PN +YVWEDGTNT K
  S:    15 TGAFGIVSAVPLIVSSCSSTDNDETNNNNNGQDNQGNTENPQNQKVTPKLKSSINFSGDLGKIYDSSSGTNRKTTDTLLEEEFTKNPDLIFTNAKELED--KDFKIEVDGGFDTNNAWTGTPYSGTGGWKTSVLRSVFYAESLSSIDITSLNDLKTKLDNATISKII--TAASLQFSN-TTYTVQNQLSLENGDLLHVNVLGTIGNSSRSFTLDLQIPISDLNLVIPNLSISVSGTDVELIDKQEVNLDFNIGINENTNFNQGAT-TLTKDNVVDADKALVALGYATTSNNVTTLNNTKISSAIGIYNCTFSASTV-VLKSTDTNTYTINLVAKPNTEYVWEDGTNTSK 356
>gi|26554160|ref|NP_758094.1| signal-peptide-less P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454169|dbj|BAC44498.1| signal-peptide-less P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (692 aa)
Score = 386, Expect = 2.3e-35, Identities = 121/304 (39%), Positives = 179/304 (58%)
  Q:    58 VTPTIKTEVSLSGALSKIYDG------KKTTSDLIAEDIKANPTNYFDNGDALKELIKDATVSVNGGFTESTFKGETYDVWSKDAKK---GTYPQSAAQLNIKSINDLETQLGDSKAIQTLCESISSLKITNGSDYKVEKNALKLDGDLLHVNITAKEDGKTDRVKMDLAIPVSDLNLKIDDLKISVNGTGIKTSTDLTTKYTFNVGIDNTVK-TITGAKGVLAENERKEFLKVMKALGYTDTAGTN-------LDNDKLSDALGLYNCSFEVTGVDPVTGSTSGEYTIKLKATPNKDYVWEDGTNTPKTDVSFVATLSNS 361
           +TP +   ++L+G++SKI+D       +K T+ +IAEDIKANP NYF NG  LK  I D  V+VNG F  ST+ G  Y+ W         G Y  S  QLNI S++DL+T++        L   ++S    +G+ +  +      D DLLHV +  +       V +DL IP+S +NL +  L +SVNGTG++T T+  T YT+N+GID+TV  T       L E  +    + + +LG+  T  TN       LD+ K+S ALG+YNC+FE   +      ++  YTI LKATPN +Y W+ GTN  + +++F   L++S
  S:   383 ITPDLNQTINLTGSVSKIFDTTTTSGTRKDTNTVIAEDIKANPENYFSNGSDLKT-ISDLAVTVNGNFPTSTWTGSPYETWKSTVTSTNVGIYSPSLPQLNISSLSDLKTKINQLGIYNVL---LTSGLTYSGATFAFQNELGFTDDDLLHVCV--RVTSTYGNVNVDLGIPLSSINLTVSALAVSVNGTGVQTLTNGNTNYTYNIGIDDTVNFTKPTTVSPLTEENKTNVNEALVSLGFA-TKNTNSNPNTYTLDSTKISKALGVYNCTFEGIAIQE---DSANNYTITLKATPNANYNWDSGTNESR-ELTFKVDLASS 692
Score = 288, Expect = 5.1e-24, Identities = 123/345 (35%), Positives = 191/345 (55%)
  Q:    10 KALALTGAFGIVATVPVIVSS---CSSTSDNNGNSDNNPGGQGDGGQQQTEVTPTIKTEVSLSGALSKIYDGKKT--TSDLIAEDIKANPTNYFDNGDALKELIKDATVSVNGGFTE-STFKGETY---DVWSK--DAKKGTYPQSAAQLNIKSINDLETQLGDSKAIQTLCESISSLKITNGSDYKVEKNALKLDGDLLHVNITAKEDGKTDRVKMDLAIPVSDLNLKIDDLKISVNGTGIKTSTDLTTKYTFNVGIDN-TVKTITGAKGVLAENERKEFLKVMKALGYTDTAGTN---LDNDKLSDALGLYNCSFEVTGVDP---VTGSTSGEYTIKLKATP--NKDYVWEDGTNTPKTDVSF 354
           K LA+TG F + A  P+ + S       S N  +++NN  G G+   Q   +TP +K+ ++LSG++ KIY  + +  T  LIA++IK N  + F+N + LK  + +  +SV G F + S++ G  Y   + WS      +  Y      LNI S+NDL+ QL D+K  + L  S SS K+   ++Y V+        +L+H+N+   E   +    +DL IP S +N  I +++ISV+G  ++T T+ TT   +NV I+  T  T   ++     +E  +  KV+  LG+ +    N   L+   L + LG+YN  F    + P    T   SG Y I   ATP  NK +VWEDGT+T K+ VSF
  S:    16 KILAITGIFTVSAATPIALVSKYVIFKNSSNGNSNNNNNNGGGNTNPQNQTITPKLKSSINLSGSIDKIYSSQNSSDTKTLIAQEIKNNLDSAFENSEELKS-VNNLNISVEGDFGDNSSWAGIEYSGTNGWSSTVSGNEVLYSTDLNTLNISSLNDLKYQLTDAKIKEILNASDSS-KLKTNAEYTVKNKPGFTSNNLIHINVF--EILGSSVKNLDLQIPYSSVNFNISNMQISVSGDNVQT-TNATTTLNYNVAINTETNSTQIASRPTATASEISDVNKVLVKLGFAEIGSDNNVTLNQKALQEELGIYNVVFSNASIAPSGTTTDGQSGAYKISFDATPIANKGFVWEDGTSTAKS-VSF 374
>gi|26554120|ref|NP_758054.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454128|dbj|BAC44458.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (389 aa)
Score = 380, Expect = 1.2e-34, Identities = 149/344 (43%), Positives = 208/344 (60%)
  Q:    15 TGAFGIVATVPVIVSSCSSTSDNNGNSDNNPGGQGDGGQQQTEVTPTIKTEVSLSGALSKIYD--GKKTTSDLIAEDIKANPTNYFDNGDALKELIKDATVSVNGGFTE--STFKGETY------------DVWSKDAKKGT--YPQSAAQLNIKSINDLETQLGDSKAIQTLCESISSLKITNGSDYKVEKNALKLDGDLLHVNI--TAKEDGKTDRVKMDLAIPVSDLNLKIDDLKISVNGTGIK--TSTDLTTKYTFNVGIDNTVKTITGAKGVLAENERKEFLKVMKALGYTDTAGTNLDNDKLSDALGLYNCSFEVTGVD------PVTGSTSGEYTIKLKATPNKD----YVWEDGTNTPKTDVSFVATL 358
           TGAFGIVATVPVIVSSCSSTSDNN   D N GG   G  Q  ++TP +  +VSLSG+L  IYD  G   T++L+A++IK N    F NG+ L E   D  ++VNG F E  S +K   Y              WS      T  Y  S+ Q+NIKS++DL TQL   K ++ + ++ + +  T+ S Y+++      + DL+HVN+  TA +  KT  +  DL IP SD+NL + DL + V G  I+   ST  TT+  FN+GID+T           A+ +  E  KV++ L +  T  T +DN+ L   LG+YN +F + G            +T  EY + LKATPNK+    YVW+DGT+  K D++F  T+
