>gi|26553521|ref|NP_757455.1| putative two-component response regulator [Mycoplasma penetrans HF-2] >gi|26453527|dbj|BAC43859.1| putative two-component response regulator [Mycoplasma penetrans HF-2] (240 aa)
Score = 1139, Expect = 5.1e-123, Identities = 240/240 (100%), Positives = 240/240 (100%)
  Q:     1 MRNTFLIAYISINENSNSVVYESYSKFSSEILLNDKTFKIERVMLKPNEIDYLTTVHASVVIFDNIPSDQIDEAMVKKIKLISPITHFVYFCENYDEDTFLSVLQKGFEFCVSLDFFTPSLFFQTLLNIFHKVEVINLMNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQYIYKLKKKIGKDNIVSSTYNGYCFKLRESFRK 240
           MRNTFLIAYISINENSNSVVYESYSKFSSEILLNDKTFKIERVMLKPNEIDYLTTVHASVVIFDNIPSDQIDEAMVKKIKLISPITHFVYFCENYDEDTFLSVLQKGFEFCVSLDFFTPSLFFQTLLNIFHKVEVINLMNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQYIYKLKKKIGKDNIVSSTYNGYCFKLRESFRK
  S:     1 MRNTFLIAYISINENSNSVVYESYSKFSSEILLNDKTFKIERVMLKPNEIDYLTTVHASVVIFDNIPSDQIDEAMVKKIKLISPITHFVYFCENYDEDTFLSVLQKGFEFCVSLDFFTPSLFFQTLLNIFHKVEVINLMNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQYIYKLKKKIGKDNIVSSTYNGYCFKLRESFRK 240
>gi|196190944|gb|EDX85908.1| response regulator receiver domain protein [Synechococcus sp. PCC 7335] (226 aa)
Score = 187, Expect = 1.3e-12, Identities = 35/98 (35%), Positives = 62/98 (63%)
  Q:   140 NNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKKIGKDNIVSSTYNGYCFKLRES 237
           N+ ++W +N+S++L+ R+V  SG+ +++   EF + + F  HP    S+E++  +VWGYD  P + +V  Y+  L+KK+G D I   T  G  ++LR+S
  S:   130 NDQMLWASNVSLDLLTRRVQVSGEIVDLPAREFTLAETFFRHPGQVLSREQLLDRVWGYDYSPGSNIVDVYVGYLRKKLGADLI--ETVRGIGYRLRQS 226
>gi|196187840|gb|EDX82806.1| Transcriptional regulatory C terminal domain protein [Synechococcus sp. PCC 7335] (179 aa)
Score = 175, Expect = 3.9e-11, Identities = 48/138 (34%), Positives = 76/138 (55%)
  Q:    98 DTFLSVLQKGFEFCVSLDFFTPSLFFQTLLNIFHKVEV------INLMNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGKDNIVSSTYNGYCFKLR 235
           D  ++VL+ G +     D+ T    F+ LL    KV++        L +  ++   +LS+NLI R+   SG+ +E++  EF + +  L HP    SKE++  +VWGYD DP   VI+ YI  L++K G   I   T  G  ++LR
  S:    38 DDTVTVLESGAD-----DYVTKPFRFEELLARI-KVQMRGLHGQQKLQSETVLRVGDLSLNLITRQAIISGRTVELSAREFVLAEVLLRHPMHVMSKEQLLNRVWGYDYDPGSNVIEVYIRHLRQKFGNGYI--ETIRGMGYRLR 174
>gi|152994457|ref|YP_001339292.1| two component transcriptional regulator [Marinomonas sp. MWYL1] >gi|150835381|gb|ABR69357.1| two component transcriptional regulator, winged helix family [Marinomonas sp. MWYL1] (229 aa)
Score = 173, Expect = 5.6e-11, Identities = 32/90 (35%), Positives = 59/90 (65%)
  Q:   147 NNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKKIGKDNI--VSSTYNGYCFKLRE 236
           ++L M+L+ R+VW +G+EI +   EF IL++ +EHP    ++  +F+ VW YD DP T ++  ++ +L+KK+  D++  +  T  G  ++L E
  S:   133 SDLKMDLLTRQVWRAGREISLQPKEFQILRYLMEHPKQVVTRTLLFEAVWDYDFDPQTNVIDVHVARLRKKVETDDLPPILETIRGVGYRLVE 225
>gi|158339279|ref|YP_001520456.1| two component transcriptional regulator [Acaryochloris marina MBIC11017] >gi|158309520|gb|ABW31137.1| two component transcriptional regulator, winged helix family [Acaryochloris marina MBIC11017] (226 aa)
Score = 168, Expect = 2.4e-10, Identities = 33/90 (36%), Positives = 52/90 (57%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGKDNIVSSTYNGYCFKLRES 237
           NLS++L+ R+ W   + +E++  EF + +  L HP    SKE++  +VWGYD DP   +I+ YI  L++K G   I   T  G  ++L  S
  S:   136 NLSLDLLTRQAWVGNRVVELSAKEFILAEVLLRHPMQVMSKEQLLNRVWGYDYDPGSNIIEVYIRHLRRKFGSQYI--ETVRGMGYRLNSS 224
>gi|196183159|gb|EDX78143.1| response regulator receiver domain protein [Microcoleus chthonoplastes PCC 7420] (222 aa)
Score = 162, Expect = 1.0e-09, Identities = 34/88 (38%), Positives = 53/88 (60%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKKIGKDNIVSSTYNGYCFKLR 235
           ++S++L  R+V   GQ +E++  EF + +  L HP    S+E++   VWGYD DP + +V  YI  L+KK+G D I   T  G  ++LR
  S:   135 HVSLDLRTRRVRVKGQRVELSAREFTLAETLLRHPGQVMSREQLLSHVWGYDYDPGSNIVDVYIGYLRKKLGSDLI--ETVRGMGYRLR 221
>gi|56751805|ref|YP_172506.1| two-component response regulator [Synechococcus elongatus PCC 6301] >gi|81301114|ref|YP_401322.1| two component transcriptional regulator [Synechococcus elongatus PCC 7942] >gi|2944391|gb|AAC33849.1| response regulator NblR [Synechococcus sp. PCC 7942] >gi|56686764|dbj|BAD79986.1| two-component response regulator [Synechococcus elongatus PCC 6301] >gi|81169995|gb|ABB58335.1| two component transcriptional regulator, winged helix family [Synechococcus elongatus PCC 7942] (228 aa)
Score = 162, Expect = 1.1e-09, Identities = 37/91 (40%), Positives = 59/91 (64%)
  Q:   147 NNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKI---GKDNIVSSTYNGYCFKLRES 237
           +NL+++L  R+   +G++I++T  EFD+L+F +EHP    ++E+I + VWGYD      VI+ YI  L+ KI   G+  +V  T  G  + LRES
  S:   135 SNLTLDLSTRRAARNGRQIDLTMKEFDLLRFLMEHPREVLTREQILENVWGYDFMGESNVIEVYIRYLRLKIEIEGEKRLV-QTVRGVGYVLRES 228
>gi|17232680|ref|NP_489228.1| two-component response regulator [Nostoc sp. PCC 7120] >gi|17134327|dbj|BAB76887.1| two-component response regulator [Nostoc sp. PCC 7120] (222 aa)
Score = 161, Expect = 1.3e-09, Identities = 35/97 (36%), Positives = 53/97 (54%)
  Q:   139 MNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKKIGKDNIVSSTYNGYCFKLR 235
           M   +I   N+ ++L  RKV      IE+   EF + + F  HP    S+E++  +VWGYD DP + +V  Y+  L+KK+G D I   T  G  ++LR
  S:   126 MEETVIKSGNIVLDLRSRKVKIGQDTIELPAREFTLAETFFRHPGQVLSREQLLDRVWGYDYDPGSNIVDVYVGYLRKKLGNDLI--ETVRGMGYRLR 221
>gi|21220620|ref|NP_626399.1| two component system response regulator [Streptomyces coelicolor A3(2)] >gi|4539212|emb|CAB39870.1| putative two component system response regulator [Streptomyces coelicolor A3(2)] (221 aa)
Score = 160, Expect = 1.9e-09, Identities = 31/82 (37%), Positives = 49/82 (59%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKKIGKDNIVSSTYNGY 230
           LS++L  R+    G+ +++T  EF +L+ FL HP    S+E+I   VWGYD DP + +V  Y+  L+KK+G   + +    GY
  S:   134 LSLDLRTRRARSEGRTVDLTAREFVLLELFLRHPGQVLSREQILSHVWGYDFDPGSNIVDVYVRALRKKLGARQVETVRGMGY 216
>gi|189218617|ref|YP_001939258.1| DNA-binding response regulator, OmpR family (REC-wHTH domains) [Methylokorus infernorum V4] >gi|189185475|gb|ACD82660.1| DNA-binding response regulator, OmpR family (REC-wHTH domains) [Methylacidiphilum infernorum V4] (268 aa)
Score = 159, Expect = 2.5e-09, Identities = 34/87 (39%), Positives = 56/87 (64%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKKI--GKDNIVSSTYNGYCFKL 234
           NL++NL+ R+V+   ++IE+T  EF IL+  +  P   F++ ++ ++VW Y  DP T LV  YI KL+KKI  G++  +  T  G  +K+
  S:   176 NLTLNLLTREVFRGQKKIELTAKEFSILELLMRTPGRVFTRTQVCERVWNYHFDPGTNLVDVYIQKLRKKIDEGEEQKLIQTVRGVGYKI 265
>gi|161075795|gb|ABX56645.1| DNA binding copper response regulator [Verrucomicrobiae bacterium V4] (223 aa)
Score = 159, Expect = 2.5e-09, Identities = 34/87 (39%), Positives = 56/87 (64%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKKI--GKDNIVSSTYNGYCFKL 234
           NL++NL+ R+V+   ++IE+T  EF IL+  +  P   F++ ++ ++VW Y  DP T LV  YI KL+KKI  G++  +  T  G  +K+
  S:   131 NLTLNLLTREVFRGQKKIELTAKEFSILELLMRTPGRVFTRTQVCERVWNYHFDPGTNLVDVYIQKLRKKIDEGEEQKLIQTVRGVGYKI 220
>gi|126172546|ref|YP_001048695.1| two component transcriptional regulator [Shewanella baltica OS155] >gi|149117026|ref|ZP_01843735.1| two component transcriptional regulator, winged helix family [Shewanella baltica OS223] >gi|152998839|ref|YP_001364520.1| two component transcriptional regulator [Shewanella baltica OS185] >gi|125995751|gb|ABN59826.1| two component transcriptional regulator, winged helix family [Shewanella baltica OS155] >gi|146862983|gb|EDK48573.1| two component transcriptional regulator, winged helix family [Shewanella baltica OS223] >gi|151363457|gb|ABS06457.1| two component transcriptional regulator, winged helix family [Shewanella baltica OS185] (225 aa)
Score = 159, Expect = 2.6e-09, Identities = 39/122 (31%), Positives = 69/122 (56%)
  Q:   115 DFFTPSLFFQTLL----NIFHKVEVINLMNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKK---IGKDNIVSSTYNGYCFKLRE 236
           D+ T    F  LL     + H+ + + +  ++++ G  L M L+ R V   GQE+ +   EF +LK+ +EH N   S+  +F+ VW Y  DP T ++  +I KL++K   +G   ++  T  G  ++LR+
  S:    97 DYMTKPFAFSELLVRAEKLMHRGQSVPVTTDLVVGG--LKMELLTRNVTLDGQELMLQPKEFQLLKYLMEHANQVISRTLLFEAVWDYHFDPRTNVIDVHIAKLRRKFEELGHGELI-ETVRGAGYRLRQ 223
>gi|113476704|ref|YP_722765.1| two component transcriptional regulator [Trichodesmium erythraeum IMS101] >gi|110167752|gb|ABG52292.1| two component transcriptional regulator, winged helix family [Trichodesmium erythraeum IMS101] (235 aa)
Score = 159, Expect = 2.7e-09, Identities = 37/90 (41%), Positives = 56/90 (62%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKI---GKDNIVSSTYNGYCFKLRES 237
           NL ++   R+V+C G+ IE+T  EF++LKF +EHP    S+E+I + VWGY       VI+ YI  L+ KI   G+  ++  T  G  + LRE+
  S:   143 NLILDFASRRVFCHGRSIELTMKEFELLKFLMEHPREVLSREQILENVWGYSFLGESNVIEVYIRYLRLKIEREGEKRLI-QTIRGIGYVLRET 235
>gi|37519591|ref|NP_922968.1| two-component response regulator [Gloeobacter violaceus PCC 7421] >gi|35210582|dbj|BAC87963.1| two-component response regulator [Gloeobacter violaceus PCC 7421] (222 aa)
Score = 158, Expect = 3.0e-09, Identities = 31/94 (32%), Positives = 55/94 (58%)
  Q:   142 VIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKKIGKDNIVSSTYNGYCFKLR 235
           +++    +S++L  RKV   G+ +E++  EF + + F+ HP    S+E +  +VWGYD DP + +V  Y+  L++K+  D I   T  G  ++LR
  S:   129 LVLRSGEISLDLRTRKVSAGGRTVELSAREFTLAETFMRHPGQVMSREHLLSRVWGYDYDPGSNIVDVYVGYLRRKLNTDRI--ETVRGMGYRLR 221
>gi|160873420|ref|YP_001552736.1| two component transcriptional regulator [Shewanella baltica OS195] >gi|160858942|gb|ABX47476.1| two component transcriptional regulator, winged helix family [Shewanella baltica OS195] (225 aa)
Score = 158, Expect = 3.3e-09, Identities = 39/122 (31%), Positives = 69/122 (56%)
  Q:   115 DFFTPSLFFQTLL----NIFHKVEVINLMNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKK---IGKDNIVSSTYNGYCFKLRE 236
           D+ T    F  LL     + H+ + + +  ++++ G  L M L+ R V   GQE+ +   EF +LK+ +EH N   S+  +F+ VW Y  DP T ++  +I KL++K   +G   ++  T  G  ++LR+
  S:    97 DYMTKPFAFSELLVRAEKLMHRGQSVPVTTDLVVGG--LKMELLTRNVTLDGQELLLQPKEFQLLKYLMEHANQVISRTLLFEAVWDYHFDPRTNVIDVHIAKLRRKFEELGHGELI-ETVRGAGYRLRQ 223
>gi|75908656|ref|YP_322952.1| two component transcriptional regulator [Anabaena variabilis ATCC 29413] >gi|75702381|gb|ABA22057.1| two component transcriptional regulator, winged helix family [Anabaena variabilis ATCC 29413] (222 aa)
Score = 158, Expect = 3.6e-09, Identities = 34/98 (34%), Positives = 55/98 (56%)
  Q:   138 LMNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKKIGKDNIVSSTYNGYCFKLR 235
           +M  ++I   ++ ++L  RKV      IE+   EF + + F  HP    S+E++  +VWGYD DP + +V  Y+  L+KK+G D I   T  G  ++LR
  S:   125 VMEEMVIKSGHIVLDLRSRKVKIGQDTIELPAREFTLAETFFRHPGQVLSREQLLDRVWGYDYDPGSNIVDVYVGYLRKKLGNDLI--ETVRGMGYRLR 221
>gi|72161734|ref|YP_289391.1| response regulator receiver [Thermobifida fusca YX] >gi|71915466|gb|AAZ55368.1| response regulator receiver [Thermobifida fusca YX] (219 aa)
Score = 156, Expect = 6.2e-09, Identities = 36/116 (31%), Positives = 60/116 (51%)
  Q:   115 DFFTPSLFFQTLL-NIFHKVEVINLMNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGKDNIVSSTYNGY 230
           D+ T    F+ LL  I  ++   +     ++   +L+++L  R+       +++T  EF +L+ FL HP    S+++I   VWGYD DP   V+  +I  L+KKIG   I +    GY
  S:    98 DYMTKPFRFEELLARIRLRMRSAHNAETTVLHAGDLALDLRTRRASTPEATVDLTAREFALLELFLRHPGQVLSRQQILSHVWGYDYDPGSNVVDVFIRALRKKIGAHRIETLRGMGY 215
>gi|163749892|ref|ZP_02157137.1| DNA-binding response regulator [Shewanella benthica KT99] >gi|161330406|gb|EDQ01385.1| DNA-binding response regulator [Shewanella benthica KT99] (225 aa)
Score = 154, Expect = 8.4e-09, Identities = 35/89 (39%), Positives = 54/89 (60%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKK---IGKDNIVSSTYNGYCFKLRE 236
           NL M L+ RKV   G E+ +   EF +LK+ +EHPN   S+  +F+ VW Y  DP T ++  +I KL++K   +G   ++  T  G  ++LRE
  S:   132 NLVMELLTRKVTLDGSELMLQPKEFQLLKYLMEHPNQVVSRTLLFEAVWDYHFDPRTNVIDVHIAKLRRKFEELGFGELI-ETVRGAGYRLRE 223
>gi|75908143|ref|YP_322439.1| two component transcriptional regulator [Anabaena variabilis ATCC 29413] >gi|75701868|gb|ABA21544.1| two component transcriptional regulator, winged helix family [Anabaena variabilis ATCC 29413] (228 aa)
Score = 154, Expect = 9.3e-09, Identities = 35/90 (38%), Positives = 57/90 (63%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKI---GKDNIVSSTYNGYCFKLRES 237
           +L ++L +R+   SG+ +E+T  EF++LK+ +EHP    ++E+I + VWGYD      VI+ YI  L+ KI   G+  ++  T  G  + LRES
  S:   136 DLILDLANRRAVYSGRNVELTMKEFELLKYLMEHPREVLTREQILENVWGYDFMGESNVIEVYIRYLRLKIEDEGQKRLI-QTVRGVGYVLRES 228
>gi|17232242|ref|NP_488790.1| two-component response regulator [Nostoc sp. PCC 7120] >gi|17133887|dbj|BAB76449.1| two-component response regulator [Nostoc sp. PCC 7120] (228 aa)
Score = 154, Expect = 9.3e-09, Identities = 35/90 (38%), Positives = 57/90 (63%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKI---GKDNIVSSTYNGYCFKLRES 237
           +L ++L +R+   SG+ +E+T  EF++LK+ +EHP    ++E+I + VWGYD      VI+ YI  L+ KI   G+  ++  T  G  + LRES
  S:   136 DLILDLANRRAVYSGRNVELTMKEFELLKYLMEHPREVLTREQILENVWGYDFMGESNVIEVYIRYLRLKIEDEGQKRLI-QTVRGVGYVLRES 228
>gi|169827847|ref|YP_001698005.1| DNA-binding response regulator [Lysinibacillus sphaericus C3-41] >gi|168992335|gb|ACA39875.1| DNA-binding response regulator [Lysinibacillus sphaericus C3-41] (228 aa)
Score = 154, Expect = 1.0e-08, Identities = 29/74 (39%), Positives = 50/74 (67%)
  Q:   147 NNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKKIGKD 220
           + L+++   RKV+ +G+E+  T  EFD+L FF++HPN   SKE+++++ WGY+       V  +I KL++KI +D
  S:   135 HGLTIDTSARKVFVNGEEVAFTTKEFDLLVFFVKHPNQVLSKEQLYERNWGYESAADVSTVTVHIRKLREKIERD 209
>gi|22297805|ref|NP_681052.1| two-component response regulator [Thermosynechococcus elongatus BP-1] >gi|22293982|dbj|BAC07814.1| two-component response regulator [Thermosynechococcus elongatus BP-1] (229 aa)
Score = 154, Expect = 1.1e-08, Identities = 39/121 (32%), Positives = 71/121 (58%)
  Q:   117 FTPSLFFQTLLNIFHKVEVINLMNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGKD--NIVSSTYNGYCFKLRES 237
           ++P  F Q ++ ++ K  V     + ++  +NL+++L+ R+   +G+ I++T  E+++LKF +EHP    ++E+I + VWGYD      VI+ YI  L+ KI  D    +  T  G  + LRE+
  S:   110 YSPKSFLQ-MIQLYLKPPV---TQSEVLRFDNLTLDLLTRRAERNGRIIDLTMKEYELLKFLMEHPREVLTREQILENVWGYDFLGESNVIEVYIRYLRLKIEPDGEKRLIHTVRGVGYVLREA 229
>gi|108803040|ref|YP_642977.1| two component transcriptional regulator [Rubrobacter xylanophilus DSM 9941] >gi|108764283|gb|ABG03165.1| two component transcriptional regulator, winged helix family [Rubrobacter xylanophilus DSM 9941] (227 aa)
Score = 153, Expect = 1.1e-08, Identities = 34/118 (28%), Positives = 68/118 (57%)
  Q:   115 DFFTPSLFFQTLL-NIFHKVEVINLMNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKI---GKDNIVSSTYN-GYCF 232
           D+ T    F+ LL  I   V   +   +  +   +L ++L+ R+VW +G+++E++  EF +L++ + HP    S+++I   VW Y  DP   V+  Y+  L++K+   G+ +++++    GY F
  S:    97 DYLTKPFAFEELLARIRALVRRADQPESTALRAGDLKLDLLSRRVWRAGRQVELSSREFALLEYLMRHPRQVLSRQQILSAVWDYAFDPGSNVVDVYVRYLRRKLDRPGEPSLITTVRGAGYRF 220
>gi|196163444|ref|ZP_03123975.1| two-component response regulator [Clostridium difficile QCD-23m63] (223 aa)
Score = 153, Expect = 1.3e-08, Identities = 43/131 (32%), Positives = 76/131 (58%)
  Q:   106 KGFEFCVSLDFFTPSLFFQTLL---NIFHKVEVINLMNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD-DDPTGLVIQYIYKLKKKIGKD--NIVSSTYNGYCFKLRE 236
           KG+E+    D+ T     + LL   N   +     +  N +I G    M +  R+V+   + I++T  EF++L+ F+E+PN  FS+E++   +WGYD +  T  V  +I  L+KK+G +  +IV+   +GY F+++E
  S:    89 KGYEYGAD-DYITKPFSPKVLLAKVNALLRRYTTGIPKNSLILGKIFIM-VASRQVYVEDKLIDLTYKEFELLRLFMENPNQVFSREKLLNCIWGYDFEGNTRTVDTHIKTLRKKLGSEGHHIVTLIRSGYKFEVKE 223
>gi|170729101|ref|YP_001763127.1| two component transcriptional regulator [Shewanella woodyi ATCC 51908] >gi|169814448|gb|ACA89032.1| two component transcriptional regulator, winged helix family [Shewanella woodyi ATCC 51908] (225 aa)
Score = 152, Expect = 1.6e-08, Identities = 34/89 (38%), Positives = 54/89 (60%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKK---IGKDNIVSSTYNGYCFKLRE 236
           NL M L+ RKV   G E+ +   EF +LK+ +EHPN   S+  +F+ VW Y  DP T ++  +I KL++K   +G   ++  T  G  ++LR+
  S:   132 NLVMELLTRKVTLDGNELMLQPKEFQLLKYLMEHPNQVISRTLLFEAVWDYHFDPRTNVIDVHIAKLRRKFEELGFGELI-ETVRGAGYRLRQ 223
>gi|186682106|ref|YP_001865302.1| two component transcriptional regulator [Nostoc punctiforme PCC 73102] >gi|186464558|gb|ACC80359.1| two component transcriptional regulator, winged helix family [Nostoc punctiforme PCC 73102] (226 aa)
Score = 152, Expect = 1.8e-08, Identities = 34/89 (38%), Positives = 56/89 (62%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGKDN--IVSSTYNGYCFKLRE 236
           +LS+N   R+V+   + IE+T  EFD+L++ L HP   F++++I +KVWGYD      +I+ YI  L+ K+ ++N   +  T  G  + LRE
  S:   133 DLSLNRRTREVFREKRSIELTAKEFDLLEYLLSHPRQVFTRDQILEKVWGYDFMGDSNIIEVYIRYLRLKLEENNEKRLIHTVRGVGYALRE 224
>gi|157377522|ref|YP_001476122.1| two component transcriptional regulator [Shewanella sediminis HAW-EB3] >gi|157319896|gb|ABV38994.1| two component transcriptional regulator, winged helix family [Shewanella sediminis HAW-EB3] (225 aa)
Score = 151, Expect = 2.0e-08, Identities = 34/89 (38%), Positives = 54/89 (60%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKK---IGKDNIVSSTYNGYCFKLRE 236
           NL M L+ RKV   G E+ +   EF +LK+ +EHPN   S+  +F+ VW Y  DP T ++  +I KL++K   +G   ++  T  G  ++LR+
  S:   132 NLVMELLTRKVTLDGTELMLQPKEFQLLKYLMEHPNQVISRTLLFEAVWDYHFDPRTNVIDVHIAKLRRKFEELGFGELI-ETVRGAGYRLRQ 223
>gi|166996358|ref|ZP_02262818.1| DNA-binding response regulator [Bacillus cereus AH820] >gi|166997589|ref|ZP_02264048.1| DNA-binding response regulator [Bacillus cereus AH820] (229 aa)
Score = 151, Expect = 2.0e-08, Identities = 29/74 (39%), Positives = 49/74 (66%)
  Q:   147 NNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDD-DPTGLVIQYIYKLKKKIGKD 220
           + +S++   RKV+ + +EI  T  EFD+L FF+ HPN   +KE++F+++WG D       V+ +I KL++KI +D
  S:   136 HGISIDQRARKVFINNEEIAFTTKEFDLLTFFVTHPNQVLNKEQLFERIWGLDSAGDLATVVVHIRKLREKIERD 210
>gi|194344400|gb|EDX25366.1| two-component system response regulator [Streptomyces sp. Mg1] (243 aa)
Score = 151, Expect = 2.1e-08, Identities = 31/88 (35%), Positives = 55/88 (62%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKI--GKDNIVSSTYNGYCFKLR 235
           +L M+L  R+V  +G+ +E+T+ EF +L+ FL HP    ++E+I K VWG+D +P+   +  Y+  L++K   G ++ +  T  G  + LR
  S:   146 DLRMDLATREVTRAGRPVELTRTEFTLLEMFLAHPRQVLTREQILKTVWGFDFEPSSNSLDVYVMYLRRKTEAGGESRLVHTVRGVGYVLR 236
>gi|16330036|ref|NP_440764.1| OmpR subfamily [Synechocystis sp. PCC 6803] >gi|1652523|dbj|BAA17444.1| OmpR subfamily [Synechocystis sp. PCC 6803] (234 aa)
Score = 151, Expect = 2.3e-08, Identities = 31/100 (31%), Positives = 61/100 (61%)
  Q:   134 EVINLMNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQYIYK-LKKKIGKDN---IVSSTY-NGYCFK 233
           E +  + N ++  NN+S+++ ++  +C GQ I +++ E  +L  FL+ P    S EEI+  +W  +  P+  V+  + + L++KI + N   +++S Y  GYCF+
  S:   128 ETLGAVKNNLLSVNNVSLDVANQVAYCQGQRIALSEKEVALLTLFLQAPGQILSHEEIYSHLWPGESPPSSNVLAALVRLLRRKIEQPNAPRLINSVYGKGYCFE 232
>gi|170746673|ref|YP_001752933.1| two component transcriptional regulator [Methylobacterium radiotolerans JCM 2831] >gi|170653195|gb|ACB22250.1| two component transcriptional regulator, winged helix family [Methylobacterium radiotolerans JCM 2831] (226 aa)
Score = 150, Expect = 2.6e-08, Identities = 28/75 (37%), Positives = 51/75 (68%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGKDNI 222
           +L ++LI+R ++C+G+EIE+   EF I++F +++  T  S++ IF+ VWGY  +    VI  +I K++KK+  D +
  S:   133 DLRLDLIERVLYCAGREIELLPKEFAIIEFLMQNAGTLVSRKMIFESVWGYSFNHQSSVIDVHIGKIRKKLDPDGL 208
>gi|158317452|ref|YP_001509960.1| two component transcriptional regulator [Frankia sp. EAN1pec] >gi|158112857|gb|ABW15054.1| two component transcriptional regulator, winged helix family [Frankia sp. EAN1pec] (220 aa)
Score = 150, Expect = 2.6e-08, Identities = 29/82 (35%), Positives = 48/82 (58%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGKDNIVSSTYNGY 230
           +S++L  R+    G+ +++T  EF + + FL HP    ++E++   VWGYD DP   V+  Y+  L++KIG D I +    GY
  S:   134 VSLDLRTRRAQVGGRTVDLTAREFVLAETFLRHPGQVLAREQLLSAVWGYDYDPGSNVVDVYVGYLRRKIGADCITTVRGMGY 216
>gi|21222554|ref|NP_628333.1| two-component systen response regulator [Streptomyces coelicolor A3(2)] >gi|7636029|emb|CAB88489.1| putative two-component systen response regulator [Streptomyces coelicolor A3(2)] (248 aa)
Score = 150, Expect = 2.7e-08, Identities = 30/89 (33%), Positives = 56/89 (62%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKI--GKDNIVSSTYNGYCFKLRE 236
           +L+M+L  R+V  +G+ +E+T+ EF +L+ F+ HP    ++E+I K VWG+D +P+   +  Y+  L++K   G +  +  T  G  + LR+
  S:   153 DLTMDLATREVSRAGRPVELTRTEFTLLEMFMAHPRQVLTREQILKAVWGFDFEPSSNSLDVYVMYLRRKTEAGGEPRLVHTVRGVGYVLRQ 244
>gi|168144070|ref|ZP_02587299.1| Two-component response regulator [Bacillus cereus G9842] (229 aa)
Score = 150, Expect = 3.1e-08, Identities = 28/74 (37%), Positives = 49/74 (66%)
  Q:   147 NNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDD-DPTGLVIQYIYKLKKKIGKD 220
           + +S++   RKV+ + +E+  T  EFD+L FF+ HPN   +KE++F+++WG D       V+ +I KL++KI +D
  S:   136 HGISIDQRARKVFINNEEVAFTTKEFDLLTFFVTHPNQVLNKEQLFERIWGLDSAGDLATVVVHIRKLREKIERD 210
>gi|167935042|ref|ZP_02522117.1| DNA-binding response regulator [Bacillus cereus AH1134] (229 aa)
Score = 150, Expect = 3.1e-08, Identities = 28/74 (37%), Positives = 49/74 (66%)
  Q:   147 NNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDD-DPTGLVIQYIYKLKKKIGKD 220
           + +S++   RKV+ + +E+  T  EFD+L FF+ HPN   +KE++F+++WG D       V+ +I KL++KI +D
  S:   136 HGISIDQRARKVFINNEEVAFTTKEFDLLTFFVTHPNQVLNKEQLFERIWGLDSAGDLATVVVHIRKLREKIERD 210
>gi|75760731|ref|ZP_00740754.1| Two-component response regulator [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|74491786|gb|EAO54979.1| Two-component response regulator [Bacillus thuringiensis serovar israelensis ATCC 35646] (233 aa)
Score = 149, Expect = 3.3e-08, Identities = 28/74 (37%), Positives = 49/74 (66%)
  Q:   147 NNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDD-DPTGLVIQYIYKLKKKIGKD 220
           + +S++   RKV+ + +E+  T  EFD+L FF+ HPN   +KE++F+++WG D       V+ +I KL++KI +D
  S:   140 HGISIDQRARKVFINNEEVAFTTKEFDLLTFFVTHPNQVLNKEQLFERIWGLDSAGDLATVVVHIRKLREKIERD 214
>gi|168713692|ref|ZP_02745969.1| two-component response regulator [Clostridium difficile QCD-63q42] >gi|196127727|ref|ZP_03119476.1| two-component response regulator [Clostridium difficile ATCC 43255] (223 aa)
Score = 149, Expect = 3.4e-08, Identities = 45/131 (34%), Positives = 77/131 (58%)
  Q:   106 KGFEFCVSLDFFTPSLFFQTLLNIFHKVEVINLMNNVIIWGNNLSMNLI-----DRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD-DDPTGLVIQYIYKLKKKIGKD--NIVSSTYNGYCFKLRE 236
           KG+E+    D+ T     + LL    KV  +       I  N+LS+  I      R+V+   + I++T  EF++L+ F+E+PN  FS+E++   +WGYD +  T  V  +I  L+KK+G +  +IV+   +GY F+++E
  S:    89 KGYEYGAD-DYITKPFSPKVLLA---KVNALLRRYTTDIPKNSLSLGKIFIMVASRQVYVEDKLIDLTYKEFELLRLFMENPNQVFSREKLLNCIWGYDFEGNTRTVDTHIKTLRKKLGSEGHHIVTLIRSGYKFEVKE 223
>gi|75906838|ref|YP_321134.1| two component transcriptional regulator [Anabaena variabilis ATCC 29413] >gi|75700563|gb|ABA20239.1| two component transcriptional regulator, winged helix family [Anabaena variabilis ATCC 29413] (228 aa)
Score = 149, Expect = 3.4e-08, Identities = 34/89 (38%), Positives = 55/89 (61%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGKDN--IVSSTYNGYCFKLRE 236
           +LS+N   R+V+   + IE+T  EFD+L++ L HP   F++++I +KVWGYD      +I+ YI  L+ K+ + N   +  T  G  + LRE
  S:   133 DLSLNRRTREVFRGNRAIELTAKEFDLLEYLLSHPRQVFTRDQILEKVWGYDFMGDSNIIEVYIRYLRLKLEEHNEKRLIHTVRGVGYALRE 224
>gi|168137790|ref|ZP_02581019.1| DNA-binding response regulator [Bacillus cereus B4264] (229 aa)
Score = 149, Expect = 3.4e-08, Identities = 28/74 (37%), Positives = 49/74 (66%)
  Q:   147 NNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDD-DPTGLVIQYIYKLKKKIGKD 220
           + +S++   RKV+ + +E+  T  EFD+L FF+ HPN   +KE++F+++WG D       V+ +I KL++KI +D
  S:   136 HGISIDQRARKVFINNEEVAFTTKEFDLLTFFVTHPNQVLNKEQLFERIWGLDSAGDLATVVVHIRKLREKIERD 210
>gi|120401900|ref|YP_951729.1| two component transcriptional regulator [Mycobacterium vanbaalenii PYR-1] >gi|119954718|gb|ABM11723.1| two component transcriptional regulator, winged helix family [Mycobacterium vanbaalenii PYR-1] (224 aa)
Score = 149, Expect = 3.5e-08, Identities = 30/89 (33%), Positives = 52/89 (58%)
  Q:   142 VIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQYIYKLKKKIGKDNIVSSTY-NGY 230
           V I   +L++    R V  +G  + +T  EFD+L FFL HP+T F++E++ K+VW +D      V  ++ +L+ K+G  + V + +  GY
  S:   127 VDIRSGDLTVTTASRTVTMAGTPVSLTNREFDLLLFFLTHPDTVFTREDLLKQVWLWDFGDLSTVTVHVKRLRSKLGDRHRVQTVWGRGY 216
>gi|145953709|ref|ZP_01802717.1| hypothetical protein CdifQ_04003714 [Clostridium difficile QCD-32g58] >gi|168694494|ref|ZP_02726771.1| two-component response regulator [Clostridium difficile QCD-37x79] >gi|168726598|ref|ZP_02758875.1| two-component response regulator [Clostridium difficile QCD-76w55] >gi|168733241|ref|ZP_02765518.1| two-component response regulator [Clostridium difficile QCD-97b34] >gi|196160620|ref|ZP_03121181.1| two-component response regulator [Clostridium difficile CIP 107932] (223 aa)
Score = 149, Expect = 3.5e-08, Identities = 45/131 (34%), Positives = 77/131 (58%)
  Q:   106 KGFEFCVSLDFFTPSLFFQTLLNIFHKVEVINLMNNVIIWGNNLSMNLI-----DRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD-DDPTGLVIQYIYKLKKKIGKD--NIVSSTYNGYCFKLRE 236
           KG+E+    D+ T     + LL    KV  +       I  N+LS+  I      R+V+   + I++T  EF++L+ F+E+PN  FS+E++   +WGYD +  T  V  +I  L+KK+G +  +IV+   +GY F+++E
  S:    89 KGYEYGAD-DYITKPFSPKVLLA---KVNALLRRYTTDIPKNSLSLGKIFIMVASRQVYVEDKLIDLTYKEFELLRLFMENPNQVFSREKLLNCIWGYDFEGNTRTVDTHIKTLRKKLGSEGHHIVTLIRSGYKFEVKE 223
>gi|126700822|ref|YP_001089719.1| two-component response regulator [Clostridium difficile 630] >gi|115252259|emb|CAJ70100.1| two-component response regulator [Clostridium difficile 630] (223 aa)
Score = 149, Expect = 3.5e-08, Identities = 45/131 (34%), Positives = 77/131 (58%)
  Q:   106 KGFEFCVSLDFFTPSLFFQTLLNIFHKVEVINLMNNVIIWGNNLSMNLI-----DRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD-DDPTGLVIQYIYKLKKKIGKD--NIVSSTYNGYCFKLRE 236
           KG+E+    D+ T     + LL    KV  +       I  N+LS+  I      R+V+   + I++T  EF++L+ F+E+PN  FS+E++   +WGYD +  T  V  +I  L+KK+G +  +IV+   +GY F+++E
  S:    89 KGYEYGAD-DYITKPFSPKVLLA---KVNALLRRYTTDIPKNSLSLGKIFIMVASRQVYVEDKLIDLTYKEFELLRLFMENPNQVFSREKLLNCIWGYDFEGNTRTVDTHIKTLRKKLGSEGHHIVTLIRSGYKFEVKE 223
>gi|127511031|ref|YP_001092228.1| two component transcriptional regulator [Shewanella loihica PV-4] >gi|126636326|gb|ABO21969.1| two component transcriptional regulator, winged helix family [Shewanella loihica PV-4] (225 aa)
Score = 149, Expect = 3.6e-08, Identities = 34/88 (38%), Positives = 54/88 (61%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKK---IGKDNIVSSTYNGYCFKLRE 236
           L M L+ RKV  +G EI +   EF +LK+ +EHPN   S+  +F+ VW Y  DP T ++  +I KL++K   +G   ++  T  G  ++LR+
  S:   133 LVMELLTRKVTLAGSEILLQPKEFQLLKYLMEHPNQVISRTLLFEAVWDYHFDPRTNVIDVHIAKLRRKFEELGFGELI-ETVRGAGYRLRQ 223
>gi|20146148|dbj|BAB88961.1| probable response regulator [Bacillus cereus] (162 aa)
Score = 149, Expect = 3.7e-08, Identities = 28/74 (37%), Positives = 49/74 (66%)
  Q:   147 NNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDD-DPTGLVIQYIYKLKKKIGKD 220
           + +S++   RKV+ + +E+  T  EFD+L FF+ HPN   +KE++F+++WG D       V+ +I KL++KI +D
  S:    88 HGISIDQRARKVFINNEEVAFTTKEFDLLTFFVTHPNQVLNKEQLFERIWGLDSAGDLATVVVHIRKLREKIERD 162
>gi|196241488|ref|ZP_03140251.1| two component transcriptional regulator, winged helix family [Cyanothece sp. PCC 7425] >gi|196214548|gb|EDY09204.1| two component transcriptional regulator, winged helix family [Cyanothece sp. PCC 7425] (228 aa)
Score = 149, Expect = 3.8e-08, Identities = 31/88 (35%), Positives = 52/88 (59%)
  Q:   147 NNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKKIGKDNIVSSTYNGYCFKL 234
           +N+ ++L  RKV    + +E++  EF + + F  HP    S+E++  +VWGYD DP + +V  Y+  L+KK+G + I +    GY  KL
  S:   135 DNVLLDLRTRKVKVGDRWLELSAREFTLAETFFRHPGQVLSREQLLDRVWGYDYDPGSNIVDVYVGYLRKKLGNELIETVRGMGYRLKL 223
>gi|119487957|ref|ZP_01621454.1| Two component Transcriptional regulator, Winged helix family protein [Lyngbya sp. PCC 8106] >gi|119455533|gb|EAW36671.1| Two component Transcriptional regulator, Winged helix family protein [Lyngbya sp. PCC 8106] (231 aa)
Score = 148, Expect = 4.1e-08, Identities = 35/91 (38%), Positives = 56/91 (61%)
  Q:   147 NNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKI---GKDNIVSSTYNGYCFKLRES 237
           + L ++L  R  + +G+ IE+T  EFD+L++ +EHP    ++E+I + VWGYD      VI+ YI  L+ KI   G+  ++  T  G  + LRES
  S:   138 SELGLDLATRCAFRNGRTIELTMKEFDLLRYLMEHPREVLTREQILENVWGYDFLGESNVIEVYIRYLRLKIEEEGEKRLI-QTVRGVGYVLRES 231
>gi|75909659|ref|YP_323955.1| two component transcriptional regulator [Anabaena variabilis ATCC 29413] >gi|75703384|gb|ABA23060.1| two component transcriptional regulator, winged helix family [Anabaena variabilis ATCC 29413] (224 aa)
Score = 148, Expect = 4.4e-08, Identities = 34/103 (33%), Positives = 60/103 (58%)
  Q:   115 DFFTPSLFFQTLLNIFHKV--EVINLMNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKKI 217
           D+     F + L+   H V    I    N+++ G  L ++ I R+V C+ + IE+T  EF++L++ +  P   F++ +I + VWGYD +P T +V   I +++KKI
  S:    97 DYIAKPFFVEELVARIHAVVRRSIGDRQNLLVIGT-LKLDRITREVTCNQRVIELTSREFNLLEYLMRSPGRVFTRTQILEHVWGYDFNPNTNVVDVCIQRIRKKI 201
>gi|126650762|ref|ZP_01722978.1| sensor histidine kinase [Bacillus sp. B14905] >gi|126592427|gb|EAZ86445.1| sensor histidine kinase [Bacillus sp. B14905] (713 aa)
Score = 148, Expect = 4.9e-08, Identities = 28/74 (37%), Positives = 50/74 (67%)
  Q:   147 NNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKKIGKD 220
           + ++++   RKV+ +G+E+  T  EFD+L FF++HPN   SKE+++++ WGY+       V  +I KL++KI +D
  S:   620 HGITIDTSARKVFVNGEEVAFTTKEFDLLVFFVKHPNQVLSKEQLYERNWGYESAADVSTVTVHIRKLREKIERD 694
>gi|120597082|ref|YP_961656.1| two component transcriptional regulator [Shewanella sp. W3-18-1] >gi|124545903|ref|ZP_01705053.1| two component transcriptional regulator, winged helix family [Shewanella putrefaciens 200] >gi|146291504|ref|YP_001181928.1| two component transcriptional regulator [Shewanella putrefaciens CN-32] >gi|120557175|gb|ABM23102.1| two component transcriptional regulator, winged helix family [Shewanella sp. W3-18-1] >gi|124510506|gb|EAY54575.1| two component transcriptional regulator, winged helix family [Shewanella putrefaciens 200] >gi|145563194|gb|ABP74129.1| two component transcriptional regulator, winged helix family [Shewanella putrefaciens CN-32] (225 aa)
Score = 147, Expect = 5.3e-08, Identities = 38/122 (31%), Positives = 67/122 (54%)
  Q:   115 DFFTPSLFFQTLL----NIFHKVEVINLMNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKK---IGKDNIVSSTYNGYCFKLRE 236
           D+ T    F  LL     +  + +   +  ++++ G  L M L+ R V   GQE+ +   EF +LK+ +EH N   S+  +F+ VW Y  DP T ++  +I KL++K   +G   ++  T  G  ++LR+
  S:    97 DYMTKPFAFSELLVRAEKLMQRGQSTPISTDLVVGG--LKMELLTRNVTLDGQELMLQPKEFQLLKYLMEHANQVISRTLLFEAVWDYHFDPRTNVIDVHIAKLRRKFEELGHGELI-ETVRGAGYRLRQ 223
>gi|167461939|ref|ZP_02327028.1| hypothetical protein Plarl_05185 [Paenibacillus larvae subsp. larvae BRL-230010] (205 aa)
Score = 147, Expect = 6.1e-08, Identities = 31/73 (42%), Positives = 47/73 (64%)
  Q:   147 NNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD-DDPTGLVIQYIYKLKKKIGK 219
           ++L MNL  R+V  +GQ +E+T  EFD+L++ +EH     ++E+I   VWGYD    T +V  YI  L++KI K
  S:   107 DDLDMNLKSREVRRNGQWVELTPKEFDLLQYLMEHKGEVRTREDIISDVWGYDFVGDTNIVDVYIRYLRQKIEK 180
>gi|15893613|ref|NP_346962.1| response regulator [Clostridium acetobutylicum ATCC 824] >gi|15023165|gb|AAK78302.1|AE007546_8 Response regulator (CheY-like domain, HTH domain) [Clostridium acetobutylicum ATCC 824] (230 aa)
Score = 147, Expect = 6.2e-08, Identities = 35/84 (41%), Positives = 53/84 (63%)
  Q:   137 NLMNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDD-DPTGLVIQYIYKLKKKIGKD 220
           NL + + I G  L++N   RKV+ +G+E + T  EFD+L F  ++P+  FSKEE+F K+WG D       V  +I K+++KI KD
  S:   129 NLDDEIEIRG--LNINKASRKVFVNGKESQFTAKEFDLLVFLAQNPDRVFSKEELFDKIWGMDSFGEIATVTVHIKKIREKIEKD 211
>gi|118467913|ref|YP_885396.1| DNA-binding response regulator ResD [Mycobacterium smegmatis str. MC2 155] >gi|118169200|gb|ABK70096.1| DNA-binding response regulator ResD [Mycobacterium smegmatis str. MC2 155] (225 aa)
Score = 147, Expect = 6.4e-08, Identities = 29/82 (35%), Positives = 49/82 (59%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQYIYKLKKKIGKDNIVSSTY-NGY 230
           L ++   R V  SG+ + +T  EFD+L FFL H +T FS+E++ K+VW +D      V  ++ +L+ K+G  + V + +  GY
  S:   137 LRVSTASRSVTLSGRPVNLTNREFDLLVFFLTHTDTVFSREDLLKRVWRWDFGDLSTVTVHVKRLRSKLGTHHRVQTVWGRGY 219
>gi|169828289|ref|YP_001698447.1| response regulator ArlR [Lysinibacillus sphaericus C3-41] >gi|168992777|gb|ACA40317.1| response regulator ArlR [Lysinibacillus sphaericus C3-41] (247 aa)
Score = 147, Expect = 6.7e-08, Identities = 31/89 (34%), Positives = 52/89 (58%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDD-PTGLVIQYIYKLKKKI-GKDNIVSSTYNGYCFKLRE 236
           ++ +++   +V+  G ++++TK E+D+LK  +EH N   ++E I   VWGYD D  T +V  YI  L+ K+ G  N    T  G  + +RE
  S:   157 DIEIDIAAYEVFVQGNKLDLTKTEYDLLKLLIEHKNRVCTREHILTSVWGYDTDIETNVVDVYIRHLRSKLPGDTNAYIETVRGVGYVMRE 247
>gi|196237938|ref|ZP_03136714.1| two component transcriptional regulator, winged helix family [Cyanothece sp. PCC 7425] >gi|196217728|gb|EDY12371.1| two component transcriptional regulator, winged helix family [Cyanothece sp. PCC 7425] (225 aa)
Score = 146, Expect = 8.9e-08, Identities = 32/89 (35%), Positives = 57/89 (64%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKI---GKDNIVSSTYNGYCFKLRES 237
           L ++L++R+   +G+ I++T  EF++LK+ +EHP    ++E+I + VWGYD      VI+ YI  L+ K+   G+  ++  T  G  + LRE+
  S:   134 LGLDLVNRRAERNGRRIDLTMKEFELLKYLMEHPRQVLNREQILENVWGYDYVGESNVIEVYIRYLRLKVEEEGERRLI-HTVRGVGYVLRET 225
>gi|126657526|ref|ZP_01728682.1| two-component response regulator [Cyanothece sp. CCY0110] >gi|126621230|gb|EAZ91943.1| two-component response regulator [Cyanothece sp. CCY0110] (222 aa)
Score = 145, Expect = 9.8e-08, Identities = 36/116 (31%), Positives = 64/116 (55%)
  Q:   115 DFFTPSLFFQTLLNIFHKVEVINLMNNVI-----IWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKKIGKDNIVSSTYNGY 230
           D+ T    F+ LL    ++ + N ++N I     +    + +NL  R+V+   Q +EI+  EF +L+  + H     +++++   VWGY  DP + +V  YI  L+KK+GK+ I +    GY
  S:    98 DYVTKPFRFEELLARI-RLRLKNRVDNFIPIQTELKSGKIVLNLRSRQVYLDNQLVEISNTEFTLLEILISHKGQVMTRQQLLDHVWGYSYDPGSNIVDVYIGYLRKKVGKNTIATIRGIGY 218
>gi|126654044|ref|ZP_01725875.1| response regulator ArlR [Bacillus sp. B14905] >gi|126589478|gb|EAZ83623.1| response regulator ArlR [Bacillus sp. B14905] (247 aa)
Score = 145, Expect = 9.8e-08, Identities = 31/89 (34%), Positives = 52/89 (58%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDD-PTGLVIQYIYKLKKKI-GKDNIVSSTYNGYCFKLRE 236
           ++ +++   +V+  G ++++TK E+D+LK  +EH N   ++E I   VWGYD D  T +V  YI  L+ K+ G  N    T  G  + +RE
  S:   157 DIEIDIAAYEVFVQGNKLDLTKTEYDLLKLLIEHKNRVCTREHILTSVWGYDTDIETNVVDVYIRHLRTKLPGDTNAYIETVRGVGYVMRE 247
>gi|159029102|emb|CAO90091.1| unnamed protein product [Microcystis aeruginosa PCC 7806] (226 aa)
Score = 145, Expect = 1.0e-07, Identities = 29/74 (39%), Positives = 46/74 (62%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGKDN 221
           +L++N + R+V+   Q IE+T  EFD+L+F L HP    ++E+I + VWGYD      +I+ YI  L+ K+   N
  S:   133 DLTLNCLAREVYRDSQLIELTAKEFDLLEFILRHPRQVLTREQILETVWGYDFMGDSNIIEVYIRALRVKLESAN 207
>gi|186684285|ref|YP_001867481.1| two component transcriptional regulator [Nostoc punctiforme PCC 73102] >gi|186466737|gb|ACC82538.1| two component transcriptional regulator, winged helix family [Nostoc punctiforme PCC 73102] (228 aa)
Score = 145, Expect = 1.0e-07, Identities = 34/90 (37%), Positives = 55/90 (61%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKI---GKDNIVSSTYNGYCFKLRES 237
           +L +++  R+    G+ I++T  EF++LKF +EHP    ++E+I + VWGYD      VI+ YI  L+ KI   G+  ++  T  G  + LRES
  S:   136 DLILDIASRRAIHGGRAIDLTMKEFELLKFLMEHPREVLTREQILENVWGYDFLGESNVIEVYIRYLRLKIEDEGQKRLI-QTVRGVGYVLRES 228
>gi|119776666|ref|YP_929406.1| response regulator receiver protein [Shewanella amazonensis SB2B] >gi|119769166|gb|ABM01737.1| response regulator receiver protein [Shewanella amazonensis SB2B] (225 aa)
Score = 144, Expect = 1.3e-07, Identities = 32/88 (36%), Positives = 52/88 (59%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKK---IGKDNIVSSTYNGYCFKLRE 236
           L M L+ R V   G E+ +   EF +LK+ +EHPN   S+  +F+ VW Y  DP T ++  +I KL++K   +G   ++  T  G  ++LR+
  S:   133 LEMELLTRNVTLDGHELMLQPKEFQLLKYLMEHPNQVISRTLLFEAVWDYHFDPRTNVIDVHIAKLRRKFEELGYGELI-ETVRGAGYRLRQ 223
>gi|160915022|ref|ZP_02077235.1| hypothetical protein EUBDOL_01029 [Eubacterium dolichum DSM 3991] >gi|158432821|gb|EDP11110.1| hypothetical protein EUBDOL_01029 [Eubacterium dolichum DSM 3991] (232 aa)
Score = 144, Expect = 1.3e-07, Identities = 28/89 (31%), Positives = 53/89 (59%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD-DDPTGLVIQYIYKLKKKIGKDNIVSSTYNGYCFKLRE 236
           ++ M+L  R +    QE+E+TK EFD+L++F+ +     S++ I  ++WG+D D  T +V  +++KL+ K+   NI   +  G  + + E
  S:   139 DICMDLKRRSILLKEQELELTKKEFDLLEYFISNKEVVLSRDNILNEIWGFDYDGDTRIVDVHVFKLRSKLANSNIQIKSMRGIGYVIEE 228
>gi|134096719|ref|YP_001102380.1| two component system response regulator [Saccharopolyspora erythraea NRRL 2338] >gi|133909342|emb|CAL99454.1| two component system response regulator [Saccharopolyspora erythraea NRRL 2338] (220 aa)
Score = 144, Expect = 1.3e-07, Identities = 30/82 (36%), Positives = 45/82 (54%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGKDNIVSSTYNGY 230
           LS++L  R+       +++T  EF +L+ FL H     S+E+I   VWGYD DP   V+  Y+  L++KIG   I +    GY
  S:   134 LSLDLRTRRAQVPEGTVDLTAREFSMLELFLRHSGQVLSREQILSHVWGYDFDPGSNVVDVYVRALRRKIGSTRIHTVRGMGY 216
>gi|170076628|ref|YP_001733267.1| two-component response regulator; transcriptional regulatory protein [Synechococcus sp. PCC 7002] >gi|169887490|gb|ACB01198.1| two-component response regulator; transcriptional regulatory protein [Synechococcus sp. PCC 7002] (223 aa)
Score = 144, Expect = 1.3e-07, Identities = 31/74 (41%), Positives = 46/74 (62%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGKDN 221
           +LS+N I R+V+   Q I++T  EFD+L+  L HP    ++E+I +KVWGYD      VI+ YI  L+ K+   N
  S:   133 DLSLNGITREVYRDRQLIQLTAKEFDLLELLLRHPRQVLTREQILEKVWGYDFMGESNVIEVYIRALRLKLEATN 207
>gi|167622073|ref|YP_001672367.1| two component transcriptional regulator [Shewanella halifaxensis HAW-EB4] >gi|167352095|gb|ABZ74708.1| two component transcriptional regulator, winged helix family [Shewanella halifaxensis HAW-EB4] (225 aa)
Score = 144, Expect = 1.3e-07, Identities = 33/88 (37%), Positives = 54/88 (61%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKK---IGKDNIVSSTYNGYCFKLRE 236
           L++ L+ RKV   GQEI +   EF +LK+ +EH N   S+  +F+ VW Y  DP T ++  +I KL++K   +G   ++  T  G  ++LR+
  S:   133 LTIELLTRKVTLDGQEILLQPKEFQLLKYLMEHVNQVISRTLLFEAVWDYHFDPRTNVIDVHIAKLRRKFEELGHGELI-ETVRGAGYRLRQ 223
>gi|157963921|ref|YP_001503955.1| two component transcriptional regulator [Shewanella pealeana ATCC 700345] >gi|157848921|gb|ABV89420.1| two component transcriptional regulator, winged helix family [Shewanella pealeana ATCC 700345] (225 aa)
Score = 144, Expect = 1.3e-07, Identities = 33/88 (37%), Positives = 54/88 (61%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKK---IGKDNIVSSTYNGYCFKLRE 236
           L++ L+ RKV   GQEI +   EF +LK+ +EH N   S+  +F+ VW Y  DP T ++  +I KL++K   +G   ++  T  G  ++LR+
  S:   133 LTIELLTRKVTLDGQEILLQPKEFQLLKYLMEHVNQVISRTLLFEAVWDYHFDPRTNVIDVHIAKLRRKFEELGHGELI-ETVRGAGYRLRQ 223
>gi|17228689|ref|NP_485237.1| two-component response regulator [Nostoc sp. PCC 7120] >gi|17130541|dbj|BAB73151.1| two-component response regulator [Nostoc sp. PCC 7120] (228 aa)
Score = 144, Expect = 1.4e-07, Identities = 32/89 (35%), Positives = 56/89 (62%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGKDN--IVSSTYNGYCFKLRE 236
           +LS+N   R+V+   + +E+T  EFD+L++ L +P   F++++I +KVWGYD      +I+ YI  L+ K+ ++N   +  T  G  + LRE
  S:   133 DLSLNRRTREVFRGNRAVELTAKEFDLLEYLLSYPRQVFTRDQILEKVWGYDFMGDSNIIEVYIRYLRLKLEENNEKRLVHTVRGVGYALRE 224
>gi|152966752|ref|YP_001362536.1| two component transcriptional regulator [Kineococcus radiotolerans SRS30216] >gi|151361269|gb|ABS04272.1| two component transcriptional regulator, winged helix family [Kineococcus radiotolerans SRS30216] (220 aa)
Score = 144, Expect = 1.4e-07, Identities = 25/76 (32%), Positives = 44/76 (57%)
