>gi|26553522|ref|NP_757456.1| intracellular protease [Mycoplasma penetrans HF-2] >gi|26453528|dbj|BAC43860.1| predicted intracellular protease [Mycoplasma penetrans HF-2] (193 aa)
Score = 940, Expect = 4.2e-100, Identities = 193/193 (100%), Positives = 193/193 (100%)
  Q:     1 MIKHKVSNIRIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILYTKK 193
           MIKHKVSNIRIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILYTKK
  S:     1 MIKHKVSNIRIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILYTKK 193
>gi|31544415|ref|NP_852993.1| hypothetical protein MGA_0998 [Mycoplasma gallisepticum R] >gi|31541259|gb|AAP56561.1| conserved hypothetical protein [Mycoplasma gallisepticum R] (193 aa)
Score = 262, Expect = 1.7e-21, Identities = 62/192 (32%), Positives = 113/192 (58%)
  Q:     1 MIKHKVSNIRIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGK--KWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNY-SDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILYTK 192
           M K+    IRIA + +   +D++++IP D+W RA  IV+ +S EKK S+ L  GT I C   I+K NL ++NA+Y+PGG G +R   D  +++ + + KF   +    +++     +  +L  LG+L  KK+  +   ++ +G N+ S  N+++  N ++ ++  HA +FA+  V+ L +K+ A ++A  I Y +
  S:     1 MKKNIKRQIRIAAIVATGVDDLELIIPTDLWRRARFIVDYISIEKKNSVTLAQGTSIKCGLTIDKSNLMQYNAIYLPGGLGSKRFGDD--QKLTHYLSKFNEKDQTTPRYILAINESPIILKNLGLLEGKKVVASKEHKDAIGSNFDSKTNVLLSDNIITARATGHAIDFAIETVKILASKKEADDLAKMISYER 193
>gi|13508033|ref|NP_109982.1| intracellular protease [Mycoplasma pneumoniae M129] >gi|12644627|sp|P75483|Y294_MYCPN Uncharacterized protein MPN_294 >gi|1674238|gb|AAB96189.1| intracellular protease-like protein [Mycoplasma pneumoniae M129] (206 aa)
Score = 220, Expect = 1.4e-16, Identities = 52/182 (28%), Positives = 96/182 (52%)
  Q:     5 KVSNIRIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEK---LGKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIAN 186
           K   +RIAI+ + ++ND+   +P  +W +A   V+ +S E K SI L+ G  + C   + K N +++ A +IP G   + +  D+  + + K V +      +WLF++G  + VL E  ++   ++ T    +E    LGKN+    + VDKN +S  +     +F+  ++E+L   ++A   AN
  S:    15 KSRPVRIAIIITQKTNDLHATVPCFLWRKARYAVDLISAEAKASIMLEMGIHVRCDNTLSKTNFNQYTAAFIPHGNTTRLVEIDKLRKDLEKFV-YKPKGPMRWLFSSGNGACVLKEFDLIAPDQLVTVQNEKEMVKLLGKNFIKQPVHVDKNIISCANSCGLTKFSFKVIEELSGIELARKTAN 198
>gi|156546896|ref|XP_001599104.1| PREDICTED: similar to GH09983p [Nasonia vitripennis] (188 aa)
Score = 200, Expect = 2.8e-14, Identities = 56/172 (32%), Positives = 89/172 (51%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYS---DNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILY 190
           + +M+ ++  DI  RAG+ V   S   K+ I      KI    +I  +   K++A+ +PGG G + L        + +I+K A +   K +    AA  VL   G+   KKIT+ P  +  L  +YS   D  +V D N ++ K P  A+ F L IVEKL++K+ A  +A+ +LY
  S:    14 AEEMEAIVTVDILRRAGVSVTVASITDKECIKCSRDVKICTDAKIGDIEGQKYDAVILPGGVGWKNLAASAR---VGEILK-AQESESKVIAAICAAPNVLKAHGIAKGKKITSYPSVKNDLTSDYSYIDDQIVVTDGNLITSKGPATAYAFGLAIVEKLVDKETAQKVADGLLY 184
>gi|66531474|ref|XP_624271.1| PREDICTED: similar to dj-1 CG1349-PA [Apis mellifera] (186 aa)
Score = 194, Expect = 1.2e-13, Identities = 51/174 (29%), Positives = 89/174 (51%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYS--DNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILYTK 192
           S +M+ VI  DI  RAG+ V      +   +      KI    +++ V   K++ + +PGG    +      E  + K+++   +E  +++    AA T L   G+   K+IT+ P  +++L   Y   +N +V+D N ++ + P  AF F L I EKL++KQ A N+A  +LY +
  S:    14 SEEMEAVITTDILRRAGVDVTVAGLTENPYVNCSRNVKIHVDAKLQDVINQKYDVVILPGGLDGSKAFASSAE--VGKLLQRQQEE-NRFIAAICAAPTALKAHGIAKGKQITSYPAMKDQLVDYYKYLENKVVIDDNLITSRGPATAFAFGLAIAEKLIDKQTADNVAQAMLYVQ 186
>gi|146093628|ref|XP_001466925.1| 4-methyl-5(beta-hydroxyethyl)-thiazole monophosphate synthesis protein [Leishmania infantum JPCM5] >gi|134071289|emb|CAM69974.1| 4-methyl-5(beta-hydroxyethyl)-thiazole monophosphate synthesis protein, putative [Leishmania infantum] (196 aa)
Score = 186, Expect = 1.1e-12, Identities = 57/181 (31%), Positives = 96/181 (53%)
  Q:     9 IRIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVL-GNKKITTAPGFEEKLGKN--YSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           + + ++ +  S D++++   D+ +RAGI V   S  + KSI L  G  + C   I +V+  +++A+ +PGG  G   L    N   + KI++ A    K +     A +  LA +G+L G   +T  PGFE+KL  +  YS N +V  +N +S + P  A  FAL +V  L +  +A  +A  +L
  S:     1 MNVLVVAADHSEDIELISIIDVLSRAGIKVTLASVMESKSITLAHGVNVMCDALIGEVSAVEYDAVLLPGGMPGAVHL---GNNEALKKILQNARVGKKLYGGICAAPAVALAPMGLLEGVDTVTCYPGFEDKLPSSVKYSTNAVVKSENCLSSRGPGTAIYFALAVVSILKSPDLAERLAKAML 182
>gi|195341624|ref|XP_002037406.1| GM12907 [Drosophila sechellia] >gi|194131522|gb|EDW53565.1| GM12907 [Drosophila sechellia] (187 aa)
Score = 186, Expect = 1.2e-12, Identities = 54/171 (31%), Positives = 93/171 (54%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIE--------KVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYS---DNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           + +M+ +I  D+  RAGI V TV+        L  G  + CS +++        +V  DKF+ + +PGG G    + + +  ++  +++ + + G   +    AA TVLA+ GV   K +T+ P  + +L  NYS   D  +V D N ++ + P  A+EFAL I E+L  K+    +A  +L
  S:    13 AEEMEFIIAADVLRRAGIKV-TVAG-------LNGGEAVKCSRDVQILPDTSLAQVASDKFDVVVLPGGLGGSNAMGESS--LVGDLLR-SQESGGGLIAAICAAPTVLAKHGVASGKSLTSYPSMKPQLVDNYSYVDDKTVVKDGNLITSRGPGTAYEFALRIAEELAGKEKVQEVAKGLL 183
>gi|28571932|ref|NP_651825.3| dj-1beta CG1349-PA [Drosophila melanogaster] >gi|16767998|gb|AAL28218.1| GH09983p [Drosophila melanogaster] >gi|18642508|dbj|BAB84672.1| DJ-1 beta [Drosophila melanogaster] >gi|28381503|gb|AAF57086.2| CG1349-PA [Drosophila melanogaster] (205 aa)
Score = 185, Expect = 1.5e-12, Identities = 54/171 (31%), Positives = 93/171 (54%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIE--------KVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYS---DNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           + +M+ +I  D+  RAGI V TV+        L  G  + CS +++        +V  DKF+ + +PGG G    + + +  ++  +++ + + G   +    AA TVLA+ GV   K +T+ P  + +L  NYS   D  +V D N ++ + P  A+EFAL I E+L  K+    +A  +L
  S:    31 AEEMEFIIAADVLRRAGIKV-TVAG-------LNGGEAVKCSRDVQILPDTSLAQVASDKFDVVVLPGGLGGSNAMGESS--LVGDLLR-SQESGGGLIAAICAAPTVLAKHGVASGKSLTSYPSMKPQLVNNYSYVDDKTVVKDGNLITSRGPGTAYEFALKIAEELAGKEKVQEVAKGLL 201
>gi|194905210|ref|XP_001981151.1| GG11777 [Drosophila erecta] >gi|190655789|gb|EDV53021.1| GG11777 [Drosophila erecta] (187 aa)
Score = 182, Expect = 3.0e-12, Identities = 52/171 (30%), Positives = 92/171 (53%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIE--------KVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYS---DNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           + +M+ +I  D+  RAG+ V TV+        L  G  + CS +++        +V  D+F+A+ +PGG G    + + +  V+  I++     G   +    AA TVLA+ G+   K +T+ P  + +L  NYS   D  +V D N ++ + P  ++EFAL + E+L  K+    +A  +L
  S:    13 AEEMEFIIAADVLRRAGVKV-TVAG-------LNGGELVKCSRDVQILPDTALAQVAADQFDAVVLPGGLGGSNAMAESS--VVGDILRRQESSG-GLIAAICAAPTVLAKHGIAAGKSLTSYPAMKPQLVDNYSYVDDKTVVKDGNLITSRGPGTSYEFALRVAEELAGKEKVLEVAKGLL 183
>gi|195505290|ref|XP_002099440.1| GE10903 [Drosophila yakuba] >gi|194185541|gb|EDW99152.1| GE10903 [Drosophila yakuba] (187 aa)
Score = 180, Expect = 5.6e-12, Identities = 54/171 (31%), Positives = 91/171 (53%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIE--------KVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYS---DNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           + +M+ +I  D+  RAGI V TV+        L  G  + CS +++        +V  D+F+ + +PGG G    + + +  V+  I++     G   +    AA TVLA+ G+   K +T+ P  + +L  NYS   D  +V D N ++ + P  A+EFAL I E+L  K+    +A  +L
  S:    13 AEEMEFIIAADVLRRAGIKV-TVAG-------LNGGELVKCSRDVQILPDTSLAQVAADQFDVVVLPGGLGGSNAMAESS--VVGDILRRQESSGG-LIAAICAAPTVLAKHGIASGKSLTSYPSMKPQLLDNYSYVDDKTVVKDGNLLTSRGPGTAYEFALRIAEELAGKEKVLEVAKGLL 183
>gi|168208769|ref|ZP_02634394.1| DJ-1 family protein [Clostridium perfringens B str. ATCC 3626] >gi|170713222|gb|EDT25404.1| DJ-1 family protein [Clostridium perfringens B str. ATCC 3626] (191 aa)
Score = 178, Expect = 9.9e-12, Identities = 53/161 (32%), Positives = 89/161 (55%)
  Q:    29 DIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGK-NY-SDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           D+  RA +     S  + +++    GT + C + I   +L+ ++A+ +PGG      L D NERV + I K+  ++  K +    AA   LA+ GV+  KK+T+ PGF+E+LG  NY  ++ +VVD N ++ + P  A  F L I++KL  ++ A  I   +L
  S:    22 DVCNRAKVTCHACSLTENRTVNSAHGTMVLCDKLISDNDLETYDAIVLPGGMPGATNLRD-NERVQSLIKKY--NKENKIVAAICAAPIALAKAGVIEGKKVTSYPGFKEELGNVNYVEEDTVVVDGNIITSRGPATALVFGLEILKKLGYEKEAEEIREGML 181
>gi|18311049|ref|NP_562983.1| DJ-1 family protein [Clostridium perfringens str. 13] >gi|18145731|dbj|BAB81773.1| 4-methyl-5(beta-hydroxyethyl)-thiazole monophosphate synthesis protein [Clostridium perfringens str. 13] (193 aa)
Score = 178, Expect = 1.0e-11, Identities = 53/161 (32%), Positives = 89/161 (55%)
  Q:    29 DIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGK-NY-SDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           D+  RA +     S  + +++    GT + C + I   +L+ ++A+ +PGG      L D NERV + I K+  ++  K +    AA   LA+ GV+  KK+T+ PGF+E+LG  NY  ++ +VVD N ++ + P  A  F L I++KL  ++ A  I   +L
  S:    24 DVCNRAKVTCHACSLTENRTVNSAHGTMVLCDKLISDNDLETYDAIILPGGMPGATNLRD-NERVQSLIKKY--NKENKIVAAICAAPIALAKAGVIEGKKVTSYPGFKEELGNVNYVEEDTVVVDGNIITSRGPATALVFGLEILKKLGYEKEAEEIREGML 183
>gi|110801657|ref|YP_699347.1| DJ-1 family protein [Clostridium perfringens SM101] >gi|110682158|gb|ABG85528.1| DJ-1 family protein [Clostridium perfringens SM101] (191 aa)
Score = 177, Expect = 1.1e-11, Identities = 53/161 (32%), Positives = 89/161 (55%)
  Q:    29 DIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGK-NY-SDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           D+  RA +     S  + +++    GT + C + I   +L+ ++A+ +PGG      L D NE+V + I K+  +E  K +    AA   LA+ GV+  KK+T+ PGF+E+LG  NY  ++ +VVD N ++ + P  A  F L I++KL  ++ A  I   +L
  S:    22 DVCNRAKVTCHACSLTENRTVNSAHGTMVLCDKLISDNDLETYDAIVLPGGMPGSTNLRD-NEKVQSLIKKY--NEENKIVAAICAAPIALAKAGVIEGKKVTSYPGFKEELGNVNYVEEDTVVVDGNTITSRGPATALVFGLEILKKLGYEKEAEEIREGML 181
>gi|89210012|ref|ZP_01188405.1| DJ-1 [Halothermothrix orenii H 168] >gi|89160352|gb|EAR80007.1| DJ-1 [Halothermothrix orenii H 168] (181 aa)
Score = 177, Expect = 1.3e-11, Identities = 48/169 (28%), Positives = 88/169 (52%)
  Q:    21 DMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGK-NYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           +++ +   D+  RAGI V T S  +   +      K+T    ++KV++D  + + +PGG      L D + R+I  I +     G   +    AA  VL + GV+  K+ T+ PGF++++   NY +N +VVD N ++ + P  A EFAL +V  L ++ +   ++  ++
  S:    13 EIEAITSIDVLRRAGIEVITSSLTESTEVMGSHDVKVTADTTLDKVSVDNLDGILLPGGMPGSANLKD-DIRIIKLIKRLNKKSG--LIAAICAAPIVLEKAGVIKEKRATSYPGFDKEMKTCNYQENRVVVDGNIITGRGPGVAMEFALTVVNYLTSEDMVKELSEKMM 179
>gi|168022258|ref|XP_001763657.1| predicted protein [Physcomitrella patens subsp. patens] >gi|162685150|gb|EDQ71547.1| predicted protein [Physcomitrella patens subsp. patens] (405 aa)
Score = 177, Expect = 1.4e-11, Identities = 52/172 (30%), Positives = 86/172 (50%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYS-DNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILY 190
           S + ++VI  DI  RAG  V   S E + +I      ++     I +V   KF+ + +PGG  G  RL   +  + + +I++   +EG+ +     A + +L   G+L  KK T  P F  KL    + +  +V+D   ++ + P  A EF L IVEKL ++  A  IA  +L+
  S:   232 SEETEVVIIVDILRRAGAKVVVASVESEATIKAARNVQLVADTLISEVANTKFDLVVLPGGMPGADRL---QKSKELMRILQEQAEEGRIYGAICAAPAVILESSGLLHGKKATCHPTFSSKLKDQTAMEGRVVIDGPVITSRGPGTAMEFTLNIVEKLYSRVKAQEIAEAMLF 402
Score = 125, Expect = 1.2e-05, Identities = 44/157 (28%), Positives = 70/157 (44%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL-GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKL 175
           + +M+ VI  ++  RAG  V   S E+   I    G  I     I +    +++ + +PGG  G +RL   R+ + +  I +      +       A    L   G+L     T  P F  KL  K   ++ IV D    + ++P  AFEFAL +VE+L
  S:    28 TEEMEAVIVINVLRRAGATVTVASVEEGMQIAASRGVNIVADCLISECEEQEYDLVALPGGMPGAERL---RDSKALKSIAEKQVKAKRMIAAICAAPVVALQAWGLLKGLHATCHPSFTGKLEDKAAVESRIVRDSILTTSRAPGTAFEFALALVEQL 183
>gi|168016342|ref|XP_001760708.1| predicted protein [Physcomitrella patens subsp. patens] >gi|162688068|gb|EDQ74447.1| predicted protein [Physcomitrella patens subsp. patens] (395 aa)
Score = 175, Expect = 2.2e-11, Identities = 50/181 (27%), Positives = 89/181 (49%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYS-DNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILY 190
           R+ +  +  S +M++VI  DI  RAG  V   S E + +I      ++     + ++   KF+ + +PGG  G  RL   +    ++KI+    + G+ +     A + VL   G+L  KK T+ P F   L    + +  +V+D   ++ + P  A EF L IVEKL ++  A  +A  +++
  S:   213 RVLVPVANGSEEMEVVIIVDILRRAGAEVVVASVESETTIKASRNVQLVADTLVSEIVQTKFDLVVLPGGMPGATRL---QESEELSKILNQQVESGRCYGAICAAPAVVLEANGLLNGKKATSHPAFSSILKDQSAVEGRVVIDGRLITSRGPGTAMEFTLNIVEKLFSRSKAQEVAEPMVF 392
Score = 144, Expect = 8.2e-08, Identities = 45/171 (26%), Positives = 79/171 (46%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL-GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           + +M+ VI  D+  RAG  V   S E+ K +    G  +     I +    +++ + +PGG  G +R    R+ +V+ +I      E + +     A    L   G+L     T  PGF  KL  K+     +V D    + ++P  AFEFAL ++E+L   +    +A+ ++
  S:    18 TEEMEAVIVIDVLRRAGAAVTVASVEEGKLVNASRGVNLLADCLISECEGVEYDLVVLPGGMPGAERF---RDSQVLKRITVKQSQEKRMFAAICAAPVVALQSWGLLAGLNATCHPGFAVKLEDKSSVGGRVVRDGALTTSRAPGTAFEFALALIEQLYGPESVPAVADPMV 187
>gi|168205875|ref|ZP_02631880.1| DJ-1 family protein [Clostridium perfringens E str. JGS1987] >gi|170662622|gb|EDT15305.1| DJ-1 family protein [Clostridium perfringens E str. JGS1987] (191 aa)
Score = 174, Expect = 2.4e-11, Identities = 52/161 (32%), Positives = 89/161 (55%)
  Q:    29 DIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGK-NY-SDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           D+  RA +     S  + +++    GT + C + I   +L+ ++A+ +PGG      L D NE+V + I K+  ++  K +    AA   LA+ GV+  KK+T+ PGF+E+LG  NY  ++ +VVD N ++ + P  A  F L I++KL  ++ A  I   +L
  S:    22 DVCNRAKVTCHACSLTENRTVNSAHGTMVLCDKLISDDDLETYDAIVLPGGMPGSTNLRD-NEKVQSLIKKY--NKENKIVAAICAAPIALAKAGVIEGKKVTSYPGFKEELGNVNYVEEDTVVVDGNIITSRGPATALVFGLEILKKLGYEKEAEEIREGML 181
>gi|110799272|ref|YP_696747.1| DJ-1 family protein [Clostridium perfringens ATCC 13124] >gi|168212896|ref|ZP_02638521.1| DJ-1 family protein [Clostridium perfringens CPE str. F4969] >gi|110673919|gb|ABG82906.1| DJ-1 family protein [Clostridium perfringens ATCC 13124] >gi|170715639|gb|EDT27821.1| DJ-1 family protein [Clostridium perfringens CPE str. F4969] (191 aa)
Score = 174, Expect = 2.8e-11, Identities = 52/161 (32%), Positives = 89/161 (55%)
  Q:    29 DIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGK-NY-SDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           D+  RA +     S  + +++    GT + C + I   +L+ ++A+ +PGG      L D NE+V + I K+  ++  K +    AA   LA+ GV+  KK+T+ PGF+E+LG  NY  ++ +VVD N ++ + P  A  F L I++KL  ++ A  I   +L
  S:    22 DVCNRAKVTCHACSLTENRTVNSAHGTMVLCDKLISDNDLETYDAIVLPGGMPGSTNLRD-NEKVQSLIKKY--NKENKIVAAICAAPIALAKAGVIEGKKVTSYPGFKEELGNVNYVEEDTVVVDGNIITSRGPATALVFGLEILKKLGYEKEAEEIREGML 181
>gi|53715247|ref|YP_101239.1| ThiJ family intracellular protease [Bacteroides fragilis YCH46] >gi|60683181|ref|YP_213325.1| putative thiamine biosynthesis related protein [Bacteroides fragilis NCTC 9343] >gi|52218112|dbj|BAD50705.1| putative ThiJ family intracellular protease [Bacteroides fragilis YCH46] >gi|60494615|emb|CAH09416.1| putative thiamine biosynthesis related protein [Bacteroides fragilis NCTC 9343] (183 aa)
Score = 172, Expect = 4.9e-11, Identities = 53/159 (33%), Positives = 84/159 (52%)
  Q:    21 DMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNA--LYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL-GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQ 179
           +++ +   D   RAG+ VE VS    + +       + C +  E  N D F+A  L++PGG      L D++E +   I+ FA  E  K +    AA  VL +LG+L  +++T  P FE+ L G + ++  +V D N ++   P  A EFAL IV+ LL K+
  S:    14 EIEALTTIDTLRRAGLDVEIVSVTPDEIVVGAHDVSVLCDKNFE--NCDFFDAELLFLPGGMPGAATL-DKHEGLRKLILSFA--EKNKPIAAICAAPMVLGKLGLLKGRRVTCYPSFEQYLDGADCTNEPVVRDGNIITGMGPGAAMEFALTIVDTLLGKE 170
>gi|86171677|ref|XP_966258.1| 4-methyl-5(B-hydroxyethyl)-thiazol monophosphate biosynthesis enzyme [Plasmodium falciparum 3D7] >gi|46361227|emb|CAG25088.1| 4-methyl-5(B-hydroxyethyl)-thiazol monophosphate biosynthesis enzyme [Plasmodium falciparum 3D7] (189 aa)
Score = 171, Expect = 5.5e-11, Identities = 49/171 (28%), Positives = 82/171 (47%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           S D++ +   D+  RAG+ V T S EK + + LQS   +     I KV  + ++ L IPGG      +++ +E +   ++K      + +     A  TVL    ++ + +    P FE    K+     + V KN ++   P  A EF L IVE LL +Q+A ++A+  L
  S:    15 SEDVEYITVVDVLRRAGVHVTTASVEKSEQVCLQSKNVVLADTTISKVRNNIYDVLVIPGGMKGSNTISECSEFI--DMLKEQKANNRLYAAICAAPETVLDRHSLIDDVEAVAYPSFERNF-KHIGKGRVCVSKNCITSVGPGSAVEFGLKIVEHLLGRQVALSLASGFL 182
>gi|119953402|ref|YP_945611.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Borrelia turicatae 91E135] >gi|119862173|gb|AAX17941.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Borrelia turicatae 91E135] (181 aa)
Score = 171, Expect = 6.0e-11, Identities = 46/181 (25%), Positives = 92/181 (50%)
  Q:     9 IRIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGK-NYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           +R+AI+ +    +++ +IP DI  R G+ ++ +S    K +    G      E+I   + D F+ + +PGG  G   L   ++   ++KI++    +GK       + + VL+  G+LG  K T  PGFE  +    + D ++V+  NF++ K    A EFA  +++ +  +++  ++   +L
  S:     1 MRVAIVLANGFEEIEAIIPMDILKRGGVDLKVISLSDDKVVSSSRGFTFYADEKISDYSEDHFDLIILPGGMPGAVNLFESKD---LDKILRNMNLQGKLIAAICASPAIVLSAKGLLGANKFTCYPGFENDITDGEFVDEDVVISNNFITSKGVGTALEFAFTLLKIVKGERVLEDVKKQVL 180
>gi|168215694|ref|ZP_02641319.1| DJ-1 family protein [Clostridium perfringens NCTC 8239] >gi|182381974|gb|EDT79453.1| DJ-1 family protein [Clostridium perfringens NCTC 8239] (191 aa)
Score = 171, Expect = 6.2e-11, Identities = 51/161 (31%), Positives = 89/161 (55%)
  Q:    29 DIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGK-NY-SDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           D+  RA +     S  + +++    GT + C + I   +L+ ++A+ +PGG      L D NE+V + I K+  ++  K +    AA   LA+ GV+  KK+T+ PGF+++LG  NY  ++ +VVD N ++ + P  A  F L I++KL  ++ A  I   +L
  S:    22 DVCNRAKVTCHACSLTENRTVNSAHGTMVLCDKLISDNDLETYDAIVLPGGMPGSTNLRD-NEKVQSLIKKY--NKENKIVAAICAAPIALAKAGVIEGKKVTSYPGFKDELGNVNYVEEDTVVVDGNIITSRGPATALVFGLEILKKLGYEKEAEEIREGML 181
>gi|182623906|ref|ZP_02951694.1| DJ-1 family protein [Clostridium perfringens D str. JGS1721] >gi|177910799|gb|EDT73153.1| DJ-1 family protein [Clostridium perfringens D str. JGS1721] (191 aa)
Score = 170, Expect = 7.1e-11, Identities = 51/161 (31%), Positives = 88/161 (54%)
  Q:    29 DIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGK-NY-SDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           D+  RA +     S  + +++    GT + C + I   +L+ ++A+ +PGG      L D NE+V + I K+  ++  K +    AA   LA+ GV+  KK+T+ PGF+E+LG  NY  ++ +VVD N ++ + P  A  F L I+++L   + A  I   +L
  S:    22 DVCNRAKVTCHACSLTENRTVNSAHGTMVLCDKLISDDDLETYDAIVLPGGMPGSTNLRD-NEKVQSLIKKY--NKENKIVAAICAAPIALAKAGVIEGKKVTSYPGFKEELGNVNYVEEDTVVVDGNIITSRGPATALVFGLEILKELGYSKEAEEIREGML 181
>gi|194765116|ref|XP_001964673.1| GF22924 [Drosophila ananassae] >gi|190614945|gb|EDV30469.1| GF22924 [Drosophila ananassae] (188 aa)
Score = 170, Expect = 7.2e-11, Identities = 53/179 (29%), Positives = 90/179 (50%)
  Q:    13 IMCSIESNDMDIVIPYDIWTRAGIIVETVS-NEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTA-GAASTVLAELGVLGNKKITTAPGFEEKLGKNYS---DNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILYT 191