  S:    15 TGAFGIVATVPVIVSSCSSTSDNNTGGDTNQGGGTGGDTQSEKITPELNDKVSLSGSLKDIYDSTGATKTNELLAKEIKDNINTVFKNGEKL-EAETDLKITVNGNFPETLSNWKDLPYIDSTEASNPTPAKSWSATTNLQTVVYATSSEQINIKSLDDLHTQLSVEKTLKDILKA-AGVTNTDTSTYEIKNRPGLTNDDLIHVNVGGTANDTNKTKTI-YDLQIPTSDINLVVSDLSVKVEGKNIETTDSTKTTTELDFNIGIDSTTHYNQTIDVTEADEKNVEVNKVLETLKFVKTDKT-IDNEALIKELGVYNVTFSLDGASIAKKETTARAATPTEYVVTLKATPNKNDKNTYVWDDGTSGTK-DITFPVTI 385
>gi|26554103|ref|NP_758037.1| putative P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|22901855|gb|AAN10106.1| putative lipoprotein mp8 [Mycoplasma penetrans] >gi|26454111|dbj|BAC44441.1| P35 lipoprotein homolog fragment [Mycoplasma penetrans HF-2] (329 aa)
Score = 376, Expect = 3.7e-34, Identities = 142/292 (48%), Positives = 193/292 (66%)
  Q:    14 LTGAFGIVATVPVIVSSCSSTSDNNGNSDNNPGGQGDGGQQQTEVTPTIKTEVSLSGALSKIYDG----KKTTSDLIAEDIKANPTNYFDNGDALKELIKDATVSVNGGFTESTFK---GETYDVWSKDAK----KGTYPQSAAQLNIKSINDLETQ-LGDSKAIQTLC--ESISSLKITNGSDYKVEKNALKLDGDLLHVNITA-KEDGKTDRVKMDLAIPVSDLNLKID-----DLKISVNGTGIKTSTDLTTKYTFNVGIDNTVK-TITGAKGVLAENERKEFLKVMKALGY-TDTAGT-NLDNDKLSDALG 305
           +TGAFGIVATVPVIVSSCSSTSDNNGN +NN GGQG   Q QT + P IK++V LSG L+ IYD     +K T+ LI++DIKANP  YF NG  +K+ IKDA V+VNG F+ S +     + Y  WSKD      K  YP  AAQ++I S+N+L+T+   DS+ I        I+   + N  +++VE      D DLLHVN+ A  +      + +DL IPVS++NLK       D   +  G  I+  + LTT +++N+GID+TVK T       +  +E K+   V++ LGY T+T+G   LDNDK+S A+G
  S:    14 MTGAFGIVATVPVIVSSCSSTSDNNGNGNNN-GGQGGDQQTQTTIKPAIKSDVQLSGKLNNIYDASTTDRKDTNTLISDDIKANPDKYFTNGADIKDAIKDAKVTVNGNFSASEWNDQGAKEYSEWSKDGNNNISKILYPTEAAQIDIASLNELKTKTFKDSETINKFITDSKITIANLANMQNFRVENKLYLSDEDLLHVNLKADNKTANQSGLNLDLEIPVSNINLKTTLTVSVDATTNTTGNKIEAVSGLTTNFSYNIGIDSTVKFTDPKTYPTVTTDEAKKAETVLEKLGYATNTSGNITLDNDKISAAIG 327
>gi|26554125|ref|NP_758059.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454133|dbj|BAC44463.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (378 aa)
Score = 376, Expect = 3.7e-34, Identities = 149/345 (43%), Positives = 199/345 (57%)
  Q:    15 TGAFGIVATVPVIVSSCSSTSDNNGNSDNNPGGQGDGGQQQTEVTPTIKTEVSLSGALSKIYDGKKTTSD----LIAEDIKANPTNYFDNGDALKELIKDATVSVNGGFTESTFKGETYD----VWSKDAKKGTYPQSAAQLNIKSINDLETQLGDSKAIQTLCESISSLKITNGSDYK-----VEKNALKLDGDLLHVN----ITAKEDGKTDRVKMDLAIPVSDLNLKIDDLKISVNGTGIKTSTDLTTKYTFNVGID--------NTVKTITGAKGVLAENERKEFLKVMKALGYTDTAG--TNLDNDKLSDALGLYNCSFEVTGVDPVTGSTSGEYTIKLKATPNKDYVWEDGTNTPKTDVSFVATLS 359
           TGAFGIVATVPVIVSSCSSTSDNN   DNN      GG Q   +TP I++ V+L+GALS IYD   ++S+     IAE+IK N    F NG AL + + D  ++V+  F EST+ G  Y      +S       Y  +   L I S++DL+TQL DSK  +    + ++         +       KN    + DLLHVN    +  +  G       DL IPVSDLNL++ DL ++V GT +   T LTT  T+N+GI+         T  T+ G+   +  ++     K + AL Y   A   T LDN+K+S  LG+YN  F    + PV G  + +YTI L ATP   YVWEDG+NT K  VSF  T +
  S:    15 TGAFGIVATVPVIVSSCSSTSDNNTGGDNN-----GGGTQTQTITPQIQSAVTLNGALSDIYDTANSSSENTNAKIAEEIKNNLETVFTNGAALSD-VSDLEITVSHNFPESTWIGTAYSGDSGWYSAQMDTVLYDYTLNPLTISSLSDLKTQLSDSKIQEIFTAAGTTTTTNATYAVQNALGFTNKNNGAENRDLLHVNVLETVPGQSGGDPTTKNYDLQIPVSDLNLELKDLSVTVKGTNV-AETTLTTTLTYNIGINEAQNFTQPTTNPTVQGSD--IQNDDANAANKALVALTYATEADGQTTLDNEKISAELGIYNSVFTAVSIKPVDGGNN-QYTITLSATPKDGYVWEDGSNTAK-QVSFNVTFT 375
>gi|26554159|ref|NP_758093.1| signal-peptide-less P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454168|dbj|BAC44497.1| signal-peptide-less P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (713 aa)
Score = 369, Expect = 2.1e-33, Identities = 119/305 (39%), Positives = 183/305 (60%)
  Q:    57 EVTPTIKTEVSLSGALSKIYD------GKKTTSDLIAEDIKANPTNYFDNGDALKELIKDATVSVNGGF-TESTFKGETYDVWSKDAK-KGTYPQSAAQLNIKSINDLETQLGDSKAIQTLCESISSLKITNGSDYKVEKNALKLDGDLLHVNITAKEDGKTDRVKMDLAIPVSDLNLKIDDLKISVNGTGIKTSTDLTTKYTFNVGIDNTVKTITGAKGV--LAENERKEFLKVMKALGY-TDTAGTN-----LDNDKLSDALGLYNCSFEVTGVDPVTGSTSGEYTIKLKATPNKDYVWEDGTNTPKTDVSFVATLSNS 361