  Q:   143 IIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIG 218
           ++    L ++L+ R    +G+ + ++  EF + + FL HP    S+E++   VWGYD DP   V+  Y+  L+KK+G
  S:   127 VLAAGELQLDLLSRTAAVAGRSVALSSREFSLAEAFLRHPGQVLSREQLLSSVWGYDFDPGSNVVDVYVRYLRKKLG 203
>gi|125975548|ref|YP_001039458.1| two component transcriptional regulator [Clostridium thermocellum ATCC 27405] >gi|125715773|gb|ABN54265.1| two component transcriptional regulator, winged helix family [Clostridium thermocellum ATCC 27405] (230 aa)
Score = 143, Expect = 1.6e-07, Identities = 31/84 (36%), Positives = 52/84 (61%)
  Q:   137 NLMNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDD-DPTGLVIQYIYKLKKKIGKD 220
           N +N++ I G  L +    R+V+ +G+E+ + + EFD+L F  ++PN  FS+EEIF +VWG D       V  +I ++++KI  D
  S:   129 NNVNSITIRG--LEIQKDSRRVFVNGKEVNLAQKEFDVLLFLAQNPNRVFSREEIFDRVWGMDALGDAATVTVHIGRIREKIESD 211
>gi|192807860|ref|ZP_03036537.1| response regulator receiver [Geobacillus sp. Y412MC10] >gi|192803280|gb|EDV79783.1| response regulator receiver [Geobacillus sp. Y412MC10] (239 aa)
Score = 143, Expect = 1.7e-07, Identities = 31/82 (37%), Positives = 53/82 (64%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTG---LVIQYIYKLKKKIGKDNIVSSTYNGY 230
           L + L +R+V+ +G+E+++T  EF++L+ F EHPN  F+++E+   VWG  DD  G    V   I +L+KK+ +  I +   +GY
  S:   146 LQLQLEERRVFWNGEEVDMTNKEFEMLRVFAEHPNRAFTRDELLTSVWG--DDYFGSDRAVDHLIKRLRKKVEQLPIEAIWGHGY 228
>gi|167757753|ref|ZP_02429880.1| hypothetical protein CLOSCI_00084 [Clostridium scindens ATCC 35704] >gi|167664635|gb|EDS08765.1| hypothetical protein CLOSCI_00084 [Clostridium scindens ATCC 35704] (221 aa)
Score = 143, Expect = 1.7e-07, Identities = 29/87 (33%), Positives = 57/87 (65%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD-DDPTGLVIQYIYKLKKKIGKDN--IVSSTYNGYCFKL 234
           NL++      V  +G ++++T  EF++L+FF+++ N  FS+E++  ++WGYD +  T  V  +I  L++K+G +   IV+   +GY F++
  S:   132 NLTLIPTSHSVMVAGDDVDLTYKEFELLRFFMQNKNQVFSREQLLNRIWGYDFEGNTRTVDTHIKTLRQKLGAEGRYIVTLIRSGYKFEV 221
>gi|186685384|ref|YP_001868580.1| two component transcriptional regulator [Nostoc punctiforme PCC 73102] >gi|186467836|gb|ACC83637.1| two component transcriptional regulator, winged helix family [Nostoc punctiforme PCC 73102] (227 aa)
Score = 143, Expect = 1.7e-07, Identities = 34/103 (33%), Positives = 59/103 (57%)
  Q:   115 DFFTPSLFFQTLLNIFHKVEVINLMN--NVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKKI 217
           D+     F + L    H V   ++ N  N++  G  + ++ I R+V C  Q IE+T  EF++L++ +  P   F++ +I + VWGYD +P T +V   I +++KKI
  S:    97 DYIAKPFFVEELAARIHAVVRRSVSNRQNILSVGP-IRLDRITREVTCDRQAIELTSREFNLLEYLMRSPGRVFTRTQILEHVWGYDFNPNTNVVDVCIQRIRKKI 201
>gi|113968625|ref|YP_732418.1| two component transcriptional regulator [Shewanella sp. MR-4] >gi|114049227|ref|YP_739777.1| two component transcriptional regulator [Shewanella sp. MR-7] >gi|117918739|ref|YP_867931.1| two component transcriptional regulator [Shewanella sp. ANA-3] >gi|113883309|gb|ABI37361.1| two component transcriptional regulator, winged helix family [Shewanella sp. MR-4] >gi|113890669|gb|ABI44720.1| two component transcriptional regulator, winged helix family [Shewanella sp. MR-7] >gi|117611071|gb|ABK46525.1| two component transcriptional regulator, winged helix family [Shewanella sp. ANA-3] (225 aa)
Score = 143, Expect = 1.8e-07, Identities = 36/122 (29%), Positives = 67/122 (54%)
  Q:   115 DFFTPSLFFQTLL----NIFHKVEVINLMNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKK---IGKDNIVSSTYNGYCFKLRE 236
           D+ T    F  LL     +  + + + +  ++++ G  L M L+ R V   G ++ +   EF +LK+ +EH N   S+  +F+ VW Y  DP T ++  +I KL++K   +G   ++  T  G  ++LR+
  S:    97 DYMTKPFAFSELLVRAEKLMQRGQSVPITTDLVVGG--LKMELLTRNVTLDGHDLMLQPKEFQLLKYLMEHANQVISRTLLFEAVWDYHFDPRTNVIDVHIAKLRRKFEELGHGELI-ETVRGAGYRLRQ 223
>gi|30264741|ref|NP_847118.1| DNA-binding response regulator [Bacillus anthracis str. Ames] >gi|47778345|ref|YP_021563.2| DNA-binding response regulator [Bacillus anthracis str. 'Ames Ancestor'] >gi|167633821|ref|ZP_02392144.1| DNA-binding response regulator [Bacillus anthracis str. A0442] >gi|167638012|ref|ZP_02396290.1| DNA-binding response regulator [Bacillus anthracis str. A0193] >gi|170685925|ref|ZP_02877148.1| DNA-binding response regulator [Bacillus anthracis str. A0465] >gi|170705358|ref|ZP_02895822.1| DNA-binding response regulator [Bacillus anthracis str. A0389] >gi|177651324|ref|ZP_02934155.1| DNA-binding response regulator [Bacillus anthracis str. A0174] >gi|190568258|ref|ZP_03021166.1| DNA-binding response regulator [Bacillus anthracis Tsiankovskii-I] >gi|196033267|ref|ZP_03100680.1| DNA-binding response regulator [Bacillus cereus W] >gi|196040860|ref|ZP_03108158.1| DNA-binding response regulator [Bacillus cereus NVH0597-99] >gi|196044024|ref|ZP_03111261.1| DNA-binding response regulator [Bacillus cereus 03BB108] >gi|30259416|gb|AAP28604.1| DNA-binding response regulator [Bacillus anthracis str. Ames] >gi|47552050|gb|AAT34038.2| DNA-binding response regulator [Bacillus anthracis str. 'Ames Ancestor'] >gi|167513829|gb|EDR89197.1| DNA-binding response regulator [Bacillus anthracis str. A0193] >gi|167530622|gb|EDR93324.1| DNA-binding response regulator [Bacillus anthracis str. A0442] >gi|170129483|gb|EDS98346.1| DNA-binding response regulator [Bacillus anthracis str. A0389] >gi|170670389|gb|EDT21129.1| DNA-binding response regulator [Bacillus anthracis str. A0465] >gi|172083150|gb|EDT68212.1| DNA-binding response regulator [Bacillus anthracis str. A0174] >gi|190560514|gb|EDV14491.1| DNA-binding response regulator [Bacillus anthracis Tsiankovskii-I] >gi|195994696|gb|EDX58651.1| DNA-binding response regulator [Bacillus cereus W] >gi|196025360|gb|EDX64030.1| DNA-binding response regulator [Bacillus cereus 03BB108] >gi|196028314|gb|EDX66923.1| DNA-binding response regulator [Bacillus cereus NVH0597-99] (229 aa)
Score = 143, Expect = 1.8e-07, Identities = 28/74 (37%), Positives = 49/74 (66%)
  Q:   147 NNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDD-DPTGLVIQYIYKLKKKIGKD 220
           + +S++   RKV+ + +EI  T  EFD+L FF+ +PN   +KE++F+++WG D       V+ +I KL++KI +D
  S:   136 HGISIDQRARKVFINNEEIAFTTKEFDLLTFFVTNPNQVLNKEQLFERIWGLDSAGDLATVVVHIRKLREKIERD 210
>gi|78045188|ref|YP_358964.1| DNA-binding response regulator [Carboxydothermus hydrogenoformans Z-2901] >gi|77997303|gb|ABB16202.1| DNA-binding response regulator [Carboxydothermus hydrogenoformans Z-2901] (234 aa)
Score = 143, Expect = 1.9e-07, Identities = 28/72 (38%), Positives = 46/72 (63%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDD-DPTGLVIQYIYKLKKKIGKD 220
           L ++   R+V+   +E+ +T  EFD+L F  ++PN  F+KEE+F+++WG D       V  +I KL++KI KD
  S:   137 LVIDTAARRVFAGDKEVNLTGKEFDLLLFLAKNPNRVFTKEELFERIWGMDSLGDLSTVTVHIRKLREKIEKD 209
>gi|65322038|ref|ZP_00394997.1| COG0745: Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Bacillus anthracis str. A2012] (232 aa)
Score = 143, Expect = 1.9e-07, Identities = 28/74 (37%), Positives = 49/74 (66%)
  Q:   147 NNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDD-DPTGLVIQYIYKLKKKIGKD 220
           + +S++   RKV+ + +EI  T  EFD+L FF+ +PN   +KE++F+++WG D       V+ +I KL++KI +D
  S:   139 HGISIDQRARKVFINNEEIAFTTKEFDLLTFFVTNPNQVLNKEQLFERIWGLDSAGDLATVVVHIRKLREKIERD 213
>gi|49187559|ref|YP_030812.1| DNA-binding response regulator [Bacillus anthracis str. Sterne] >gi|118479811|ref|YP_896962.1| DNA-binding response regulator [Bacillus thuringiensis str. Al Hakam] >gi|49181486|gb|AAT56862.1| DNA-binding response regulator [Bacillus anthracis str. Sterne] >gi|118419036|gb|ABK87455.1| DNA-binding response regulator [Bacillus thuringiensis str. Al Hakam] (233 aa)
Score = 143, Expect = 1.9e-07, Identities = 28/74 (37%), Positives = 49/74 (66%)
  Q:   147 NNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDD-DPTGLVIQYIYKLKKKIGKD 220
           + +S++   RKV+ + +EI  T  EFD+L FF+ +PN   +KE++F+++WG D       V+ +I KL++KI +D
  S:   140 HGISIDQRARKVFINNEEIAFTTKEFDLLTFFVTNPNQVLNKEQLFERIWGLDSAGDLATVVVHIRKLREKIERD 214
>gi|62425747|ref|ZP_00380878.1| COG0745: Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Brevibacterium linens BL2] (272 aa)
Score = 143, Expect = 2.0e-07, Identities = 30/89 (33%), Positives = 57/89 (64%)
  Q:   151 MNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD-DDPTGLVIQYIYKLKKKIGKD----NIVSSTYN-GYCFKLRESFR 239
           +++  R+V  +G  +E++  EFD+L FFL+HP+  F +E + + VWG++  DP+ + +  + +L++KI  D      +S+ +  GY F + E  R
  S:   179 LDVSGRRVSRNGIPLEVSAREFDLLAFFLKHPHQVFDRETLLRSVWGWEIGDPSTITVT-VRRLREKIEDDPSHAQFLSTVWGAGYRFDVEEELR 272
>gi|126433314|ref|YP_001069005.1| two component transcriptional regulator [Mycobacterium sp. JLS] >gi|126233114|gb|ABN96514.1| two component transcriptional regulator, winged helix family [Mycobacterium sp. JLS] (237 aa)
Score = 142, Expect = 2.2e-07, Identities = 27/82 (32%), Positives = 49/82 (59%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQYIYKLKKKIGKDNIVSSTY-NGY 230
           L+++   R V   G+ + +T  EFD+L FF+ H +T F++EE+ K+VW +D      V  ++ +L+ K+G  + V + +  GY
  S:   137 LTISAAARSVTVDGRPVSLTNREFDLLLFFITHADTVFTREELLKQVWRWDFGDLSTVTVHVKRLRSKLGDQHRVQTVWGRGY 219
>gi|108797689|ref|YP_637886.1| two component transcriptional regulator [Mycobacterium sp. MCS] >gi|119866777|ref|YP_936729.1| two component transcriptional regulator [Mycobacterium sp. KMS] >gi|108768108|gb|ABG06830.1| two component transcriptional regulator, winged helix family [Mycobacterium sp. MCS] >gi|119692866|gb|ABL89939.1| two component transcriptional regulator, winged helix family [Mycobacterium sp. KMS] (237 aa)
Score = 142, Expect = 2.2e-07, Identities = 27/82 (32%), Positives = 49/82 (59%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQYIYKLKKKIGKDNIVSSTY-NGY 230
           L+++   R V   G+ + +T  EFD+L FF+ H +T F++EE+ K+VW +D      V  ++ +L+ K+G  + V + +  GY
  S:   137 LTISAAARSVTVDGRPVSLTNREFDLLLFFITHADTVFTREELLKQVWRWDFGDLSTVTVHVKRLRSKLGDQHRVQTVWGRGY 219
>gi|160936708|ref|ZP_02084075.1| hypothetical protein CLOBOL_01599 [Clostridium bolteae ATCC BAA-613] >gi|158440499|gb|EDP18244.1| hypothetical protein CLOBOL_01599 [Clostridium bolteae ATCC BAA-613] (231 aa)
Score = 142, Expect = 2.3e-07, Identities = 33/87 (37%), Positives = 56/87 (64%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDD-DPTGLVIQYIYKLKKKIGKDNIVSSTY------NGYCFKL 234
           NL++   +R+V+ +G+E+ +   EF++L F  E+PN  FSK+ +F ++WG D    T  V  +I +L++K+ K N  SS +       GY FK+
  S:   138 NLAIRPKERRVYLNGEEMNLANKEFEVLLFLAENPNIVFSKDTLFDRIWGMDSVGNTATVTVHINRLREKLEK-NADSSPFIETVWGAGYRFKV 230
>gi|29830959|ref|NP_825593.1| two-component system response regulator [Streptomyces avermitilis MA-4680] >gi|29608073|dbj|BAC72128.1| putative two-component system response regulator [Streptomyces avermitilis MA-4680] (249 aa)
Score = 142, Expect = 2.3e-07, Identities = 25/75 (33%), Positives = 45/75 (60%)
  Q:   146 GNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQYIYKLKKKIGKD 220
            + L+++   R+    G+E+ +T  EFD+L FFL HP   FS+E++ ++VWG+D      V  ++ +L+ K+  D
  S:   149 ASGLALDPAARRATKDGEELALTIREFDLLAFFLRHPGRAFSREDLMREVWGWDFGDLSTVTVHVRRLRGKVEDD 223
>gi|29830590|ref|NP_825224.1| two-component system response regulator [Streptomyces avermitilis MA-4680] >gi|29607702|dbj|BAC71759.1| putative two-component system response regulator [Streptomyces avermitilis MA-4680] (243 aa)
Score = 142, Expect = 2.5e-07, Identities = 30/88 (34%), Positives = 52/88 (59%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKI--GKDNIVSSTYNGYCFKLR 235
           +L M+L  R+V   G+ +E+ + EF +L+ FL HP    ++E+I K VWG+D +P+   +  Y+  L++K   G +  +  T  G  + LR
  S:   148 DLRMDLATREVTRGGRSVELIRTEFTLLEMFLAHPRQVLTREQILKAVWGFDFEPSSNSLDVYVMYLRRKTEAGGEPRLVHTVRGVGYVLR 238
>gi|158340377|ref|YP_001521733.1| two component transcriptional regulator [Acaryochloris marina MBIC11017] >gi|158310618|gb|ABW32232.1| two component transcriptional regulator, winged helix family [Acaryochloris marina MBIC11017] (222 aa)
Score = 142, Expect = 2.5e-07, Identities = 30/83 (36%), Positives = 48/83 (57%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKKIGKDNIVSSTYNGY 230
           N+ ++L  RK     Q IE+   EF + + F +HP    S++++  +VWGYD DP + +V  Y+  L+KK+G D I +    GY
  S:   135 NVVLDLRARKAKVHDQWIELPAREFILTEAFFQHPGQVLSRQQLLDRVWGYDYDPGSNIVDVYVGYLRKKLGDDLIQTVRGVGY 218
>gi|89097111|ref|ZP_01170001.1| DNA-binding response regulator [Bacillus sp. NRRL B-14911] >gi|89087934|gb|EAR67045.1| DNA-binding response regulator [Bacillus sp. NRRL B-14911] (227 aa)
Score = 142, Expect = 2.5e-07, Identities = 30/72 (41%), Positives = 47/72 (65%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDD--DPTGLVIQYIYKLKKKIGKD 220
           L M+   R+V+  G+E   T  EFD+L F   +P+  FSKE +F+++WGYD   D T + + +I K+++KI KD
  S:   137 LVMDADSRRVYADGEEKVFTAKEFDLLWFLASNPDRVFSKEHLFERIWGYDSLGDITTVTV-HIRKIREKIEKD 209
>gi|182437750|ref|YP_001825469.1| putative two-component systen response regulator [Streptomyces griseus subsp. griseus NBRC 13350] >gi|178466266|dbj|BAG20786.1| putative two-component systen response regulator [Streptomyces griseus subsp. griseus NBRC 13350] (245 aa)
Score = 142, Expect = 2.6e-07, Identities = 30/88 (34%), Positives = 52/88 (59%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKI--GKDNIVSSTYNGYCFKLR 235
           +L M+L  R+V    + +E+T+ EF +L+ FL HP    ++E+I K VWG+D +P+   +  Y+  L++K   G +  +  T  G  + LR
  S:   148 DLRMDLATREVTRGERRVELTRTEFTLLEMFLSHPRQVLTREQILKAVWGFDFEPSSNSLDVYVMYLRRKTEAGGEPRLVHTVRGVGYALR 238
>gi|119513599|ref|ZP_01632611.1| two-component response regulator [Nodularia spumigena CCY9414] >gi|119461752|gb|EAW42777.1| two-component response regulator [Nodularia spumigena CCY9414] (236 aa)
Score = 142, Expect = 2.6e-07, Identities = 33/90 (36%), Positives = 55/90 (61%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGKDN--IVSSTYNGYCFKLRES 237
           +L +++  R+   +G+ I++T  EF++LKF +EHP    ++E+I + VWGYD      VI+ YI  L+ KI  ++   +  T  G  + LRES
  S:   144 DLILDVATRRAIHNGRTIDLTMKEFELLKFLMEHPREVLTREQILENVWGYDFMGESNVIEVYIRYLRLKIEDESHKRLIQTVRGVGYVLRES 236
>gi|166982932|ref|ZP_02254357.1| DNA-binding response regulator [Bacillus cereus AH187] >gi|168163838|ref|ZP_02599071.1| DNA-binding response regulator [Bacillus cereus H3081.97] (229 aa)
Score = 141, Expect = 2.7e-07, Identities = 27/74 (36%), Positives = 49/74 (66%)
  Q:   147 NNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDD-DPTGLVIQYIYKLKKKIGKD 220
           + +S++   RKV+ + +E+  T  EFD+L FF+ +PN   +KE++F+++WG D       V+ +I KL++KI +D
  S:   136 HGISIDQRARKVFINNEEVAFTTKEFDLLTFFVTNPNQVLNKEQLFERIWGLDSAGDLATVVVHIRKLREKIERD 210
>gi|30022740|ref|NP_834371.1| two-component response regulator [Bacillus cereus ATCC 14579] >gi|29898299|gb|AAP11572.1| Two-component response regulator [Bacillus cereus ATCC 14579] (229 aa)
Score = 141, Expect = 2.7e-07, Identities = 27/74 (36%), Positives = 49/74 (66%)
  Q:   147 NNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDD-DPTGLVIQYIYKLKKKIGKD 220
           + +S++   RKV+ + +E+  T  EFD+L FF+ +PN   +KE++F+++WG D       V+ +I KL++KI +D
  S:   136 HGISIDQRARKVFINNEEVAFTTKEFDLLTFFVTNPNQVLNKEQLFERIWGLDSAGDLATVVVHIRKLREKIERD 210
>gi|117928802|ref|YP_873353.1| two component transcriptional regulator [Acidothermus cellulolyticus 11B] >gi|117649265|gb|ABK53367.1| two component transcriptional regulator, winged helix family [Acidothermus cellulolyticus 11B] (227 aa)
Score = 141, Expect = 2.7e-07, Identities = 29/90 (32%), Positives = 56/90 (62%)
  Q:   147 NNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKI---GKDNIVSSTYNGYCFKLRE 236
           ++L+++L  R+VW   + I +T+ EF++L+ F+ HP     + +I ++VWGYD   T   ++ Y+  L++K+   G+  ++  T  G  + LRE
  S:   132 SDLTLDLATREVWRGSRPIALTRTEFNLLEMFMRHPRQVLRRSQILEEVWGYDFPTTANSLEVYVGYLRRKLEAQGEPRLI-HTIRGVGYALRE 224
>gi|49478722|ref|YP_038715.1| DNA-binding response regulator [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|52140835|ref|YP_085995.1| DNA-binding response regulator [Bacillus cereus E33L] >gi|49330278|gb|AAT60924.1| DNA-binding response regulator [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|51974304|gb|AAU15854.1| DNA-binding response regulator [Bacillus cereus E33L] (233 aa)
Score = 141, Expect = 2.8e-07, Identities = 27/74 (36%), Positives = 49/74 (66%)
  Q:   147 NNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDD-DPTGLVIQYIYKLKKKIGKD 220
           + +S++   RKV+ + +E+  T  EFD+L FF+ +PN   +KE++F+++WG D       V+ +I KL++KI +D
  S:   140 HGISIDQRARKVFINNEEVAFTTKEFDLLTFFVTNPNQVLNKEQLFERIWGLDSAGDLATVVVHIRKLREKIERD 214
>gi|196181344|gb|EDX76332.1| Transcriptional regulatory C terminal domain protein [Microcoleus chthonoplastes PCC 7420] (233 aa)
Score = 141, Expect = 3.0e-07, Identities = 33/90 (36%), Positives = 53/90 (58%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGK--DNIVSSTYNGYCFKLRES 237
           +L+++L  R+    G+ I++T  EF++LK+ + HP    ++E+I + VWGYD      VI+ YI  L+ KI    D  +  T  G  + LRES
  S:   141 DLALDLTTRRAMRGGRVIDLTMKEFELLKYLMTHPREVLTREQILENVWGYDFLGESNVIEVYIRYLRLKIEDEGDKRLIQTVRGVGYVLRES 233
>gi|154505270|ref|ZP_02042008.1| hypothetical protein RUMGNA_02784 [Ruminococcus gnavus ATCC 29149] >gi|153794468|gb|EDN76888.1| hypothetical protein RUMGNA_02784 [Ruminococcus gnavus ATCC 29149] (230 aa)
Score = 141, Expect = 3.3e-07, Identities = 29/84 (34%), Positives = 48/84 (57%)
  Q:   137 NLMNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDD-DPTGLVIQYIYKLKKKIGKD 220
           N+  N +I    L ++   R+VW +G+E   T  EFD+L F   HPN  ++KEE+F+++W  +       V  +I K+++KI  D
  S:   127 NVEENDVIEIRGLKIDTTARRVWVNGEERSFTTKEFDLLTFLAGHPNHVYTKEELFREIWDMESVGDIATVTVHIKKIREKIEYD 211
>gi|153815879|ref|ZP_01968547.1| hypothetical protein RUMTOR_02124 [Ruminococcus torques ATCC 27756] >gi|145846698|gb|EDK23616.1| hypothetical protein RUMTOR_02124 [Ruminococcus torques ATCC 27756] (230 aa)
Score = 141, Expect = 3.4e-07, Identities = 29/84 (34%), Positives = 46/84 (54%)
  Q:   137 NLMNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDD-DPTGLVIQYIYKLKKKIGKD 220
           N   N +I    L ++   R+VW  G+E   T  EFD+L F   HPN  ++KEE+F+++W  +       V  +I K+++KI  D
  S:   127 NAEENEVIEIRGLKIDTTARRVWVGGEERSFTTKEFDLLTFLASHPNHVYTKEELFREIWDMESIGDIATVTVHIKKIREKIEYD 211
>gi|153853514|ref|ZP_01994894.1| hypothetical protein DORLON_00883 [Dorea longicatena DSM 13814] >gi|149753669|gb|EDM63600.1| hypothetical protein DORLON_00883 [Dorea longicatena DSM 13814] (229 aa)
Score = 140, Expect = 3.6e-07, Identities = 28/80 (35%), Positives = 46/80 (57%)
  Q:   141 NVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDD-DPTGLVIQYIYKLKKKIGKD 220
           N +I    L ++   R+VW +G+E   T  EFD+L F   HPN  +SKEE+F+++W  +       V  +I K+++K+  D
  S:   130 NKVIEIRGLKIDTTARRVWVNGEERTFTTKEFDLLTFLASHPNHVYSKEELFREIWDMESIGDIATVTVHIKKIREKVEVD 210
>gi|159899318|ref|YP_001545565.1| two component transcriptional regulator [Herpetosiphon aurantiacus ATCC 23779] >gi|159892357|gb|ABX05437.1| two component transcriptional regulator, winged helix family [Herpetosiphon aurantiacus ATCC 23779] (236 aa)
Score = 140, Expect = 3.6e-07, Identities = 29/95 (30%), Positives = 57/95 (60%)
  Q:   142 VIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGK--DNIVSSTYNGYCFKLRE 236
           V++  N L MN   R+V  +G+ +++T  E+++L+ F+ HP    +++ I+ +VWGYD      +I+ Y+  L++K+ +  +  +  T  G  + LRE
  S:   133 VVLQVNGLEMNTASREVTIAGRAVQLTAKEYELLELFMRHPGQVLTRDVIYDRVWGYDFGGESNIIEVYVRYLRQKLEESGEGRMLHTVRGAGYILRE 230
>gi|111024797|ref|YP_707217.1| response regulator, two-component system [Rhodococcus sp. RHA1] >gi|110823776|gb|ABG99059.1| response regulator, two-component system [Rhodococcus sp. RHA1] (225 aa)
Score = 140, Expect = 3.8e-07, Identities = 30/87 (34%), Positives = 50/87 (57%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD-DDPTGLVIQYIYKLKKKIGK--DNIVSSTYNGYCFKL 234
           +L ++   R+VW  G++I++T  EF +L+F L HP     K +I   VW +D D    +V  Y+ +L+ K+G+  D  V  T  G  ++L
  S:   131 DLRLDPSARRVWRRGEQIDLTTREFAVLEFLLRHPGEVLPKTDILGHVWDFDFDGDPNIVEVYVRRLRTKLGRPTDPPVIETVRGAGYRL 220
>gi|163942945|ref|YP_001647829.1| two component transcriptional regulator [Bacillus weihenstephanensis KBAB4] >gi|163865142|gb|ABY46201.1| two component transcriptional regulator, winged helix family [Bacillus weihenstephanensis KBAB4] (223 aa)
Score = 140, Expect = 3.8e-07, Identities = 32/96 (33%), Positives = 56/96 (58%)
  Q:   139 MNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDD-DPTGLVIQYIYKLKKKIGKDNIVSSTYNGYCFKL 234
           +N+ +I   NL +   +RK+  SGQEI++T  EF++ + F+ +P   F ++E+ +KVWG++    T  V   + +L+KK+G       T  G  +KL
  S:   125 LNHEVIGAGNLLICPKERKLHVSGQEIQLTYREFNLCQLFVSNPQRVFMRDELLEKVWGFEYIGNTRAVDIMVQRLRKKLGASGEYIKTIYGVGYKL 221
>gi|169185898|ref|ZP_02846060.1| two component transcriptional regulator, winged helix family [Paenibacillus sp. JDR-2] >gi|169007319|gb|EDS54168.1| two component transcriptional regulator, winged helix family [Paenibacillus sp. JDR-2] (229 aa)
Score = 140, Expect = 3.9e-07, Identities = 30/66 (45%), Positives = 44/66 (66%)
  Q:   156 RKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD---DDPTGLVIQYIYKLKKKIGKDN 221
           RKV+ + +E  +T  EFD+L F   HPN  FSKE +F+++WG D   D  T  V  +I K+++KI KD+
  S:   145 RKVYVNDEEAVLTTKEFDLLYFLASHPNKVFSKEHLFERIWGVDALGDMQT--VTVHIRKIREKIEKDS 211
>gi|56696508|ref|YP_166865.1| DNA-binding response regulator [Silicibacter pomeroyi DSS-3] >gi|56678245|gb|AAV94911.1| DNA-binding response regulator [Silicibacter pomeroyi DSS-3] (226 aa)
Score = 140, Expect = 3.9e-07, Identities = 36/103 (34%), Positives = 58/103 (56%)
  Q:   115 DFFTPSLFFQTLLNIFHKVEVI-----NLMNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKKI 217
           D+      FQ LL    +VE +     +     ++   +L M+L+ RKV  +G+EI +T  EF IL+FFL   N   ++  + + VW Y  DP T +V  +I KL+++I
  S:    99 DYLVKPFSFQELLA---RVEALLRRPQDTQEATVLACRDLEMDLMRRKVTRAGREITLTPREFQILEFFLRRKNRVITRTMLLEGVWDYHFDPNTNIVDVHISKLRRQI 204
>gi|158317067|ref|YP_001509575.1| two component transcriptional regulator [Frankia sp. EAN1pec] >gi|158112472|gb|ABW14669.1| two component transcriptional regulator, winged helix family [Frankia sp. EAN1pec] (246 aa)
Score = 140, Expect = 4.0e-07, Identities = 30/88 (34%), Positives = 54/88 (61%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKI--GKDNIVSSTYNGYCFKLRE 236
           ++++   R+V   G+E+ +TK EF++L+ FL HP    S+  I +KVWGYD  P+   ++ ++  L++K+  G +  +  T  G  + LRE
  S:   150 VALDPASRQVLREGRELTLTKTEFELLELFLTHPRQVLSRSMIMEKVWGYDFGPSSNSLEVFVSYLRRKLEAGGEPRLLHTVRGVGYVLRE 240
>gi|109647225|ref|ZP_01371129.1| two component transcriptional regulator, winged helix family [Desulfitobacterium hafniense DCB-2] >gi|109642471|gb|EAT52025.1| two component transcriptional regulator, winged helix family [Desulfitobacterium hafniense DCB-2] (230 aa)
Score = 140, Expect = 4.3e-07, Identities = 36/98 (36%), Positives = 54/98 (55%)
  Q:   123 FQTLLNIFHKVEVINLMNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWG---YDDDPTGLVIQYIYKLKKKIGKD 220
           ++ L      +EVIN           L +N    KV+ +G+E++ T  E+++L FF  +PN  FSKE IF  +WG   Y D  T  V  +I K++KKI +D
  S:   121 YERLTGKHQGIEVIN--------HRGLEINTASHKVYVNGKEVQFTAKEYELLLFFASNPNILFSKERIFDLLWGAEYYGDLAT--VPVHIQKIRKKIERD 211
>gi|83310469|ref|YP_420733.1| response regulator [Magnetospirillum magneticum AMB-1] >gi|82945310|dbj|BAE50174.1| Response regulator [Magnetospirillum magneticum AMB-1] (240 aa)
Score = 139, Expect = 4.6e-07, Identities = 31/78 (39%), Positives = 50/78 (64%)
  Q:   143 IIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDD--DPTGLVIQYIYKLKKKIGKD 220
           I WG+ +SM+L   +V  +G+ I +   EF +L+FFL+HP T FS+EE+   VWG D   +P  + + +I +L+K +  D
  S:   141 ISWGD-VSMDLASHRVVRAGKAIHLGPTEFRLLQFFLQHPGTVFSREELLDAVWGPDIYVEPRTVDV-HIRRLRKALNCD 218
>gi|24375906|ref|NP_719949.1| DNA-binding response regulator [Shewanella oneidensis MR-1] >gi|24350882|gb|AAN57393.1|AE015875_9 DNA-binding response regulator [Shewanella oneidensis MR-1] (225 aa)
Score = 139, Expect = 4.6e-07, Identities = 36/122 (29%), Positives = 66/122 (54%)
  Q:   115 DFFTPSLFFQTLL----NIFHKVEVINLMNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKK---IGKDNIVSSTYNGYCFKLRE 236
           D+ T    F  LL     +  + +   +  ++++ G  L M L+ R V   G ++ +   EF +LK+ +EH N   S+  +F+ VW Y  DP T ++  +I KL++K   +G   ++  T  G  ++LR+
  S:    97 DYMTKPFAFSELLVRAEKLMQRGQSTPITTDLVVGG--LKMELLTRNVTLDGHDLMLQPKEFQLLKYLMEHANQVISRTLLFEAVWDYHFDPRTNVIDVHIAKLRRKFEELGHGELI-ETVRGAGYRLRQ 223
>gi|118444074|ref|YP_877404.1| two-component response regulator [Clostridium novyi NT] >gi|118134530|gb|ABK61574.1| two-component response regulator [Clostridium novyi NT] (227 aa)
Score = 139, Expect = 4.6e-07, Identities = 52/198 (26%), Positives = 101/198 (51%)
  Q:    30 EILLNDKTFKIERVMLKPNEIDYLTTVHASVVIFDNIPSDQIDEAMVKKIKLISPITHFVYFCENYDEDTFLSVLQKGFEFCVSLDFFTPSLFFQ-TLLNIFHKVEVINLMNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGK-DNIVSSTY 227
           E+ L  + +++       + ++ L+  +  ++I D +  D     ++ KIK IS I   +   +N   D  L  LQ G +  ++  F +  L  +  + +   K +++N  N +I+   +L +   +RK+  +  E+ +T  EF++L +  E+    FS+EE+  KVWGYD + T   +   I +L+KK+GK  N + + Y
  S:    17 EMTLELENYEVMTAKTGLDALNILSKENIQLIILDAMLPDINGFNLIPKIKNISDIPIIMLTAKNDINDKILG-LQLGADDYITKPFNSTELILRIKIASKRVKKDIVNEKNEIIL--GSLRILKKERKLIINSTEVTLTYKEFEVLSYLCENKEKVFSREELLSKVWGYDFEGTTRAVDILIQRLRKKLGKCQNYIKTLY 214
>gi|170754678|ref|YP_001781488.1| DNA-binding response regulator [Clostridium botulinum B1 str. Okra] >gi|169119890|gb|ACA43726.1| DNA-binding response regulator [Clostridium botulinum B1 str. Okra] (176 aa)
Score = 139, Expect = 4.7e-07, Identities = 33/86 (38%), Positives = 49/86 (56%)
  Q:   136 INLMNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD-DDPTGLVIQYIYKLKKKIGKDN 221
           + L N   I    L++++  RKV    +EI  T  EFDI++    HP   FSKE+I++KVWGYD +     V ++I K++ K  K N
  S:    69 VPLNNRSKISFEKLTLDINSRKVHYEDEEILFTAKEFDIVELLALHPEQVFSKEQIYEKVWGYDAEGDANTVAEHIKKIRAKFIKRN 155
>gi|116670002|ref|YP_830935.1| two component transcriptional regulator [Arthrobacter sp. FB24] >gi|116610111|gb|ABK02835.1| two component transcriptional regulator, winged helix family [Arthrobacter sp. FB24] (247 aa)
Score = 139, Expect = 4.8e-07, Identities = 27/72 (37%), Positives = 40/72 (55%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQYIYKLKKKIGKD 220
             +N   R V   G  + +T  EFD+L FFL  PN  FS+EE+ + VWG+D      V  ++ +L++KI  D
  S:   148 FELNPAARTVTHHGSPLALTIREFDLLAFFLRRPNQVFSREELIRAVWGWDFGDLSTVTVHVRRLREKIEAD 219
>gi|114561278|ref|YP_748791.1| two component transcriptional regulator, winged helix family protein [Shewanella frigidimarina NCIMB 400] >gi|114332571|gb|ABI69953.1| two component transcriptional regulator, winged helix family protein [Shewanella frigidimarina NCIMB 400] (227 aa)
Score = 139, Expect = 4.8e-07, Identities = 35/102 (34%), Positives = 54/102 (52%)
  Q:   115 DFFTPSLFFQTLLNIFHKVEVINLMNNVI--IWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKK 216
           D+ T    F  LL    K+   N++      I   +L M L+ RKV     E+ +   EF +LK+ +EHPN   S+  +F+ VW Y  DP T ++  +I KL++K
  S:    99 DYMTKPFAFAELLVRAEKLAQRNVVEPAATEIEVGSLKMELLTRKVTLDDSELMLQPKEFQLLKYLMEHPNQVISRTLLFEAVWDYHFDPRTNVIDVHIAKLRRK 203
>gi|158339459|ref|YP_001520636.1| two component transcriptional regulator [Acaryochloris marina MBIC11017] >gi|158309700|gb|ABW31317.1| two component transcriptional regulator, winged helix family [Acaryochloris marina MBIC11017] (222 aa)
Score = 139, Expect = 5.1e-07, Identities = 36/121 (29%), Positives = 62/121 (51%)
  Q:   115 DFFTPSLFFQTLLNI----FHKVEVINLMNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKKIGKDNIVSSTYNGYCFKLR 235
           D+ T    F+ LL         V +      + +  +N+ ++L  RK     Q IE+   EF + + F  HP    S++++  +VWGYD DP + +V  Y+  L+KK+G  N +  T  G  ++L+
  S:    98 DYMTKPFRFEELLARVRVRLRTVSIGTPPETMTMTAHNVVLDLRTRKAKVDDQWIELPAREFILAETFFRHPGQVLSRQQLLDRVWGYDYDPGSNIVDVYVGYLRKKLG--NSLIETVRGVGYRLK 221
>gi|167760385|ref|ZP_02432512.1| hypothetical protein CLOSCI_02759 [Clostridium scindens ATCC 35704] >gi|167662058|gb|EDS06188.1| hypothetical protein CLOSCI_02759 [Clostridium scindens ATCC 35704] (231 aa)
Score = 139, Expect = 5.2e-07, Identities = 25/72 (34%), Positives = 45/72 (62%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQYIYKLKKKIGKD 220
            ++++  + ++ +G+EI +T  EF +L  F++HP   FSK+E+F++VW  D      ++ YI KL+ KI  D
  S:   141 FTLHMNSQTIFKNGKEIALTSKEFALLCLFMDHPGHTFSKQELFQEVWKNDGSDNNTILVYIKKLRSKIEDD 212
>gi|170761752|ref|YP_001787320.1| DNA-binding response regulator [Clostridium botulinum A3 str. Loch Maree] >gi|169408741|gb|ACA57152.1| DNA-binding response regulator [Clostridium botulinum A3 str. Loch Maree] (229 aa)
Score = 139, Expect = 5.3e-07, Identities = 33/86 (38%), Positives = 50/86 (58%)
  Q:   136 INLMNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD-DDPTGLVIQYIYKLKKKIGKDN 221
           + L N   I    L++++  RKV    +EI  T  EFDI++    HP   FSKE+I++KVWGYD +     V ++I K++ K+ K N
  S:   122 VPLNNRSKISFEKLTLDINSRKVHYEEEEILFTAKEFDIIELLALHPEQVFSKEQIYEKVWGYDAEGDANTVAEHIKKIRAKLIKRN 208
>gi|29375010|ref|NP_814163.1| DNA-binding response regulator [Enterococcus faecalis V583] >gi|29342469|gb|AAO80234.1| DNA-binding response regulator [Enterococcus faecalis V583] >gi|44933142|gb|AAS49388.1| response regulator [Enterococcus faecalis] (230 aa)
Score = 139, Expect = 5.5e-07, Identities = 27/79 (34%), Positives = 49/79 (62%)
  Q:   147 NNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD--DDPTGLVIQYIYKLKKKIGKDNIVSS 225
           N ++++    KV+    E+  T  E+ +L F +EHPN  ++KEE+F+ VWG+D  D     V+ +I ++++K+ K N+  S
  S:   136 NEIAVDTAAHKVFVLENEVIFTSKEYKLLVFLMEHPNRVWNKEELFESVWGFDALDTEVSTVVVHIKRIREKLKKANLSDS 216
>gi|187779465|ref|ZP_02995938.1| hypothetical protein CLOSPO_03061 [Clostridium sporogenes ATCC 15579] >gi|187773090|gb|EDU36892.1| hypothetical protein CLOSPO_03061 [Clostridium sporogenes ATCC 15579] (229 aa)
Score = 139, Expect = 5.6e-07, Identities = 33/84 (39%), Positives = 49/84 (58%)
  Q:   136 INLMNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD-DDPTGLVIQYIYKLKKKIGK 219
           + L N   I    L+++L  RKV+   +EI  T  EFDI++    HP   FSKE+I++KVWGYD +     V ++I K++ K  K
  S:   122 VPLNNKSKISFGKLNLDLSSRKVYYEEEEIIFTAKEFDIVELLALHPEQVFSKEQIYEKVWGYDAEGDANTVAEHIKKIRAKFIK 206
>gi|126731908|ref|ZP_01747712.1| two component response regulator [Sagittula stellata E-37] >gi|126707735|gb|EBA06797.1| two component response regulator [Sagittula stellata E-37] (226 aa)
Score = 138, Expect = 6.2e-07, Identities = 24/73 (32%), Positives = 48/73 (65%)
  Q:   147 NNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGK 219
           ++L +NL+ R+    G+ I++   EF +L+ F+E+P   FS+  I +K+W ++ DP   V++ ++ KL++K+ K
  S:   132 HDLKLNLLTRQAQRQGRNIDLLGKEFSLLQLFMENPGRIFSRTLILEKIWDFNFDPGTTVVETHVSKLRQKVDK 205
>gi|163839443|ref|YP_001623848.1| two-component response regulator [Renibacterium salmoninarum ATCC 33209] >gi|162952919|gb|ABY22434.1| two-component response regulator [Renibacterium salmoninarum ATCC 33209] (241 aa)
Score = 138, Expect = 6.3e-07, Identities = 25/70 (35%), Positives = 43/70 (61%)
  Q:   151 MNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQYIYKLKKKIGKD 220
           +N   R V  +G ++ +T  EFD+L FFL  PN  FS+E++ + VWG+D      V  ++ +L++KI ++
  S:   149 LNPASRVVSLNGVDLALTAREFDLLAFFLRRPNQVFSREDLIRAVWGWDFGDLSTVTVHVRRLREKIEQN 218
>gi|153939783|ref|YP_001391249.1| DNA-binding response regulator [Clostridium botulinum F str. Langeland] >gi|152935679|gb|ABS41177.1| DNA-binding response regulator [Clostridium botulinum F str. Langeland] (229 aa)
Score = 138, Expect = 6.3e-07, Identities = 34/86 (39%), Positives = 49/86 (56%)
  Q:   136 INLMNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD-DDPTGLVIQYIYKLKKKIGKDN 221
           I L N   I    L++++  RKV    +EI  T  EFDI++    HP   FSKE+I++KVWGYD +     V ++I K++ K  K N
  S:   122 IPLNNRSKISFGKLTLDINSRKVHYEEEEILFTAKEFDIVELLALHPEQVFSKEQIYEKVWGYDAEGDANTVAEHIKKIRAKFIKRN 208
>gi|152999147|ref|YP_001364828.1| two component transcriptional regulator [Shewanella baltica OS185] >gi|160873754|ref|YP_001553070.1| two component transcriptional regulator [Shewanella baltica OS195] >gi|151363765|gb|ABS06765.1| two component transcriptional regulator, winged helix family [Shewanella baltica OS185] >gi|160859276|gb|ABX47810.1| two component transcriptional regulator, winged helix family [Shewanella baltica OS195] (227 aa)
Score = 138, Expect = 6.5e-07, Identities = 24/70 (34%), Positives = 43/70 (61%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKKIG 218
           L ++ I+R + C GQ +E+T  EF +L+  +  PN   ++ ++ + VWGYD DP T +V   I +++ K+ 
  S:   132 LQLDCINRSINCQGQSVELTSREFSLLEHLMRSPNQVLTRGQLLEHVWGYDFDPCTNVVDVCIKRIRSKMA 202
>gi|177665861|ref|ZP_02941659.1| two component transcriptional regulator, winged helix family [Cyanothece sp. PCC 8801] >gi|172075084|gb|EDT60500.1| two component transcriptional regulator, winged helix family [Cyanothece sp. PCC 8801] (223 aa)
Score = 138, Expect = 6.6e-07, Identities = 28/88 (31%), Positives = 51/88 (57%)
  Q:   143 IIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKKIGKDNIVSSTYNGY 230
           I+   N+ ++L   +V+     +E++  EF +L+  + HP    +++++   VWGY+ DP + +V  YI  L+KK+GKD I +    GY
  S:   131 ILSSGNIKLDLKSHQVYLDDVVVELSTTEFTLLEILMSHPRQVMTRQQLLDHVWGYNYDPGSNIVDVYIGYLRKKLGKDLIDTVRGVGY 219
>gi|42519058|ref|NP_964988.1| two-component system response regulator [Lactobacillus johnsonii NCC 533] >gi|41583345|gb|AAS08954.1| two-component system response regulator [Lactobacillus johnsonii NCC 533] (231 aa)
Score = 138, Expect = 6.8e-07, Identities = 32/88 (36%), Positives = 48/88 (54%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD-DDPTGLVIQYIYKLKKKIGKDNIVSSTYNGYCFKLRE 236
           L ++L+  K WC G+EI +T  E+ +L   +  P    S++E+   VWGYD    T  V  YI  L+ K+GK   +  T  GY + LR+
  S:   138 LKIDLVSHKFWCKGEEIYLTPKEYALLCELMNDPEKVKSRDELLDIVWGYDFVGQTNTVDVYIRALRNKLGKYRNLIKTVRGYGYCLRK 226
>gi|196245598|ref|ZP_03144321.1| two component transcriptional regulator, winged helix family [Cyanothece sp. PCC 8802] >gi|196206565|gb|EDY01361.1| two component transcriptional regulator, winged helix family [Cyanothece sp. PCC 8802] (124 aa)
Score = 138, Expect = 7.0e-07, Identities = 28/88 (31%), Positives = 51/88 (57%)
  Q:   143 IIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKKIGKDNIVSSTYNGY 230
           I+   N+ ++L   +V+     +E++  EF +L+  + HP    +++++   VWGY+ DP + +V  YI  L+KK+GKD I +    GY
  S:    32 ILSSGNIKLDLKSHQVYLDDVVVELSTTEFTLLEILMSHPRQVMTRQQLLDHVWGYNYDPGSNIVDVYIGYLRKKLGKDLIDTVRGVGY 120
>gi|168179635|ref|ZP_02614299.1| DNA-binding response regulator [Clostridium botulinum NCTC 2916] >gi|182669357|gb|EDT81333.1| DNA-binding response regulator [Clostridium botulinum NCTC 2916] (229 aa)
Score = 138, Expect = 7.2e-07, Identities = 33/86 (38%), Positives = 49/86 (56%)
  Q:   136 INLMNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD-DDPTGLVIQYIYKLKKKIGKDN 221
           + L N   I    L+++L  RKV     EI +T  EFDI++    HP   FSKE+I++K+WGYD +     V ++I K++ K  K N
  S:   122 VPLNNRSKISFGKLTLDLNSRKVHYEEDEIILTAKEFDIVELLALHPEQVFSKEQIYEKIWGYDAEGDANTVAEHIKKIRAKFIKRN 208
>gi|75758377|ref|ZP_00738500.1| Two-component response regulator [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|74494103|gb|EAO57196.1| Two-component response regulator [Bacillus thuringiensis serovar israelensis ATCC 35646] (235 aa)
Score = 138, Expect = 7.5e-07, Identities = 30/90 (33%), Positives = 50/90 (55%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDD---PTGLVIQYIYKLKKKIGKDNIVSSTYNGYCFKLRES 237
           N+ +NL+  KV   G+++ +T   F++L +F+ H     SKEE++K +WGYD      T  +   I +L+  IG D I +    GY  ++  S
  S:   143 NIEINLLTHKVTVDGKQVHLTNQLFELLHYFITHKGKIISKEELYKNIWGYDPSELQETNTLEVNIRRLRNSIGIDIIKTVRGKGYVLEVFNS 235
>gi|148379888|ref|YP_001254429.1| DNA-binding response regulator [Clostridium botulinum A str. ATCC 3502] >gi|148289372|emb|CAL83468.1| two-component response regulator [Clostridium botulinum A str. ATCC 3502] (228 aa)
Score = 137, Expect = 7.7e-07, Identities = 33/80 (41%), Positives = 50/80 (62%)
  Q:   143 IIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD-DDPTGLVIQYIYKLKKKIGKDNI 222
           II+G  L+++L  RKV    +EI  T  EFDI++    HP   FSKE+I++KVWGYD +     V ++I K++ K  K ++
  S:   130 IIFGK-LTLDLNSRKVHYEEEEILFTAKEFDIVELLALHPEQIFSKEQIYEKVWGYDAEGDANTVAEHIKKIRAKFIKISV 209
>gi|134298626|ref|YP_001112122.1| two component transcriptional regulator [Desulfotomaculum reducens MI-1] >gi|134051326|gb|ABO49297.1| two component transcriptional regulator, winged helix family [Desulfotomaculum reducens MI-1] (223 aa)
Score = 137, Expect = 8.3e-07, Identities = 38/126 (30%), Positives = 64/126 (50%)
  Q:    92 CENYDEDTFLSVL-----------QKGFEFCVSLDFFTPSLFFQTLLNIFHKVEVINLMNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKI 217
           C+ + +D F  +L            KG       D+       + LL     +    +  N +I  ++L M+L  R+V  +G  + +T  EFD+L  F+ HPN   ++E+I  +VWG D      V++ YI  L++KI
  S:    65 CQRFRKDNFTPILILSARDEVESKVKGLNLGAD-DYLGKPFALEELLARVQALLRRRITANKVIQFSDLKMDLEAREVRRAGNLLTLTSREFDLLAHFMHHPNQVLTREQIIDRVWGLDFTGGSNVLEVYINMLRQKI 201
>gi|84497467|ref|ZP_00996289.1| putative two-component system response regulator [Janibacter sp. HTCC2649] >gi|84382355|gb|EAP98237.1| putative two-component system response regulator [Janibacter sp. HTCC2649] (254 aa)
Score = 137, Expect = 8.4e-07, Identities = 27/77 (35%), Positives = 46/77 (59%)
  Q:   156 RKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQYIYKLKKKIGKD-----NIVSSTYNGYCF 232
           R     G+ +E+T  EFD+L + + HP   F+KE++ ++VWG+D   T  V  ++ ++++KI  D      IV+    GY F
  S:   166 RTATVDGRGVELTTREFDLLAYLIAHPGLTFTKEQLMRRVWGWDFGDTSTVTVHVRRVREKIETDPSDPQRIVTVRGAGYRF 247
>gi|21222153|ref|NP_627932.1| response regulator [Streptomyces coelicolor A3(2)] >gi|7211008|emb|CAB76988.1| putative response regulator [Streptomyces coelicolor A3(2)] (256 aa)
Score = 137, Expect = 8.5e-07, Identities = 24/65 (36%), Positives = 39/65 (60%)
  Q:   156 RKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQYIYKLKKKIGKD 220
           R+    G E+ +T  EFD+L FFL HP   F++EE+ ++VWG+D      V  ++ +L+ K+  D
  S:   167 RRATKDGAELALTLREFDLLAFFLRHPGRAFAREELMREVWGWDFGDLSTVTVHVRRLRGKVEDD 231
>gi|195978046|ref|YP_002123290.1| TCS transcriptional regulatory protein ciaR [Streptococcus equi subsp. zooepidemicus str. MGCS10565] >gi|195974751|gb|ACG62277.1| TCS transcriptional regulatory protein ciaR [Streptococcus equi subsp. zooepidemicus str. MGCS10565] (224 aa)
Score = 137, Expect = 8.7e-07, Identities = 38/130 (29%), Positives = 70/130 (53%)
  Q:   107 GFEFCVSLDFFTPSLFFQTL-LNIFHKVEVINLMNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGKDNIVSSTYN----GYCFKLRE 236
           GFE     D+ T   + + L + I   ++ +   N+  +   NL+++   ++V  +GQ IE+   E D+L + L++ N    K +IF ++WG+D D T  V++ Y+ K++KK+   + V+        GY  K  E
  S:    90 GFELGAD-DYLTKPFYLEELKMRIQALLKRVGKFNDKSLKFGNLTVDTTRKEVQVNGQAIELLGKELDLLIYILQNQNVILPKSQIFDRIWGFDSDTTISVVEVYVSKIRKKLKGTDFVNHLQTLRSVGYILKANE 224
>gi|153934205|ref|YP_001384185.1| DNA-binding response regulator [Clostridium botulinum A str. ATCC 19397] >gi|153934696|ref|YP_001387726.1| DNA-binding response regulator [Clostridium botulinum A str. Hall] >gi|152930249|gb|ABS35749.1| DNA-binding response regulator [Clostridium botulinum A str. ATCC 19397] >gi|152930610|gb|ABS36109.1| DNA-binding response regulator [Clostridium botulinum A str. Hall] (228 aa)
Score = 137, Expect = 9.2e-07, Identities = 33/80 (41%), Positives = 50/80 (62%)
  Q:   143 IIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD-DDPTGLVIQYIYKLKKKIGKDNI 222
           II+G  L+++L  RKV    +EI  T  EFDI++    HP   FSKE+I++KVWGYD +     V ++I K++ K  K ++
  S:   130 IIFGK-LTLDLNSRKVHYEEEEILFTAKEFDIVELLALHPEQVFSKEQIYEKVWGYDAEGDANTVAEHIKKIRAKFIKISV 209
>gi|111221291|ref|YP_712085.1| putative transcriptional regulatory protein [Frankia alni ACN14a] >gi|111148823|emb|CAJ60501.1| Putative Transcriptional regulatory protein [Frankia alni ACN14a] (250 aa)
Score = 137, Expect = 1.0e-06, Identities = 32/97 (32%), Positives = 59/97 (60%)
  Q:   140 NNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKI--GKDNIVSSTYNGYCFKLRE 236
           ++V+ +G  +S++   R+V    +E+ +TK EF++L+ FL HP    S+  I ++VWGYD  PT   ++ ++  L++K+  G +  +  T  G  + LRE
  S:   146 DSVLRYGG-VSLDQASRQVTRGERELTLTKTEFELLELFLSHPRQVLSRSMIMERVWGYDFGPTSNSLEVFVSYLRRKLEAGGEPRLLHTVRGVGYVLRE 244
>gi|196178856|gb|EDX73853.1| response regulator receiver domain protein [Microcoleus chthonoplastes PCC 7420] (227 aa)
Score = 136, Expect = 1.1e-06, Identities = 32/90 (35%), Positives = 55/90 (61%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKI---GKDNIVSSTYNGYCFKLRES 237
           +LS+N   R+V+   + IE+T  EFD+L + + HP    ++++I ++VWGYD      +I+ Y+  L+ K+   G+  +V  T  G  + LRES
  S:   133 DLSLNHSTREVYRGDRLIELTAKEFDLLDYLISHPRQVLTRDQILERVWGYDFMGDSNIIEVYVRYLRLKLEANGEKRLV-QTVRGVGYVLRES 225