           I+ +  + +M+ +I  D+  RAGI V      +  + +       I     + KV  +KF+ + +PGG G    + D +   + +++K    E    L  A  AA TVLA+ G+   K +T+ P  + +L   YS   D N+V D N ++ + P  A+ FAL I E+L  K+ A  +A  +L +
  S:     7 IILAPGAEEMEFIIAADVLRRAGIKVTVAGLGDSTEPVKCSRDILIVPDTPLSKVASEKFDVVVLPGGLGGSNAMGDSS--AVGELLK--NQEASGGLIAAICAAPTVLAKHGIASGKSLTSYPSMKAQLVDKYSYVDDKNVVQDGNLITSRGPGTAYNFALKISEELAGKEKAQEVAKGLLLS 186
>gi|195575173|ref|XP_002105554.1| GD21547 [Drosophila simulans] >gi|194201481|gb|EDX15057.1| GD21547 [Drosophila simulans] (187 aa)
Score = 170, Expect = 7.4e-11, Identities = 50/171 (29%), Positives = 86/171 (50%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTA-GAASTVLAELGVLGNKKITTAPGFEEKLGKNYS---DNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           + +M+ +I  D+  RAGI V        +++      +I     +++V   KF+ + +PGG G    + + +  ++  +++    E    L  A  AA TVLA+ GV   K +T+ P  + +L  NYS   D  +V D N ++ + P  A+EFAL I E+L  K     +A  +L
  S:    13 AEEMEFIIAADVLRRAGIKVTVAGLNGGEAVKCSRDVQILPDTSLDQVASVKFDVVVLPGGLGGSNAMGESS--LVGDLLR--SQESAGGLIAAICAAPTVLAKHGVASGKSLTSYPSMKPQLVDNYSYVDDKTVVKDGNLITSRGPGTAYEFALRIAEELAGKDKVQEVAKGLL 183
>gi|195124421|ref|XP_002006691.1| GI18446 [Drosophila mojavensis] >gi|193911759|gb|EDW10626.1| GI18446 [Drosophila mojavensis] (226 aa)
Score = 169, Expect = 9.8e-11, Identities = 49/188 (26%), Positives = 93/188 (49%)
  Q:     4 HKVSNIRIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDK-FNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNY---SDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILYT 191
           +K+   R  I+ +  + +M+  I  D+  RAGIIV     E  + +       I   + +E    ++ ++ + +PGG G    ++  N + + ++++     G+  +    AA T LA+ G+   K +T+ P  + +L + Y    D N+V D N ++ + P  A+EFAL I E+L     A  +A  +L +
  S:    36 NKMDGKRALIVLAPGAEEMEFTIAADVLRRAGIIVTVAGLEGSEPVKCSRDVMIVPDKSLEDAVTEQVYDVIVLPGGLGGSTAMS--NSKAVGELLQKQESAGR-LIAAICAAPTALAKHGIATGKSLTSYPAMKPQLVEKYCYVDDQNVVQDGNLITSRGPGTAYEFALKISEQLAGTAKAQEVAKAMLLS 224
>gi|83319368|ref|YP_424483.1| DJ-1 family protein [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|83283254|gb|ABC01186.1| DJ-1 family protein [Mycoplasma capricolum subsp. capricolum ATCC 27343] (182 aa)
Score = 169, Expect = 1.0e-10, Identities = 50/180 (27%), Positives = 95/180 (52%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGK-NYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           +IA+  +    +++ V P D+  RAGI+V+ +S      +       I   +  + +N++ ++ + +PGG G   L   +N+ +I+ I++F  ++  K + +  AA  V+ +  +L NK IT  P  +  L K N  +   VVD+NF++  S   + +F+L IVE LL K+    I  +++
  S:     3 KIALYLNPGFEEIEAVTPCDVLKRAGILVDMISTTDNLEVKGSHNITIKADKLWKDLNINYYDGMILPGGSGVTSLF--KNQTLIDNILEF--NKQNKLIASICAAPQVIGQTRLLDNKTITHYPKCDLYLDKANVVNKPYVVDQNFITATSAGTSMQFSLAIVEYLLGKEKKEEIFKNLV 179
>gi|156101181|ref|XP_001616284.1| 4-methyl-5(B-hydroxyethyl)-thiazol monophosphate biosynthesis enzyme, putative [Plasmodium vivax SaI-1] >gi|148805158|gb|EDL46557.1| 4-methyl-5(B-hydroxyethyl)-thiazol monophosphate biosynthesis enzyme, putative [Plasmodium vivax] (189 aa)
Score = 168, Expect = 1.3e-10, Identities = 52/171 (30%), Positives = 82/171 (47%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           S D++ +   D+  RA I V T S E+ + + LQS   +     I+KV  + F+ + IPGG KG   +    N   + +++K      K +     A  TVL    ++ + +    P FE    K+     + V KN ++   P  A EFAL IVE LL++  A N+A+  L
  S:    15 SEDVEYITTVDVLRRANISVTTASVEETEKVCLQSKNVVIADTTIDKVKDNTFDVIVIPGGMKGSNAI---SNCPTVIEMLKVQKSSNKFYAAICAAPETVLHRHSLIDDVEAVAYPSFESDF-KHIGKGRVCVSKNCITSVGPGSAVEFALKIVEMLLSRDAALNLASGFL 182
>gi|157104409|ref|XP_001648396.1| dj-1 protein (park7) [Aedes aegypti] >gi|108880380|gb|EAT44605.1| dj-1 protein (park7) [Aedes aegypti] (186 aa)
Score = 168, Expect = 1.3e-10, Identities = 53/173 (30%), Positives = 90/173 (52%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTA-GAASTVLAELGVLGNKKITTAPGFEEKLGKNYS---DNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILYT 191
           + +M+ VI  D+  R G+ V TV+    K++       I     +E+   + F+A+ +PGG G  + ++   +  + +++K    +GK  L TA  AA TVL    V   K +T+ P F+++    Y+   D  +VVD N V+ + P  AF+FAL + E L+       +A  +LYT
  S:    13 AEEMEFVICVDVLRRCGVNV-TVAGLTDKTVKCSRDVVIKADTTLEEAANEDFDAIALPGGLGGSKAMSGSTK--LGEVLKSFESKGK--LITAICAAPTVLLTHSVALGKTLTSYPSFKDEFAGKYTYVEDKTVVVDGNLVTSRGPGTAFDFALKLGEILVGLDKTKQVAKGMLYT 184
>gi|125772586|ref|XP_001357594.1| GA12322-PA [Drosophila pseudoobscura] >gi|195159116|ref|XP_002020428.1| GL13517 [Drosophila persimilis] >gi|54637326|gb|EAL26728.1| GA12322-PA [Drosophila pseudoobscura] >gi|194117197|gb|EDW39240.1| GL13517 [Drosophila persimilis] (187 aa)
Score = 168, Expect = 1.4e-10, Identities = 48/179 (26%), Positives = 86/179 (48%)
  Q:    13 IMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNY---SDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILYT 191
           I+ +  + +M+ VI  D+  RAGI V     +  + +       I     + K   DKF+ + +PGG G    + D     +  +++ A +     +    AA TVLA+ G+   K +T+ P  +E+L   Y    D ++V D N ++ + P  A++FAL I E+L   +    +A  +L +
  S:     7 IILAPGAEEMEFVIAADVLRRAGIKVTVAGLKDSEPVKCSRDVVIVPDTSLAKAACDKFDVVVLPGGLGGSNAMGD--SAAVGDLLR-AQESAGGLIAAICAAPTVLAKHGIAAGKSLTSYPSMKEQLVDKYCYVDDKSVVKDGNLITSRGPGTAYDFALKIAEELAGLEKVKEVAKGLLLS 185
>gi|157872239|ref|XP_001684668.1| 4-methyl-5(beta-hydroxyethyl)-thiazole monophosphate synthesis protein, putative [Leishmania major] >gi|68127738|emb|CAJ06016.1| 4-methyl-5(beta-hydroxyethyl)-thiazole monophosphate synthesis protein, putative [Leishmania major] (196 aa)
Score = 168, Expect = 1.5e-10, Identities = 53/181 (29%), Positives = 94/181 (51%)
  Q:     9 IRIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVL-GNKKITTAPGFEEKLGKN--YSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           + + ++ +  S D++++   D+ +RA I V   S  + KSI L  G  + C   I +V+  +++A+ +PGG  G   L    N   + KI++ A    K +     A +  LA +G+L G   +T  PGFE+KL  +  +S   +V  +N ++ + P  A  FAL +V  L +  +A  +A  +L
  S:     1 MHVLVVAADHSEDIELISITDVLSRAAIKVTLASVMESKSITLAHGVNVMCDALIGEVSGVEYDAVLLPGGMPGAVHL---GNSEALKKILQNARAGKKLYGGICAAPAVALAPMGLLEGVDTVTCYPGFEDKLPSSVKHSTKAVVKSENCLTSRGPGTAIYFALAVVSILKSPDLAERLAKAML 182
>gi|116754114|ref|YP_843232.1| DJ-1 family protein [Methanosaeta thermophila PT] >gi|116665565|gb|ABK14592.1| DJ-1 family protein [Methanosaeta thermophila PT] (182 aa)
Score = 167, Expect = 1.7e-10, Identities = 51/172 (29%), Positives = 88/172 (51%)
  Q:    21 DMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGK-GCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGK--NYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILYTK 192
           +++ V   DI  RAGI VE ++  +   +    G ++      +KV+L+  +A+ +PGG  G   L   ++ERV++ + K +     K++     A +VL + GVL  +  T  P  +E++     Y D  +VVD   V+ + P  A +FAL +VE L  K+   N+  + L  K
  S:    13 EIEFVTVVDILRRAGIDVE-IAGLRDGPVQGSHGVRVIPDTTFDKVDLNSADAIVLPGGNPGFINL--GKDERVLDAVRKMSA--AGKYVAAICGAPSVLVKAGVLSGRMATVHPAGKEEVAACARYMDERVVVDGKMVTSQGPGTAMDFALKLVELLAGKEAMLNVGRETLVLK 182
>gi|166031011|ref|ZP_02233840.1| hypothetical protein DORFOR_00692 [Dorea formicigenerans ATCC 27755] >gi|166029278|gb|EDR48035.1| hypothetical protein DORFOR_00692 [Dorea formicigenerans ATCC 27755] (187 aa)
Score = 167, Expect = 1.7e-10, Identities = 49/188 (26%), Positives = 100/188 (53%)
  Q:     5 KVSNIRIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNY-SDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILYTK 192
           K S  ++ ++ +    +++ +   D+  RA + V+TVS     ++    G  +   + I +++  + + + +PGG  G   L  D N R   K V+ A D+G+ ++    AA T+LA++G+L  K+ T  P  E ++   Y +   +  D+N ++ +    A +FAL ++E L++++ A  IA+ I+Y +
  S:     2 KFSMKKVTVLLADGFEEIEALTVVDLLRRAKVYVDTVSITDDYTVRGAHGIPVQTEDLITEIDFKESDMIVLPGGMPGTTNLKEDENVR---KAVQEAYDDGR-YVAAICAAPTILADMGLLKGKRATCYPDMESEIEDAYLTGAPVATDENIITSQGVGTAIDFALKLIEVLISEEKAVEIADSIVYQR 187
>gi|187918480|ref|YP_001884043.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Borrelia hermsii DAH] >gi|119861328|gb|AAX17123.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Borrelia hermsii DAH] (181 aa)
Score = 167, Expect = 1.9e-10, Identities = 45/181 (24%), Positives = 90/181 (49%)
  Q:     9 IRIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGK-NYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           +R AI+ +    +++ V+P DI  R G+ ++ +     + +    G      ++I   + D F+ + +PGG  G   L   +N   ++KI++    +GK       + + VL+  G+LG  K T  PGFE  +    + D+++VV  NF++ K    AF+FA  +++ +  + +  ++    L
  S:     1 MRAAIVLANGFEEIEAVVPMDILRRGGVDLKVIGLNDDRVVLSSRGFTFWTDKKISDCSADHFDLIILPGGMPGATNLFESQN---LDKILRNMNLQGKLIAAICASPAVVLSAKGLLGTNKFTCYPGFENGITDGEFVDDDVVVSNNFITSKGVGTAFKFAFTLLKIIKGESVLEDVKRKAL 180
>gi|153954760|ref|YP_001395525.1| hypothetical protein CKL_2142 [Clostridium kluyveri DSM 555] >gi|146347618|gb|EDK34154.1| Conserved hypothetical protein [Clostridium kluyveri DSM 555] (186 aa)
Score = 167, Expect = 1.9e-10, Identities = 51/161 (31%), Positives = 84/161 (52%)
  Q:    29 DIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL-GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           D+  R  I     S   K+ +    G  +     ++ +N D++ A+ +PGG      L D NE+VI  + KF  D   K +    AA  VL + G++ N+K+T+ PGFEE+L   NYS+  +V ++N ++ + P  A  FAL ++E L   +   N+  D+L
  S:    22 DVLRRGNIDCRICSISGKEDVKGAHGVVVKAEILLQNINEDEYEAIILPGGMPGAVNLRD-NEKVIEIVKKF--DRENKIIAAICAAPIVLKKAGIIYNRKVTSYPGFEEELQAYNYSEEIVVQERNLITSRGPATAPYFALKVLENLSGTEGVENLRKDML 180
>gi|157341016|emb|CAO47821.1| unnamed protein product [Vitis vinifera] (375 aa)
Score = 167, Expect = 1.9e-10, Identities = 49/168 (29%), Positives = 82/168 (48%)
  Q:    22 MDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYS-DNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           M+ VI  D+  RAG  V   S E +  I   SGT++     I   + + F+ + +PGG  G  RL   R+  ++ KI     +E + +     A +  L   G+L  K++T  P F +KL    +  +N+ V     + + P  AFEFAL +V++L  + +A  +   +L
  S:     1 MEAVILVDVLRRAGANVVVASVEPQLEIEASSGTRLVADTSISTCSDEIFDLIALPGGMPGSARL---RDSEILRKITSKHAEEKRLYGAICAAPAITLQPWGLLRRKQMTCHPAFMDKLPTFRAVKSNLQVSGELTTSRGPGTAFEFALALVDQLFGESVAKEVGELLL 167
Score = 159, Expect = 1.7e-09, Identities = 50/172 (29%), Positives = 85/172 (49%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAAS-TVLAELGVLGNKKITTAPGFEEKLGKNYSDN-NIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILY 190
           S ++++V   DI  RA + V   S EK   I    G K+   + I+      ++ + +PGG  G +RL      +V+ K++K  G  G+  ++ A  +S TVL   G+L  K+ T  P    KL     +   +V+D   ++ +    A EFAL IV KL +   A ++A  +++
  S:   201 SEEIEVVTVVDILRRAKVDVVVASVEKSLQILASRGIKLIADKSIDNAAESIYDLIILPGGIAGAERL---HKSKVLKKMLKEQGSAGR--IYGAICSSPTVLHRQGLLKGKRATAHPSVASKLTNEVVEGARVVIDGKLITSRGLATAIEFALAIVSKLFSHARARSVAEGLVF 370
>gi|56201615|dbj|BAD73062.1| putative 4-methyl-5(B-hydroxyethyl)-thiazol monophosphate biosynthesis enzyme [Oryza sativa Japonica Group] (426 aa)
Score = 166, Expect = 2.1e-10, Identities = 51/172 (29%), Positives = 89/172 (51%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGT-KITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL-GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILY 190
           S +M+ +   DI  RAG  V   S E K  +  +     +     +E+    +F+ + +PGG  G Q+L    + +V+  ++K   +  K +     + + VL   G+L  KK T+ P     L  ++  D+ +VVD N ++ K+P  A EFAL IVEKL  ++ A +IA ++++
  S:   254 SEEMEALNLIDILRRAGANVTVASVEDKLQVVTRRHKFNLIADIMVEEAAKREFDLIVMPGGLPGAQKL---SSTKVLVDLLKKQAESNKPYGAICASPAYVLEPHGLLKGKKATSFPPMAHLLTDQSACDSRVVVDGNLITSKAPGSATEFALAIVEKLFGREKAVSIAKELIF 425
Score = 146, Expect = 5.2e-08, Identities = 44/157 (28%), Positives = 80/157 (50%)
  Q:    29 DIWTRAGIIVETVSNE---KKKSIFLQS--GTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNY--SDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIA 185
           D+  RAG  V   + +     + + +++  G K+     +  +  + F+ + +PGG  G   L   R+ +V+ K+VK   ++G  +       +  LA  G+L   K T  P F EK        ++ +VVD+N V+ + P  A E+AL +VE+L  K+ +  +A
  S:    54 DVLNRAGARVTVATADPAGDDRGLLVEAAFGVKLVADGRVADLEGEAFDLIALPGGMPGSANL---RDCKVLEKMVKKQAEQGGLYAAICATPAVTLAHWGLLKGLKATCYPSFMEKFTAEIIPVNSRVVVDRNAVTSQGPATAIEYALALVEQLYGKEKSEEVA 215
>gi|115435298|ref|NP_001042407.1| Os01g0217800 [Oryza sativa (japonica cultivar-group)] >gi|113531938|dbj|BAF04321.1| Os01g0217800 [Oryza sativa (japonica cultivar-group)] (513 aa)
Score = 166, Expect = 2.2e-10, Identities = 51/172 (29%), Positives = 89/172 (51%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGT-KITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL-GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILY 190
           S +M+ +   DI  RAG  V   S E K  +  +     +     +E+    +F+ + +PGG  G Q+L    + +V+  ++K   +  K +     + + VL   G+L  KK T+ P     L  ++  D+ +VVD N ++ K+P  A EFAL IVEKL  ++ A +IA ++++
  S:   341 SEEMEALNLIDILRRAGANVTVASVEDKLQVVTRRHKFNLIADIMVEEAAKREFDLIVMPGGLPGAQKL---SSTKVLVDLLKKQAESNKPYGAICASPAYVLEPHGLLKGKKATSFPPMAHLLTDQSACDSRVVVDGNLITSKAPGSATEFALAIVEKLFGREKAVSIAKELIF 512
Score = 146, Expect = 5.4e-08, Identities = 44/157 (28%), Positives = 80/157 (50%)
  Q:    29 DIWTRAGIIVETVSNE---KKKSIFLQS--GTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNY--SDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIA 185
           D+  RAG  V   + +     + + +++  G K+     +  +  + F+ + +PGG  G   L   R+ +V+ K+VK   ++G  +       +  LA  G+L   K T  P F EK        ++ +VVD+N V+ + P  A E+AL +VE+L  K+ +  +A
  S:   141 DVLNRAGARVTVATADPAGDDRGLLVEAAFGVKLVADGRVADLEGEAFDLIALPGGMPGSANL---RDCKVLEKMVKKQAEQGGLYAAICATPAVTLAHWGLLKGLKATCYPSFMEKFTAEIIPVNSRVVVDRNAVTSQGPATAIEYALALVEQLYGKEKSEEVA 302
>gi|169343644|ref|ZP_02864643.1| DJ-1 family protein [Clostridium perfringens C str. JGS1495] >gi|169298204|gb|EDS80294.1| DJ-1 family protein [Clostridium perfringens C str. JGS1495] (191 aa)
Score = 166, Expect = 2.2e-10, Identities = 50/161 (31%), Positives = 88/161 (54%)
  Q:    29 DIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGK-NY-SDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           D+  RA +     S  + +++    GT + C + I   +L+ ++A+ +PGG      L D NE+V + I K+  ++  K +    AA   LA+ GV+  KK+T+ PGF+++LG  NY  ++ +VVD N ++ + P  A  F L I+++L   + A  I   +L
  S:    22 DVCNRAKVTCHACSLTENRTVNSAHGTMVLCDKLISDDDLETYDAIVLPGGMPGATNLRD-NEKVQSLIKKY--NKENKIVAAICAAPIALAKAGVIEGKKVTSYPGFKDELGNVNYVEEDTVVVDGNIITSRGPATALVFGLEILKELGYSKEAEEIREGML 181
>gi|51598874|ref|YP_073062.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein [Borrelia garinii PBi] >gi|51573445|gb|AAU07470.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein [Borrelia garinii PBi] (184 aa)
Score = 166, Expect = 2.2e-10, Identities = 47/169 (27%), Positives = 80/169 (47%)
  Q:    21 DMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEK-LGKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           D++ +IP DI  R  + ++ +S      +    G      + I     + F+ + +PGG  G   L    N + ++ I+K     GK       + + VLA  G+LG+ K T  PG E+  L   + D N+V+  NF++ K    +FEFA  ++E +  +QI  N+    L
  S:    13 DIEAIIPIDILRRGNVNIQVISLNDNNVVTSSKGVSFLTDDVILNCKENYFDLIILPGGMPGATNLF---NSKELDLILKDMNSRGKFIAAICASPAVVLAAKGLLGSNKFTCYPGLEKSVLDGEFVDKNVVISNNFITSKGVGTSFEFAFTLLEMVKGRQIMENVKKATL 180
>gi|121997998|ref|YP_001002785.1| DJ-1 family protein [Halorhodospira halophila SL1] >gi|121589403|gb|ABM61983.1| DJ-1 family protein [Halorhodospira halophila SL1] (188 aa)
Score = 166, Expect = 2.5e-10, Identities = 48/177 (27%), Positives = 91/177 (51%)
  Q:     8 NIRIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTD-RNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNI 184
           ++R+ +  +    +++ V   D+  RAG  V  V+  +  ++    G ++    E+++V  + F+ + +PGG  G +RL  D R  R++      A +E   W+    AA  VLAE+GVL  ++ T  P   E+ G    D+ +V+D N ++ + P  A +FAL ++E +   + A  +
  S:     3 SVRVLVPLAHGCEELEAVTVIDLLRRAGAEV-VVAGLESGTVRASRGVQLVPDTELDRVVEETFDLIVLPGGLGGAERLEGDARIARMLQ-----AQNERGGWIAAICAAPRVLAEVGVLQGRRATAFPTQLERHGIEPEDSAVVIDDNLITSRGPGTAMDFALRLIEVVYGDEKAAEV 175
>gi|118580535|ref|YP_901785.1| metal dependent phosphohydrolase [Pelobacter propionicus DSM 2379] >gi|118503245|gb|ABK99727.1| metal dependent phosphohydrolase [Pelobacter propionicus DSM 2379] (388 aa)
Score = 165, Expect = 3.0e-10, Identities = 43/127 (33%), Positives = 69/127 (54%)
  Q:    63 IEKVNLDKFNALYIPGGK-GCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL-GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           I+    D+F+ + +PGG+ G   L  D   RVI  +  F+ D   K +    AA+TVL+E G++  K++T  P + ++L G  Y D+ +V+D   ++ + P  A  FAL IV +   K  A  IA  +L
  S:    55 IDAARSDQFDMVILPGGQPGAANLSAD--VRVIRLLNDFSKD--NKLIGAICAATTVLSEAGLIRGKRVTAYPDYRDRLPGAQYEDSAVVIDGKIITSQGPGTAMAFALAIVSRFAGKHTADEIAGKML 179
>gi|164688437|ref|ZP_02212465.1| hypothetical protein CLOBAR_02082 [Clostridium bartlettii DSM 16795] >gi|164602850|gb|EDQ96315.1| hypothetical protein CLOBAR_02082 [Clostridium bartlettii DSM 16795] (188 aa)
Score = 164, Expect = 4.0e-10, Identities = 51/127 (40%), Positives = 76/127 (59%)
  Q:    63 IEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGK-NYSDNNIVV-DKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           I+ ++ D+++A+ +PGG  G   LL   ++RV +  +KF  DEGK  +    AA   L + G+L +KK T+ PGF +   K NY +N IVV DKN ++ + P  A EFA  I+E+L  K  A  I  D+L
  S:    55 IDNIDQDEYDAIVLPGGLPGADNLL---DKRVKDIAIKF-NDEGK-IVAAICAAPQTLEQFGILDDKKCTSYPGFIKGREKVNYLENQIVVVDKNIITSRGPATALEFAFKILEELGYKDKAEEIKKDML 179
>gi|188590733|ref|YP_001920144.1| protein ThiJ [Clostridium botulinum E3 str. Alaska E43] >gi|188501014|gb|ACD54150.1| protein ThiJ [Clostridium botulinum E3 str. Alaska E43] (178 aa)
Score = 164, Expect = 4.1e-10, Identities = 57/162 (35%), Positives = 94/162 (58%)
  Q:    29 DIWTRAGIIVETVS-NEKKKSIFLQSGTKITC-SEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL-GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILY 190
           DI  RA ++ + VS NE+    F+ S   +T  +++I K +++ ++ + +PGG    + L D +ERVI  + K   D+  K +    AA  VL + GV   + IT+ PGFE++L   NY +NN+VVD N ++ + P  A EFA  ++EKL   ++   +A  +LY
  S:    22 DIIRRADMVCDLVSINEE----FVTSSHGVTIKADKIFKSDME-YDLVALPGGMPGAKNLRD-DERVIEFVKKH--DKQGKIIGAICAAPIVLGKAGVTNERNITSYPGFEDELINCNYKENNVVVDGNIITSRGPATAIEFAYKLIEKLGYDKV-EELAKSMLY 177
>gi|111115451|ref|YP_710069.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein [Borrelia afzelii PKo] >gi|167942340|ref|ZP_02529414.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein [Borrelia afzelii ACA-1] >gi|110890725|gb|ABH01893.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein [Borrelia afzelii PKo] (184 aa)
Score = 164, Expect = 4.1e-10, Identities = 48/169 (28%), Positives = 80/169 (47%)
  Q:    21 DMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL-GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           D++ ++P DI  R  + ++ +S      +    G      + I   N ++F+ + +PGG  G   L    N + ++ I+K    +GK       +   VLA  G+LG  K T  PG EE +    + D N+V   NF++ K    +FEFA  ++E +  KQI  N+    L
  S:    13 DIEAIVPIDILRRGNVNIQVISINDNNVVTSSKGVSFLTDDIISNCNENRFDLIILPGGMPGATNLF---NSKELDLILKDMNAKGKFIAAICASPVVVLAAKGLLGFNKFTCYPGMEENVVDGEFVDKNVVRSNNFITSKGVGTSFEFAFTLLEIVKGKQIMENVKKATL 180
>gi|62752059|ref|NP_001015851.1| MGC108042 protein [Xenopus tropicalis] >gi|62859573|ref|NP_001017109.1| Parkinson disease (autosomal recessive, early onset) 7 [Xenopus tropicalis] >gi|60422832|gb|AAH90355.1| MGC108042 protein [Xenopus tropicalis] >gi|89270947|emb|CAJ81253.1| Parkinson disease (autosomal recessive [Xenopus tropicalis] (189 aa)
Score = 164, Expect = 4.2e-10, Identities = 58/180 (32%), Positives = 93/180 (51%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEI--EKVNLDKFNALYIPGGK-GCQRLLTDRNERVINKIVKFAGDEGKKWLFTA-GAASTVLAELGVLGNKKITTAPGFEEKLGK----NYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           R  ++ +  + +M+ VIP D+  RAGI V T++    K   L S   + C +    E      ++ + +PGG  G Q L       V+ +++K    E K  L  A  A  T L   GV   K ITT P  ++K+       YS+  +V D NF++ + P  +FEFAL+IV  L+ K++A  + + +L