           E++P + T ++L+G LSKIYD       +K+T+ LIAEDIKAN   YF NG+ LK  +++ +VS +G F T S++ G  Y  WS   +    Y QS  Q+NI S+NDL+T+         L  S   L+ ++ S + V+       GDLLH+NI     G T    +DL IP S++NL +  L+++ NG+ + +    TT +T+N+GI +TV  +    GV  LA   +    + + +LG+ T    +N     LD++K+S ALG++NC+FE   +     S    YTI LKA+PN +Y WE G++ PK ++SF   L++S
  S:   400 EISPALNTTLNLTGPLSKIYDVEGTSGSRKSTNTLIAEDIKANLDTYFSNGNDLKT-VENLSVSASGSFPTTSSWTGTEYSTWSTSVQYSAVYGQSLGQINISSLNDLKTKWNSQGIYNVLLGS--GLRFSD-STFTVQNLLGFTGGDLLHMNIFVNS-GYTANFTVDLQIPASNINLTVPTLRVTANGSNVASLQVDTTNFTYNIGIKDTVDFVKPTTGVTALAPANKTNVNEALVSLGFATRNTSSNPYTYTLDSEKISAALGVFNCTFEGISITE-DESNPNNYTIVLKASPNANYNWESGSSDPK-ELSFKVDLASS 713
Score = 335, Expect = 1.9e-29, Identities = 129/354 (36%), Positives = 197/354 (55%)
  Q:     1 MKIKKIKLLKALALTGAFGIVATVPVIVSS----CSSTSDNNGN-----------------------SDNNPGGQGDGGQQQTEVTPTIKTEVSLSGALSKIYDGKKT--TSDLIAEDIKANPTNYFDNGDALKELIKDATVSVNGGFTE-STFKGETYD-----VWSKDAKKGTYPQSAAQLNIKSINDLETQLGDSKAIQTLCESISSLKITNGSDYKVEKNALKLDGDLLHVNITAKEDGKTDRVKMDLAIPVSDLNLKIDDLKISVNGTGIKTSTDLTTKYTFNVGIDNTVKTITGAKGV--LAENERKEFLKVMKALGYTDTAGTN---LDNDKLSDALGLYNCSFEVTGVDPVTGSTS--GEYTIKLKATP--NKDYVWEDGTNTPKTDVSF 354
           MK K+ KLLK L++ G F + A VP+ + S     + TS +NGN                          N     +   Q   + P +K+ ++LSG + KIY+ +    T++LIAE+IK N    FDN   L E + D  ++VNG F + S++ G  YD       S    +  Y  S  QLNI S+NDL+ QL D+K I+ +  S  S K+   ++Y V+      + +L+HVNI   E   +     DL IP+S +N  + ++ ISV+GT ++T T+ TT + +N+ I+NT             + +E     K++  LGY D    N   L+ + L +  G+YN  F    + P T +    G Y I L ATP  NK ++W+DGT + K+ VSF
  S:     1 MKSKRSKLLKILSVIGIFAVSAAVPITLVSKYVIFTKTSSSNGNVDDNSGNNNGNDNSNPNDNNGNNDGGNDSNNNNTTPQDGSIVPRLKSSINLSGTVDKIYNSQNASETNNLIAEEIKTNLEQAFDNSTEL-ENVNDLNITVNGNFADTSSWGGNPYDGTNGWSGSTTGNEILYSTSLNQLNISSLNDLKHQLTDAK-IKEILRSSDSSKLNESAEYTVKNKLGFTNNNLVHVNIM--EILGSGVRNFDLQIPISSINFNVSNMSISVSGTDVQT-TNATTNFNYNIAINNTESNTPQPTSTPKASSSEVTNADKILVKLGYADVGTNNSIVLNQELLQEEFGIYNVEFSNAKIAPNTSTNRQVGSYKITLDATPIANKGFIWQDGTTSTKS-VSF 392
>gi|26554157|ref|NP_758091.1| signal-peptide-less P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454166|dbj|BAC44495.1| signal-peptide-less P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (448 aa)
Score = 367, Expect = 4.2e-33, Identities = 112/304 (36%), Positives = 185/304 (60%)
  Q:    58 VTPTIKTEVSLSGALSKIYD------GKKTTSDLIAEDIKANPTNYFDNGDALKELIKDATVSVNGGF-TESTFKGETYDVWSKDAKKGT-YPQSAAQLNIKSINDLETQLGDSKAIQTLCESISSLKITNGSDYKVEKNALKLDGDLLHVNITAKEDGKTDRVKMDLAIPVSDLNLKIDDLKISVNGTGIKTSTDLTTKYTFNVGIDNTVKTITGAKGV--LAENERKEFLKVMKALGYT--DTAGTNLDNDKLSDALGLYNCSFEVTGVDPVTGSTSGEYTIKLKATPNKDYVWEDGTNTPKTDVSFVATLSNS 361
           +TP I   ++L+G+L++I+D       +K+T  +IA+DI AN   YF NG+ +K  + + T+  +G F + S++ G  Y  WS + K  T Y  S  Q+NI S+NDL+T+  DS+ +Q +    S LK +N S + ++      DGDL+H+NI   E G  +   +DL IPVSD+NL I  L+++ NG  ++     TT +T+N+GID+TV  +    GV  L+   + +  + + +LG+   ++    L+++K+S ALG++NC+FE   +     S    +TI L+ATPN +Y WE+G+   K ++SF   L +S
  S:   140 ITPAINKTINLTGSLTRIFDVNTPASYRKSTDIMIAQDIHANLEKYFSNGNDIKT-VNNLTIDASGSFPSVSSWTGLAYANWSSNVKHSTVYASSLPQINITSLNDLKTKW-DSQGLQNILLE-SGLKFSN-STFTIQNLLGFTDGDLVHMNIFV-ESGYGEDFTVDLQIPVSDINLTIPGLRVTANGENVQYLLIDTTNFTYNIGIDDTVNFVKPKTGVTSLSSANKNKVNEALVSLGFATRNSGSYTLNSNKISAALGVFNCTFEGVSITE-DQSKPNNFTIVLRATPNVNYYWENGSRDYK-ELSFKVDLVSS 448
Score = 129, Expect = 1.6e-05, Identities = 42/119 (35%), Positives = 71/119 (59%)
  Q:   231 LKISVNGTGIKTSTDLTTKYTFNVGIDNTV---KTITGAKGVLAENERKEFLKVMKALGYTDTAGT---NLDNDKLSDALGLYNCSFEVTGVDPVTGST---SGEYTIKLKATP--NKDYVWEDGTNTPK 349
           ++ISV+GT ++T T+ T  + +N+GI++     +  +  +G  + +E K+  K++  LGY + A      L+ + L +  G+YN  F    + P   +    SG YTI L  TP  NK +VWEDG++  K
  S:     1 MQISVSGTDVRT-TNTTINFNYNIGINSQSSLPQLTSTPRG--SSSEAKDPNKILVKLGYAEIASNKEITLNQEVLQEEFGIYNVEFSNASISPSKNTQNGYSGVYTITLDVTPITNKGFVWEDGSSNTK 127
>gi|3850052|emb|CAA07192.1| putative lipoprotein [Mycoplasma penetrans] (353 aa)
Score = 350, Expect = 3.6e-31, Identities = 131/307 (42%), Positives = 187/307 (60%)