>gi|58038870|ref|YP_190834.1| DNA binding response regulator [Gluconobacter oxydans 621H] >gi|58001284|gb|AAW60178.1| DNA binding response regulator [Gluconobacter oxydans 621H] (251 aa)
Score = 136, Expect = 1.1e-06, Identities = 33/87 (37%), Positives = 55/87 (63%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKKI---GKDNIVSSTYNGYCFKLR 235
           L M+LI+R+V+ +GQEI++   EF +L++ +  P+T  ++  + + VW Y   P T LV  +I KL++KI   G+  ++ S   G  F LR
  S:   159 LEMDLIERRVFRNGQEIDLLPREFRLLEYMMRRPDTVLTRTMLLEDVWNYRFVPQTNLVDVHIGKLRRKIDVPGEPPLIHSI-RGAGFSLR 248
>gi|150424873|gb|EDN16650.1| transcriptional regulator [Vibrio cholerae AM-19226] (224 aa)
Score = 136, Expect = 1.1e-06, Identities = 34/103 (33%), Positives = 53/103 (51%)
  Q:   115 DFFTPSLFFQTLLNIFHKVEVINLMNNVI--IWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKKI 217
           D+      F+ LL     ++  N+  +    +   +L + L   +V+ + Q IE+T  E  IL+ FL  P   FS+E I   VWG   DP T +V  Y+ +L+KKI
  S:    97 DYLAKPFHFEELLARIEALQRRNIQTHTCNKLRFADLELCLSTMRVYRADQPIELTAKEISILELFLRKPGHIFSRERILANVWGIHQDPLTNVVDVYMRRLRKKI 202
>gi|182438910|ref|YP_001826629.1| putative two-component system response regulator [Streptomyces griseus subsp. griseus NBRC 13350] >gi|178467426|dbj|BAG21946.1| putative two-component system response regulator [Streptomyces griseus subsp. griseus NBRC 13350] (219 aa)
Score = 136, Expect = 1.1e-06, Identities = 25/66 (37%), Positives = 41/66 (62%)
  Q:   165 IEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKKIGKDNIVSSTYNGY 230
           +++T  EF +L+ FL HP    S+E+I   VWGYD DP + +V  Y+  L++K+G + + +    GY
  S:   150 VDLTAREFVLLEMFLRHPGQVLSREQILSHVWGYDFDPGSNIVDVYVRALRRKLGAERLETIRGMGY 216
>gi|160944658|ref|ZP_02091885.1| hypothetical protein FAEPRAM212_02172 [Faecalibacterium prausnitzii M21/2] >gi|158443842|gb|EDP20846.1| hypothetical protein FAEPRAM212_02172 [Faecalibacterium prausnitzii M21/2] (138 aa)
Score = 136, Expect = 1.2e-06, Identities = 28/84 (33%), Positives = 51/84 (60%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD-DDPTGLVIQYIYKLKKKI-GKDNIVSSTYNGYCF 232
           L+++ +  +V C+ +++ +T+ EFD+L     H    FSKE++F+ VWG + DD   +V   +  L+KK+ G  + + +T  GY F
  S:    44 LTLDGMTHEVSCNDRKVSLTRLEFDLLLMLASHEGQIFSKEKLFRAVWGQNCDDTLKVVANTVSNLRKKLAGCGSFIRTTQGGYAF 129
>gi|158333980|ref|YP_001515152.1| two-component transcriptional regulator [Acaryochloris marina MBIC11017] >gi|158304221|gb|ABW25838.1| two-component transcriptional regulator [Acaryochloris marina MBIC11017] (235 aa)
Score = 136, Expect = 1.2e-06, Identities = 29/90 (32%), Positives = 53/90 (58%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YI--YKLKKKIGKDNIVSSTYNGYCFKLRES 237
           +L ++L  R+     + IE+T  EF++L++ +EHP    ++E+I + VWG+D      VI+ YI   +LK ++  +  +  T  G  + LRE+
  S:   143 DLQLDLATRRAQRRSRTIELTMKEFELLRYLMEHPREILTREQILENVWGFDFRGESNVIEVYIRYLRLKVQVAPEKRLIHTVRGVGYVLREA 235
>gi|170078061|ref|YP_001734699.1| two-component response regulator [Synechococcus sp. PCC 7002] >gi|169885730|gb|ACA99443.1| two-component response regulator [Synechococcus sp. PCC 7002] (222 aa)
Score = 136, Expect = 1.3e-06, Identities = 31/87 (35%), Positives = 51/87 (58%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKKIGKDNIVSSTYNGYCFKLR 235
           L ++L  R+V      +E+   EF +L+  L HP+   S++++  +VWGYD DP + +V  YI  L+KK+G D I   T  G  ++L+
  S:   136 LELDLKARRVRQGDVWLELPTREFILLETLLRHPDQVLSRQQLLDQVWGYDYDPGSNIVDVYIGYLRKKLGSDLI--ETVRGIGYRLK 221
>gi|153886170|ref|ZP_02007325.1| two component transcriptional regulator, winged helix family [Ralstonia pickettii 12D] >gi|187927399|ref|YP_001897886.1| two component transcriptional regulator, winged helix family [Ralstonia pickettii 12J] >gi|151577135|gb|EDN41536.1| two component transcriptional regulator, winged helix family [Ralstonia pickettii 12D] >gi|187724289|gb|ACD25454.1| two component transcriptional regulator, winged helix family [Ralstonia pickettii 12J] (242 aa)
Score = 136, Expect = 1.3e-06, Identities = 27/73 (36%), Positives = 42/73 (57%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGKD 220
           NL +  + R+V   G+ IE+T  EFD+L FF  HP   FS+ ++  +VWGY  D     +  +I +L+ K+  D
  S:   141 NLEIEPLAREVRVDGKPIELTPREFDLLHFFARHPGKVFSRLDLLNQVWGYQHDGYEHTVNTHINRLRAKVEVD 214
>gi|91786449|ref|YP_547401.1| two component transcriptional regulator [Polaromonas sp. JS666] >gi|91695674|gb|ABE42503.1| two component transcriptional regulator, winged helix family [Polaromonas sp. JS666] (241 aa)
Score = 135, Expect = 1.4e-06, Identities = 26/73 (35%), Positives = 42/73 (57%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGKD 220
           NL ++ + R+V   G+ +E+T  EFD+L FF  HP   FS+  +  +VWGY  D     +  +I +L+ K+  D
  S:   141 NLRVDPVAREVQVEGKSVELTPREFDLLYFFARHPGKVFSRLNLLNQVWGYQHDGYEHTVNTHINRLRMKVEAD 214
>gi|152991031|ref|YP_001356753.1| two-component response regulator [Nitratiruptor sp. SB155-2] >gi|151422892|dbj|BAF70396.1| two-component response regulator [Nitratiruptor sp. SB155-2] (221 aa)
Score = 135, Expect = 1.4e-06, Identities = 28/87 (32%), Positives = 52/87 (59%)
  Q:   146 GNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGKDNIVSSTYNGYCF 232
            +N+  ++   ++  + + I + + E  +LK FL+HPN   S E I++ +W Y++ P+ + ++ YI  L+K IGK+ I S   +GY F
  S:   132 ASNIFFDIKSNQLILNNEPINLNQKELRLLKLFLQHPNEVLSHETIYEHLWDYEETPSDMALRTYIKNLRKYIGKERIESIKRHGYKF 219
>gi|153829425|ref|ZP_01982092.1| transcriptional regulator [Vibrio cholerae 623-39] >gi|148875079|gb|EDL73214.1| transcriptional regulator [Vibrio cholerae 623-39] (224 aa)
Score = 135, Expect = 1.4e-06, Identities = 34/103 (33%), Positives = 53/103 (51%)
  Q:   115 DFFTPSLFFQTLLNIFHKVEVINLMNNVI--IWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKKI 217
           D+      F+ LL     ++  N+  +    +   +L + L   +V+ + Q IE+T  E  IL+ FL  P   FS+E I   VWG   DP T +V  Y+ +L+KKI
  S:    97 DYLAKPFHFEELLARIEALQRRNIQTHTCNKLRFADLELCLSTMRVYRAEQPIELTAKEISILELFLRKPGHIFSRERILANVWGIHQDPLTNVVDVYMRRLRKKI 202
>gi|182417343|ref|ZP_02948678.1| alkaline phosphatase synthesis transcriptional regulatory proteinphoP [Clostridium butyricum 5521] >gi|182378773|gb|EDT76295.1| alkaline phosphatase synthesis transcriptional regulatory proteinphoP [Clostridium butyricum 5521] (231 aa)
Score = 135, Expect = 1.4e-06, Identities = 36/120 (30%), Positives = 69/120 (57%)
  Q:   117 FTPSLFFQTLLNIFHKVEV---INLMNNVIIWG---NNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDD-PTGLVIQYIYKLKKKIGKDNIVSSTYNGYCFKLRE 236
           F+P      +  IF ++E    IN+  N+ I      N+++NL ++ V    + +++T NE+++LK+  E+     S+EE+  K+WGYD +  T      + +L+KKI   ++   T  G+ F+L++
  S:   104 FSPMSLVMRVKAIFRRIEFEHNINIEKNIPISELKFGNITINLHNKIVTFKDENLDLTPNEYNLLKYLFENCERAVSREELLDKIWGYDSEVETRAADDTVKRLRKKISHTDVSIETVWGFGFRLKD 230
>gi|119487882|ref|ZP_01621379.1| Two component Transcriptional regulator, Winged helix family protein [Lyngbya sp. PCC 8106] >gi|119455458|gb|EAW36596.1| Two component Transcriptional regulator, Winged helix family protein [Lyngbya sp. PCC 8106] (222 aa)
Score = 135, Expect = 1.4e-06, Identities = 26/88 (29%), Positives = 51/88 (57%)
  Q:   143 IIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKKIGKDNIVSSTYNGY 230
           ++   ++ ++L  R+   +   I+++  EF +L+  + HP    S+E++  +VWGYD DP + +V  Y+  L+KK+G + I +    GY
  S:   130 VLTAGDILLDLYTRQAQVADCPIKLSAKEFQLLETLMRHPEQVMSREQLLDRVWGYDYDPGSNIVDVYVGYLRKKLGGNRIETVRGMGY 218
>gi|157164687|ref|YP_001466781.1| extracellular solute-binding protein [Campylobacter concisus 13826] >gi|112800153|gb|EAT97497.1| DNA-binding response regulator [Campylobacter concisus 13826] (220 aa)
Score = 135, Expect = 1.5e-06, Identities = 25/72 (34%), Positives = 48/72 (66%)
  Q:   161 SGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGKDNIVSSTYNGYCF 232
           +G+ + I+  E D+L  FL++     +K+EIF K+W +D++P+ L ++ YI  L++ +GKD I++   +GY +
  S:   147 NGENVNISSKESDLLALFLQNKGKILTKDEIFNKIWKFDEEPSELSLRVYIKNLRQILGKDAILNKRGDGYIY 219
>gi|145220641|ref|YP_001131319.1| two component transcriptional regulator [Mycobacterium gilvum PYR-GCK] >gi|145213127|gb|ABP42531.1| two component transcriptional regulator, winged helix family [Mycobacterium gilvum PYR-GCK] (236 aa)
Score = 135, Expect = 1.5e-06, Identities = 28/96 (29%), Positives = 53/96 (55%)
  Q:   142 VIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQYIYKLKKKIGKDNIVSSTY-NGYCFKLRES 237
           V I   +L+++   R     G+ + +T  EFD+L FFL H  T +++E++ K+VW +D      V  ++ +L+ K+G  + V + +  GY +   E+
  S:   131 VDITSGDLTVSTASRSATVGGRTVSLTNREFDLLLFFLTHAGTVYTREDLLKEVWHWDFGDLSTVTVHVKRLRSKLGDRHRVQTVWGRGYMWAPDEA 227
>gi|111225916|ref|YP_716710.1| two-component system response regulator [Frankia alni ACN14a] >gi|111153448|emb|CAJ65206.1| Two-component system response regulator [Frankia alni ACN14a] (203 aa)
Score = 135, Expect = 1.6e-06, Identities = 23/78 (29%), Positives = 50/78 (64%)
  Q:   140 NNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQYIYKLKKKI 217
           N+ +++G+ +S++L  R+V  +G+ I++T  E+++L F   HP   FS+EE+ ++VWG        V +++ +++ K+
  S:   105 NDPLVYGD-VSIDLRAREVAVAGERIDLTAREYELLAFLARHPRRVFSREELLEQVWGTRFQDPATVTEHVRRVRTKV 181
>gi|167647848|ref|YP_001685511.1| two component transcriptional regulator [Caulobacter sp. K31] >gi|167350278|gb|ABZ73013.1| two component transcriptional regulator, winged helix family [Caulobacter sp. K31] (223 aa)
Score = 135, Expect = 1.6e-06, Identities = 31/86 (36%), Positives = 50/86 (58%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKKIGK--DNIVSSTYNGYCFKL 234
           L MNLI+R V   G+EI++   EF +L+F + H     ++  + +KVW Y  DP T ++  +I +L+ KI K  D  +  T  G  ++L
  S:   133 LEMNLINRTVHRQGKEIDLQPREFQLLEFMMRHAGQSVTRTMLLEKVWEYHFDPQTNVIDVHISRLRSKIDKGFDRAMLQTVRGAGYRL 221
>gi|16126989|ref|NP_421553.1| DNA-binding response regulator [Caulobacter crescentus CB15] >gi|13424351|gb|AAK24721.1| DNA-binding response regulator [Caulobacter crescentus CB15] (223 aa)
Score = 135, Expect = 1.6e-06, Identities = 31/86 (36%), Positives = 50/86 (58%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKKIGK--DNIVSSTYNGYCFKL 234
           L MNLI+R V   G+EI++   EF +L+F + H     ++  + +KVW Y  DP T ++  +I +L+ KI K  D  +  T  G  ++L
  S:   133 LEMNLINRTVHRQGKEIDLQPREFQLLEFMMRHAGQSVTRTMLLEKVWEYHFDPQTNVIDVHISRLRSKIDKGFDRAMLQTVRGAGYRL 221
>gi|168184914|ref|ZP_02619578.1| DNA-binding response regulator [Clostridium botulinum Bf] >gi|182672034|gb|EDT83995.1| DNA-binding response regulator [Clostridium botulinum Bf] (229 aa)
Score = 135, Expect = 1.6e-06, Identities = 32/86 (37%), Positives = 49/86 (56%)
  Q:   136 INLMNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD-DDPTGLVIQYIYKLKKKIGKDN 221
           + L N   I    L++++  R+V    +EI  T  EFDI++    HP   FSKE+I++KVWGYD +     V ++I K++ K  K N
  S:   122 VPLNNRSKISFGKLTLDINSRRVHYEEEEILFTAKEFDIVELLALHPQQVFSKEQIYEKVWGYDAEGDANTVAEHIKKIRAKFIKRN 208
>gi|186903551|ref|ZP_02976484.1| two component transcriptional regulator, winged helix family [Cyanothece sp. PCC 7424] >gi|186689397|gb|EDU14040.1| two component transcriptional regulator, winged helix family [Cyanothece sp. PCC 7424] (224 aa)
Score = 135, Expect = 1.7e-06, Identities = 28/89 (31%), Positives = 55/89 (61%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGY----DDDPTGLVIQYIYKLKKKIGKDNIVSSTYNGYCFKLRE 236
           +L +N   R+V+ + + IE+T  EFD+L++ + HP    ++E+I ++VWGY    D +   + ++Y+ +LK +  ++  +  T  G  + LRE
  S:   133 DLRLNRSSREVYRANRLIELTAKEFDLLEYLMSHPRQVLTREQILERVWGYDFMGDSNIIEVYVRYL-RLKLENNQEKRLIQTVRGIGYVLRE 224
>gi|167628753|ref|YP_001679252.1| transcriptional regulator [Heliobacterium modesticaldum Ice1] >gi|167591493|gb|ABZ83241.1| transcriptional regulator [Heliobacterium modesticaldum Ice1] (232 aa)
Score = 135, Expect = 1.7e-06, Identities = 24/73 (32%), Positives = 47/73 (64%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPT-GLVIQYIYKLKKKIGKD 220
           +L +NL DR V   G+ +E+T  E+D+L F  ++PN +FS +++ + VW +    +   ++ +I  L++K+G+D
  S:   139 DLRINLFDRTVEMKGERVELTVKEYDLLLFLAQNPNRYFSSDQLIEAVWNHPRSISQKALMTHISNLRRKLGED 212
>gi|167938726|ref|ZP_02525801.1| Two-component response regulator [Bacillus cereus AH1134] (223 aa)
Score = 134, Expect = 1.8e-06, Identities = 29/80 (36%), Positives = 48/80 (60%)
  Q:   155 DRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDD-DPTGLVIQYIYKLKKKIGKDNIVSSTYNGYCFKL 234
           +RKV  SGQEI++T  EF++ + F+ +P   F ++E+ +KVWG++    T  V   + +L+KK+G       T  G  +KL
  S:   141 ERKVHVSGQEIQLTYREFNLCQLFVSNPQRVFMRDELLEKVWGFEYIGNTRAVDIMVQRLRKKLGTSGEYIKTIYGVGYKL 221
>gi|57242734|ref|ZP_00370671.1| response regulator, putative [Campylobacter upsaliensis RM3195] >gi|57016663|gb|EAL53447.1| response regulator, putative [Campylobacter upsaliensis RM3195] (236 aa)
Score = 134, Expect = 1.8e-06, Identities = 37/111 (33%), Positives = 61/111 (54%)
  Q:   120 SLFFQTLL--NIFHKVEVINLMNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGKDNIVSSTYNGY 230
           SL  + LL  + FHK E      N    G  L  +L ++ ++   + + +   E  +L   L++ N F S EEIF K+W YD++P+ L ++ Y+  L+K +GKD I++    GY
  S:   126 SLRVEALLKRSFFHKNE------NYEDLGEGLKFSLKNQILYKDDKVLALPSKEIKLLTLLLQNKNNFLSVEEIFDKLWEYDEEPSELSLRAYVKNLRKILGKDKIINQRGRGY 233
>gi|177672879|ref|ZP_02945463.1| two component transcriptional regulator, winged helix family [Micrococcus luteus NCTC 2665] >gi|172070589|gb|EDT56643.1| two component transcriptional regulator, winged helix family [Micrococcus luteus NCTC 2665] (254 aa)
Score = 134, Expect = 1.9e-06, Identities = 36/106 (33%), Positives = 60/106 (56%)
  Q:   115 DFFTPSLFFQTLLNIFHKV----EVINLMNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGKD 220
           D+ T     + +L   H++     V++  + V++ G+ L MN    +V   G EIE+T  ++++LKF + +  T  SKE I + VWGYD      +++ YI  L+KKI  D
  S:   127 DYVTKPFSMEEVLIRAHRLVQRSGVVSGGSEVLVVGD-LVMNTRTHEVTRGGDEIELTATQYNLLKFLMANVRTVLSKERILQDVWGYDFGGRANIVELYISYLRKKIDAD 236
>gi|88856681|ref|ZP_01131337.1| putative two-component system response regulator [marine actinobacterium PHSC20C1] >gi|88814142|gb|EAR24008.1| putative two-component system response regulator [marine actinobacterium PHSC20C1] (266 aa)
Score = 134, Expect = 1.9e-06, Identities = 23/60 (38%), Positives = 38/60 (63%)
  Q:   161 SGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQYIYKLKKKIGKD 220
           +G+E+ +T  EFD+L F L+HP   FS+E++ K VWG++      V   + +L++KI  D
  S:   184 AGEELALTAREFDLLAFLLKHPGQAFSREQLLKSVWGWEFGDLSTVTVTVRRLREKIETD 243
>gi|153801779|ref|ZP_01956365.1| transcriptional regulator [Vibrio cholerae MZO-3] >gi|124122679|gb|EAY41422.1| transcriptional regulator [Vibrio cholerae MZO-3] (168 aa)
Score = 134, Expect = 1.9e-06, Identities = 29/70 (41%), Positives = 41/70 (58%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKKI 217
           +L + L   +V+ + Q IE+T  E  IL+ FL  P   FS+E I   VWG   DP T +V  Y+ +L+KKI
  S:    76 DLELCLSTMRVYRAEQPIELTAKEISILELFLRKPGHIFSRERILANVWGIHQDPLTNVVDVYMRRLRKKI 146
>gi|15601007|ref|NP_232637.1| transcriptional regulator [Vibrio cholerae O1 biovar eltor str. N16961] >gi|121587109|ref|ZP_01676885.1| transcriptional regulator [Vibrio cholerae 2740-80] >gi|121729896|ref|ZP_01682322.1| transcriptional regulator [Vibrio cholerae V52] >gi|147672355|ref|YP_001215826.1| transcriptional regulator [Vibrio cholerae O395] >gi|153215292|ref|ZP_01949936.1| transcriptional regulator [Vibrio cholerae 1587] >gi|153221603|ref|ZP_01952528.1| transcriptional regulator [Vibrio cholerae MAK 757] >gi|153802077|ref|ZP_01956663.1| transcriptional regulator [Vibrio cholerae MZO-3] >gi|153802458|ref|ZP_01957044.1| transcriptional regulator [Vibrio cholerae MZO-3] >gi|153820149|ref|ZP_01972816.1| transcriptional regulator [Vibrio cholerae NCTC 8457] >gi|153822561|ref|ZP_01975228.1| transcriptional regulator [Vibrio cholerae B33] >gi|153826711|ref|ZP_01979378.1| transcriptional regulator [Vibrio cholerae MZO-2] >gi|194531540|ref|YP_002066990.1| transcriptional regulator [Vibrio cholerae MO10] >gi|194536898|ref|YP_002072050.1| transcriptional regulator [Vibrio cholerae V51] >gi|9657634|gb|AAF96150.1| transcriptional regulator [Vibrio cholerae O1 biovar eltor str. N16961] >gi|121548645|gb|EAX58695.1| transcriptional regulator [Vibrio cholerae 2740-80] >gi|121628363|gb|EAX60865.1| transcriptional regulator [Vibrio cholerae V52] >gi|124114831|gb|EAY33651.1| transcriptional regulator [Vibrio cholerae 1587] >gi|124119513|gb|EAY38256.1| transcriptional regulator [Vibrio cholerae MAK 757] >gi|124122026|gb|EAY40769.1| transcriptional regulator [Vibrio cholerae MZO-3] >gi|124122376|gb|EAY41119.1| transcriptional regulator [Vibrio cholerae MZO-3] >gi|125617494|gb|EAZ46057.1| transcriptional regulator [Vibrio cholerae MO10] >gi|125621511|gb|EAZ49844.1| transcriptional regulator [Vibrio cholerae V51] >gi|126509301|gb|EAZ71895.1| transcriptional regulator [Vibrio cholerae NCTC 8457] >gi|126519921|gb|EAZ77144.1| transcriptional regulator [Vibrio cholerae B33] >gi|146314738|gb|ABQ19278.1| transcriptional regulator [Vibrio cholerae O395] >gi|149739498|gb|EDM53732.1| transcriptional regulator [Vibrio cholerae MZO-2] (224 aa)
Score = 134, Expect = 1.9e-06, Identities = 29/70 (41%), Positives = 41/70 (58%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKKI 217
           +L + L   +V+ + Q IE+T  E  IL+ FL  P   FS+E I   VWG   DP T +V  Y+ +L+KKI
  S:   132 DLELCLSTMRVYRAEQPIELTAKEISILELFLRKPGHIFSRERILANVWGIHQDPLTNVVDVYMRRLRKKI 202
>gi|30023294|ref|NP_834925.1| two-component response regulator [Bacillus cereus ATCC 14579] >gi|29898855|gb|AAP12126.1| Two-component response regulator [Bacillus cereus ATCC 14579] (224 aa)
Score = 134, Expect = 1.9e-06, Identities = 29/80 (36%), Positives = 48/80 (60%)
  Q:   155 DRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDD-DPTGLVIQYIYKLKKKIGKDNIVSSTYNGYCFKL 234
           +RKV  SGQEI++T  EF++ + F+ +P   F ++E+ +KVWG++    T  V   + +L+KK+G       T  G  +KL
  S:   142 ERKVHVSGQEIQLTYREFNLCQLFVSNPQRVFMRDELLEKVWGFEYIGNTRAVDIMVQRLRKKLGTSGEYIKTIYGVGYKL 222
>gi|168136058|ref|ZP_02579287.1| Two-component response regulator [Bacillus cereus B4264] (223 aa)
Score = 134, Expect = 1.9e-06, Identities = 29/80 (36%), Positives = 48/80 (60%)
  Q:   155 DRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDD-DPTGLVIQYIYKLKKKIGKDNIVSSTYNGYCFKL 234
           +RKV  SGQEI++T  EF++ + F+ +P   F ++E+ +KVWG++    T  V   + +L+KK+G       T  G  +KL
  S:   141 ERKVHVSGQEIQLTYREFNLCQLFVSNPQRVFMRDELLEKVWGFEYIGNTRAVDIMVQRLRKKLGTSGEYIKTIYGVGYKL 221
>gi|75907851|ref|YP_322147.1| multi-component transcriptional regulator [Anabaena variabilis ATCC 29413] >gi|75701576|gb|ABA21252.1| multi-component transcriptional regulator, winged helix family [Anabaena variabilis ATCC 29413] (613 aa)
Score = 134, Expect = 1.9e-06, Identities = 28/80 (35%), Positives = 46/80 (57%)
  Q:   138 LMNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPT-GLVIQYIYKLKKKI 217
           L+ N++ W  NL +N+I  +V   GQ I ++  E+ +L  FL +P   FS+ EI  ++W  D  P+ G V   I  L++K+
  S:   123 LIPNLLSW-ENLDVNVISAEVTYKGQPISLSPKEYSLLGLFLRNPQRIFSRSEIIDRLWSIDATPSEGAVTNLIKDLRQKL 202
>gi|126651767|ref|ZP_01723969.1| two-component response regulator [Bacillus sp. B14905] >gi|126591445|gb|EAZ85552.1| two-component response regulator [Bacillus sp. B14905] (212 aa)
Score = 134, Expect = 1.9e-06, Identities = 44/161 (27%), Positives = 83/161 (51%)
  Q:    70 QIDEAMV-KKIKLISPITHFVYFCENYDEDTFLSVLQKGFEFCVSLDFFTPSLFFQTLLNIFHKVEVINLMNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD--DDPTGLVIQYIYKLKKKIGKDNIVSSTYNGY 230
           ++D  MV +++K    I   +    +  ED F   L  G +  V+  F+   L  +       ++E I  +++V       S ++  ++VW +G EIE+TK EF++L+ F ++     +++++   VWG D   DP   V  +I +L++KIG++ I +    GY
  S:    56 KVDGMMVCREMKRTQKIKVLMLTARDTGEDEF-KALADGADDYVNKPFYPKVLIMRA--KKLLQIEAIQQLHDV-------SFDVTSKRVWRAGTEIELTKTEFELLRIFSQNRRQILTRDQLLDLVWGLDYMGDPR-TVDTHIRRLREKIGENIIQTHRGIGY 208
>gi|168142885|ref|ZP_02586114.1| Two-component response regulator [Bacillus cereus G9842] (223 aa)
Score = 134, Expect = 2.1e-06, Identities = 29/80 (36%), Positives = 48/80 (60%)
  Q:   155 DRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDD-DPTGLVIQYIYKLKKKIGKDNIVSSTYNGYCFKL 234
           +RKV  SGQEI++T  EF++ + F+ +P   F ++E+ +KVWG++    T  V   + +L+KK+G       T  G  +KL
  S:   141 ERKVHVSGQEIQLTYREFNLCQLFVSNPQRVFMRDELLEKVWGFEYIGNTRAVDIMVQRLRKKLGTSGEYIKTIYGVGYKL 221
>gi|158318231|ref|YP_001510739.1| two component transcriptional regulator [Frankia sp. EAN1pec] >gi|158113636|gb|ABW15833.1| two component transcriptional regulator, winged helix family [Frankia sp. EAN1pec] (231 aa)
Score = 134, Expect = 2.1e-06, Identities = 27/70 (38%), Positives = 44/70 (62%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKI 217
           +L MN   R+V  +G+EI +T  EF++L++F+ +P    SK +I  +VW YD      V++ Y+  L+KKI
  S:   139 DLIMNEESREVTRAGREIRLTATEFELLRYFMRNPRRVLSKAQILDRVWNYDFGGQANVVELYVSYLRKKI 209
>gi|118581362|ref|YP_902612.1| two component transcriptional regulator [Pelobacter propionicus DSM 2379] >gi|118504072|gb|ABL00555.1| two component transcriptional regulator, winged helix family [Pelobacter propionicus DSM 2379] (223 aa)
Score = 134, Expect = 2.2e-06, Identities = 31/93 (33%), Positives = 54/93 (58%)
  Q:   144 IWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD-DDPTGLVIQYIYKLKKKIGKD--NIVSSTYNGYCFKLRE 236
           I+  +L ++ +  KVW SG EI++T  E+ +L++ + +PN   S+  I + VW Y  D  T ++  Y+  L+KK+ K+    +  T  G  + LRE
  S:   127 IFFADLRLDPVSHKVWRSGNEIDLTAKEYGLLEYLVRNPNKVLSRAMIAEHVWDYAFDSFTNIIDVYVNYLRKKVDKEYSTKLIHTVRGQGYILRE 222
>gi|160941449|ref|ZP_02088785.1| hypothetical protein CLOBOL_06341 [Clostridium bolteae ATCC BAA-613] >gi|158435659|gb|EDP13426.1| hypothetical protein CLOBOL_06341 [Clostridium bolteae ATCC BAA-613] (229 aa)
Score = 134, Expect = 2.2e-06, Identities = 33/94 (35%), Positives = 54/94 (57%)
  Q:   141 NVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDD-DPTGLVIQYIYKLKKKI----GKDNIVSSTYN-GYCFKL 234
           N +I    L ++   R+VW +G+E   T  EFD+L F  ++PN  F+KEE+F K+W  +       V  +I K+++KI     K   + + +  GY FK+
  S:   130 NELIEIRGLKIDKTARRVWVNGEEKTFTTKEFDLLTFLAQNPNHVFTKEELFSKIWDMESIGDIATVTVHIKKIREKIEFNTAKPQYIETIWGVGYRFKV 229
>gi|94495738|ref|ZP_01302318.1| phosphate regulon response regulator [Sphingomonas sp. SKA58] >gi|94425126|gb|EAT10147.1| phosphate regulon response regulator [Sphingomonas sp. SKA58] (233 aa)
Score = 133, Expect = 2.2e-06, Identities = 29/73 (39%), Positives = 41/73 (56%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGKD 220
           ++ M+ +  KV  SGQ I +   EF +LK FLEHP   FS+E +   VWG D D     +  +I +L+K I  D
  S:   137 DVEMDTVGHKVRRSGQVIPLGPTEFRLLKHFLEHPGWVFSRERLLDSVWGQDSDIELRTVDVHIRRLRKAINAD 210
>gi|166032567|ref|ZP_02235396.1| hypothetical protein DORFOR_02282 [Dorea formicigenerans ATCC 27755] >gi|166026924|gb|EDR45681.1| hypothetical protein DORFOR_02282 [Dorea formicigenerans ATCC 27755] (231 aa)
Score = 133, Expect = 2.3e-06, Identities = 26/73 (35%), Positives = 44/73 (60%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQYIYKLKKKIGKD 220
           + ++ +  + V  +G+EI +T  EF +L  F+E+P   FSK+E+F KVW  D+     ++ YI KL+ K+  D
  S:   140 SFTLRMESQTVLKNGKEISLTSKEFSLLYLFIENPEYIFSKQELFSKVWRSDNCDDSTILVYIKKLRDKLEDD 212
>gi|167748370|ref|ZP_02420497.1| hypothetical protein ANACAC_03114 [Anaerostipes caccae DSM 14662] >gi|167652362|gb|EDR96491.1| hypothetical protein ANACAC_03114 [Anaerostipes caccae DSM 14662] (229 aa)
Score = 133, Expect = 2.3e-06, Identities = 37/118 (31%), Positives = 63/118 (53%)
  Q:   117 FTPSLFFQTL---LNIFHKVEVINLMNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDD-DPTGLVIQYIYKLKKKI----GKDNIVSSTYN-GYCFKL 234
           F+PS     +   L  + ++   N   N ++    L ++   R+V+ +G+E   T  EFD+L F   HPN  F+KEE+F K+W  +       V  +I K+++KI     K   + + +  GY FK+
  S:   103 FSPSELVARVKAHLERYRRLVSSNTQENDVVEIRGLKIDKTARRVYLNGEEKAFTTKEFDLLTFLASHPNRVFTKEELFNKIWDMESLGDIATVTVHIKKIREKIELNTAKPQYIETIWGVGYRFKM 229
>gi|86739037|ref|YP_479437.1| two component transcriptional regulator [Frankia sp. CcI3] >gi|86565899|gb|ABD09708.1| two component transcriptional regulator, winged helix family [Frankia sp. CcI3] (406 aa)
Score = 133, Expect = 2.3e-06, Identities = 26/70 (37%), Positives = 44/70 (62%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKI 217
           +L+M+   R+V  +GQ + +T  EF++L+FF+ +P    SK +I  +VW YD      V++ Y+  L+KKI
  S:   293 DLTMDEESREVQRAGQPVHLTATEFELLRFFMRNPRRVLSKAQILDRVWNYDFGGQANVVELYVSYLRKKI 363
>gi|116618899|ref|YP_819270.1| DNA-binding response regulator [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|116097746|gb|ABJ62897.1| DNA-binding response regulator, OmpR family (Rec-wHTH domains) [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (233 aa)
Score = 133, Expect = 2.3e-06, Identities = 29/92 (31%), Positives = 59/92 (64%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKK---IGKDNIVSSTYN-GYCFKLRESFR 239
           ++ +NL +R V   GQ +++   EFDIL +  ++ N   ++++IF +VWG D D T  V+  Y+  L++K   +G++N++ +  N G+  ++ ++ R
  S:   135 DVMINLENRGVQVHGQPVKLVGKEFDILTYLAQNKNIIVTRDQIFDRVWGIDSDTTINVVNIYLNNLRRKLEAVGQNNLIKTLRNIGFILEVEDAER 231
>gi|138893945|ref|YP_001124398.1| subtilin biosynthesis regulatory protein SpaR [Geobacillus thermodenitrificans NG80-2] >gi|196250503|ref|ZP_03149194.1| two component transcriptional regulator, winged helix family [Geobacillus sp. G11MC16] >gi|134265458|gb|ABO65653.1| Subtilin biosynthesis regulatory protein SpaR [Geobacillus thermodenitrificans NG80-2] >gi|196209993|gb|EDY04761.1| two component transcriptional regulator, winged helix family [Geobacillus sp. G11MC16] (232 aa)
Score = 133, Expect = 2.3e-06, Identities = 26/70 (37%), Positives = 47/70 (67%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPT-GLVIQYIYKLKKKI 217
           N++++L+  +V+C G+++ +TK E++I+K  + +    FSKE IF++VWG D D     V + I  ++KKI
  S:   135 NITIDLLANEVFCKGKKLPLTKKEYEIVKLLMLNKKVVFSKERIFERVWGIDSDSQLDTVTESIKNIRKKI 205
>gi|153852940|ref|ZP_01994377.1| hypothetical protein DORLON_00362 [Dorea longicatena DSM 13814] >gi|149754582|gb|EDM64513.1| hypothetical protein DORLON_00362 [Dorea longicatena DSM 13814] (235 aa)
Score = 133, Expect = 2.4e-06, Identities = 24/64 (37%), Positives = 43/64 (67%)
  Q:   157 KVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDD-DPTGLVIQYIYKLKKKIGKD 220
           +VW +G+E+++   EF++L F  ++PN  FSKE +F+K+WG+D       V  +I +L++K+  D
  S:   152 RVWKAGEEVKLPHREFELLVFLAKNPNIVFSKEALFEKIWGFDYVSDAATVSVHINRLREKLEDD 216
>gi|89896612|ref|YP_520099.1| hypothetical protein DSY3866 [Desulfitobacterium hafniense Y51] >gi|89336060|dbj|BAE85655.1| hypothetical protein [Desulfitobacterium hafniense Y51] (228 aa)
Score = 133, Expect = 2.4e-06, Identities = 31/72 (43%), Positives = 45/72 (62%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWG---YDDDPTGLVIQYIYKLKKKIGKD 220
           L +N    KV  +G+E++ T  E+++L FF  +PN  FSKE IF  +WG   Y D  T  V  +I K++KKI +D
  S:   137 LEINTASHKVSVNGKEVQFTAKEYELLLFFASNPNILFSKERIFDLLWGAEYYGDLAT--VPVHIQKIRKKIERD 209
>gi|167617621|ref|ZP_02386252.1| DNA-binding response regulator [Burkholderia thailandensis Bt4] (225 aa)
Score = 133, Expect = 2.4e-06, Identities = 26/69 (37%), Positives = 44/69 (63%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKKI 217
           L+++LI RKV+  G EI +   E+ +L+F + H     ++  +F+ VWGY  DP T L+  ++ +L+KKI
  S:   136 LTLDLISRKVYRDGAEIALLPTEYRVLEFMMRHAGQTITRMMLFEAVWGYHFDPGTNLIDVHMGRLRKKI 205
>gi|167579523|ref|ZP_02372397.1| DNA-binding response regulator [Burkholderia thailandensis TXDOH] (225 aa)
Score = 133, Expect = 2.4e-06, Identities = 26/69 (37%), Positives = 44/69 (63%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKKI 217
           L+++LI RKV+  G EI +   E+ +L+F + H     ++  +F+ VWGY  DP T L+  ++ +L+KKI
  S:   136 LTLDLISRKVYRDGAEIALLPTEYRVLEFMMRHAGQTITRMMLFEAVWGYHFDPGTNLIDVHMGRLRKKI 205
>gi|83719535|ref|YP_440832.1| DNA-binding response regulator [Burkholderia thailandensis E264] >gi|83653360|gb|ABC37423.1| DNA-binding response regulator [Burkholderia thailandensis E264] (272 aa)
Score = 133, Expect = 2.4e-06, Identities = 26/69 (37%), Positives = 44/69 (63%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKKI 217
           L+++LI RKV+  G EI +   E+ +L+F + H     ++  +F+ VWGY  DP T L+  ++ +L+KKI
  S:   183 LTLDLISRKVYRDGAEIALLPTEYRVLEFMMRHAGQTITRMMLFEAVWGYHFDPGTNLIDVHMGRLRKKI 252
>gi|157150145|ref|YP_001450361.1| transcriptional regulatory protein CiaR [Streptococcus gordonii str. Challis substr. CH1] >gi|157074939|gb|ABV09622.1| Transcriptional regulatory protein CiaR [Streptococcus gordonii str. Challis substr. CH1] (224 aa)
Score = 133, Expect = 2.4e-06, Identities = 25/70 (35%), Positives = 47/70 (67%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKI 217
           ++++NL       +G+E+E+   EFD+L +FL++ N    K +IF ++WG+D D T  V++ Y+ K++KK+
  S:   131 DVTVNLSTNTTLVNGKEVELLGKEFDLLVYFLQNQNVILPKTQIFDRLWGFDSDTTISVVEVYVSKIRKKL 201
>gi|42784424|ref|NP_981671.1| DNA-binding response regulator [Bacillus cereus ATCC 10987] >gi|42740356|gb|AAS44279.1| DNA-binding response regulator [Bacillus cereus ATCC 10987] (223 aa)
Score = 133, Expect = 2.4e-06, Identities = 29/80 (36%), Positives = 48/80 (60%)
  Q:   155 DRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDD-DPTGLVIQYIYKLKKKIGKDNIVSSTYNGYCFKL 234
           +RKV  SGQEI++T  EF++ + F+ +P   F ++E+ +KVWG++    T  V   + +L+KK+G       T  G  +KL
  S:   141 ERKVHVSGQEIQLTYREFNLCQLFVSNPQRVFMRDELLEKVWGFEYIGNTRAVDIMVQRLRKKLGNSGEYIKTIYGVGYKL 221
>gi|158312167|ref|YP_001504675.1| two component transcriptional regulator [Frankia sp. EAN1pec] >gi|158107572|gb|ABW09769.1| two component transcriptional regulator, winged helix family [Frankia sp. EAN1pec] (243 aa)
Score = 133, Expect = 2.4e-06, Identities = 23/78 (29%), Positives = 49/78 (62%)
  Q:   140 NNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQYIYKLKKKI 217
           N  +I+G+ +S++L  R+V  +G+ +++T  E+++L F   HP   FS+EE+ ++VWG        V +++ +++ K+
  S:   145 NEPLIYGD-VSIDLRAREVAVAGERVDLTAREYELLAFLARHPRRVFSREELLEQVWGTRFQDPATVTEHVRRVRTKV 221
>gi|56418841|ref|YP_146159.1| lantibiotic biosynthesis protein (response regulator) [Geobacillus kaustophilus HTA426] >gi|56378683|dbj|BAD74591.1| lantibiotic biosynthesis protein (response regulator) [Geobacillus kaustophilus HTA426] (232 aa)
Score = 133, Expect = 2.5e-06, Identities = 26/70 (37%), Positives = 47/70 (67%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPT-GLVIQYIYKLKKKI 217
           N++++L+  +V+C G+++ +TK E++I+K  + +    FSKE IF++VWG D D     V + I  ++KKI
  S:   135 NITIDLLANEVFCKGKKLPLTKKEYEIVKLLMLNKKVVFSKERIFERVWGIDSDSQLDTVTESIKNIRKKI 205
>gi|118480301|ref|YP_897452.1| DNA-binding response regulator [Bacillus thuringiensis str. Al Hakam] >gi|118419526|gb|ABK87945.1| DNA-binding response regulator [Bacillus thuringiensis str. Al Hakam] (241 aa)
Score = 133, Expect = 2.6e-06, Identities = 29/80 (36%), Positives = 48/80 (60%)
  Q:   155 DRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDD-DPTGLVIQYIYKLKKKIGKDNIVSSTYNGYCFKL 234
           +RKV  SGQEI++T  EF++ + F+ +P   F ++E+ +KVWG++    T  V   + +L+KK+G       T  G  +KL
  S:   159 ERKVHVSGQEIQLTYREFNLCQLFVSNPQRVFMRDELLEKVWGFEYIGNTRAVDIMVQRLRKKLGNSGEYIKTIYGVGYKL 239
>gi|47569367|ref|ZP_00240050.1| DNA-binding response regulator VicR [Bacillus cereus G9241] >gi|47553955|gb|EAL12323.1| DNA-binding response regulator VicR [Bacillus cereus G9241] (223 aa)
Score = 133, Expect = 2.6e-06, Identities = 29/80 (36%), Positives = 48/80 (60%)
  Q:   155 DRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDD-DPTGLVIQYIYKLKKKIGKDNIVSSTYNGYCFKL 234
           +RKV  SGQEI++T  EF++ + F+ +P   F ++E+ +KVWG++    T  V   + +L+KK+G       T  G  +KL
  S:   141 ERKVHVSGQEIQLTYREFNLCQLFVSNPQRVFMRDELLEKVWGFEYIGNTRAVDIMVQRLRKKLGNSGEYIKTIYGVGYKL 221
>gi|166996545|ref|ZP_02263005.1| DNA-binding response regulator [Bacillus cereus AH820] >gi|196039393|ref|ZP_03106698.1| DNA-binding response regulator [Bacillus cereus NVH0597-99] >gi|196045673|ref|ZP_03112903.1| DNA-binding response regulator [Bacillus cereus 03BB108] >gi|196023504|gb|EDX62181.1| DNA-binding response regulator [Bacillus cereus 03BB108] >gi|196029553|gb|EDX68155.1| DNA-binding response regulator [Bacillus cereus NVH0597-99] (223 aa)
Score = 133, Expect = 2.7e-06, Identities = 29/80 (36%), Positives = 48/80 (60%)
  Q:   155 DRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDD-DPTGLVIQYIYKLKKKIGKDNIVSSTYNGYCFKL 234
           +RKV  SGQEI++T  EF++ + F+ +P   F ++E+ +KVWG++    T  V   + +L+KK+G       T  G  +KL
  S:   141 ERKVHVSGQEIQLTYREFNLCQLFVSNPQRVFMRDELLEKVWGFEYIGNTRAVDIMVQRLRKKLGNSGEYIKTIYGVGYKL 221
>gi|169187917|ref|ZP_02848075.1| two component transcriptional regulator, winged helix family [Paenibacillus sp. JDR-2] >gi|169005333|gb|EDS52186.1| two component transcriptional regulator, winged helix family [Paenibacillus sp. JDR-2] (230 aa)
Score = 133, Expect = 2.9e-06, Identities = 31/96 (32%), Positives = 59/96 (61%)
  Q:   140 NNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKI--GKDNIVSSTYNGYCFKLR 235
           +N I++ ++L+++L  R+   SG+ IE+T  E+D+L  F+++P    +++ I +K+WGYD      V++ YI  L++K+  G    +  T  G  + LR
  S:   130 SNKIVF-DDLALDLDSREAIRSGRRIELTAKEYDLLLLFMQNPRRVLTRDAIMEKIWGYDFSGESNVLEVYIAMLRQKLEEGGAKRIIQTVRGTGYVLR 227
>gi|50843487|ref|YP_056714.1| putative two-component system response regulator [Propionibacterium acnes KPA171202] >gi|50841089|gb|AAT83756.1| putative two-component system response regulator [Propionibacterium acnes KPA171202] (243 aa)
Score = 132, Expect = 2.9e-06, Identities = 26/72 (36%), Positives = 46/72 (63%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGK 219
           +L+++   R+V  +G+EI +T  EF++L++F+ +P    SK +I  +VW YD      V++ YI  L+KKI +
  S:   151 DLTLDENSREVRRAGEEIHLTTTEFELLRYFMRNPKRVLSKAQILDRVWNYDFRGQANVVELYISYLRKKIDR 223
>gi|52140301|ref|YP_086529.1| DNA-binding response regulator [Bacillus cereus E33L] >gi|51973770|gb|AAU15320.1| DNA-binding response regulator [Bacillus cereus E33L] (223 aa)
Score = 132, Expect = 3.0e-06, Identities = 29/80 (36%), Positives = 48/80 (60%)
  Q:   155 DRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDD-DPTGLVIQYIYKLKKKIGKDNIVSSTYNGYCFKL 234
           +RKV  SGQEI++T  EF++ + F+ +P   F ++E+ +KVWG++    T  V   + +L+KK+G       T  G  +KL
  S:   141 ERKVHVSGQEIQLTYREFNLCQLFVSNPQRVFMRDELLEKVWGFEYIGNTRAVDIMVQRLRKKLGNSGEYIKTIYGVGYKL 221
>gi|169186281|ref|ZP_02846442.1| two component transcriptional regulator, winged helix family [Paenibacillus sp. JDR-2] >gi|169006250|gb|EDS53100.1| two component transcriptional regulator, winged helix family [Paenibacillus sp. JDR-2] (232 aa)
Score = 132, Expect = 3.1e-06, Identities = 27/74 (36%), Positives = 47/74 (63%)
  Q:   147 NNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD----DDPTGLVIQYIYKLKKKIGKD 220
           N + +    R+V+ + +E+  T  E+D+L + + HPN  F KE++F+++WG D    D  T  V  +I KL++KI +D
  S:   138 NGIRIEKQSRRVFVNEREVSFTAKEYDLLFYLVTHPNRVFRKEDLFEQIWGMDAIGSDHAT--VTVHISKLREKIERD 213
>gi|114797880|ref|YP_760030.1| DNA-binding response regulator [Hyphomonas neptunium ATCC 15444] >gi|114738054|gb|ABI76179.1| DNA-binding response regulator [Hyphomonas neptunium ATCC 15444] (235 aa)
Score = 132, Expect = 3.1e-06, Identities = 25/78 (32%), Positives = 49/78 (62%)
  Q:   143 IIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKKIGKD 220
           ++   +L MNL+ RKV  +G++I++   EF +L++ + H     ++  + +KVW Y+ DP T ++  +I +L+ KI K+
  S:   137 VLKAGDLEMNLLTRKVTRAGKKIDLQPREFRLLEYLMRHAGQVVTRTMLLEKVWDYNFDPQTNVIDVHISRLRAKIDKE 215
>gi|196036337|ref|ZP_03103735.1| DNA-binding response regulator [Bacillus cereus W] >gi|195991129|gb|EDX55099.1| DNA-binding response regulator [Bacillus cereus W] (223 aa)
Score = 132, Expect = 3.1e-06, Identities = 29/80 (36%), Positives = 48/80 (60%)
  Q:   155 DRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDD-DPTGLVIQYIYKLKKKIGKDNIVSSTYNGYCFKL 234
           +RKV  SGQEI++T  EF++ + F+ +P   F ++E+ +KVWG++    T  V   + +L+KK+G       T  G  +KL
  S:   141 ERKVHVSGQEIQLTYREFNLCQLFVSNPQRVFMRDELLEKVWGFEYIGNTRAVDIMVQRLRKKLGTSGEYIKTIYGVGYKL 221
>gi|49480400|ref|YP_039253.1| DNA-binding response regulator [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|49331956|gb|AAT62602.1| DNA-binding response regulator [Bacillus thuringiensis serovar konkukian str. 97-27] (223 aa)
Score = 132, Expect = 3.1e-06, Identities = 29/80 (36%), Positives = 48/80 (60%)
  Q:   155 DRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDD-DPTGLVIQYIYKLKKKIGKDNIVSSTYNGYCFKL 234
           +RKV  SGQEI++T  EF++ + F+ +P   F ++E+ +KVWG++    T  V   + +L+KK+G       T  G  +KL
  S:   141 ERKVHVSGQEIQLTYREFNLCQLFVSNPQRVFMRDELLEKVWGFEYIGNTRAVDIMVQRLRKKLGDSGEYIKTIYGVGYKL 221
>gi|170702575|ref|ZP_02893449.1| two component transcriptional regulator, winged helix family [Burkholderia ambifaria IOP40-10] >gi|170132509|gb|EDT00963.1| two component transcriptional regulator, winged helix family [Burkholderia ambifaria IOP40-10] (232 aa)
Score = 132, Expect = 3.1e-06, Identities = 27/69 (39%), Positives = 43/69 (62%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKKI 217
           LS++LI RKV   G EI +   EF +L+F + H     ++  +F+ VWGY  DP T L+  ++ +L+KK+
  S:   143 LSLDLITRKVHRDGTEIALLPTEFRVLEFMMRHAGQTITRTMLFEAVWGYHFDPGTNLIDVHMGRLRKKL 212
>gi|81096729|ref|ZP_00875062.1| Response regulator receiver:Transcriptional regulatory protein, C-terminal [Streptococcus suis 89/1591] >gi|146318749|ref|YP_001198461.1| response regulator [Streptococcus suis 05ZYH33] >gi|146320952|ref|YP_001200663.1| response regulator [Streptococcus suis 98HAH33] >gi|80977204|gb|EAP40754.1| Response regulator receiver:Transcriptional regulatory protein, C-terminal [Streptococcus suis 89/1591] >gi|145689555|gb|ABP90061.1| Response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Streptococcus suis 05ZYH33] >gi|145691758|gb|ABP92263.1| Response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Streptococcus suis 98HAH33] (224 aa)
Score = 132, Expect = 3.1e-06, Identities = 32/111 (28%), Positives = 62/111 (55%)
  Q:   107 GFEFCVSLDFFTPSLFFQTL-LNIFHKVEVINLMNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKI 217
           GFE     D+ T   + + L + I   ++     N   +   +++++L       +G+E+E+   EFD+L +FL++ N    K +IF ++WG+D D T  V++ Y+ K++KK+
  S:    91 GFELGAD-DYLTKPFYLEELKMRIQALLKRAGKFNENTLTFGDVTVDLSTNMTMVNGEEVELLGKEFDLLVYFLQNQNVILPKTQIFDRIWGFDSDTTISVVEVYVSKIRKKL 202
>gi|125623601|ref|YP_001032084.1| two-component system regulator llrF [Lactococcus lactis subsp. cremoris MG1363] >gi|4104695|gb|AAD02113.1| putative response regulator; RrF [Lactococcus lactis] >gi|124492409|emb|CAL97351.1| two-component system regulator llrF [Lactococcus lactis subsp. cremoris MG1363] (222 aa)
Score = 132, Expect = 3.2e-06, Identities = 24/78 (30%), Positives = 48/78 (61%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGKDNIVSS 225
           N+ +NL ++      Q +++   EFD++ + +++ N    KE+IF ++WGYD D T  V++ Y+ K++KK+     V++
  S:   132 NIRLNLSNKSTLVDDQPVDLIGKEFDLVVYLMQNQNVILPKEQIFDRIWGYDSDTTVTVVEVYMSKIRKKLKDTEFVNN 210
>gi|15673657|ref|NP_267831.1| two-component system regulator [Lactococcus lactis subsp. lactis Il1403] >gi|12724689|gb|AAK05773.1|AE006398_4 two-component system regulator [Lactococcus lactis subsp. lactis Il1403] (225 aa)
Score = 132, Expect = 3.2e-06, Identities = 24/78 (30%), Positives = 48/78 (61%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGKDNIVSS 225
           N+ +NL ++      Q +++   EFD++ + +++ N    KE+IF ++WGYD D T  V++ Y+ K++KK+     V++
  S:   135 NIRLNLSNKSTLVDDQPVDLIGKEFDLVVYLMQNQNVILPKEQIFDRIWGYDSDTTVTVVEVYMSKIRKKLKDTEFVNN 213
>gi|116512538|ref|YP_811445.1| DNA-binding response regulator [Lactococcus lactis subsp. cremoris SK11] >gi|116108192|gb|ABJ73332.1| DNA-binding response regulator, OmpR family (Rec-wHTH domains) [Lactococcus lactis subsp. cremoris SK11] (225 aa)
Score = 132, Expect = 3.2e-06, Identities = 24/78 (30%), Positives = 48/78 (61%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGKDNIVSS 225
           N+ +NL ++      Q +++   EFD++ + +++ N    KE+IF ++WGYD D T  V++ Y+ K++KK+     V++
  S:   135 NIRLNLSNKSTLVDDQPVDLIGKEFDLVVYLMQNQNVILPKEQIFDRIWGYDSDTTVTVVEVYMSKIRKKLKDTEFVNN 213
>gi|125717796|ref|YP_001034929.1| two-component response transcriptional regulator [Streptococcus sanguinis SK36] >gi|125497713|gb|ABN44379.1| Two-component response transcriptional regulator (CheY-like receiver domain and a winged-helix DNA-binding domains), putative [Streptococcus sanguinis SK36] (224 aa)
Score = 132, Expect = 3.2e-06, Identities = 32/111 (28%), Positives = 62/111 (55%)
  Q:   107 GFEFCVSLDFFTPSLFFQTL-LNIFHKVEVINLMNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKI 217
           GFE     D+ T   + + L + I   ++     N   +   ++++NL       +G+++E+   EFD+L +FL++ N    K +IF ++WG+D D T  V++ Y+ K++KK+
  S:    90 GFELGAD-DYLTKPFYLEELKMRIQALLKRAGKFNENTLSYGDVTVNLSTNSTTKAGKDVELLGKEFDLLVYFLQNQNVILPKTQIFDRLWGFDSDTTVSVVEVYVSKIRKKL 201
>gi|42524753|ref|NP_970133.1| two component response regulator [Bdellovibrio bacteriovorus HD100] >gi|39576963|emb|CAE78192.1| two component response regulator [Bdellovibrio bacteriovorus HD100] (224 aa)