  S:     5 RALLILAKGAEEMETVIPADVMRRAGIKV-TIAGLSGKDPVLCSRDVVLCPDTSLEEARTQGPYDVVVLPGGNLGAQNL---SESPVVKEVLK--EQEAKNGLIAAICAGPTALTVHGVGIGKTITTHPLAKDKIVNADHYKYSEERVVKDGNFITSRGPGTSFEFALMIVSTLVGKEVADQVKSPLL 186
>gi|77163576|ref|YP_342101.1| DJ-1 [Nitrosococcus oceani ATCC 19707] >gi|76881890|gb|ABA56571.1| DJ-1 [Nitrosococcus oceani ATCC 19707] (184 aa)
Score = 163, Expect = 4.9e-10, Identities = 54/168 (32%), Positives = 88/168 (52%)
  Q:     9 IRIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGK-GCQRLLTDRNERVINKIVKFAGDEGKKWLFTAG--AASTVLAELGVLGNKKITTAPGFEEKLG---KNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLL 176
           +++ I  +    +++ V   D+  R GI V T   +++  +    GT++     ++KV   +F+ + +PGG+ G   L  DR    I  ++K   + GK    TA   AA TVLA  G+L +K+ T  PGF +KL        D  +VVD   V+ K P  A +FAL ++E L+
  S:     2 VKVLIPLAQGCEELEAVTLIDLLRRGGIQVVTAGLDEQ-VVTASRGTRLLPDTSLDKVFQQEFDMVVLPGGQPGADNLNGDRR---IRALLKRTAERGK---ITAAICAAPTVLASTGLLASKRATGYPGFLDKLDLPTTTLEDQAVVVDGCVVTSKGPGTAMDFALTLIELLV 168
>gi|146281307|ref|YP_001171460.1| putative intracellular protease/amidase [Pseudomonas stutzeri A1501] >gi|145569512|gb|ABP78618.1| putative intracellular protease/amidase [Pseudomonas stutzeri A1501] (187 aa)
Score = 163, Expect = 5.5e-10, Identities = 49/180 (27%), Positives = 86/180 (47%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL-GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           R+ I  +  S D++ V   D+  RA   V   S E+++ +    GT+IT    +  V    F+ + +PGG    + L +     + + V+     G  +     A +  L   GVL  +++T  PG  + L G ++ D  +VVD N ++ + P  A EFAL +VE+L  +     +A+ +L
  S:     4 RVLIPIADGSEDLEAVTLIDVLRRAEFDVVVASAEERRMLTCARGTRITADTMLLDVLAQDFDLIVLPGGMPGAKTLGELEP--LAERVRQQARAGLDYAAICAAPAVALHPYGVLKGRQVTCYPGMSDNLTGTHFLDQPVVVDGNCITSQGPATALEFALTLVERLAGRGKRREVADAML 182
>gi|147900143|ref|NP_001083896.1| SP22 [Xenopus laevis] >gi|46329781|gb|AAH68860.1| Park7 protein [Xenopus laevis] (189 aa)
Score = 162, Expect = 6.2e-10, Identities = 56/180 (31%), Positives = 89/180 (49%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLD-KFNALYIPGGK-GCQRLLTDRNERVINKIVKFAGDEGKKWLFTA-GAASTVLAELGVLGNKKITTAPGFEEKLGK----NYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           R  ++ +  + +M+ VIP D+  RAGI V       K  +       +     +E+      ++ + +PGG  G Q L       V+ +++K    E KK L  A  A  T L   GV   K ITT P  ++K+       YS+  +V D+NF++ + P  +FEFAL IV  LL K++A  +   +L
  S:     5 RALVILAKGAEEMETVIPTDVMRRAGIKVTVAGLSGKDPVQCSRDVMLCPDTSLEEARTQGPYDVVVLPGGNLGAQNL---SESPVVKEVLK--EQEAKKGLIAAICAGPTALTVHGVGIGKTITTHPLAKDKIVNPDQYKYSEERVVKDENFITSRGPGTSFEFALEIVCTLLGKEVAEQVKTPLL 186
>gi|116793831|gb|ABK26894.1| unknown [Picea sitchensis] (376 aa)
Score = 162, Expect = 7.0e-10, Identities = 53/173 (30%), Positives = 84/173 (48%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYSDN-NIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILYT 191
           S++M+IV+  D+  RA   V   S E    I    GTKI      +   L  ++ +++PGG  G Q+L     E++I+ + + A  E  K      AA+ +L   G+L  KK TT P +  KL    S N  +V+D   ++        E+AL IVEKL   + A  +A  + ++
  S:   204 SDEMEIVVVVDVLRRAKANVVVASVEDSLEIVAARGTKIVADRLFKDAILSNYDFIHLPGGWYGAQKL--GSTEQLIDLLREHA--ESNKAYGVVCAAAVMLDTKGLLKGKKATTHPHYSNKLSDQSSVNVRVVIDGKLITSFGTGSTMEYALSIVEKLFGMERANEVAEAMAFS 374
Score = 92, Expect = 8.6e-02, Identities = 38/162 (23%), Positives = 69/162 (42%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQI 180
           S + ++V   D++   G +V+  S E    I   SG K      I       F+ + +PGG  G +RL   ++ +V+ KI +    EG+ +  ++ A++ VL + G+L   ++       + LG                        +F+L I E+L  K+I
  S:    21 SEETEVVTLVDVFRGGGALVKVASVENDIQIECSSGVKFVADTFISDCESQIFDLVVLPGGMPGLERL---QDCKVLRKITEAHAKEGRLYGSSSEASAVVLEKWGLLKGCQVDGMVTTSQGLGL---------------------TLDFSLSIAEQLFGKKI 159
>gi|187932475|ref|YP_001884984.1| protein ThiJ [Clostridium botulinum B str. Eklund 17B] >gi|187720628|gb|ACD21849.1| protein ThiJ [Clostridium botulinum B str. Eklund 17B] (178 aa)
Score = 161, Expect = 8.5e-10, Identities = 56/162 (34%), Positives = 94/162 (58%)
  Q:    29 DIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL-GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILY 190
           DI  RAG+I + VS +++  +    G  I  +++I K +++ ++ + +PGG    + L D +ERVI + VK    +GK  +    AA  VL + G+   + IT+ PGFE++L   NY +NN+VVD N ++ + P  A EFA  ++EKL   ++   +A  +LY
  S:    22 DIIRRAGMICDLVSIDEE-CVSSSHGVTIK-ADKIFKSDME-YDLVALPGGMPGAKNLRD-DERVI-EFVKKHNKQGK-IIGAICAAPIVLGKAGLTNERNITSYPGFEDELINCNYKENNVVVDGNIITSRGPATAIEFAYKLIEKLGYDKV-EELAKSMLY 177
>gi|15594966|ref|NP_212755.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein (thiJ) [Borrelia burgdorferi B31] >gi|167943553|ref|ZP_02530627.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein (thiJ) [Borrelia burgdorferi Bol26] >gi|168692407|ref|ZP_02725199.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein (thiJ) [Borrelia burgdorferi 94a] >gi|195941441|ref|ZP_03086823.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein (thiJ) [Borrelia burgdorferi 80a] >gi|195951060|ref|ZP_03092157.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein (thiJ) [Borrelia burgdorferi 29805] >gi|195955617|ref|ZP_03094310.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein (thiJ) [Borrelia burgdorferi CA-11.2a] >gi|195960361|ref|ZP_03096566.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein (thiJ) [Borrelia burgdorferi 64b] >gi|2688544|gb|AAC66975.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein (thiJ) [Borrelia burgdorferi B31] (184 aa)
Score = 161, Expect = 9.7e-10, Identities = 48/172 (27%), Positives = 79/172 (45%)
  Q:    21 DMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEK-LGKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILYTK 192
           D++ +IP DI  R  + ++ +S      +    G      + I     + F+ + +PGG  G   L    N + ++ I+K    +GK       +   VLA  G+LG  K T  PG E+  L   + D N+V   NF++ K    +FEFA  ++E +  KQI  ++    L  K
  S:    13 DIEAIIPIDILRRGNVNIQIISTNDSNVVISSKGVSFLADDIISNCKENCFDLIILPGGMPGATNLF---NSKELDLILKDMNSKGKFIAAICASPVVVLAAKGLLGFNKFTCYPGLEKNVLDGEFVDENVVRSNNFITSKGVGTSFEFAFTLLEMVKGKQIMEDVKKATLLCK 183
>gi|146305868|ref|YP_001186333.1| DJ-1 family protein [Pseudomonas mendocina ymp] >gi|145574069|gb|ABP83601.1| DJ-1 family protein [Pseudomonas mendocina ymp] (183 aa)
Score = 161, Expect = 9.9e-10, Identities = 53/179 (29%), Positives = 88/179 (49%)
  Q:    11 IAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRL-----LTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL-GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           IA+   +E  D++ V   D+  RA I V   S E ++ I    GT++T    +  V    F+ + +PGG  G Q L     L +R        V+     G+ +     A +  L + GVL  +++T  P F ++L G  + D  +VVD N ++ + P  A  FAL +VE+L+ +     +A  +L
  S:     7 IAVAEGVE--DLECVTLIDVLRRAEIEVLVASIEDRRMITCARGTRLTADAMLVDVLAQDFDLIVLPGGMPGAQHLAEFEPLAER--------VRQQAKAGELFAAICAAPALALQQYGVLRQRRMTCYPAFSDRLSGCTFVDEAVVVDGNCITSQGPGTALVFALTLVEQLVGRSTRNEVAKAML 182
>gi|188997020|ref|YP_001931271.1| DJ-1 family protein [Sulfurihydrogenibium sp. YO3AOP1] >gi|188932087|gb|ACD66717.1| DJ-1 family protein [Sulfurihydrogenibium sp. YO3AOP1] (182 aa)
Score = 160, Expect = 1.2e-09, Identities = 59/162 (36%), Positives = 88/162 (54%)
  Q:    29 DIWTRAGIIVETV-SNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGK-GCQRLLTDRNERVINKIVKFAGDEGKKWLFTAG--AASTVLAELGVLGNKKITTAPGFEEKLGK-NYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILY 190
           DI  RAGI  ETV +   +  I    G K+     I+ +  + F+ + +PGG+ G   L  D  ERV  K+++   ++GK    T    AA  VLA  GVL  KK T+ P ++EKLG  NY ++ +V D N ++ + P  A  FA  IV+KL  K+ A  +   +L+
  S:    22 DILRRAGI--ETVIAGLHEGPITSARGVKVLPDTTIDTIKAEDFDMIVLPGGQPGTDNLNAD--ERV-KKLIQDFYNKGK---LTGAICAAPYVLANAGVLEGKKATSYPTYKEKLGNVNYLEDTVVEDSNVLTSRGPGTAACFAFKIVKKLAGKEKADQLKQAMLF 180
>gi|167932754|ref|ZP_02519841.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein (thiJ) [Borrelia burgdorferi 156a] (184 aa)
Score = 160, Expect = 1.3e-09, Identities = 47/172 (27%), Positives = 79/172 (45%)
  Q:    21 DMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEK-LGKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILYTK 192
           D++ ++P DI  R  + ++ +S      +    G      + I     + F+ + +PGG  G   L    N + ++ I+K    +GK       +   VLA  G+LG  K T  PG E+  L   + D N+V   NF++ K    +FEFA  ++E +  KQI  ++    L  K
  S:    13 DIEAIVPIDILRRGNVNIQIISTNDSNVVISSKGVSFLADDIISNCKENCFDLIILPGGMPGATNLF---NSKELDLILKDMNSKGKFIAAICASPVVVLAAKGLLGFNKFTCYPGLEKNVLDGEFVDENVVRSNNFITSKGVGTSFEFAFTLLEMVKGKQIMEDVKKATLLCK 183
>gi|195056378|ref|XP_001995087.1| GH22956 [Drosophila grimshawi] >gi|193899293|gb|EDV98159.1| GH22956 [Drosophila grimshawi] (189 aa)
Score = 160, Expect = 1.3e-09, Identities = 48/179 (26%), Positives = 87/179 (48%)
  Q:    13 IMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEK-VNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNY---SDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILYT 191
           I+ +  + +M+  I  D+  RAGI V        + +       I   + +++ V+   ++ + +PGG G    + D   + I  +++ A +   + +    AA T LA+ G+   K +T+ P  + +L   Y    D N+V D N ++ + P  AFEFAL I E+L   + A  +A  +L T
  S:     7 IILAPGAEEMEFTIAADVLRRAGITVTVAGLTGSEPVKGSRDIYIVPDKSLKQAVDAQPYDVVVLPGGLGGSNAMCD--SQAIGDLLR-AQESAGRLIAAICAAPTALAKHGIATGKSLTSYPAMKPQLIDKYCYVDDKNVVQDGNLITSRGPGTAFEFALKISEQLAGAEKAKEVAKGLLLT 186
>gi|168183166|ref|ZP_02617830.1| DJ-1 family protein [Clostridium botulinum Bf] >gi|182673680|gb|EDT85641.1| DJ-1 family protein [Clostridium botulinum Bf] (183 aa)
Score = 160, Expect = 1.3e-09, Identities = 50/161 (31%), Positives = 83/161 (51%)
  Q:    29 DIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKN-YSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           D+  RA I  +  S    K +       +   + +E++  +++N+L IPGG      L D N +VIN + +F  DE  K +    A   VL++  ++  K++T+ PGFEE L ++ Y ++ +V D N ++ + P  A  FA  I+E  L K  A  I  D+L
  S:    22 DVLRRANIQCDMCSITSDKEVKGAHNILVNVDKTLEEIKTNEYNSLVIPGGMPGATNLRD-NNKVINLVKEFNRDE--KLIAAICAGPIVLSKANIIKGKEVTSYPGFEEDLKESIYKEDLVVQDGNIITSRGPSAAMYFAFKILEN-LKKDSAKEIKEDML 179
>gi|194247405|emb|CAQ40805.1| 4-methyl-5(b-hydroxyethyl)-thiazol monophosphate synthase, putative [Plasmodium knowlesi strain H] (189 aa)
Score = 159, Expect = 1.4e-09, Identities = 52/171 (30%), Positives = 82/171 (47%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           S D++ +   D+  RA I V T S E+ + + LQS   I     I+KV  + F+ + IPGG KG   +    N   +  ++K   +  + +     A  TVL    ++ + +    P FE    K+     + V KN ++   P  A EFAL IVE LL++  A N+A+  L
  S:    15 SEDVEYITTVDVLRRANISVTTASVEETEKVCLQSKNVIIADTLIDKVKDNIFDVIIIPGGMKGSNAI---SNCPTVITMLKAQKNSNRFYAAICAAPETVLHRHSLIDDVEAVAYPSFETDF-KHIGKGRVCVSKNCITSVGPGSAVEFALKIVEILLSRDAALNLASGFL 182
>gi|16303786|gb|AAL16803.1|AF394958_1 SP22 [Xenopus laevis] (189 aa)
Score = 159, Expect = 1.4e-09, Identities = 55/180 (30%), Positives = 89/180 (49%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLD-KFNALYIPGGK-GCQRLLTDRNERVINKIVKFAGDEGKKWLFTA-GAASTVLAELGVLGNKKITTAPGFEEKLGK----NYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           R  ++ +  + +M+ VIP D+  RAGI V       K  +       +     +E+      ++ + +PGG  G Q L       V+ +++K    E KK L  A  A  T L   GV   K ITT P  ++K+       YS+  +V D+NF++ + P  +FEFAL IV  LL K++A  +   ++
  S:     5 RALVILAKGAEEMETVIPTDVMRRAGIKVTVAGLSGKDPVQCSRDVMLCPDTSLEEARTQGPYDVVVLPGGNLGAQNL---SESPVVKEVLK--EQEAKKGLIAAICAGPTALTVHGVGIGKTITTHPLAKDKIVNPDQYKYSEERVVKDENFITSRGPGTSFEFALEIVCTLLGKEVAEQVKTPLV 186
>gi|157278183|ref|NP_001098191.1| dj-1 protein [Oryzias latipes] >gi|54792718|dbj|BAD67176.1| DJ-1 [Oryzias latipes] (189 aa)
Score = 159, Expect = 1.5e-09, Identities = 50/175 (28%), Positives = 87/175 (49%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLD-KFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTA-GAASTVLAELGVLGNKKITTAPGFEEKLGK----NYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNI 184
           R  ++ S  + +M+ VIP D+  RAGI V       K+ +       I     +E+ +    ++ + +PGG  G Q L        + +++K    +G+K L  A  A  T L   G+     +TT P  +EK+       YS+  +  D ++++ + P  +FEFAL IVE+L+   +AT +
  S:     5 RALVILSKGAEEMETVIPVDVMRRAGIAVTVAGLTGKEPVQCSRNVVICPDTSLEEASKQGPYDVVLLPGGMPGAQNL---AESPAVKEVLK--DQDGRKGLIAAICAGPTALLAHGIGFGSTVTTHPAMKEKMMAGDHYKYSEARVQKDGHYITSRGPGTSFEFALTIVEELMGADVATQV 181
>gi|195947632|ref|ZP_03088818.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein [Borrelia garinii PBr] (184 aa)
Score = 158, Expect = 1.9e-09, Identities = 47/169 (27%), Positives = 77/169 (45%)
  Q:    21 DMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEK-LGKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           D++ +IP DI  R  + ++ +S      +    G      + +       F+ + +PGG  G   L    N + ++ I+K     GK       +   VLA  G+LG  K T  PG E+  L   + D N+V+  NF++ K    +FEFA  ++E +  KQI  N+    L
  S:    13 DIEAIIPIDILRRGNVNIQVISLNDNNVVTSSKGVSFLTDDVVSNCKESCFDLIILPGGMPGATNLF---NSKELDLILKDMNARGKFIAAICASPVVVLAAKGLLGFNKFTCYPGLEKSVLDGEFVDKNVVISNNFITSKGVGTSFEFAFTLLEIIKGKQIMENVKKATL 180
>gi|54400374|ref|NP_001005938.1| Parkinson disease protein 7 [Danio rerio] >gi|82180540|sp|Q5XJ36|PARK7_BRARE Protein DJ-1 (zDJ-1) (Parkinson disease protein 7 homolog) >gi|53734023|gb|AAH83475.1| Parkinson disease (autosomal recessive, early onset) 7 [Danio rerio] >gi|114329258|gb|ABI64158.1| Dj1 [Danio rerio] (189 aa)
Score = 158, Expect = 2.0e-09, Identities = 50/175 (28%), Positives = 86/175 (49%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLD-KFNALYIPGGK-GCQRLLTDRNERVINKIVKFAGDEGKKWLFTA-GAASTVLAELGVLGNKKITTAPGFEEKLGK----NYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNI 184
           R  ++ +  + +M+ VIP D+  RAGI V       K+ +       I     +E  +    ++ + +PGG  G Q L        + +++K    EG+K L  A  A  T L   G+     +TT PG ++K+       YS+  +  D N ++ + P  +FEFAL IVE+L+  ++A  +
  S:     5 RALVILAKGAEEMETVIPVDVMRRAGIAVTVAGLAGKEPVQCSREVMICPDSSLEDAHKQGPYDVVLLPGGLLGAQNL---SESPAVKEVLK--DQEGRKGLIAAICAGPTALLAHGIAYGSTVTTHPGAKDKMMAGDHYKYSEARVQKDGNVITSRGPGTSFEFALTIVEELMGAEVAAQV 181
>gi|163815497|ref|ZP_02206870.1| hypothetical protein COPEUT_01662 [Coprococcus eutactus ATCC 27759] >gi|158449134|gb|EDP26129.1| hypothetical protein COPEUT_01662 [Coprococcus eutactus ATCC 27759] (181 aa)
Score = 158, Expect = 2.1e-09, Identities = 49/164 (29%), Positives = 86/164 (52%)
  Q:    29 DIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL-GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILYTK 192
           DI  RAGI    V+ +  +++    G  ++  E++ +++  + + + +PGG  G   L  +     +  +VK   D G  ++    A  T L   GVL +KK T  PG E +L  K +S + +VVD N ++ +    A +F L IVE +++K IA ++A  I+Y +
  S:    21 DILRRAGIECAMVAADDSEAVTGAHGICVSMDEKLSEIS-GECDIVILPGGIPGVPNLKANPK---VEALVKKQNDRGA-YVAAICAGPTALGAFGVLADKKATCYPGCEGQLMAKTHSTDPVVVDGNVITSRGVGTAIDFGLKIVEVMIDKTIADDLAEKIVYKR 181
>gi|167575609|ref|ZP_02368483.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein [Borrelia valaisiana VS116] (182 aa)
Score = 157, Expect = 2.4e-09, Identities = 45/169 (26%), Positives = 78/169 (46%)
  Q:    21 DMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL-GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           D++ ++P DI  R  + ++ +S      +    G      + I     + F+ + +PGG  G   L    N + ++ I+K     GK       +   VLA  G+LG  K T  PG E+ +    + D N+V+  NF++ K    +FEFA  ++E +  +QI  N+    L
  S:    13 DIEAIVPIDILRRGNVNIQVISINDNNVVISSKGVSFLTDDVISNCKENYFDLIILPGGMPGATNLF---NSKELDLILKDMNARGKFIAAICASPVVVLAAKGLLGLNKFTCYPGLEKNVFDGEFVDKNVVISNNFITSKGVGTSFEFAFTLLEMVKGRQIMENVKKATL 180
>gi|195962357|ref|ZP_03098562.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein (thiJ) [Borrelia spielmanii A14S] (184 aa)
Score = 157, Expect = 2.4e-09, Identities = 48/169 (28%), Positives = 79/169 (46%)
  Q:    21 DMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEK-LGKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           D++ +IP DI  R  + V+ +S      +    G   +  + I     + F+ + +PGG  G   L    N + ++ I+K    +GK       +   VLA  G+LG  K T  PG E+  L   + D N+V   NF++ K    +FEFA  ++E +  +QI  N+    L
  S:    13 DIEAIIPIDILRRGNVNVQVISVNDSNVVTSSKGVSFSTDDVISNCKENCFDLIILPGGMPGATNLF---NSKELDLILKDMNAKGKFIAAICASPVVVLAAKGLLGLNKFTCYPGLEKNVLDGEFVDKNVVRSNNFITSKGVGTSFEFAFTLLEIVKGRQIMENVKKATL 180
>gi|156082790|ref|XP_001608879.1| 4-methyl-5(B-hydroxyethyl)-thiazol monophosphate biosynthesis enzyme, putative [Babesia bovis T2Bo] >gi|154796129|gb|EDO05311.1| 4-methyl-5(B-hydroxyethyl)-thiazol monophosphate biosynthesis enzyme, putative [Babesia bovis] (195 aa)
Score = 157, Expect = 2.5e-09, Identities = 49/161 (30%), Positives = 73/161 (45%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTA-PGFEEKLGKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQ 179
           S D++ V   D+  RAG+ V   S  K K + +  GTKIT    I+ V    F+ + +PGG        +    +  K++    D  + +     A + VLA  G+L  +    A PGFE+ L        + V    V+ K+P  A EFAL +VE L   Q
  S:    22 SEDIEFVTVVDVLRRAGVTVTVASVHKSKDVVMAHGTKITADAAIDDVAKKTFDLIVVPGGLPGSTHCAESTTLI--KMLNQHKDGNRYYAAICAAPAVVLAAGGILDKQTAAVAYPGFEDAL-PYVGKGRVCVSGKCVTSKAPGTAMEFALKLVELLCGVQ 180
>gi|77461116|ref|YP_350623.1| DJ-1 [Pseudomonas fluorescens PfO-1] >gi|77385119|gb|ABA76632.1| DJ-1 [Pseudomonas fluorescens PfO-1] (183 aa)
Score = 157, Expect = 2.7e-09, Identities = 48/170 (28%), Positives = 82/170 (48%)
  Q:    20 NDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGK-GCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL-GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           +D+  V   D+  RAGI V   S E ++ +    GT++T    +  V    F+ + +PGG  G Q L      + + +++K     G+ +   A A +  L   GVL  +++T  P     L G  + D  +VVD N ++ +    A  FAL +VE+L  K +   +A ++L
  S:    14 DDLQCVTLIDVLRRAGIEVVAASIEGRRMLTCARGTRLTADGMLIDVLAQTFDLIVLPGGAVGAQHLAA---HQPLQQLLKDQASAGRLFAAIAEAPAVALQSFGVLRQRRMTCLPVSSHNLSGCTFVDQPVVVDGNCITAQGSGAALAFALTLVEQLAGKAVRAKVAGELL 182
>gi|170759632|ref|YP_001788085.1| DJ-1 family protein [Clostridium botulinum A3 str. Loch Maree] >gi|169406621|gb|ACA55032.1| DJ-1 family protein [Clostridium botulinum A3 str. Loch Maree] (183 aa)
Score = 156, Expect = 3.1e-09, Identities = 50/161 (31%), Positives = 81/161 (50%)
  Q:    29 DIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKN-YSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           D+  RA I  +       K +       +   + +E++  +++N+L IPGG      L D N +VIN I +F  DE  K +    A   VL++  ++  K++T+ PGFEE L +  Y ++ +V D N ++ + P  A  FA  I+E  L K  A  I  D+L
  S:    22 DVLRRANIQCDMCGITSNKEVKGAHNILVNVDKTLEEIKTNEYNSLVIPGGMPGATNLRD-NNKVINLIKEFNRDE--KLIAAICAGPIVLSKANIIKGKEVTSYPGFEEDLKEGIYKEDLVVQDGNIITSRGPSAAMYFAFKILEN-LKKDSAKEIKEDML 179
>gi|15894907|ref|NP_348256.1| intracellular protease/amidase [Clostridium acetobutylicum ATCC 824] >gi|15024587|gb|AAK79596.1|AE007672_3 Putative intracellular protease/amidase, ThiJ family [Clostridium acetobutylicum ATCC 824] (188 aa)
Score = 156, Expect = 3.2e-09, Identities = 52/161 (32%), Positives = 87/161 (54%)
  Q:    29 DIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRN-ERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGK-NYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           DI  RA II +  S E K+ +      K+   + IE +++ +++ L +PGG  G + L   RN E VIN + KF  ++ KK +    AA  VL +  VL  +  T+ PG+ +++G  NY +   V D N ++ + P  A  F L +VE L  K++A  + + ++
  S:    21 DILRRADIICDMCSLEAKEVVGAHK-IKVCADKTIEDIDIAEYDGLVLPGGMPGAENL---RNSEFVINAVKKF--NKEKKIVAAICAAPIVLGKAEVLEGRDATSYPGYGDEMGNCNYLEKITVKDGNILTSRGPATAIYFGLRLVEILKGKEVANGLKDGMM 178
>gi|47229845|emb|CAG07041.1| unnamed protein product [Tetraodon nigroviridis] (189 aa)
Score = 156, Expect = 3.3e-09, Identities = 50/175 (28%), Positives = 86/175 (49%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEK-VNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTA-GAASTVLAELGVLGNKKITTAPGFEEKLGK----NYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNI 184