  Q:    14 LTGAFGIVATVPVIVSSCSSTSDNNGNSDNNPGGQGDGG----QQQTEVTPTIKTEVSLSGALSKIY-----DGKKTTSDLIAEDIKANPTNYFDNGDALKELIKDATVSVNGGF-------TESTFKGETYDVWSKDAKKG----------TYPQSAAQLNIKSINDLETQLGDSKAIQTLCESISSLKITNGSDYKVEKNALKLDGDLLHVNITAKEDGKTDRVKMDLAIPVSDLNLKIDDLKISVNGTGIKT--STDLTTKYTFNVGIDNTVKTITGAKGVLAENERK-EFLKVMKALGYTDTAGTNLDNDKLSDALGLYNCSFEVTGVDPVT 320
           LTGAFGIVATVPVIVSSCSSTSDNNGN +NN    G G     QQ T  TP IKTEVSLSG+LSKIY     D +K T+++IA+DI +NP +YF NG  LK  ++  +V+V+GGF       T+  +   T D   KD  K            Y   + Q+NIKS++DL+T+L  +  ++   +          + ++++      + DL+HVN+   +  K+  V+ DL IP SD+NL + +L + V G  I++  +T  TT++ FN+GID+T     G+    A  E   +  KV+K L         L+N+ L  ALG+YN +F    +   T
  S:     1 LTGAFGIVATVPVIVSSCSSTSDNNGNGNNNNDNNGGGSGTDQQQGTTYTPAIKTEVSLSGSLSKIYDTTTGDSRKNTNEMIAQDILSNPEDYFTNGADLKN-VQGWSVTVDGGFPEKLTNWTDLPYVDNTDDASKKDPNKSWSAITDLNPVLYSTKSNQINIKSLDDLKTELQKTDVLKNALKDAGVSTAETSTAFEIKNQPALTNDDLVHVNVIETKSDKST-VQHDLQIPTSDINLVVSNLSVKVEGKNIESTDTTKTTTEFNFNIGIDSTQHYDQGSAKSAATTEGDVDVNKVLKDLNLATDDKGALNNEALIKALGIYNVTFSSPSIKKAT 334
>gi|26554117|ref|NP_758051.1| P35 lipoprotein homolog reported as putative lipoprotein IMP13 [Mycoplasma penetrans HF-2] >gi|26454125|dbj|BAC44455.1| P35 lipoprotein homolog reported as putative lipoprotein IMP13 [Mycoplasma penetrans HF-2] >gi|27260911|dbj|BAC45034.1| lipoprotein P42 [Mycoplasma penetrans] (390 aa)
Score = 347, Expect = 8.2e-31, Identities = 139/344 (40%), Positives = 204/344 (59%)
  Q:    15 TGAFGIVATVPVIVSSCSSTSDNNGNSDNNPGGQGDGGQQQTE-VTPTIKTEVSLSGALSKIYD--GKKTTSDLIAEDIKANPTNYFDNGDALKELIKDATVSVNGGF-------TESTFKGETYDVWSKDAKKG----------TYPQSAAQLNIKSINDLETQLGDSKAIQTLCESISSLKITNGSDYKVEKNALKLDGDLLHVNITAKEDGKTDRVKMDLAIPVSDLNLKIDDLKISVNGTGIKT--STDLTTKYTFNVGIDNTVKTITGAKGVLAENERK-EFLKVMKALGYTDTAGTNLDNDKLSDALGLYNCSFEVTGVDP----VTGSTSGEYTIKLKATPNKD----YVWEDGTNTPKTDVSFVATL 358
           TGAFGIVATVPVIVSSCSSTSDNN  + NN  G G  G  Q+E +TP +  +VSL+G+L  IYD  G K +++LIAE+IK N  + F NG+ L     D  ++V+GGF       T+  +   T D   KD  K            Y   + Q+NIKS++DL+T+L  +  ++   +          + ++++      + DL+HVN+   +  K+  V+ DL IP SD+NL + +L + V G  I++  +T  TT++ FN+GID+T     G+    A  E   +  KV+K L         L+N+ L  ALG+YN +F    +         +T+  Y I LKATPNK+    YVW+DGT   K D++F  T+
  S:    15 TGAFGIVATVPVIVSSCSSTSDNNNGNGNNNNGGGSDGNTQSEKITPELNDKVSLAGSLKDIYDSTGTKKSNELIAEEIKNNIKDVFKNGEKLAAE-TDLKITVDGGFPEKLTNWTDLPYVDNTDDASKKDPNKSWSAITDLNPVLYSTKSNQINIKSLDDLKTELQKTDVLKNALKDAGVSTAETSTAFEIKNQPALTNDDLVHVNVIETKSDKST-VQHDLQIPTSDINLVVSNLSVKVEGKNIESTDTTKTTTEFNFNIGIDSTQHYDQGSAKSAATTEGDVDVNKVLKDLNLATDDKGALNNEALIKALGIYNVTFSSPSIKKATVTARAATATSYEITLKATPNKEGNNTYVWDDGTTEAK-DITFPVTI 386
>gi|26554118|ref|NP_758052.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454126|dbj|BAC44456.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (388 aa)
Score = 340, Expect = 5.1e-30, Identities = 143/344 (41%), Positives = 203/344 (59%)
  Q:    15 TGAFGIVATVPVIVSSCSSTSDNNGNSDNNPGGQGDGGQQQTEVTPTIKTEVSLSGALSKIYD--GKKTTSDLIAEDIKANPTNYFDNGDALKELIKDATVSVNGGFTESTFK---------GETYD------VWSKDA--KKGTYPQSAAQLNIKSINDLETQLGDSKAIQTLCESISSLKITNGSDYKVEKNALKLDGDLLHVNITAKEDGKTDRVKMDLAIPVSDLNLKIDDLKISVNGTGI--KTSTDLTTKYTFNVGIDNTVKTITGAKGVLAENER----KEFLKVMKALGYTDTAGTNLDNDKLSDALGLYNCSFEVTGVDPVTGSTSG------EYTIKLKATPNKD----YVWEDGTNTPKTDVSFVATL 358
           TGAFGIVATVPVIVS+CSST++   N     GG      Q  ++TP +  +VSL G+L  IYD  G K T++LIAE+IKAN  + F NG+ L     D  ++VNG F E+             ET D       WS  A   K  YP ++ Q++IKS++DL T+L ++     L E   +   T+ S + ++      + DL+HVN+   +   T +V+ DL IP SD+NL + DL + V G  I    +T  TT++ FN+GID T     G++   A+ E     ++ LK +K L   D   T LDN+ L  ALG+Y  +F +        S         +YT+ LKATPNKD    YVW+DGT+  K D++F  T+
  S:    15 TGAFGIVATVPVIVSACSSTNNGGNNQGGGSGGT----TQTEKITPELNEKVSLGGSLKDIYDSTGTKKTNELIAEEIKANINSVFKNGEKLAAE-SDLKITVNGNFPETLSNWKDLPYLDSSETADNATADKSWSATASLNKVLYPTTSKQIDIKSLDDLYTKLDEATIKAALKEGGVTTTETSKS-FTIKNRPGLTNDDLIHVNVEETKSDDT-KVQHDLQIPTSDINLVVSDLTVKVEGQNIETTENTKTTTEFDFNIGIDTTTHYNQGSETSTAQTEDAVKVEQVLKDLK-LATADGNNTKLDNEALIKALGVYTVTFSLDDAKVTKDSVQSRAPVDTKYTVTLKATPNKDSNNTYVWDDGTSDAK-DITFPVTI 384