Score = 132, Expect = 3.3e-06, Identities = 26/73 (35%), Positives = 47/73 (64%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKKIGKD 220
           +L +N ++R V  +G+++++ + EF +L  F+ +PN    K+ I K+VW YD DP T +V   + +L+ K+ KD
  S:   132 DLKLNRLNRDVVRAGRKLDLQEREFVLLDLFMSNPNKIIGKQTILKEVWNYDFDPQTNVVDVLVCRLRNKLEKD 205
>gi|162147357|ref|YP_001601818.1| putative transcriptional regulatory protein kdpE [Gluconacetobacter diazotrophicus PAl 5] >gi|161785934|emb|CAP55510.1| putative transcriptional regulatory protein kdpE [Gluconacetobacter diazotrophicus PAl 5] (228 aa)
Score = 132, Expect = 3.4e-06, Identities = 51/195 (26%), Positives = 94/195 (48%)
  Q:    42 RVMLKPNEIDYLTTVHAS---VVIFDNIPSDQIDEAMVKKIKLISPITHFVYFCENYDEDTFLSVLQKGFEFCVSLDFFTPSLFFQTLLNIFHKVEVINLMNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQYIYKLKKKIGKD-----NIVSSTYNGYCFKLRE 236
           RV+   N I  L  V A    VV+ D    D     ++++I+L+ P    V      DE   ++ L  G +  V+  F    L  +    + H ++    +   +    +LS++L+ R V  SG+E+ ++  E+DIL+  + H     + + I  ++WG + D   L + YI +L++K+  +     +I++ T  GY   L E
  S:    29 RVIEAGNGISALAAVKAEEIDVVLLDLGLPDMDGIEVIRQIRLVLPTLPIVVLSVRDDERGKVAALDLGADDYVTKPFGMAELVARLRAALRHALQKEGTIPLYV--SGDLSVDLVRRIVTRSGEEVHLSPREWDILRLLIRHAGRVLTHKHILGQLWGANGDVQQLRV-YIRQLRQKLEINPERPRHIITETGIGYRLTLVE 228
>gi|168162366|ref|ZP_02597599.1| DNA-binding response regulator [Bacillus cereus H3081.97] (223 aa)
Score = 132, Expect = 3.4e-06, Identities = 28/80 (35%), Positives = 48/80 (60%)
  Q:   155 DRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDD-DPTGLVIQYIYKLKKKIGKDNIVSSTYNGYCFKL 234
           +RKV  SGQE+++T  EF++ + F+ +P   F ++E+ +KVWG++    T  V   + +L+KK+G       T  G  +KL
  S:   141 ERKVHVSGQEVQLTYREFNLCQLFVSNPQRVFMRDELLEKVWGFEYIGNTRAVDIMVQRLRKKLGSSGEYIKTIYGVGYKL 221
>gi|88855767|ref|ZP_01130430.1| transcriptional regulator, GlnR family protein [marine actinobacterium PHSC20C1] >gi|88815091|gb|EAR24950.1| transcriptional regulator, GlnR family protein [marine actinobacterium PHSC20C1] (246 aa)
Score = 132, Expect = 3.4e-06, Identities = 26/78 (33%), Positives = 50/78 (64%)
  Q:   163 QEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDD-DPTGLVIQYIYKLKKKIGK-DNIVSSTYN-GYCFKLRESFRK 240
           + +++T  EF++L+F   HP+  F++E++  +VWGYD    T  V  ++ +L+ K+G  ++++ +  N GYCF + E   K
  S:   142 RSLDLTFKEFELLRFLASHPSHVFTREQLLSEVWGYDYFGGTRTVDVHVRRLRAKLGDLESLIGTVRNVGYCFNIAEEAEK 222
>gi|146311032|ref|YP_001176106.1| two component transcriptional regulator [Enterobacter sp. 638] >gi|145317908|gb|ABP60055.1| two component transcriptional regulator, winged helix family [Enterobacter sp. 638] (238 aa)
Score = 132, Expect = 3.5e-06, Identities = 29/92 (31%), Positives = 54/92 (58%)
  Q:   129 IFHKVEVINL-MNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGKD 220
           +F + + + L   N  I+ + L+++ + R V  +G+E+ +T  EF++L FF  HP   FS+  + ++VWGY  +     +  +I +L+ KI KD
  S:   119 LFRRQQAMGLAQTNGQIYAHGLALDPLLRSVQLNGKEVVLTPREFELLYFFARHPGEVFSRLALLEQVWGYQHEGYEHTVNTHINRLRIKIEKD 212
>gi|62425309|ref|ZP_00380444.1| COG0745: Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Brevibacterium linens BL2] (219 aa)
Score = 132, Expect = 3.5e-06, Identities = 24/83 (28%), Positives = 49/83 (59%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGKDNIVSSTYNGY 230
           ++ ++L+ R+VW + + I+++  E  + +  L++     S+E++   VWG+D DP   V+  Y+  L+KK+G D + +    GY
  S:   133 DVRIDLLKRQVWVADKIIDLSARELSLAEILLQNRGNVLSREQLLSHVWGFDFDPGSNVVDVYVGYLRKKLGSDFVTTVRGFGY 216
>gi|15614507|ref|NP_242810.1| two-component response regulator [Bacillus halodurans C-125] >gi|10174562|dbj|BAB05663.1| two-component response regulator [Bacillus halodurans C-125] (229 aa)
Score = 132, Expect = 3.5e-06, Identities = 32/88 (36%), Positives = 51/88 (57%)
  Q:   147 NNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGL--VIQYIYKLKKKIG-KDNIVSSTYN-GYCFKL 234
           N L +    RKV+ +GQEI +TK E+D+L F LEH    F++E +  ++WG D     L  V  +I  L+ K+   D  + + +  GY F++
  S:   136 NELRIQPSGRKVFVNGQEISLTKKEYDLLVFLLEHRGRVFTREHLHDRLWGMDTQQGTLRTVDTHIKTLRLKLKPADRFIKTVWGVGYKFEV 227
>gi|166984665|ref|ZP_02255998.1| DNA-binding response regulator [Bacillus cereus AH187] (223 aa)
Score = 132, Expect = 3.6e-06, Identities = 28/80 (35%), Positives = 48/80 (60%)
  Q:   155 DRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDD-DPTGLVIQYIYKLKKKIGKDNIVSSTYNGYCFKL 234
           +RKV  SGQE+++T  EF++ + F+ +P   F ++E+ +KVWG++    T  V   + +L+KK+G       T  G  +KL
  S:   141 ERKVHVSGQEVQLTYREFNLCQLFVSNPQRVFMRDELLEKVWGFEYIGNTRAVDIMVQRLRKKLGSSGEYIKTIYGVGYKL 221
>gi|196189979|gb|EDX84943.1| response regulator receiver domain protein [Synechococcus sp. PCC 7335] (871 aa)
Score = 132, Expect = 3.7e-06, Identities = 31/100 (31%), Positives = 59/100 (59%)
  Q:   138 LMNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPT-GLVIQYIYKLKKK---IGKDNIVSSTYNGYCFKLRES 237
           +++ V+ WG+ L ++    +V C    I +T  E+ +L+ FL +P   FS + +  KVW ++D PT   V  +I  L++K   +G  +++S+ Y G  ++LR +
  S:   117 IVSPVLQWGD-LQLDPCSSRVTCGDVPIALTPKEYALLELFLRNPERIFSLDSLLDKVWPFEDTPTVASVRTHIKGLRQKLRQVGLSDVISTVY-GLGYRLRTA 218
>gi|167746545|ref|ZP_02418672.1| hypothetical protein ANACAC_01255 [Anaerostipes caccae DSM 14662] >gi|167653505|gb|EDR97634.1| hypothetical protein ANACAC_01255 [Anaerostipes caccae DSM 14662] (228 aa)
Score = 132, Expect = 3.8e-06, Identities = 25/75 (33%), Positives = 45/75 (60%)
  Q:   143 IIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKI 217
           +I    L ++   R+V  +G+E+ +T  EFD+L+  + HPN  +S+E++   VWGYD       +  +I +L++KI
  S:   131 VIESRGLKIDCDSRRVHINGKEVNLTAKEFDLLELLVFHPNKVYSREDLLNTVWGYDYPGDARTVDVHIRRLREKI 206
>gi|154492635|ref|ZP_02032261.1| hypothetical protein PARMER_02269 [Parabacteroides merdae ATCC 43184] >gi|154086940|gb|EDN85985.1| hypothetical protein PARMER_02269 [Parabacteroides merdae ATCC 43184] (228 aa)
Score = 132, Expect = 3.8e-06, Identities = 37/85 (43%), Positives = 51/85 (60%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWG---YDDDPTGLVIQYIYKLKKKIGK--DNIVSSTYNGYCFK 233
           LS++    K    GQE+ +TK EF+ILK  LE+    FS+EEI  ++W    Y  D T  +   I +L+KKIG    NIV+    GYCF+
  S:   140 LSLDTKRIKASVDGQEVPLTKKEFEILKLLLENKGNVFSREEILSRIWKDEVYVLDRT--IDVNITRLRKKIGPYGKNIVTRLGFGYCFE 227
>gi|111220157|ref|YP_710951.1| alkaline phosphatase synthesis transcriptional regulatory protein PhoP [Frankia alni ACN14a] >gi|111147689|emb|CAJ59345.1| Alkaline phosphatase synthesis transcriptional regulatory protein phoP [Frankia alni ACN14a] (240 aa)
Score = 131, Expect = 3.8e-06, Identities = 28/75 (37%), Positives = 48/75 (64%)
  Q:   161 SGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD--DDPTGLVIQYIYKLKKKIGKDN-IVSSTYNGYCFKLR 235
           +G+ IE++  EF +L++FL +PN   S+ +I   VW YD   +PT +V QY+  L++K+G+    +  T  G+ + LR
  S:   156 AGEPIELSPTEFTLLRYFLTNPNRVLSRVQILDAVWSYDFAGEPT-VVDQYVSYLRRKLGRHGPSLIHTQRGFGYALR 232
>gi|119963894|ref|YP_948693.1| putative transcriptional regulatory protein [Arthrobacter aurescens TC1] >gi|119950753|gb|ABM09664.1| putative transcriptional regulatory protein [Arthrobacter aurescens TC1] (232 aa)
Score = 131, Expect = 3.9e-06, Identities = 29/74 (39%), Positives = 48/74 (64%)
  Q:   161 SGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD-DDPTGLVIQYIYKLKKKIGKD--NIVSSTYN-GYCFKL 234
           SGQ + +T  EF++LK+  +HP   F+++++  +VWGYD    T  V  +I +L+ K+G D  N++S+  N GY   L
  S:   144 SGQPLNLTFKEFELLKYLAQHPGRVFTRQQLLTEVWGYDYYGGTRTVDVHIRRLRAKLGVDHENLISTVRNVGYRLTL 221
>gi|86607308|ref|YP_476071.1| DNA-binding response regulator [Synechococcus sp. JA-3-3Ab] >gi|86555850|gb|ABD00808.1| DNA-binding response regulator [Synechococcus sp. JA-3-3Ab] (230 aa)
Score = 131, Expect = 3.9e-06, Identities = 28/89 (31%), Positives = 55/89 (61%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKI---GKDNIVSSTYNGYCFKLRE 236
           +L+++ + R+     +++E+T  E+D+L++ +EHP    ++++I + VWGYD      +I+ YI  L+ KI   G+  ++  T  G  + LRE
  S:   139 DLTLDPVTRQASRGERQVELTAKEYDLLRYLMEHPRQVLTRQQILEHVWGYDFTGDSNIIEVYIRYLRLKIEGPGEKRLI-QTVRGVGYVLRE 230
>gi|39937833|ref|NP_950109.1| winged helix family two component transcriptional regulator [Rhodopseudomonas palustris CGA009] >gi|167367203|ref|ZP_02301345.1| two component transcriptional regulator, winged helix family [Rhodopseudomonas palustris TIE-1] >gi|192293618|ref|YP_001994223.1| two component transcriptional regulator, winged helix family [Rhodopseudomonas palustris TIE-1] >gi|39651693|emb|CAE30215.1| two-component phosphate transcriptional regulator PhoB [Rhodopseudomonas palustris CGA009] >gi|192287367|gb|ACF03748.1| two component transcriptional regulator, winged helix family [Rhodopseudomonas palustris TIE-1] (237 aa)
Score = 131, Expect = 4.0e-06, Identities = 36/102 (35%), Positives = 60/102 (58%)
  Q:   139 MNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD---DDPTGLVIQYIYKLKK--KIGKDNIVSSTYNGYCFKLRESFRK 240
           +  V+ +G+ L ++   R+V  SG+ I++   E+ +L+FFLEHP   FS+E++   VWG D   D+ T  V  +I +L+K   IG++     T  G  + L + F K
  S:   128 LATVLAYGD-LELDRDKRRVARSGRPIDLGPTEYRLLEFFLEHPGRVFSREQLLDGVWGRDIYIDERT--VDVHIGRLRKLLNIGREQDPIRTVRGAGYALDDRFAK 231
>gi|77920671|ref|YP_358486.1| two component signal transduction response regulator [Pelobacter carbinolicus DSM 2380] >gi|77546754|gb|ABA90316.1| two component transcriptional regulator, winged helix family [Pelobacter carbinolicus DSM 2380] (223 aa)
Score = 131, Expect = 4.0e-06, Identities = 26/77 (33%), Positives = 48/77 (62%)
  Q:   144 IWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD-DDPTGLVIQYIYKLKKKIGKD 220
           I+  +L ++ +  KVW S QEI++T  E+ +L++F+ +PN   ++  I + VW Y  D  T ++  Y+  L+KK+ +D
  S:   127 IYFADLRLDPVSHKVWRSDQEIDLTAKEYALLEYFMRNPNQVLTRAMIAEHVWDYTFDSFTNIIDVYVNYLRKKVDRD 204
>gi|192808505|ref|ZP_03037181.1| response regulator receiver [Geobacillus sp. Y412MC10] >gi|192802476|gb|EDV78980.1| response regulator receiver [Geobacillus sp. Y412MC10] (231 aa)
Score = 131, Expect = 4.1e-06, Identities = 24/65 (36%), Positives = 40/65 (61%)
  Q:   156 RKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDD-PTGLVIQYIYKLKKKIGKD 220
           R+V+   QE+  T  EF++L+F   HPN  F+K E+F+++WG D       V  ++ KL++K+  D
  S:   147 RRVFVRNQEVAFTTREFNLLEFLASHPNRVFNKHELFERIWGMDSSGDIATVTVHVRKLREKMELD 212
>gi|187603988|ref|ZP_02990199.1| two component transcriptional regulator, winged helix family [Exiguobacterium sp. AT1b] >gi|187484050|gb|EDU22043.1| two component transcriptional regulator, winged helix family [Exiguobacterium sp. AT1b] (225 aa)
Score = 131, Expect = 4.1e-06, Identities = 18/51 (35%), Positives = 39/51 (76%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD 199
           L++++   +V+C G+++++T+ EFD+L FFLE+P    +++++ + VWG+D
  S:   137 LTVDVNRHEVYCDGKKVDLTRREFDLLVFFLENPERVLTRDQLVEHVWGFD 187
>gi|163847991|ref|YP_001636035.1| response regulator receiver [Chloroflexus aurantiacus J-10-fl] >gi|187599544|ref|ZP_02985778.1| two component transcriptional regulator, winged helix family [Chloroflexus sp. Y-400-fl] >gi|163669280|gb|ABY35646.1| response regulator receiver [Chloroflexus aurantiacus J-10-fl] >gi|187488976|gb|EDU26943.1| two component transcriptional regulator, winged helix family [Chloroflexus sp. Y-400-fl] (238 aa)
Score = 131, Expect = 4.2e-06, Identities = 26/85 (30%), Positives = 54/85 (63%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDD-DPTGLVIQYIYKLKKKIG--KDNIVSSTYN-GYCFK 233
           L+++   R+V  +G+++E+T  EF +L+ F+ HP   F++E +  +VWG+     + +V  ++  L++KIG  +  ++ + Y  GYC +
  S:   142 LTLDTETREVTLNGRQLELTPTEFALLELFMRHPRRVFTRETLLSRVWGFTYVGDSNIVEVHMSNLREKIGDHERKLIRTIYGVGYCLR 230
>gi|22538189|ref|NP_689040.1| DNA-binding response regulator [Streptococcus agalactiae 2603V/R] >gi|25012047|ref|NP_736442.1| DNA-binding response regulator [Streptococcus agalactiae NEM316] >gi|76797838|ref|ZP_00780102.1| putative two-component response regulator [Streptococcus agalactiae 18RS21] >gi|77412950|ref|ZP_00789153.1| DNA-binding response regulator [Streptococcus agalactiae 515] >gi|22535099|gb|AAN00913.1|AE014284_8 DNA-binding response regulator [Streptococcus agalactiae 2603V/R] >gi|24413590|emb|CAD47668.1| gbs2009 [Streptococcus agalactiae NEM316] >gi|76586798|gb|EAO63292.1| putative two-component response regulator [Streptococcus agalactiae 18RS21] >gi|77160962|gb|EAO72070.1| DNA-binding response regulator [Streptococcus agalactiae 515] (228 aa)
Score = 131, Expect = 4.3e-06, Identities = 35/118 (29%), Positives = 61/118 (51%)
  Q:   117 FTPSLFFQTLLNIFHKVEVINLMNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQYIYKLKKKIGK--DNIVSSTYNGYCFKL 234
           F+P      +  +F +++   + N+      +L+++   R    S +E+ +TK EFD L   +E P T FS+E +  ++WG+DD  +  V   I +L+KK  +    +   T  GY FKL
  S:   104 FSPIKLSLHVKALFKRLDEKAIKNDTQYQFLDLTLDTEKRIALLSNEEMPLTKTEFDFLLVLIEKPETAFSRETLLNRIWGFDDIESRAVDDTIKRLRKKFKQYHSQVSIKTVWGYGFKL 223
>gi|76788079|ref|YP_330584.1| DNA-binding response regulator [Streptococcus agalactiae A909] >gi|77406151|ref|ZP_00783223.1| DNA-binding response regulator [Streptococcus agalactiae H36B] >gi|77412206|ref|ZP_00788526.1| DNA-binding response regulator [Streptococcus agalactiae CJB111] >gi|76563136|gb|ABA45720.1| DNA-binding response regulator [Streptococcus agalactiae A909] >gi|77161747|gb|EAO72738.1| DNA-binding response regulator [Streptococcus agalactiae CJB111] >gi|77175231|gb|EAO78028.1| DNA-binding response regulator [Streptococcus agalactiae H36B] (228 aa)
Score = 131, Expect = 4.4e-06, Identities = 35/118 (29%), Positives = 61/118 (51%)
  Q:   117 FTPSLFFQTLLNIFHKVEVINLMNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQYIYKLKKKIGK--DNIVSSTYNGYCFKL 234
           F+P      +  +F +++   + N+      +L+++   R    S +E+ +TK EFD L   +E P T FS+E +  ++WG+DD  +  V   I +L+KK  +    +   T  GY FKL
  S:   104 FSPIKLSLHVKALFKRLDEKAIKNDTQYQFLDLTLDTEKRIALLSNEEMPLTKTEFDFLLVLIEKPETAFSRETLLNRIWGFDDIESRAVDDTIKRLRKKFKQYHSQVSIKTVWGYGFKL 223
>gi|15644015|ref|NP_229064.1| phosphate regulon transcriptional regulatory protein PhoB [Thermotoga maritima MSB8] >gi|4981814|gb|AAD36333.1|AE001781_4 phosphate regulon transcriptional regulatory protein PhoB [Thermotoga maritima MSB8] (229 aa)
Score = 131, Expect = 4.5e-06, Identities = 29/74 (39%), Positives = 41/74 (55%)
  Q:   162 GQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQYIYKLKKKIGKDNIVSSTYNGYCFKLR 235
           G+ +E+T  EF++LK     PN  FS+EEI  +VWG D     +V  +I  ++ KIGK  I +    GY F  R
  S:   149 GKNVEMTAKEFELLKLLATTPNKVFSREEILNRVWGDDYVSDRVVDVHISAIRSKIGKGWIKTVRGLGYKFSTR 222
>gi|23098039|ref|NP_691505.1| two-component response regulator [Oceanobacillus iheyensis HTE831] >gi|22776264|dbj|BAC12540.1| two-component response regulator [Oceanobacillus iheyensis HTE831] (227 aa)
Score = 131, Expect = 4.5e-06, Identities = 30/82 (36%), Positives = 50/82 (60%)
  Q:   155 DRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVI-QYIYKLKKKIGKDNIVSSTYNGYCFKLRE 236
           +R+V+  G+E E T  E+D+L    E+PN  FS+EE+  K+WG D   +   +   I +++KK+G  NI   T  G+ ++LR+
  S:   144 ERRVFFEGEEFETTTKEYDMLLLLAENPNRAFSREELLMKIWGNDYFGSDRAVDDLIKRIRKKMG--NIPLETVWGFGYRLRK 224
>gi|196239418|ref|ZP_03138190.1| two component transcriptional regulator, winged helix family [Cyanothece sp. PCC 7425] >gi|196216232|gb|EDY10879.1| two component transcriptional regulator, winged helix family [Cyanothece sp. PCC 7425] (224 aa)
Score = 131, Expect = 4.6e-06, Identities = 32/94 (34%), Positives = 57/94 (60%)
  Q:   143 IIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKI---GKDNIVSSTYNGYCFKLRE 236
           I+   +LS+N   R+V    + IE+T  EFD+L++ L +P   +++++I +KVWGYD      +I+ Y+  L+ K+   G+  ++  T  G  + LRE
  S:   128 ILQFEDLSLNRRTREVRRGQRSIELTAKEFDLLEYLLSNPRQVYTRDQILEKVWGYDFMGDSNIIEVYVRYLRLKLEEQGEKRLI-HTVRGVGYALRE 224
>gi|148270636|ref|YP_001245096.1| two component transcriptional regulator [Thermotoga petrophila RKU-1] >gi|170289342|ref|YP_001739580.1| two component transcriptional regulator [Thermotoga sp. RQ2] >gi|147736180|gb|ABQ47520.1| two component transcriptional regulator, winged helix family [Thermotoga petrophila RKU-1] >gi|170176845|gb|ACB09897.1| two component transcriptional regulator, winged helix family [Thermotoga sp. RQ2] (226 aa)
Score = 131, Expect = 4.8e-06, Identities = 29/74 (39%), Positives = 41/74 (55%)
  Q:   162 GQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQYIYKLKKKIGKDNIVSSTYNGYCFKLR 235
           G+ +E+T  EF++LK     PN  FS+EEI  +VWG D     +V  +I  ++ KIGK  I +    GY F  R
  S:   146 GKNVEMTAKEFELLKLLATTPNKVFSREEILNRVWGDDYVSDRVVDVHISAIRSKIGKGWIKTVRGLGYKFSTR 219
>gi|145221065|ref|YP_001131743.1| two component transcriptional regulator [Mycobacterium gilvum PYR-GCK] >gi|145213551|gb|ABP42955.1| two component transcriptional regulator, winged helix family [Mycobacterium gilvum PYR-GCK] (248 aa)
Score = 131, Expect = 4.8e-06, Identities = 29/89 (32%), Positives = 53/89 (59%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD-DDPTGLVIQYIYKLKKKIGKDNI--VSSTYNGYCFKLRE 236
           +L+++   R V+ +G+ +E+TK EFD+L    E+     S++ + + VWGYD D  T +   ++  L++K+ +D +  V  T  G  + LRE
  S:   155 SLTIDTARRLVFVAGERVELTKREFDLLAALAENAGVVLSRQRLLELVWGYDFDVDTNVADVFVSYLRRKLERDGLPRVIHTVRGIGYVLRE 246
>gi|154499764|ref|ZP_02037802.1| hypothetical protein BACCAP_03421 [Bacteroides capillosus ATCC 29799] >gi|150271362|gb|EDM98619.1| hypothetical protein BACCAP_03421 [Bacteroides capillosus ATCC 29799] (143 aa)
Score = 130, Expect = 5.1e-06, Identities = 30/80 (37%), Positives = 45/80 (56%)
  Q:   156 RKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWG--YDDDPTGLVIQYIYKLKKKIGKDNIVSSTYNGYCFKLR 235
           R+VW +GQ +E+T  EFDIL      P   FS  +I++ V    YD   TG +   +YKL++K+G   I +   +GY F  +
  S:    63 RQVWQTGQTVELTPMEFDILLLLARRPGQVFSARQIYEAVAADTYDASWTG-ISSMVYKLRRKLGAGIIETVRGHGYRFTTK 143
>gi|42521858|ref|NP_967238.1| two-component response regulator [Bdellovibrio bacteriovorus HD100] >gi|39574388|emb|CAE77892.1| two-component response regulator [Bdellovibrio bacteriovorus HD100] (251 aa)
Score = 130, Expect = 5.1e-06, Identities = 31/89 (34%), Positives = 51/89 (57%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQYIYKLKKKIGKDN--IVSSTYNGYCFKLRE 236
           N+ MNL+ R+V+  G+E+ +T  +FDILK  +   N   ++E+   ++WG  +  +  V   I  LK+KI K N  IV+    GY  + +E
  S:   161 NMKMNLLSRQVFVDGEEVNLTPKQFDILKLLVAGKNNLVTREKCLSEIWGDTEVTSRNVDSQINYLKRKIHKFNGRIVAVPSLGYRLEAQE 251
>gi|154174037|ref|YP_001408153.1| DNA-binding response regulator [Campylobacter curvus 525.92] >gi|112802824|gb|EAU00168.1| DNA-binding response regulator [Campylobacter curvus 525.92] (220 aa)
Score = 130, Expect = 5.2e-06, Identities = 24/68 (35%), Positives = 47/68 (69%)
  Q:   165 IEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGKDNIVSSTYNGYCF 232
           + I+  E ++L  FL++ N   SK+ IF++VWG+D++P+   ++ YI  L++ +GKD+I++   +GY +
  S:   151 VSISGKESELLTLFLQNKNKLLSKQTIFERVWGFDEEPSEQSLRVYIKNLRQILGKDSIINKRGDGYIY 219
>gi|126652912|ref|ZP_01725055.1| hypothetical protein BB14905_20830 [Bacillus sp. B14905] >gi|126590332|gb|EAZ84453.1| hypothetical protein BB14905_20830 [Bacillus sp. B14905] (229 aa)
Score = 130, Expect = 5.3e-06, Identities = 30/89 (33%), Positives = 55/89 (61%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD-DDPTGLVIQYIYKLKKKIGKDNI--VSSTYNGYCFKLRES 237
           LS+N   R+V   G+EI++T  E+D+L + ++HP    ++E+I + VWG+D    T +V  YI  +++K+   N+  +  T  G  + L+E+
  S:   136 LSINEQTREVIYYGKEIQLTPREYDLLLYLMKHPKQVLTREQILETVWGFDYYGDTNVVDVYIRYVRQKLEIANVTPIIQTVRGVGYVLKEN 227
>gi|118470690|ref|YP_884659.1| two component response transcriptional regulatory protein prra [Mycobacterium smegmatis str. MC2 155] >gi|118171977|gb|ABK72873.1| two component response transcriptional regulatory protein prra [Mycobacterium smegmatis str. MC2 155] (246 aa)
Score = 130, Expect = 5.4e-06, Identities = 29/88 (32%), Positives = 52/88 (59%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD-DDPTGLVIQYIYKLKKKIGKDNI--VSSTYNGYCFKLRE 236
           ++++   R V+ SG+ +++TK EFD+L    E+     S++ + + VWGYD D  T +   +I  L++K+ +D +  V  T  G  + LRE
  S:   154 VTIDTARRLVFVSGERVDLTKREFDLLAVLAENAGVVLSRQRLLELVWGYDFDVDTNVADVFISYLRRKLERDGVPRVIHTVRGIGYVLRE 244
>gi|169187647|ref|ZP_02847806.1| two component transcriptional regulator, winged helix family [Paenibacillus sp. JDR-2] >gi|169005656|gb|EDS52508.1| two component transcriptional regulator, winged helix family [Paenibacillus sp. JDR-2] (238 aa)
Score = 130, Expect = 5.4e-06, Identities = 29/77 (37%), Positives = 42/77 (54%)
  Q:   144 IWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWG--YDDDPTGLVIQYIYKLKKKIGKD 220
           I    L+++   R V      I++T  EFDIL     HP   FS E IF++VWG  Y +     V+ +I  L+KK+G+D
  S:   141 IVAGGLTIDQEQRNVTLYNDRIDLTPKEFDILYLLASHPKKVFSAEHIFQQVWGEAYYESGGNTVMVHIRTLRKKLGED 219
>gi|157146486|ref|YP_001453805.1| hypothetical protein CKO_02246 [Citrobacter koseri ATCC BAA-895] >gi|157083691|gb|ABV13369.1| hypothetical protein CKO_02246 [Citrobacter koseri ATCC BAA-895] (235 aa)
Score = 130, Expect = 5.7e-06, Identities = 26/77 (33%), Positives = 46/77 (59%)
  Q:   144 IWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGKD 220
           I  + L+++ + R V   GQ++++T  EF++L FF  HP   FS+  + ++VWGY  +     +  +I +L+ KI KD
  S:   132 IQAHGLTLDPLARTVRLHGQDVDLTPREFELLYFFARHPGEVFSRLALLEQVWGYQHEGYEHTVNTHINRLRIKIEKD 209
>gi|167768425|ref|ZP_02440478.1| hypothetical protein CLOSS21_02984 [Clostridium sp. SS2/1] >gi|167709949|gb|EDS20528.1| hypothetical protein CLOSS21_02984 [Clostridium sp. SS2/1] (229 aa)
Score = 130, Expect = 5.9e-06, Identities = 39/118 (33%), Positives = 64/118 (54%)
  Q:   117 FTPSLFFQTL---LNIFHKVEVINLMNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDD-DPTGLVIQYIYKLKKKI----GKDNIVSSTYN-GYCFKL 234
           F+PS     +   LN + ++    +  N II    L ++   R+V+ +G+E   T  EFD+L F   HPN  F+KEE+F K+W  +       V  +I K+++KI     K   + + +  GY FK+
  S:   103 FSPSELVARVKAHLNRYQRLVNNQMEVNDIIEIRGLKIDKTARRVYLNGEEKVFTTKEFDLLTFLAGHPNRVFTKEELFNKIWDMESLGDIATVTVHIKKIREKIEVNTAKPQYIETIWGVGYRFKM 229
>gi|86742984|ref|YP_483384.1| two component transcriptional regulator [Frankia sp. CcI3] >gi|86569846|gb|ABD13655.1| two component transcriptional regulator, winged helix family [Frankia sp. CcI3] (244 aa)
Score = 130, Expect = 5.9e-06, Identities = 22/75 (29%), Positives = 48/75 (64%)
  Q:   143 IIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQYIYKLKKKI 217
           +++G+ +S++L  R+V  +G+ I++T  E+++L F   HP   FS+EE+ ++VWG        V +++ +++ K+
  S:   149 LVYGD-VSIDLRAREVAVAGERIDLTAREYELLAFLARHPRRVFSREELLEQVWGTRFQDPATVTEHVRRVRTKV 222
>gi|172035733|ref|YP_001802234.1| two component transcriptional regulator [Cyanothece sp. ATCC 51142] >gi|171697187|gb|ACB50168.1| two component transcriptional regulator [Cyanothece sp. ATCC 51142] (225 aa)
Score = 130, Expect = 6.0e-06, Identities = 28/89 (31%), Positives = 55/89 (61%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGY----DDDPTGLVIQYIYKLKKKIGKDNIVSSTYNGYCFKLRE 236
           +LS+N   R+V+   + IE+T  EFD+L++ + HP    S+++I ++VWGY    D +   + ++Y+ +LK +  ++  +  T  G  + LR+
  S:   134 DLSLNRNTREVFRGSRLIELTAKEFDLLEYLMSHPKQVLSRDQILERVWGYDFMGDSNIIEVYVRYL-RLKLEAEQEKRLIQTVRGVGYVLRD 225
>gi|91791478|ref|YP_561129.1| response regulator receiver [Shewanella denitrificans OS217] >gi|91713480|gb|ABE53406.1| response regulator receiver [Shewanella denitrificans OS217] (225 aa)
Score = 130, Expect = 6.0e-06, Identities = 26/68 (38%), Positives = 41/68 (60%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKK 216
           L M L+ R V  +  E+ +   EF +LK+ +EHPN   S+  +F+ VW Y  DP T ++  +I KL++K
  S:   133 LRMELLTRVVTLAEHELMLQPKEFQLLKYLMEHPNKVISRTLLFEAVWDYHFDPRTNVIDVHIAKLRRK 201
>gi|192812416|ref|ZP_03041084.1| response regulator receiver [Geobacillus sp. Y412MC10] >gi|192798823|gb|EDV75335.1| response regulator receiver [Geobacillus sp. Y412MC10] (231 aa)
Score = 130, Expect = 6.1e-06, Identities = 27/88 (30%), Positives = 50/88 (56%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD-DDPTGLVIQYIYKLKKKIGKDNIVSSTYNGYCFKLRE 236
           L++NL++R +   G+ +E+T  EFD++     +P   +S+E + ++VW  D    T  V  ++ +L+KK+G  + V  T  G  +K  E
  S:   140 LTINLLNRTIHAEGKPLELTPKEFDLMALLARNPERVYSREALLEQVWDMDFAGGTRTVDIHVQRLRKKLGNQHEVIQTVYGIGYKSTE 228
>gi|51891828|ref|YP_074519.1| two-component response regulator [Symbiobacterium thermophilum IAM 14863] >gi|51855517|dbj|BAD39675.1| two-component response regulator [Symbiobacterium thermophilum IAM 14863] (225 aa)
Score = 130, Expect = 6.1e-06, Identities = 22/64 (34%), Positives = 40/64 (62%)
  Q:   157 KVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQYIYKLKKKIGKD 220
           +VW  G+E+ +T  E ++L F   HP   FS+E+++ +VWG   DP  + + +I ++++KI  D
  S:   141 RVWRDGREVAMTAKELELLIFLARHPGQVFSREQLYDRVWGDFGDPRTVTV-HINRIREKIEAD 203
>gi|163943423|ref|YP_001642653.1| two component transcriptional regulator [Bacillus weihenstephanensis KBAB4] >gi|163865620|gb|ABY46678.1| two component transcriptional regulator, winged helix family [Bacillus weihenstephanensis KBAB4] (235 aa)
Score = 130, Expect = 6.1e-06, Identities = 30/98 (30%), Positives = 52/98 (53%)
  Q:   137 NLMNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDD---PTGLVIQYIYKLKKKIGKDNIVSSTYNGYCFKL 234
           ++ N  I    N+ +NL+  KV   G+ + +TK  F++L +F+ H     SKEE++K +WGYD      T  +   I +L+  +  D I +    GY  ++
  S:   132 DISNGGITRCGNIEINLLTHKVIVEGKHVHLTKQLFELLHYFIIHKGQIISKEELYKNIWGYDPSELQETNTLEVNIRRLRNSLDVDIIKTVRGKGYVLEV 232
>gi|116490257|ref|YP_809801.1| DNA-binding response regulator [Oenococcus oeni PSU-1] >gi|118586509|ref|ZP_01543953.1| two-component system regulator [Oenococcus oeni ATCC BAA-1163] >gi|116090982|gb|ABJ56136.1| DNA-binding response regulator, OmpR family (Rec-wHTH domains) [Oenococcus oeni PSU-1] >gi|118433073|gb|EAV39795.1| two-component system regulator [Oenococcus oeni ATCC BAA-1163] (231 aa)
Score = 130, Expect = 6.2e-06, Identities = 27/81 (33%), Positives = 51/81 (62%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKK---IGKDNIVSSTYN 228
           NL ++L +R V    Q +++   E+DIL +  ++ N   +K++IF +VWG D D T  V+  Y+  L++K   +GK++++ +  N
  S:   136 NLKIHLSNRTVTVGNQNVQLVGKEYDILVYLAKNKNIIITKDQIFDRVWGLDSDTTTSVVNIYLNNLRRKLESVGKNDLIKTLRN 220
>gi|118728198|ref|ZP_01576765.1| two component transcriptional regulator, winged helix family [Clostridium cellulolyticum H10] >gi|118662418|gb|EAV69112.1| two component transcriptional regulator, winged helix family [Clostridium cellulolyticum H10] (233 aa)
Score = 130, Expect = 6.3e-06, Identities = 29/78 (37%), Positives = 49/78 (62%)
  Q:   143 IIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWG--YDDDPTGLVIQYIYKLKKKIGKD 220
           II   N+ MN+   +V      + +T  EF+ILK FL++P   F+K ++FK +WG  Y +D   +++ +I +L++KI KD
  S:   135 IIRHMNIEMNVDTYEVKVGDNSVTLTAKEFEILKLFLQNPRKVFTKNQLFKSIWGENYINDENTVMV-HIRRLREKIEKD 213
>gi|118474091|ref|YP_892015.1| transcriptional activator protein CopR [Campylobacter fetus subsp. fetus 82-40] >gi|118413317|gb|ABK81737.1| transcriptional activator protein CopR [Campylobacter fetus subsp. fetus 82-40] (222 aa)
Score = 130, Expect = 6.4e-06, Identities = 28/91 (30%), Positives = 56/91 (61%)
  Q:   140 NNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGKDNIVSSTYNGY 230
           +N II  +N   +++ +K+   G+ + + K E ++L  FL++ N   S++EI+ ++W + + P+ L ++ YI  L+K IG + I+S +  GY
  S:   127 DNFIIINSNFKFDILQKKLMQDGKVLPLAKKETELLCLFLKNKNRILSRDEIYSQIWEFYEVPSELSLRVYIRNLRKLIGNEKIISHSKLGY 218
>gi|119961724|ref|YP_947342.1| two-component system response regulator [Arthrobacter aurescens TC1] >gi|119948583|gb|ABM07494.1| two-component system response regulator [Arthrobacter aurescens TC1] (274 aa)
Score = 129, Expect = 6.5e-06, Identities = 25/69 (36%), Positives = 39/69 (56%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQYIYKLKKKI 217
           L ++   R V   G  + +T  EFD+L F +  PN  FS+EE+ K VWG+D      V  ++ +L++KI
  S:   164 LELDPASRTVTHGGVPLALTVREFDLLAFMMRRPNQVFSREELIKAVWGWDFGDLSTVTVHVRRLREKI 232
>gi|196243096|ref|ZP_03141826.1| two component transcriptional regulator, winged helix family [Cyanothece sp. PCC 8802] >gi|196208995|gb|EDY03784.1| two component transcriptional regulator, winged helix family [Cyanothece sp. PCC 8802] (231 aa)
Score = 129, Expect = 6.6e-06, Identities = 31/90 (34%), Positives = 54/90 (60%)
  Q:   147 NNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKI---GKDNIVSSTYNGYCFKLRE 236
           ++L ++L  R+++   + I++T  EF++LK+ + HP    ++E+I + VWGYD      VI+ YI  L+ KI   G   ++  T  G  + LRE
  S:   138 DDLVLDLSTRRLFLKEKAIDLTMKEFELLKYLMSHPKEVLTREKILENVWGYDFQGESNVIEVYIRYLRLKIESEGHKRLI-HTVRGVGYVLRE 230
>gi|167758624|ref|ZP_02430751.1| hypothetical protein CLOSCI_00964 [Clostridium scindens ATCC 35704] >gi|167663820|gb|EDS07950.1| hypothetical protein CLOSCI_00964 [Clostridium scindens ATCC 35704] (229 aa)
Score = 129, Expect = 6.6e-06, Identities = 26/80 (32%), Positives = 45/80 (56%)
  Q:   141 NVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDD-DPTGLVIQYIYKLKKKIGKD 220
           N +I    L ++   R+VW + +E   T  EFD+L F   HPN  ++KEE+F+++W  +       V  +I K+++K+  D
  S:   130 NKVIEIRGLKIDTTARRVWVNEEERTFTTKEFDLLTFLASHPNHVYTKEELFREIWDMESIGDIATVTVHIKKIREKVEMD 210
>gi|171324918|ref|ZP_02913429.1| two component transcriptional regulator, winged helix family [Geobacillus sp. WCH70] >gi|171089193|gb|EDT35527.1| two component transcriptional regulator, winged helix family [Geobacillus sp. WCH70] (233 aa)
Score = 129, Expect = 6.8e-06, Identities = 26/70 (37%), Positives = 46/70 (65%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPT-GLVIQYIYKLKKKI 217
           N++++L+  +V+C G ++ +TK E++I+K  + + N  FSKE IF+ VWG D +     V + I  ++KKI
  S:   136 NITIDLLANEVFCKGVKLHLTKKEYEIIKLLMLNKNMVFSKERIFESVWGLDSESQLETVTESIKNIRKKI 206
>gi|170017835|ref|YP_001728754.1| response regulator [Leuconostoc citreum KM20] >gi|169804692|gb|ACA83310.1| Response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Leuconostoc citreum KM20] (229 aa)
Score = 129, Expect = 6.9e-06, Identities = 30/89 (33%), Positives = 57/89 (64%)
  Q:   140 NNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKK---IGKDNIVSSTYN 228
           +N+I  G+ L +NL +R V   GQ +++   EFDIL +  ++ N   ++++IF +VWG D D T  V+  Y+  L++K   +G+++++ +  N
  S:   128 DNMITVGDVL-INLENRGVQVHGQPVKLVGKEFDILTYLAQNKNIIVTRDQIFDRVWGIDSDTTINVVNIYLNNLRRKLEAVGQNDLIKTLRN 219
>gi|88858377|ref|ZP_01133019.1| phosphate regulon transcriptional regulatory protein phoB [Pseudoalteromonas tunicata D2] >gi|88819994|gb|EAR29807.1| phosphate regulon transcriptional regulatory protein phoB [Pseudoalteromonas tunicata D2] (229 aa)
Score = 129, Expect = 7.0e-06, Identities = 36/116 (31%), Positives = 63/116 (54%)
  Q:   117 FTPSLFFQTLLNIFHKVEVINLMNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWG---YDDDPTGLVIQYIYKLKKKI---GKDNIVSSTY-NGYCF 232
           F+P      +  +  +V   +L   + + G  L ++ I  +V  +G E+++   EF +L FF+ HP   +S+E++   VWG   Y +D T  V  +I +L+K I   G D +V +   +GY F
  S:   107 FSPKELMARIKAVIRRVSPTSLEEAIEVHG--LRLDPISHRVTSAGSELDMGPTEFRLLHFFMTHPERVYSREQLLDHVWGTNVYVEDRT--VDVHIRRLRKAIAPMGHDKLVQTVRGSGYRF 225
>gi|148557691|ref|YP_001265273.1| two component transcriptional regulator [Sphingomonas wittichii RW1] >gi|148502881|gb|ABQ71135.1| two component transcriptional regulator, winged helix family [Sphingomonas wittichii RW1] (230 aa)
Score = 129, Expect = 7.0e-06, Identities = 30/88 (34%), Positives = 51/88 (57%)
  Q:   147 NNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKKI--GKDNIVSSTYNGYCFKL 234
           ++L M+L+ RKV   GQ IE+   EF +L+F L H     ++  + + VW Y  DP T ++  ++ +L+KKI  G+   +  T  G  ++L
  S:   136 DDLEMDLLSRKVRRGGQPIELQPREFRLLEFLLRHAEQVVTRTMLLEGVWDYHFDPGTNVIDVHVSRLRKKIDEGQARPLLHTVRGSGYRL 226
>gi|177663625|ref|ZP_02939429.1| two component transcriptional regulator, winged helix family [Cyanothece sp. PCC 8801] >gi|172077339|gb|EDT62749.1| two component transcriptional regulator, winged helix family [Cyanothece sp. PCC 8801] (231 aa)
Score = 129, Expect = 7.1e-06, Identities = 31/90 (34%), Positives = 54/90 (60%)
  Q:   147 NNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKI---GKDNIVSSTYNGYCFKLRE 236
           ++L ++L  R+++   + I++T  EF++LK+ + HP    ++E+I + VWGYD      VI+ YI  L+ KI   G   ++  T  G  + LRE
  S:   138 DDLVLDLSTRRLFLKEKAIDLTMKEFELLKYLMSHPKEVLTREKILENVWGYDFQGESNVIEVYIRYLRLKIESEGHKRLI-HTVRGVGYVLRE 230
>gi|24379561|ref|NP_721516.1| putative response regulator CiaR [Streptococcus mutans UA159] >gi|24377506|gb|AAN58822.1|AE014950_5 putative response regulator CiaR [Streptococcus mutans UA159] (224 aa)
Score = 129, Expect = 7.2e-06, Identities = 24/69 (34%), Positives = 45/69 (65%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKI 217
           L+++        +G+E+E+   EFD+L +FL++ N    K +IF ++WG+D D T  V++ Y+ K++KK+
  S:   132 LTVDTATNTTMVNGKEVELLGKEFDLLVYFLQNQNVILPKSQIFDRIWGFDSDTTISVVEVYVSKIRKKL 201
>gi|154250109|ref|YP_001410934.1| two component transcriptional regulator [Fervidobacterium nodosum Rt17-B1] >gi|154154045|gb|ABS61277.1| two component transcriptional regulator, winged helix family [Fervidobacterium nodosum Rt17-B1] (229 aa)
Score = 129, Expect = 7.3e-06, Identities = 30/78 (38%), Positives = 47/78 (60%)
  Q:   155 DRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGKDNIVSSTYNGYCF 232
           D  V   GQ+I++T  EF+ILK   + P+  +S+EEI + +W  + D    V+  +I  L+KK+GKD I++    GY F
  S:   137 DYVVLYDGQKIDLTAKEFEILKLLAQRPDRVYSREEILETIWTDEYDVFDRVVDVHINSLRKKLGKDWIITVRGVGYKF 215
>gi|169190803|ref|ZP_02850710.1| two component transcriptional regulator, winged helix family [Paenibacillus sp. JDR-2] >gi|169002538|gb|EDS49421.1| two component transcriptional regulator, winged helix family [Paenibacillus sp. JDR-2] (229 aa)
Score = 129, Expect = 7.4e-06, Identities = 25/72 (34%), Positives = 42/72 (58%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDD-PTGLVIQYIYKLKKKIGKD 220
           L +++  R+V    +E  +T  E+D+L     HPN  F KEE+F+++WG D +     V  +I +L++KI  D
  S:   138 LLIDVTSRRVTIHDREAMLTSKEYDLLLLLASHPNRVFEKEELFERIWGLDSNGDAATVTVHIRRLREKIEHD 210
>gi|169828380|ref|YP_001698538.1| two-component response regulator [Lysinibacillus sphaericus C3-41] >gi|168992868|gb|ACA40408.1| two-component response regulator [Lysinibacillus sphaericus C3-41] (212 aa)
Score = 129, Expect = 7.7e-06, Identities = 29/83 (34%), Positives = 53/83 (63%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD---DDPTGLVIQYIYKLKKKIGKDNIVSSTYNGY 230
           N+S ++  ++VW +G EIE+TK EF++L+ F ++     +++++   VWG D   D  T  V  +I +L++KIG++ I +    GY
  S:   125 NVSFDVTSKRVWRAGIEIELTKTEFELLRIFSQNRRQILTRDQLLDLVWGLDYMGDART--VDTHIRRLREKIGENIIQTHRGIGY 208
>gi|196479569|gb|ACG79097.1| response regulator(with CheY-like receiver domain and winged-helix DNA-binding domain) [Phenylobacterium zucineum HLK1] (223 aa)
Score = 129, Expect = 7.8e-06, Identities = 31/94 (32%), Positives = 53/94 (56%)
  Q:   141 NVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKKIGK--DNIVSSTYNGYCFKL 234
           N ++    L M+LI R V  +G+EI++   EF +L+F + H     ++  + +KVW Y  DP T ++  +I +L+ KI K  D  +  T  G  ++L
  S:   125 NTLLRVGELEMDLIARTVHRAGKEIDLQPREFQLLEFMMRHAGQSVTRTMLLEKVWHYHFDPQTNVIDVHISRLRSKIDKGFDRPMLQTVRGAGYRL 221
>gi|126658291|ref|ZP_01729441.1| Two component Transcriptional regulator, Winged helix family protein [Cyanothece sp. CCY0110] >gi|126620440|gb|EAZ91159.1| Two component Transcriptional regulator, Winged helix family protein [Cyanothece sp. CCY0110] (225 aa)
Score = 129, Expect = 7.9e-06, Identities = 28/89 (31%), Positives = 55/89 (61%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGY----DDDPTGLVIQYIYKLKKKIGKDNIVSSTYNGYCFKLRE 236
           +LS+N   R+V+   + IE+T  EFD+L++ + HP    S+++I ++VWGY    D +   + ++Y+ +LK +  ++  +  T  G  + LR+
  S:   134 DLSLNRNTREVFRGNRLIELTAKEFDLLEYLMSHPKQVLSRDQILERVWGYDFMGDSNIIEVYVRYL-RLKLEAEQEKRLIQTVRGVGYVLRD 225
>gi|139438314|ref|ZP_01771867.1| Hypothetical protein COLAER_00856 [Collinsella aerofaciens ATCC 25986] >gi|133776511|gb|EBA40331.1| Hypothetical protein COLAER_00856 [Collinsella aerofaciens ATCC 25986] (250 aa)
Score = 129, Expect = 7.9e-06, Identities = 24/81 (29%), Positives = 48/81 (59%)
  Q:   156 RKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD-DDPTGLVIQYIYKLKKKIGKDNIVSSTYNGYCFKLRE 236
           R+V  +G+ +++T  EFD+L++ +  P   F++E + + VWG+D D  +  V  ++  L++K+G+      T  G  ++L E
  S:   150 REVTVAGESLKLTLREFDLLEYLMRKPGVVFTRESLLQSVWGWDFDGGSRTVDVHVQTLRQKLGEHASAIETVRGVGYRLAE 231
>gi|118047509|ref|ZP_01516144.1| response regulator receiver [Chloroflexus aggregans DSM 9485] >gi|117996014|gb|EAV10220.1| response regulator receiver [Chloroflexus aggregans DSM 9485] (245 aa)
Score = 129, Expect = 8.0e-06, Identities = 30/87 (34%), Positives = 53/87 (60%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDD-DPTGLVIQYIYKLKKKIG--KDNIVSSTYNGYCFKLR 235
           LS+NL  R+V   G+ IE+T  EF +L+ F+ HP   F+++ +  +VWG+     + +V  +I  L++KIG  +  ++ + Y G  + LR
  S:   149 LSLNLETREVTLHGRAIELTPTEFALLEQFMRHPRRVFTRQTLLSRVWGFTYVGDSNIVEVHISNLREKIGDHERKLIRTVY-GVGYTLR 237
>gi|30020982|ref|NP_832613.1| two-component response regulator [Bacillus cereus ATCC 14579] >gi|29896535|gb|AAP09814.1| Two-component response regulator [Bacillus cereus ATCC 14579] (215 aa)
Score = 129, Expect = 8.1e-06, Identities = 33/94 (35%), Positives = 57/94 (60%)
  Q:   143 IIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD---DDPTGLVIQYIYKLKKKIGKDNIVSSTYNGYCFKLRE 236
           II   ++ +N    KV+ +  E+EITK E +++K FL H  T  +++++   VWG+D   ++ T  V  ++ +L+KKIG+D I   T+ G  + L E
  S:   120 IIQVQDVKINFAKNKVYKNDIELEITKTELELIKCFLNHKGTILTRKKLLDIVWGFDYFGEERT--VDTHVRRLRKKIGEDII--KTHRGLGYSLEE 212
>gi|168136929|ref|ZP_02580158.1| two component transcriptional regulator, winged helix family protein [Bacillus cereus B4264] (235 aa)
Score = 129, Expect = 8.2e-06, Identities = 30/98 (30%), Positives = 52/98 (53%)
  Q:   137 NLMNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDD---PTGLVIQYIYKLKKKIGKDNIVSSTYNGYCFKL 234
           ++ N  I    N+ +NL+  KV   G+ + +TK  F++L +F+ H     SKEE++K +WGYD      T  +   I +L+  +  D I +    GY  ++
  S:   132 DISNGGITRCGNIEINLLTHKVIVEGKHVHLTKQLFELLHYFIIHKGQIISKEELYKNIWGYDPSELQETNTLEVNIRRLRNSLDIDIIKTVRGKGYVLEV 232
>gi|23012748|ref|ZP_00052758.1| COG0745: Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Magnetospirillum magnetotacticum MS-1] (124 aa)
Score = 129, Expect = 8.3e-06, Identities = 29/78 (37%), Positives = 48/78 (61%)
  Q:   143 IIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDD--DPTGLVIQYIYKLKKKIGKD 220
           I WG+ ++M+L   +V   G+ I +   EF +L+FFL+HP   FS+EE+   VWG D   +P  + + +I +L+K +  D
  S:    25 IGWGD-IAMDLASHRVTRGGKPIHLGPTEFRLLQFFLQHPGQVFSREELLDAVWGPDIYVEPRTVDV-HIRRLRKALNCD 102
>gi|83643472|ref|YP_431907.1| response regulator [Hahella chejuensis KCTC 2396] >gi|83631515|gb|ABC27482.1| Response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Hahella chejuensis KCTC 2396] (226 aa)
Score = 128, Expect = 8.6e-06, Identities = 30/90 (33%), Positives = 53/90 (58%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKKIGKD--NIVSSTYNGYCFKLRES 237
           +L M+L+ R V  +G  I++   EF +L++F+ +P    ++  + +KVW Y  DP T ++  +I +L+ KI KD    +  T  G  + LRE+
  S:   133 DLEMDLLARTVKRNGLSIDLQPREFRLLEYFMRNPGQVLTRTMLLEKVWDYHFDPQTNVIDVHISRLRAKIDKDFETPLLHTIRGAGYVLREA 225
>gi|194364248|ref|YP_002026858.1| two component transcriptional regulator, winged helix family [Stenotrophomonas maltophilia R551-3] >gi|194347052|gb|ACF50175.1| two component transcriptional regulator, winged helix family [Stenotrophomonas maltophilia R551-3] (239 aa)
Score = 128, Expect = 8.7e-06, Identities = 25/72 (34%), Positives = 40/72 (55%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGKD 220
           L ++ + R     G  +E+T  EFD+L FF  HP+  F++ E+  +VWGY  D     +  +I +L+ KI  D
  S:   142 LQLDPVARTASVDGNALELTPREFDLLLFFARHPDQVFARMELLNQVWGYQHDGYEHTVNTHINRLRSKIEPD 214
>gi|190572650|ref|YP_001970495.1| putative two-component response regulator transcriptional regulatory protein [Stenotrophomonas maltophilia K279a] >gi|190010572|emb|CAQ44181.1| putative two-component response regulator transcriptional regulatory protein [Stenotrophomonas maltophilia K279a] (239 aa)
Score = 128, Expect = 8.7e-06, Identities = 25/72 (34%), Positives = 40/72 (55%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGKD 220
           L ++ + R     G  +E+T  EFD+L FF  HP+  F++ E+  +VWGY  D     +  +I +L+ KI  D
  S:   142 LQLDPVARTASVDGNALELTPREFDLLLFFARHPDQVFARMELLNQVWGYQHDGYEHTVNTHINRLRSKIEPD 214
>gi|160895408|ref|ZP_02076177.1| hypothetical protein CLOL250_02965 [Clostridium sp. L2-50] >gi|156862910|gb|EDO56341.1| hypothetical protein CLOL250_02965 [Clostridium sp. L2-50] (229 aa)
Score = 128, Expect = 9.0e-06, Identities = 29/82 (35%), Positives = 46/82 (56%)
  Q:   139 MNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDD-DPTGLVIQYIYKLKKKIGKD 220
           + N +I    L ++  DR+V+  G+E   T  EFD+L F   +PN  FSK+E+F K+W  +       V  +I K+++KI  D
  S:   128 LQNDVIEIRGLKIDKTDRRVYVDGEEKVFTNKEFDLLTFLASNPNKVFSKDELFNKIWNMESIGDIATVTVHIKKIREKIEFD 210