           R  ++ +  + +M+ VIP DI  RAGI V       K+ +     T I     +E       ++ + +PGG  G Q L        + +++K    +G+K L  A  A  T L   G+     +TT P  +EK+       YS+  +  D ++++ + P  +FEFAL IVE+L+  ++A  +
  S:     5 RALVILAKGAEEMETVIPVDIMRRAGIAVTVAGLTGKEPVQCSRNTVICPDASLEDDSKQGPYDVVLLPGGMPGAQNL---AESAAVKEVLK--DQDGRKGLIAAICAGPTALLAHGIGYGSTVTTHPAMKEKMMTGDHYKYSEARVQKDGHYITSRGPGTSFEFALTIVEELMGAEVAAQV 181
>gi|147905238|ref|NP_001086295.1| MGC84701 protein [Xenopus laevis] >gi|49522782|gb|AAH74440.1| MGC84701 protein [Xenopus laevis] (189 aa)
Score = 155, Expect = 4.0e-09, Identities = 55/180 (30%), Positives = 88/180 (48%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLD-KFNALYIPGGK-GCQRLLTDRNERVINKIVKFAGDEGKKWLFTA-GAASTVLAELGVLGNKKITTAPGFEEKLGK----NYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           R  ++ +  + + + VIP D+  RAGI V       K  +       +     +E+      ++ + +PGG  G Q L       V+ +++K    E KK L  A  A  T L   GV   K ITT P  ++K+       YS+  +V D+NF++ + P  +FEFAL IV  LL K++A  +   +L
  S:     5 RALVILAKGAEETETVIPADVMRRAGIKVTIAGLNGKDPVQCSRDVMLCPDTSLEEARTQGPYDVVVLPGGNLGAQNL---SESPVVKEVLK--EQEAKKGLIAAICAGPTALTVHGVGIGKSITTHPLAKDKIVNPDQYKYSEERVVKDENFITSRGPGTSFEFALEIVCTLLGKEVAEQVKTPLL 186
>gi|195959291|ref|ZP_03095500.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein (thiJ) [Borrelia sp. SV1] (184 aa)
Score = 155, Expect = 4.4e-09, Identities = 47/172 (27%), Positives = 78/172 (45%)
  Q:    21 DMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEK-LGKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILYTK 192
           D++ +IP DI  R  + ++ +S      +    G      + I     + F+ + +PGG  G   L    N + ++ I+K    +GK       +   VLA  G+LG  K T  P  E+  L   + D N+V   NF++ K    +FEFA  ++E +  KQI  ++    L  K
  S:    13 DIEAIIPIDILRRGNVNIQIISANDSNVVISSKGVSFLADDIISNCKENCFDLIILPGGMPGATNLF---NSKELDLILKDMNSKGKYIAAICASPVVVLAAKGLLGFNKFTCYPSLEKNVLDGEFVDENVVRSNNFITSKGVGTSFEFAFTLLEMVKGKQIMEDVKKATLLCK 183
>gi|153939756|ref|YP_001392047.1| DJ-1 family protein [Clostridium botulinum F str. Langeland] >gi|152935652|gb|ABS41150.1| DJ-1 family protein [Clostridium botulinum F str. Langeland] (183 aa)
Score = 155, Expect = 4.7e-09, Identities = 49/162 (30%), Positives = 81/162 (50%)
  Q:    29 DIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKN-YSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILY 190
           D+  RA I  +  S    K +       +   + +E++  + +N+L IPGG      L D N +VIN + +F  DE  K +    A   VL++  ++  K++T+ PGFEE L +  Y ++ +V D N ++ + P  A  FA  I+E    K  A  I  D+L+
  S:    22 DVLRRANIRCDMCSITSNKEVKGAHNILVNVDKTLEEIKTNDYNSLVIPGGMPGAANLRD-NNKVINLVKEFNRDE--KLIAAICAGPIVLSKANIIKGKEVTSYPGFEEDLKECIYKEDLVVQDGNIITSRGPSAAMYFAFKILEN-FKKDSAKEIKEDMLF 180
>gi|168526004|ref|ZP_02719643.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein (thiJ) [Borrelia burgdorferi 118a] >gi|168579661|ref|ZP_02723657.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein (thiJ) [Borrelia burgdorferi 72a] (184 aa)
Score = 154, Expect = 6.0e-09, Identities = 47/172 (27%), Positives = 78/172 (45%)
  Q:    21 DMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEK-LGKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILYTK 192
           D++ +IP DI  R  + ++ +S      +    G      + I     + F+ + +PGG  G   L    N + ++ I+K    +GK       +   VLA   +LG  K T  PG E+  L   + D N+V   NF++ K    +FEFA  ++E +  KQI  ++    L  K
  S:    13 DIEAIIPIDILRRGNVNIQIISTNDSNVVISSKGVSFLADDIISNCKENCFDLIILPGGMPGATNLF---NSKELDLILKDMNSKGKFIAAICASPVVVLAAKDLLGFNKFTCYPGLEKNVLDGEFVDENVVRSNNFITSKGVGTSFEFAFTLLEMVKGKQIMEDVKKATLLCK 183
>gi|193624960|ref|XP_001944360.1| PREDICTED: similar to DJ-1 [Acyrthosiphon pisum] (185 aa)
Score = 154, Expect = 6.5e-09, Identities = 49/172 (28%), Positives = 87/172 (50%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGK--NYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILY 190
           S ++++V P DI  RA + V        + +  +S   I    +++ V  +KF+A+ IPGG    ++L+  +  V+ +I+    ++  K +    AA  VL + G+   K +T+ P  +  +     Y +++ VVD N V+ + P  A EF L +VE LL  +    +A  ILY
  S:    14 SEELELVAPVDILRRANVTVTIADLADSEYVKTKSNLLIKTDAKLKDVKNNKFDAVVIPGGPS-HKVLSSAD--VVGQIL-LEHEKCGKVIAAICAAPFVLFKHGIAKGKSLTSYPTVKSDIEGFYQYKEDSTVVDGNLVTSRGPATAVEFGLALVEVLLGNEEKVKVAKGILY 183
>gi|148380727|ref|YP_001255268.1| DJ-1 family protein [Clostridium botulinum A str. ATCC 3502] >gi|153932262|ref|YP_001385011.1| DJ-1 family protein [Clostridium botulinum A str. ATCC 19397] >gi|153935560|ref|YP_001388481.1| DJ-1 family protein [Clostridium botulinum A str. Hall] >gi|148290211|emb|CAL84330.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Clostridium botulinum A str. ATCC 3502] >gi|152928306|gb|ABS33806.1| DJ-1 family protein [Clostridium botulinum A str. ATCC 19397] >gi|152931474|gb|ABS36973.1| DJ-1 family protein [Clostridium botulinum A str. Hall] (183 aa)
Score = 153, Expect = 7.8e-09, Identities = 49/161 (30%), Positives = 81/161 (50%)
  Q:    29 DIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKN-YSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           D+  RA I  +  S    K +       +   + +E++  + +++L IPGG      L D N +VIN + +F  DE  K +    A   VL++  ++  K++T+ PGFEE L +  Y ++ +V D N ++ + P  A  FA  I+E  L K  A  I  D+L
  S:    22 DVLRRANIRCDMCSITSNKEVKGAHNILVNVDKTLEEIKTNDYSSLVIPGGMPGAANLRD-NNKVINLVKEFNRDE--KLIAAICAGPIVLSKANIIKGKEVTSYPGFEEDLKEGIYKEDLVVQDGNIITSRGPSAAMYFAFKILEN-LKKDSAKGIKEDML 179
>gi|168180824|ref|ZP_02615488.1| DJ-1 family protein [Clostridium botulinum NCTC 2916] >gi|182668186|gb|EDT80165.1| DJ-1 family protein [Clostridium botulinum NCTC 2916] (183 aa)
Score = 153, Expect = 8.2e-09, Identities = 48/161 (29%), Positives = 81/161 (50%)
  Q:    29 DIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKN-YSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           D+  RA I  +  S    K +       +   + +E++  +++N+L IPGG      L D N +VI+ + +F  DE  K +    A   VL++  ++  K++T+ PGFEE L +  Y ++ +V D N ++ + P  A  FA  I+E    K  A  I  D+L
  S:    22 DVLRRANIQCDMCSITSNKEVTGAHNILVNVDKTLEEIKTNEYNSLVIPGGMPGATNLRD-NNKVIDLVKEFNRDE--KLIAAICAGPIVLSKANIIKGKEVTSYPGFEEDLKEGIYKEDLVVQDGNIITSRGPSAAMYFAFKILEN-FKKDSAKEIKEDML 179
>gi|82541449|ref|XP_724964.1| hypothetical protein PY04638 [Plasmodium yoelii yoelii str. 17XNL] >gi|23479798|gb|EAA16529.1| Drosophila melanogaster CG1349 gene product [Plasmodium yoelii yoelii] (189 aa)
Score = 152, Expect = 9.2e-09, Identities = 48/171 (28%), Positives = 82/171 (47%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           S D++ +   D+  RA I V T S  + + + LQS   +     I+KV  D F+ + IPGG      ++D   +V+ ++++      + +     A + VL    ++ + +    P FE    K+     + V KN V+   P  A EFAL IVE LL+++ A  +A+  L
  S:    15 SEDVEYITTVDVLRRANIDVTTASIHETEKVQLQSKNTVFADTIIDKVKNDIFDVIIIPGGMKGSNAISDC--QVVIEMLRDQKKNNRLYAAICAAPALVLHRHSLIDDVEAVAYPSFESDF-KHIGKGRVCVSKNCVTSLGPGTAVEFALKIVELLLDRESALRLASGFL 182
>gi|170755120|ref|YP_001782375.1| DJ-1 family protein [Clostridium botulinum B1 str. Okra] >gi|169120332|gb|ACA44168.1| DJ-1 family protein [Clostridium botulinum B1 str. Okra] (183 aa)
Score = 152, Expect = 1.0e-08, Identities = 48/162 (29%), Positives = 81/162 (50%)
  Q:    29 DIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKN-YSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILY 190
           D+  RA I  +  S    K +       +   + +E++  + +++L IPGG      L D N +VIN + +F  DE  K +    A   VL++  ++  K++T+ PGFEE L +  Y ++ +V D N ++ + P  A  FA  I+E    K  A  I  D+L+
  S:    22 DVLRRANIRCDMCSIASNKEVKGAHNILVNVDKTLEEIKTNDYSSLVIPGGMPGAANLRD-NNKVINLVKEFNRDE--KLIAAICAGPIVLSKANIIKGKEVTSYPGFEEDLKEGIYKEDLVVQDGNIITSRGPSAAMYFAFKILEN-FKKDSAKEIKEDMLF 180
>gi|150003061|ref|YP_001297805.1| ThiJ family intracellular protease [Bacteroides vulgatus ATCC 8482] >gi|149931485|gb|ABR38183.1| putative ThiJ family intracellular protease [Bacteroides vulgatus ATCC 8482] (183 aa)
Score = 152, Expect = 1.1e-08, Identities = 50/169 (29%), Positives = 81/169 (47%)
  Q:    21 DMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL-GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           +++ + P D+  RAG+ V+TVS     ++    G  +      E+V       + +PGG  G   L  D +E +   I+ FA  E  + L    AA  V  + G+L  KK+T  PGFE+ L G  Y+   +  D NF++ K P  A  F+  I EK +  +  T +   ++
  S:    14 EVEALTPVDVLRRAGLPVKTVSVTGVLTVNGAHGVPVVADMVFEEVKEGDAEMIVLPGGLPGATNL--DAHEGLGKLIMTFA--EAGRPLSAICAAPLVYGKRGLLKGKKVTCYPGFEKYLEGAEYTAALVEKDGNFITGKGPGAAMAFSFAIAEKYVGAEKVTELKQGMM 180
>gi|28211406|ref|NP_782350.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Clostridium tetani E88] >gi|28203847|gb|AAO36287.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Clostridium tetani E88] (188 aa)
Score = 151, Expect = 1.2e-08, Identities = 48/181 (26%), Positives = 90/181 (49%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL-GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILY 190
           +I +M +    +++ +   DI  R G+  +T S  ++K +       +     ++      F+ + +PGG      L D N+ VI  I +F  ++  K +    AA  VL E  ++ NK IT+ PGFEE+L G NY ++ +V   N ++ + P  A +F   I+E +++++    +   +LY
  S:     9 KIVVMLAKGFEEIEALTVVDILRRVGVDCKTCSITEEKMVKGAHNIYVKSDTLLKDFKEYGFSGIVLPGGMPGATNLRD-NKEVIGIIKEF--NDENKLIAAICAAPIVLKEADIVENKNITSYPGFEEELKGSNYKEDKVVQHGNIITSRGPSTAIDFTFKILENIIDEKELEELKKSMLY 187
>gi|187778657|ref|ZP_02995130.1| hypothetical protein CLOSPO_02252 [Clostridium sporogenes ATCC 15579] >gi|187772282|gb|EDU36084.1| hypothetical protein CLOSPO_02252 [Clostridium sporogenes ATCC 15579] (183 aa)
Score = 151, Expect = 1.2e-08, Identities = 49/161 (30%), Positives = 80/161 (49%)
  Q:    29 DIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKN-YSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           D+  RA I  +  S    K I       +   + +E++  +++NAL IPGG      L D N ++IN + +F  D  KK +    A   VL++  ++  K++T+ PGFEE L +  Y ++ +V D N ++ + P  A  FA  I+E    K     I  D+L
  S:    22 DVLRRANIQCDMCSITSNKEIKGAHNILVNVDKTLEEIKSNEYNALVIPGGMPGATNLRD-NNKLINLVKEFNRD--KKLIAAICAGPIVLSKANIIKGKEVTSYPGFEEDLKEGLYKEDLVVQDGNIITSRGPSAAMYFAFKILEN-FKKDSVKEIKEDML 179
>gi|149631877|ref|XP_001505364.1| PREDICTED: similar to DJ-1 [Ornithorhynchus anatinus] (189 aa)
Score = 151, Expect = 1.3e-08, Identities = 50/175 (28%), Positives = 83/175 (47%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLD-KFNALYIPGGK-GCQRLLTDRNERVINKIVKFAGDEGKKWLFTA-GAASTVLAELGVLGNKKITTAPGFEEKLGK----NYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNI 184
           R  ++ +  + +M+ VIP D+  RAGI V       K+ +       I     +E    +  ++ + +PGG  G Q L      + + K       E +K L  A  A  T L   G+    K+TT PG ++K+       YS+N +  D   ++ + P  +FEF L IVE L+ K++A  +
  S:     5 RALVILAKGAEEMETVIPTDVMRRAGIKVTVAGLTGKEPVQCSRDVLICPDASLEDAKKEGPYDVVVLPGGNLGAQNLSESSTVKAVLK-----DQENRKGLIAAICAGPTALLAHGIGFGSKVTTHPGAKDKMMNGDHYKYSENRVEKDGMILTSRGPGTSFEFGLAIVETLMGKEVADQV 181
>gi|195949256|ref|ZP_03090356.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein (thiJ) [Borrelia burgdorferi WI91-23] (184 aa)
Score = 151, Expect = 1.4e-08, Identities = 46/172 (26%), Positives = 78/172 (45%)
  Q:    21 DMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEK-LGKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILYTK 192
           D++ +IP DI  R  + ++ +S      +    G      + I     + F+ + +PGG  G   L    N + ++ I+K    +GK       +   VLA   +LG  K T  PG E+  +   + D N+V   NF++ K    +FEFA  ++E +  KQI  ++    L  K
  S:    13 DIEAIIPIDILRRGNVNIQIISTNDSNVVISSKGVSFLADDIISNCKENCFDLIILPGGMPGATNLF---NSKELDLILKDMNSKGKFIAAICASPVVVLAAKDLLGFNKFTCYPGLEKNVIDGEFVDENVVRSNNFITSKGVGTSFEFAFTLLEMVKGKQIMEDVKKATLLCK 183
>gi|125569532|gb|EAZ11047.1| hypothetical protein OsJ_000872 [Oryza sativa (japonica cultivar-group)] (354 aa)
Score = 149, Expect = 1.9e-08, Identities = 49/166 (29%), Positives = 83/166 (50%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGT-KITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL-GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNI 184
           S +M+ +   DI  RAG  V   S E K  +  +     +     +E+    +F+ + +PGG  G Q+L    + +V+  ++K   +  K +     + + VL   G+L  KK T+ P     L  ++  D+ +VVD N ++ K+P  A EFAL IVEKL  ++ A  +
  S:   186 SEEMEALNLIDILRRAGANVTVASVEDKLQVVTRRHKFNLIADIMVEEAAKREFDLIVMPGGLPGAQKL---SSTKVLVDLLKKQAESNKPYGAICASPAYVLEPHGLLKGKKATSFPPMAHLLTDQSACDSRVVVDGNLITSKAPGSATEFALAIVEKLFGREKAVPV 351
Score = 126, Expect = 1.0e-05, Identities = 31/97 (31%), Positives = 52/97 (53%)
  Q:    89 RNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNY--SDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIA 185
           R+ +V+ K+VK   ++G  +       +  LA  G+L   K T  P F EK        ++ +VVD+N V+ + P  A E+AL +VE+L  K+ +  +A
  S:    36 RDCKVLEKMVKKQAEQGGLYAAICATPAVTLAHWGLLKGLKATCYPSFMEKFTAEIIPVNSRVVVDRNAVTSQGPATAIEYALALVEQLYGKEKSEEVA 134
>gi|125524923|gb|EAY73037.1| hypothetical protein OsI_000884 [Oryza sativa (indica cultivar-group)] (427 aa)
Score = 149, Expect = 1.9e-08, Identities = 49/166 (29%), Positives = 83/166 (50%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGT-KITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL-GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNI 184
           S +M+ +   DI  RAG  V   S E K  +  +     +     +E+    +F+ + +PGG  G Q+L    + +V+  ++K   +  K +     + + VL   G+L  KK T+ P     L  ++  D+ +VVD N ++ K+P  A EFAL IVEKL  ++ A  +
  S:   259 SEEMEALNLIDILRRAGANVTVASVEDKLQVVTRRHKFNLIADIMVEEAAKREFDLIVMPGGLPGAQKL---SSTKVLVDLLKKQAESNKPYGAICASPAYVLEPHGLLKGKKATSFPPMAHLLTDQSACDSRVVVDGNLITSKAPGSATEFALAIVEKLFGREKAVPV 424
Score = 146, Expect = 5.4e-08, Identities = 44/157 (28%), Positives = 80/157 (50%)
  Q:    29 DIWTRAGIIVETVSNE---KKKSIFLQS--GTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNY--SDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIA 185
           D+  RAG  V   + +     + + +++  G K+     +  +  + F+ + +PGG  G   L   R+ +V+ K+VK   ++G  +       +  LA  G+L   K T  P F EK        ++ +VVD+N V+ + P  A E+AL +VE+L  K+ +  +A
  S:    46 DVLNRAGARVTVATADPAGDDRGLLVEAAFGVKLVADGRVADLEGEAFDLIALPGGMPGSANL---RDCKVLEKMVKKQAEQGGLYAAICATPAVTLAHWGLLKGLKATCYPSFMEKFTAEIIPVNSRVVVDRNAVTSQGPATAIEYALALVEQLYGKEKSEEVA 207
>gi|167761294|ref|ZP_02433421.1| hypothetical protein CLOSCI_03699 [Clostridium scindens ATCC 35704] >gi|167660960|gb|EDS05090.1| hypothetical protein CLOSCI_03699 [Clostridium scindens ATCC 35704] (187 aa)
Score = 149, Expect = 2.1e-08, Identities = 52/187 (27%), Positives = 93/187 (49%)
  Q:     6 VSNIRIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL-GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILYTK 192
           +S  +++++ +    +++ +   D+  RA I V+TVS  ++ ++    G  +   +  E+VN  + + + +PGG  G   L      R   ++VK   +EG K++    A  TVLA LG+L  K+IT  P  E+ + G   +   + VD N ++ +    A +FAL ++E L     A  I   I Y K
  S:     2 ISMKKVSVILADGFEEIEALTAVDLLRRAQIYVDTVSITEEYTVHGAHGINVQTEDLFEEVNFVESDMIVLPGGMPGTLNLDAHSGVR---RVVKDFFEEG-KYIGAICAGPTVLANLGLLKGKRITCHPTVEQDIQGAVITKVPVTVDNNVITGRGAGAAVDFALKLIEVLAGSDKAKEIGEMIAYEK 186
>gi|66267684|dbj|BAD98543.1| DJ-1 [Pseudemys nelsoni] (189 aa)
Score = 149, Expect = 2.4e-08, Identities = 51/175 (29%), Positives = 84/175 (48%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLD-KFNALYIPGGK-GCQRLLTDRNERVINKIVKFAGDEGKKWLFTA-GAASTVLAELGVLGNKKITTAPGFEEKLGK----NYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNI 184
           R  ++ +  + +M+ VIP D+  RAGI V       K  +       I     +E    +  ++ + +PGG  G Q L      + I         E +K L  A  A  T L   G+   +K+TT P  ++K+ K     YS++ +  D NF++ + P  +FEF L IVE L+ K++A  +
  S:     5 RALVILAKGAEEMETVIPTDVMRRAGIKVTIAGLTGKDPVQCSRDVFICPDASLEDARKEGPYDVVVLPGGNLGAQNLSESPAVKDI-----LVDQENRKGLIAAICAGPTALMAHGIGFGRKVTTHPLAKDKMMKGEHYKYSESRVEKDGNFLTSRGPGTSFEFGLAIVEILMGKEVADQV 181
>gi|157338341|emb|CAO39385.1| unnamed protein product [Vitis vinifera] (375 aa)
Score = 148, Expect = 2.6e-08, Identities = 49/192 (25%), Positives = 90/192 (46%)
  Q:     2 IKHKVSNIRIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLG-KNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILYTKK 193
           I  K  N +I +  +  + +M+ VI  D   RA   V   S E K  I      K+     +++     ++ + +PGG G  +     +E+++N ++K   +  K +     + + VL   G+L  KK T  P    KL  ++  +N ++VD N ++ + P  + EFAL I+EK      A  +A  +L++ +
  S:   185 IDWKCDNPQILVPIANGTEEMEAVIIIDFLRRAKANVVVASVEDKLEIVASRKVKLVADVLLDEAVKLSYDLIVLPGGLGGAQAFAS-SEKLVN-LLKNQRESNKPYGAICASPALVLEPHGLLKGKKATAFPALCSKLSDQSEIENRVLVDGNLITSRGPGTSMEFALAIIEKFFGHGKALELAKVMLFSSQ 375
Score = 131, Expect = 2.5e-06, Identities = 43/168 (25%), Positives = 76/168 (45%)
  Q:    22 MDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYS--DNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           M+ VI  D+  RAG  V   S EK+  +    G KI     I       F+ + +PGG      L  R+  ++  +VK    +G+ +     A +  L   G++   K T  P F E+L    +  ++ +  D   V+ + P    EF++ +VE+L  K+ A  ++  ++
  S:     1 MEAVIIIDVLRRAGADVTVASVEKRLQVDACHGVKIVADALISDCADTGFDLISLPGGMPGAATL--RDCGMLESMVKKHAADGQLYAGICAAPAVALGSWGLMKGLKATCYPSFMEQLSSTATTVESRVQQDGKVVTSRGPGTTMEFSVSLVEQLYGKEKANEVSGPLV 168
>gi|14520685|ref|NP_126160.1| intracellular protease [Pyrococcus abyssi GE5] >gi|13124456|sp|Q9V1F8|PFPI_PYRAB Intracellular protease 1 (Intracellular protease I) >gi|5457901|emb|CAB49391.1| pfpI intracellular protease. protease I [Pyrococcus abyssi GE5] (166 aa)
Score = 148, Expect = 3.0e-08, Identities = 45/153 (29%), Positives = 83/153 (54%)
  Q:     9 IRIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSDNNIVVDKNFVSFKSP 161
           +R+ I+ + +  D++++ PY      G  V  V++ K+  I  + G  +      E+VN D+F+AL +PGG+  +R+    NE+ + +I K    EGK  + +      +L   GVL  ++ T+ PG ++ +   G ++ D  +VVD N+VS + P
  S:     1 MRVLILSADQFEDVELIYPYHRLKEEGHEV-LVASFKRGVITGKHGYTVNVDLAFEEVNPDEFDALVLPGGRAPERVRL--NEKAV-EIAKKMFSEGKP-VASICHGPQILISAGVLRGRRGTSYPGIKDDMINAGVDWVDAEVVVDGNWVSSRVP 151
>gi|192811860|ref|ZP_03040529.1| intracellular protease, PfpI family [Geobacillus sp. Y412MC10] >gi|192799007|gb|EDV75518.1| intracellular protease, PfpI family [Geobacillus sp. Y412MC10] (168 aa)
Score = 147, Expect = 3.6e-08, Identities = 39/152 (25%), Positives = 81/152 (53%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSG-TKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKF--AGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSDNNIVVDKNFVSFKSP 161
           ++A + + +  D ++  PYD    AG   + +  ++ + +  + G    T  + I  VN++ ++A+ IPGG       +  N R+ + I++F  A D+  K + +      +LA   +L  + IT+ P  ++ +   G N+ D  +VVD+NF++ ++P
  S:     3 KVAFLLADQFEDSEMKTPYDAVKEAGHQADIIGLKQGQEVKGKQGKASYTTDKAIADVNINDYDAVVIPGGS------SPENLRLDSHILQFVAAADKAGKPIASICHGPQILASADLLKGRTITSYPPLQDDMVNAGANFKDEEVVVDRNFITSRTP 154
>gi|154151074|ref|YP_001404692.1| PfpI family intracellular peptidase [Candidatus Methanoregula boonei 6A8] >gi|153999626|gb|ABS56049.1| intracellular protease, PfpI family [Candidatus Methanoregula boonei 6A8] (168 aa)
Score = 147, Expect = 4.0e-08, Identities = 46/152 (30%), Positives = 72/152 (47%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGD--EGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSDNNIVVDKNFVSFKSP 161
           +IA++ +    D++   P D +  AG  +  V      ++  + GT +   +    V  D F+AL+IPGG    RL  D N       V+FA D  E KK +F    A+ +L    VL  +++T      + +   G  Y D  +VVD N VS + P
  S:     3 KIAVILTDMFQDVEYQRPVDAFRNAGHTIVHVGLVAGSTVKGEYGTPVLIEKAARDVTADDFDALFIPGGYSPDRLRADANA------VRFAADFFEKKKPVFAICHAAQLLITAQVLKGRRVTGWMSLVQDIRNAGAEYVDKEVVVDGNLVSSRKP 153
>gi|160936369|ref|ZP_02083738.1| hypothetical protein CLOBOL_01261 [Clostridium bolteae ATCC BAA-613] >gi|158440652|gb|EDP18390.1| hypothetical protein CLOBOL_01261 [Clostridium bolteae ATCC BAA-613] (191 aa)
Score = 147, Expect = 4.1e-08, Identities = 47/165 (28%), Positives = 77/165 (46%)
  Q:    29 DIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL-GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILYTKK 193