>gi|26554189|ref|NP_758123.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454198|dbj|BAC44527.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (517 aa)
Score = 324, Expect = 3.9e-28, Identities = 117/335 (34%), Positives = 183/335 (54%)
  Q:    15 TGAFGIVATVPVIVSSCSSTSDNNGNSDNNPG------------GQGDGGQQQTEVTPTIKTEVSLSGALSKIYD--GKKTTSDLIAEDIKANPTNYFDNGDALKELIKDATVSVNGGFTESTFKGETYDV----WSKDAK-----KGTYPQSAAQLNIKSINDLETQLGDSKAIQTLCESISSLKITNGSDYKVEKNALKLDGDLLHVNITAKEDGKTDRVK-MDLAIPVSDLNLKIDDLKISVNGTGI-KTSTDLTTKYTFNVGIDNTVKTITGAKGVLAENERKEFLKVMKALGYTD-----TAGTNLDNDKLSDALGLYNCSFEV------TGVDPVTGSTSGEYTIKLKATPNKDYVWEDGTNTPK 349
           TG FGIV T+P IVS+CSS  + N  S +N G            G G+GG    ++ P I + V L G+L+ IYD  G K  + L+ E +  N +  F N D L+   K+  ++V G F+  ++ G+ YD     W   +K     +  Y   + QLNI S++DL++QL +    + L    + + +   + Y V       D  LLHVN+T    G T   K  DL IPVSD+ L I DLK+ V+G+ + +  +D+  K  FN+GI +  KT    + +   N       ++  LG+ D     T G  L+++ L  ALG+YN +F        + + P    +   YT+ +  +PN+ Y ++D T+  K
  S:    15 TGTFGIVITIPAIVSACSSIKEKNDGSQSNNGNNQDNSKDQGSEGSGNGGITNQKIVPKINSSVDLIGSLTDIYDSTGNKDINVLLGEKLSNNASKIFTNADELEN--KNYAIAVKGNFSRDSWSGDQYDAGNNKWGSGSKIDPANQVVYSSKSKQLNISSLDDLKSQLTNDFLKKEL--EKAGVTVNQSATYAVANKLGLTDDILLHVNVTETASGTTSVSKNFDLQIPVSDIKLDIKDLKVIVSGSDVEQIESDINLK--FNIGIKS--KTNYSPRDIKKFNVTPNVDSIIATLGFKDSSVTSTEGVALNSEALGKALGVYNTTFSKPALTLNSDIKPDVTGSFLTYTVIVDGSPNQGYYFDDETDYSK 377
>gi|26553715|ref|NP_757649.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26453722|dbj|BAC44053.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (519 aa)
Score = 319, Expect = 1.2e-27, Identities = 128/336 (38%), Positives = 196/336 (58%)
  Q:    15 TGAFGIVATVPVIVSSCSSTSDNNGNSDNNPGGQGDGGQQQTEVTPTIKTEVSLSGALSKIYDGK--KTTSDLIAEDIKANPTNYFDNGDALKELIKDATVSVNGGFTESTFKGETYD------VWSKDAKKGTYPQSAAQLNIKSINDLETQLGDSKAIQTLCESISSLKI--TNGSDYKVEKNALKLDGDLLHVNITAKEDGKTDRVKMDLAIPVSDLNLKIDDLKISVNGTGIKTSTDLTTKYTFNVGIDNTVKTITGAKGVLAENERKEFLKVMKALGYTDTAGTN----------------------LDNDKLSDALGLYNCSFE------VTGVDPVTGSTSGE----YTIKLKATPNKDYVWEDGTNTPKT 350
           TGAFGI+ATVPVIVSSCS+TSDNNG ++N  GG G G  Q  +VTP  K+ ++L GAL+ IY+    K T+ L+ E+IK N  + F+N + L+   K+  V+V G F+ S++ GE Y       V   D  K  Y   + Q++I S+NDL+ +L D     TL E++S   +  T GS Y ++      D +L+HVN+  K    T   + DL IPVSD+NL + ++ IS++G  +    + +    FN+GI N+  T T         ++     VM+ LG+  T+ T                       LD DK++++LG++N  F+      V+  +P       +    Y I +  +P + Y ++DG    KT
  S:    15 TGAFGIIATVPVIVSSCSTTSDNNGGNNNTGGGSGGGTTQTEKVTPKFKSSINLIGALTDIYNPSEGKNTNTLLGEEIKNNLDSAFENSNELEN--KNFAVTVKGNFSNSSWGGEQYTNGNWNGVTITDDNKLYYDSESPQIDISSLNDLKNKLSDE---TTLKEALSKAGVADTEGSTYTIKNRLGLTDNNLIHVNVEGKSSTAT--TQYDLQIPVSDINLDLSNVDISISGDDV-NPVEESVNLNFNIGI-NSKTTYTAPTETQKLTKKATVDSVMEQLGFKATSTTKNVVRTSITLTQDNGASTTSLVGLDTDKIAESLGIFNTEFKNITLTRVSEWNPYDEVQENQNYLTYRIDITGSPKQGYYFDDGKTEDKT 383
>gi|3850055|emb|CAA07194.1| putative lipoprotein [Mycoplasma penetrans] (336 aa)
Score = 307, Expect = 3.5e-26, Identities = 121/307 (39%), Positives = 178/307 (57%)
  Q:    14 LTGAFGIVATVPVIVSSCSSTSDNNGNSDNNPGGQGDGGQQQTE-VTPTIKTEVSLSGALSKIYD--GKKTTSDLIAEDIKANPTNYFDNGDALKELIKDATVSVNGGFTES-------TFKGETYDVWSKDAKKG----------TYPQSAAQLNIKSINDLETQLGDSKAIQTLCESISSLKITNGSDYKVEKNALKLDGDLLHVNITAKEDGKTDRVKMDLAIPVSDLNLKIDDLKISVNGTGIKT--STDLTTKYTFNVGIDNTVKTITGAKGVLAENERK-EFLKVMKALGYTDTAGTNLDNDKLSDALGLYNCSFEVTGVDPVT 320
           LTGAFGIVATVPVIVSSCSSTSDNN  + NN  G G  G  Q+E +TP +  +VSL+G+L  IYD  G K +++LIAE+IK N  + F NG+ L     D  ++V+GGF E         +   T D   KD  K            Y   + Q+NIKS++DL+T+L  +  ++   +          + ++++      + DL+HVN+   +  K+  V+ DL IP SD+NL + +L + V G  I++  +T  TT++ FN+GID+T     G+    A  E   +  KV+K L         L+N+ L  ALG+YN +F    +   T
  S:     1 LTGAFGIVATVPVIVSSCSSTSDNNNGNGNNNNGGGSDGNTQSEKITPELNDKVSLAGSLKDIYDSTGTKKSNELIAEEIKNNIKDVFKNGEKLAAE-TDLKITVDGGFPEKLTNWTDLPYVDNTDDASKKDPNKSWSAITDLNPVLYSTKSNQINIKSLDDLKTELQKTDVLKNALKDAGVSTAETSTAFEIKNQPALTNDDLVHVNVIETKSDKST-VQHDLQIPTSDINLVVSNLSVKVEGKNIESTDTTKTTTEFNFNIGIDSTQHYDQGSAKSAATTEGDVDVNKVLKDLNLATDDKGALNNEALIKALGIYNVTFSSPSIKKAT 328