>gi|91779281|ref|YP_554489.1| two component transcriptional regulator [Burkholderia xenovorans LB400] >gi|91691941|gb|ABE35139.1| two component transcriptional regulator, winged helix family [Burkholderia xenovorans LB400] (248 aa)
Score = 128, Expect = 9.0e-06, Identities = 25/72 (34%), Positives = 43/72 (59%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGKD 220
           LS++ + R+   +G+ IE+T  EFD+L +F +HP   FS+ ++   VWGY  +     +  +I +L+ KI  D
  S:   142 LSIDPLTREAAANGKPIELTPREFDLLYYFAQHPGKVFSRMDLLNAVWGYQHEGYEHTVNTHINRLRAKIEAD 214
>gi|167456431|ref|ZP_02322649.1| two component transcriptional regulator, winged helix family [Anaeromyxobacter dehalogenans 2CP-1] >gi|167417160|gb|EDR83867.1| two component transcriptional regulator, winged helix family [Anaeromyxobacter dehalogenans 2CP-1] (230 aa)
Score = 128, Expect = 9.1e-06, Identities = 23/72 (31%), Positives = 43/72 (59%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVI-QYIYKLKKKIGKD 220
           + ++L  R+    G+ +E+T  EFD+L FF+ HP+  +S+E++ + VWG     T   +  ++ +L+  IG D
  S:   139 IELDLDARRALVDGRALELTSREFDLLAFFVTHPDRVYSREQLMEAVWGSRYFGTARTVDNFVARLRAHIGDD 211
>gi|86156839|ref|YP_463624.1| two component transcriptional regulator [Anaeromyxobacter dehalogenans 2CP-C] >gi|85773350|gb|ABC80187.1| two component transcriptional regulator, winged helix family [Anaeromyxobacter dehalogenans 2CP-C] (230 aa)
Score = 128, Expect = 9.1e-06, Identities = 23/72 (31%), Positives = 43/72 (59%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVI-QYIYKLKKKIGKD 220
           + ++L  R+    G+ +E+T  EFD+L FF+ HP+  +S+E++ + VWG     T   +  ++ +L+  IG D
  S:   139 IELDLDARRALVDGRALELTSREFDLLAFFVTHPDRVYSREQLMEAVWGSRYFGTARTVDNFVARLRAHIGDD 211
>gi|163856778|ref|YP_001631076.1| two-component response regulator [Bordetella petrii DSM 12804] >gi|163260506|emb|CAP42808.1| two-component response regulator [Bordetella petrii] (238 aa)
Score = 128, Expect = 9.3e-06, Identities = 25/74 (33%), Positives = 42/74 (56%)
  Q:   147 NNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGKD 220
           + LS++ + R     GQ +++T  EFD+L FF  HP   FS+ ++  +VWGY  +     +  +I +L+ KI  D
  S:   138 SGLSIDPVTRDATVDGQPLDLTPREFDLLYFFARHPGKVFSRMDLLNQVWGYQHEGYEHTVNTHINRLRTKIEAD 212
>gi|182440354|ref|YP_001828073.1| putative two-component system response regulator [Streptomyces griseus subsp. griseus NBRC 13350] >gi|178468870|dbj|BAG23390.1| putative two-component system response regulator [Streptomyces griseus subsp. griseus NBRC 13350] (215 aa)
Score = 128, Expect = 9.4e-06, Identities = 27/95 (28%), Positives = 54/95 (56%)
  Q:   141 NVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKKIGKDNIVSSTYNGYCFKLR 235
           N ++   +L ++L  R+     +  +++  EF + +  + +P+   S+E++  +VWG+D DP + +V  YI  L++KIG D +   T  G  ++LR
  S:   121 NFLLRVGDLILDLRTRRAQVGDRVSDLSAREFALAEILMRNPDRVLSREQLLSQVWGFDYDPGSNIVDVYIRYLRRKIGADRV--QTVRGVGYRLR 214
>gi|86739863|ref|YP_480263.1| two component transcriptional regulator [Frankia sp. CcI3] >gi|86566725|gb|ABD10534.1| two component transcriptional regulator, winged helix family [Frankia sp. CcI3] (235 aa)
Score = 128, Expect = 9.4e-06, Identities = 29/86 (33%), Positives = 53/86 (61%)
  Q:   151 MNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKI---GKDNIVSSTYNGYCFKLRE 236
           ++ + R+V    +E+ +TK EF++L+ FL HP    S+  I ++VWGYD  PT   ++ ++  L++K+   G+  ++  T  G  + LRE
  S:   141 LDQVSRQVTRGDRELILTKTEFELLELFLAHPRQVLSRSMIMERVWGYDFGPTSNSLEVFVSYLRRKLEANGEPRLL-HTVRGVGYVLRE 229
>gi|50058178|dbj|BAD27458.1| putative response regulator [Streptomyces griseus] (157 aa)
Score = 128, Expect = 9.4e-06, Identities = 27/95 (28%), Positives = 54/95 (56%)
  Q:   141 NVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKKIGKDNIVSSTYNGYCFKLR 235
           N ++   +L ++L  R+     +  +++  EF + +  + +P+   S+E++  +VWG+D DP + +V  YI  L++KIG D +   T  G  ++LR
  S:    63 NFLLRVGDLILDLRTRRAQVGDRVSDLSAREFALAEILMRNPDRVLSREQLLSQVWGFDYDPGSNIVDVYIRYLRRKIGADRV--QTVRGVGYRLR 156
>gi|20807496|ref|NP_622667.1| response regulator [Thermoanaerobacter tengcongensis MB4] >gi|20516025|gb|AAM24271.1| Response regulators consisting of a CheY-like receiver domain and a HTH DNA-binding domain [Thermoanaerobacter tengcongensis MB4] (229 aa)
Score = 128, Expect = 9.4e-06, Identities = 33/86 (38%), Positives = 50/86 (58%)
  Q:   151 MNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD-DDPTGLVIQYIYKLKKKIGK--DNIVSSTYNGYCFKLRE 236
           M+L   +V   G +I++TK EFD+L+F + + N   S+E+I + VWGYD    T +V  YI  L+ KI    D  +  T  G  + LR+
  S:   136 MDLTTHEVRRQGVKIDLTKKEFDLLEFLMRNANIALSREKILRSVWGYDYYGDTNVVDVYIRYLRSKIDDPFDRKLIHTIRGVGYSLRD 224
>gi|167629665|ref|YP_001680164.1| two-component response regulator [Heliobacterium modesticaldum Ice1] >gi|167592405|gb|ABZ84153.1| two-component response regulator [Heliobacterium modesticaldum Ice1] (235 aa)
Score = 128, Expect = 9.5e-06, Identities = 23/74 (31%), Positives = 43/74 (58%)
  Q:   147 NNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDD-DPTGLVIQYIYKLKKKIGKD 220
           ++L ++L + +V   GQ + +   E  +L F  +HPN  F+ +E++ ++WGY D      V+ +I  ++KKI  D
  S:   142 DDLEIDLANYRVAVGGQPVSLAAKELQLLFFLAQHPNQVFTAQELYTRIWGYKDIGDYRTVMTHISNIRKKIKTD 216
>gi|119492095|ref|ZP_01623548.1| two-component response regulator [Lyngbya sp. PCC 8106] >gi|119453305|gb|EAW34470.1| two-component response regulator [Lyngbya sp. PCC 8106] (222 aa)
Score = 128, Expect = 9.6e-06, Identities = 28/89 (31%), Positives = 52/89 (58%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD-DDPTGLVIQYIYKLKKKIGKDNIVSSTYNGYCFKLRE 236
           N+++++  R V    + +E++  EF +L   + HP+   S+++I   VWGYD D  + +V  YI  L+KK+ ++ I +    GY  +LR+
  S:   135 NITLDIRSRTVMVGDRRVELSNYEFILLDTLMRHPDQVLSRDQILNYVWGYDYDSSSNIVDVYIGYLRKKLNRNLIETVRSVGY--RLRK 222
>gi|169827681|ref|YP_001697839.1| transcription response regulator-like protein [Lysinibacillus sphaericus C3-41] >gi|168992169|gb|ACA39709.1| transcription response regulator-like protein [Lysinibacillus sphaericus C3-41] (220 aa)
Score = 128, Expect = 9.8e-06, Identities = 41/131 (31%), Positives = 70/131 (53%)
  Q:   106 KGFEFCVSLDFFTPSLFFQTLLNIFHKVEVINLMNNVIIWGNNLSMNLID-----RKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD-DDPTGLVIQYIYKLKKKIGKDNIVSSTYNGYCFKLRE 236
           KGF+  +  D+ T    F  L+    +V+ +   +N   WGN+L+ N ++      K + + +EI +T  EF+IL+  L +     ++E I +KVWGYD    T ++  +I  L+KK+    I   T  G  +K+ E
  S:    90 KGFDLGID-DYITKPFSFHVLI---RRVQAVLRRSNHKSWGNHLNFNELNVDCDGYKAYVNKEEIPLTTKEFEILQLLLHNEKKVLTREIIVEKVWGYDYSGETRMIDTHIKNLRKKLNLPYI--KTVKGIGYKIDE 220
>gi|116669221|ref|YP_830154.1| two component transcriptional regulator [Arthrobacter sp. FB24] >gi|116609330|gb|ABK02054.1| two component transcriptional regulator, winged helix family [Arthrobacter sp. FB24] (246 aa)
Score = 128, Expect = 9.8e-06, Identities = 28/103 (27%), Positives = 59/103 (57%)
  Q:   115 DFFTPSLFFQTLLNIFHKV---EVINLMNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKI 217
           D+ T     + +L   H++     +  M+   +   +L +N+  R+V  +G+E+++T  +F++L++ +E+P    SK +I  +VW YD      +++ YI  L+KK+
  S:   118 DYVTKPFSMEEVLLRLHRLVQRSGVAAMDTAELVVGDLVLNIDTREVTRAGEELQLTATQFELLRYLMENPRRVVSKAQILDRVWDYDFGGQANIVELYISYLRKKV 224
>gi|67921356|ref|ZP_00514875.1| Response regulator receiver:Transcriptional regulatory protein, C-terminal [Crocosphaera watsonii WH 8501] >gi|67857473|gb|EAM52713.1| Response regulator receiver:Transcriptional regulatory protein, C-terminal [Crocosphaera watsonii WH 8501] (225 aa)
Score = 128, Expect = 9.8e-06, Identities = 27/89 (30%), Positives = 55/89 (61%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGY----DDDPTGLVIQYIYKLKKKIGKDNIVSSTYNGYCFKLRE 236
           +L++N   R+V+   + IE+T  EFD+L++ + HP    ++++I ++VWGY    D +   + ++Y+ +LK +  K+  +  T  G  + LR+
  S:   134 DLTLNSNTRQVFRGDRLIELTAKEFDLLEYLMSHPKQVLTRDQILERVWGYDFMGDSNIIEVYVRYL-RLKLEAEKEKRIIQTVRGVGYVLRD 225
>gi|15675198|ref|NP_269372.1| putative response regulator [Streptococcus pyogenes M1 GAS] >gi|71910761|ref|YP_282311.1| transcriptional regulatory protein [Streptococcus pyogenes MGAS5005] >gi|13622364|gb|AAK34093.1| putative response regulator [Streptococcus pyogenes M1 GAS] >gi|71853543|gb|AAZ51566.1| transcriptional regulatory protein [Streptococcus pyogenes MGAS5005] (224 aa)
Score = 128, Expect = 9.9e-06, Identities = 26/70 (37%), Positives = 46/70 (65%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKI 217
           NL ++L  ++V   G+ +E+   EFD+L + L++ N    K +IF ++WG+D D T  V++ YI K++KK+
  S:   131 NLVVDLARKEVKVEGKVVELLGKEFDLLVYLLQNQNVILPKTQIFDRLWGFDSDTTISVVEVYISKIRKKL 201
>gi|153812004|ref|ZP_01964672.1| hypothetical protein RUMOBE_02397 [Ruminococcus obeum ATCC 29174] >gi|149831903|gb|EDM86989.1| hypothetical protein RUMOBE_02397 [Ruminococcus obeum ATCC 29174] (229 aa)
Score = 128, Expect = 1.0e-05, Identities = 31/96 (32%), Positives = 55/96 (57%)
  Q:   139 MNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDD-DPTGLVIQYIYKLKKKI----GKDNIVSSTYN-GYCFKL 234
           + N II    + ++   R++W +G+E   T  EFD+L F  E+PN  F+K E+F+++W  +       V  +I K+++KI     K   + + +  GY FK+
  S:   128 VKNDIIEIRGIKIDKTARRIWVNGEEKTFTTKEFDLLTFLAENPNRVFTKAELFRQIWDMESVGDIATVTVHIKKIREKIEFNTAKPQYIETIWGVGYRFKV 229
>gi|19746167|ref|NP_607303.1| putative response regulator [Streptococcus pyogenes MGAS8232] >gi|21910410|ref|NP_664678.1| putative DNA-binding response regulator [Streptococcus pyogenes MGAS315] >gi|28895986|ref|NP_802336.1| putative response regulator [Streptococcus pyogenes SSI-1] >gi|50914283|ref|YP_060255.1| CiaR [Streptococcus pyogenes MGAS10394] >gi|56807753|ref|ZP_00365614.1| COG0745: Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Streptococcus pyogenes M49 591] >gi|71903585|ref|YP_280388.1| transcriptional regulatory protein [Streptococcus pyogenes MGAS6180] >gi|94988681|ref|YP_596782.1| transcriptional regulatory protein [Streptococcus pyogenes MGAS9429] >gi|94990571|ref|YP_598671.1| transcriptional regulatory protein ciaR [Streptococcus pyogenes MGAS10270] >gi|94992504|ref|YP_600603.1| transcriptional regulatory protein ciaR [Streptococcus pyogenes MGAS2096] >gi|94994493|ref|YP_602591.1| Transcriptional regulatory protein ciaR [Streptococcus pyogenes MGAS10750] >gi|139473693|ref|YP_001128409.1| response regulator protein [Streptococcus pyogenes str. Manfredo] >gi|19748346|gb|AAL97802.1| putative response regulator [Streptococcus pyogenes MGAS8232] >gi|21904608|gb|AAM79481.1| putative DNA-binding response regulator [Streptococcus pyogenes MGAS315] >gi|28811236|dbj|BAC64169.1| putative response regulator [Streptococcus pyogenes SSI-1] >gi|50903357|gb|AAT87072.1| CiaR [Streptococcus pyogenes MGAS10394] >gi|71802680|gb|AAX72033.1| transcriptional regulatory protein [Streptococcus pyogenes MGAS6180] >gi|94542189|gb|ABF32238.1| transcriptional regulatory protein [Streptococcus pyogenes MGAS9429] >gi|94544079|gb|ABF34127.1| Transcriptional regulatory protein ciaR [Streptococcus pyogenes MGAS10270] >gi|94546012|gb|ABF36059.1| Transcriptional regulatory protein ciaR [Streptococcus pyogenes MGAS2096] >gi|94548001|gb|ABF38047.1| Transcriptional regulatory protein ciaR [Streptococcus pyogenes MGAS10750] >gi|134271940|emb|CAM30178.1| response regulator protein [Streptococcus pyogenes str. Manfredo] (224 aa)
Score = 128, Expect = 1.0e-05, Identities = 26/70 (37%), Positives = 46/70 (65%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKI 217
           NL ++L  ++V   G+ +E+   EFD+L + L++ N    K +IF ++WG+D D T  V++ YI K++KK+
  S:   131 NLVVDLARKEVKVEGKVVELLGKEFDLLVYLLQNQNVILPKTQIFDRLWGFDSDTTISVVEVYISKIRKKL 201
>gi|95928481|ref|ZP_01311228.1| two component transcriptional regulator, winged helix family [Desulfuromonas acetoxidans DSM 684] >gi|95135271|gb|EAT16923.1| two component transcriptional regulator, winged helix family [Desulfuromonas acetoxidans DSM 684] (223 aa)
Score = 128, Expect = 1.0e-05, Identities = 26/77 (33%), Positives = 48/77 (62%)
  Q:   144 IWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD-DDPTGLVIQYIYKLKKKIGKD 220
           I+  +L ++ +  KVW + +EI++T  E+ +L++F+ +PN   ++  I + VW Y  D  T ++  Y+  L+KKI KD
  S:   127 IYFADLRLDPVTHKVWRADKEIDLTAKEYGLLEYFMRNPNQVLTRTMIAEHVWDYTFDSFTNIIDVYVNYLRKKIDKD 204
>gi|89896827|ref|YP_520314.1| hypothetical protein DSY4081 [Desulfitobacterium hafniense Y51] >gi|89336275|dbj|BAE85870.1| hypothetical protein [Desulfitobacterium hafniense Y51] (234 aa)
Score = 128, Expect = 1.0e-05, Identities = 25/72 (34%), Positives = 47/72 (65%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWG--YDDDPTGLVIQYIYKLKKKIGKD 220
           L +N    +V+  G+ + +T  EF++L F  EHP+  F++E++F  +WG  Y +D + + + +I KL++KI +D
  S:   143 LEINCESHEVFVRGKPVYLTPKEFELLTFMAEHPDQVFTREQLFAHMWGDEYVNDTSTITV-FIRKLREKIERD 215
>gi|119717917|ref|YP_924882.1| response regulator receiver [Nocardioides sp. JS614] >gi|119538578|gb|ABL83195.1| response regulator receiver [Nocardioides sp. JS614] (236 aa)
Score = 128, Expect = 1.0e-05, Identities = 25/70 (35%), Positives = 44/70 (62%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKI 217
           +L ++   R+V+ +G+E+ +T  EF++L+F + +P    SK +I  +VW YD      V++ YI  L+KKI
  S:   144 DLELDEDSREVFRAGREVTLTATEFELLRFLMRNPRRVLSKAQILDRVWNYDFGGQANVVELYISYLRKKI 214
>gi|82502198|gb|ABB80126.1| SubR [Bacillus subtilis] (238 aa)
Score = 128, Expect = 1.0e-05, Identities = 29/72 (40%), Positives = 45/72 (62%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWG---YDDDPTGLVIQYIYKLKKKIGKD 220
           L+++L    V   GQEI +T  EF++LKFF  +P   F+K ++F+  W     +DD T  V+ +I +L+KKI  D
  S:   141 LTIDLKTYTVTAGGQEISLTAKEFELLKFFASNPGQVFTKTQLFRNAWSDQYIEDDNT--VMVHIRRLRKKIEPD 213
>gi|16078390|ref|NP_389208.1| hypothetical protein BSU13250 [Bacillus subtilis subsp. subtilis str. 168] >gi|23396975|sp|O34903|YKOG_BACSU Uncharacterized sensory transduction protein ykoG >gi|2632045|emb|CAA05604.1| YkoG [Bacillus subtilis] >gi|2633679|emb|CAB13182.1| ykoG [Bacillus subtilis subsp. subtilis str. 168] (228 aa)
Score = 128, Expect = 1.1e-05, Identities = 26/71 (36%), Positives = 44/71 (61%)
  Q:   147 NNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDD-DPTGLVIQYIYKLKKKI 217
           ++L +N   R+V    +E+E+T  EFD+L + L+HP    ++E+I   VWG+D    T +V  YI  ++KK+
  S:   136 DDLRVNEKTREVRRGDKEVELTPREFDLLVYMLKHPQQVLTREQILSSVWGFDYIGDTNVVDVYIRYIRKKL 207
>gi|170783035|ref|YP_001711369.1| putative transcriptional regulatory protein [Clavibacter michiganensis subsp. sepedonicus] >gi|169157605|emb|CAQ02803.1| putative transcriptional regulatory protein [Clavibacter michiganensis subsp. sepedonicus] (230 aa)
Score = 128, Expect = 1.1e-05, Identities = 26/75 (34%), Positives = 50/75 (66%)
  Q:   162 GQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDD-DPTGLVIQYIYKLKKKIGK-DNIVSSTYN-GYCFKLRE 236
           G+ +++T  EF++L+FF  HP+  F++E++  +VWGYD    T  V  ++ +L+ K+G  ++++ +  N GY F + E
  S:   141 GKPLDLTFKEFELLRFFASHPSRVFTREQLLSEVWGYDYFGGTRTVDVHVRRLRAKLGDLESLIGTVRNVGYRFNVYE 218
>gi|148273685|ref|YP_001223246.1| transcriptional regulator [Clavibacter michiganensis subsp. michiganensis NCPPB 382] >gi|147831615|emb|CAN02583.1| transcriptional regulator [Clavibacter michiganensis subsp. michiganensis NCPPB 382] (232 aa)
Score = 128, Expect = 1.1e-05, Identities = 26/75 (34%), Positives = 50/75 (66%)
  Q:   162 GQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDD-DPTGLVIQYIYKLKKKIGK-DNIVSSTYN-GYCFKLRE 236
           G+ +++T  EF++L+FF  HP+  F++E++  +VWGYD    T  V  ++ +L+ K+G  ++++ +  N GY F + E
  S:   141 GKPLDLTFKEFELLRFFASHPSRVFTREQLLSEVWGYDYFGGTRTVDVHVRRLRAKLGDLESLIGTVRNVGYRFNVYE 218
>gi|119962132|ref|YP_946602.1| two-component system response regulator [Arthrobacter aurescens TC1] >gi|119948991|gb|ABM07902.1| two-component system response regulator [Arthrobacter aurescens TC1] (246 aa)
Score = 128, Expect = 1.1e-05, Identities = 29/103 (28%), Positives = 58/103 (56%)
  Q:   115 DFFTPSLFFQTLLNIFHKV---EVINLMNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKI 217
           D+ T     + +L   H++     +  M+   +   +L++N+  R+V   G++I +T  +F++L++ +E+P    SK +I  +VW YD      +++ YI  L+KKI
  S:   118 DYVTKPFSMEEVLLRLHRLVQRSGVAAMDTAELVVGDLTLNVDTREVTRGGEDISLTATQFELLRYLMENPKRVVSKAQILDRVWDYDFGGQANIVELYISYLRKKI 224
>gi|167760992|ref|ZP_02433119.1| hypothetical protein CLOSCI_03390 [Clostridium scindens ATCC 35704] >gi|167661371|gb|EDS05501.1| hypothetical protein CLOSCI_03390 [Clostridium scindens ATCC 35704] (235 aa)
Score = 128, Expect = 1.1e-05, Identities = 27/65 (41%), Positives = 44/65 (67%)
  Q:   157 KVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD---DDPTGLVIQYIYKLKKKIGKDN 221
           KV+   +EI     EF++L+F   +PN  FSKE++F+K+WGYD   D  T  V+ +I ++++KI  D+
  S:   152 KVYKGEKEIRFPNREFELLQFLAMNPNIVFSKEQLFEKIWGYDYVGDSAT--VMVHINRIREKIEDDS 217
>gi|119718459|ref|YP_925424.1| transcriptional regulator domain-containing protein [Nocardioides sp. JS614] >gi|119539120|gb|ABL83737.1| transcriptional regulator domain protein [Nocardioides sp. JS614] (257 aa)
Score = 128, Expect = 1.1e-05, Identities = 27/73 (36%), Positives = 49/73 (67%)
  Q:   162 GQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDD-DPTGLVIQYIYKLKKKIGKDN--IVSSTYN-GYCFKL 234
           G+ +++T  EF++LKF  +HP   FS++++ ++VWGYD    T  V  ++ +L+ K+G +N  ++ +  N GY F L
  S:   148 GRPLDLTFKEFELLKFLAQHPGRVFSRQQLLQEVWGYDYFGGTRTVDVHVRRLRAKLGPENETLIGTVRNVGYRFVL 224
>gi|109647085|ref|ZP_01370989.1| two component transcriptional regulator, winged helix family [Desulfitobacterium hafniense DCB-2] >gi|109642331|gb|EAT51885.1| two component transcriptional regulator, winged helix family [Desulfitobacterium hafniense DCB-2] (233 aa)
Score = 128, Expect = 1.1e-05, Identities = 23/60 (38%), Positives = 39/60 (65%)
  Q:   161 SGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDD-PTGLVIQYIYKLKKKIGKD 220
           +G+ +E+T  EF++L+F   HPN   ++E+IF  VWG+++      V  +I KL++KI  D
  S:   151 AGRPLELTTKEFELLRFLALHPNQVLTREQIFANVWGFNESGDLNTVTVHIKKLREKIESD 211
>gi|145619558|ref|ZP_01775606.1| two component transcriptional regulator, winged helix family [Geobacter bemidjiensis Bem] >gi|144944129|gb|EDJ79206.1| two component transcriptional regulator, winged helix family [Geobacter bemidjiensis Bem] >gi|197086920|gb|ACH38191.1| two component transcriptional regulator, winged helix family [Geobacter bemidjiensis Bem] (235 aa)
Score = 128, Expect = 1.1e-05, Identities = 29/86 (33%), Positives = 52/86 (60%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWG--YDDDPTGLVIQYIYKLKKKIGKD-----NIVSSTYNGYCFK 233
           +L+++L  R+V   G E+++T  E+D+L+  + H +   +  +I K++WG  Y D P  L +  I  L+KK+ +D     +I +    GY FK
  S:   140 DLTVDLNLRRVTVEGAEVQLTPTEYDLLRLLITHADKVITHSQILKQIWGVAYQDQPQVLRVT-ISNLRKKVERDPSRPRHITTEPGVGYRFK 231
>gi|4481749|gb|AAD21216.2| BacR [Bacillus licheniformis] (238 aa)
Score = 128, Expect = 1.1e-05, Identities = 29/72 (40%), Positives = 45/72 (62%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWG---YDDDPTGLVIQYIYKLKKKIGKD 220
           L+++L    V   GQEI +T  EF++LKFF  +P   F+K ++F+  W     +DD T  V+ +I +L+KKI  D
  S:   141 LTIDLKTYTVTAGGQEISLTAKEFELLKFFASNPGQVFTKTQLFRNAWSDQYIEDDNT--VMVHIRRLRKKIEPD 213
>gi|27376207|ref|NP_767736.1| phosphate regulon, two-component response regulator [Bradyrhizobium japonicum USDA 110] >gi|2769532|emb|CAA11074.1| phosphate regulatory protein [Bradyrhizobium japonicum] >gi|27349347|dbj|BAC46361.1| phosphate regulon, two-component response regulator [Bradyrhizobium japonicum USDA 110] (235 aa)
Score = 128, Expect = 1.1e-05, Identities = 34/102 (33%), Positives = 60/102 (58%)
  Q:   139 MNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD---DDPTGLVIQYIYKLKK--KIGKDNIVSSTYNGYCFKLRESFRK 240
           +  V+ +G+ + ++   R+V  SG+ I++   E+ +L+FFLEHP   FS+E++   VWG D   D+ T  V  +I +L+K   +G++     T  G  + L + F K
  S:   128 LATVLAYGD-IELDRDKRRVARSGRPIDLGPTEYRLLEFFLEHPGRVFSREQLLDSVWGRDIYIDERT--VDVHIGRLRKLLNLGREQDPIRTVRGAGYALDDRFAK 231
>gi|150019401|ref|YP_001311655.1| two component transcriptional regulator [Clostridium beijerinckii NCIMB 8052] >gi|149905866|gb|ABR36699.1| two component transcriptional regulator, winged helix family [Clostridium beijerinckii NCIMB 8052] (228 aa)
Score = 128, Expect = 1.1e-05, Identities = 28/78 (35%), Positives = 47/78 (60%)
  Q:   143 IIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD-DDPTGLVIQYIYKLKKKIGKD 220
           II    L +     KV+ +G+E+ +T  E++++ F   +PN  F+K+++F ++WG D    T  V  +I KL+KKI KD
  S:   131 IISHKALEIRTDSHKVFVNGKEVILTTKEYELMVFLASNPNIVFTKDQLFDRIWGEDYYGDTATVAVHIQKLRKKIEKD 209
>gi|46202620|ref|ZP_00052911.2| COG0745: Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Magnetospirillum magnetotacticum MS-1] (225 aa)
Score = 128, Expect = 1.1e-05, Identities = 25/73 (34%), Positives = 44/73 (60%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKKIGKD 220
           +L M+L+ R V   GQEI++   EF +L++ + H     ++  + + VW Y  DP T L+  +I +L++K+ KD
  S:   132 DLEMDLLARAVTRGGQEIDLQPREFRLLEYLMRHAGQVVTRTMLLENVWEYHFDPQTNLIDVHISRLRQKVDKD 205
>gi|152969448|ref|YP_001334557.1| putative positive response regulator [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] >gi|150954297|gb|ABR76327.1| putative positive response regulator [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] (238 aa)
Score = 127, Expect = 1.1e-05, Identities = 24/74 (32%), Positives = 45/74 (60%)
  Q:   147 NNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGKD 220
           + LS++ + R+V   G+ +++T  EFD+L +F  HP   FS+  + ++VWGY  +     +  +I +L+ KI +D
  S:   138 HGLSIDPLSREVKLRGETVDLTPREFDLLYYFARHPGEVFSRLALLEQVWGYQHEGYEHTVNTHINRLRSKIERD 212
>gi|167753811|ref|ZP_02425938.1| hypothetical protein ALIPUT_02096 [Alistipes putredinis DSM 17216] >gi|167658436|gb|EDS02566.1| hypothetical protein ALIPUT_02096 [Alistipes putredinis DSM 17216] (225 aa)
Score = 127, Expect = 1.2e-05, Identities = 31/85 (36%), Positives = 48/85 (56%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQY-IYKLKKKIGK--DNIVSSTYNGYCFK 233
           L ++L  +    +GQE+ +TK EF+IL   L HP   FS+E+I  +VW  +       I   I +L+KKIG    ++V+    GY F+
  S:   137 LCLDLQSKVCRVNGQEVPLTKKEFEILTLLLSHPRVIFSREQILARVWNNEVIVLDRTIDVNITRLRKKIGPYGSHLVTRLGYGYGFE 224
>gi|154498856|ref|ZP_02037234.1| hypothetical protein BACCAP_02848 [Bacteroides capillosus ATCC 29799] >gi|150272114|gb|EDM99329.1| hypothetical protein BACCAP_02848 [Bacteroides capillosus ATCC 29799] (208 aa)
Score = 127, Expect = 1.2e-05, Identities = 26/91 (28%), Positives = 55/91 (60%)
  Q:   143 IIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDD-PTGLVIQYIYKLKKKIG--KDNIVSSTYNGYCFK 233
           I +  +L+++  +R ++  G+ + + K EFDI++   ++P   F KE I++++WGYD +  + +V ++I +++ K+    D I   T  G  +K
  S:   112 IKFAGDLTIDYSERCLFFDGKRLGLAKKEFDIVELLSQNPGQVFDKERIYERIWGYDSEGDSSVVAEHIRRIRSKLAAYTDRIYIETVWGCGYK 205
>gi|114567685|ref|YP_754839.1| response regulator receiver protein [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|114338620|gb|ABI69468.1| response regulator receiver protein [Syntrophomonas wolfei subsp. wolfei str. Goettingen] (223 aa)
Score = 127, Expect = 1.2e-05, Identities = 29/87 (33%), Positives = 50/87 (57%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGK--DNIVSSTYNGYCFKL 234
           + ++NL   ++      + +T+ EFDI+++F+  PN   SK+E+ +KVWG+D +     I+ YI  L+KK+         ST  G  +KL
  S:   132 DFTLNLSTYELEGKNSSVRLTRKEFDIMRYFVYRPNRVLSKDELIEKVWGFDSEADYNNIEVYISFLRKKLAHIGSQAAISTLRGIGYKL 221
>gi|126651117|ref|ZP_01723327.1| transcription response regulator-like protein [Bacillus sp. B14905] >gi|126591955|gb|EAZ86021.1| transcription response regulator-like protein [Bacillus sp. B14905] (220 aa)
Score = 127, Expect = 1.3e-05, Identities = 41/131 (31%), Positives = 70/131 (53%)
  Q:   106 KGFEFCVSLDFFTPSLFFQTLLNIFHKVEVINLMNNVIIWGNNLSMNLID-----RKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD-DDPTGLVIQYIYKLKKKIGKDNIVSSTYNGYCFKLRE 236
           KGF+  +  D+ T    F  L+    +V+ +   +N   WGN+L+ N ++      K + + +EI +T  EF+IL+  L +     ++E I +KVWGYD    T ++  +I  L+KK+    I   T  G  +K+ E
  S:    90 KGFDLGID-DYITKPFSFHVLI---RRVQAVLRRSNHKNWGNHLNFNELNVDCDGYKAYVNKEEIPLTTKEFEILQLLLHNEKKVLTREIIVEKVWGYDYSGETRMIDTHIKNLRKKLNLPYI--KTVKGIGYKIDE 220
>gi|56962170|ref|YP_173893.1| two-component response regulator [Bacillus clausii KSM-K16] >gi|56908405|dbj|BAD62932.1| two-component response regulator [Bacillus clausii KSM-K16] (222 aa)
Score = 127, Expect = 1.3e-05, Identities = 33/103 (32%), Positives = 55/103 (53%)
  Q:   115 DFFTPSLFFQTLLNIFHKVEVINLMNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD-DDPTGLVIQYIYKLKKKI 217
           D+ T   F + LL     +      NN + WG  L+MN    +V   GQE+ +TK E+++L + L + N   S+E I + VWGY+    T +V  +I  +++K+
  S:    98 DYMTKPFFIEELLARIRVIFREKTTNNSLHWGE-LTMNPDTYQVIVKGQELGLTKKEYELLYYLLVNRNIALSRENIIENVWGYEYYGDTNIVDVFIKNIRRKL 200
>gi|153011101|ref|YP_001372315.1| two component transcriptional regulator [Ochrobactrum anthropi ATCC 49188] >gi|151562989|gb|ABS16486.1| two component transcriptional regulator, winged helix family [Ochrobactrum anthropi ATCC 49188] (233 aa)
Score = 127, Expect = 1.3e-05, Identities = 45/185 (24%), Positives = 89/185 (48%)
  Q:    53 LTTVHASVVIFDNIPSDQIDEAMVKKIKLISPITHFVYFCENYDEDTFLSVLQKGFEFCVSLDFFTPSLFFQTLLNIFHKVEVINLMNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQYIYKLKKKIGKDN-----IVSSTYNGYCFKLRES 237
           +TT    +V+ D    D    A++++ +        +      DE   +  L++G +  V   F    L  +  + + H+++        +   + L+++L+ R V  +G+EI+++  E+DIL+  ++H     +   I  +VWG   D   L I Y+ +L++KI K       I++ T  GY  +LRE+
  S:    45 ITTEKPDIVVLDLGLPDTDGHALLQRWRETGVTLPILVLSSRTDEAGIVRALEEGADDYVPKPFGMKELAARLRVALRHRLQ--QQGEKPLFQSDGLTVDLVRRIVKLNGEEIKLSPKEYDILRLLVQHAGKVLTHHFILSQVWGPAADVQYLRI-YVRQLRQKIEKSPDQPHYILTETGVGY--RLREA 229
>gi|187919209|ref|YP_001888240.1| two component transcriptional regulator, winged helix family [Burkholderia phytofirmans PsJN] >gi|187717647|gb|ACD18870.1| two component transcriptional regulator, winged helix family [Burkholderia phytofirmans PsJN] (245 aa)
Score = 127, Expect = 1.3e-05, Identities = 25/72 (34%), Positives = 42/72 (58%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGKD 220
           LS++ + R+    G+ IE+T  EFD+L +F +HP   FS+ ++   VWGY  +     +  +I +L+ KI  D
  S:   142 LSIDPLTREAAVDGKPIELTPREFDLLYYFAQHPGKVFSRMDLLNAVWGYQHEGYEHTVNTHINRLRAKIEAD 214
>gi|86747907|ref|YP_484403.1| two component transcriptional regulator [Rhodopseudomonas palustris HaA2] >gi|86570935|gb|ABD05492.1| two component transcriptional regulator, winged helix family [Rhodopseudomonas palustris HaA2] (233 aa)
Score = 127, Expect = 1.3e-05, Identities = 35/102 (34%), Positives = 60/102 (58%)
  Q:   139 MNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD---DDPTGLVIQYIYKLKKKI--GKDNIVSSTYNGYCFKLRESFRK 240
           +  V+ +G+ L ++   R+V  SG+ I++   E+ +L+FFLEHP   FS+E++   VWG D   D+ T  V  +I +L+K +  G++     T  G  + L + F K
  S:   128 LATVLTYGD-LELDRDKRRVARSGRPIDLGPTEYRLLEFFLEHPGRVFSREQLLDGVWGRDIYIDERT--VDVHIGRLRKLLNPGREQDPIRTVRGAGYALDDRFAK 231
>gi|115526874|ref|YP_783785.1| two component transcriptional regulator [Rhodopseudomonas palustris BisA53] >gi|115520821|gb|ABJ08805.1| two component transcriptional regulator, winged helix family [Rhodopseudomonas palustris BisA53] (234 aa)
Score = 127, Expect = 1.3e-05, Identities = 35/102 (34%), Positives = 60/102 (58%)
  Q:   139 MNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD---DDPTGLVIQYIYKLKKKI--GKDNIVSSTYNGYCFKLRESFRK 240
           +  V+ +G+ L ++   R+V  SG+ I++   E+ +L+FFLEHP   FS+E++   VWG D   D+ T  V  +I +L+K +  G++     T  G  + L + F K
  S:   128 LATVLTYGD-LELDRDKRRVARSGRPIDLGPTEYRLLEFFLEHPGRVFSREQLLDGVWGRDIYIDERT--VDVHIGRLRKLLNPGREQDPIRTVRGAGYALDDRFAK 231
>gi|91975373|ref|YP_568032.1| winged helix family two component transcriptional regulator [Rhodopseudomonas palustris BisB5] >gi|91681829|gb|ABE38131.1| two component transcriptional regulator, winged helix family [Rhodopseudomonas palustris BisB5] (233 aa)
Score = 127, Expect = 1.3e-05, Identities = 35/102 (34%), Positives = 60/102 (58%)
  Q:   139 MNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD---DDPTGLVIQYIYKLKKKI--GKDNIVSSTYNGYCFKLRESFRK 240
           +  V+ +G+ L ++   R+V  SG+ I++   E+ +L+FFLEHP   FS+E++   VWG D   D+ T  V  +I +L+K +  G++     T  G  + L + F K
  S:   128 LATVLTYGD-LELDRDKRRVARSGRPIDLGPTEYRLLEFFLEHPGRVFSREQLLDGVWGRDIYIDERT--VDVHIGRLRKLLNPGREQDPIRTVRGAGYALDDRFAK 231
>gi|168184842|ref|ZP_02619506.1| DNA-binding response regulator [Clostridium botulinum Bf] >gi|182672112|gb|EDT84073.1| DNA-binding response regulator [Clostridium botulinum Bf] (228 aa)
Score = 127, Expect = 1.4e-05, Identities = 25/83 (30%), Positives = 47/83 (56%)
  Q:   117 FTPSLFFQTLLNIFHKVEVINLMNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD 199
           F P      +  I  +V  +   ++ II G    ++L  +K++ + +EI+IT  E+ ++K F+E+P   F+++E+   VWGYD
  S:   104 FNPLELTLRIKAILRRVNAVKESDDNIITGGPFKIDLYSKKIYKNEEEIDITPTEYLLMKIFIENPGKAFNRDELLDLVWGYD 186
>gi|148378355|ref|YP_001252896.1| DNA-binding response regulator [Clostridium botulinum A str. ATCC 3502] >gi|153933802|ref|YP_001382754.1| DNA-binding response regulator [Clostridium botulinum A str. ATCC 19397] >gi|153934962|ref|YP_001386305.1| DNA-binding response regulator [Clostridium botulinum A str. Hall] >gi|153938363|ref|YP_001389720.1| DNA-binding response regulator [Clostridium botulinum F str. Langeland] >gi|168177695|ref|ZP_02612359.1| DNA-binding response regulator [Clostridium botulinum NCTC 2916] >gi|148287839|emb|CAL81905.1| two-component response regulator [Clostridium botulinum A str. ATCC 3502] >gi|152929846|gb|ABS35346.1| DNA-binding response regulator [Clostridium botulinum A str. ATCC 19397] >gi|152930876|gb|ABS36375.1| DNA-binding response regulator [Clostridium botulinum A str. Hall] >gi|152934259|gb|ABS39757.1| DNA-binding response regulator [Clostridium botulinum F str. Langeland] >gi|182670981|gb|EDT82955.1| DNA-binding response regulator [Clostridium botulinum NCTC 2916] (228 aa)
Score = 127, Expect = 1.4e-05, Identities = 25/83 (30%), Positives = 47/83 (56%)
  Q:   117 FTPSLFFQTLLNIFHKVEVINLMNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD 199
           F P      +  I  +V  +   ++ II G    ++L  +K++ + +EI+IT  E+ ++K F+E+P   F+++E+   VWGYD
  S:   104 FNPLELTLRIKAILRRVNAVKESDDNIITGGPFKIDLYSKKIYKNEEEIDITPTEYLLMKIFIENPGKAFNRDELLDLVWGYD 186
>gi|170760898|ref|YP_001785689.1| DNA-binding response regulator [Clostridium botulinum A3 str. Loch Maree] >gi|169407887|gb|ACA56298.1| DNA-binding response regulator [Clostridium botulinum A3 str. Loch Maree] (228 aa)
Score = 127, Expect = 1.4e-05, Identities = 25/83 (30%), Positives = 47/83 (56%)
  Q:   117 FTPSLFFQTLLNIFHKVEVINLMNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD 199
           F P      +  I  +V  +   ++ II G    ++L  +K++ + +EI+IT  E+ ++K F+E+P   F+++E+   VWGYD
  S:   104 FNPLELTLRIKAILRRVNAVKESDDNIITGGPFKIDLYSKKIYKNEEEIDITPTEYLLMKIFIENPGKAFNRDELLDLVWGYD 186
>gi|158334650|ref|YP_001515822.1| two-component transcriptional regulator [Acaryochloris marina MBIC11017] >gi|158304891|gb|ABW26508.1| two-component transcriptional regulator [Acaryochloris marina MBIC11017] (224 aa)
Score = 127, Expect = 1.4e-05, Identities = 27/90 (30%), Positives = 54/90 (60%)
  Q:   147 NNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGY----DDDPTGLVIQYIYKLKKKIGKDNIVSSTYNGYCFKLRE 236
           +NL++N   R+++   + IE+T  EFD+L + + HP    +++ I ++VWGY    D +   + I+Y+ +LK +  ++  +  T  G  + +RE
  S:   132 SNLTLNQRTREIFRGERSIELTAKEFDLLVYLMMHPRQVLTRDRILEQVWGYDFMGDSNIIEVYIRYL-RLKLEENQEKRLIQTVRGVGYVMRE 224
>gi|49477181|ref|YP_035526.1| response regulator [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|49328737|gb|AAT59383.1| response regulator [Bacillus thuringiensis serovar konkukian str. 97-27] (223 aa)
Score = 127, Expect = 1.4e-05, Identities = 29/84 (34%), Positives = 50/84 (59%)
  Q:   151 MNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD-DDPTGLVIQYIYKLKKKIGKD-NIVSSTYN-GYCFKL 234
           +N   RK+   G+ I +T  EFD+L F  +H    FS+E++ +KVWGYD    T  V  ++  ++ K+G+  N + + +  GY F++
  S:   137 INEKSRKIEADGEPISLTVKEFDLLYFLCQHTGQVFSREQLLEKVWGYDYAGSTRTVDTHVKTMRLKLGESGNYIQTVWGVGYKFEV 223
>gi|119468896|ref|ZP_01611921.1| phosphate regulon transcriptional regulatory protein phoB [Alteromonadales bacterium TW-7] >gi|119447548|gb|EAW28815.1| phosphate regulon transcriptional regulatory protein phoB [Alteromonadales bacterium TW-7] (229 aa)
Score = 127, Expect = 1.4e-05, Identities = 31/102 (30%), Positives = 54/102 (52%)
  Q:   117 FTPSLFFQTLLNIFHKVEVINLMNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWG---YDDDPTGLVIQYIYKLKKKIG 218
           F+P      +  +  +V   +L   + + G  L ++ I  +V   G E+++   EF +L FF+ HP   +S+E++   VWG   Y +D T  V  +I +L+K IG
  S:   107 FSPKELMARIKAVIRRVSPTSLEEAIEVHG--LRLDPISHRVTSEGNELDMGPTEFRLLHFFMTHPERVYSREQLLDHVWGTNVYVEDRT--VDVHIRRLRKAIG 207
>gi|149375578|ref|ZP_01893348.1| response regulator, OmpR-family protein [Marinobacter algicola DG893] >gi|149360283|gb|EDM48737.1| response regulator, OmpR-family protein [Marinobacter algicola DG893] (236 aa)
Score = 127, Expect = 1.4e-05, Identities = 26/72 (36%), Positives = 43/72 (59%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGKD 220
           L ++   R+V+   QE+E+T  EFD+L  F  HP   FS+ ++  KVWGY+ +     +  +I +L+ KI +D
  S:   145 LRIDPTRRRVFVWEQEVELTAREFDLLWHFASHPGRVFSRVQLLDKVWGYNHEGYEHTVNTHINRLRGKIEQD 217
>gi|194534953|ref|YP_002070145.1| transcriptional regulator [Vibrio cholerae RC385] >gi|150419747|gb|EDN12063.1| transcriptional regulator [Vibrio cholerae RC385] (224 aa)
Score = 126, Expect = 1.5e-05, Identities = 28/70 (40%), Positives = 40/70 (57%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKKI 217
           +L + L   +V+ + Q I +T  E  IL+ FL  P   FS+E I   VWG   DP T +V  Y+ +L+KKI
  S:   132 DLELCLSTMRVYRAEQPIGLTAKEISILELFLRKPGHIFSRERILANVWGIHQDPLTNVVDVYMRRLRKKI 202
>gi|167766653|ref|ZP_02438706.1| hypothetical protein CLOSS21_01159 [Clostridium sp. SS2/1] >gi|167711776|gb|EDS22355.1| hypothetical protein CLOSS21_01159 [Clostridium sp. SS2/1] (229 aa)
Score = 126, Expect = 1.5e-05, Identities = 24/69 (34%), Positives = 42/69 (60%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKI 217
           L ++   R+V   G+E+ +T  EFD+L+  + HPN  +S+E++   VWGYD       +  +I +L++KI
  S:   138 LKIDCESRRVHIHGKEVNLTAKEFDLLELLVFHPNKVYSREDLLNTVWGYDYPGDARTVDVHIRRLREKI 207
>gi|52144036|ref|YP_082792.1| response regulator [Bacillus cereus E33L] >gi|118476873|ref|YP_894024.1| response regulator [Bacillus thuringiensis str. Al Hakam] >gi|166991944|ref|ZP_02258404.1| response regulator [Bacillus cereus AH820] >gi|196035354|ref|ZP_03102759.1| DNA-binding response regulator [Bacillus cereus W] >gi|196040638|ref|ZP_03107937.1| DNA-binding response regulator [Bacillus cereus NVH0597-99] >gi|196046479|ref|ZP_03113704.1| DNA-binding response regulator [Bacillus cereus 03BB108] >gi|51977505|gb|AAU19055.1| response regulator [Bacillus cereus E33L] >gi|118416098|gb|ABK84517.1| response regulator [Bacillus thuringiensis str. Al Hakam] >gi|195992031|gb|EDX55994.1| DNA-binding response regulator [Bacillus cereus W] >gi|196022663|gb|EDX61345.1| DNA-binding response regulator [Bacillus cereus 03BB108] >gi|196028428|gb|EDX67036.1| DNA-binding response regulator [Bacillus cereus NVH0597-99] (223 aa)
Score = 126, Expect = 1.5e-05, Identities = 29/84 (34%), Positives = 50/84 (59%)
  Q:   151 MNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD-DDPTGLVIQYIYKLKKKIGKD-NIVSSTYN-GYCFKL 234
           +N   RK+   G+ I +T  EFD+L F  +H    FS+E++ +KVWGYD    T  V  ++  ++ K+G+  N + + +  GY F++
  S:   137 INEKSRKIEADGEPISLTVKEFDLLYFLCQHTGQVFSREQLLEKVWGYDYAGSTRTVDTHVKTMRLKLGESGNYIQTVWGVGYKFEV 223
>gi|153955055|ref|YP_001395820.1| transcriptional regulator [Clostridium kluyveri DSM 555] >gi|146347913|gb|EDK34449.1| Predicted transcriptional regulator [Clostridium kluyveri DSM 555] (162 aa)
Score = 126, Expect = 1.5e-05, Identities = 36/98 (36%), Positives = 55/98 (56%)
  Q:   137 NLMNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD-DDPTGLVIQYIYKLKKKIGKDN-----IVSSTYNGYCFKL 234
           N  ++ II    L +N    +V  +G+E+++T  E++IL F   +PN  F+K  IF  +WG +       V  +I K++KKI KD      I +S   GY FKL
  S:    59 NNFSSEIIAVKGLEINRASHRVTVNGKEVKLTSKEYEILVFLASNPNIVFTKGNIFDSIWGSEFIGDLATVAVHIQKIRKKIEKDPQNPEFIETSWGTGYRFKL 162
>gi|148243511|ref|YP_001228668.1| two-component system response regulator [Synechococcus sp. RCC307] >gi|147851821|emb|CAK29315.1| Two-component system response regulator [Synechococcus sp. RCC307] (229 aa)
Score = 126, Expect = 1.5e-05, Identities = 28/88 (31%), Positives = 51/88 (57%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGY----DDDPTGLVIQYIYKLKKKIGKDNIVSSTYNGYCFKLR 235
           +L +N  +R+    GQE+ +T  EFD+L+ FL +P    S+ ++ + VWG     DD+   + ++Y+ +  +++  D I+  T  G  F LR
  S:   136 DLHLNGAERRCSYGGQELTLTVREFDLLECFLRNPRQALSRTQLIQNVWGEDYFGDDNVVDVYVRYLRRKLEEVKPDRII-QTIRGIGFALR 226
>gi|163749364|ref|ZP_02156613.1| DNA-binding response regulator [Shewanella benthica KT99] >gi|161331083|gb|EDQ02009.1| DNA-binding response regulator [Shewanella benthica KT99] (224 aa)
Score = 126, Expect = 1.5e-05, Identities = 27/77 (35%), Positives = 43/77 (55%)
  Q:   156 RKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGKDNIVSSTYNGYCF 232
           + V   G+  E+T  EF +LK FL  P    SK ++  K++ +DD+    V++ Y+  L+KK+GK  I +    GY F
  S:   142 QSVSVEGKSFELTAMEFRLLKIFLMSPKKLLSKSQLSDKLYQFDDEKESNVVEVYVTHLRKKLGKTTIETRRGQGYIF 219
>gi|16125542|ref|NP_420106.1| DNA-binding response regulator [Caulobacter crescentus CB15] >gi|13422630|gb|AAK23274.1| DNA-binding response regulator [Caulobacter crescentus CB15] (242 aa)
Score = 126, Expect = 1.5e-05, Identities = 26/77 (33%), Positives = 42/77 (54%)
  Q:   141 NVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKKI 217
           N  +   N+ ++    +V   G+E+ +T  E  +L+ FL  P    S+E I   VWG D+DP T +V  Y+ +L+ KI
  S:   135 NRTLKAGNVELDRTTMRVSRDGEEVVLTARELALLELFLSSPGRVLSRERILSNVWGVDEDPLTNVVDVYVRRLRAKI 212
>gi|167761524|ref|ZP_02433651.1| hypothetical protein CLOSCI_03935 [Clostridium scindens ATCC 35704] >gi|167661190|gb|EDS05320.1| hypothetical protein CLOSCI_03935 [Clostridium scindens ATCC 35704] (224 aa)
Score = 126, Expect = 1.6e-05, Identities = 25/88 (28%), Positives = 51/88 (57%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD-DDPTGLVIQYIYKLKKKIGKDNIVSSTYNGYCFKLRE 236
           + MNL   +V  +G+ I +T  E+++LK  +++ N   +++++ + +WGYD D  T  V  ++  L++K+G       T  G  +++RE
  S:   136 IEMNLKKHEVTAAGEVISLTLKEYELLKRLMKNSNIVLTRDQLLEDIWGYDFDGETRTVDVHVRTLRQKLGSAGERIETVRGVGYRMRE 224
>gi|144898432|emb|CAM75296.1| Response regulator receiver:Transcriptional regulatory protein, C-terminal [Magnetospirillum gryphiswaldense MSR-1] (225 aa)
Score = 126, Expect = 1.6e-05, Identities = 29/90 (32%), Positives = 52/90 (57%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKKIGK--DNIVSSTYNGYCFKLRES 237
           +L M+L+ R V  SG++I++   EF +L++ L H     ++  + + VW Y  DP T L+  +I +L++K+ K  D  +  T  G  + LR +
  S:   132 DLEMDLLARTVTRSGRDIDLQPREFRLLEYLLRHAGQVVTRTMLLENVWEYHFDPQTNLIDVHISRLRQKVDKDFDQALIHTVRGAGYTLRAA 224
>gi|83311994|ref|YP_422258.1| response regulator [Magnetospirillum magneticum AMB-1] >gi|82946835|dbj|BAE51699.1| Response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Magnetospirillum magneticum AMB-1] (225 aa)
Score = 126, Expect = 1.6e-05, Identities = 25/73 (34%), Positives = 44/73 (60%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKKIGKD 220
           +L M+L+ R V   GQEI++   EF +L++ + H     ++  + + VW Y  DP T L+  +I +L++K+ KD
  S:   132 DLEMDLLARTVTRGGQEIDLQPREFRLLEYLMRHGGQVVTRTMLLENVWEYHFDPQTNLIDVHISRLRQKVDKD 205
>gi|134099882|ref|YP_001105543.1| two-component response regulator [Saccharopolyspora erythraea NRRL 2338] >gi|133912505|emb|CAM02618.1| two-component response regulator [Saccharopolyspora erythraea NRRL 2338] (234 aa)
Score = 126, Expect = 1.6e-05, Identities = 27/104 (25%), Positives = 50/104 (48%)
  Q:   117 FTPSLFFQTLLNIFHKVEVINLMNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQYIYKLKKKIGKD 220
           F+P      + +I  +          ++    L ++L  R+    G E+ +T  EFD+L F L HP   FS+ E+ ++VWG+       V  ++ +L++K+  D
  S:   110 FSPRELVLRVASILRRARTSQPAEGEVLTDGALRLDLDARRGTLDGGELALTGREFDLLVFLLRHPGRAFSRAELLEQVWGWSFGDHSTVTVHMRRLREKVEPD 213
>gi|147678166|ref|YP_001212381.1| response regulator [Pelotomaculum thermopropionicum SI] >gi|146274263|dbj|BAF60012.1| response regulator [Pelotomaculum thermopropionicum SI] (239 aa)
Score = 126, Expect = 1.6e-05, Identities = 27/76 (35%), Positives = 49/76 (64%)
  Q:   158 VWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD---DDPTGLVIQYIYKLKKKIGK----DNIVSSTYN-GYCFK 233
           V+  G ++++T  EF++L+F    P   FS+E++ ++VWGYD   D  T  V  +I  +++K+G+    D  + +    GYCF+
  S:   152 VYVDGVKVDLTPKEFELLRFLARQPGRVFSREQLLEQVWGYDYAGDSRT--VDVHIRHIRQKLGRLSESDQPIETVRGVGYCFR 233