           D+  R+G+ V  VS    + +    G ++      E VN D  + L++PGG  G   L      R     V+ A  +G++ +    AA ++L  +G+L  +  T  PGFE++L G +Y+   +V D N  + +    A +  L ++  L   Q A  IA  I Y  K
  S:    29 DVLRRSGVEVTLVSVTGDRKVTGSHGIELGTDALFEDVNPDVADVLFLPGGMPGTNNLKAHMGLRA---AVECANKQGRR-IAAICAAPSILGSMGLLKGRTATCYPGFEDQLTGVSYTSQGVVTDGNITTGRGLGFALDMGLELIRLLQGPQQAQKIAAAIQYNWK 191
>gi|88813049|ref|ZP_01128291.1| putative protease [Nitrococcus mobilis Nb-231] >gi|88789682|gb|EAR20807.1| putative protease [Nitrococcus mobilis Nb-231] (188 aa)
Score = 146, Expect = 4.2e-08, Identities = 46/164 (28%), Positives = 84/164 (51%)
  Q:    21 DMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKG-CQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGF-EEKLGKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNI 184
           +++ V   D+  RA I V  V+   + ++    G  +     ++ V    F+ + +PGG G   RL  D     I+++++   D G+ ++    AA  VLA  G+L  +++T+ PGF ++  G NY    +VVD   V+ + P  A +FAL ++  LL ++ A  +
  S:    14 ELEAVTVIDLLRRASIDV-VVAGLAEGAVKASRGVVLVPDVTLDAVLEQSFDMIVLPGGAGGAARLEADTR---IHQLLRRQADTGR-YIAAICAAPKVLAAAGLLAGRRVTSFPGFLDQAEGVNYEMTAVVVDGRVVTSRGPGTALDFALNLIALLLGERAAREV 174
>gi|68069269|ref|XP_676545.1| 4-methyl-5(B-hydroxyethyl)-thiazol monophosphate biosynthesis enzyme [Plasmodium berghei strain ANKA] >gi|56496293|emb|CAH96778.1| 4-methyl-5(B-hydroxyethyl)-thiazol monophosphate biosynthesis enzyme, putative [Plasmodium berghei] (182 aa)
Score = 146, Expect = 4.7e-08, Identities = 48/171 (28%), Positives = 81/171 (47%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           S D++ +   DI  RA I V T S  + + + LQS   +     I+KV    F+ + IPGG      ++D   +V+ ++++      + +     A + VL    ++ + +    P FE    K+     + V KN V+   P  A EFAL IVE LL+++ A  +A+  L
  S:     8 SEDVEYITTVDILRRANIDVTTASIHETEKVQLQSKNTVFADTIIDKVKDYIFDVIIIPGGMKGSNAISDC--QVVIEMLRDQKKNNRLYAAICAAPAIVLHRHSLIDDVEAVAYPSFESDF-KHIGKGRVCVSKNCVTSLGPGTAVEFALKIVELLLDRESALRLASGFL 175
>gi|24653499|ref|NP_610916.1| DJ-1alpha CG6646-PA [Drosophila melanogaster] >gi|21627206|gb|AAF58316.2| CG6646-PA [Drosophila melanogaster] (217 aa)
Score = 146, Expect = 4.7e-08, Identities = 52/181 (28%), Positives = 89/181 (49%)
  Q:    13 IMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEI---------EKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTA-GAASTVLAELGVLGNKKITTAPGFEEKLGKNY---SDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILYTKK 193
           I+ +  + +M+  I  D+  R  I+V TV+        L     + CS  +         E V    ++ + +PGG    + L   N   +  +++    E K  L  A  AA T LA+ G+   K IT+ P  + +L + Y    D  +V D N ++ + P   F+FAL I E+L+  ++A  +A  +L+T K
  S:    35 IILAPGAEEMEFTISADVLRRGKILV-TVAG-------LHDCEPVKCSRSVVIVPDTSLEEAVTRGDYDVVVLPGGLAGNKALM--NSSAVGDVLRC--QESKGGLIAAICAAPTALAKHGIGKGKSITSHPDMKPQLKELYCYIDDKTVVQDGNIITSRGPGTTFDFALKITEQLVGAEVAKEVAKAMLWTYK 216
>gi|157164576|ref|YP_001467321.1| DJ-1 family protein [Campylobacter concisus 13826] >gi|112801887|gb|EAT99231.1| protein ThiJ [Campylobacter concisus 13826] (183 aa)
Score = 146, Expect = 4.7e-08, Identities = 51/181 (28%), Positives = 91/181 (50%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKN----YSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILY 190
           ++A++ +    +++ +   D+  RAG I  ++++ K   I       +     + +V    ++A+ +PGG  G + L  D   R I  + +F  D+  K +    AA  VL    VL +      PGFEE +  +     SD N++ D+N ++ K P  + EFAL IV+ LL ++    + ND+LY
  S:     3 KVAVILADGFEEIEALTSVDVLRRAGAIA-SIASLKDAQIRGAHNINVKADVTLREVEELGYDAIVLPGGLPGAENLANDAKLREI--LQEF--DKKGKLICAICAAPMVLERARVLKDS-FVCYPGFEENVRSDKRGYVSDKNVLKDQNIITGKGPAFSMEFALFIVKNLLGEEAYHKVKNDLLY 182
>gi|195381197|ref|XP_002049341.1| GJ21531 [Drosophila virilis] >gi|194144138|gb|EDW60534.1| GJ21531 [Drosophila virilis] (188 aa)
Score = 146, Expect = 4.9e-08, Identities = 44/177 (24%), Positives = 86/177 (48%)
  Q:    13 IMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDK-FNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNY---SDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           I+ +  + +M+  I  D+  RAG+ V        + +       I   + +E+   D+ ++ + +PGG G    + D   + + ++++ + +   + +    AA T LA+ G+   K +T+ P  + +L   Y    D N+V D N ++ + P  A+EFAL I E+L     A  +A  +L
  S:     7 IILAPGAEEMEFTIAADVLRRAGVNVTVAGLNGSEPVKCSRDVVIVPDKSLEEALADEPYDVVVLPGGLGGSNAMGD--SKAMGELLR-SQESAGRLIAAICAAPTALAKHGIATGKTLTSYPAMKPQLVDKYCYVDDANVVQDGNLITSRGPGTAYEFALKISEQLAGTAKAQEVAKGML 184
>gi|188159341|ref|ZP_02998717.1| ThiJ/PfpI family protein [Mycoplasma mycoides subsp. mycoides LC str. GM12] (183 aa)
Score = 146, Expect = 5.0e-08, Identities = 50/180 (27%), Positives = 91/180 (50%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKN--YSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           +IA+  +    +++ V   D+  RAGI+V+ VS      +       I  ++  +++N++ ++ + +PGG G   L    N+ +I+ I++F  ++  K + +  AA  V+ +  +L NK IT  P     L K     D   VVD NF++  S   +  F+L IVE LL K+    I  +++
  S:     3 KIALYLNPGFEEIEAVTACDVLKRAGILVDMVSTIDSLEVKGAHNIVIKANKLWKELNINYYDGMVLPGGSGVTSLFD--NQTLIDNILEF--NKQNKLIASICAAPQVIGQTKLLDNKTITHYPNCNFYLDKANVVLDKPFVVDNNFITGASAGSSMLFSLAIVEYLLGKEKKEEIYKNLV 180
>gi|195953431|ref|YP_002121721.1| DJ-1 family protein [Hydrogenobaculum sp. Y04AAS1] >gi|195933043|gb|ACG57743.1| DJ-1 family protein [Hydrogenobaculum sp. Y04AAS1] (183 aa)
Score = 145, Expect = 6.1e-08, Identities = 52/181 (28%), Positives = 95/181 (52%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKV-NLDKFNALYIPGGK-GCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKN-YSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILY 190
           ++A++ +    +++ + P DI  R G+ V  V   K K I      KI     I+++ ++D  + + IPGG  G + L   ++E V N I +   +  KK++    A   VL   GV+ NK IT+ P  + +  ++ Y + ++V D+N +S + P  A  F   ++EKL +K+ A  +A  +L+
  S:     3 KVAVLLAPGFEEVEAIAPIDILRRGGVEVLIVG-VKDKVIPSARNVKIEVDVTIDELKDVDNLDMIIIPGGMIGVENL--KKSEEVKNLINQM--NAKKKYVSAICAGPLVLKNAGVVENKHITSHPSVKLEFNEHLYKEESVVEDENIISSRGPATAMVFGFRLLEKLTSKEKAKEVAKAMLF 181
>gi|22329146|ref|NP_195128.2| DJ-1 family protein [Arabidopsis thaliana] >gi|18377684|gb|AAL66992.1| unknown protein [Arabidopsis thaliana] >gi|20465753|gb|AAM20345.1| unknown protein [Arabidopsis thaliana] (472 aa)
Score = 145, Expect = 6.7e-08, Identities = 46/171 (26%), Positives = 84/171 (49%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYS-DNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           + +++ V+  D+  RAG  V   S E+K  +   SGT++     I K     ++ + +PGG  G  RL   R+  ++ KI+K   ++ + +   + A +  L   G+L  K+ T  P F  KL   ++   NI +     + + P  +F+FAL + E+L  +  A +I   +L
  S:    94 TEEIEAVVLVDVLRRAGADVTVASVEQKLEVEGSSGTRLLADVLISKCADQVYDLVALPGGMPGAVRL---RDCEILEKIMKRQAEDKRLYGAISMAPAITLLPWGLLTRKRTTGHPAFFGKLPTFWAVKTNIQISGELTTSRGPGTSFQFALSLAEQLFGETTAKSIEEFLL 263
Score = 121, Expect = 3.4e-05, Identities = 45/181 (24%), Positives = 91/181 (50%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPG-FEEKLGKNYSDN-NIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILY 190
           R+ I  +  S  +++V   D+  RA + V   S E+   I    GTKI   + I +     ++ + +PGG  G +RL   +  +++ K+++   + G+ +  T  ++STVL + G+L  K+ T  P   +E + +   +   +V+D N ++        +F+L IV KL     A +++  +++
  S:   288 RVLIPVANGSEAVELVSIADVLRRAKVDVTVSSVERSLRITAFQGTKIITDKLIGEAAESSYDLIILPGGHTGSERL---QKSKILKKLLREQHESGRIYGAT-NSSSTVLHKHGLLKEKRTTVYPSESDEPMNQQMIEGAEVVIDGNVITSLGLATVTKFSLAIVSKLFGHARARSVSEGLVH 467
>gi|152990421|ref|YP_001356143.1| 4-methyl-5(beta-hydroxyethyl)-thiazole monophosphate synthesis protein [Nitratiruptor sp. SB155-2] >gi|151422282|dbj|BAF69786.1| 4-methyl-5(beta-hydroxyethyl)-thiazole monophosphate synthesis protein [Nitratiruptor sp. SB155-2] (185 aa)
Score = 145, Expect = 6.8e-08, Identities = 50/151 (33%), Positives = 77/151 (50%)
  Q:    29 DIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKN--YSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQ 179
           D+ +RAG  V        +     +G K+     ++ V +D ++ + +PGG  G + L   ++E V   I K   +E  K++    AA   L E GVL  KK T  PGFEEK G+    +D  +V+D N V+ + P  A  F L +V +LLN +
  S:    22 DVLSRAGNNVTVAGLFDNEVEGANTGLKVLVHTLLKDVEIDTYDLMVLPGGLPGAEHLA--KSELVQEMIRKM--NEKGKYVGAICAAPWALKEAGVLEGKKHTNYPGFEEKTGEEGYVADQKVVIDGNVVTSRGPGTAICFGLELV-RLLNGE 170
>gi|185132712|ref|NP_001116995.1| dj-1 protein [Salmo salar] >gi|18642506|dbj|BAB84671.1| DJ-1 [Salmo salar] (173 aa)
Score = 144, Expect = 7.4e-08, Identities = 47/163 (28%), Positives = 78/163 (47%)
  Q:    22 MDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLD-KFNALYIPGGK-GCQRLLTDRNERVINKIVKFAGDEGKKWLFTA-GAASTVLAELGVLGNKKITTAPGFEEKLGK----NYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNI 184
           M+ VIP D+  RAGI V       K  +       +     +E       ++ + +PGG  G Q L        + +++K    EG+K L  A  A  T L   G+     +TT PG ++K+       YS+  +  D + ++ + P  +FEFAL IVE+L+  ++A  +
  S:     1 METVIPVDVMRRAGIAVTLAGLTGKDPVQCSRDIYLVPDSSLEDARKQGPYDVILLPGGALGAQNL---SESPAVKEVLK--DQEGRKGLIAAICAGPTALLAHGIAYGSTVTTHPGAKDKMMTGGHYTYSEARVQKDCHLITSRGPGTSFEFALAIVEELMGAEVAATV 165
>gi|154341537|ref|XP_001566720.1| 4-methyl-5(beta-hydroxyethyl)-thiazole monophosphate synthesis protein, putative [Leishmania braziliensis MHOM/BR/75/M2904] >gi|134064045|emb|CAM40236.1| 4-methyl-5(beta-hydroxyethyl)-thiazole monophosphate synthesis protein, putative [Leishmania braziliensis] (180 aa)
Score = 144, Expect = 8.1e-08, Identities = 52/161 (32%), Positives = 84/161 (52%)
  Q:    29 DIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAAS--TVLAELGVL-GNKKITTAPGFEEKLGK--NYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           D+ +R  + V   S  + K I L  GT + C   + +V+   ++A+ +PGG      L+  N   + KI++     GKK L+ A  AS   VLA +G+L G + +T  PGFEE+L    +YS + +V   N ++ + P  A  F L  V  L +  +A  +A  +L
  S:     3 DVLSRGAMKVTLASVMESKCITLAHGTNVKCDVLVGEVSASDYDAVLLPGGMPGAVHLS--NSVALKKILQ-EMRMGKK-LYGAICASPAVVLAPMGLLEGVESVTCYPGFEERLPSSVSYSTSAVVKSGNCLTSRGPGTAIYFGLAAVSVLKSPDLAEQLAKAML 164
>gi|34540440|ref|NP_904919.1| ThiJ/PfpI family protein [Porphyromonas gingivalis W83] >gi|34396753|gb|AAQ65818.1| ThiJ/PfpI family protein [Porphyromonas gingivalis W83] (181 aa)
Score = 144, Expect = 8.4e-08, Identities = 49/162 (30%), Positives = 75/162 (46%)
  Q:    29 DIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-------KGCQ---RLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL-GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILY 190
           DI  R G++ E VS     S++++    IT   +    +L   +AL +PGG         C+   RLL++                 +K +    AA  V   LG +  +K T  PGFE KL G +Y+      D + ++ K P   F FA+ +V  L   Q+A  IA   L+
  S:    23 DILRRGGVVAEFVS--ITDSLYVEGANGITVKADRLMTDLPTVDALVLPGGLPGADNLNSCEPLRRLLSEHYA-------------AQKLVAAICAAPLVFGGLGFVCGRKATCYPGFESKLEGADYTGEAATRDGHVITGKGPACVFAFAIEVVRYLCGDQVADEIATGTLF 180
>gi|188994539|ref|YP_001928791.1| conserved hypothetical protein [Porphyromonas gingivalis ATCC 33277] >gi|188594219|dbj|BAG33194.1| conserved hypothetical protein [Porphyromonas gingivalis ATCC 33277] (181 aa)
Score = 144, Expect = 8.6e-08, Identities = 49/162 (30%), Positives = 75/162 (46%)
  Q:    29 DIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-------KGCQ---RLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL-GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILY 190
           DI  R G++ E VS     S++++    IT   +    +L   +AL +PGG         C+   RLL++                 +K +    AA  V   LG +  +K T  PGFE KL G +Y+      D + ++ K P   F FA+ +V  L   Q+A  IA   L+
  S:    23 DILRRGGVVAEFVS--ITDSLYVEGANGITVKADRLMTDLPAVDALVLPGGLPGADNLNSCEPLRRLLSEHYA-------------AQKLVAAICAAPLVFGGLGFVCGRKATCYPGFESKLEGADYTGEAATRDGHVITGKGPACVFAFAIEVVRYLCGDQVADEIATGTLF 180
>gi|194883232|ref|XP_001975707.1| GG22458 [Drosophila erecta] >gi|190658894|gb|EDV56107.1| GG22458 [Drosophila erecta] (217 aa)
Score = 144, Expect = 8.9e-08, Identities = 53/193 (27%), Positives = 96/193 (49%)
  Q:     1 MIKHKVSNIRIA----IMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEI---------EKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNY---SDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILYTKK 193
           M++ K S  + A    I+ +  + +M+  I  D+  R  I V TV+        LQ    + CS  +         + V+   ++ L +PGG    + L   +   + ++++    +G   +    AA T LA+ G+   K IT+ P  + +L   Y    D  +V D N ++ + P   F+FAL I E+L+  ++A  +A  +L+T K
  S:    19 MVRCKSSQDKCARNALIILAPGAEEMEFTISADVLRRGKIHV-TVAG-------LQDCEPVKCSRSVVIVPDTSLEQAVSRGDYDVLVLPGGLAGNKALM--SSSAVGEVLRCQDSKGG-LIAAICAAPTALAKHGIGRGKSITSHPDMKPQLKDLYCYIDDKTVVQDGNLITSRGPGTTFDFALKITEQLVGAEVAKEVAKAMLWTYK 216
>gi|153854555|ref|ZP_01995825.1| hypothetical protein DORLON_01820 [Dorea longicatena DSM 13814] >gi|149752864|gb|EDM62795.1| hypothetical protein DORLON_01820 [Dorea longicatena DSM 13814] (181 aa)
Score = 143, Expect = 1.2e-07, Identities = 44/162 (27%), Positives = 84/162 (51%)
  Q:    29 DIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKN-YSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILY 190
           D+  RA I V+TVS      +    G  +   +  ++V+ ++F+ + +PGG      L + +   +  +VK    EG+ ++    AA T+L  LG+L  ++ T  PG E+++     ++  +VVD N ++ +    A +FAL ++E L  ++ A  IA  I++
  S:    22 DLLRRAKIYVDTVSIMDDYIVHGAHGINVQTEDLFDEVDFEEFDMVVLPGGMPGTLNLKEHDG--VRYVVKQYAKEGR-FVGAICAAPTILKSLGLLEGRRATCYPGVEDEMENVILTETAVVVDDNIITSQGVGTAIDFALKLIEVLDGEEKAKEIAESIVF 181
>gi|17531319|ref|NP_493696.1| DJ-1 (mammalian transcriptional regulator) Related family member (djr-1.1) [Caenorhabditis elegans] >gi|1707138|gb|AAB37889.1| Dj-1 (mammalian transcriptional regulator) related protein 1.1 [Caenorhabditis elegans] (187 aa)
Score = 142, Expect = 1.2e-07, Identities = 50/179 (27%), Positives = 87/179 (48%)
  Q:    11 IAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           + I+ +  + +M+++I  D+  R  I V     +  + +    G  I    ++E V  +KF+ + +PGG+     L    E ++ + V  +  E    +    AA   L   GV   + +T+ P  +EKL   G  YS++ +VV    ++ + P  AFEFAL IVE L  K  AT++   +L
  S:     7 LIILAAEGAEEMEVIITGDVLARGEIRVVYAGLDGAEPVKCARGAHIVPDVKLEDVETEKFDIVILPGGQPGSNTLA---ESLLVRDVLKSQVESGGLIGAICAAPIALLSHGVKA-ELVTSHPSVKEKLEKGGYKYSEDRVVVSGKIITSRGPGTAFEFALKIVELLEGKDKATSLIAPML 184
>gi|160915371|ref|ZP_02077583.1| hypothetical protein EUBDOL_01379 [Eubacterium dolichum DSM 3991] >gi|158432762|gb|EDP11051.1| hypothetical protein EUBDOL_01379 [Eubacterium dolichum DSM 3991] (177 aa)
Score = 142, Expect = 1.3e-07, Identities = 44/158 (27%), Positives = 76/158 (48%)
  Q:    33 RAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILY 190
           RAGI V+  +++  K +  +    +   +++++V+   ++AL++PGG   Q L +D     I +I+  +     K +    AA T+L   G L NK  T      E  G  Y D   V+D N ++ +S     +FA  ++EKLL K+    +   I Y
  S:    25 RAGIDVDVCTSDANK-VSGRFNLTLQPVKDLKEVDPTSYDALFLPGGPHYQTLESDA---YIMEILS-SYIHSNKVVAAICAAPTILGRAGYLKNKNYTCFTSMNEDFGGTYVDRYAVIDGNIITGRSAAAVIDFAFALIEKLLGKESCDKVKASIYY 177
>gi|154506032|ref|ZP_02042770.1| hypothetical protein RUMGNA_03574 [Ruminococcus gnavus ATCC 29149] >gi|153793531|gb|EDN75951.1| hypothetical protein RUMGNA_03574 [Ruminococcus gnavus ATCC 29149] (205 aa)
Score = 142, Expect = 1.3e-07, Identities = 47/162 (29%), Positives = 77/162 (47%)
  Q:    29 DIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYSDNNIV-VDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILY 190
           D+  RAG+ V  VS   +K++    G  +      E++  +  + L +PGG  G + L   R+   + K  +F   E  ++L    AA TV  ELG L  +K    PG E  L    ++   V VD + ++ +    A  FAL ++E L  K+ A  I + ++Y
  S:    45 DLLRRAGVTVTNVSVTGEKTVHGSHGIGVEADALFEEMEFEGMDMLVLPGGMPGTKHLKEHRDLCALLK--EFYAKE--RYLAAICAAPTVFGELGFLEGRKACCYPGMESGLSHAETNEEPVNVDGHMITSRGLGTAIPFALKLIELLCGKEKAEEIGHGVVY 204
>gi|194757776|ref|XP_001961138.1| GF11154 [Drosophila ananassae] >gi|190622436|gb|EDV37960.1| GF11154 [Drosophila ananassae] (173 aa)
Score = 142, Expect = 1.4e-07, Identities = 45/172 (26%), Positives = 86/172 (50%)
  Q:    22 MDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEK-VNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYS--DNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILYTKK 193
           M+  I  D+  RA I V     +  + I       I     +E+ +    ++ + +PGG    + L +  +  + ++++    +G   +    AA T LA+ G+   K +T+ P  + +L + Y   + ++V D N ++ + P  +F+FAL IVE+LL  ++A N+A  +L T K
  S:     1 MEFTISADVLRRAKINVTIAGLDTCEPIKCSRDVVIVPDTSLEQAMGQGNYDVVVLPGGLAGNKALMESCD--VGELLRQQESQGG-LIAAICAAPTALAKHGIGKGKALTSHPDMKRQLEEKYCYIEQSVVQDGNLITSRGPGTSFDFALKIVEQLLGAEVAKNVAKPMLVTFK 172
>gi|153863963|ref|ZP_01996998.1| protease [Beggiatoa sp. SS] >gi|152146534|gb|EDN72994.1| protease [Beggiatoa sp. SS] (188 aa)
Score = 142, Expect = 1.4e-07, Identities = 46/164 (28%), Positives = 86/164 (52%)
  Q:    21 DMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAG--AASTVLAELGVLGNKKITTAPGFEEKLG---KNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNI 184
           +++ V   D+  RAGI V T   +K+  +    G  +     +++     F+ + +PGG  G   L    N+  I++++K    +GK   +TA   AA  VLA  G+L NKK T+ PG  +K+    +++ D  ++ D   ++ + P  A +F L ++E L+ ++I   +
  S:    18 ELEAVTIIDLLRRAGITVVTAGLDKE-PVQASRGVMLIPDTTLDEAIKQSFDMIVLPGGLPGADHL---DNDPRIHQLLKDMYQQGK---YTAAICAAPKVLANAGLLANKKATSYPGVLDKMSVPHQHFVDAPVIKDGQVITGRGPGTAMDFTLELIETLVGREIRDQV 180
>gi|195334198|ref|XP_002033771.1| GM20244 [Drosophila sechellia] >gi|195359241|ref|XP_002045322.1| GM23255 [Drosophila sechellia] >gi|194125741|gb|EDW47784.1| GM20244 [Drosophila sechellia] >gi|194127116|gb|EDW49159.1| GM23255 [Drosophila sechellia] (217 aa)
Score = 142, Expect = 1.5e-07, Identities = 52/181 (28%), Positives = 89/181 (49%)
  Q:    13 IMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEI---------EKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTA-GAASTVLAELGVLGNKKITTAPGFEEKLGKNY---SDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILYTKK 193
           I+ +  + +M+  I  D+  R  I V TV+        L     + CS  +         E V    ++ + +PGG    + L   N   + ++++    E K  L  A  AA T LA+ G+   K IT+ P  + +L + Y    D  +V D N ++ + P   F+FAL I E+L+  ++A  +A  +L+T K
  S:    35 IILAPGAEEMEFTISADVLRRGKIHV-TVAG-------LHGCEPVKCSRSVLIVPDTSLEEAVTRGDYDVVVLPGGLAGNKALM--NSSAVGEVLRC--QESKGGLIAAICAAPTALAKHGIGKGKSITSHPDMKPQLKELYCYIDDKTVVQDGNIITSRGPGTTFDFALKITEQLVGAEVAKEVAKAMLWTYK 216
>gi|189200318|ref|XP_001936496.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] >gi|187983595|gb|EDU49083.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] (197 aa)
Score = 142, Expect = 1.5e-07, Identities = 54/181 (29%), Positives = 88/181 (48%)
  Q:    13 IMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEE---IEKVNL----DKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKK-------ITTAPGFEEKL---GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILYTKK 193
           I+ +  S +++ V PYD+ TRAG  V +     K   +      +    +   +  V L    + F+ L +PGG    +     ++ V+  I KF   +  KW+    AA+T L    V   KK       +T+ P   E++   G  YS++ IVVD   V+ + P  A  FAL IVE +  K+    I   ++  +K
  S:     6 ILVADGSEEIEFVTPYDVLTRAGFDVTSAGVSLKNEAYAHMSRNVRIVPDHPNLSSVPLQTAHEDFDVLILPGGAPGAKAFCG-SDAVLELISKF--QKAGKWVAAICAATTAL----VASTKKFEGAKTTVTSHPSVAEEIKQAGWEYSEDRIVVDDKIVTSRGPGTAILFALTIVEAICGKEKRDEIGGPMMLAEK 196
>gi|157738460|ref|YP_001491144.1| 4-methyl-5(beta-hydroxyethyl)-thiazole monophosphate synthesis protein ThiJ [Arcobacter butzleri RM4018] >gi|157700314|gb|ABV68474.1| 4-methyl-5(beta-hydroxyethyl)-thiazole monophosphate synthesis protein ThiJ [Arcobacter butzleri RM4018] (179 aa)
Score = 142, Expect = 1.5e-07, Identities = 57/161 (35%), Positives = 80/161 (49%)
  Q:    29 DIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLG-KNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           DI  RA I V   S E  K I   +  KI    +IE V  D F+ + +PGG      L  D N + + K  K      +K +    AA   L +  VL NK  T  P FEEK+    YS  ++VVD+N ++ + P  A +FAL IV+ L +K+   N+ N +L