>gi|26553716|ref|NP_757650.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26453723|dbj|BAC44054.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (518 aa)
Score = 306, Expect = 5.0e-26, Identities = 126/349 (36%), Positives = 195/349 (55%)
  Q:     1 MKIKKIKLLKALALTGAFGIVATVPVIVSSCSSTSDNNGNSDNNPGGQGDGGQQQ--TEVTPTIKTEVSLSGALSKIYDGK--KTTSDLIAEDIKANPTNYFDNGDALKELIKDATVSVNGGFTESTFKGETYDV----WSKD-AKKGTYPQSAAQLNIKSINDLETQLGDSKAIQTLCESISSLKITNGSDYKVEKNALKLDGDLLHVNITAKEDGKTDRVKMDLAIPVSDLNLKIDDLKISVNGTGIKTSTDLTTKYTFNVGIDNTVKTI-----------TGAKGVL----------AENERKEFLKVMKALGYTDTAGTNLDNDKLSDALGLYNCSFEVTGVDPV----------TGSTSGEYTIKLKATPNKDYVWEDGTNTPK 349
           MK  K K+LK LA+TGAFGI+ATVPVI+S+CSS S+N+  +  N  G   G   +   +VTP +K+ ++L G+++ IY+ +   T+ DL+ + IK+N    F+N   L  + KD  + +   F+ S + GETY+V    W  D   K TY  S AQ+N  S+NDL+ QL D   I+ + +  S +  T  + YK+E      + ++LH+N+   E GK+     DL IPVSDL L +  + + V+   I  S +      FN+GI++    +             A  +L           +N  K  +   +  G + T   +LD+DK+ + LG++N +F    +  +          T      Y I L   PNK Y +EDGT   K
  S:     1 MKTAKKKVLKTLAITGAFGIIATVPVIISACSSASNNSNTNGGNNTGDNSGNGTRDPQKVTPKLKSSINLVGSITDIYNHEVNNTSHDLLIKKIKSNLGLVFENESEL--VNKDINIKLESDFSNSEWIGETYNVTNKNWGSDTTTKLTYAHSLAQINFSSLNDLKMQLSDQIKIKEILKE-SGVPDTYLNTYKIENKTGLTENNILHINVI--EVGKSSPKNYDLQIPVSDLKLVLPQVNVLVSENDI-NSINQPIDINFNIGIESHSNYVGPVETQIIDERASANSILEKLGFIKMTNTKNSNKTNMTFTEINGASVTTNIDLDSDKVGETLGVFNTTFSDVKLTRISEWNPYDVVSTEDNYLTYKIDLNGRPNKGYYFEDGTTESK 383
>gi|26554161|ref|NP_758095.1| signal-peptide-less P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454170|dbj|BAC44499.1| signal-peptide-less P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (494 aa)
Score = 284, Expect = 1.4e-23, Identities = 105/347 (30%), Positives = 182/347 (52%)
  Q:     1 MKIKKIKLLKALALTGAFGIVATVPVIVSSCSSTSDNNGNSDNNPGGQG-----DGGQQQTEVTPTIKTEVSLSGALSKIYD--GKKTTSDLIAEDIKANPTNYFDNGDALKELIKDATVSVNGGFTESTFKGETYDV----WS---KDAKKGTYPQSAAQLNIKSINDLETQLGDSKAIQTLCESISSLKITNGSDYKVE-KNALKLDGDLLHVNITAKEDGKTDRVKMDLAIPVSDLNLKIDDLKISVNGTGIKTSTDLTTKYTFNVGIDNTVKTITGAKGVLAENERKEFLKVMKALGYTDTAGTN-----LDNDKLSDALGLYNCSFEVTGVD----PVTGSTSGEYTIKLKATPNKDYVWEDGTNT 347
           MK ++ K+ K +AL+G F + A VP  V S ++    NGN  NN  G         G + T+VTP +K+ + + G+   ++D    KTT++L+A+ IK NP+ +F+N + L    K+  V V    + S + G++YDV    W    +++ K  Y  S+    I S++D + +L    A   L +S+++  +   S+     KN + L   L H+N+ A    K  +   DL IP S++N   ++L I V G  +   T     + +++GI  ++    G+  ++      E   VM  LG+  ++        LDN+K+S ALG++N +F  T ++     V       + + +    N DY +EDGT +
  S:     1 MKTQRSKIGKVIALSGIFTVTAAVPAAVLSSAAL---NGNFANNQSGDALIPSNPSGHENTKVTPKLKSSIQMMGS-EDLFDLGSNKTTNELLAQKIKDNPSLFFENPEVLAG--KNFDVVVEDNLSSSAWTGQSYDVSKGNWGNTIEESNKLLYSSSSPNFTISSLDDFKAKL---NAGSRLKDSLTAAGLNVDSNTTPSIKNKIGLSDGLFHINVEASVSNK--KADYDLQIPTSNINFSFENLNIKVTGNDV-VETKQRVAFKYSIGI-KSISKYNGSSEIMKMWYASES-AVMSGLGFLSSSKNESSELILDNNKVSKALGVFNTTFSNTKLELDNSAVNEGNYLTFKVTITGNANADYCFEDGTTS 357
>gi|26554106|ref|NP_758040.1| putative P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454114|dbj|BAC44444.1| P35 lipoprotein homolog fragment [Mycoplasma penetrans HF-2] (179 aa)
Score = 236, Expect = 5.5e-18, Identities = 75/151 (49%), Positives = 98/151 (64%)
  Q:    14 LTGAFGIVATVPVIVSSCSSTSDNNGNSDNNPGGQGDGGQQQTEVTPTIKTEVSLSGALSKIYDGK--KTTSDLIAEDIKANPTNYFDNGDALKELIKDATVSVNGGFTESTFKGETYDV----WSKDAKKGT----------YPQSAAQLNIKSINDLETQLGDSK 164
           +TGAFGI+ATVPVIVSSCSSTSDNNG +    G    GG+Q   + P IK+ V+LSGAL+ IY+      T+ LIA++IK N  + FDNG  L   + D  VSV   F  ST+ G ++D     W  +   G              S +QLNI S++DL+TQL D+K
  S:    14 MTGAFGIIATVPVIVSSCSSTSDNNGGN----GDTNQGGEQSQTIIPQIKSSVTLSGALTDIYNPTDISKTNSLIADEIKNNLADVFDNGSDLTN-VSDLEVSVTHTFPASTWTGLSFDSTSGNWKAEGSSGNDVTIDNANKLVYSSESQLNISSLSDLKTQLDDTK 175