>gi|124521341|ref|ZP_01696288.1| two component transcriptional regulator, winged helix family [Bacillus coagulans 36D1] >gi|124496900|gb|EAY44476.1| two component transcriptional regulator, winged helix family [Bacillus coagulans 36D1] (232 aa)
Score = 126, Expect = 1.6e-05, Identities = 30/90 (33%), Positives = 54/90 (60%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD-DDPTGLVIQYIYKLKKKI--GKDNIVSSTYNGYCFKLRES 237
           +L +N   R+V   G+ IE+TK EFD+L + L++     ++E++  +VWG++    T +V  YI  L+KKI  G +  +  T  G  + ++E+
  S:   139 DLLVNTATRQVTRGGKPIELTKREFDLLCYLLKNKRIVLNREQLLNEVWGFEYAGDTNVVDVYIGYLRKKIDHGHETALIHTVRGVGYTMKET 231
>gi|158318851|ref|YP_001511359.1| winged helix family two component response transcriptional regulator [Frankia sp. EAN1pec] >gi|158114256|gb|ABW16453.1| putative two component transcriptional regulator, winged helix family [Frankia sp. EAN1pec] (134 aa)
Score = 126, Expect = 1.6e-05, Identities = 25/83 (30%), Positives = 48/83 (57%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKKIGKDNIVSSTYNGY 230
           +L+++L  R+     + +++T  EF + + FL H +   ++E++   VWGYD DP + +V  Y+  L++K+G   I +    GY
  S:    34 DLALDLRTRRARVGDRVVDLTAREFVLAETFLRHSSQVLAREQLLSAVWGYDYDPGSNIVDVYVGYLRRKLGAGRIATVRGMGY 117
>gi|186899950|ref|ZP_02972910.1| two component transcriptional regulator, winged helix family [Cyanothece sp. PCC 7424] >gi|186692886|gb|EDU17502.1| two component transcriptional regulator, winged helix family [Cyanothece sp. PCC 7424] (225 aa)
Score = 126, Expect = 1.7e-05, Identities = 28/89 (31%), Positives = 55/89 (61%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKI---GKDNIVSSTYNGYCFKLRES 237
           + ++L  R++  + +EI++T  EF++LK+ + HP    ++E+I + VWG+D      VI+ Y+  L+ K+   G+  ++  T  G  + LRE+
  S:   134 MVLDLSTRRLLINDKEIDLTMKEFELLKYLMSHPREVLTREQILENVWGFDFRGESNVIEVYVRYLRLKMENEGQKRLI-HTVRGVGYVLRET 225
>gi|196191251|gb|EDX86215.1| Transcriptional regulatory C terminal domain protein [Synechococcus sp. PCC 7335] (243 aa)
Score = 126, Expect = 1.7e-05, Identities = 30/90 (33%), Positives = 55/90 (61%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKI---GKDNIVSSTYNGYCFKLRES 237
           ++ +++  R+V    + IE+T  EF++LK+ +EHP    ++++I + VWGYD      VI+ YI  L+ K+   G+  ++  T  G  + LRE+
  S:   151 DMVLDVSQRQVLRGNRIIELTMKEFELLKYLMEHPREVLTRKQILESVWGYDFIGESNVIEVYIRYLRLKMDEEGEKRLI-QTVRGVGYVLRET 243
>gi|165870463|ref|ZP_02215118.1| DNA-binding response regulator [Bacillus anthracis str. A0488] >gi|190568741|ref|ZP_03021645.1| DNA-binding response regulator [Bacillus anthracis Tsiankovskii-I] >gi|164713958|gb|EDR19480.1| DNA-binding response regulator [Bacillus anthracis str. A0488] >gi|190560157|gb|EDV14138.1| DNA-binding response regulator [Bacillus anthracis Tsiankovskii-I] (218 aa)
Score = 126, Expect = 1.7e-05, Identities = 29/84 (34%), Positives = 50/84 (59%)
  Q:   151 MNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD-DDPTGLVIQYIYKLKKKIGK-DNIVSSTYN-GYCFKL 234
           +N   RK+   G+ I +T  EFD+L F  +H    FS+E++ +KVWGYD    T  V  ++  ++ K+G+  N + + +  GY F++
  S:   132 INEKSRKIEADGEPISLTVKEFDLLYFLCQHTGQVFSREQLLEKVWGYDYAGSTRTVDTHVKTMRLKLGEGGNYIQTVWGVGYKFEV 218
>gi|47566185|ref|ZP_00237213.1| two-component response regulator [Bacillus cereus G9241] >gi|47556738|gb|EAL15069.1| two-component response regulator [Bacillus cereus G9241] (223 aa)
Score = 126, Expect = 1.7e-05, Identities = 29/84 (34%), Positives = 50/84 (59%)
  Q:   151 MNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD-DDPTGLVIQYIYKLKKKIGKD-NIVSSTYN-GYCFKL 234
           +N   RK+   G+ I +T  EFD+L F  +H    FS+E++ +KVWGYD    T  V  ++  ++ K+G+  N + + +  GY F++
  S:   137 INEKSRKIEADGEPISLTVKEFDLLYFLCQHTGQVFSREQLLEKVWGYDYAGSTRTVDTHVKTMRLKLGESGNYIQTVWGVGYKFEV 223
>gi|30261401|ref|NP_843778.1| DNA-binding response regulator [Bacillus anthracis str. Ames] >gi|47526577|ref|YP_017926.1| DNA-binding response regulator [Bacillus anthracis str. 'Ames Ancestor'] >gi|49184231|ref|YP_027483.1| DNA-binding response regulator [Bacillus anthracis str. Sterne] >gi|65318666|ref|ZP_00391625.1| COG0745: Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Bacillus anthracis str. A2012] >gi|167634425|ref|ZP_02392746.1| DNA-binding response regulator [Bacillus anthracis str. A0442] >gi|167639277|ref|ZP_02397549.1| DNA-binding response regulator [Bacillus anthracis str. A0193] >gi|170686885|ref|ZP_02878105.1| DNA-binding response regulator [Bacillus anthracis str. A0465] >gi|170706300|ref|ZP_02896761.1| DNA-binding response regulator [Bacillus anthracis str. A0389] >gi|177651390|ref|ZP_02934179.1| DNA-binding response regulator [Bacillus anthracis str. A0174] >gi|30255255|gb|AAP25264.1| DNA-binding response regulator [Bacillus anthracis str. Ames] >gi|47501725|gb|AAT30401.1| DNA-binding response regulator [Bacillus anthracis str. 'Ames Ancestor'] >gi|49178158|gb|AAT53534.1| DNA-binding response regulator [Bacillus anthracis str. Sterne] >gi|167512716|gb|EDR88090.1| DNA-binding response regulator [Bacillus anthracis str. A0193] >gi|167530313|gb|EDR93039.1| DNA-binding response regulator [Bacillus anthracis str. A0442] >gi|170128834|gb|EDS97700.1| DNA-binding response regulator [Bacillus anthracis str. A0389] >gi|170669408|gb|EDT20151.1| DNA-binding response regulator [Bacillus anthracis str. A0465] >gi|172082668|gb|EDT67731.1| DNA-binding response regulator [Bacillus anthracis str. A0174] (223 aa)
Score = 126, Expect = 1.7e-05, Identities = 29/84 (34%), Positives = 50/84 (59%)
  Q:   151 MNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD-DDPTGLVIQYIYKLKKKIGK-DNIVSSTYN-GYCFKL 234
           +N   RK+   G+ I +T  EFD+L F  +H    FS+E++ +KVWGYD    T  V  ++  ++ K+G+  N + + +  GY F++
  S:   137 INEKSRKIEADGEPISLTVKEFDLLYFLCQHTGQVFSREQLLEKVWGYDYAGSTRTVDTHVKTMRLKLGEGGNYIQTVWGVGYKFEV 223
>gi|22537145|ref|NP_687996.1| DNA-binding response regulator CiaR [Streptococcus agalactiae 2603V/R] >gi|25011074|ref|NP_735469.1| DNA-binding response regulator CiaR [Streptococcus agalactiae NEM316] >gi|76787511|ref|YP_329701.1| DNA-binding response regulator CiaR [Streptococcus agalactiae A909] >gi|76797790|ref|ZP_00780056.1| Transcriptional regulatory protein ciaR [Streptococcus agalactiae 18RS21] >gi|77405694|ref|ZP_00782781.1| DNA-binding response regulator CiaR [Streptococcus agalactiae H36B] >gi|77409201|ref|ZP_00785911.1| DNA-binding response regulator CiaR [Streptococcus agalactiae COH1] >gi|77411995|ref|ZP_00788324.1| DNA-binding response regulator CiaR [Streptococcus agalactiae CJB111] >gi|77413624|ref|ZP_00789810.1| DNA-binding response regulator CiaR [Streptococcus agalactiae 515] >gi|22534008|gb|AAM99868.1|AE014237_2 DNA-binding response regulator CiaR [Streptococcus agalactiae 2603V/R] >gi|23095473|emb|CAD46679.1| Unknown [Streptococcus agalactiae NEM316] >gi|76562568|gb|ABA45152.1| DNA-binding response regulator CiaR [Streptococcus agalactiae A909] >gi|76586866|gb|EAO63358.1| Transcriptional regulatory protein ciaR [Streptococcus agalactiae 18RS21] >gi|77160333|gb|EAO71458.1| DNA-binding response regulator CiaR [Streptococcus agalactiae 515] >gi|77161951|gb|EAO72933.1| DNA-binding response regulator CiaR [Streptococcus agalactiae CJB111] >gi|77172177|gb|EAO75336.1| DNA-binding response regulator CiaR [Streptococcus agalactiae COH1] >gi|77175690|gb|EAO78472.1| DNA-binding response regulator CiaR [Streptococcus agalactiae H36B] (226 aa)
Score = 126, Expect = 1.7e-05, Identities = 25/78 (32%), Positives = 51/78 (65%)
  Q:   140 NNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKI 217
           +N +I+G+ + +++     + +  E+E+   EFD+L +FL++ N    K +IF ++WG+D D T  V++ Y+ K++KK+
  S:   124 DNSLIYGD-IRVDMSTNSTFVNQTEVELLGKEFDLLVYFLQNQNVILPKSQIFDRIWGFDSDTTISVVEVYVSKVRKKL 201
>gi|163814967|ref|ZP_02206354.1| hypothetical protein COPEUT_01117 [Coprococcus eutactus ATCC 27759] >gi|158449650|gb|EDP26645.1| hypothetical protein COPEUT_01117 [Coprococcus eutactus ATCC 27759] (229 aa)
Score = 126, Expect = 1.7e-05, Identities = 30/82 (36%), Positives = 45/82 (54%)
  Q:   139 MNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDD-DPTGLVIQYIYKLKKKIGKD 220
           + N +I    L ++  DR+V+   +E   T  EFDIL F   +PN  FSK+E+F K+W  D       V  +I K+++KI  D
  S:   128 LKNDVIEIRGLKIDKTDRRVYVDNEEKVFTNKEFDILCFLASNPNKVFSKDELFSKIWNMDSIGDIATVTVHIKKIREKIEFD 210
>gi|50955395|ref|YP_062683.1| GlnR family transcriptional regulator [Leifsonia xyli subsp. xyli str. CTCB07] >gi|50951877|gb|AAT89578.1| transcriptional regulator, GlnR family [Leifsonia xyli subsp. xyli str. CTCB07] (234 aa)
Score = 126, Expect = 1.7e-05, Identities = 25/73 (34%), Positives = 50/73 (68%)
  Q:   162 GQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDD-DPTGLVIQYIYKLKKKIGK-DNIVSSTYN-GYCFKL 234
           G+++++T  EF++L+FF  HP+  F++E++  +VWGYD    T  V  ++ +L+ K+G  ++++ +  N GY F +
  S:   141 GRQLDLTFKEFELLRFFATHPSRVFTREQLLSEVWGYDYFGGTRTVDVHVRRLRAKLGDLESLIGTVRNVGYRFTV 216
>gi|167939037|ref|ZP_02526112.1| DNA-binding response regulator [Bacillus cereus AH1134] (232 aa)
Score = 126, Expect = 1.8e-05, Identities = 27/65 (41%), Positives = 38/65 (58%)
  Q:   156 RKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVW--GYDDDPTGLVIQYIYKLKKKIGKD 220
           R V   G+ I++T  EFDIL     HP   +S E IF+++W   Y DD    V  +I  L+KK+G+D
  S:   147 RTVHVYGERIDLTPKEFDILYLLASHPKKVYSLENIFQQIWTNDYYDDNNNTVTVHIRTLRKKLGED 213
>gi|149374413|ref|ZP_01892187.1| DNA-binding heavy metal response regulator, putative [Marinobacter algicola DG893] >gi|149361116|gb|EDM49566.1| DNA-binding heavy metal response regulator, putative [Marinobacter algicola DG893] (221 aa)
Score = 126, Expect = 1.8e-05, Identities = 25/71 (35%), Positives = 42/71 (59%)
  Q:   162 GQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGKDNIVSSTYNGYCF 232
           G E  +T  EF +L+  +  P   FSKE++ ++++  +D P+  VI+ YI +L+K +G D I +    GY F
  S:   146 GTEHSLTGTEFRLLRCLMSRPGQVFSKEQLMEQLYNLNDTPSENVIEAYIRRLRKLVGNDTISTRRGQGYLF 217
>gi|149921141|ref|ZP_01909599.1| two-component response regulator [Plesiocystis pacifica SIR-1] >gi|149818028|gb|EDM77487.1| two-component response regulator [Plesiocystis pacifica SIR-1] (230 aa)
Score = 126, Expect = 1.8e-05, Identities = 21/56 (37%), Positives = 41/56 (73%)
  Q:   162 GQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTG-LVIQYIYKLKKKI 217
           G+E+++T  E+D+L++F+E+PN   S++E+ +KVW  D+ P   +V  +I +L+K +
  S:   151 GEELKLTALEYDLLRYFIENPNRVLSRQELQEKVWKLDNYPNSRMVDNFILRLRKHL 207
>gi|152974825|ref|YP_001374342.1| two component transcriptional regulator [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|152023577|gb|ABS21347.1| two component transcriptional regulator, winged helix family [Bacillus cereus subsp. cytotoxis NVH 391-98] (223 aa)
Score = 126, Expect = 1.8e-05, Identities = 30/86 (34%), Positives = 51/86 (59%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD-DDPTGLVIQYIYKLKKKIGKD-NIVSSTYN-GYCFKL 234
           + MN   RK   +G+ I +T  EFD+L F  +H    FS+E++ +KVWGYD    T  V  ++  ++ K+G+  N + + +  GY F++
  S:   135 IRMNEKSRKAETNGKIISLTVKEFDLLYFLCQHHGQVFSREQLLEKVWGYDYAGSTRTVDTHVKTMRLKLGESGNCIQTVWGVGYKFEV 223
>gi|157691146|ref|YP_001485608.1| response regulator [Bacillus pumilus SAFR-032] >gi|157679904|gb|ABV61048.1| response regulator [Bacillus pumilus SAFR-032] (227 aa)
Score = 126, Expect = 1.8e-05, Identities = 27/63 (42%), Positives = 46/63 (73%)
  Q:   156 RKVWCSGQEIE-ITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD---DDPTGLVIQYIYKLKKKIG 218
           R+V+  G+ IE +T  E+D+L FF++HP   FS+E++ +++WGY    D+ T  V  +I +L++KIG
  S:   143 REVFLDGEPIENLTPKEYDLLCFFIQHPRQVFSREQLLEQIWGYQFYGDERT--VDVHIKRLRQKIG 207
>gi|51893644|ref|YP_076335.1| two-component response regulator [Symbiobacterium thermophilum IAM 14863] >gi|51857333|dbj|BAD41491.1| two-component response regulator [Symbiobacterium thermophilum IAM 14863] (233 aa)
Score = 126, Expect = 1.9e-05, Identities = 28/72 (38%), Positives = 44/72 (61%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWG---YDDDPTGLVIQYIYKLKKKIGKD 220
           L ++ + R V+  G+EI +T  EFDIL     HP   FS EEIF++VW    +  + T  V+ +I +L++K+  D
  S:   142 LRIDPLGRSVFKDGREIALTPTEFDILLLLASHPGRVFSSEEIFERVWKEHYFQSNNT--VMVHIRRLREKVEDD 214
>gi|167935427|ref|ZP_02522502.1| Two-component response regulator [Bacillus cereus AH1134] >gi|168136274|ref|ZP_02579503.1| Two-component response regulator [Bacillus cereus B4264] (223 aa)
Score = 126, Expect = 1.9e-05, Identities = 20/63 (31%), Positives = 43/63 (68%)
  Q:   155 DRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKI 217
           D+ V   GQ I++T  ++++L++ +++      +E+IF +VWG+D D T  +++ Y++ L+KK+
  S:   138 DKDVQVDGQSIKLTLKQYELLEYLIQNSGKILMREQIFDRVWGFDSDTTVAIVEVYVHHLRKKL 201
>gi|169826328|ref|YP_001696486.1| putative sensory transduction protein [Lysinibacillus sphaericus C3-41] >gi|168990816|gb|ACA38356.1| Hypothetical sensory transduction protein [Lysinibacillus sphaericus C3-41] (229 aa)
Score = 125, Expect = 1.9e-05, Identities = 30/89 (33%), Positives = 53/89 (59%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD-DDPTGLVIQYIYKLKKK--IGKDNIVSSTYNGYCFKLRES 237
           LS+N   R+V   G+EI++T  E+D+L + ++HP    ++E+I + VWG+D    T +V  YI  +++K  I     +  T  G  + L+E+
  S:   136 LSINEQTREVIYYGKEIQLTPREYDLLLYLMKHPKQVLTREQILETVWGFDYYGDTNVVDVYIRYVRQKLEIANATPIIQTVRGVGYVLKEN 227
>gi|194566633|ref|YP_002101654.1| Response regulator [Burkholderia dolosa AUO158] >gi|124901385|gb|EAY72135.1| Response regulator [Burkholderia dolosa AUO158] (286 aa)
Score = 125, Expect = 1.9e-05, Identities = 26/72 (36%), Positives = 40/72 (55%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGKD 220
           LS++ I R+    G  I++T  EFD+L FF  HP   FS+ ++   VWGY  +     +  +I +L+ KI  D
  S:   189 LSIDPIAREASVDGMRIDLTPREFDLLYFFARHPGKVFSRMDLLNAVWGYQHEGYEHTVNTHINRLRAKIETD 261
>gi|47564778|ref|ZP_00235822.1| DNA-binding response regulator [Bacillus cereus G9241] >gi|47558151|gb|EAL16475.1| DNA-binding response regulator [Bacillus cereus G9241] (233 aa)
Score = 125, Expect = 1.9e-05, Identities = 27/65 (41%), Positives = 38/65 (58%)
  Q:   156 RKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVW--GYDDDPTGLVIQYIYKLKKKIGKD 220
           R V   G+ I++T  EFDIL     HP   +S E IF+++W   Y DD    V  +I  L+KK+G+D
  S:   148 RTVHVYGERIDLTPKEFDILYLLASHPKKVYSLENIFQQIWTNDYYDDNNNTVTVHIRTLRKKLGED 214
>gi|69245529|ref|ZP_00603493.1| Response regulator receiver:Transcriptional regulatory protein, C-terminal [Enterococcus faecium DO] >gi|68195780|gb|EAN10217.1| Response regulator receiver:Transcriptional regulatory protein, C-terminal [Enterococcus faecium DO] (226 aa)
Score = 125, Expect = 1.9e-05, Identities = 45/171 (26%), Positives = 85/171 (49%)
  Q:    53 LTTVHASVVIFDNIPSDQIDEAMVKKIKLISPITHFVYFCENYDEDTFLSVLQKGFEFCVSLDFFTPSLFFQTLLNIFHK--VEVINLMNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWG---YDDDPTGLVIQYIYKLKKKIGKDNIV 223
           L+T    +++ D +      EA++ +I+  S +   +      D+   +S+L  G +  V+  F    L  +  + + H+  V+V +L     I+   + ++   R V  +G  + +T  EFD+LK FLEHP   FS+  +++ VW    +D + T  V  +I  L+ K+ K + V
  S:    43 LSTYPVDLILLDLMLPGLSGEALLAEIRQTSNVP-IIVLSAKSDQRDKVSLLAAGADDYVTKPFDIEELLLRIGIQLRHQTSVQVKDLSQR--IYYKEILLDKESRDVNVNGVAVHLTGREFDLLKLFLEHPKKVFSRANLYETVWQEPYFDSEKT--VNMHISNLRGKLAKAHAV 213
>gi|166996924|ref|ZP_02263384.1| dna-binding response regulator [Bacillus cereus AH820] (232 aa)
Score = 125, Expect = 2.0e-05, Identities = 31/77 (40%), Positives = 46/77 (59%)
  Q:   156 RKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTG-LVIQYIYKLKKKIG----KDNIVSSTYN-GYCF 232
           R V   G++IE+T  EFDIL     HP   ++ E IF++VW  D    G  V+ +I  L+KK+G    KD ++ + +  GY F
  S:   148 RTVNVYGEQIELTPKEFDILYLLASHPKKVYNVENIFQQVWADDYYEGGNTVMVHIRTLRKKLGEDKRKDKLIKTVWGVGYTF 230
>gi|55822759|ref|YP_141200.1| response regulator (homolog to ciaR Spn), truncated [Streptococcus thermophilus CNRZ1066] >gi|55738744|gb|AAV62385.1| response regulator (homolog to ciaR Spn), truncated [Streptococcus thermophilus CNRZ1066] (173 aa)
Score = 125, Expect = 2.0e-05, Identities = 34/111 (30%), Positives = 62/111 (55%)
  Q:   107 GFEFCVSLDFFTPSLFFQTLLNIFHKVEVINLM-------NNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKI 217
           GFE  V  D+ T   + + L     K+ +  L+        N   +G+ + +NL     +   +E+E+   EFD+L +FL++ N    K +IF ++WG+D D    V++ Y+ K++KK+
  S:    44 GFELGVD-DYLTKPFYLEEL-----KMRIQALLKRSGKFDQNTFSFGD-VCVNLSTNSTYVGDKEVELLGKEFDLLVYFLQNQNVILPKSQIFDRLWGFDSDTNVSVVEVYVSKIRKKL 155
>gi|196158136|ref|YP_002127625.1| Response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Alteromonas macleodii 'Deep ecotype'] >gi|88774239|gb|EAR05496.1| Response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Alteromonas macleodii 'Deep ecotype'] >gi|196113915|gb|ACG67631.1| Response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Alteromonas macleodii 'Deep ecotype'] (226 aa)
Score = 125, Expect = 2.0e-05, Identities = 32/105 (30%), Positives = 59/105 (56%)
  Q:   115 DFFTPSLFFQTLLNIFHKVEVINLMNN-----VIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKKIGK 219
           D+ T    F+ LL    +VE +   N       +I   +L+++L++RKV    QEI++   EF +L+  L H     ++  + ++VW Y  DP T ++  +I +L++K+ K
  S:    97 DYLTKPFAFEELLA---RVEGLAGRNKDGEDKTLIKVGDLTLDLVNRKVLRGDQEIDLQSKEFQLLECLLRHKGKVVTRSMLLEQVWNYHFDPQTNVIDVHISRLRQKVDK 204
>gi|167936946|ref|ZP_02524021.1| Two-component response regulator [Bacillus cereus AH1134] (223 aa)
Score = 125, Expect = 2.1e-05, Identities = 28/84 (33%), Positives = 51/84 (60%)
  Q:   151 MNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD-DDPTGLVIQYIYKLKKKIGKD-NIVSSTYN-GYCFKL 234
           +N   R++  +G+ I +T  EFD+L F  +H    FS+E++ +KVWGYD    T  V  ++  ++ K+G+  N + + +  GY F++
  S:   137 INEKSRRIEANGESISLTVKEFDLLYFLCQHTGQVFSREQLLEKVWGYDYAGSTRTVDTHVKTMRLKLGESGNYIQTVWGVGYKFEV 223
>gi|111022019|ref|YP_704991.1| response regulator, two-component system [Rhodococcus sp. RHA1] >gi|110821549|gb|ABG96833.1| response regulator, two-component system [Rhodococcus sp. RHA1] (228 aa)
Score = 125, Expect = 2.1e-05, Identities = 25/88 (28%), Positives = 50/88 (56%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKKIGKDNIVSSTYNGYCFKLR 235
           ++ ++L++R+V     EI +T+ EFD+L +F   P    ++E +  +VWG+ D   +  V  ++  L++K+G D I +    GY   ++
  S:   139 DIEVDLVERRVRRGVDEIHLTRTEFDLLAYFASRPRAAIARESLLAEVWGWGDGAGSRTVDSHVKALRRKLGGDLIRTVHGVGYALDVQ 227
>gi|186456075|ref|ZP_02966388.1| two component transcriptional regulator, winged helix family [bacterium Ellin514] >gi|184206848|gb|EDU03894.1| two component transcriptional regulator, winged helix family [bacterium Ellin514] (233 aa)
Score = 125, Expect = 2.1e-05, Identities = 44/175 (25%), Positives = 83/175 (47%)
  Q:    43 VMLKPNEIDYLTTV---HASVVIFDNIPSDQIDEAMVKKIKLISPITHFVYFCENYDEDTFLSVLQKGFEFCVSLDFFTPSLFFQTLLNIFHKVEVINLMNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWG-YDDDPTGLVIQYIYKLKKKI 217
           V+  P  ID +  V   H   V+ D    D    A++K+++  S +   V      D+D  ++ L  G +  ++  F T  L  +  L + H+          +    NL ++L  R V  +GQ++++T  E+ +L  F+ H     +  ++ +++WG  D D TG +  Y+  L++KI
  S:    35 VIEAPTGIDGIGEVARCHPDAVLLDLGLPDMDGLAVLKRLREWSQVPVLVVSVRGQDDDKIVA-LDNGADDYLTKPFSTGELLAR--LRVAHR-HAQPSSPPAVFRARNLEVDLATRTVKVNGQKVKLTATEYSLLNMFVRHAGKVLTHGQVLREIWGPADADKTGYLRVYMAYLREKI 209
>gi|59713744|ref|YP_206519.1| two component response regulator [Vibrio fischeri ES114] >gi|163728343|ref|ZP_02135827.1| transcriptional regulator [Vibrio fischeri MJ11] >gi|59481992|gb|AAW87631.1| two component response regulator [Vibrio fischeri ES114] >gi|161398514|gb|EDQ22799.1| transcriptional regulator [Vibrio fischeri MJ11] (218 aa)
Score = 125, Expect = 2.1e-05, Identities = 28/88 (31%), Positives = 51/88 (57%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGKDNIVSSTYNGYCFKLR 235
           NL+++   R V  SG+ + +T+ EFD+L F   +    F+++E+  +VWGY+  PT   +  +I +L++KI    I   T  G  +K++
  S:   131 NLAIDTSTRDVVNSGENVTLTRTEFDLLLFLASNLGKVFTRDELLDQVWGYNHFPTTRTVDTHILQLRQKIVGIEI--ETLRGVGYKMK 217
>gi|189348733|ref|YP_001941929.1| OmpR family two-component system response regulator [Burkholderia multivorans ATCC 17616] >gi|189338871|dbj|BAG47939.1| OmpR family two-component system response regulator [Burkholderia multivorans ATCC 17616] (239 aa)
Score = 125, Expect = 2.1e-05, Identities = 26/72 (36%), Positives = 40/72 (55%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGKD 220
           LS++ I R+    G  I++T  EFD+L FF  HP   FS+ ++   VWGY  +     +  +I +L+ KI  D
  S:   142 LSIDPIAREASVDGTRIDLTPREFDLLYFFARHPGKVFSRMDLLNAVWGYQHEGYEHTVNTHINRLRAKIEAD 214
>gi|187777045|ref|ZP_02993518.1| hypothetical protein CLOSPO_00590 [Clostridium sporogenes ATCC 15579] >gi|187773973|gb|EDU37775.1| hypothetical protein CLOSPO_00590 [Clostridium sporogenes ATCC 15579] (228 aa)
Score = 125, Expect = 2.1e-05, Identities = 25/83 (30%), Positives = 46/83 (55%)
  Q:   117 FTPSLFFQTLLNIFHKVEVINLMNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD 199
           F P      +  I  +V  +   ++ II G    ++L  +K++   +EI+IT  E+ ++K F+E+P   F+++E+   VWGYD
  S:   104 FNPLELTLRIKAILRRVNAVKENDDNIITGGPFKIDLYSKKIYKDEEEIDITPTEYLLMKIFIENPGKAFNRDELLDLVWGYD 186
>gi|161522391|ref|YP_001585320.1| two component transcriptional regulator [Burkholderia multivorans ATCC 17616] >gi|160345944|gb|ABX19028.1| two component transcriptional regulator, winged helix family [Burkholderia multivorans ATCC 17616] (272 aa)
Score = 125, Expect = 2.1e-05, Identities = 26/72 (36%), Positives = 40/72 (55%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGKD 220
           LS++ I R+    G  I++T  EFD+L FF  HP   FS+ ++   VWGY  +     +  +I +L+ KI  D
  S:   175 LSIDPIAREASVDGTRIDLTPREFDLLYFFARHPGKVFSRMDLLNAVWGYQHEGYEHTVNTHINRLRAKIEAD 247
>gi|42780487|ref|NP_977734.1| DNA-binding response regulator [Bacillus cereus ATCC 10987] >gi|166982058|ref|ZP_02253505.1| DNA-binding response regulator [Bacillus cereus AH187] >gi|168163122|ref|ZP_02598355.1| DNA-binding response regulator [Bacillus cereus H3081.97] >gi|42736406|gb|AAS40342.1| DNA-binding response regulator [Bacillus cereus ATCC 10987] (223 aa)
Score = 125, Expect = 2.1e-05, Identities = 29/84 (34%), Positives = 50/84 (59%)
  Q:   151 MNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD-DDPTGLVIQYIYKLKKKIGKD-NIVSSTYN-GYCFKL 234
           +N   RK+   G+ I +T  EFD+L F  +H    FS+E++ +KVWGYD    T  V  ++  ++ K+G+  N + + +  GY F++
  S:   137 INEKSRKIEVDGEPISLTVKEFDLLYFLCQHTGQVFSREQLLEKVWGYDYAGSTRTVDTHVKTMRLKLGESGNYIQTVWGVGYKFEV 223
>gi|196183949|gb|EDX78925.1| response regulator receiver domain protein [Brevundimonas sp. BAL3] (223 aa)
Score = 125, Expect = 2.1e-05, Identities = 30/87 (34%), Positives = 48/87 (55%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKKIGK--DNIVSSTYNGYCFKL 234
           +L MNLI R V     EI++   EF +L+F + H     ++  + +KVW Y  DP T ++  +I +L+ KI K  D  +  T  G  ++L
  S:   132 DLEMNLIARTVHRGATEIDLQPREFQLLEFLMRHAGQSVTRTMLLEKVWEYHFDPQTNVIDVHISRLRSKIDKGFDRAMLQTVRGAGYRL 221
>gi|167746354|ref|ZP_02418481.1| hypothetical protein ANACAC_01063 [Anaerostipes caccae DSM 14662] >gi|167654347|gb|EDR98476.1| hypothetical protein ANACAC_01063 [Anaerostipes caccae DSM 14662] (245 aa)
Score = 125, Expect = 2.2e-05, Identities = 28/81 (34%), Positives = 50/81 (61%)
  Q:   140 NNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVW---GYDDDPTGLVIQYIYKLKKKIGKD 220
           NN +I G  L+++L  + ++  G+ +++T  EF IL   + HP   FS EEI+++VW    Y  + T  V+ +I ++++KI  D
  S:   144 NNRLILGG-LTLDLDGKCIYVDGEPVKVTATEFKILNLLMRHPGRVFSAEEIYERVWEEAAYATENT--VMVHIRRIREKIEID 224
>gi|119469680|ref|ZP_01612549.1| DNA-binding response regulator [Alteromonadales bacterium TW-7] >gi|119446927|gb|EAW28198.1| DNA-binding response regulator [Alteromonadales bacterium TW-7] (241 aa)
Score = 125, Expect = 2.2e-05, Identities = 39/142 (27%), Positives = 71/142 (50%)
  Q:    57 HASVVIFDNIPSDQIDE-AMVKKIKLISPITHFVYFCE-NYDEDTFLSVLQKGFEFCVSLDFFTPSLFFQTLLNIFHKVEVINLMNN--------VIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGY 198
           H   +I  +I   Q+D  ++ +KIK   P T  +     + D D  +  L+ G +  +   FF   L  +    + H+ +++   N           +   +L++     +V+ + Q I +T  EFD+L +F  HPN  FS++++  KVWGY
  S:    46 HPYGLILLDINLPQMDGLSLCRKIKEHYPTTSVILLTALSSDMDRVIG-LEMGADDYICKPFFARELQARVKTQLRHRAQLLASQNTDEPSVASEQTLKVGSLNIEFDSHQVYLAEQAINLTATEFDLLVYFARHPNHVFSRQQLLDKVWGY 196
>gi|86739024|ref|YP_479424.1| two component transcriptional regulator [Frankia sp. CcI3] >gi|86565886|gb|ABD09695.1| two component transcriptional regulator, winged helix family [Frankia sp. CcI3] (239 aa)
Score = 125, Expect = 2.2e-05, Identities = 25/75 (33%), Positives = 46/75 (61%)
  Q:   161 SGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD-DDPTGLVIQYIYKLKKKIGKDN-IVSSTYNGYCFKLR 235
           +G+ I+++  EF +L++FL +PN   S+ +I   VW YD    + +V QY+  L++K+G+    +  T  G+ + LR
  S:   155 AGEPIDLSPTEFSLLRYFLTNPNRVLSRTQILDAVWSYDYGGESTIVDQYVSYLRRKLGRHGPSLIHTQRGFGYVLR 231
>gi|71736484|ref|YP_275217.1| DNA-binding response regulator [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71557037|gb|AAZ36248.1| DNA-binding response regulator [Pseudomonas syringae pv. phaseolicola 1448A] (227 aa)
Score = 125, Expect = 2.2e-05, Identities = 30/86 (34%), Positives = 52/86 (60%)
  Q:   132 KVEVINLMNNVIIWGN------NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKKI 217
           +VEV+   +N +  G       +L +NLI R+    G+ + +   EF +L+F + +     ++  IF++VWGY  DP T L+  +I +L+KKI
  S:   112 RVEVLLRRSNPVSAGKTVLQVADLELNLISREACRGGEPLTLLPTEFKLLEFLMRNSGQIITRMMIFQEVWGYHFDPGTNLIDVHIGRLRKKI 204
>gi|118048757|ref|ZP_01517341.1| response regulator receiver [Chloroflexus aggregans DSM 9485] >gi|117994732|gb|EAV08989.1| response regulator receiver [Chloroflexus aggregans DSM 9485] (225 aa)
Score = 125, Expect = 2.2e-05, Identities = 21/70 (30%), Positives = 44/70 (62%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKI 217
           NL+++   R++    + +E+T  E+D+L+ F+ HPN   +++ I+ +VW YD      +I+ Y+  L++K+
  S:   132 NLTLDTRSRELRVGDRRVELTAKEYDLLELFMRHPNQVLTRDVIYDRVWNYDFGGESNIIEVYVRYLRQKL 202
>gi|30264915|ref|NP_847292.1| DNA-binding response regulator [Bacillus anthracis str. Ames] >gi|49187736|ref|YP_030989.1| DNA-binding response regulator [Bacillus anthracis str. Sterne] >gi|49481633|ref|YP_038895.1| DNA-binding response regulator [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|50196963|ref|YP_052651.1| DNA-binding response regulator [Bacillus anthracis str. 'Ames Ancestor'] >gi|65322218|ref|ZP_00395177.1| COG0745: Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Bacillus anthracis str. A2012] >gi|165869742|ref|ZP_02214400.1| DNA-binding response regulator [Bacillus anthracis str. A0488] >gi|167634021|ref|ZP_02392344.1| DNA-binding response regulator [Bacillus anthracis str. A0442] >gi|167638206|ref|ZP_02396484.1| DNA-binding response regulator [Bacillus anthracis str. A0193] >gi|170705481|ref|ZP_02895945.1| DNA-binding response regulator [Bacillus anthracis str. A0389] >gi|177651118|ref|ZP_02933949.1| DNA-binding response regulator [Bacillus anthracis str. A0174] >gi|190567194|ref|ZP_03020109.1| DNA-binding response regulator [Bacillus anthracis Tsiankovskii-I] >gi|196033098|ref|ZP_03100511.1| DNA-binding response regulator [Bacillus cereus W] >gi|30259590|gb|AAP28778.1| DNA-binding response regulator [Bacillus anthracis str. Ames] >gi|49181663|gb|AAT57039.1| DNA-binding response regulator [Bacillus anthracis str. Sterne] >gi|49333189|gb|AAT63835.1| DNA-binding response regulator [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|50083025|gb|AAT70159.1| DNA-binding response regulator [Bacillus anthracis str. 'Ames Ancestor'] >gi|164714571|gb|EDR20090.1| DNA-binding response regulator [Bacillus anthracis str. A0488] >gi|167514023|gb|EDR89391.1| DNA-binding response regulator [Bacillus anthracis str. A0193] >gi|167530822|gb|EDR93524.1| DNA-binding response regulator [Bacillus anthracis str. A0442] >gi|170129606|gb|EDS98469.1| DNA-binding response regulator [Bacillus anthracis str. A0389] >gi|172082944|gb|EDT68006.1| DNA-binding response regulator [Bacillus anthracis str. A0174] >gi|190561698|gb|EDV15668.1| DNA-binding response regulator [Bacillus anthracis Tsiankovskii-I] >gi|195994527|gb|EDX58482.1| DNA-binding response regulator [Bacillus cereus W] (232 aa)
Score = 125, Expect = 2.2e-05, Identities = 31/77 (40%), Positives = 46/77 (59%)
  Q:   156 RKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTG-LVIQYIYKLKKKIG----KDNIVSSTYN-GYCF 232
           R V   G++IE+T  EFDIL     HP   ++ E IF++VW  D    G  V+ +I  L+KK+G    KD ++ + +  GY F
  S:   148 RTVNVYGEQIELTPKEFDILYLLASHPKKVYNVENIFQQVWADDYYEGGNTVMVHIRTLRKKLGEDKRKDKLIKTVWGVGYTF 230
>gi|127511517|ref|YP_001092714.1| two component transcriptional regulator [Shewanella loihica PV-4] >gi|126636812|gb|ABO22455.1| two component transcriptional regulator, winged helix family [Shewanella loihica PV-4] (224 aa)
Score = 125, Expect = 2.2e-05, Identities = 26/70 (37%), Positives = 41/70 (58%)
  Q:   163 QEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGKDNIVSSTYNGYCF 232
           Q+ E+T  EF +LK FL  P    SK ++  K++ +DD+    V++ Y+  L+KK+GK  I +    GY F
  S:   149 QQFELTAMEFRLLKIFLMSPKKLLSKAQLTDKLYQFDDEKESNVVEVYVTHLRKKLGKTAIETRRGQGYIF 219
>gi|62424427|ref|ZP_00379573.1| COG0745: Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Brevibacterium linens BL2] (242 aa)
Score = 125, Expect = 2.2e-05, Identities = 38/161 (23%), Positives = 77/161 (47%)
  Q:    57 HASVVIFDNIPSDQIDEAMVKKIKLISPITHFVYFCENYDEDTFLSVLQKGFEFCVSLDFFTPSLFFQTLLNIFHKVEVINLMNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKI 217
           H   ++ D +  D    A+++K++     T  V+     + D  L+ L+ G +  V+  F    +  +    +     VI   +  ++   +L +++   +V  +G  I++T  EF++L  F+ +P    SK +I  +VW YD    G +++ Y+  L+KKI
  S:    56 HFDAIVLDVMLPDLDGFAVIEKVRGEGIDTPVVFLSARDEVDDRLTGLRLGGDDYVTKPFNLDEVIARVEARLRRSAPVIPSGDEDLLRVGDLELDVRSHEVSRAGHPIDLTAREFEVLLLFMRNPRAVLSKAQILDRVWDYDFGGNGNIVELYVSYLRKKI 217
>gi|196041427|ref|ZP_03108720.1| DNA-binding response regulator [Bacillus cereus NVH0597-99] >gi|196027675|gb|EDX66289.1| DNA-binding response regulator [Bacillus cereus NVH0597-99] (232 aa)
Score = 125, Expect = 2.2e-05, Identities = 31/77 (40%), Positives = 46/77 (59%)
  Q:   156 RKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTG-LVIQYIYKLKKKIG----KDNIVSSTYN-GYCF 232
           R V   G++IE+T  EFDIL     HP   ++ E IF++VW  D    G  V+ +I  L+KK+G    KD ++ + +  GY F
  S:   148 RTVNVYGEQIELTPKEFDILYLLASHPKKVYNVENIFQQVWADDYYEGGNTVMVHIRTLRKKLGEDKRKDKLIKTVWGVGYTF 230
>gi|166031390|ref|ZP_02234219.1| hypothetical protein DORFOR_01079 [Dorea formicigenerans ATCC 27755] >gi|166028795|gb|EDR47552.1| hypothetical protein DORFOR_01079 [Dorea formicigenerans ATCC 27755] (229 aa)
Score = 125, Expect = 2.2e-05, Identities = 27/80 (33%), Positives = 44/80 (55%)
  Q:   141 NVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDD-DPTGLVIQYIYKLKKKIGKD 220
           N II    L ++   R+VW +  E   T  EFD+L F   HPN  ++KEE+F+++W  +       V  +I K+++K+  D
  S:   130 NKIIEIRGLRIDTTARRVWVNDVEKTFTTKEFDLLTFLASHPNHVYTKEELFREIWDMESIGDIATVTVHIKKIREKVEVD 210
>gi|160878354|ref|YP_001557322.1| two component transcriptional regulator [Clostridium phytofermentans ISDg] >gi|160427020|gb|ABX40583.1| two component transcriptional regulator, winged helix family [Clostridium phytofermentans ISDg] (226 aa)
Score = 125, Expect = 2.2e-05, Identities = 31/91 (34%), Positives = 55/91 (60%)
  Q:   140 NNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKK----IGKDNIVSSTYNGY 230
           N+V++W N +S++ + R V  SG ++ +TK E  +L++FL + +   S+EE+ + VW  + D  +  V  +I  L+KK    +G D I +    GY
  S:   124 NSVLVW-NEISLDTVGRTVSVSGIDVTMTKKELALLEYFLLNQSKVISQEELMEHVWNMEADSFSNAVRVHIASLRKKLKIALGYDPIATKIGEGY 218
>gi|172058611|ref|YP_001815071.1| two component transcriptional regulator [Exiguobacterium sibiricum 255-15] >gi|171991132|gb|ACB62054.1| two component transcriptional regulator, winged helix family [Exiguobacterium sibiricum 255-15] (223 aa)
Score = 125, Expect = 2.2e-05, Identities = 23/70 (32%), Positives = 43/70 (61%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD-DDPTGLVIQYIYKLKKKIG 218
           L+++  +R +   G+ + +T  E+ +L  FL+HP   F +EE+ ++VWG+D    T  V   + +L+KK+G
  S:   134 LTIDSAERTILLDGEPLPLTYREYALLALFLQHPKRVFEREELLEQVWGFDFSGQTRAVDIMVQRLRKKLG 204
>gi|193077836|gb|ABO12711.2| putative two-component response regulator [Acinetobacter baumannii ATCC 17978] (220 aa)
Score = 125, Expect = 2.2e-05, Identities = 25/90 (27%), Positives = 55/90 (61%)
  Q:   141 NVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGKDNIVSSTYNGY 230
           +++ WG+ L ++   + V C+G+ I++T  EF IL+  + HP    +++++ + ++ + ++     I+ +IY+L+KKIG  +I +    GY
  S:   125 SILTWGD-LQLDTQAKVVLCAGKTIDLTAKEFQILRKLMVHPEHIITRDQLEEALYAWGEEIESNAIEVFIYQLRKKIGSSSIKTIRGLGY 214
>gi|184158807|ref|YP_001847146.1| response regulator [Acinetobacter baumannii ACICU] >gi|183210401|gb|ACC57799.1| Response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Acinetobacter baumannii ACICU] (220 aa)
Score = 125, Expect = 2.2e-05, Identities = 25/90 (27%), Positives = 55/90 (61%)
  Q:   141 NVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGKDNIVSSTYNGY 230
           +++ WG+ L ++   + V C+G+ I++T  EF IL+  + HP    +++++ + ++ + ++     I+ +IY+L+KKIG  +I +    GY
  S:   125 SILTWGD-LQLDTQAKVVLCAGKTIDLTAKEFQILRKLMVHPEHIITRDQLEEALYAWGEEIESNAIEVFIYQLRKKIGSSSIKTIRGLGY 214
>gi|149926314|ref|ZP_01914576.1| probable two-component response regulator transcription regulator protein [Limnobacter sp. MED105] >gi|149825132|gb|EDM84344.1| probable two-component response regulator transcription regulator protein [Limnobacter sp. MED105] (241 aa)
Score = 125, Expect = 2.2e-05, Identities = 24/70 (34%), Positives = 44/70 (62%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKKI 217
           +L+++L   ++  +G+EI++T  E  +++  +  P   FS+E I   VWG ++DP T +V  YI +L+ KI
  S:   143 DLNLDLEKMRLSRAGREIQLTAKELALVELLMSAPGRLFSRERILSNVWGVNEDPLTNVVDVYIRRLRTKI 213
>gi|30019451|ref|NP_831082.1| two-component response regulator [Bacillus cereus ATCC 14579] >gi|168135933|ref|ZP_02579162.1| Two-component response regulator [Bacillus cereus B4264] >gi|29894995|gb|AAP08283.1| Two-component response regulator [Bacillus cereus ATCC 14579] (223 aa)
Score = 125, Expect = 2.3e-05, Identities = 28/84 (33%), Positives = 50/84 (59%)
  Q:   151 MNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD-DDPTGLVIQYIYKLKKKIGKD-NIVSSTYN-GYCFKL 234
           +N   R++   G+ I +T  EFD+L F  +H    FS+E++ +KVWGYD    T  V  ++  ++ K+G+  N + + +  GY F++
  S:   137 INEKSRRIEADGESISLTVKEFDLLYFLCQHTGQVFSREQLLEKVWGYDYAGSTRTVDTHVKTMRLKLGESGNYIQTVWGVGYKFEV 223
>gi|170787985|gb|EDT29029.1| phosphate regulon transcriptional regulatory protein PhoB [Oligotropha carboxidovorans OM5] (234 aa)
Score = 125, Expect = 2.3e-05, Identities = 34/100 (34%), Positives = 61/100 (61%)
  Q:   141 NVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD---DDPTGLVIQYIYKLKKKI--GKDNIVSSTYNGYCFKLRESFRK 240
           +V+I+G+ + ++   R+V  SG+ I++   E+ +L+FFL+HP   FS+E++   VWG D   D+ T  V  +I +L+K +  G++     T  G  + L + F K
  S:   130 SVLIYGD-IELDREKRRVARSGRPIDLGPTEYRLLEFFLQHPGRVFSREQLLDGVWGRDIYIDERT--VDVHIGRLRKLLNPGEEQDPIRTVRGAGYALDDRFAK 231
>gi|114564455|ref|YP_751969.1| two component transcriptional regulator, winged helix family protein [Shewanella frigidimarina NCIMB 400] >gi|114335748|gb|ABI73130.1| two component transcriptional regulator, winged helix family protein [Shewanella frigidimarina NCIMB 400] (224 aa)
Score = 125, Expect = 2.3e-05, Identities = 31/87 (35%), Positives = 48/87 (55%)
  Q:   146 GNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGKDNIVSSTYNGYCF 232
           G NL  N  ++KV       E+T  EF +LK FL  P    SK+++  K++ +DD+    V++ Y+  L+KK+GK  I +    GY F
  S:   134 GVNLDEN--EQKVTVGEHIYELTSMEFRLLKIFLMSPKKLLSKQQLTDKLYQFDDEKESNVVEVYVTHLRKKLGKTAIETRRGQGYIF 219
>gi|126646802|ref|ZP_01719312.1| response regulator DrrA [Algoriphagus sp. PR1] >gi|126576850|gb|EAZ81098.1| response regulator DrrA [Algoriphagus sp. PR1] (258 aa)
Score = 125, Expect = 2.3e-05, Identities = 30/81 (37%), Positives = 48/81 (59%)
  Q:   154 IDRKVWC---SGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGKDNIVSSTYNGYCFKL 234
           IDR  +    SG+ I + K EF++L F  ++PN  FS++E+ + +WG D       +  +I K+++KIG D I +    GY F L
  S:   173 IDRGSYTIDKSGKTITLPKKEFELLYFLAKNPNMVFSRDELLQNIWGADVFVLARTVDVHIRKVREKIGDDYITTVKGVGYKFDL 257
>gi|126642329|ref|YP_001085313.1| putative two-component response regulator [Acinetobacter baumannii ATCC 17978] (146 aa)
Score = 125, Expect = 2.3e-05, Identities = 25/90 (27%), Positives = 55/90 (61%)
  Q:   141 NVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGKDNIVSSTYNGY 230
           +++ WG+ L ++   + V C+G+ I++T  EF IL+  + HP    +++++ + ++ + ++     I+ +IY+L+KKIG  +I +    GY
  S:    51 SILTWGD-LQLDTQAKVVLCAGKTIDLTAKEFQILRKLMVHPEHIITRDQLEEALYAWGEEIESNAIEVFIYQLRKKIGSSSIKTIRGLGY 140
>gi|15807647|ref|NP_295328.1| response regulator [Deinococcus radiodurans R1] (243 aa)
Score = 125, Expect = 2.3e-05, Identities = 24/84 (28%), Positives = 47/84 (55%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVW-GYDDDPTGLVIQYIYKLKKKIGKDNIVSSTYNGYCF 232
           L ++   R V+ SG+ + +T  EF +L+    HP   ++++E+  +VW G  D  + +V  Y+  L++K+G + + +    GY F
  S:   155 LRLDWTSRAVFRSGERVALTAKEFSLLEVLASHPGRVYTRDELIDRVWDGRFDAESNVVDTYVRNLRRKLGDEVVQTMRGVGYSF 239
>gi|170685581|ref|ZP_02876804.1| DNA-binding response regulator [Bacillus anthracis str. A0465] >gi|170670045|gb|EDT20785.1| DNA-binding response regulator [Bacillus anthracis str. A0465] (232 aa)
Score = 125, Expect = 2.3e-05, Identities = 31/77 (40%), Positives = 46/77 (59%)
  Q:   156 RKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTG-LVIQYIYKLKKKIG----KDNIVSSTYN-GYCF 232
           R V   G++IE+T  EFDIL     HP   ++ E IF++VW  D    G  V+ +I  L+KK+G    KD ++ + +  GY F
  S:   148 RTVNVYGEQIELTPKEFDILYLLASHPKKVYNVENIFQQVWADDYYEGGNTVMVHIRTLRKKLGEDKRKDKLIKTVWGVGYTF 230
>gi|56962949|ref|YP_174676.1| two-component response regulator [Bacillus clausii KSM-K16] >gi|56909188|dbj|BAD63715.1| two-component response regulator [Bacillus clausii KSM-K16] (233 aa)
Score = 125, Expect = 2.4e-05, Identities = 30/72 (41%), Positives = 41/72 (56%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDD-DPTGLVIQYIYKLKKKIGKD 220
           L ++L  R V   G+ IE+T  EFDIL     HP   FS E IFK+VWG    +    V+ +I  L+KK+ +D
  S:   142 LVISLEQRTVTLYGENIELTPKEFDILYLLASHPKKVFSVENIFKQVWGEAYFEGANTVMVHIRTLRKKLEED 214
>gi|167935223|ref|ZP_02522298.1| DNA-binding response regulator [Bacillus cereus AH1134] (232 aa)
Score = 125, Expect = 2.4e-05, Identities = 31/77 (40%), Positives = 46/77 (59%)
  Q:   156 RKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTG-LVIQYIYKLKKKIG----KDNIVSSTYN-GYCF 232
           R V   G++IE+T  EFDIL     HP   ++ E IF++VW  D    G  V+ +I  L+KK+G    KD ++ + +  GY F
  S:   148 RTVNVYGEQIELTPKEFDILYLLASHPKKVYNVENIFQQVWADDYYEGGNTVMVHIRTLRKKLGEDKRKDKLIKTVWGVGYTF 230
>gi|153006996|ref|YP_001381321.1| two component transcriptional regulator [Anaeromyxobacter sp. Fw109-5] >gi|152030569|gb|ABS28337.1| two component transcriptional regulator, winged helix family [Anaeromyxobacter sp. Fw109-5] (230 aa)
Score = 125, Expect = 2.4e-05, Identities = 23/72 (31%), Positives = 42/72 (58%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVI-QYIYKLKKKIGKD 220
           + ++L  R+    G  +++T  E+D+L FF+ HP+  FS+E++ + VWG     T   +  +I +L+  IG D
  S:   139 IELDLEARRATVGGSTLDLTSREYDLLAFFVTHPDRVFSREQLMENVWGSRYFGTARTVDNFIARLRAHIGDD 211
>gi|25026789|ref|NP_736843.1| putative transcription regulator [Corynebacterium efficiens YS-314] >gi|23492068|dbj|BAC17043.1| putative transcription regulator [Corynebacterium efficiens YS-314] (224 aa)
Score = 125, Expect = 2.4e-05, Identities = 26/91 (28%), Positives = 50/91 (54%)
  Q:   140 NNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGKDNIVSSTYNGY 230
           N  ++    L ++L  +KV+ + +  ++++ EFD+L+  + HP    S+ ++   VW    DP   V+  YI  L+KKIG + + +   +GY
  S:   130 NTHLLKHGTLELDLRTQKVFVADKWRDLSRREFDLLETLMRHPGQILSRAQLLNMVWDMSFDPGSNVVDVYIRALRKKIGTEKVETIRGSGY 221
>gi|163767274|ref|ZP_02174289.1| two component transcriptional regulator, winged helix family [Anaeromyxobacter sp. K] >gi|196170708|gb|ACG71681.1| two component transcriptional regulator, winged helix family [Anaeromyxobacter sp. K] (230 aa)
Score = 125, Expect = 2.4e-05, Identities = 22/72 (30%), Positives = 43/72 (59%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVI-QYIYKLKKKIGKD 220
           + ++L  R+    G+ +++T  EFD+L FF+ HP+  +S+E++ + VWG     T   +  ++ +L+  IG D
  S:   139 IELDLDARRALVDGRALDLTSREFDLLAFFVTHPDRVYSREQLMEAVWGSRYFGTARTVDNFVARLRAHIGDD 211
>gi|148323079|gb|EDK88329.1| OmpR family response regulator [Fusobacterium nucleatum subsp. polymorphum ATCC 10953] (224 aa)
Score = 125, Expect = 2.5e-05, Identities = 35/90 (38%), Positives = 55/90 (61%)
  Q:   147 NNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD-DDPTGLVIQYIYKLKKKIG-KDNIVSSTYN-GYCFKLRE 236
           N + M++  +KV+ +  EI +TK EF IL++F+++     S+E+I   VWGYD D    +V  YI  L+KKI  K N + +    GY F+ +E