  S:    22 DICRRANIEVIIASVENIKIIGAHN-IKIEADCKIEHVKADDFDMIVLPGGLPNAFTLAEDINVQNLLKEFKVK----RKKIAAICAAPYALHKADVL-NKNFTCYPSFEEKIRLDGYSKEDVVVDENVITSRGPATAMKFALEIVKTLTSKETYENVKNGLL 178
>gi|42560993|ref|NP_975444.1| ThiJ/PfpI family protein [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|42492490|emb|CAE77086.1| ThiJ/PfpI family protein [Mycoplasma mycoides subsp. mycoides SC str. PG1] (183 aa)
Score = 141, Expect = 1.7e-07, Identities = 50/180 (27%), Positives = 90/180 (50%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKN--YSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           +IA+  +    +++ V   D+  RAGI+V+ VS      +       I  ++  + +N++ ++ + +PGG G   L    N+ +I+ I++F  ++  K + +  AA  V+ +  +L NK IT  P     L K     D   VVD NF++  S   +  F+L IVE LL K+    I  +++
  S:     3 KIALYLNPGFEEIEAVTVCDVLKRAGILVDMVSTIDSLEVKGAHNIVIKANKLWKDLNINYYDGMVLPGGSGVTSLFD--NQTLIDNILEF--NKQNKLIASICAAPQVIGQTKLLDNKTITHYPNCNFYLDKANVVLDKPFVVDNNFITGVSAGSSMLFSLAIVEYLLGKEKKEEIYKNLV 180
>gi|194246632|ref|YP_002004271.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Candidatus Phytoplasma mali] >gi|193806989|emb|CAP18424.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Candidatus Phytoplasma mali] (170 aa)
Score = 141, Expect = 2.0e-07, Identities = 42/155 (27%), Positives = 78/155 (50%)
  Q:    21 DMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAG--DEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYSDN-NIVVDKNFVSFKSPFHAFEFALLIVEKL 175
           D + ++   I  +    + TV+N K  ++F  +   +     +E +N D +N L IPGG   + ++ ++N+  + KI+      ++  K +    AA   L +LG+L   K +  PG E  +   Y  N + VV  N ++ +SP   F+FA  +++KL
  S:    13 DCEALVTRAILKKNDFDITTVTNNKNLNVFSATRLNLKADCYLENINYDDYNFLIIPGGPYVKSVI-NKNDYALTKILDIINYFNKNNKIIGAICAAPIFLGKLGLLKKHKFSCYPGCEILIEGEYCPNISTVVSDNLITSRSPETVFDFAFTLIKKL 169
>gi|162447986|ref|YP_001621118.1| glutamine amidotransferase superfamily, DJ-1/PfpI family protein [Acholeplasma laidlawii PG-8A] >gi|161986093|gb|ABX81742.1| glutamine amidotransferase superfamily, DJ-1/PfpI family protein [Acholeplasma laidlawii PG-8A] (181 aa)
Score = 140, Expect = 2.2e-07, Identities = 43/158 (27%), Positives = 84/158 (53%)
  Q:    33 RAGIIVETVSNEKKKSIFLQSGTKITCSEE--IEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEE--KLGKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILY 190
           RAG+ +++V+  K+  +++++G  IT   +  +  + L  +  L IPGG    +++ D  + + + I  F  ++  K ++   AA   L  LG+L N   T  PG EE  KLG   +   +VV    ++ +S     EF   I++K  ++ ++ ++ N+I+Y
  S:    25 RAGMHIDSVT--KEPDLYVKTGFGITVKADYHLHDIKLSNYQFLIIPGGGYVAKVI-DHADYIYDLIKAFKRED--KDIYAICAAPRFLGRLGLLDNLDFTAFPGSEEDAKLGHYLASKKVVVTPRIITARSAGAVIEFVYQIIKKNQDEALSKSLINNIMY 181
>gi|146329634|ref|YP_001209317.1| hypothetical protein DNO_0400 [Dichelobacter nodosus VCS1703A] >gi|146233104|gb|ABQ14082.1| conserved hypothetical protein [Dichelobacter nodosus VCS1703A] (178 aa)
Score = 140, Expect = 2.2e-07, Identities = 51/169 (30%), Positives = 81/169 (47%)
  Q:    21 DMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL-GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           +++ +   DI  RA I V TVS ++  ++    G  +T    +  ++ D      IPGG        + +    N++++ A + GK  +    AA  VL  LG+L  KK T  P FE  L G     + +VVD N ++ + P  AF+FAL +VE L  K     +A  +L
  S:    14 EIEALATVDILRRAAINVATVSLQEDLTVTGAHGIAVTADCLLADID-DGAELFVIPGGTTA----FNGHAAFKNQLMQHA-NRGKT-IAAICAAPMVLGNLGLLRGKKATCYPSFECYLDGAQVQTSAVVVDGNIITARGPACAFDFALQLVEHLAGKATRQKVAASML 176
>gi|50080322|gb|AAT69656.1| 'unknown protein, similar to DJ-1/PfpI family, PF01965' [Oryza sativa (japonica cultivar-group)] >gi|53793697|gb|AAU93578.1| unknown protein [Oryza sativa (japonica cultivar-group)] (454 aa)
Score = 140, Expect = 2.2e-07, Identities = 48/180 (26%), Positives = 83/180 (46%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYS-DNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           ++ +  ++ + +M+ VI   +  RAG  V   S E    +    G+ I   + I       F+ + +PGG  G  RL   R+  ++ +I     +E + +     A + VL   G+   KKIT  P F E L    + ++N+ V     + + P  AF+FAL  VE+L     A ++ N +L
  S:    68 KVLLPIAMGTEEMEAVILAGVLRRAGADVTLASVEDGLEVEASRGSHIVADKRIAACADQVFDLVALPGGMPGSVRL---RDSVILQRITVRQAEEKRLYGAICAAPAVVLMPWGLHKRKKITCHPSFIEDLPTFRTVESNVQVSGELTTSRGPGTAFQFALSFVEQLFGPCKAEDMDNTLL 246
Score = 134, Expect = 1.2e-06, Identities = 44/172 (25%), Positives = 84/172 (48%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAAST--VLAELGVLGNKKITTAPGFEEKLGKNYSD-NNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILY 190
           S +M+I++  D+  RA + V   S EK  SI      +I   + I   +  +++ + +PGG  G +RL       V+ K++K     G+ +    G  S+  +L + G+L +K +T  P    +L     D + +V+D N ++        +F+L I++K      A  +AN +++
  S:   280 SEEMEIIMLTDVLRRANVNVVLASVEKSTSIVGSQRMRIVADKCISDASALEYDLIILPGGPAGAERL---HKSSVLKKLLKEQKQTGRMY---GGICSSPVILQKQGLLQDKTVTAHPSIVNQLTCEVIDRSKVVIDGNLITGMGLGTVIDFSLAIIKKFFGHGRAKGVANGMVF 449
>gi|52784646|ref|YP_090475.1| hypothetical protein BLi00848 [Bacillus licheniformis ATCC 14580] >gi|52347148|gb|AAU39782.1| putative protein [Bacillus licheniformis DSM 13] (257 aa)
Score = 140, Expect = 2.3e-07, Identities = 47/169 (27%), Positives = 90/169 (53%)
  Q:    21 DMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEI--EKVNLDKFNALYIPGGK-GCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL-GKNYSDN-NIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           +++ +   D+  RA +   TVS +  +S+  + G  I    ++  +  +  + + L +PGG  G +++L     + ++K++  A + GK ++    AA+  L + G++  KK T  PG EE L G + + + N+VVD N ++ + P     FAL + E L  K+ A  +A  +L
  S:    88 EIEAIATIDVLRRAEVETVTVSLDPSRSV--KGGHDIVVEADVMFDDADWQEADMLILPGGNVGSKKML---EHQALHKMLTEAANAGK-YVAAICAATMTLGKTGLVSGKKATCYPGVEEHLTGADVTAHENVVVDGNIITSRGPATTIPFALKLAELLNGKEKAGAVAKGML 255
>gi|169350564|ref|ZP_02867502.1| hypothetical protein CLOSPI_01332 [Clostridium spiroforme DSM 1552] >gi|169292884|gb|EDS75017.1| hypothetical protein CLOSPI_01332 [Clostridium spiroforme DSM 1552] (190 aa)
Score = 140, Expect = 2.5e-07, Identities = 47/147 (31%), Positives = 75/147 (51%)
  Q:    29 DIWTRAGIIVETVSNEK---KKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKN-YSDNNIVVDKNFVSFKSPFHAFEFALLIVEKL 175
           D+ TRA +    V  +K   + S  ++      C E     N++ ++AL IPGG  G   L  D+  RVI+ + KF  +   K +    A   VL + GV+ +KK+T  PGFE++L    Y D  +  D N ++ + P  +  F+  I+E L
  S:    28 DVMTRANVTCTMVGMDKLEVESSHHIKVVMDCLCDE-----NIETYDALVIPGGLPGATNLRDDK--RVIDLVQKF--NNANKIVAAICAGPIVLEKAGVIKDKKVTCFPGFEKELNSAIYQDTLVYQDGNIITGRGPAASLAFSYCILEAL 170
>gi|118474065|ref|YP_892402.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Campylobacter fetus subsp. fetus 82-40] >gi|118413291|gb|ABK81711.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Campylobacter fetus subsp. fetus 82-40] (179 aa)
Score = 140, Expect = 2.5e-07, Identities = 49/182 (26%), Positives = 87/182 (47%)
  Q:     9 IRIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKN--YSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILY 190
           +++A+M      +++     D+  RAGI    V      +I   +   +      + +N D F+ + +PGG      L  ++E++   +  F  DE  K++    AA   L+   VLG+   T  PGFE+ + K    SD N+V+D N ++ K P  A EFAL +V+ L   +    + + +L+
  S:     1 MKVAVMLVDGFEEIEATTIIDVLRRAGIDAVFVGLNSDTAIGAHN-ISMKADTAFDDINFDNFDMIVLPGGLPGAEYLA-KSEKLQKVLKDF--DEKDKFIGAICAAPWALSTSNVLGDS-YTCYPGFEKVVAKGGYVSDKNVVIDGNIITSKGPATAMEFALELVKVLQGNEKYIEVKDGLLF 179
>gi|23321215|gb|AAN23110.1| thiJ-like protein [Brassica rapa subsp. pekinensis] (127 aa)
Score = 139, Expect = 2.8e-07, Identities = 39/127 (30%), Positives = 69/127 (54%)
  Q:    63 IEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLG-KNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           +++V    F+ + +PGG G QR  +   E+++N + K A +  K +     +   V    G+L +KK TT P    +L  +++ D+ +VVD N ++ ++P  A EF+L IVEK   ++ A  +A   L
  S:     2 LDEVAEKSFDLIVLPGGNGAQRFAS--CEKLVNMLNKQA-EANKPYGGICKSPVYVFEHNGLLKDKKATTHPRVSNELSDQSHIDHRVVVDGNVITSRAPGTAMEFSLAIVEKFYGREKALQLAKATL 126
>gi|66267682|dbj|BAD98542.1| DJ-1 [Alligator mississippiensis] (189 aa)
Score = 139, Expect = 2.8e-07, Identities = 49/184 (26%), Positives = 89/184 (48%)
  Q:     6 VSNIRIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLD-KFNALYIPGGK-GCQRLLTDRNERVINKIVKFAGDEGKKWLFTA-GAASTVLAELGVLGNKKITTAPGFEEKLGK----NYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           +S  R  ++ +  + +M+ VIP D+  RAGI V       K+ +       +     +E    +  ++ + +PGG  G Q L        +  I+K    E +K L  A  A  T L   G+    K+TT P  ++K+       YS+N +  D N ++ + P  +FEF L I+E L+ K+++  + + ++
  S:     1 MSAKRALVILAKGAEEMETVIPTDLMRRAGIKVTVAGLTGKEPVQCSRDVFVCPDTSLEDARKEGPYDVVVLPGGNLGAQNL---SESSAVKDILK--DQEMRKGLIAAICAGPTALLAHGIGFGSKVTTHPLAKDKMMNGEHYKYSENRVEKDGNILTSRGPGTSFEFGLAIIETLMGKEVSDQVKSPLI 186
>gi|66267686|dbj|BAD98544.1| DJ-1 [Crocodylus niloticus] (189 aa)
Score = 139, Expect = 2.8e-07, Identities = 48/180 (26%), Positives = 87/180 (48%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLD-KFNALYIPGGK-GCQRLLTDRNERVINKIVKFAGDEGKKWLFTA-GAASTVLAELGVLGNKKITTAPGFEEKLGK----NYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           R  ++ +  + +M+ VIP D+  RAGI V       K+ +       +     +E    +  ++ + +PGG  G Q L        +  I+K    E +K L  A  A  T L   G+    K+TT P  ++K+       YS+N +  D N ++ + P  +FEF L I+E L+ K+++  + + ++
  S:     5 RALVILAKGAEEMETVIPTDLMRRAGIKVTVAGLTGKEPVQCSRDVFVCPDTSLEDARKEGPYDVVVLPGGNLGAQNL---SESSAVKDILK--DQEMRKGLIAAICAGPTALLAHGIGFGSKVTTHPLAKDKMMNGEHYKYSENRVEKDGNILTSRGPGTSFEFGLAIIETLMGKEVSDQVKSPLI 186
>gi|56756959|gb|AAW26651.1| SJCHGC05973 protein [Schistosoma japonicum] (184 aa)
Score = 139, Expect = 2.9e-07, Identities = 48/179 (26%), Positives = 87/179 (48%)
  Q:    13 IMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL-GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILYT 191
           ++ S  + +M+ V   DI  RAG+ V     +    I    G  I  +  +  V+   F+ + +PGG G    + +   +++ +I++     GK ++    AA   L    +   KK+T+ PGFE++L    Y ++ +VVD   V+ + P  A  FA+ +VE L +K  A  +A  +L +
  S:     7 VILSEGAEEMEAVTVADILARAGVNVTMGGLQGDAIIKGSHGVLIKPNVALSSVSSKLFDMVVMPGGMGGSNAMAE--SKLVGQILREHEKHGK-YIAAICAAPIALESHKIAVGKKLTSYPGFEDRLRSYTYCEDIVVVDDKLVTSRGPGTAIAFAMKLVELLCSKSKAQTLAKGMLVS 183
>gi|153813466|ref|ZP_01966134.1| hypothetical protein RUMOBE_03886 [Ruminococcus obeum ATCC 29174] >gi|149830410|gb|EDM85502.1| hypothetical protein RUMOBE_03886 [Ruminococcus obeum ATCC 29174] (185 aa)
Score = 139, Expect = 3.0e-07, Identities = 48/173 (27%), Positives = 84/173 (48%)
  Q:    21 DMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL-GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILYTKK 193
           D++ +   D+  RA I ++TVS ++ K I    G  +       + +    + L +PGG    + L +  + + + +  F    GK  +    AA TV A LG L  +K T  P   + L G   S  ++VVD N  + +    A +FAL ++ +LL ++ A  IA  ++Y++K
  S:    15 DIEGLTVVDLMRRADIDIKTVSIKESKEITTSHGISMLTDLVFVETDFSDADMLVLPGGMPGTKYLNEY-QSLRDLLADFYRKGGK--VAAICAAPTVFASLGFLEGRKATAYPSCMDGLAGAERSLESVVVDGNVTTSRGLGTAVDFALSLIGQLLGEKKADEIAESVVYSRK 185
>gi|81865403|sp|Q7TQ35|PARK7_MESAU Protein DJ-1 (Parkinson disease protein 7 homolog) (Contraception-associated protein 1) >gi|32452351|emb|CAD24072.2| CAP1 protein [Mesocricetus auratus] (189 aa)
Score = 139, Expect = 3.1e-07, Identities = 54/175 (30%), Positives = 87/175 (49%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLD-KFNALYIPGGK-GCQRLLTDRNERVINKIVKFAGDEGKKWLFTA---GAASTVLAELGVLGNKKITTAPGFEEKL--GKNYSDNNIVVDKN--FVSFKSPFHAFEFALLIVEKLLNKQIATNI 184
           R  ++ +  + +M+ VIP DI  RAGI V       K  +       I     +E       ++ + +PGG  G Q L       V+ +I+K    E +K L  A   G  + +  E+G     K+TT PG ++K+  G +YS +   V+K+   ++ + P  +FEFAL IVE L  K+ A  +
  S:     5 RALVILAKGAEEMETVIPVDIMRRAGIKVTVAGLAGKDPVQCSRDVMICPDTSLEDAKKQGPYDVVVLPGGNLGAQNL---SESPVVKEILK--EQESRKGLIAAICAGPTALLAHEIGF--GSKVTTHPGAKDKMMNGSHYSYSESRVEKDGLILTSRGPGTSFEFALAIVEALSGKEAADQV 181
>gi|186460344|ref|ZP_02970644.1| intracellular protease, PfpI family [bacterium Ellin514] >gi|184203106|gb|EDU00165.1| intracellular protease, PfpI family [bacterium Ellin514] (236 aa)
Score = 139, Expect = 3.4e-07, Identities = 45/167 (26%), Positives = 82/167 (49%)
  Q:     1 MIKHKVSNIRIAIMCSIESNDMDIVIPYDIWTRAGIIVETVS---NEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSDNNIVVDKNFVSFKSPFHAFEF 167
           M   K++ IR+A++ +     +++  P     + G  +E +S    + K    L  G  I  +  I + N D ++AL IPGG      L  +++ V+  + +F  D   K +        VL   GV+ N+ +T+ PG ++ +   G N+ +N  V D N++S +SP    +F
  S:     1 MAGKKLNGIRVAVLAADGVEQIELTSPVKHLEKHGAQIEVISLHPGKIKGMNLLLPGKNIKVNRTIFRANPDNYDALLIPGGHINPDFLR-QSDSVLQFVREF--DAANKPIAVICHGPWVLVSAGVVKNRTLTSWPGIKDDVINAGGNWVNNAAVRDGNWISSRSPLDLIQF 170
>gi|110005004|emb|CAK99335.1| conserved hypothetical peptidase protein [Spiroplasma citri] (183 aa)
Score = 139, Expect = 3.4e-07, Identities = 44/181 (24%), Positives = 87/181 (48%)
  Q:     9 IRIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGK-GCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYSDNNI--VVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           ++ A+  +    + + +I   +  R GI +E +S  K   +       I   + IE V  + ++   +PGG+ G   L   +NE + + ++K   +  +K +    AA  +L  LG+L NK+ T+ PG  E + K   +N I  + D + ++  S      FAL I +++L  +    + N+++
  S:     1 MKFALFLATGFEEGEAIITTGVLRRGGIKLELISITKALEVVSSHDVTIKADKLIEDVKYEDYDGFILPGGRIGVDNLA--KNEMLKDWLLK--ANNAQKTIAAVCAAPQILGHLGILDNKEATSYPGCTEGMDKAIYNNEIAAITDGHIITGASVGSTMNFALAIADRVLGAEKVMKLQNELV 180
>gi|45383015|ref|NP_989916.1| Parkinson disease 7 [Gallus gallus] >gi|82106351|sp|Q8UW59|PARK7_CHICK Protein DJ-1 (Parkinson disease protein 7 homolog) >gi|17974316|dbj|BAB79527.1| DJ-1 [Gallus gallus] (189 aa)
Score = 139, Expect = 3.4e-07, Identities = 49/175 (28%), Positives = 83/175 (47%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLD-KFNALYIPGGK-GCQRLLTDRNERVINKIVKFAGDEGKKWLFTA-GAASTVLAELGVLGNKKITTAPGFEEKLGKN----YSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNI 184
           R  ++ +  + +M+ VIP D+  RAGI V       K+ +       I     +E    +  ++ + +PGG  G Q L        +  I+K    E +K L  A  A  T L   G+    K+ T P  ++K+       YS++ +  D N ++ + P  +FEF L IVE L+ K++A  +
  S:     5 RALVILAKGAEEMETVIPTDVMRRAGIKVTVAGLTGKEPVQCSRDVLICPDASLEDARKEGPYDVIVLPGGNLGAQNL---SESAAVKDILK--DQESRKGLIAAICAGPTALLAHGIGFGSKVITHPLAKDKMMNGAHYCYSESRVEKDGNILTSRGPGTSFEFGLAIVEALMGKEVAEQV 181
>gi|24214952|ref|NP_712433.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Leptospira interrogans serovar Lai str. 56601] >gi|45657551|ref|YP_001637.1| hypothetical protein LIC11685 [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] >gi|24195989|gb|AAN49451.1|AE011396_3 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Leptospira interrogans serovar Lai str. 56601] >gi|45600790|gb|AAS70274.1| conserved hypothetical protein [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] (181 aa)
Score = 138, Expect = 3.8e-07, Identities = 44/155 (28%), Positives = 81/155 (52%)
  Q:    21 DMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNK-KITTAPGFEEKLGKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKL 175
           +M+ VI  D+  RAGI V + S  K+  +    G +I     ++++N + F+ + +PGG G  ++L+   E  +++++K A  E  KW+    AA ++L    +L +K + T  PG        Y+ + + +    ++   P  AFEFAL +V+ L
  S:    14 EMEAVIIVDVLRRAGIEVLSAS-LKEGPVKASRGIRILADTTLDEINFEDFDMIVLPGGGGGTKVLS--AEPKVSELLKNA-KEKNKWIAAICAAPSILVHQNILTSKDRFTAFPGIISN-NSGYTGSRLEISGKIITSIGPGSAFEFALELVKIL 164
>gi|163802379|ref|ZP_02196273.1| murein transglycosylase A [Vibrio campbellii AND4] >gi|159173908|gb|EDP58722.1| murein transglycosylase A [Vibrio campbellii AND4] (199 aa)
Score = 138, Expect = 3.9e-07, Identities = 45/182 (24%), Positives = 90/182 (49%)
  Q:     8 NIRIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNL--DKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKN-YSDNNIVVD--KNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           N +I +  +  + +++ V   D+  RAG  V   S +   ++ +++   +T + +   V++  D+F+A+ +PGG G    L  R+  V+ +++K    EGK       A + VL    +     +T  P F+  + +N +    + +D   N ++ + P  A EFA+ I+ KL  KQ    +A  ++
  S:     2 NKKILVPIATGTEELEAVTVIDLMVRAGYDVTVASADFDGALTMKASRGVTLTADCRLVDIADDEFDAIVLPGGVGGAETL--RDSTVMIEMLKQHTYEGKLVAAICAAPALVLQHHNLFPQALMTCHPSFQSHIPENKWRAKRVTIDVNHNLITSQGPGSALEFAMEIIIKLSGKQHGWAVAEPLV 186
>gi|160947210|ref|ZP_02094377.1| hypothetical protein PEPMIC_01143 [Peptostreptococcus micros ATCC 33270] >gi|158446344|gb|EDP23339.1| hypothetical protein PEPMIC_01143 [Peptostreptococcus micros ATCC 33270] (196 aa)
Score = 138, Expect = 4.0e-07, Identities = 45/150 (30%), Positives = 72/150 (48%)
  Q:    29 DIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFE-EKLGKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNK 178
           D   RA I V+ +S   K  +    G  +   + IE +NL ++  + IPGG      + + ++RV+  I KF  DE  K +    A  +VLA+ GVL  +     PG E E L  N  ++ I +D N ++ +    A E A  ++ K+  K
  S:    22 DYLRRADIKVDMISITGKLQVTSNRGITVLADDLIENINLKEYAGIIIPGGLPAAFDIRE-DKRVLEIIKKF--DEEHKLISAICAGPSVLAKAGVLSGRNAVIYPGMEDELLDANVKEDAICIDDNIITARGAGLAGELAYTLIRKIKGK 169
>gi|37523322|ref|NP_926699.1| 4-methyl-5(beta-hydroxyethyl)-thiazole monophosphate synthesis protein [Gloeobacter violaceus PCC 7421] >gi|35214326|dbj|BAC91694.1| 4-methyl-5(beta-hydroxyethyl)-thiazole monophosphate synthesis protein [Gloeobacter violaceus PCC 7421] (182 aa)
Score = 138, Expect = 4.0e-07, Identities = 44/152 (28%), Positives = 76/152 (50%)
  Q:    21 DMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLG-KNYSDNNIVVDKNFVSFKSPFHAFEFALLIV 172
           +++ V   D+  RA I V TV+     ++    G  +     ++++N   F+A+ +PGG G  RL  D  ERV   +++    E  +W     AA TVL++ G+L   + T+ P    +L    Y + ++VVD   V+ +    A +FAL +V
  S:    14 EIEAVTIIDVLRRADIEV-TVAALADLAVQGSHGITLVADTRLDEINPLTFDAVVLPGGPGVARLRAD--ERVRKLLLEMRAAE--RWTAAICAAPTVLSDAGLLAGARATSYPSVRPELTVGEYLETSVVVDGRIVTSRGVGTALDFALKLV 161
>gi|167756491|ref|ZP_02428618.1| hypothetical protein CLORAM_02024 [Clostridium ramosum DSM 1402] >gi|167703899|gb|EDS18478.1| hypothetical protein CLORAM_02024 [Clostridium ramosum DSM 1402] (183 aa)
Score = 138, Expect = 4.2e-07, Identities = 39/108 (36%), Positives = 57/108 (52%)
  Q:    68 LDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL-GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKL 175
           LD ++A+ IPGG      L D + RVI+ + +F  D   K +    A   VL E  V+  K +T  PGFEE+L G NY +  +  D+N ++ K P  A  F   ++E L
  S:    58 LDNYDAVVIPGGMPGASNLRD-DSRVIDLVKQFNHD--GKIIGAICAGPIVLQEADVIKGKTVTCYPGFEEQLIGSNYQETLVQRDENIITGKGPAAALAFGYTLLEAL 163
>gi|147775474|emb|CAN62882.1| hypothetical protein [Vitis vinifera] (427 aa)
Score = 138, Expect = 4.4e-07, Identities = 47/182 (25%), Positives = 85/182 (46%)
  Q:     4 HKVSNIRIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLG-KNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIA 185
           ++VS   I +  +  + +M+ VI  D   RA   V   S E K  I      K+     +++     ++ + +PGG G  +     +E+++N ++K   +  K +     + + VL   G+L  KK T  P    KL  ++  +N ++VD N ++ + P  + EFAL I+EK      A  +A
  S:   215 NEVSGPLILVPIANGTEEMEAVIIIDFLRRAKANVVVASVEDKLEIVASRKVKLVADVLLDEAVKLSYDLIVLPGGLGGAQAFAS-SEKLVN-LLKNQRESNKPYGAICASPALVLEPHGLLKGKKATAFPALCSKLSDQSEIENRVLVDGNLITSRGPGTSMEFALAIIEKFFGHGKALELA 395
Score = 132, Expect = 1.8e-06, Identities = 44/171 (25%), Positives = 75/171 (43%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYS--DNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           S  M+ VI  D+  RAG  V   S EK+  +    G KI     I       F+ + +PGG      L D     +  +VK    +G+ +     A +  L   G++   K T  P F E+L    +  ++ +  D   V+ + P    EF++ +VE+L  K+ A  ++  ++
  S:    52 SEPMEAVIIIDVLRRAGADVTVASVEKQLQVDACHGVKIVADALISDCADTGFDLISLPGGMPGAATLRDCG--XLESMVKKHAADGQLYAGICAAPAVALGSWGLMKGLKATCYPSFMEQLSSTATTVESRVQQDGKVVTSRGPGTTMEFSVSLVEQLYAKEKANEVSGPLI 222
>gi|168334168|ref|ZP_02692375.1| putative thiamine biosynthesis related protein [Epulopiscium sp. 'N.t. morphotype B'] (177 aa)