>gi|26554195|ref|NP_758129.1| putative P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454204|dbj|BAC44533.1| P35 lipoprotein homolog fragment [Mycoplasma penetrans HF-2] (144 aa)
Score = 191, Expect = 9.1e-13, Identities = 65/129 (50%), Positives = 87/129 (67%)
  Q:     9 LKALALTGAFGIVATVPVIVSSCSSTSDNNGNSDNNPGGQGDGGQQQT-------EVTPTIKTEVSLSGALSKIYD--GKKTTSDLIAEDIKANPTNYFDNGDALKELIKDATVSVNGGFTESTFKGETYDVWSKDAK 137
           +KALALTGAFGI+ATVPVIVSSCSSTS+NNG S N   G   GG           +VTP +K+ ++L GAL  IY+    KTT DL+A++IK NP+  F++ + L    K+  VSV   F+ S++  +TYD   K  +
  S:     1 MKALALTGAFGIIATVPVIVSSCSSTSENNGGSGNGGTGDNQGGGGSGGGTTDTQKVTPKLKSSINLVGALKDIYNPASGKTTKDLLAQEIKNNPSLAFEDSEKLNG--KNFDVSVEATFSRSSWTDKTYDTEKKTMR 136
>gi|3850053|emb|CAA07193.1| putative lipoprotein [Mycoplasma penetrans] (120 aa)
Score = 177, Expect = 4.6e-11, Identities = 57/86 (66%), Positives = 68/86 (79%)
  Q:     8 LLKALALTGAFGIVATVPVIVSSCSSTSDNNGNSDNNPGGQGDGGQQQTE-VTPTIKTEVSLSGALSKIYD--GKKTTSDLIAEDIKAN 93
           LLKALALTGAFGIVATVPVIVSSCSSTSDNN  + NN  G G  G  Q+E +TP +  +VSL+G+L  IYD  G K +++LIAE+IK N
  S:     1 LLKALALTGAFGIVATVPVIVSSCSSTSDNNNGNGNNNNGGGSDGNTQSEKITPELNDKVSLAGSLKDIYDSTGTKKSNELIAEEIKNN 89
>gi|26554158|ref|NP_758092.1| signal-peptide-less P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454167|dbj|BAC44496.1| signal-peptide-less P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (204 aa)
Score = 173, Expect = 1.2e-10, Identities = 69/187 (36%), Positives = 101/187 (54%)
  Q:     1 MKIKKIKLLKALALTGAFGIVATVPV-----IVSSCSSTSDNNGNSDNNPGGQGDGGQQQTEVTPTIKTEVSLSGALSKIYDGKKTT--SDLIAEDIKANPTNYFDNGDALKELIKDATVSVNGGFTEST-FKGETYDV---WSKDAKKGT--YPQSAAQLNIKSINDLETQLGDSKAIQTLCESISSLKITNGSDYKVE 187
           MK    KLLK  ++ G F      P+      V S  S SD+NGN  N     G        + P +K+ ++LSG L KIY+ +  +  +D IA++IK N    F+N + LK  + D  + +NG F +S+ + G  YD    WS   K+    Y  S  QLN+ S+ DL+ QL DSK  + L E  SS K+   ++Y V+
  S:     1 MKSNVAKLLKISSVVGIFAASTAAPISLVSMYVFSNKSLSDSNGNDSNTNPEDG-------SIIPKLKSSINLSGPLDKIYNSQNASEANDWIAQEIKTNLDLAFENSEELKS-VTDLNILINGDFLDSSSWDGNPYDGNNGWSSLTKENQILYSASLEQLNVSSLTDLKNQLTDSKIKEILNEYDSS-KLNWTAEYSVK 191
>gi|26554105|ref|NP_758039.1| putative P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454113|dbj|BAC44443.1| P35 lipoprotein homolog fragment [Mycoplasma penetrans HF-2] (159 aa)
Score = 163, Expect = 1.9e-09, Identities = 56/133 (42%), Positives = 82/133 (61%)
  Q:   217 LAIPVSDLNLKIDDLKISVNGTGIKTSTDLTTKYTFNVGID---NTVKTITGAKGVLAENERKEFLKVMKALGY-TDTAGT----NLDNDKLSDALGLYNCSFEVTG------VDPVTGSTSGEYTIKLKATPNKDYVWEDGTNTPK 349
           + IPVSDLNL I +L ++V GT + T T L T +T+N+GI+   N  +         A+++  +   +++ LGY T ++GT     ++ND +  ALG+YN +F  TG       D    +    YTI L ATPN  +VWED TNT K
  S:     1 MQIPVSDLNLVISNLSVTVKGTNV-TETTLETNFTYNIGINSASNYEEPTNKPSITQAQSQTLDANVILEKLGYVTASSGTPTTYTVNNDTIVKALGVYNVTFTNTGATVTEKTDANNAANQKTYTITLNATPNDGHVWEDATNTSK 146
>gi|26554194|ref|NP_758128.1| putative P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454203|dbj|BAC44532.1| P35 lipoprotein homolog fragment [Mycoplasma penetrans HF-2] (381 aa)
Score = 152, Expect = 3.3e-08, Identities = 61/215 (28%), Positives = 107/215 (49%)
  Q:   135 DAKKGTYPQSAAQLNIKSINDLETQLGDSKAIQTLCESISSLKITNGSDYKVEKNALKLDGDLLHVNITAKEDGKTDRVKMDLAIPVSDLNLKIDDLKISVNGTGIKTSTDLTTKYTFNVGIDNTVKTITGAKGVLAENERKEFLKVMKALGYTDTAGTN------------LDNDKLSDALGLYNCSFE--VTGVDPVTGSTSGE----YTIKLKATPNKDYVWEDGTNTPK 349
           +  K  Y  ++ Q++IKS++DL+TQL D   ++   +   +  +   + Y ++      D DL+HVN+ + +   T     DL IP SD+NL I DL + V+G  + T  +      +N+ I +   + TG   +   N       VM+ LG+  T  T             L+++K+ + LG++N  F   V  +D     +S      Y I +  TP + Y +E G  + +
  S:    15 ETNKLHYSYNSPQIDIKSLDDLKTQLSDQTKLKDALKEAGA-TVDETATYTIKNQPGLTDDDLIHVNVESSKASAT-ATNYDLQIPASDINLVISDLNVKVSGADV-TEVNEKVNLNYNIAIKDET-SYTGPADIKKMNATPTEDSVMQELGFKATTRTKRSTDATPAATVALNSEKIGETLGVFNTEFSNPVLELDSTNNPSSTNNFFTYKITVTGTPKEGYHFEGGETSKQ 243