  S:   131 NEIKMDISAKKVFLNEVEISLTKTEFLILEYFMKNKGLSCSREKIIVGVWGYDFDGEEKIVDVYINSLRKKIDPKSNYIHTIRGFGYIFQYKE 223
>gi|166031592|ref|ZP_02234421.1| hypothetical protein DORFOR_01292 [Dorea formicigenerans ATCC 27755] >gi|166028569|gb|EDR47326.1| hypothetical protein DORFOR_01292 [Dorea formicigenerans ATCC 27755] (224 aa)
Score = 124, Expect = 2.5e-05, Identities = 27/96 (28%), Positives = 55/96 (57%)
  Q:   141 NVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD-DDPTGLVIQYIYKLKKKIGKDNIVSSTYNGYCFKLRE 236
           +VI+ G+ + MN    +V   G+ + +T  E+++LK  +++PN   +++ + + +WGYD D  T  V  ++  L++K+GK      T  G  +++ E
  S:   129 DVIVLGD-IEMNTKKHEVTADGEVVTLTLKEYELLKRLMKNPNIVMTRDCLLEDIWGYDFDGETRTVDVHVRTLRQKLGKSGEKIETVRGVGYRMSE 224
>gi|177665962|ref|ZP_02941760.1| two component transcriptional regulator, winged helix family [Cyanothece sp. PCC 8801] >gi|196245706|ref|ZP_03144429.1| two component transcriptional regulator, winged helix family [Cyanothece sp. PCC 8802] >gi|172075185|gb|EDT60601.1| two component transcriptional regulator, winged helix family [Cyanothece sp. PCC 8801] >gi|196206673|gb|EDY01469.1| two component transcriptional regulator, winged helix family [Cyanothece sp. PCC 8802] (231 aa)
Score = 124, Expect = 2.5e-05, Identities = 27/85 (31%), Positives = 54/85 (63%)
  Q:   148 NLSMNLIDRKVWCSGQE-----IEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKKI---GKDNIVSSTYN-GYCF 232
           NL+++     ++C  +E     I +T  EF +L++FL HPN   +++++  ++W ++ +P + +V   I  L++K+   G DN + + Y  GY F
  S:   133 NLTLDYSTYTIFCQDKEGDNQTIALTNKEFQLLEYFLHHPNQIVTRDQLLSQLWEWESEPMSNVVAAQIRLLRRKLAPYGGDNWIETIYGLGYRF 227
>gi|152995826|ref|YP_001340661.1| two component transcriptional regulator [Marinomonas sp. MWYL1] >gi|150836750|gb|ABR70726.1| two component transcriptional regulator, winged helix family [Marinomonas sp. MWYL1] (227 aa)
Score = 124, Expect = 2.5e-05, Identities = 28/82 (34%), Positives = 49/82 (59%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGKDNIVSSTYNG 229
           N+ +N   R+V+  G+   IT  EF +L+ FL H     SK+EI   ++ +++ P    I+ Y+ +L+KK+G+ ++V ST  G
  S:   131 NIVVNRDSRQVFIDGELTVITNREFRLLEIFLGHLGRVLSKDEITDHLFNFNETPGPNAIELYVGRLRKKMGQGDLVISTLRG 213
>gi|186454588|ref|ZP_02964903.1| two component transcriptional regulator, winged helix family [bacterium Ellin514] >gi|184208147|gb|EDU05191.1| two component transcriptional regulator, winged helix family [bacterium Ellin514] (224 aa)
Score = 124, Expect = 2.5e-05, Identities = 33/103 (32%), Positives = 55/103 (53%)
  Q:   115 DFFTPSLFFQTLLNIFHKVEVINLMNN----VIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKKI 217
           D + P  F   L  +  +V  I   +N    V++   +L+++ I R+    G   E+T  E+ +L+F +  P     +  I +KVW YD DP T LV  YI +L++K+
  S:    96 DDYLPKPF--ALAELIARVRSIGRRSNEPKSVLLQVADLTLDTITRQAQRGGTSFELTTREYRLLEFLMRTPGRICGRMAILEKVWDYDFDPGTNLVDVYIKRLREKV 201
>gi|169176034|ref|ZP_02837857.1| two component transcriptional regulator, winged helix family [Arthrobacter chlorophenolicus A6] >gi|169015778|gb|EDS62280.1| two component transcriptional regulator, winged helix family [Arthrobacter chlorophenolicus A6] (246 aa)
Score = 124, Expect = 2.6e-05, Identities = 23/70 (32%), Positives = 45/70 (64%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKI 217
           +L +N+  R+V  +G ++++T  +F++L++ +E+P    SK +I  +VW YD      +++ YI  L+KKI
  S:   154 DLVLNVDTREVTRAGDDVQLTATQFELLRYLMENPKRVISKAQILDRVWDYDFGGQANIVELYISYLRKKI 224
>gi|147676785|ref|YP_001211000.1| response regulator [Pelotomaculum thermopropionicum SI] >gi|146272882|dbj|BAF58631.1| response regulator [Pelotomaculum thermopropionicum SI] (225 aa)
Score = 124, Expect = 2.6e-05, Identities = 27/89 (30%), Positives = 53/89 (59%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKI--GKDNIVSSTYNGYCFKLRE 236
           +L+++   R+V   G+ I++T  EF++L  F+EHP    ++++I  +VWG D      V++ Y+  L++K+  G +  +  T  G  + L+E
  S:   134 DLTLDHATREVRRGGRPIQLTAREFELLALFMEHPRQVLTRDQIMDRVWGIDYGGESNVLEVYVGMLRQKLEEGGEKRIIHTVRGVGYVLKE 225
>gi|171779491|ref|ZP_02920455.1| hypothetical protein STRINF_01336 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gi|171282108|gb|EDT47539.1| hypothetical protein STRINF_01336 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] (224 aa)
Score = 124, Expect = 2.6e-05, Identities = 22/57 (38%), Positives = 41/57 (71%)
  Q:   161 SGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKI 217
           +G+++E+   EFD+L +FL++ N    K +IF ++WG+D D T  V++ Y+ K++KK+
  S:   144 NGKKVELLGKEFDLLVYFLQNQNVILPKSQIFDRIWGFDSDTTISVVEVYVSKIRKKL 201
>gi|169824516|ref|YP_001692127.1| two-component response regulator [Finegoldia magna ATCC 29328] >gi|167831321|dbj|BAG08237.1| two-component response regulator [Finegoldia magna ATCC 29328] (239 aa)
Score = 124, Expect = 2.6e-05, Identities = 42/162 (25%), Positives = 80/162 (49%)
  Q:    38 FKIERVMLKPNEIDYLTTVHASVVIFDNIPSDQIDEAMVKKIKLISPITHFVYFCENYDEDTFLSVLQKGFEFCVSLDFFTPSLFFQTLLNIFHKVEVINLMNNVIIWGNN--LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD 199
           F++E+       ID + +   S++I D +      E +++ I+  +  T  +      DED  L  L+ G +  ++  F +  +  Q +  I  +VE + L  +  I+ +N  +S++  D      G+ I +T NEF I+K    +PN  F+++EI +  +GYD
  S:    33 FRVEQAFDGQEAIDMINSTDYSMIILDLMLPKISGEKVMEVIRSRTE-TPVIMVTAKIDEDEILEGLKLGADDYITKPF-SLKILVQKVKTILRRVEKLGLPKSDKIYFDNGRVSISFDDNTFIKDGESISLTSNEFQIIKTLFSNPNKIFTRDEIIELSFGYD 194
>gi|145621231|ref|ZP_01777216.1| two component transcriptional regulator, winged helix family [Geobacter bemidjiensis Bem] >gi|144942465|gb|EDJ77605.1| two component transcriptional regulator, winged helix family [Geobacter bemidjiensis Bem] >gi|197086003|gb|ACH37274.1| two component transcriptional regulator, winged helix family [Geobacter bemidjiensis Bem] (224 aa)
Score = 124, Expect = 2.6e-05, Identities = 28/89 (31%), Positives = 53/89 (59%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD-DDPTGLVIQYIYKLKKKIGK--DNIVSSTYNGYCFKLRE 236
           +L ++L+  KVW   +EI++T  E+ +L++F+ +P+   ++  I + VW Y  D  T ++  Y+  L+KKI +  D  +  T  G  + L+E
  S:   131 DLRLDLVTHKVWRKDKEIDLTAKEYGLLEYFMRNPHQVLTRTMIAEHVWDYTFDSFTNIIDVYVNYLRKKIDREADKKLIHTVRGVGYILKE 222
>gi|145224579|ref|YP_001135257.1| two component transcriptional regulator [Mycobacterium gilvum PYR-GCK] >gi|145217065|gb|ABP46469.1| two component transcriptional regulator, winged helix family [Mycobacterium gilvum PYR-GCK] (220 aa)
Score = 124, Expect = 2.6e-05, Identities = 23/83 (27%), Positives = 46/83 (55%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGKDNIVSSTYNGY 230
           NL ++L  R+       ++++  EF + + FL HP    +++++ ++VWG D +P   V+  Y+  L++K+G    V+    GY
  S:   131 NLRLDLRTRRAHVGDYSVDLSAREFALAEMFLRHPGQVLTRDQLLRQVWGNDYEPGSNVVDVYVRYLRRKLGARRFVTLRGMGY 214
>gi|168139738|ref|ZP_02582967.1| Two-component response regulator [Bacillus cereus G9842] (215 aa)
Score = 124, Expect = 2.7e-05, Identities = 33/94 (35%), Positives = 58/94 (61%)
  Q:   143 IIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD---DDPTGLVIQYIYKLKKKIGKDNIVSSTYNGYCFKLRE 236
           II   ++ +N    KV+ +  E+EITK E +++K FL H  T  +++++   VWG+D   ++ T  V  ++ +L+KKIG +NI+  T+ G  + L E
  S:   120 IIQVQDVKINFAKNKVYKNDIELEITKTELELIKCFLNHKGTILTRKKLLDIVWGFDYFGEERT--VDTHVRRLRKKIG-ENII-KTHRGLGYSLEE 212
>gi|75765087|ref|ZP_00744378.1| Two-component response regulator [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|74487425|gb|EAO51350.1| Two-component response regulator [Bacillus thuringiensis serovar israelensis ATCC 35646] (215 aa)
Score = 124, Expect = 2.7e-05, Identities = 33/94 (35%), Positives = 58/94 (61%)
  Q:   143 IIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD---DDPTGLVIQYIYKLKKKIGKDNIVSSTYNGYCFKLRE 236
           II   ++ +N    KV+ +  E+EITK E +++K FL H  T  +++++   VWG+D   ++ T  V  ++ +L+KKIG +NI+  T+ G  + L E
  S:   120 IIQVQDVKINFAKNKVYKNDIELEITKTELELIKCFLNHKGTILTRKKLLDIVWGFDYFGEERT--VDTHVRRLRKKIG-ENII-KTHRGLGYSLEE 212
>gi|153952701|ref|YP_001393466.1| transcriptional regulator [Clostridium kluyveri DSM 555] >gi|146345582|gb|EDK32118.1| Predicted transcriptional regulator [Clostridium kluyveri DSM 555] (229 aa)
Score = 124, Expect = 2.7e-05, Identities = 31/78 (39%), Positives = 52/78 (66%)
  Q:   140 NNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWG---YDDDPTGLVIQYIYKLKKKI 217
           N +II G  L +    R+V+ +G+EI + + EFDIL +  E+PN  F++EE+F+K+WG     D+ T  V  +I ++++KI
  S:   131 NKLIIRG--LEILKDSRQVFVNGKEITLAQKEFDILLYMAENPNRVFNREELFEKIWGLGSMGDNAT--VTVHIRRIREKI 207
>gi|29377770|ref|NP_816924.1| DNA-binding response regulator [Enterococcus faecalis V583] >gi|29345238|gb|AAO82994.1| DNA-binding response regulator [Enterococcus faecalis V583] (240 aa)
Score = 124, Expect = 2.7e-05, Identities = 34/157 (21%), Positives = 79/157 (50%)
  Q:    61 VIFDNIPSDQIDEAMVKKIKLISPITHFVYFCENYDEDTFLSVLQKGFEFCVSLDFFTPSLFFQTLLNIFHKVEVINLMNNVI----IWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQYIYKLKKKI 217
           ++ DN+  D     +V+ I+   P+   ++F    +E+  ++ L+ G +  ++  F + ++F   ++   ++  +I    NV     +   +   +    +++     I ++  E  +++FFLE+P   FSKE+I+  VWG  D     ++ +I +L+ K+
  S:    52 ILDDNLEHDSDGYYLVQMIREKYPLVPIIFFSSKKEEEDIIAALEMGVDSYITKPF-SLNVFKAQVIASLNRARMIRKQLNVYKKEELQVGDFRFDYGRYQLFKKDLPISLSSKEVQLIQFFLENPEQVFSKEQIYSSVWGTGDVDANTIMVFINRLRSKL 211
>gi|168143141|ref|ZP_02586370.1| response regulator [Bacillus cereus G9842] (223 aa)
Score = 124, Expect = 2.7e-05, Identities = 28/84 (33%), Positives = 50/84 (59%)
  Q:   151 MNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD-DDPTGLVIQYIYKLKKKIGKD-NIVSSTYN-GYCFKL 234
           +N   R++   G+ I +T  EFD+L F  +H    FS+E++ +KVWGYD    T  V  ++  ++ K+G+  N + + +  GY F++
  S:   137 INEKSRRIEADGEPISLTVKEFDLLYFLCQHTGQVFSREQLLEKVWGYDYAGSTRTVDTHVKTMRLKLGESGNYIQTVWGVGYKFEV 223
>gi|118476709|ref|YP_893860.1| response regulator [Bacillus thuringiensis str. Al Hakam] >gi|196044305|ref|ZP_03111541.1| DNA-binding response regulator [Bacillus cereus 03BB108] >gi|118415934|gb|ABK84353.1| response regulator [Bacillus thuringiensis str. Al Hakam] >gi|196024944|gb|EDX63615.1| DNA-binding response regulator [Bacillus cereus 03BB108] (234 aa)
Score = 124, Expect = 2.7e-05, Identities = 30/67 (44%), Positives = 48/67 (71%)
  Q:   154 IDR---KVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWG---YDDDPTGLVIQYIYKLKKKIGKD 220
           IDR   ++  +G+ +E +   F +L FF E+PN  FSKEEI++KVWG   Y+ D   +++ +I KL++KI +D
  S:   143 IDRYSAELTVNGRVVECSAQLFQLLLFFCENPNYVFSKEEIYEKVWGAPAYNGDDNTVMV-HIRKLREKIEQD 214
>gi|167937304|ref|ZP_02524379.1| Two-component response regulator [Bacillus cereus AH1134] (215 aa)
Score = 124, Expect = 2.8e-05, Identities = 33/99 (33%), Positives = 61/99 (61%)
  Q:   138 LMNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD---DDPTGLVIQYIYKLKKKIGKDNIVSSTYNGYCFKLRE 236
           + ++ II   ++ +N    KV+ +  E+EITK E +++K FL H  T  +++++   VWG+D   ++ T  V  ++ +L+KKIG +NI+  T+ G  + L E
  S:   115 IQHDNIIQVQDVKINFAKNKVYKNDIELEITKTELELIKCFLNHKGTILTRKKLLDIVWGFDYFGEERT--VDTHVRRLRKKIG-ENII-KTHRGLGYSLEE 212
>gi|19704596|ref|NP_604158.1| two-component response regulator [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >gi|19714890|gb|AAL95457.1| Two-component response regulator [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] (233 aa)
Score = 124, Expect = 2.8e-05, Identities = 33/90 (36%), Positives = 54/90 (60%)
  Q:   147 NNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD-DDPTGLVIQYIYKLKKKIGKDNIVSSTYN--GYCFKLRE 236
           N + M+++ +KV+ +  E+ +TK EF IL++F+++     S+E+I   VWGYD D    +V  YI  L+KKI   +    T    GY F+ +E
  S:   140 NEIKMDILAKKVFLNEVEVSLTKTEFLILEYFMKNKGLSCSREKIIIGVWGYDFDGEEKIVDVYINSLRKKIDPKSYYIHTIRGFGYIFQYKE 232
>gi|134299753|ref|YP_001113249.1| two component transcriptional regulator [Desulfotomaculum reducens MI-1] >gi|134052453|gb|ABO50424.1| two component transcriptional regulator, winged helix family [Desulfotomaculum reducens MI-1] (230 aa)
Score = 124, Expect = 2.8e-05, Identities = 41/170 (24%), Positives = 80/170 (47%)
  Q:    30 EILLNDKTFKIERVMLKPNEIDYLTTVHASVVIFDNIPSDQIDEAMVKKIKLISPITHFVYFCENYDEDTFLSVLQKGFEFCVSLDFFTPSLFFQTLLNIFHKVE---VINLMNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD 199
           ++ L  + F+++ +      +D + + H  +V+ D +       ++ K+I+ IS I   +   +  + D  + +     ++ V    F+P      +  I  +V    +I      I+  + L++N  +R V   G EI +T  EFD+L F  + P   FS+E + + VWGYD
  S:    18 KVYLVKEGFEVDELDNGNRVVDSIKSSHFDMVVLDIMLPGPDGLSLCKEIRKISNIPIIMLTAKGDEIDRIIGLEVGADDYIVKP--FSPRELVARINAILRRVAAQPIIQEDRTAILSFSELTINPDNRTVEVRGSEIALTPKEFDLLYFMAKTPGRAFSRENLLENVWGYD 188
>gi|167636524|ref|ZP_02394820.1| DNA-binding response regulator [Bacillus anthracis str. A0442] >gi|170689415|ref|ZP_02880607.1| DNA-binding response regulator [Bacillus anthracis str. A0465] >gi|167528056|gb|EDR90856.1| DNA-binding response regulator [Bacillus anthracis str. A0442] >gi|170666642|gb|EDT17413.1| DNA-binding response regulator [Bacillus anthracis str. A0465] (223 aa)
Score = 124, Expect = 2.8e-05, Identities = 28/80 (35%), Positives = 47/80 (58%)
  Q:   155 DRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDD-DPTGLVIQYIYKLKKKIGKDNIVSSTYNGYCFKL 234
           +RKV  S QEI++T  EF++ + F+ +P   F ++E+ +KVWG++    T  V   + +L+KK+G       T  G  +KL
  S:   141 ERKVHVSEQEIQLTYREFNLCQLFVSNPQRVFMRDELLEKVWGFEYIGNTRAVDIMVQRLRKKLGNSGEYIKTIYGVGYKL 221
>gi|110834226|ref|YP_693085.1| DNA-binding heavy metal response regulator, putative [Alcanivorax borkumensis SK2] >gi|110647337|emb|CAL16813.1| DNA-binding heavy metal response regulator, putative [Alcanivorax borkumensis SK2] >gi|196196128|gb|EDX91087.1| response regulator receiver domain protein [Alcanivorax sp. DG881] (222 aa)
Score = 124, Expect = 2.8e-05, Identities = 27/78 (34%), Positives = 46/78 (58%)
  Q:   155 DRKVWCSGQEIE--ITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGKDNIVSSTYNGYCF 232
           +R+   +G E E  +T  EF +L+  +  P   FSKE++  +++  DD P+  VI+ Y+ +L+K +G D I +    GY F
  S:   137 NRQTLRAGDETEHSLTGTEFRLLRCLMSRPGQVFSKEQLLDQLYSIDDIPSENVIEAYVRRLRKLVGPDTIKTRRGQGYLF 217
>gi|146338745|ref|YP_001203793.1| two-component regulatory system response regulator [Bradyrhizobium sp. ORS278] >gi|146191551|emb|CAL75556.1| response regulator in two-component regulatory system with PhoR (or CreC), regulation of Pi uptake (OmpR family) [Bradyrhizobium sp. ORS278] (235 aa)
Score = 124, Expect = 2.9e-05, Identities = 32/85 (37%), Positives = 51/85 (60%)
  Q:   156 RKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD---DDPTGLVIQYIYKLKKKI--GKDNIVSSTYNGYCFKLRESFRK 240
           R+V  SG+ I++   E+ +L+FFLEHP   FS+E++   VWG D   D+ T  V  +I +L+K +  G++     T  G  + L + F K
  S:   144 RRVARSGRPIDLGPTEYRLLEFFLEHPGRVFSREQLLDSVWGRDIYIDERT--VDVHIGRLRKLLNPGREQDPIRTVRGAGYALDDRFAK 231
>gi|126664543|ref|ZP_01735527.1| Response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Marinobacter sp. ELB17] >gi|126630869|gb|EBA01483.1| Response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Marinobacter sp. ELB17] (226 aa)
Score = 124, Expect = 2.9e-05, Identities = 29/90 (32%), Positives = 52/90 (57%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKKIGK--DNIVSSTYNGYCFKLRES 237
           +L M+L+ R V  +GQ I++   EF +L++ + +     ++  + +KVW Y  DP T ++  +I +L+ KI K  D  +  T  G  + LRE+
  S:   133 DLEMDLLARTVKRAGQNIDVQPREFRLLEYLMRNAGQVVTRTMLLEKVWDYHFDPQTNVIDVHISRLRAKIDKEFDTPLLQTVRGAGYMLRET 225
>gi|148253503|ref|YP_001238088.1| two component transcriptional regulator [Bradyrhizobium sp. BTAi1] >gi|146405676|gb|ABQ34182.1| two component transcriptional regulator, winged helix family [Bradyrhizobium sp. BTAi1] (235 aa)
Score = 124, Expect = 2.9e-05, Identities = 32/85 (37%), Positives = 51/85 (60%)
  Q:   156 RKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD---DDPTGLVIQYIYKLKKKI--GKDNIVSSTYNGYCFKLRESFRK 240
           R+V  SG+ I++   E+ +L+FFLEHP   FS+E++   VWG D   D+ T  V  +I +L+K +  G++     T  G  + L + F K
  S:   144 RRVARSGRPIDLGPTEYRLLEFFLEHPGRVFSREQLLDSVWGRDIYIDERT--VDVHIGRLRKLLNPGREQDPIRTVRGAGYALDDRFAK 231
>gi|120556645|ref|YP_960996.1| two component transcriptional regulator [Marinobacter aquaeolei VT8] >gi|120326494|gb|ABM20809.1| two component transcriptional regulator, winged helix family [Marinobacter aquaeolei VT8] (226 aa)
Score = 124, Expect = 2.9e-05, Identities = 29/90 (32%), Positives = 52/90 (57%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKKIGK--DNIVSSTYNGYCFKLRES 237
           +L M+L+ R V  +GQ I++   EF +L++ + +     ++  + +KVW Y  DP T ++  +I +L+ KI K  D  +  T  G  + LRE+
  S:   133 DLEMDLLARTVKRAGQNIDVQPREFRLLEYLMRNAGQVVTRTMLLEKVWDYHFDPQTNVIDVHISRLRAKIDKEFDTPLLQTVRGAGYMLRET 225
>gi|42780293|ref|NP_977540.1| DNA-binding response regulator [Bacillus cereus ATCC 10987] >gi|42736212|gb|AAS40148.1| DNA-binding response regulator [Bacillus cereus ATCC 10987] (234 aa)
Score = 124, Expect = 3.0e-05, Identities = 30/67 (44%), Positives = 47/67 (70%)
  Q:   154 IDR---KVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWG---YDDDPTGLVIQYIYKLKKKIGKD 220
           IDR   ++  +G  +E +   F +L FF E+PN  FSKEEI++KVWG   Y+ D   +++ +I KL++KI +D
  S:   143 IDRDSAELTVNGHVVECSAQLFQLLLFFCENPNYVFSKEEIYEKVWGAPAYNGDDNTVMV-HIRKLREKIEQD 214
>gi|168133883|ref|ZP_02577112.1| Two-component response regulator [Bacillus cereus B4264] (215 aa)
Score = 124, Expect = 3.0e-05, Identities = 33/94 (35%), Positives = 58/94 (61%)
  Q:   143 IIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD---DDPTGLVIQYIYKLKKKIGKDNIVSSTYNGYCFKLRE 236
           II   ++ +N    KV+ +  E+EITK E +++K FL H  T  +++++   VWG+D   ++ T  V  ++ +L+KKIG +NI+  T+ G  + L E
  S:   120 IIQVQDVKINFAKNKVYKNDIELEITKTELELIKCFLNHKGTILTRKKLLDIVWGFDYFGEERT--VDTHVRRLRKKIG-ENII-KTHRGLGYSLEE 212
>gi|134291059|ref|YP_001114828.1| two component transcriptional regulator [Burkholderia vietnamiensis G4] >gi|134134248|gb|ABO58573.1| two component transcriptional regulator, winged helix family [Burkholderia vietnamiensis G4] (239 aa)
Score = 124, Expect = 3.1e-05, Identities = 26/72 (36%), Positives = 40/72 (55%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGKD 220
           LS++ I R+    G  I++T  EFD+L FF  HP   FS+ ++   VWGY  +     +  +I +L+ KI  D
  S:   142 LSIDPIAREASVDGTRIDLTPREFDLLYFFARHPGKVFSRMDLLNAVWGYRHEGYEHTVNTHINRLRAKIEAD 214
>gi|160902317|ref|YP_001567898.1| two component transcriptional regulator [Petrotoga mobilis SJ95] >gi|160359961|gb|ABX31575.1| two component transcriptional regulator, winged helix family [Petrotoga mobilis SJ95] (222 aa)
Score = 124, Expect = 3.1e-05, Identities = 29/97 (29%), Positives = 59/97 (60%)
  Q:   141 NVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIG-KDNIVSSTYNGYCFKLRES 237
           N ++   +L++N + R+VW   +++++T  E++IL++F+ +P    ++  + +K+W  D +    VI  YI +L+KKIG K+  +  T  G  ++L  S
  S:   124 NPVLKVGDLTLNTLTREVWMGEKKLKLTPKEYNILEYFMRNPKIVVTRTILEEKMWDIDFEGNSNVIDVYIRRLRKKIGDKEGKILETVRGAGYRLTVS 222
>gi|15900691|ref|NP_345295.1| DNA-binding response regulator CiaR [Streptococcus pneumoniae TIGR4] >gi|111658151|ref|ZP_01408848.1| hypothetical protein SpneT_02000676 [Streptococcus pneumoniae TIGR4] >gi|148985849|ref|ZP_01818943.1| DNA-binding response regulator CiaR [Streptococcus pneumoniae SP3-BS71] >gi|148990411|ref|ZP_01821577.1| DNA-binding response regulator CiaR [Streptococcus pneumoniae SP6-BS73] >gi|148992467|ref|ZP_01822162.1| DNA-binding response regulator CiaR [Streptococcus pneumoniae SP9-BS68] >gi|148997122|ref|ZP_01824776.1| DNA-binding response regulator CiaR [Streptococcus pneumoniae SP11-BS70] >gi|149003430|ref|ZP_01828319.1| DNA-binding response regulator CiaR [Streptococcus pneumoniae SP14-BS69] >gi|149007683|ref|ZP_01831300.1| DNA-binding response regulator CiaR [Streptococcus pneumoniae SP18-BS74] >gi|149010570|ref|ZP_01831941.1| DNA-binding response regulator CiaR [Streptococcus pneumoniae SP19-BS75] >gi|149021667|ref|ZP_01835698.1| DNA-binding response regulator CiaR [Streptococcus pneumoniae SP23-BS72] >gi|168484457|ref|ZP_02709409.1| transcriptional regulatory protein CiaR [Streptococcus pneumoniae CDC1873-00] >gi|168486188|ref|ZP_02710696.1| transcriptional regulatory protein CiaR [Streptococcus pneumoniae CDC1087-00] >gi|168489819|ref|ZP_02714018.1| transcriptional regulatory protein CiaR [Streptococcus pneumoniae SP195] >gi|168490895|ref|ZP_02715038.1| transcriptional regulatory protein CiaR [Streptococcus pneumoniae CDC0288-04] >gi|168492956|ref|ZP_02717099.1| transcriptional regulatory protein CiaR [Streptococcus pneumoniae CDC3059-06] >gi|168575461|ref|ZP_02721397.1| transcriptional regulatory protein CiaR [Streptococcus pneumoniae MLV-016] >gi|169833866|ref|YP_001694261.1| transcriptional regulatory protein CiaR [Streptococcus pneumoniae Hungary19A-6] >gi|194398608|ref|YP_002037443.1| CiaR response regulator TCS05 [Streptococcus pneumoniae G54] >gi|61220925|sp|P0A4H7|CIAR_STRPN Transcriptional regulatory protein ciaR >gi|61220927|sp|P0A4H8|CIAR_STRR6 Transcriptional regulatory protein ciaR >gi|495276|emb|CAA54465.1| response regulator [Streptococcus pneumoniae] >gi|14972274|gb|AAK74935.1| DNA-binding response regulator CiaR [Streptococcus pneumoniae TIGR4] >gi|147756822|gb|EDK63862.1| DNA-binding response regulator CiaR [Streptococcus pneumoniae SP11-BS70] >gi|147758613|gb|EDK65611.1| DNA-binding response regulator CiaR [Streptococcus pneumoniae SP14-BS69] >gi|147760838|gb|EDK67809.1| DNA-binding response regulator CiaR [Streptococcus pneumoniae SP18-BS74] >gi|147765051|gb|EDK71980.1| DNA-binding response regulator CiaR [Streptococcus pneumoniae SP19-BS75] >gi|147921995|gb|EDK73119.1| DNA-binding response regulator CiaR [Streptococcus pneumoniae SP3-BS71] >gi|147924316|gb|EDK75409.1| DNA-binding response regulator CiaR [Streptococcus pneumoniae SP6-BS73] >gi|147928784|gb|EDK79797.1| DNA-binding response regulator CiaR [Streptococcus pneumoniae SP9-BS68] >gi|147930128|gb|EDK81114.1| DNA-binding response regulator CiaR [Streptococcus pneumoniae SP23-BS72] >gi|168996368|gb|ACA36980.1| transcriptional regulatory protein CiaR [Streptococcus pneumoniae Hungary19A-6] >gi|172042318|gb|EDT50364.1| transcriptional regulatory protein CiaR [Streptococcus pneumoniae CDC1873-00] >gi|183570751|gb|EDT91279.1| transcriptional regulatory protein CiaR [Streptococcus pneumoniae CDC1087-00] >gi|183571796|gb|EDT92324.1| transcriptional regulatory protein CiaR [Streptococcus pneumoniae SP195] >gi|183574782|gb|EDT95310.1| transcriptional regulatory protein CiaR [Streptococcus pneumoniae CDC0288-04] >gi|183577079|gb|EDT97607.1| transcriptional regulatory protein CiaR [Streptococcus pneumoniae CDC3059-06] >gi|183578577|gb|EDT99105.1| transcriptional regulatory protein CiaR [Streptococcus pneumoniae MLV-016] >gi|194358275|gb|ACF56723.1| CiaR response regulator TCS05 [Streptococcus pneumoniae G54] (224 aa)
Score = 124, Expect = 3.1e-05, Identities = 27/77 (35%), Positives = 47/77 (61%)
  Q:   141 NVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKI 217
           N + +GN + +NL    V      +E+   EFD+L +FL++ N    K +IF ++WG+D D T  V++ Y+ K++KK+
  S:   125 NTLTYGN-IVVNLSTNTVKVEDTPVELLGKEFDLLVYFLQNQNVILPKTQIFDRLWGFDSDTTISVVEVYVSKVRKKL 201
>gi|49477096|ref|YP_035355.1| response regulator [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|166991742|ref|ZP_02258202.1| response regulator [Bacillus cereus AH820] >gi|196037687|ref|ZP_03104998.1| DNA-binding response regulator [Bacillus cereus NVH0597-99] >gi|49328652|gb|AAT59298.1| response regulator [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|196031929|gb|EDX70525.1| DNA-binding response regulator [Bacillus cereus NVH0597-99] (234 aa)
Score = 124, Expect = 3.1e-05, Identities = 30/67 (44%), Positives = 48/67 (71%)
  Q:   154 IDR---KVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWG---YDDDPTGLVIQYIYKLKKKIGKD 220
           IDR   ++  +G+ +E +   F +L FF E+PN  FSKEEI++KVWG   Y+ D   +++ +I KL++KI +D
  S:   143 IDRYSAELTVNGRVVECSAQLFQLLLFFCENPNYVFSKEEIYEKVWGAPAYNGDDNTVMV-HIRKLREKIEQD 214
>gi|169188079|ref|ZP_02848236.1| two component transcriptional regulator, winged helix family [Paenibacillus sp. JDR-2] >gi|169005103|gb|EDS51957.1| two component transcriptional regulator, winged helix family [Paenibacillus sp. JDR-2] (230 aa)
Score = 124, Expect = 3.2e-05, Identities = 24/72 (33%), Positives = 45/72 (62%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDD-PTGLVIQYIYKLKKKIGKD 220
           L++N    +V+   QE+ +T  EF++L F   +PN  FSK+++F+K+WG D +     V  +I ++++K+  D
  S:   139 LTINPSSHRVFVHEQEVFLTAKEFEVLVFMATNPNRVFSKDQLFEKIWGLDSNGDIATVTVHISRIREKLEAD 211
>gi|168162423|ref|ZP_02597656.1| DNA-binding response regulator [Bacillus cereus H3081.97] (232 aa)
Score = 124, Expect = 3.2e-05, Identities = 30/77 (38%), Positives = 46/77 (59%)
  Q:   156 RKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTG-LVIQYIYKLKKKIG----KDNIVSSTYN-GYCF 232
           R V   G+++E+T  EFDIL     HP   ++ E IF++VW  D    G  V+ +I  L+KK+G    KD ++ + +  GY F
  S:   148 RTVNVYGEQVELTPKEFDILYLLASHPKKVYNVENIFQQVWADDYYEGGNTVMVHIRTLRKKLGEDKRKDKLIKTVWGVGYTF 230
>gi|192810639|ref|ZP_03039312.1| response regulator receiver [Geobacillus sp. Y412MC10] >gi|192800931|gb|EDV77438.1| response regulator receiver [Geobacillus sp. Y412MC10] (235 aa)
Score = 124, Expect = 3.2e-05, Identities = 27/77 (35%), Positives = 47/77 (61%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD---DDPTGLVIQYIYKLKKKIGKDNIVSS 225
           LS++   RKV    +EI ++  EFD+L F   +PN  F+K ++  +VWGY    +D T  +  Y+ +L++K+ +  I S+
  S:   140 LSIDKGARKVMAGQREIALSAKEFDLLYFLASNPNQVFTKTQLLDQVWGYSAYVEDNT--ITVYVRRLREKLERSGIKSA 217
>gi|170701392|ref|ZP_02892352.1| two component transcriptional regulator, winged helix family [Burkholderia ambifaria IOP40-10] >gi|170133701|gb|EDT02069.1| two component transcriptional regulator, winged helix family [Burkholderia ambifaria IOP40-10] (277 aa)
Score = 124, Expect = 3.2e-05, Identities = 25/72 (34%), Positives = 40/72 (55%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGKD 220
           LS++ I R+    G  I++T  EFD+L FF  HP   FS+ ++   VWGY  +     +  +I +L+ K+  D
  S:   180 LSIDPIAREASVDGTRIDLTPREFDLLYFFARHPGKVFSRMDLLNAVWGYQHEGYEHTVNTHINRLRAKVEAD 252
>gi|168142591|ref|ZP_02585820.1| Two-component response regulator [Bacillus cereus G9842] (223 aa)
Score = 124, Expect = 3.2e-05, Identities = 20/63 (31%), Positives = 43/63 (68%)
  Q:   155 DRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKI 217
           D+ V   GQ I++T  ++++L++ +++      +E+IF +VWG+D D T  +++ Y++ L+KK+
  S:   138 DKDVQVDGQGIKLTLKQYELLEYLIQNSGKILMREQIFDRVWGFDSDTTVAIVEVYVHHLRKKL 201
>gi|172064834|ref|YP_001815546.1| two component transcriptional regulator [Burkholderia ambifaria MC40-6] >gi|171997076|gb|ACB67993.1| two component transcriptional regulator, winged helix family [Burkholderia ambifaria MC40-6] (239 aa)
Score = 124, Expect = 3.2e-05, Identities = 25/72 (34%), Positives = 40/72 (55%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGKD 220
           LS++ I R+    G  I++T  EFD+L FF  HP   FS+ ++   VWGY  +     +  +I +L+ K+  D
  S:   142 LSIDPIAREASVDGTRIDLTPREFDLLYFFARHPGKVFSRMDLLNAVWGYQHEGYEHTVNTHINRLRAKVEAD 214
>gi|115360529|ref|YP_777666.1| two component transcriptional regulator [Burkholderia ambifaria AMMD] >gi|115285857|gb|ABI91332.1| two component transcriptional regulator, winged helix family [Burkholderia ambifaria AMMD] (239 aa)
Score = 124, Expect = 3.2e-05, Identities = 25/72 (34%), Positives = 40/72 (55%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGKD 220
           LS++ I R+    G  I++T  EFD+L FF  HP   FS+ ++   VWGY  +     +  +I +L+ K+  D
  S:   142 LSIDPIAREASVDGTRIDLTPREFDLLYFFARHPGKVFSRMDLLNAVWGYQHEGYEHTVNTHINRLRAKVEAD 214
>gi|157364554|ref|YP_001471321.1| two component transcriptional regulator [Thermotoga lettingae TMO] >gi|157315158|gb|ABV34257.1| two component transcriptional regulator, winged helix family [Thermotoga lettingae TMO] (217 aa)
Score = 123, Expect = 3.2e-05, Identities = 27/80 (33%), Positives = 47/80 (58%)
  Q:   155 DRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQYIYKLKKKIGKDNIVSSTYNGYCFKL 234
           +R +  + + +E++  EF+IL  F E+P   F++ EI   VW  +D    +V  Y+  L+KK+GK+ +V  T +G  +KL
  S:   139 ERILLINDESVELSAKEFEILLMFFENPKKVFTRSEILDNVWQNEDRSERIVDVYMSLLRKKLGKERLV--TVHGVGYKL 216
>gi|150007457|ref|YP_001302200.1| two-component system response regulator [Parabacteroides distasonis ATCC 8503] >gi|149935881|gb|ABR42578.1| two-component system response regulator [Parabacteroides distasonis ATCC 8503] (228 aa)
Score = 123, Expect = 3.2e-05, Identities = 34/77 (44%), Positives = 46/77 (59%)
  Q:   157 KVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWG---YDDDPTGLVIQYIYKLKKKIGK--DNIVSSTYNGYCFK 233
           K    G E+ +TK EF+ILK  LE+    FS+EEI  ++W    Y  D T  +   I +L+KKIG    NIV+    GYCF+
  S:   148 KATVDGVEVPLTKKEFEILKLLLENKGNVFSREEILSRIWKDEVYVLDRT--IDVNITRLRKKIGPYGKNIVTRLGFGYCFE 227
>gi|66046356|ref|YP_236197.1| response regulator receiver:transcriptional regulatory protein, C-terminal [Pseudomonas syringae pv. syringae B728a] >gi|63257063|gb|AAY38159.1| Response regulator receiver:Transcriptional regulatory protein, C-terminal [Pseudomonas syringae pv. syringae B728a] (227 aa)
Score = 123, Expect = 3.2e-05, Identities = 25/70 (35%), Positives = 43/70 (61%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKKI 217
           +L +NLI R+    G+ + +   EF +L+F + +     ++  IF++VWGY  DP T L+  +I +L+KKI
  S:   134 DLELNLITREACRGGEPLTLLPTEFKLLEFLMRNSGQIITRMMIFQEVWGYHFDPGTNLIDVHIGRLRKKI 204
>gi|38233301|ref|NP_939068.1| putative two component system response regulator [Corynebacterium diphtheriae NCTC 13129] >gi|38199560|emb|CAE49211.1| Putative two component system response regulator [Corynebacterium diphtheriae] (232 aa)
Score = 123, Expect = 3.2e-05, Identities = 26/73 (35%), Positives = 46/73 (63%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDD-DPTGLVIQYIYKLKKKIGKD 220
           +L+++++  +V    +EI++T  EFD+L      P   F++EE+ +KVWGY +   T LV  ++ +L+ KI KD
  S:   139 DLTIDVLGHEVTRGDEEIQLTPLEFDLLLELASKPGQVFTREELLQKVWGYRNASDTRLVNVHVQRLRSKIEKD 212
>gi|52140648|ref|YP_086180.1| DNA-binding response regulator [Bacillus cereus E33L] >gi|51974117|gb|AAU15667.1| DNA-binding response regulator [Bacillus cereus E33L] (232 aa)
Score = 123, Expect = 3.3e-05, Identities = 30/77 (38%), Positives = 46/77 (59%)
  Q:   156 RKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTG-LVIQYIYKLKKKIG----KDNIVSSTYN-GYCF 232
           R V   G+++E+T  EFDIL     HP   ++ E IF++VW  D    G  V+ +I  L+KK+G    KD ++ + +  GY F
  S:   148 RTVNVYGEQVELTPKEFDILYLLASHPKKVYNVENIFQQVWADDYYEGGNTVMVHIRTLRKKLGEDKRKDKLIKTVWGVGYTF 230
>gi|153827358|ref|ZP_01980025.1| transcriptional regulator [Vibrio cholerae MZO-2] >gi|149738727|gb|EDM53069.1| transcriptional regulator [Vibrio cholerae MZO-2] (218 aa)
Score = 123, Expect = 3.3e-05, Identities = 26/89 (29%), Positives = 53/89 (59%)
  Q:   147 NNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGKDNIVSSTYNGYCFKLR 235
           +NL+++   R+V+ +G+ I +T+ EFD+L F   +    F+++E+   VWGY+  PT   +  ++ +L++K+    I   T  G  +K++
  S:   130 SNLTIDKATREVFFNGESITLTRTEFDLLLFLASNLGRVFTRDELLDHVWGYNHFPTTRTVDTHVLQLRQKLPGLEI--ETLRGVGYKMK 217
>gi|75759474|ref|ZP_00739566.1| Two-component response regulator [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|74493049|gb|EAO56173.1| Two-component response regulator [Bacillus thuringiensis serovar israelensis ATCC 35646] (232 aa)
Score = 123, Expect = 3.3e-05, Identities = 20/63 (31%), Positives = 43/63 (68%)
  Q:   155 DRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKI 217
           D+ V   GQ I++T  ++++L++ +++      +E+IF +VWG+D D T  +++ Y++ L+KK+
  S:   147 DKDVQVDGQGIKLTLKQYELLEYLIQNSGKILMREQIFDRVWGFDSDTTVAIVEVYVHHLRKKL 210
>gi|30265287|ref|NP_847664.1| DNA-binding response regulator [Bacillus anthracis str. Ames] >gi|47530822|ref|YP_022171.1| DNA-binding response regulator [Bacillus anthracis str. 'Ames Ancestor'] >gi|49188099|ref|YP_031352.1| DNA-binding response regulator [Bacillus anthracis str. Sterne] >gi|65317232|ref|ZP_00390191.1| COG0745: Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Bacillus anthracis str. A2012] >gi|165869866|ref|ZP_02214523.1| DNA-binding response regulator [Bacillus anthracis str. A0488] >gi|167641807|ref|ZP_02400048.1| DNA-binding response regulator [Bacillus anthracis str. A0193] >gi|170708959|ref|ZP_02899391.1| DNA-binding response regulator [Bacillus anthracis str. A0389] >gi|177654055|ref|ZP_02936065.1| DNA-binding response regulator [Bacillus anthracis str. A0174] >gi|190567646|ref|ZP_03020558.1| DNA-binding response regulator [Bacillus anthracis Tsiankovskii-I] >gi|30259965|gb|AAP29150.1| DNA-binding response regulator [Bacillus anthracis str. Ames] >gi|47505970|gb|AAT34646.1| DNA-binding response regulator [Bacillus anthracis str. 'Ames Ancestor'] >gi|49182026|gb|AAT57402.1| DNA-binding response regulator [Bacillus anthracis str. Sterne] >gi|164714189|gb|EDR19709.1| DNA-binding response regulator [Bacillus anthracis str. A0488] >gi|167510219|gb|EDR85624.1| DNA-binding response regulator [Bacillus anthracis str. A0193] >gi|170126124|gb|EDS95019.1| DNA-binding response regulator [Bacillus anthracis str. A0389] >gi|172080938|gb|EDT66017.1| DNA-binding response regulator [Bacillus anthracis str. A0174] >gi|190561062|gb|EDV15035.1| DNA-binding response regulator [Bacillus anthracis Tsiankovskii-I] (223 aa)
Score = 123, Expect = 3.3e-05, Identities = 28/80 (35%), Positives = 47/80 (58%)
  Q:   155 DRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDD-DPTGLVIQYIYKLKKKIGKDNIVSSTYNGYCFKL 234
           +RKV  S QEI++T  EF++ + F+ +P   F ++E+ +KVWG++    T  V   + +L+KK+G       T  G  +KL
  S:   141 ERKVHVSEQEIQLTYREFNLCQLFVSNPQRVFMRDELLEKVWGFEYIGNTRAVDIMVQRLRKKLGNSGEYIKTIYGVGYKL 221
>gi|126642782|ref|YP_001085766.1| transcriptional regulator [Acinetobacter baumannii ATCC 17978] (168 aa)
Score = 123, Expect = 3.4e-05, Identities = 30/90 (33%), Positives = 50/90 (55%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGKDNIVSSTYNGYCFKLRES 237
           +L +N+        GQ I+++  E+ IL   + HPN  FSK  +  K++ +D D T   I+ Y++ L+ K+GKD I   T  G  ++L +S
  S:    80 DLVLNVEQHIATFKGQRIDLSNREWAILIPLMTHPNKIFSKANLEDKLYDFDSDVTSNTIEVYVHHLRAKLGKDFI--RTIRGLGYRLGQS 168
>gi|87199648|ref|YP_496905.1| two component transcriptional regulator [Novosphingobium aromaticivorans DSM 12444] >gi|87135329|gb|ABD26071.1| two component transcriptional regulator, winged helix family [Novosphingobium aromaticivorans DSM 12444] (227 aa)
Score = 123, Expect = 3.4e-05, Identities = 21/57 (36%), Positives = 37/57 (64%)
  Q:   161 SGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKKI 217
           +G  +++T  E  +L+  +E P T  S+ EI + VWG +DDP T +V  Y+ +L++K+
  S:   150 AGTPVQLTVKEMGVLRLLMESPGTVISRTEILRAVWGMEDDPLTNIVEVYLSRLRRKL 207
>gi|47567578|ref|ZP_00238289.1| response regulator DrrA [Bacillus cereus G9241] >gi|47555773|gb|EAL14113.1| response regulator DrrA [Bacillus cereus G9241] (234 aa)
Score = 123, Expect = 3.4e-05, Identities = 27/60 (45%), Positives = 43/60 (71%)
  Q:   161 SGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWG---YDDDPTGLVIQYIYKLKKKIGKD 220
           +G+ +E +   F +L FF E+PN  FSKEEI++KVWG   Y+ D   +++ +I KL++KI +D
  S:   153 NGRIVECSAQLFQLLLFFCENPNYVFSKEEIYEKVWGAPAYNGDDNTVMV-HIRKLREKIEQD 214
>gi|183601477|ref|ZP_02962847.1| response regulator of two-component system [Bifidobacterium animalis subsp. lactis HN019] >gi|183219083|gb|EDT89724.1| response regulator of two-component system [Bifidobacterium animalis subsp. lactis HN019] (239 aa)
Score = 123, Expect = 3.4e-05, Identities = 31/109 (28%), Positives = 57/109 (52%)
  Q:   129 IFHKVEVINLMNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGY-DDDPTGLVIQYIYKLKKKIGKDNIVSSTYNGYCFKLRES 237
           I HK E     N+ I+    L ++   R+V   G+E+ +T  EFD+L    + P++  ++E++ ++VW + D   T  V  ++  L+ K+G   I +    GY F+  E+
  S:   135 IAHKSE-----NDCILDFGTLVIDPAKRQVTLDGKEVHLTPTEFDLLTTLAKQPHSVLTREQLLEEVWDWVDASSTRTVDSHVKALRHKLGASTIRTVHGVGYAFEPPEA 239
>gi|148984378|ref|ZP_01817666.1| response regulator [Streptococcus pneumoniae SP3-BS71] >gi|147923155|gb|EDK74269.1| response regulator [Streptococcus pneumoniae SP3-BS71] (235 aa)
Score = 123, Expect = 3.4e-05, Identities = 28/80 (35%), Positives = 52/80 (65%)
  Q:   157 KVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD-DDPTGLVIQYIYKLKKKIGKDNIVS----STYNGYCFKLRE 236
           +V+ + + + +T  EF++L + ++HPN   ++E + +++WGYD    T LV  +I KL++KI +DN  +     T  GY +K +E
  S:   151 EVYKANKLLSLTPKEFELLLYLMKHPNMTLTRERLLERIWGYDFGQETRLVDVHIGKLREKI-EDNPKAPQFIRTIRGYGYKFKE 234
>gi|84496068|ref|ZP_00994922.1| putative two component response regulator [Janibacter sp. HTCC2649] >gi|84382836|gb|EAP98717.1| putative two component response regulator [Janibacter sp. HTCC2649] (247 aa)
Score = 123, Expect = 3.4e-05, Identities = 27/72 (37%), Positives = 42/72 (58%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWG---YDDDPTGLVIQYIYKLKKKIGKD 220
           L+++ I R VW   Q + +T+ EFD+L    E P   FS+ ++  +VWG     DD   LV  +I  L++K+G D
  S:   154 LAIDPIGRDVWLDDQPVSLTRTEFDVLAVLSERPGMAFSRRQLIDQVWGGTWVGDD--HLVDVHIGHLRRKLGDD 226
>gi|158318242|ref|YP_001510750.1| two component transcriptional regulator [Frankia sp. EAN1pec] >gi|158113647|gb|ABW15844.1| two component transcriptional regulator, winged helix family [Frankia sp. EAN1pec] (270 aa)
Score = 123, Expect = 3.4e-05, Identities = 26/73 (35%), Positives = 46/73 (63%)
  Q:   163 QEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVW--GYDDDPTGLVIQYIYKLKKKIGKDN-IVSSTYNGYCFKLR 235
           Q +E++  EF +L++FL +PN   S+ +I   VW   +D +PT +V QY+  L++K+G+    +  T  G+ + LR
  S:   172 QPVELSPTEFSLLRYFLHNPNRVLSRAQILAAVWDRDFDGEPT-VVDQYVSYLRRKLGQHGPPLIHTQRGFGYALR 246
>gi|34763104|ref|ZP_00144075.1| Two-component response regulator [Fusobacterium nucleatum subsp. vincentii ATCC 49256] >gi|27887238|gb|EAA24338.1| Two-component response regulator [Fusobacterium nucleatum subsp. vincentii ATCC 49256] (227 aa)
Score = 123, Expect = 3.4e-05, Identities = 33/89 (37%), Positives = 54/89 (60%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD-DDPTGLVIQYIYKLKKKIGKDNIVSSTYN--GYCFKLRE 236
           ++ ++L  ++V+   +EI +TK EF IL++F+++     S+E+I   VWGYD D    +V  YI  L+KKI  D+    T    GY F+ +E
  S:   135 DIKLDLSAKRVYLGEEEINLTKTEFLILEYFMKNKGLSCSREKIIIGVWGYDFDGEEKIVDVYINSLRKKIDLDSKYIHTIRGFGYMFQYKE 226
>gi|196188745|gb|EDX83709.1| response regulator receiver domain protein [Synechococcus sp. PCC 7335] (227 aa)
Score = 123, Expect = 3.5e-05, Identities = 26/74 (35%), Positives = 44/74 (59%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGKDN 221
           +LS+N   R+V    + IE+T  EFD+L + + HP    +++ I ++VWGYD      +I+ YI  L+ K+  +N
  S:   136 DLSLNRKTREVRRGDRLIELTAKEFDLLDYLISHPKQVLTRDRILEEVWGYDFMGDSNIIEVYIRYLRLKLEAEN 210
>gi|68536723|ref|YP_251428.1| two-component system response regulator MtrA [Corynebacterium jeikeium K411] >gi|68264322|emb|CAI37810.1| two-component system response regulator MtrA [Corynebacterium jeikeium K411] (225 aa)
Score = 123, Expect = 3.5e-05, Identities = 27/73 (36%), Positives = 43/73 (58%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGY-DDDPTGLVIQYIYKLKKKIGKD 220
           +L +++   +V   GQEI +T  EFD+L      P   FS+EE+ ++VWGY     T LV  +I +L+ K+ +D
  S:   133 DLKIDVPGHQVIRDGQEIALTPIEFDLLVTLASRPRQVFSREELLEQVWGYRKSSDTRLVNVHIQRLRSKVERD 206
>gi|15901898|ref|NP_346502.1| response regulator [Streptococcus pneumoniae TIGR4] >gi|15903934|ref|NP_359484.1| response regulator [Streptococcus pneumoniae R6] >gi|111657578|ref|ZP_01408316.1| hypothetical protein SpneT_02001237 [Streptococcus pneumoniae TIGR4] >gi|116516111|ref|YP_817297.1| response regulator [Streptococcus pneumoniae D39] >gi|148989900|ref|ZP_01821183.1| response regulator [Streptococcus pneumoniae SP6-BS73] >gi|148992075|ref|ZP_01821849.1| response regulator [Streptococcus pneumoniae SP9-BS68] >gi|148998124|ref|ZP_01825637.1| response regulator [Streptococcus pneumoniae SP11-BS70] >gi|149006952|ref|ZP_01830633.1| response regulator [Streptococcus pneumoniae SP18-BS74] >gi|149023777|ref|ZP_01836238.1| response regulator [Streptococcus pneumoniae SP23-BS72] >gi|168486897|ref|ZP_02711405.1| alkaline phosphatase synthesis transcriptional regulatory proteinphoP [Streptococcus pneumoniae CDC1087-00] >gi|168489143|ref|ZP_02713342.1| alkaline phosphatase synthesis transcriptional regulatory proteinphoP [Streptococcus pneumoniae SP195] >gi|168491607|ref|ZP_02715750.1| alkaline phosphatase synthesis transcriptional regulatory proteinphoP [Streptococcus pneumoniae CDC0288-04] >gi|168494164|ref|ZP_02718307.1| alkaline phosphatase synthesis transcriptional regulatory proteinphoP [Streptococcus pneumoniae CDC3059-06] >gi|168577113|ref|ZP_02722933.1| alkaline phosphatase synthesis transcriptional regulatory proteinphoP [Streptococcus pneumoniae MLV-016] >gi|194397101|ref|YP_002038671.1| PnpR response regulator TCS04 [Streptococcus pneumoniae G54] >gi|5830529|emb|CAB54572.1| response regulator [Streptococcus pneumoniae] >gi|14973592|gb|AAK76142.1| response regulator [Streptococcus pneumoniae TIGR4] >gi|15459586|gb|AAL00695.1| Response regulator [Streptococcus pneumoniae R6] >gi|116076687|gb|ABJ54407.1| response regulator [Streptococcus pneumoniae D39] >gi|147756134|gb|EDK63177.1| response regulator [Streptococcus pneumoniae SP11-BS70] >gi|147761553|gb|EDK68518.1| response regulator [Streptococcus pneumoniae SP18-BS74] >gi|147924685|gb|EDK75770.1| response regulator [Streptococcus pneumoniae SP6-BS73] >gi|147929124|gb|EDK80135.1| response regulator [Streptococcus pneumoniae SP9-BS68] >gi|147929573|gb|EDK80566.1| response regulator [Streptococcus pneumoniae SP23-BS72] >gi|183570147|gb|EDT90675.1| alkaline phosphatase synthesis transcriptional regulatory proteinphoP [Streptococcus pneumoniae CDC1087-00] >gi|183572272|gb|EDT92800.1| alkaline phosphatase synthesis transcriptional regulatory proteinphoP [Streptococcus pneumoniae SP195] >gi|183574008|gb|EDT94536.1| alkaline phosphatase synthesis transcriptional regulatory proteinphoP [Streptococcus pneumoniae CDC0288-04] >gi|183575934|gb|EDT96462.1| alkaline phosphatase synthesis transcriptional regulatory proteinphoP [Streptococcus pneumoniae CDC3059-06] >gi|183577273|gb|EDT97801.1| alkaline phosphatase synthesis transcriptional regulatory proteinphoP [Streptococcus pneumoniae MLV-016] >gi|194356768|gb|ACF55216.1| PnpR response regulator TCS04 [Streptococcus pneumoniae G54] (235 aa)