Score = 138, Expect = 4.5e-07, Identities = 39/148 (26%), Positives = 71/148 (47%)
  Q:    32 TRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQ 179
           T  G+   TVS+ +K  + + +         +E VN D F+ + +PGG G +  L    E++ N I  F G+   K++    AA  +L   G+L ++ +T  P  E   G +     +VVD N ++   P  + EF   ++ K+ +++
  S:    31 TMIGLTDSTVSSAQKIQVIMDA--------TVESVNFDDFDMIVMPGGAGAENYLP--CEKLKNAIAAFLGNN-NKFVGAICAAPNILGRWGLLNHRSVTVYPTIEVA-GADIRRQKVVVDGNLITGAGPGASMEFGYALLSKMADEE 166
>gi|160878529|ref|YP_001557497.1| DJ-1 family protein [Clostridium phytofermentans ISDg] >gi|160427195|gb|ABX40758.1| DJ-1 family protein [Clostridium phytofermentans ISDg] (181 aa)
Score = 138, Expect = 4.5e-07, Identities = 45/162 (27%), Positives = 86/162 (53%)
  Q:    29 DIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL-GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILY 190
           D+  RAG+ V TVS  +   +    G  +  ++ + K +L + + L +PGG    R L D +E + + ++ +  ++  ++L    AA ++L   G+L  K+    PGFE+KL G   +++ +VVD   ++ K    + EF+L +++ L  ++ +  I N I Y
  S:    22 DLLRRAGVDVTTVSITENNLVHGAHGIDVM-ADILFKDDLSEADMLVLPGGGLGTRNLLD-HEGLKDLLIDY--EKKGRYLAAICAAPSILGTHGLLKGKRAICYPGFEDKLTGAVVTNDKVVVDGKIITSKGAGTSIEFSLELIKILCGEEASNQILNGIQY 180
>gi|171854671|dbj|BAG16525.1| putative 4-methyl-5(b-hydroxyethyl)-thiazol monophosphate biosynthesis enzyme [Capsicum chinense] (392 aa)
Score = 138, Expect = 4.6e-07, Identities = 46/164 (28%), Positives = 77/164 (46%)
  Q:    22 MDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKN--YSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIA 185
           ++ + P DI  RAG  V   S E +  I +  G K+     I      +F+ + +PGG  G   L    N +++  IVK   + GK +     A +  L   G+L   K T  P F E+L  +    ++ +  D   V+ + P  + EFA+ +VE+L  K+ A  ++
  S:    20 IEAIAPIDILRRAGAEVTVASIENQLQIEVMYGIKMVADALISDCTNTEFDLIALPGGLPGAANL---GNCKILESIVKKQAENGKFYAAICAAPAVALGSWGLLKGLKATCYPSFMEELSSHAIAIESRVQKDAKVVTSRGPGTSIEFAVALVEELYGKEKANEVS 183
Score = 132, Expect = 2.3e-06, Identities = 42/172 (24%), Positives = 80/172 (46%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGK-NYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILY 190
           S +M+  I  D+  RA   V   S E    I      K+     +++     ++ + +PGG G       ++ ++I+ ++K   +  K +     + + VL   G+L +KK T  P    KL   + ++N +VVD N V+ + P    EFAL I +K + ++    +A  +++
  S:   222 SEEMEATIIIDVLRRANAQVVVASLEDTLEIVASRKVKLVADVLLDEAAKQSYDLIVLPGGLGGAEAFA-KSAKLID-MLKKQRESSKPYGAMCASPALVLEHHGLLKDKKATAFPALCNKLSDPSEAENRVVVDGNLVTSRGPGTTMEFALAIADKFIGRKETLELAKALVF 392
>gi|70946017|ref|XP_742766.1| 4-methyl-5(B-hydroxyethyl)-thiazol monophosphate biosynthesis enzyme [Plasmodium chabaudi chabaudi] >gi|56521930|emb|CAH74975.1| 4-methyl-5(B-hydroxyethyl)-thiazol monophosphate biosynthesis enzyme, putative [Plasmodium chabaudi] (184 aa)
Score = 137, Expect = 4.9e-07, Identities = 48/171 (28%), Positives = 77/171 (45%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           S D++ +   DI  RA I V T S    + + LQS   +     I+KV  + F+ + IPGG      ++D    V  ++++      + +     A +TVL    ++ + +    P FE    K+     + V KN V+   P  A EFA  IVE LL +  A  +A+  L
  S:    10 SEDVEYITTVDILRRANIEVTTASIHDTEKVQLQSKNIVFADTIIDKVKNNIFDVIIIPGGMKGSNAISDCP--VAIEMLREQKKNNRLYAAICAAPATVLHRHSLIDDVEAVAYPSFESDF-KHIGKGRVCVSKNCVTSLGPGTAGEFAFKIVELLLGRDAALRLASGFL 177
>gi|159117119|ref|XP_001708780.1| 4-methyl-5-thiazole monophosphate biosynthesis enzyme [Giardia lamblia ATCC 50803] >gi|157436893|gb|EDO81106.1| 4-methyl-5-thiazole monophosphate biosynthesis enzyme [Giardia lamblia ATCC 50803] (186 aa)
Score = 137, Expect = 5.3e-07, Identities = 44/178 (24%), Positives = 83/178 (46%)
  Q:    12 AIMCSIESND-MDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           A++C +E  + ++ V   D+  R G+ V     EK +      G  +     + ++    ++A+ +PGG G + + T+    VI  + +     GK  +    A S  LA  G+L +K+ T  P  ++ L   G  + D  +VVD  F++ + P  A  FA+  +E L+  +    +   +L
  S:     4 ALVCVVEGFEPIECVTVVDVLRRGGVSVTLAGTEKVQK--GAHGVTVHTDALVSEIGNTLYDAIVLPGGPGWKEMQTNG---VIKALTENHSRHGKWVMAICAAPSASLASWGLLKDKRATCYPAMKDGLVANGAQFVDEPVVVDGKFLTSQGPATALLFAVKALELLVTPEKHAEVTKGML 180
>gi|157754002|ref|XP_001680713.1| Hypothetical protein CBG07016 [Caenorhabditis briggsae AF16] >gi|187033693|emb|CAP27328.1| C. briggsae CBR-DJR-1.1 protein [Caenorhabditis briggsae] (187 aa)
Score = 137, Expect = 5.8e-07, Identities = 45/179 (25%), Positives = 86/179 (48%)
  Q:    11 IAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           + IM    + +M+++I  D+  R GI V+       + +      +I  S   +     +++ + +PGG+     L +  +  +  ++K   D GK W+    AA   L   G+   + +T+ P  +++L   G  YS++ +VV    ++ + P  AFEFAL IVE L   + A ++   +L
  S:     7 LIIMSPKGAEEMEVIITGDVLERGGIHVDYAGLTGAEPVECARKARIVPSIAFDDAQNKEYDIVILPGGQPGSNTLAETPK--VGDLLKKQADAGK-WIGAICAAPIALLSHGI-KTEVLTSHPSVKDQLVKGGYTYSEDRVVVSGKVITSRGPGTAFEFALKIVELLEGTEKANSLIEPML 184
>gi|71415766|ref|XP_809938.1| hypothetical protein Tc00.1047053509047.40 [Trypanosoma cruzi strain CL Brener] >gi|70874396|gb|EAN88087.1| hypothetical protein, conserved [Trypanosoma cruzi] (198 aa)
Score = 136, Expect = 6.2e-07, Identities = 46/171 (26%), Positives = 86/171 (50%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVL-GNKKITTAPGFEEKLGK--NYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           + ++++    DI  RA I V   S  + +++ L  G KIT    ++  +   ++ +++PGG  G   L  + +   + KI++    +GK +     +  + LA +G+L G K +T  P  +EK+    ++S + +V     ++ K P  A  F L IV  LL K  A  +A ++L
  S:    13 TEEIELTCITDILRRAEIQVTVASVMESQNLILSRGLKITTDSLLKDESAAAYDGVFLPGGLPGADHLGKNAH---LKKILEEMRSQGKWYGAICASPVSALAPMGMLEGVKTVTCYPAMKEKIPSHVHWSTDPVVRCGKCLTSKGPGTAIAFGLAIVAALLTKDCALRLAKELL 184
>gi|29349330|ref|NP_812833.1| ThiJ family intracellular protease/amidase [Bacteroides thetaiotaomicron VPI-5482] >gi|29341238|gb|AAO79027.1| putative ThiJ family intracellular protease/amidase [Bacteroides thetaiotaomicron VPI-5482] (183 aa)
Score = 136, Expect = 6.3e-07, Identities = 52/150 (34%), Positives = 75/150 (50%)
  Q:    29 DIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNA--LYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL-GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNK 178
           D   RAG+ VE VS    + +       + C  +I   N D F+A  L +PGG      L D++E +   ++ FA  +GK  +    AA  VL +LG+L  +K T  P FE+ L G       +V D N ++   P  A EFAL IV+ L+ K
  S:    22 DTLRRAGLNVEIVSVTPDEIVMGAHDVSLLC--DINFDNCDFFDADLLLLPGGMPGAATL-DKHEGLRKLLLDFAA-KGKP-IAAICAAPMVLGKLGLLKGRKATCYPSFEQYLEGAECVSEPVVRDGNIITGMGPGAAMEFALAIVDLLVGK 169
>gi|15669157|ref|NP_247962.1| intracellular protease (pfpI) [Methanocaldococcus jannaschii DSM 2661] >gi|3024948|sp|Q58377|Y967_METJA Uncharacterized protein MJ0967 >gi|1499805|gb|AAB98972.1| intracellular protease (pfpI) [Methanocaldococcus jannaschii DSM 2661] (205 aa)
Score = 136, Expect = 6.3e-07, Identities = 49/155 (31%), Positives = 79/155 (50%)
  Q:    21 DMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFE-----EKLGKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKL 175
           D ++  P  ++   G+ V+ VS  K + + +  G KIT  + I  VN D + A+ I GG G +  L + N ++I  + +F      K +     +  VLA  G+L  KK T  P  E     +K G  Y D  +VVD N ++ KSP +A  F L +++ +
  S:    45 DEELFEPMAVFESNGLKVDVVSTTKGECVGML-GNKITVEKTIYDVNPDDYVAIVIVGGIGSKEYLWN-NTKLIELVKEFYNK--NKVVSAICLSPVVLARAGILKGKKATVYPAPEAIEELKKAGAIYEDRGVVVDGNVITAKSPDYARLFGLEVLKAI 200
>gi|163119299|ref|YP_078071.2| putative intracellular protease [Bacillus licheniformis ATCC 14580] >gi|145902805|gb|AAU22433.2| putative intracellular protease [Bacillus licheniformis ATCC 14580] (183 aa)
Score = 136, Expect = 6.7e-07, Identities = 47/169 (27%), Positives = 90/169 (53%)
  Q:    21 DMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEI--EKVNLDKFNALYIPGGK-GCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL-GKNYSDN-NIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           +++ +   D+  RA +   TVS +  +S+  + G  I    ++  +  +  + + L +PGG  G +++L     + ++K++  A + GK ++    AA+  L + G++  KK T  PG EE L G + + + N+VVD N ++ + P     FAL + E L  K+ A  +A  +L
  S:    14 EIEAIATIDVLRRAEVETVTVSLDPSRSV--KGGHDIVVEADVMFDDADWQEADMLILPGGNVGSKKML---EHQALHKMLTEAANAGK-YVAAICAATMTLGKTGLVSGKKATCYPGVEEHLTGADVTAHENVVVDGNIITSRGPATTIPFALKLAELLNGKEKAGAVAKGML 181
>gi|195583177|ref|XP_002081400.1| GD25730 [Drosophila simulans] >gi|194193409|gb|EDX06985.1| GD25730 [Drosophila simulans] (218 aa)
Score = 136, Expect = 7.2e-07, Identities = 52/181 (28%), Positives = 88/181 (48%)
  Q:    13 IMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEI---------EKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTA-GAASTVLAELGVLGNKKITTAPGFEEKLGKNY---SDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILYTKK 193
           I+ +  + +M+  I  D+  R  I V TV+        L     + CS  +         E V    ++ + +PGG    + L   N   +  +++    E K  L  A  AA T LA+ G+   K IT+ P  + +L + Y    D  +V D N ++ + P   F+FAL I E+L+  ++A  +A  +L+T K
  S:    36 IILAPGAEEMEFTISADVLRRGKINV-TVAG-------LYGCEPVKCSRSVVIVPDTSLEEAVTRGDYDVVVLPGGLAGNKALM--NSSAVGDVLRC--QESKGGLIAAICAAPTALAKHGIGKGKSITSHPDMKPQLKELYCYIDDKTVVQDGNIITSRGPGTTFDFALKITEQLVGVEVAKEVAKAMLWTYK 217
>gi|91085251|ref|XP_973301.1| PREDICTED: similar to DJ-1 [Tribolium castaneum] (186 aa)
Score = 136, Expect = 7.4e-07, Identities = 49/173 (28%), Positives = 79/173 (45%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAG--AASTVLAELGVLGNKKITTAPGFEEKLGK----NYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILYT 191
           + +M+ VI  D+  R G+ V          I    G  I     I +     F+A+ +PGG G  + L    E  + ++++     G+    T    AA T L   GV   K +T+ P  E ++ +     Y    +VVD   V+ + P  AF FAL +V+KL+ K  A  +A  +L +
  S:    13 AEEMEAVIAIDVLRRGGVEVTVAGLPDANIIKCSRGVNIKPDISICEAK-GPFDAIVLPGGLGGAKALAASKE--VGELIREQEAAGR---LTGAICAAPTALKAHGVYVGKTVTSYPAMEAQMLEGGQYKYKKEPVVVDGTLVTSQGPGTAFVFALTLVDKLVGKDKAAEVAKAMLLS 185
>gi|170033746|ref|XP_001844737.1| dj-1 protein [Culex quinquefasciatus] >gi|167874814|gb|EDS38197.1| dj-1 protein [Culex quinquefasciatus] (138 aa)
Score = 136, Expect = 7.7e-07, Identities = 37/122 (30%), Positives = 68/122 (55%)
  Q:    69 DKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYS---DNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILY 190
           + F+A+ +PGG G  + +++ ++  + +++K     GK  +    AA TVL    +   K +T+ P F+++L   Y    D  +VVD N V+ + P  AF+FAL + E L+  +    +A+ +LY
  S:    15 EDFDAIALPGGLGGSKAMSESSK--LGEVLKSFESNGK-LIAAICAAPTVLLTHSIALGKSLTSYPSFKDQLSGKYKYIDDKTVVVDGNLVTSRGPATAFDFALKLGEILVGLEKTKQVASGMLY 136
>gi|108996379|ref|XP_001096736.1| PREDICTED: similar to DJ-1 protein isoform 3 [Macaca mulatta] >gi|108996382|ref|XP_001096847.1| PREDICTED: similar to DJ-1 protein isoform 4 [Macaca mulatta] (189 aa)
Score = 136, Expect = 7.7e-07, Identities = 47/175 (26%), Positives = 81/175 (46%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLD-KFNALYIPGGK-GCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGK----NYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNI 184
           R  ++ +  + +M+ VIP D+  RAGI V       K  +       I     +E    +  ++ + +PGG  G Q L       V++ + K    +G       G  + +  E+G     K+TT P  ++K+       YS+N +  D   ++ + P  +FEFAL IVE L  K++A  +
  S:     5 RALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQNL--SEQASVLDALTKGRNRDGIFLFLFLGPTALLAHEIGF--GSKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSRGPGTSFEFALAIVEALNGKEVAAQV 181
>gi|189463787|ref|ZP_03012572.1| hypothetical protein BACINT_00120 [Bacteroides intestinalis DSM 17393] >gi|189438737|gb|EDV07722.1| hypothetical protein BACINT_00120 [Bacteroides intestinalis DSM 17393] (182 aa)
Score = 135, Expect = 8.1e-07, Identities = 45/151 (29%), Positives = 77/151 (50%)
  Q:    29 DIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNA--LYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL-GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQ 179
           D+  RAG+ VE ++    + +       + C + +  VN D ++A  + +PGG      L ++   +   ++ FA  E  K +    AA  +L +LG+L  +K T  PGFE+ L G   +   +  D N ++ K P  A EFAL +V+ +L K+
  S:    22 DVMRRAGLNVEMITVTPDEIVTGAHDVPVLCDKNV--VNCDFYDADLVLLPGGMPGAATL-EKCPELRKLVLDFA--EKNKPIAAICAAPMMLGKLGLLKGRKATCYPGFEQYLEGAECTGAPVERDGNIITGKGPGAAMEFALTVVDMMLGKE 170
>gi|193506762|pdb|3CZA|A Chain A, Crystal Structure Of E18d Dj-1 (197 aa)
Score = 135, Expect = 8.9e-07, Identities = 51/175 (29%), Positives = 84/175 (48%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLD-KFNALYIPGGK-GCQRLLTDRNERVINKIVKFAGDEGKKWLFTA---GAASTVLAELGVLGNKKITTAPGFEEKLGK----NYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNI 184
           R  ++ +  + +MD VIP D+  RAGI V       K  +       I     +E    +  ++ + +PGG  G Q L        + +I+K    E +K L  A   G  + +  E+G     K+TT P  ++K+       YS+N +  D   ++ + P  +FEFAL IVE L  K++A  +
  S:     5 RALVILAKGAEEMDTVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQNL---SESAAVKEILK--EQENRKGLIAAICAGPTALLAHEIGF--GSKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSRGPGTSFEFALAIVEALNGKEVAAQV 181
>gi|14591468|ref|NP_143548.1| intracellular proteinase [Pyrococcus horikoshii OT3] >gi|6093703|sp|O59413|PFPI_PYRHO Intracellular protease 1 (Intracellular protease I) >gi|3258135|dbj|BAA30818.1| 166aa long hypothetical intracellular proteinase [Pyrococcus horikoshii OT3] (166 aa)
Score = 135, Expect = 8.9e-07, Identities = 43/153 (28%), Positives = 80/153 (52%)
  Q:     9 IRIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSDNNIVVDKNFVSFKSP 161
           +++  + + E  D++++ PY      G  V   S E+  +I  + G  +      +KVN ++F+AL +PGG+  +R+    NE+ ++ I +    EGK  + +      +L   GVL  +K T+ PG ++ +   G  + D  +VVD N+VS + P
  S:     1 MKVLFLTANEFEDVELIYPYHRLKEEGHEVYIASFERG-TITGKHGYSVKVDLTFDKVNPEEFDALVLPGGRAPERVRL--NEKAVS-IARKMFSEGKP-VASICHGPQILISAGVLRGRKGTSYPGIKDDMINAGVEWVDAEVVVDGNWVSSRVP 151
>gi|90415286|ref|ZP_01223220.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein, putative [marine gamma proteobacterium HTCC2207] >gi|90332609|gb|EAS47779.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein, putative [marine gamma proteobacterium HTCC2207] (194 aa)
Score = 135, Expect = 9.4e-07, Identities = 43/157 (27%), Positives = 80/157 (50%)
  Q:    19 SNDMDIVIPYDIWTRAGI--IVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYSDN--NIVVDKNFVSFKSPFHAFEFALLIVEKL 175
           S ++++V   D+  RAG+   V + ++ +K  I    GT I     ++      ++ + +PGG  G + L       V++ +++    + K +     A + VLA  G+L +K +T  P F++ L     D    +VVD N ++ + P  A +FAL +VE+L
  S:    13 SEEIELVTIVDVLRRAGVEVTVASANSGEKLQICASRGTHIVADAMLDDCANKHYDLIAVPGGLPGSEHL---AKHAVLDVLLRDQAAQDKLFAGICAAPALVLATKGLLLDKAVTCHPSFQKSLEAKEVDGAARVVVDGNCITSQGPGTALDFALELVEQL 171
>gi|160933043|ref|ZP_02080432.1| hypothetical protein CLOLEP_01885 [Clostridium leptum DSM 753] >gi|156868117|gb|EDO61489.1| hypothetical protein CLOLEP_01885 [Clostridium leptum DSM 753] (179 aa)
Score = 135, Expect = 1.0e-06, Identities = 45/174 (25%), Positives = 85/174 (48%)
  Q:    11 IAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL-GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNI 184
           IA+  +    +++ +   D+  RA + V+TV     K I    G  +    E ++V+ D+  A+ +PGG      L      ++   +++   E   +L    AA ++L  +G+   +++T  PGFE +L G   +D ++V D   ++ K P  A +FAL IV +L  +  ++ I
  S:     2 IAVFLAQGFEEIEALAVVDVLRRAELPVKTVG-VGGKEITGAHGICVKADMEEKEVSTDELEAVVLPGGM--PGTLNLEKSPIVRTCIRYCC-ENDLYLCAICAAPSILGHMGLAAGREVTCFPGFENELTGAVETDRSVVTDGKMITGKGPGVAVDFALEIVARLCGQVESSKI 172
>gi|149689074|gb|ABR27864.1| DJ-1 [Triatoma infestans] (194 aa)
Score = 135, Expect = 1.0e-06, Identities = 42/166 (25%), Positives = 82/166 (49%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEI---------EKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL--GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNI 184
           S +M+ +I  D+  R G+ V            L+      CS ++         E +    ++A+ +PGG    +   D +   +  ++K   ++  K +    AA T L   G+   K++T  PG E++L     YS++ +V+D N ++ + P  AF+F L +VE+L+    + ++
  S:    14 SEEMECIISVDVLRRGGVNVTLAG--------LKGNEPTKCSRDVVVVPDKSMEEAIKCGPYDAIVLPGGLQGSKSFADCS--TLGNLLK-EQEKCGKIVAAICAAPTALKAHGIGLGKRVTCYPGLEKELVDSYKYSEDKVVIDGNLITSRGPGTAFDFGLALVEQLVGTDTSCSV 179
>gi|85000177|ref|XP_954807.1| 4-methyl-5(b-hydroxyethyl)-thiazol monophosphate biosynthesis enzyme, putative [Theileria annulata] >gi|65302953|emb|CAI75331.1| 4-methyl-5(b-hydroxyethyl)-thiazol monophosphate biosynthesis enzyme, putative [Theileria annulata] (254 aa)
Score = 135, Expect = 1.0e-06, Identities = 45/171 (26%), Positives = 84/171 (49%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG----KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTA-PGFEEKL-----GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           + D++++   D+  RAG+ V   S     ++ L  GTK+T  +++  +    F+ + +PGG      C       N   + +++K     G+ +     + + V  + G+L +K    A PGFE KL     G+ +  NN  + + +V+ + P  A EFAL +VE L   +    +   +L
  S:    45 TEDIELITLVDVLRRAGVSVVLASVGDSVNLVLAHGTKLTADDKVVNLTQKTFDLIAVPGGLVGATNCA------NNVTLIRMLKEQKSNGRLYAAICASPALVFGDCGLLDDKTSAVAFPGFENKLPLVGTGRVHVSNNCGIFR-YVTSQGPGTALEFALKLVELLCGVEAKNKLTKSML 218
>gi|139437224|ref|ZP_01771384.1| Hypothetical protein COLAER_00363 [Collinsella aerofaciens ATCC 25986] >gi|133776871|gb|EBA40691.1| Hypothetical protein COLAER_00363 [Collinsella aerofaciens ATCC 25986] (185 aa)
Score = 134, Expect = 1.1e-06, Identities = 40/178 (22%), Positives = 80/178 (44%)
  Q:    11 IAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKN-YSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDI 188
           +A++ +     ++ +   D+  R G+    VS    + +       +TC    +++N D+++ + +PGG  G   L  D  +RV + + +FA     K +    AA  +L EL +L  +  T  PGFE+   +  Y+   +  D N ++      +  FAL ++  +   +    +A  I
  S:     9 VAVLAADGFETIECLTMVDVMRRGGVRATLVSIMPTREVVSSLQIPVTCDALFDEINFDEYDCVVLPGGLPGATNLRAD--QRVCDVVCEFA---ATKHVAAICAAPFILGELDLLEGRHATCFPGFEKSFPEGAYTGEKVTQDGNIITASGMAQSLPFALELLRTIAGDKAVEKVAEGI 183
>gi|33149230|gb|AAP96742.1| ThiJ-like protein [Brassica rapa subsp. pekinensis] (392 aa)
Score = 134, Expect = 1.2e-06, Identities = 48/180 (26%), Positives = 91/180 (50%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRA--GIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLG-KNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           +I +  + +S +++ +   DI  RA   +++  V N  +  +      K+     +++V    F+ + +PGG  G  RL +   E+++N + K A +  K +     +   V    G+L  KK TT P    KL  +++ ++ +VVD N ++ ++P  A EF+L IVEK   ++ A  +A   L
  S:   213 QILVPIAEDSEEIEAIALVDILRRAKANVVIAAVGNSLE--VVGSRKAKLVADVLLDEVAEKSFDLIVLPGGLNGAPRLAS--CEKLVNMLKKQA-EANKPYGGICASPVYVFEPHGLLKGKKATTHPCVSNKLSDQSHVEHRVVVDGNVITSRAPGTAMEFSLAIVEKFYGREKAVQLAKATL 391
Score = 106, Expect = 2.1e-03, Identities = 39/157 (24%), Positives = 70/157 (44%)
  Q:    33 RAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLG---KNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           R G  V   S E K  +      K+     +  +    F+ + +PGG  G + L   +N + +  +VK    +G+       A +  L   G+L  K  T  P F EKL       S++ + +D   V+ + P    EF++ ++E+L  K  A  +++ +L
  S:    30 RGGADVTVASVEDKVGVDACHNIKMVADTLLSDITDSIFDLIVLPGGLPGGETL---KNCKPLENMVKKQDTDGRLNAAICCAPALALGTWGLLEGKTATGYPVFMEKLAATCATASESRVEIDGRIVTSRGPGTTIEFSITLIEQLFGKDKADEVSSGLL 187
>gi|195560606|ref|XP_002077417.1| GD13461 [Drosophila simulans] >gi|194202528|gb|EDX16104.1| GD13461 [Drosophila simulans] (218 aa)
Score = 134, Expect = 1.2e-06, Identities = 52/181 (28%), Positives = 87/181 (48%)
  Q:    13 IMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEI---------EKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTA-GAASTVLAELGVLGNKKITTAPGFEEKLGKNY---SDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILYTKK 193
           I+ +  + +M+  I  D+  R  I V TV+        L     + CS  +         E V    ++ + +PGG    + L   N   +  +++    E K  L  A  AA T LA+ G+   K IT+ P  + +L + Y    D  +V D N ++   P   F+FAL I E+L+  ++A  +A  +L+T K