>gi|26554133|ref|NP_758067.1| P35 lipoprotein [Mycoplasma penetrans HF-2] >gi|26454141|dbj|BAC44471.1| P35 lipoprotein homolog [Mycoplasma penetrans HF-2] (439 aa)
Score = 100, Expect = 3.8e-02, Identities = 90/296 (30%), Positives = 126/296 (42%)
  Q:    39 GNSDNNPGGQGDGGQQQTE------------VTPTIKTEVSLSGALSKIYDGKKT--TSDLIAEDIKANPTNYFDNGDALKELIKDATVSVNGGFTESTFKGETYD--------VWSKDAKKGT-----------YPQSAAQLNIKSINDLETQLGDSKAIQTLCESISSLKITNGSDYKVEKNA-LKLDGDLLHVNITAKEDGKTDRVKMDLAIPVSDLNLKIDDLKISVNGT-GIKTSTDLTTKYTFNVGI-DNTVKTITGAKGVLAENERKEFLKVMKALGYTDTAGTNLDNDKLSDALGLYNCSFEVTGVDPVTGSTSGEYTIKLKAT 334
           GN D+N   QG+    +              +TP IK+ V+L GALS IYD   T  T++LIA++IK N +  FDNG+ALK+ I    +SVN  F +ST+ G  ++         W  D    T           YP     L I S++DL+TQL DSK  +          I   ++ K E N    +D  L   N     D K                   D L ++V GT  ++ S D TT Y   + + D  +K       V  +N     L+            TN DN+                G  P             +AT
  S:    62 GNGDSNSNNQGESNPNENNGNGNQGDQQTETITPKIKSTVTLGGALSNIYDTANTSNTNNLIADEIKKNLSEVFDNGEALKD-ISSLDISVNHKFPDSTWTGLPFNHSSDGSSVFWGNDQADQTSILIEPENKLLYPSKTQPLTISSLSDLKTQLNDSKLKE----------ILKDTETKPEANTTYSVDNALGFTNKALGSDNK-------------------DLLHVNVVGTTKVEGSEDTTTNYDLQIPVSDLNLKLTDLEVTVKGDNVTTSTLRTTLTYNIGINDSTNQDNE----------------GAKP-------------QAT 334
>gi|7716573|gb|AAF68436.1|AF242295_1 surface layer protein [Bacillus firmus] (931 aa)
Score = 91, Expect = 4.0e-01, Identities = 46/169 (27%), Positives = 75/169 (44%)
  Q:   189 NALKLDGDLLHVNITAKEDGKTDRVKMDLAIPVSDLNLKIDDLKISVNGTGIKTSTDLTTKYTFNVGIDNTVKTITGAKGVLAENERKEFLKVMKALGYTDTAGTNLDNDKLSDALGLYNCSF---EVTGVDPVTGSTSGEYTIKLKATPNKDYVWEDGTNTPKTDVSFVAT 357
           N  K+DG  +  N     +   D + + L  P  D      +   + NG  +++   L T        DNT  T+TGA+ V A   +  F + + AL  TD A   +D+ +LS+    YN  F     +G D V  S  G+ ++ +  +PN D  W    N+ +  V+ + T
  S:   742 NNFKIDGQAVSSNSDITLNSTRDIITVSL--PSEDSVKISGNALFTTNGLALESGRALATATATVTVTDNTAPTLTGAQLVSANVIKFTFDENLDALTLTDAADL-IDDIQLSNGTVAYNGGFASGATSGGDTVVSSVDGK-SLVVTVSPNSDSNWATVVNSSQISVTTLDT 909
>gi|123290642|ref|XP_001290475.1| hypothetical protein TVAG_264520 [Trichomonas vaginalis G3] >gi|121863056|gb|EAX77545.1| conserved hypothetical protein [Trichomonas vaginalis G3] (399 aa)
Score = 89, Expect = 6.7e-01, Identities = 35/105 (33%), Positives = 50/105 (47%)
  Q:    80 KTTSDLIAEDIKANPTNYFDNGDALKELIKDATVSVNGGFTESTFKG------ETYDVWSKDAKKGTYPQSAAQLNIKSINDLETQL---GDSKAIQTLCESISSLKITNGSDY 184
           K T D++A+ + ++     ++G  LKEL K  T   N        KG      E    W++    GTYPQ   + NI  +N+LE +L    D   +QTL   I       GS Y
  S:   158 KETVDMLAQTVSSHTRGLMEDGQQLKELEKGVTELRNTKADSKWIKGYVDATKEYIFTWTE----GTYPQKYHRHNISDVNELEEKLYKKADKTELQTLKTEILQTLYPIGSIY 267
>gi|123154031|ref|XP_001277942.1| hypothetical protein TVAG_523750 [Trichomonas vaginalis G3] >gi|121823381|gb|EAX65012.1| hypothetical protein TVAG_523750 [Trichomonas vaginalis G3] (209 aa)
Score = 89, Expect = 6.8e-01, Identities = 34/105 (32%), Positives = 51/105 (48%)
  Q:    80 KTTSDLIAEDIKANPTNYFDNGDALKELIKDATVSVNGGFTESTFKG------ETYDVWSKDAKKGTYPQSAAQLNIKSINDLETQL---GDSKAIQTLCESISSLKITNGSDY 184
           K T D++A+ + ++     ++G  LKEL K  T   N     +  KG      E    W+    +GTYPQ   + +I  +N+LE +L    D   +QTL   I       GS Y
  S:    32 KETVDMLAQTVSSHTRGLMEDGQQLKELEKGVTELRNTKADSTWIKGYVDATKERIFAWT----EGTYPQKYHRHSISDVNELEEKLYKKADKTELQTLKTEILQTVYPIGSIY 141
>gi|123258852|ref|XP_001289240.1| tail fiber protein, putative [Trichomonas vaginalis G3] >gi|121859902|gb|EAX76310.1| tail fiber protein, putative [Trichomonas vaginalis G3] (289 aa)
Score = 88, Expect = 8.0e-01, Identities = 34/105 (32%), Positives = 51/105 (48%)
  Q:    80 KTTSDLIAEDIKANPTNYFDNGDALKELIKDATVSVNGGFTESTFKG------ETYDVWSKDAKKGTYPQSAAQLNIKSINDLETQL---GDSKAIQTLCESISSLKITNGSDY 184
           K T D++A+ + ++     ++G  LKEL K  T   N     +  KG      E    W+    +GTYPQ   + +I  +N+LE +L    D   +QTL   I       GS Y
  S:    48 KETVDMLAQTVSSHTRGLMEDGQQLKELEKGVTELRNTKADSTWIKGYVDATKERIFAWT----EGTYPQKYHRHSISDVNELEEKLYKKADKTELQTLKTEILQTVYPIGSIY 157