Score = 123, Expect = 3.5e-05, Identities = 28/80 (35%), Positives = 52/80 (65%)
  Q:   157 KVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD-DDPTGLVIQYIYKLKKKIGKDNIVS----STYNGYCFKLRE 236
           +V+ + + + +T  EF++L + ++HPN   ++E + +++WGYD    T LV  +I KL++KI +DN  +     T  GY +K +E
  S:   151 EVYKANKLLSLTPKEFELLLYLMKHPNMTLTRERLLERIWGYDFGQETRLVDVHIGKLREKI-EDNPKAPQFIRTIRGYGYKFKE 234
>gi|163939206|ref|YP_001644090.1| two component transcriptional regulator [Bacillus weihenstephanensis KBAB4] >gi|163861403|gb|ABY42462.1| two component transcriptional regulator, winged helix family [Bacillus weihenstephanensis KBAB4] (223 aa)
Score = 123, Expect = 3.5e-05, Identities = 29/84 (34%), Positives = 51/84 (60%)
  Q:   151 MNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD-DDPTGLVIQYIYKLKKKIGKD-NIVSSTYN-GYCFKL 234
           +N   R+V  +G+ I +T  EFD+L F  +H    FS+E++ +KVWGYD    T  V  ++  ++ K+G+  N + + +  GY F++
  S:   137 INEKSRRVETNGETIPLTVKEFDLLYFLCQHNGQVFSREQLLEKVWGYDYAGSTRTVDTHVKTMRLKLGESGNYIQTVWGVGYKFEV 223
>gi|153800662|ref|ZP_01955248.1| transcriptional regulator [Vibrio cholerae MZO-3] >gi|153828725|ref|ZP_01981392.1| transcriptional regulator [Vibrio cholerae 623-39] >gi|194534690|ref|YP_002069894.1| transcriptional regulator [Vibrio cholerae RC385] >gi|124123797|gb|EAY42540.1| transcriptional regulator [Vibrio cholerae MZO-3] >gi|125620518|gb|EAZ48887.1| transcriptional regulator [Vibrio cholerae V51] >gi|148875772|gb|EDL73907.1| transcriptional regulator [Vibrio cholerae 623-39] >gi|150419484|gb|EDN11812.1| transcriptional regulator [Vibrio cholerae RC385] (245 aa)
Score = 123, Expect = 3.5e-05, Identities = 26/89 (29%), Positives = 53/89 (59%)
  Q:   147 NNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGKDNIVSSTYNGYCFKLR 235
           +NL+++   R+V+ +G+ I +T+ EFD+L F   +    F+++E+   VWGY+  PT   +  ++ +L++K+    I   T  G  +K++
  S:   157 SNLTIDKATREVFFNGESITLTRTEFDLLLFLASNLGRVFTRDELLDHVWGYNHFPTTRTVDTHVLQLRQKLPGLEI--ETLRGVGYKMK 244
>gi|163816645|ref|ZP_02208008.1| hypothetical protein COPEUT_02835 [Coprococcus eutactus ATCC 27759] >gi|158447902|gb|EDP24897.1| hypothetical protein COPEUT_02835 [Coprococcus eutactus ATCC 27759] (235 aa)
Score = 123, Expect = 3.5e-05, Identities = 23/71 (32%), Positives = 44/71 (61%)
  Q:   147 NNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWG--YDDDPTGLVIQYIYKLKKKI 217
           N + + L  R+V+  G+E+ +T  EFD+L+  + HPN  +S+ E+   +WG  Y  D   + + ++ +L++KI
  S:   142 NGMKVELDSRRVFVGGKELNLTAKEFDLLELLMAHPNKVYSRNELLSTIWGDSYPGDARTVDV-HVRRLREKI 213
>gi|168161780|ref|ZP_02597013.1| response regulator [Bacillus cereus H3081.97] (234 aa)
Score = 123, Expect = 3.6e-05, Identities = 30/67 (44%), Positives = 48/67 (71%)
  Q:   154 IDR---KVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWG---YDDDPTGLVIQYIYKLKKKIGKD 220
           IDR   ++  +G+ +E +   F +L FF E+PN  FSKEEI++KVWG   Y+ D   +++ +I KL++KI +D
  S:   143 IDRYSAELTVNGRVVECSAQLFQLLLFFCENPNYVFSKEEIYEKVWGAPAYNGDDNTVMV-HIRKLREKIEQD 214
>gi|121535649|ref|ZP_01667454.1| two component transcriptional regulator, winged helix family [Thermosinus carboxydivorans Nor1] >gi|121305753|gb|EAX46690.1| two component transcriptional regulator, winged helix family [Thermosinus carboxydivorans Nor1] (224 aa)
Score = 123, Expect = 3.6e-05, Identities = 27/81 (33%), Positives = 50/81 (61%)
  Q:   156 RKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIG---KDNIVSSTYNGYCFKLRE 236
           R  +  GQ + +T  E+++L+F + +     ++E+IF +VWG+  + T  V+  YI+ L+KK+    +DN++  T  G  F L+E
  S:   140 RDGFVEGQALGLTAKEYELLEFLMLNKEQILTREQIFDRVWGFASETTISVVDLYIHYLRKKLASFDRDNLI-QTIRGAGFMLKE 223
>gi|160889014|ref|ZP_02070017.1| hypothetical protein BACUNI_01434 [Bacteroides uniformis ATCC 8492] >gi|156861481|gb|EDO54912.1| hypothetical protein BACUNI_01434 [Bacteroides uniformis ATCC 8492] (229 aa)
Score = 123, Expect = 3.6e-05, Identities = 34/85 (40%), Positives = 51/85 (60%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWG---YDDDPTGLVIQYIYKLKKKIG--KDNIVSSTYNGYCFK 233
           L +N+I +KV   G+E  +TK EF+IL   L++    FS+E+I  ++W    Y  D T  +   I +L+KKIG     IV+    GYCF+
  S:   140 LVLNVIKKKVCIDGEEAPLTKKEFEILLLLLQNKGRVFSREDILNRIWSDEVYVLDRT--IDVNITRLRKKIGVYGKCIVTRLGYGYCFE 227
>gi|111220170|ref|YP_710964.1| putative two-component system response regulator (partial match) [Frankia alni ACN14a] >gi|111147702|emb|CAJ59359.1| Putative two-component system response regulator (partial match) [Frankia alni ACN14a] (358 aa)
Score = 123, Expect = 3.6e-05, Identities = 25/70 (35%), Positives = 42/70 (60%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKI 217
           +L+M+   R+V   G  + +T  EF++L+FF+ +P    SK +I  +VW YD      V++ Y+  L+KKI
  S:   153 DLTMDEESREVARGGVPVHLTATEFELLRFFMRNPRRVLSKAQILDRVWNYDFGGQANVVELYVSYLRKKI 223
>gi|15601325|ref|NP_232956.1| transcriptional regulator [Vibrio cholerae O1 biovar eltor str. N16961] >gi|121591182|ref|ZP_01678486.1| transcriptional regulator [Vibrio cholerae 2740-80] >gi|121728902|ref|ZP_01681910.1| transcriptional regulator [Vibrio cholerae V52] >gi|147672319|ref|YP_001215339.1| transcriptional regulator [Vibrio cholerae O395] >gi|153217413|ref|ZP_01951164.1| transcriptional regulator [Vibrio cholerae 1587] >gi|153223279|ref|ZP_01953764.1| transcriptional regulator [Vibrio cholerae MAK 757] >gi|153819256|ref|ZP_01971923.1| transcriptional regulator [Vibrio cholerae NCTC 8457] >gi|153822842|ref|ZP_01975509.1| transcriptional regulator [Vibrio cholerae B33] >gi|194533355|ref|YP_002068772.1| transcriptional regulator [Vibrio cholerae MO10] >gi|9657975|gb|AAF96468.1| transcriptional regulator [Vibrio cholerae O1 biovar eltor str. N16961] >gi|121546967|gb|EAX57114.1| transcriptional regulator [Vibrio cholerae 2740-80] >gi|121628830|gb|EAX61291.1| transcriptional regulator [Vibrio cholerae V52] >gi|124113573|gb|EAY32393.1| transcriptional regulator [Vibrio cholerae 1587] >gi|124118312|gb|EAY37055.1| transcriptional regulator [Vibrio cholerae MAK 757] >gi|125619407|gb|EAZ47935.1| transcriptional regulator [Vibrio cholerae MO10] >gi|126510205|gb|EAZ72799.1| transcriptional regulator [Vibrio cholerae NCTC 8457] >gi|126519619|gb|EAZ76842.1| transcriptional regulator [Vibrio cholerae B33] >gi|146314702|gb|ABQ19242.1| transcriptional regulator [Vibrio cholerae O395] >gi|150425179|gb|EDN16956.1| transcriptional regulator [Vibrio cholerae AM-19226] (245 aa)
Score = 123, Expect = 3.6e-05, Identities = 26/89 (29%), Positives = 53/89 (59%)
  Q:   147 NNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGKDNIVSSTYNGYCFKLR 235
           +NL+++   R+V+ +G+ I +T+ EFD+L F   +    F+++E+   VWGY+  PT   +  ++ +L++K+    I   T  G  +K++
  S:   157 SNLTIDKATREVFFNGESITLTRTEFDLLLFLASNLGRVFTRDELLDHVWGYNHFPTTRTVDTHVLQLRQKLPGLEI--ETLRGVGYKMK 244
>gi|171780129|ref|ZP_02921033.1| hypothetical protein STRINF_01917 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gi|171281477|gb|EDT46912.1| hypothetical protein STRINF_01917 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] (230 aa)
Score = 123, Expect = 3.7e-05, Identities = 29/86 (33%), Positives = 50/86 (58%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDD-PTGLVIQYIYKLKKKIG--KDNIVSSTYNGYCFKL 234
           L ++  DR     G+ I++T  EF++LK  L H     S++++  +VWGY+ D  T +    I +L+KK+   + +++  T  GY FKL
  S:   138 LELSDKDRSATYQGKHIKLTNTEFELLKVLLSHSEEAISRDDLLSQVWGYESDVETRVTDDTIKRLRKKLRGVESHVLIETVWGYGFKL 226
>gi|167590482|ref|ZP_02382870.1| two component transcriptional regulator, winged helix family protein [Burkholderia ubonensis Bu] (277 aa)
Score = 123, Expect = 3.7e-05, Identities = 26/72 (36%), Positives = 40/72 (55%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGKD 220
           LS++ I R+    G  I++T  EFD+L FF  HP   FS+ ++   VWGY  +     +  +I +L+ KI  D
  S:   179 LSVDPIAREASVDGVRIDLTPREFDLLYFFARHPGKVFSRMDLLNAVWGYQHEGYEHTVNTHINRLRAKIEAD 251
>gi|56552060|ref|YP_162899.1| phosphate regulon response regulator [Zymomonas mobilis subsp. mobilis ZM4] >gi|4768853|gb|AAD29647.1|AF124757_7 phosphate regulatory protein PhoB [Zymomonas mobilis] >gi|56543634|gb|AAV89788.1| phosphate regulon response regulator [Zymomonas mobilis subsp. mobilis ZM4] (231 aa)
Score = 123, Expect = 3.7e-05, Identities = 22/76 (28%), Positives = 44/76 (57%)
  Q:   147 NNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGKDNI 222
           N++ M+L+  +V  +G  + I   EF +L+  +E+P   FS+E++   +WG D D     +  +I +L+K + +D +
  S:   136 NDIEMDLVSHRVKRAGTNVSIGPTEFRLLRHLMEYPRRVFSREKLLDYIWGQDSDIELRTVDVHIRRLRKALNRDGL 212
>gi|88714010|ref|ZP_01108089.1| response regulator DrrA [Flavobacteriales bacterium HTCC2170] >gi|88707661|gb|EAQ99902.1| response regulator DrrA [Flavobacteriales bacterium HTCC2170] (228 aa)
Score = 123, Expect = 3.7e-05, Identities = 33/95 (34%), Positives = 50/95 (52%)
  Q:   140 NNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGKDNIVSSTYNGYCFKL 234
           N+ I+   N+ +N  + K+   G EI + + EF++L      PN  F +E I  KVWG +    G  I  +I KL++KIG D+  +    GY F L
  S:   133 NDDIVSVGNIVINREEYKIINDGTEIILPRKEFELLSLLTSKPNKVFKREVILDKVWGNEVVVGGRTIDVHIRKLREKIGDDHFKTVKGVGYKFVL 228
>gi|27366756|ref|NP_762283.1| response regulator [Vibrio vulnificus CMCP6] >gi|27358323|gb|AAO07273.1|AE016809_35 Response regulator [Vibrio vulnificus CMCP6] (220 aa)
Score = 123, Expect = 3.8e-05, Identities = 26/88 (29%), Positives = 51/88 (57%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGKDNIVSSTYNGYCFKLR 235
           NL ++   R+V+  G++I +T+ EFD+L F   +    F+++E+   VWGY+  PT   +  ++ +L++K+    I   T  G  +K++
  S:   133 NLVIDKSTREVFFKGEQITLTRTEFDLLLFLASNLGRVFTRDELLDHVWGYNHFPTTRTVDTHVLQLRQKLAGLEI--ETLRGVGYKMK 219
>gi|29833315|ref|NP_827949.1| two-component system response regulator [Streptomyces avermitilis MA-4680] >gi|29610437|dbj|BAC74484.1| putative two-component system response regulator [Streptomyces avermitilis MA-4680] (262 aa)
Score = 123, Expect = 3.8e-05, Identities = 30/86 (34%), Positives = 51/86 (59%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKI--GKDNIVSSTYN-GYCFK 233
           +L M+   R+V   G+ IE++  EF++L+F L +P    SK +I  +VW YD      V++ YI  L+KK+  G++ ++ +    GY  K
  S:   168 DLVMDEEAREVTRGGELIELSPTEFELLRFLLRNPRRVLSKAQILDRVWSYDFGGQAHVVELYISYLRKKVDAGREPMIHTVRGAGYVIK 257
>gi|52144737|ref|YP_082091.1| response regulator [Bacillus cereus E33L] >gi|51978206|gb|AAU19756.1| probable response regulator [Bacillus cereus E33L] (229 aa)
Score = 123, Expect = 3.8e-05, Identities = 20/63 (31%), Positives = 43/63 (68%)
  Q:   155 DRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKI 217
           D+ V   GQ +++T  ++++L++ +++      +E+IF +VWG+D D T  +++ YI+ L+KK+
  S:   144 DKDVQVDGQSMKLTLKQYELLEYLVQNSGKILMREQIFDRVWGFDSDTTVAIVEVYIHHLRKKL 207
>gi|56752230|ref|YP_172931.1| two-component response regulator [Synechococcus elongatus PCC 6301] >gi|81300682|ref|YP_400890.1| two component transcriptional regulator [Synechococcus elongatus PCC 7942] >gi|56687189|dbj|BAD80411.1| two-component response regulator [Synechococcus elongatus PCC 6301] >gi|81169563|gb|ABB57903.1| two component transcriptional regulator, winged helix family [Synechococcus elongatus PCC 7942] (226 aa)
Score = 123, Expect = 3.8e-05, Identities = 24/74 (32%), Positives = 45/74 (60%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGKDN 221
           ++S++ +  +V+   Q +E+T  EFD+L+F L H     ++++I ++VWGYD      +I+ YI  L+ K+   N
  S:   133 DVSLHRLTHEVYRGSQRLELTAKEFDLLEFLLRHARQVVTRDQILEQVWGYDFMGESNIIEVYIRALRLKLEASN 207
>gi|168484408|ref|ZP_02709360.1| alkaline phosphatase synthesis transcriptional regulatory proteinphoP [Streptococcus pneumoniae CDC1873-00] >gi|172042368|gb|EDT50414.1| alkaline phosphatase synthesis transcriptional regulatory proteinphoP [Streptococcus pneumoniae CDC1873-00] (235 aa)
Score = 123, Expect = 3.8e-05, Identities = 28/80 (35%), Positives = 52/80 (65%)
  Q:   157 KVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD-DDPTGLVIQYIYKLKKKIGKDNIVS----STYNGYCFKLRE 236
           +V+ + + + +T  EF++L + ++HPN   ++E + +++WGYD    T LV  +I KL++KI +DN  +     T  GY +K +E
  S:   151 EVYKANKLLSLTPKEFELLLYLMKHPNMTLTRERLLERIWGYDFGQETRLVDVHIGKLREKI-EDNPKAPQFIRTIRGYGYKFKE 234
>gi|160893062|ref|ZP_02073850.1| hypothetical protein CLOL250_00607 [Clostridium sp. L2-50] >gi|156865145|gb|EDO58576.1| hypothetical protein CLOL250_00607 [Clostridium sp. L2-50] (228 aa)
Score = 123, Expect = 3.8e-05, Identities = 30/87 (34%), Positives = 52/87 (59%)
  Q:   147 NNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWG--YDDDPTGLVIQYIYKLKKKIGKDNIVSSTY------NGYCFK 233
           N + + L  R+V+  G+E+ +T  EFD+L+  + HPN  +S+ E+   +WG  Y  D   + + ++ +L++KI +DN     Y       GY FK
  S:   135 NGMKVELDSRRVFVHGKELNLTAKEFDLLELLMAHPNKVYSRNELLDTIWGSTYPGDARTVDV-HVRRLREKI-EDNPGEPVYIHTKWGVGYYFK 227
>gi|126432768|ref|YP_001068459.1| two component transcriptional regulator [Mycobacterium sp. JLS] >gi|126232568|gb|ABN95968.1| two component transcriptional regulator, winged helix family [Mycobacterium sp. JLS] (243 aa)
Score = 123, Expect = 3.8e-05, Identities = 28/88 (31%), Positives = 51/88 (57%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD-DDPTGLVIQYIYKLKKKIGKDNI--VSSTYNGYCFKLRE 236
           L+++   R V+  G+ +++TK EFD+L    E+     S++ + + VWGYD D  T +   +I  L++K+ +D +  V  T  G  + LR+
  S:   151 LTIDTARRLVFVDGERVDLTKREFDLLAVLAENNGVVLSRQRLLELVWGYDFDVDTNVADVFISYLRRKLERDGLPRVIHTVRGIGYVLRD 241
>gi|108797145|ref|YP_637342.1| two component transcriptional regulator [Mycobacterium sp. MCS] >gi|119866230|ref|YP_936182.1| two component transcriptional regulator [Mycobacterium sp. KMS] >gi|108767564|gb|ABG06286.1| two component transcriptional regulator, winged helix family [Mycobacterium sp. MCS] >gi|119692319|gb|ABL89392.1| two component transcriptional regulator, winged helix family [Mycobacterium sp. KMS] (243 aa)
Score = 123, Expect = 3.8e-05, Identities = 28/88 (31%), Positives = 51/88 (57%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD-DDPTGLVIQYIYKLKKKIGKDNI--VSSTYNGYCFKLRE 236
           L+++   R V+  G+ +++TK EFD+L    E+     S++ + + VWGYD D  T +   +I  L++K+ +D +  V  T  G  + LR+
  S:   151 LTIDTARRLVFVDGERVDLTKREFDLLAVLAENNGVVLSRQRLLELVWGYDFDVDTNVADVFISYLRRKLERDGLPRVIHTVRGIGYVLRD 241
>gi|192810333|ref|ZP_03039006.1| response regulator receiver [Geobacillus sp. Y412MC10] >gi|192800625|gb|EDV77132.1| response regulator receiver [Geobacillus sp. Y412MC10] (228 aa)
Score = 123, Expect = 3.9e-05, Identities = 25/69 (36%), Positives = 42/69 (60%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKK 216
           +L M+   R+V   GQ +E+T  EF++L  F+++P    S++ I  K+WGYD      V++ YI  L++K
  S:   135 DLVMDTDAREVIRGGQRLELTAKEFELLHLFMQNPKRVLSRDLIMDKIWGYDYSGESNVLEVYIAMLRQK 204
>gi|90578546|ref|ZP_01234356.1| hypothetical DNA-binding response regulator [Vibrio angustum S14] >gi|90439379|gb|EAS64560.1| hypothetical DNA-binding response regulator [Vibrio angustum S14] (225 aa)
Score = 123, Expect = 3.9e-05, Identities = 26/89 (29%), Positives = 52/89 (58%)
  Q:   147 NNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKKI--GKDNIVSSTYNGYCFKLR 235
           ++L +++   +VW   +E+ + + EF +L++ +EH  +  S+  +F+ VW Y  DP T ++  +I  L+KK+  G +  +  T  G  + LR
  S:   132 DDLRLDIKSHRVWRGSRELNLQQKEFLLLQYLMEHAESVVSRMSLFESVWSYHFDPKTNVIDVHIANLRKKLEEGGEPSLIHTVRGAGYVLR 223
>gi|163940843|ref|YP_001645727.1| two component transcriptional regulator [Bacillus weihenstephanensis KBAB4] >gi|163863040|gb|ABY44099.1| two component transcriptional regulator, winged helix family [Bacillus weihenstephanensis KBAB4] (228 aa)
Score = 123, Expect = 3.9e-05, Identities = 40/138 (28%), Positives = 70/138 (50%)
  Q:    96 DEDTFLSVLQKGFEFCVSLDFFTPSLFFQTLLNIFHKVE-VINLMNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD---DDPTGLVIQYIYKLKKKIGKDN--IVSSTYNGYCFK 233
           DED  L   + G +  V+  +  P L  +    I  +    IN+     +  + + ++   R V   G++I +T  EF+IL +F+++     S+E++  K+WGY+   DD T  V  +I  L+ K+G     IV+    GY F+
  S:    84 DEDDTLLGFEMGADDYVTKPYSPPILLARAKRLIESRYSSTINVSTADTLTSSGIHVHFPSRTVTVDGEDISMTHTEFEILTYFMQNQGIVISREQLITKIWGYEFAGDDRT--VNSHIRNLRHKLGGKATCIVTVVRTGYKFE 225
>gi|177666233|ref|ZP_02942029.1| two component transcriptional regulator, winged helix family [Cyanothece sp. PCC 8801] >gi|196245911|ref|ZP_03144633.1| two component transcriptional regulator, winged helix family [Cyanothece sp. PCC 8802] >gi|172074917|gb|EDT60334.1| two component transcriptional regulator, winged helix family [Cyanothece sp. PCC 8801] >gi|196206415|gb|EDY01212.1| two component transcriptional regulator, winged helix family [Cyanothece sp. PCC 8802] (225 aa)
Score = 123, Expect = 3.9e-05, Identities = 29/95 (30%), Positives = 57/95 (60%)
  Q:   142 VIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKI----GKDNIVSSTYNGYCFKLRE 236
           V+ WGN LS+N    +V+   Q + ++  E+ +L+FFL HP+  F++ +I   +W  +  P    ++ +I  L++KI    G  +++ + Y G  ++L+E
  S:   126 VLTWGN-LSLNPNTCEVFYQEQPLSLSPKEYKLLEFFLRHPHRVFNRTQILDHLWPLEQLPEEATVKAHISSLRQKIKAVGGVPDLIETVY-GLGYRLKE 223
>gi|169833990|ref|YP_001695445.1| alkaline phosphatase synthesis transcriptional regulatory protein PhoP [Streptococcus pneumoniae Hungary19A-6] >gi|168996492|gb|ACA37104.1| alkaline phosphatase synthesis transcriptional regulatory proteinphoP [Streptococcus pneumoniae Hungary19A-6] (235 aa)
Score = 123, Expect = 3.9e-05, Identities = 28/80 (35%), Positives = 52/80 (65%)
  Q:   157 KVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD-DDPTGLVIQYIYKLKKKIGKDNIVS----STYNGYCFKLRE 236
           +V+ + + + +T  EF++L + ++HPN   ++E + +++WGYD    T LV  +I KL++KI +DN  +     T  GY +K +E
  S:   151 EVYKANKLLSLTPKEFELLLYLMKHPNMTLTRERLLERIWGYDFGQETRLVDVHIGKLREKI-EDNPKAPQFIRTIRGYGYKFKE 234
>gi|149011938|ref|ZP_01833086.1| response regulator [Streptococcus pneumoniae SP19-BS75] >gi|147763893|gb|EDK70826.1| response regulator [Streptococcus pneumoniae SP19-BS75] (235 aa)
Score = 123, Expect = 4.0e-05, Identities = 28/80 (35%), Positives = 52/80 (65%)
  Q:   157 KVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD-DDPTGLVIQYIYKLKKKIGKDNIVS----STYNGYCFKLRE 236
           +V+ + + + +T  EF++L + ++HPN   ++E + +++WGYD    T LV  +I KL++KI +DN  +     T  GY +K +E
  S:   151 EVYKANKLLSLTPKEFELLLYLMKHPNMTLTRERLLERIWGYDFGQETRLVDVHIGKLREKI-EDNPKAPQFIRTIRGYGYKFKE 234
>gi|4530445|gb|AAD22036.1| response regulator PnpR [Streptococcus pneumoniae] (250 aa)
Score = 123, Expect = 4.0e-05, Identities = 28/80 (35%), Positives = 52/80 (65%)
  Q:   157 KVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD-DDPTGLVIQYIYKLKKKIGKDNIVS----STYNGYCFKLRE 236
           +V+ + + + +T  EF++L + ++HPN   ++E + +++WGYD    T LV  +I KL++KI +DN  +     T  GY +K +E
  S:   166 EVYKANKLLSLTPKEFELLLYLMKHPNMTLTRERLLERIWGYDFGQETRLVDVHIGKLREKI-EDNPKAPQFIRTIRGYGYKFKE 249
>gi|166981619|ref|ZP_02253074.1| response regulator [Bacillus cereus AH187] (234 aa)
Score = 123, Expect = 4.0e-05, Identities = 30/67 (44%), Positives = 47/67 (70%)
  Q:   154 IDR---KVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWG---YDDDPTGLVIQYIYKLKKKIGKD 220
           IDR   ++  +G  +E +   F +L FF E+PN  FSKEEI++KVWG   Y+ D   +++ +I KL++KI +D
  S:   143 IDRYSAELTVNGHVVECSAQLFQLLLFFCENPNYVFSKEEIYEKVWGAPAYNGDDNTVMV-HIRKLREKIEQD 214
>gi|177666107|ref|ZP_02941903.1| two component transcriptional regulator, winged helix family [Cyanothece sp. PCC 8801] >gi|172074791|gb|EDT60208.1| two component transcriptional regulator, winged helix family [Cyanothece sp. PCC 8801] (237 aa)
Score = 123, Expect = 4.1e-05, Identities = 26/76 (34%), Positives = 49/76 (64%)
  Q:   163 QEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKKIG----KDNIVSSTYNGYCFKLRESF 238
           Q I +T NEF +L++F++HPN   +++++  ++W  DD P + +V   I  L++K+     KD I   T +G+ ++L  S+
  S:   153 QNIPLTANEFRLLEYFMKHPNQTLTRDQLLAQLWETDDAPISNVVSARIRLLRRKLADYGCKDLI--ETVHGFGYRLNSSY 231
>gi|124522495|ref|ZP_01697060.1| two component transcriptional regulator, winged helix family [Bacillus coagulans 36D1] >gi|124496070|gb|EAY43692.1| two component transcriptional regulator, winged helix family [Bacillus coagulans 36D1] (224 aa)
Score = 123, Expect = 4.1e-05, Identities = 22/63 (34%), Positives = 35/63 (55%)
  Q:   137 NLMNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD 199
           N   N  I  N L  + +  +V+   Q + +T  EF +L  FL+HPN  FS+E++   +WGY+
  S:   120 NQNQNETIEKNGLKWDPVSFQVFYQNQPVSVTPKEFAMLGLFLQHPNQVFSREQLLTSIWGYE 182
>gi|37676469|ref|NP_936865.1| response regulator [Vibrio vulnificus YJ016] >gi|37201011|dbj|BAC96835.1| response regulator [Vibrio vulnificus YJ016] (232 aa)
Score = 123, Expect = 4.1e-05, Identities = 26/88 (29%), Positives = 51/88 (57%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGKDNIVSSTYNGYCFKLR 235
           NL ++   R+V+  G++I +T+ EFD+L F   +    F+++E+   VWGY+  PT   +  ++ +L++K+    I   T  G  +K++
  S:   145 NLVIDKSTREVFFKGEQITLTRTEFDLLLFLASNLGRVFTRDELLDHVWGYNHFPTTRTVNTHVLQLRQKLAGLEI--ETLRGVGYKMK 231
>gi|170754525|ref|YP_001780005.1| DNA-binding response regulator [Clostridium botulinum B1 str. Okra] >gi|169119737|gb|ACA43573.1| DNA-binding response regulator [Clostridium botulinum B1 str. Okra] (228 aa)
Score = 123, Expect = 4.1e-05, Identities = 25/83 (30%), Positives = 46/83 (55%)
  Q:   117 FTPSLFFQTLLNIFHKVEVINLMNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD 199
           F P      +  I  +V  +   ++ II G    ++L  +K+  + +EI+IT  E+ ++K F+E+P   F+++E+   VWGYD
  S:   104 FNPLELTLRIKAILRRVNAVKESDDNIITGGPFKIDLYSKKIHKNEEEIDITPTEYLLMKIFIENPGKAFNRDELLDLVWGYD 186
>gi|120553067|ref|YP_957418.1| two component transcriptional regulator [Marinobacter aquaeolei VT8] >gi|120322916|gb|ABM17231.1| two component transcriptional regulator, winged helix family [Marinobacter aquaeolei VT8] (221 aa)
Score = 123, Expect = 4.2e-05, Identities = 24/71 (33%), Positives = 42/71 (59%)
  Q:   162 GQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGKDNIVSSTYNGYCF 232
           G E  +T  EF +L+  +  P   FSKE++ ++++  D+ P+  VI+ YI +L+K +G + I +    GY F
  S:   146 GAEHALTGTEFRLLRCLMSRPGHIFSKEQLMEQLYNLDESPSENVIEAYIRRLRKLVGNETITTRRGQGYMF 217
>gi|186456124|ref|ZP_02966437.1| two component transcriptional regulator, winged helix family [bacterium Ellin514] >gi|184206897|gb|EDU03943.1| two component transcriptional regulator, winged helix family [bacterium Ellin514] (236 aa)
Score = 123, Expect = 4.2e-05, Identities = 26/88 (29%), Positives = 50/88 (56%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKKIGKDNIVSSTYNGYCFKLR 235
           +L ++L+ R+V   G++IE+   EF +L++ + +     +K  I + +W Y  DP T +V   +++L+ KI KD  +  T  G  + L+
  S:   146 DLGLDLLTREVTRGGEKIELQSREFALLEYLMRNTGRAVTKTMILEHIWDYSFDPQTNVVDVLVFRLRNKIDKDKKMLHTIRGVGYVLK 234
>gi|152974657|ref|YP_001374174.1| two component transcriptional regulator [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|152023409|gb|ABS21179.1| two component transcriptional regulator, winged helix family [Bacillus cereus subsp. cytotoxis NVH 391-98] (235 aa)
Score = 123, Expect = 4.2e-05, Identities = 27/56 (48%), Positives = 39/56 (69%)
  Q:   162 GQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWG---YDDDPTGLVIQYIYKLKKKI 217
           G  +E +   F +L FF EHPN  FSKEEI++KVWG   Y+ D   +++ +I KL++KI
  S:   154 GNIVECSAQLFQLLLFFCEHPNYVFSKEEIYEKVWGAPAYNGDDNTVMV-HIRKLREKI 211
>gi|90412642|ref|ZP_01220644.1| putative transcriptional regulator [Photobacterium profundum 3TCK] >gi|90326450|gb|EAS42862.1| putative transcriptional regulator [Photobacterium profundum 3TCK] (219 aa)
Score = 122, Expect = 4.2e-05, Identities = 25/81 (30%), Positives = 50/81 (61%)
  Q:   137 NLMNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKI 217
           +L  N+I  G  +S+N+  R+V   G  + +T+ EF++L F  ++    F+++E+  +VWGY+  PT   +  +I +L++K+
  S:   122 HLAANIITVGQ-ISINMESREVNHGGDTVTLTRTEFELLVFLAKNAGRVFTRDELLDQVWGYNHYPTTRTVDTHILQLRQKL 202
>gi|78224573|ref|YP_386320.1| two component transcriptional regulator [Geobacter metallireducens GS-15] >gi|78195828|gb|ABB33595.1| two component transcriptional regulator, winged helix family [Geobacter metallireducens GS-15] (224 aa)
Score = 122, Expect = 4.3e-05, Identities = 28/89 (31%), Positives = 52/89 (58%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD-DDPTGLVIQYIYKLKKKIGK--DNIVSSTYNGYCFKLRE 236
           +L ++ +  KVW   +EI++T  E+ +L++F+ +PN   ++  I + VW Y  D  T ++  Y+  L+KKI +  D  +  T  G  + L+E
  S:   131 DLRLDPVTHKVWRKDKEIDLTAKEYSLLEYFMRNPNQVLTRTMIAEHVWDYTFDSFTNIIDVYVNYLRKKIDREADKKLIHTVRGVGYILKE 222
>gi|149002911|ref|ZP_01827822.1| response regulator [Streptococcus pneumoniae SP14-BS69] >gi|147758914|gb|EDK65909.1| response regulator [Streptococcus pneumoniae SP14-BS69] (158 aa)
Score = 122, Expect = 4.3e-05, Identities = 28/80 (35%), Positives = 52/80 (65%)
  Q:   157 KVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD-DDPTGLVIQYIYKLKKKIGKDNIVS----STYNGYCFKLRE 236
           +V+ + + + +T  EF++L + ++HPN   ++E + +++WGYD    T LV  +I KL++KI +DN  +     T  GY +K +E
  S:    74 EVYKANKLLSLTPKEFELLLYLMKHPNMTLTRERLLERIWGYDFGQETRLVDVHIGKLREKI-EDNPKAPQFIRTIRGYGYKFKE 157
>gi|183984426|ref|YP_001852717.1| two-component transcriptional regulator TrcR [Mycobacterium marinum M] >gi|183177752|gb|ACC42862.1| two-component transcriptional regulator TrcR [Mycobacterium marinum M] (254 aa)
Score = 122, Expect = 4.4e-05, Identities = 26/73 (35%), Positives = 41/73 (56%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD-DDPTGLVIQYIYKLKKKIGKD 220
           +L ++   R+V   G  I ++  EF++L+F + +P    S+ EI  +VW YD    T +V  YI  L+KKI  D
  S:   162 DLKLDAASREVTRGGTPISLSSTEFELLRFLMRNPRRALSRTEILDRVWNYDFAGRTSIVDLYISYLRKKIDAD 235
>gi|118619706|ref|YP_908038.1| two component transcriptional regulator TrcR [Mycobacterium ulcerans Agy99] >gi|118571816|gb|ABL06567.1| two component transcriptional regulator TrcR [Mycobacterium ulcerans Agy99] (257 aa)
Score = 122, Expect = 4.4e-05, Identities = 26/73 (35%), Positives = 41/73 (56%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD-DDPTGLVIQYIYKLKKKIGKD 220
           +L ++   R+V   G  I ++  EF++L+F + +P    S+ EI  +VW YD    T +V  YI  L+KKI  D
  S:   165 DLKLDAASREVTRGGTPISLSSTEFELLRFLMRNPRRALSRTEILDRVWNYDFAGRTSIVDLYISYLRKKIDAD 238
>gi|114152683|gb|ABI52588.1| two-component response regulator [Bacillus cereus] (235 aa)
Score = 122, Expect = 4.4e-05, Identities = 27/56 (48%), Positives = 39/56 (69%)
  Q:   162 GQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWG---YDDDPTGLVIQYIYKLKKKI 217
           G  +E +   F +L FF EHPN  FSKEEI++KVWG   Y+ D   +++ +I KL++KI
  S:   154 GNIVECSAQLFQLLLFFCEHPNYVFSKEEIYEKVWGAPAYNGDDNTVMV-HIRKLREKI 211
>gi|163942589|ref|YP_001647473.1| two component transcriptional regulator [Bacillus weihenstephanensis KBAB4] >gi|163864786|gb|ABY45845.1| two component transcriptional regulator, winged helix family [Bacillus weihenstephanensis KBAB4] (232 aa)
Score = 122, Expect = 4.4e-05, Identities = 31/77 (40%), Positives = 47/77 (61%)
  Q:   156 RKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVW--GYDDDPTGLVIQYIYKLKKKIG----KDNIVSSTYN-GYCF 232
           R V   G+ IE+T  EFDIL     HP   +S E IF++VW  GY +    +++ +I  L+KK+G    KD ++ + +  GY F
  S:   148 RTVNVYGEPIELTPKEFDILYVLASHPKKVYSVENIFQQVWAEGYYESGNTVMV-HIRTLRKKLGEDKRKDKLIKTVWGVGYTF 230
>gi|167746602|ref|ZP_02418729.1| hypothetical protein ANACAC_01313 [Anaerostipes caccae DSM 14662] >gi|167653562|gb|EDR97691.1| hypothetical protein ANACAC_01313 [Anaerostipes caccae DSM 14662] (167 aa)
Score = 122, Expect = 4.4e-05, Identities = 29/65 (44%), Positives = 40/65 (61%)
  Q:   156 RKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD---DDPTGLVIQYIYKLKKKIGKD 220
           RKV   G EI +T  EFDIL F  ++    F+KE+I++ VW  D   DD    ++ +I KL+KKI  D
  S:    81 RKVLLKGSEISLTPKEFDILYFLSQNRGEVFTKEQIYRAVWEEDYLLDDSN--IMAFIRKLRKKIEPD 146
>gi|15840463|ref|NP_335500.1| DNA-binding response regulator TrcR [Mycobacterium tuberculosis CDC1551] >gi|194543377|ref|YP_002078406.1| two component transcriptional regulator trcR [Mycobacterium tuberculosis C] >gi|13880635|gb|AAK45314.1| DNA-binding response regulator TrcR [Mycobacterium tuberculosis CDC1551] >gi|124600384|gb|EAY59394.1| two component transcriptional regulator trcR [Mycobacterium tuberculosis C] (276 aa)
Score = 122, Expect = 4.4e-05, Identities = 26/73 (35%), Positives = 42/73 (57%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD-DDPTGLVIQYIYKLKKKIGKD 220
           +L+++   R+V   G  I ++  EF++L+F + +P    S+ EI  +VW YD    T +V  YI  L+KKI  D
  S:   184 DLTLDGASREVTRDGTPISLSSTEFELLRFLMRNPRRALSRTEILDRVWNYDFAGRTSIVDLYISYLRKKIDSD 257
>gi|15608173|ref|NP_215549.1| two component transcriptional regulator TRCR [Mycobacterium tuberculosis H37Rv] >gi|31792225|ref|NP_854718.1| two component transcriptional regulator TRCR [Mycobacterium bovis AF2122/97] >gi|121636963|ref|YP_977186.1| two component transcriptional regulator trcR [Mycobacterium bovis BCG str. Pasteur 1173P2] >gi|148660816|ref|YP_001282339.1| DNA-binding response regulator TrcR [Mycobacterium tuberculosis H37Ra] >gi|148822242|ref|YP_001286996.1| two component system transcriptional regulator trcR [Mycobacterium tuberculosis F11] >gi|167968534|ref|ZP_02550811.1| DNA-binding response regulator TrcR [Mycobacterium tuberculosis H37Ra] >gi|1869995|emb|CAB06846.1| TWO COMPONENT TRANSCRIPTIONAL REGULATOR TRCR [Mycobacterium tuberculosis H37Rv] >gi|2979514|gb|AAC06144.1| response regulator homolog TrcR [Mycobacterium tuberculosis] >gi|31617813|emb|CAD93922.1| TWO COMPONENT TRANSCRIPTIONAL REGULATOR TRCR [Mycobacterium bovis AF2122/97] >gi|121492610|emb|CAL71078.1| Two component transcriptional regulator trcR [Mycobacterium bovis BCG str. Pasteur 1173P2] >gi|134149462|gb|EBA41507.1| two component transcriptional regulator trcR [Mycobacterium tuberculosis str. Haarlem] >gi|148504968|gb|ABQ72777.1| DNA-binding response regulator TrcR [Mycobacterium tuberculosis H37Ra] >gi|148720769|gb|ABR05394.1| two component system transcriptional regulator trcR [Mycobacterium tuberculosis F11] (257 aa)
Score = 122, Expect = 4.4e-05, Identities = 26/73 (35%), Positives = 42/73 (57%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD-DDPTGLVIQYIYKLKKKIGKD 220
           +L+++   R+V   G  I ++  EF++L+F + +P    S+ EI  +VW YD    T +V  YI  L+KKI  D
  S:   165 DLTLDGASREVTRDGTPISLSSTEFELLRFLMRNPRRALSRTEILDRVWNYDFAGRTSIVDLYISYLRKKIDSD 238
>gi|168143609|ref|ZP_02586838.1| Two-component response regulator vanR [Bacillus cereus G9842] (232 aa)
Score = 122, Expect = 4.5e-05, Identities = 31/77 (40%), Positives = 45/77 (58%)
  Q:   156 RKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTG-LVIQYIYKLKKKIG----KDNIVSSTYN-GYCF 232
           R V   G++IE+T  EFDIL     HP   ++ E IF+ VW  D    G  V+ +I  L+KK+G    KD ++ + +  GY F
  S:   148 RTVDVYGEQIELTPKEFDILYLLASHPKKVYNVENIFQHVWADDYYEGGNTVMVHIRTLRKKLGEDKRKDKLIKTVWGVGYTF 230
>gi|90411444|ref|ZP_01219455.1| probable two-component system response regulator (Pho family) [Photobacterium profundum 3TCK] >gi|90327657|gb|EAS44000.1| probable two-component system response regulator (Pho family) [Photobacterium profundum 3TCK] (225 aa)
Score = 122, Expect = 4.5e-05, Identities = 22/73 (30%), Positives = 46/73 (63%)
  Q:   147 NNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDP-TGLVIQYIYKLKKKIGK 219
           ++L+++L+ RK+   G +I + + EF +++ F++ P   FSK  I + +WG+  DP T +V   + +L+ ++ K
  S:   131 HDLTLDLLTRKLCRDGHDILLKQREFALMQLFIQQPERVFSKTVILENIWGFQFDPQTNVVDVLVCRLRAQVDK 204
>gi|163764247|ref|ZP_02171305.1| response regulator receiver protein [Bacillus selenitireducens MLS10] >gi|160355328|gb|EDP81983.1| response regulator receiver protein [Bacillus selenitireducens MLS10] (233 aa)
Score = 122, Expect = 4.6e-05, Identities = 19/52 (36%), Positives = 35/52 (67%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD 199
           ++ +NL  RKV+  G+ + +T+ EFD+L  F++HP   F++E++   VWG +
  S:   139 SIKVNLNSRKVFIDGEAVSLTRKEFDLLVHFMKHPEQVFNREQLLDHVWGVN 190
>gi|83589678|ref|YP_429687.1| two component transcriptional regulator [Moorella thermoacetica ATCC 39073] >gi|83572592|gb|ABC19144.1| two component transcriptional regulator, winged helix family [Moorella thermoacetica ATCC 39073] (256 aa)
Score = 122, Expect = 4.6e-05, Identities = 32/86 (37%), Positives = 51/86 (59%)
  Q:   149 LSMNLIDRKVWCSGQEI-EITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD---DDPTGLVIQYIYKLKKKIGKDNIVSSTYNGYCFKL 234
           L +++  R+V   G+ I  +T  EFD+L F   HP    S+E+I +KVWGYD   D  T  V  +I  L++K+G+++   +T  G  +K 
  S:   165 LVIDIPAREVKVDGRTIGNLTPKEFDLLLFLARHPGQVMSREKILEKVWGYDFYGDLRT--VDTHIKNLREKLGREHAWIATVWGVGYKF 252
>gi|163938495|ref|YP_001643379.1| two component transcriptional regulator [Bacillus weihenstephanensis KBAB4] >gi|163860692|gb|ABY41751.1| two component transcriptional regulator, winged helix family [Bacillus weihenstephanensis KBAB4] (223 aa)
Score = 122, Expect = 4.6e-05, Identities = 19/63 (30%), Positives = 43/63 (68%)
  Q:   155 DRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKI 217
           D+ +   GQ I++T  ++++L++ +++      +E+IF +VWG+D D T  +++ Y++ L+KK+
  S:   138 DKDIQVDGQGIKLTLKQYELLEYLIQNSGKILMREQIFDRVWGFDSDTTVAIVEVYVHHLRKKL 201
>gi|171319254|ref|ZP_02908370.1| two component transcriptional regulator, winged helix family [Burkholderia ambifaria MEX-5] >gi|171095556|gb|EDT40520.1| two component transcriptional regulator, winged helix family [Burkholderia ambifaria MEX-5] (239 aa)
Score = 122, Expect = 4.7e-05, Identities = 25/72 (34%), Positives = 40/72 (55%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGKD 220
           LS++ I R+    G  I++T  EFD+L FF  HP   FS+ ++   VWGY  +     +  +I +L+ K+  D
  S:   142 LSIDPIAREASVDGTRIDLTPREFDLLYFFARHPGKVFSRMDLLNAVWGYRHEGYEHTVNTHINRLRAKVEAD 214
>gi|160945860|ref|ZP_02093086.1| hypothetical protein FAEPRAM212_03393 [Faecalibacterium prausnitzii M21/2] >gi|158443591|gb|EDP20596.1| hypothetical protein FAEPRAM212_03393 [Faecalibacterium prausnitzii M21/2] (224 aa)
Score = 122, Expect = 4.7e-05, Identities = 25/89 (28%), Positives = 54/89 (60%)
  Q:   145 WGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDD-PTGLVIQYIYKLKKKIG--KDNIVSSTYNGYCFK 233
           +  +L+++  +R ++   + + + K EFDI++   ++P   F KE I++++WGYD +  + +V ++I +++ KI    D+I   T  G  +K
  S:   130 FSGDLTIDYSERCLFFGDKRVGLAKREFDIVELLSQNPGQIFDKERIYERIWGYDSEGDSSVVAEHIRRIRTKIAAYTDHIYVETVWGCGYK 221
>gi|182413226|ref|YP_001818292.1| two component transcriptional regulator [Opitutus terrae PB90-1] >gi|177840440|gb|ACB74692.1| two component transcriptional regulator, winged helix family [Opitutus terrae PB90-1] (265 aa)
Score = 122, Expect = 4.7e-05, Identities = 24/69 (34%), Positives = 46/69 (66%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVW--GYDDDPTGLVIQYIYKLKKKI 217
           + M+L+ R V C+G+ +E+T  E+ +L+ FL++P    ++  I +KVW   YD + T L+  Y+ +L++K+
  S:   176 VRMDLLGRSVTCAGRPVELTSREYALLELFLQNPRRVLTRTLIAEKVWEASYDLE-TNLIDVYVRRLRQKL 245
>gi|169183676|ref|ZP_02844177.1| two component transcriptional regulator, winged helix family [Thauera sp. MZ1T] >gi|169009217|gb|EDS55998.1| two component transcriptional regulator, winged helix family [Thauera sp. MZ1T] (221 aa)
Score = 122, Expect = 4.7e-05, Identities = 26/81 (32%), Positives = 46/81 (56%)
  Q:   153 LIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGKDNIVSSTYNGYCFK 233
           L+DR    +G E  +T  EF +L++F+ HP+   SK  + + V+ YD +    VI+ Y+ +L+  +G + I +    GY F+
  S:   141 LVDR----AGNEQALTATEFRLLRYFMRHPDEVLSKTRLSEHVYDYDAERDSNVIEVYVRRLRGLLGNERIETRRGQGYVFR 218
>gi|167761325|ref|ZP_02433452.1| hypothetical protein CLOSCI_03730 [Clostridium scindens ATCC 35704] >gi|167660991|gb|EDS05121.1| hypothetical protein CLOSCI_03730 [Clostridium scindens ATCC 35704] (167 aa)
Score = 122, Expect = 4.7e-05, Identities = 28/65 (43%), Positives = 40/65 (61%)
  Q:   156 RKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD---DDPTGLVIQYIYKLKKKIGKD 220
           RKV   G EI +T  EFDIL F  ++    F+KE+I++ VW  D   DD    ++ ++ KL+KKI  D
  S:    81 RKVLLKGSEISLTPKEFDILYFLAQNRGEVFTKEQIYRAVWEEDYLLDDSN--IMAFVRKLRKKIEPD 146
>gi|152992275|ref|YP_001357996.1| two-component response regulator [Sulfurovum sp. NBC37-1] >gi|151424136|dbj|BAF71639.1| two-component response regulator [Sulfurovum sp. NBC37-1] (223 aa)
Score = 122, Expect = 4.8e-05, Identities = 27/89 (30%), Positives = 50/89 (56%)
  Q:   148 NLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGKDNIVSSTYNGYCFKLRE 236
           N+S +  + ++   G+ + +   E  +LK F++      + E I++ +W YD++P+   ++ YI  L+K IGKD IVS    GY F  ++
  S:   134 NISYDSKNGELIIDGESVSLGNKESRLLKLFVKKEGEVLAHERIYEHLWDYDEEPSDTALRTYIKNLRKIIGKDRIVSIKKQGYKFTAKK 223
>gi|83814805|ref|YP_446586.1| response regulator DrrA [Salinibacter ruber DSM 13855] >gi|83756199|gb|ABC44312.1| response regulator DrrA [Salinibacter ruber DSM 13855] (245 aa)
Score = 122, Expect = 4.8e-05, Identities = 30/83 (36%), Positives = 46/83 (55%)
  Q:   156 RKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYD-DDPTGLVIQYIYKLKKKIGKD----NIVSSTYN-GYCFKLRESF 238
           RKV   G+ +++T  EF++L  F  HP   FS++E+  +VWGY     +  V  +I +L+ KI  D      V + +  GY F  RE  
  S:   152 RKVTVEGEAVDLTSKEFELLLLFARHPGRAFSRDELLDEVWGYQYSGYSHTVNTHINRLRNKIEPDPSEPRYVKTVWGVGYRFAEREEL 240
>gi|47567150|ref|ZP_00237866.1| DNA-binding response regulator CiaR [Bacillus cereus G9241] >gi|47556206|gb|EAL14541.1| DNA-binding response regulator CiaR [Bacillus cereus G9241] (223 aa)
Score = 122, Expect = 4.8e-05, Identities = 19/63 (30%), Positives = 43/63 (68%)
  Q:   155 DRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKI 217
           D+ V   GQ +++T  ++++L++ +++      +E+IF +VWG+D D T  +++ Y++ L+KK+
  S:   138 DKDVQVDGQSMKLTLKQYELLEYLIQNSGKILMREQIFDRVWGFDSDTTVAIVEVYVHHLRKKL 201
>gi|195944940|emb|CAR57552.1| two-component regulatory system, response regulator protein [Burkholderia cenocepacia J2315] (239 aa)
Score = 122, Expect = 4.9e-05, Identities = 25/72 (34%), Positives = 40/72 (55%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGKD 220
           L+++ I R+    G  I++T  EFD+L FF  HP   FS+ ++   VWGY  +     +  +I +L+ KI  D
  S:   142 LAIDPIAREASVDGARIDLTPREFDLLYFFARHPGKVFSRMDLLNAVWGYQHEGYEHTVNTHINRLRAKIEAD 214
>gi|167627113|ref|YP_001677613.1| response regulator receiver protein [Francisella philomiragia subsp. philomiragia ATCC 25017] >gi|167597114|gb|ABZ87112.1| response regulator receiver protein [Francisella philomiragia subsp. philomiragia ATCC 25017] (228 aa)
Score = 122, Expect = 4.9e-05, Identities = 53/180 (29%), Positives = 85/180 (47%)
  Q:    53 LTTVHASVVIFDNIPSDQIDEAMVKKIKLISPITHFVYFCENYDEDTFLSVLQKGFEFCVSLDFFTPSLFF----QTLLNIFHKVEVINLMNNVIIWGNNLSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWG--YDDDPTGLVIQYIYKLKKKIG----KDNIVSSTYNGYCF 232
           L   H  VVI D    DQ  +  +K +++ S +   V    N D +  +  L+ G    V   F  P L      Q +  I   +E+ N+ +      +NL ++L D KV    QEI ++K EF IL + +++      +  +  +VWG  Y D    L + YI +L+KK+     +  IV+    GY F
  S:    42 LGQYHPDVVILDLGLPDQDGQDWLKVVRISSDVPIIVVSARN-DTEEVVKALENGANDYVKKPFDMPELIARVRRQLIAVIKKDLEIANVYSF-----DNLIVDLNDHKVILDNQEIHLSKKEFSILSYLVKYSGKLIMQNTLLHEVWGDCYGDGAQYLRV-YIGQLRKKLSACKKQPLIVTENAIGYRF 224
>gi|78059924|ref|YP_366499.1| two component transcriptional regulator [Burkholderia sp. 383] >gi|77964474|gb|ABB05855.1| two component transcriptional regulator, winged helix family [Burkholderia sp. 383] (277 aa)
Score = 122, Expect = 4.9e-05, Identities = 25/72 (34%), Positives = 40/72 (55%)
  Q:   149 LSMNLIDRKVWCSGQEIEITKNEFDILKFFLEHPNTFFSKEEIFKKVWGYDDDPTGLVIQ-YIYKLKKKIGKD 220
           L+++ I R+    G  I++T  EFD+L FF  HP   FS+ ++   VWGY  +     +  +I +L+ KI  D
  S:   180 LAIDPIAREASVDGARIDLTPREFDLLYFFARHPGKVFSRMDLLNAVWGYQHEGYEHTVNTHINRLRAKIEAD 252