  S:    36 IILAPGAEEMEFTISADVLRRGKINV-TVAG-------LYGCEPVKCSRSVVIVPDTSLEEAVTRGDYDVVVLPGGLAGNKALM--NSSAVGDVLRC--QESKGGLIAAICAAPTALAKHGIGKGKSITSHPDMKPQLKELYCYIDDKTVVQDGNIITSLGPVTTFDFALKITEQLVGVEVAKEVAKAMLWTYK 217
>gi|15232455|ref|NP_188117.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein, putative [Arabidopsis thaliana] >gi|11908018|gb|AAG41438.1|AF326856_1 putative 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein [Arabidopsis thaliana] >gi|13194800|gb|AAK15562.1|AF349515_1 putative 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein [Arabidopsis thaliana] >gi|14517478|gb|AAK62629.1| AT3g14990/K15M2_13 [Arabidopsis thaliana] >gi|22136580|gb|AAM91076.1| AT3g14990/K15M2_13 [Arabidopsis thaliana] (392 aa)
Score = 134, Expect = 1.2e-06, Identities = 45/157 (28%), Positives = 82/157 (52%)
  Q:    33 RAGIIVETVSNEKKKSIFLQSGTKITCSEEI--EKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLG-KNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           +A +++  V N    S+ ++   K     E+  ++V    F+ + +PGG  G QR  +   E+++N + K A +  K +     + + V    G+L  KK TT P   +KL  K++ ++ +VVD N ++ ++P  A EF+L IVEK   ++ A  +    L
  S:   238 KANVVIAAVGN----SLEVEGSRKAKLVAEVLLDEVAEKSFDLIVLPGGLNGAQRFAS--CEKLVNMLRKQA-EANKPYGGICASPAYVFEPNGLLKGKKATTHPVVSDKLSDKSHIEHRVVVDGNVITSRAPGTAMEFSLAIVEKFYGREKALQLGKATL 391
Score = 113, Expect = 2.9e-04, Identities = 39/157 (24%), Positives = 73/157 (46%)
  Q:    33 RAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYS---DNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           R G  V   S E +  +    G K+     +  +    F+ + +PGG  G + L   +N + +  +VK    +G+       A +  L   G+L  KK T  P F EKL    +   ++ + +D   V+ + P    EF++ ++E+L  K+ A  +++ +L
  S:    30 RGGADVTVASVETQVGVDACHGIKMVADTLLSDITDSVFDLIVLPGGLPGGETL---KNCKSLENMVKKQDSDGRLNAAICCAPALALGTWGLLEGKKATGYPVFMEKLAATCATAVESRVQIDGRIVTSRGPGTTIEFSITLIEQLFGKEKADEVSSILL 187
>gi|90408891|ref|ZP_01217029.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Psychromonas sp. CNPT3] >gi|90310000|gb|EAS38147.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Psychromonas sp. CNPT3] (198 aa)
Score = 134, Expect = 1.2e-06, Identities = 47/170 (27%), Positives = 82/170 (48%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGK-GCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGK-NYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQ 179
           R+A++ +    + + V+  DI  R  I V+ +S+ K  ++     T+IT    ++    + ++A+ +PGG  G   L    N +VI+  +K    EGK       + + VLA   +L  K  TT  G  +K    NY    +V+D N V+ +    +FEFA  + + LL  +
  S:     5 RVAVLLADGFEEGEAVVFIDIMRRLDIEVDVLSSMKTTALKSYFETRITADHTLDSRVTETYDAVMMPGGPVGTDNL--SANTQVIS-FIKRHMQEGKYICALCSSGAKVLAAHDLLEGKNYTTGDGLSDKYADGNYQQKKVVIDGNIVTGRGLGVSFEFAFSVAKLLLGDE 173
>gi|30683408|ref|NP_850588.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein, putative [Arabidopsis thaliana] >gi|79313237|ref|NP_001030698.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein, putative [Arabidopsis thaliana] >gi|8777482|dbj|BAA97062.1| unnamed protein product [Arabidopsis thaliana] (369 aa)
Score = 134, Expect = 1.3e-06, Identities = 45/157 (28%), Positives = 82/157 (52%)
  Q:    33 RAGIIVETVSNEKKKSIFLQSGTKITCSEEI--EKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLG-KNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           +A +++  V N    S+ ++   K     E+  ++V    F+ + +PGG  G QR  +   E+++N + K A +  K +     + + V    G+L  KK TT P   +KL  K++ ++ +VVD N ++ ++P  A EF+L IVEK   ++ A  +    L
  S:   215 KANVVIAAVGN----SLEVEGSRKAKLVAEVLLDEVAEKSFDLIVLPGGLNGAQRFAS--CEKLVNMLRKQA-EANKPYGGICASPAYVFEPNGLLKGKKATTHPVVSDKLSDKSHIEHRVVVDGNVITSRAPGTAMEFSLAIVEKFYGREKALQLGKATL 368
Score = 113, Expect = 2.9e-04, Identities = 39/157 (24%), Positives = 73/157 (46%)
  Q:    33 RAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYS---DNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           R G  V   S E +  +    G K+     +  +    F+ + +PGG  G + L   +N + +  +VK    +G+       A +  L   G+L  KK T  P F EKL    +   ++ + +D   V+ + P    EF++ ++E+L  K+ A  +++ +L
  S:     7 RGGADVTVASVETQVGVDACHGIKMVADTLLSDITDSVFDLIVLPGGLPGGETL---KNCKSLENMVKKQDSDGRLNAAICCAPALALGTWGLLEGKKATGYPVFMEKLAATCATAVESRVQIDGRIVTSRGPGTTIEFSITLIEQLFGKEKADEVSSILL 164
>gi|182418458|ref|ZP_02949752.1| protein ThiJ [Clostridium butyricum 5521] >gi|182377840|gb|EDT75384.1| protein ThiJ [Clostridium butyricum 5521] (184 aa)
Score = 134, Expect = 1.3e-06, Identities = 51/162 (31%), Positives = 85/162 (52%)
  Q:    29 DIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGK-NYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILY 190
           DI  RA +  + VS + KK +    G  I   +  ++    +++ + +PGG      L D +ERVIN I+K    EGK  +    AA  VL + G+   +KIT+ PG+E++L   +Y ++ +VVD N ++ + P  A  F+  ++E L        IA+ +LY
  S:    22 DIMRRAKVECDIVSIKDKK-VTSSHGVSIEADKIFDESM--EYDLIVLPGGIPGATNLRD-DERVIN-ILKKQNREGK-LIGAICAAPIVLGKAGLTEGRKITSYPGYEDELPNCDYLEDAVVVDGNIITSRGPATAMVFSYKLLEVLGYSHEVDGIASGMLY 178
>gi|145490787|ref|XP_001431393.1| hypothetical protein GSPATT00005847001 [Paramecium tetraurelia strain d4-2] >gi|124398498|emb|CAK63995.1| unnamed protein product [Paramecium tetraurelia] (193 aa)
Score = 134, Expect = 1.3e-06, Identities = 49/172 (28%), Positives = 82/172 (47%)
  Q:    21 DMDIVIPYDIWTRAGIIV-----ETVSNEKKKSIFLQSGTKITCSEEI-EKVNLDKFNALYIPGGK------GCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILYTK 192
           +++ V   DI  RA I V     + V +EK   I  +SG    C   + E V   +F+ + +PGG       G  + L DR        ++   +EGK       +   VL + G + N   T  P   +     +S++ + V   F++ +SP  A EFAL +VE L+++  A  +A  +L  +
  S:    18 EIETVAIIDILRRANIDVTFASIKPVEDEKAPVIVGRSGISFICDTYLTEAVLKQQFDLIALPGGLSNAQSLGTHQPLLDR--------LRQQQEEGKWIAAICASPQLVLDKNGFMINSTGTCHPAHVQDYKGQFSEDRVHVSNKFITSRSPGTAIEFALALVELLVDQHTAVQMAKSLLVKR 193
>gi|121604797|ref|YP_982126.1| PfpI family intracellular peptidase [Polaromonas naphthalenivorans CJ2] >gi|120593766|gb|ABM37205.1| intracellular protease, PfpI family [Polaromonas naphthalenivorans CJ2] (204 aa)
Score = 133, Expect = 1.6e-06, Identities = 41/159 (25%), Positives = 80/159 (50%)
  Q:     3 KHKVSNIRIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFL---QSGTKITCSEEIEKVNLDKFNALYIPGGK-GCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFE---EKLGKNYSDNNIVVDKNFVSFKSP 161
           +H++  + IAI+ +      ++  P      +G+++  +S+   +   +   Q G         +KV  D+F+A+ +PGG     R+   RN     ++V+    +GK  L     A  +L   G++  +K+T+AP  +   E+ G  + D  +VVD+N+VS + P
  S:     6 QHQLGGLNIAILVTDGFEQEEMTGPQAALEESGVMIRLLSDRTGQVQGVRHDQPGDSFDVDTTFDKVTADEFDAVLLPGGAVNASRI---RNNADAQELVRQMDQQGKP-LAMICHAPWLLVSAGLVKGRKMTSAPELQKDLEQAGAQWVDEKVVVDRNWVSSRKP 167
>gi|154482812|ref|ZP_02025260.1| hypothetical protein EUBVEN_00489 [Eubacterium ventriosum ATCC 27560] >gi|149736407|gb|EDM52293.1| hypothetical protein EUBVEN_00489 [Eubacterium ventriosum ATCC 27560] (185 aa)
Score = 133, Expect = 1.6e-06, Identities = 44/153 (28%), Positives = 80/153 (52%)
  Q:    38 VETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILY 190
           V TVS + +  +      K+   + I +++    + +++PGG  G   L     E++ ++IV++  ++GK  L    AA TV + LG+L +K  T+ P FE+++  N     +V D NF++ K    A E  L I+  L++++ A  +A  I Y
  S:    32 VVTVSIKDELLVKSSHNIKLYADKNINEIDFSSGDCIFLPGGMPGTTNL--GACEKLADEIVEY-NNQGK-LLAAICAAPTVFSNLGLLKDKNATSYPSFEDQMECNNYGGGVVRDGNFITGKGLGVALEMGLEIISYLVDEETAGEVAKAIQY 181
>gi|89275119|gb|ABD66014.1| SP22 [Xenopus laevis] (163 aa)
Score = 133, Expect = 1.7e-06, Identities = 43/119 (36%), Positives = 66/119 (55%)
  Q:    71 FNALYIPGGK-GCQRLLTDRNERVINKIVKFAGDEGKKWLFTA-GAASTVLAELGVLGNKKITTAPGFEEKLGK----NYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           ++ + +PGG  G Q L       V+ +++K    E KK L  A  A  T L   GV   K ITT P  ++K+       YS+  +V D+NF++ + P  +FEFAL IV  LL K++A  + + +L
  S:    41 YDVVVLPGGNLGAQNL---SESPVVKEVLK--EQEAKKGLIAAICAGPTALTVHGVGIGKSITTHPLAKDKIVNPDQYKYSEERVVKDENFITSRGPGTSFEFALEIVCTLLGKEVAEQVKSPLL 160
>gi|160945016|ref|ZP_02092242.1| hypothetical protein FAEPRAM212_02531 [Faecalibacterium prausnitzii M21/2] >gi|158442747|gb|EDP19752.1| hypothetical protein FAEPRAM212_02531 [Faecalibacterium prausnitzii M21/2] (183 aa)
Score = 133, Expect = 1.7e-06, Identities = 52/172 (30%), Positives = 79/172 (45%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL-GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILY 190
           + + + ++  D+  RA + V   S    + I       IT     E+V+    + + +PGG  G   L    N+ V +  V FA   GKK +    AA +VLA LG+L  K  T    F++KL G +  D  +VVD N  +      A  FAL +V +L  +  A  I + I Y
  S:    12 TEECEALLVVDLLRRAKVEVLVASASGSREILSSHKVHITADALAEEVDYSDVDLVVLPGGIPGTPNLAA--NKTVTDTCVAFA-KAGKK-VAAICAAPSVLAALGLLEGKNATAHAAFQDKLAGAHVLDTEVVVDGNITTSYGLGGAIPFALELVRQLAGEAEADRIRSAIAY 181
>gi|55822910|ref|YP_141351.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Streptococcus thermophilus CNRZ1066] >gi|55738895|gb|AAV62536.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Streptococcus thermophilus CNRZ1066] (182 aa)
Score = 133, Expect = 1.7e-06, Identities = 48/181 (26%), Positives = 92/181 (50%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGK-NYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKL--LNKQIATNIANDILY 190
           ++A++ +    +++ + P D++ RAG     +  E   S+    G ++T     E  NLD+++ + +PGG      L D ++ +I  + + A  +  K++    AA  VL   G+L  +K T  PG EE++   ++  + +VVD N V+ +    A  FA  +V+ L    +Q+A  +  D L+
  S:     3 KVAVVFADGFEEIEALSPVDVFRRAGFDCSMLGLESA-SVTGSHGIQVTMDGVFEG-NLDEYDLVVLPGGMPGSTKLRD-HQALIASLQEVA--KAGKYVAAICAAPIVLERAGLLEGRKFTCFPGVEEQIASGDHQTDLVVVDDNIVTSRGAGTALAFAYALVDLLGGDGQQLAHTMVYDRLF 181
>gi|17558714|ref|NP_504132.1| DJ-1 (mammalian transcriptional regulator) Related family member (djr-1.2) [Caenorhabditis elegans] >gi|13324922|gb|AAK18904.1| Dj-1 (mammalian transcriptional regulator) related protein 1.2 [Caenorhabditis elegans] (186 aa)
Score = 133, Expect = 1.8e-06, Identities = 43/158 (27%), Positives = 79/158 (50%)
  Q:    18 ESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKL 175
           ++ ++++++  D+  R G+ V   +    + +    G +I     ++ V    F+ + IPGG GC +L       VI +++K     G   +    A  TVL   G++  +++T     ++K+   G  Y D+N+V+    ++ K P  AFEFAL IVE L
  S:    15 DAEEIEVIVTGDVLVRGGLQV-LYAGSSTEPVKCAKGARIVPDVALKDVKNKTFDIIIIPGGPGCSKL---AECPVIGELLKTQVKSGG-LIGAICAGPTVLLAHGIVA-ERVTCHYTVKDKMTEGGYKYLDDNVVISDRVITSKGPGTAFEFALKIVETL 169
>gi|152998032|ref|YP_001342867.1| DJ-1 family protein [Marinomonas sp. MWYL1] >gi|150838956|gb|ABR72932.1| DJ-1 family protein [Marinomonas sp. MWYL1] (183 aa)
Score = 132, Expect = 2.0e-06, Identities = 50/171 (29%), Positives = 83/171 (48%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAAS--TVLAELGVLGNKKITTAPGFEEKL-GKNYSDNN-IVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           + D++ +   D+  R G+ V   S  + K I +  GTK+     + +V    F+A+ + GG      L D  E +I+ + K    + +  L  A  AS   V    G + +K+ T  PGFE+ L G  Y  N  +V+D N ++ K P  A  F+L ++  L     A N+A+ +L
  S:    12 NEDIEAITIIDVLRRGGVEVTVASIHESKQIVMAHGTKLEADVLLTEVGEQIFDAVVLAGGMPGAEHLRD-CELLIDILEK---HDIQDALLAAICASPAVVFGTHGFVVDKQATCYPGFEDGLIGAEYIANEPVVMDGNILTGKGPAAAMVFSLTVLGNLNGYDAAKNVADGLL 182
>gi|154509604|ref|ZP_02045246.1| hypothetical protein ACTODO_02137 [Actinomyces odontolyticus ATCC 17982] >gi|153799238|gb|EDN81658.1| hypothetical protein ACTODO_02137 [Actinomyces odontolyticus ATCC 17982] (194 aa)
Score = 132, Expect = 2.1e-06, Identities = 42/186 (22%), Positives = 85/186 (45%)
  Q:     7 SNIRIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILYTK 192
           ++  +AIM +    +++ +   D+  RAG+  + +S    + +    G ++     +E V+L  +  L++PGG      L  +    I   V    D  +  +    AA ++L+ELGVL  +  T  P F + +   G    +N +VVD   ++ +    + E  L IV  +L   +   +A  ++ ++
  S:     9 TDATVAIMLADGFEEVEALAVADVLYRAGVRSDLISVTDARHVTSSHGIRVVADLMLEDVDLSTYTVLFLPGGM--PGTLGLKGTPAIQAEVLRRSDAAQP-IAAICAAPSILSELGVLDGRHATANPAFVKAIAEGGAIVHENPVVVDGQIITSRGAGTSLELGLEIVRLILGDDVVDEVARGVVLSR 194
>gi|194689918|gb|ACF79043.1| unknown [Zea mays] (339 aa)
Score = 132, Expect = 2.3e-06, Identities = 47/181 (25%), Positives = 88/181 (48%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNK-KITTAPGFEEKLGKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILY 190
           R+ I  +  S +M++++  D+  RA    + V    ++ +  + GT+I     ++     +F+ + +PGG  G +  L D+ E  +  ++K     G+ +     A + VL   G++G   K TT     ++  +    + +VVD N  +  S   A EFAL +VEKLL  + A  +A  +L+
  S:   162 RVLIPVANGSEEMEVLVTVDVLRRAK--ADVVVASAEEVVVARHGTRIVADALLQDAAGQQFDLIVVPGGMPGVKTTLADKVE--LMALLKEHAAAGRAYGAIGAATAQVLEPHGLIGGSMKATTCASRADRPSE--CGSRVVVDGNLATSGSTGTAMEFALAVVEKLLGPEAAREVAEALLF 338
Score = 98, Expect = 2.0e-02, Identities = 27/77 (35%), Positives = 38/77 (49%)
  Q:   113 GAASTVLAELGVLGNKKITTAPGFEEKLGKNYS--DNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
            A    LA  G+L   K T  P F +K     +  D N+VVD   V+ + P  A EFAL +V++L  K     IA  ++
  S:    60 AAPPLALARWGLLDGVKATAHPEFVDKFPAEVAGVDANVVVDGRVVTGRGPAAAMEFALALVDQLYGKGKVDEIAKPMM 138
>gi|125553014|gb|EAY98723.1| hypothetical protein OsI_019956 [Oryza sativa (indica cultivar-group)] (390 aa)
Score = 131, Expect = 2.4e-06, Identities = 44/172 (25%), Positives = 84/172 (48%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAAST--VLAELGVLGNKKITTAPGFEEKLGKNYSD-NNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILY 190
           S +M+I++  D+  RA + V   S EK  SI      +I   + I   +  +++ + +PGG  G +RL       V+ K++K     G+ +    G  S+  +L + G+L +K +T  P    +L     D + +V+D N ++        +F+L I++K      A  +AN +++
  S:   216 SEEMEIIMLTDVLRRANVNVVLASVEKSTSIVGSQRMRIVADKCISDASALEYDLIILPGGPAGAERL---HKSSVLKKLLKEQKQTGRMY---GGICSSPVILQKQGLLQDKTVTAHPSIVNQLTCEVIDRSKVVIDGNLITGMGLGTVIDFSLAIIKKFFGHGRAKGVANGMVF 385
Score = 92, Expect = 9.0e-02, Identities = 40/180 (22%), Positives = 73/180 (40%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           ++ +  ++ + +M+ VI   +  RAG  V   S E    +    G+ I   + I       F+ + +PGG  G  RL   R+  ++ +I     +E + +     A + VL   G+   KK++                         + + P  AF+FAL  VE+L     A ++ N +L
  S:    26 KVLLPIAMGTEEMEAVILAGVLRRAGADVTLASVEDGLEVEASRGSHIVADKRIAACADQVFDLVALPGGMPGSVRL---RDSAILQRITVRQAEEKRLYGAICAAPAVVLMPWGLHKRKKVS---------------------GELTTSRGPGTAFQFALSFVEQLFGPCKAEDMDNTLL 182
>gi|195442025|ref|XP_002068761.1| GK17852 [Drosophila willistoni] >gi|194164846|gb|EDW79747.1| GK17852 [Drosophila willistoni] (189 aa)
Score = 131, Expect = 2.6e-06, Identities = 43/173 (24%), Positives = 78/173 (45%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYS---DNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILYT 191
           + +M+ VI  D+  RAGI V          +             +E V   KF+ + +PGG G    +   +  V+  +++ A +     +    AA T LA+  +   K +T+ P  + +L   Y+     N+V D N ++ + P  A++FAL I E+L   +    +A  +L +
  S:    13 AEEMEFVIAADVLRRAGITVTVAGLSGSGPVKGSRDIVFVPDASLESVASSKFDVVVLPGGLGGSNAMGASS--VVGDLLR-AQETNGGLIAAICAAPTALAKHDIATGKSLTSYPAMKPQLVDKYNYVEGKNVVQDGNLITSRGPGTAYDFALKIAEELAGLEKTQEVAKGMLLS 185
>gi|22124920|ref|NP_668343.1| hypothetical protein y1013 [Yersinia pestis KIM] >gi|45440608|ref|NP_992147.1| hypothetical protein YP_0759 [Yersinia pestis biovar Microtus str. 91001] >gi|21957757|gb|AAM84594.1|AE013704_11 4-methyl-5(beta-hydroxyethyl)-thiazole monophosphate synthesis enzyme [Yersinia pestis KIM] >gi|45435465|gb|AAS61024.1| 4-methyl-5(B-hydroxyethyl)-thiazol monophosphate biosynthesis enzyme [Yersinia pestis biovar Microtus str. 91001] (198 aa)
Score = 131, Expect = 2.6e-06, Identities = 48/167 (28%), Positives = 80/167 (47%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVET--VSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKN-YSDNNIVVDK--NFVSFKSPFHAFEFALLIVEKLLNKQIATNIA 185
           S + + V   DI  RAGI V T  V+ +    I    G ++     +  V   KF+ + +PGG KG +     R+  ++   V+   +EG+       A + VL    +     +T  P  ++K+  N + D  +V D+  N V+ + P  + +FAL IV  LL ++ A  IA
  S:    15 SEETEAVTTIDILVRAGINVTTASVAGDGALEIICSRGVRLLADTRLVDVADQKFDVIVLPGGIKGAECF---RDSPLLVATVRQTHNEGRLVAAICAAPALVLEHHQLFPVGNMTGFPSLKDKIAPNKWMDQRVVYDRRVNLVTSQGPGTSIDFALKIVFLLLGREKAEEIA 184
>gi|16123334|ref|NP_406647.1| hypothetical protein YPO3172 [Yersinia pestis CO92] >gi|51595294|ref|YP_069485.1| hypothetical protein YPTB0944 [Yersinia pseudotuberculosis IP 32953] >gi|108808657|ref|YP_652573.1| hypothetical protein YPA_2666 [Yersinia pestis Antiqua] >gi|108811081|ref|YP_646848.1| hypothetical protein YPN_0916 [Yersinia pestis Nepal516] >gi|145600066|ref|YP_001164142.1| hypothetical protein YPDSF_2807 [Yersinia pestis Pestoides F] >gi|149364982|ref|ZP_01887017.1| hypothetical protein YPE_0106 [Yersinia pestis CA88-4125] >gi|153947464|ref|YP_001402067.1| hypothetical protein YpsIP31758_3107 [Yersinia pseudotuberculosis IP 31758] >gi|165926562|ref|ZP_02222394.1| DJ-1 family protein [Yersinia pestis biovar Orientalis str. F1991016] >gi|165935833|ref|ZP_02224403.1| DJ-1 family protein [Yersinia pestis biovar Orientalis str. IP275] >gi|166011028|ref|ZP_02231926.1| DJ-1 family protein [Yersinia pestis biovar Antiqua str. E1979001] >gi|166212929|ref|ZP_02238964.1| DJ-1 family protein [Yersinia pestis biovar Antiqua str. B42003004] >gi|167398624|ref|ZP_02304148.1| DJ-1 family protein [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167421648|ref|ZP_02313401.1| DJ-1 family protein [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167423307|ref|ZP_02315060.1| DJ-1 family protein [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167469775|ref|ZP_02334479.1| DJ-1 family protein [Yersinia pestis FV-1] >gi|170025466|ref|YP_001721971.1| DJ-1 family protein [Yersinia pseudotuberculosis YPIII] >gi|186894311|ref|YP_001871423.1| DJ-1 family protein [Yersinia pseudotuberculosis PB1/+] >gi|51588576|emb|CAH20184.1| 4-methyl-5(beta-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme (thiamine biosynthesis) [Yersinia pseudotuberculosis IP 32953] >gi|108774729|gb|ABG17248.1| 4-methyl-5(B-hydroxyethyl)-thiazol monophosphate biosynthesis enzyme [Yersinia pestis Nepal516] >gi|108780570|gb|ABG14628.1| 4-methyl-5(B-hydroxyethyl)-thiazol monophosphate biosynthesis enzyme [Yersinia pestis Antiqua] >gi|115348813|emb|CAL21767.1| 4-methyl-5(B-hydroxyethyl)-thiazol monophosphate biosynthesis enzyme [Yersinia pestis CO92] >gi|145211762|gb|ABP41169.1| 4-methyl-5(B-hydroxyethyl)-thiazol monophosphate biosynthesis enzyme [Yersinia pestis Pestoides F] >gi|149291395|gb|EDM41469.1| hypothetical protein YPE_0106 [Yersinia pestis CA88-4125] >gi|152958959|gb|ABS46420.1| DJ-1 family protein [Yersinia pseudotuberculosis IP 31758] >gi|165915978|gb|EDR34585.1| DJ-1 family protein [Yersinia pestis biovar Orientalis str. IP275] >gi|165921490|gb|EDR38687.1| DJ-1 family protein [Yersinia pestis biovar Orientalis str. F1991016] >gi|165990028|gb|EDR42329.1| DJ-1 family protein [Yersinia pestis biovar Antiqua str. E1979001] >gi|166205716|gb|EDR50196.1| DJ-1 family protein [Yersinia pestis biovar Antiqua str. B42003004] >gi|166960567|gb|EDR56588.1| DJ-1 family protein [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167051128|gb|EDR62536.1| DJ-1 family protein [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167057477|gb|EDR67223.1| DJ-1 family protein [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|169752000|gb|ACA69518.1| DJ-1 family protein [Yersinia pseudotuberculosis YPIII] >gi|186697337|gb|ACC87966.1| DJ-1 family protein [Yersinia pseudotuberculosis PB1/+] (196 aa)
Score = 131, Expect = 2.6e-06, Identities = 48/167 (28%), Positives = 80/167 (47%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVET--VSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKN-YSDNNIVVDK--NFVSFKSPFHAFEFALLIVEKLLNKQIATNIA 185
           S + + V   DI  RAGI V T  V+ +    I    G ++     +  V   KF+ + +PGG KG +     R+  ++   V+   +EG+       A + VL    +     +T  P  ++K+  N + D  +V D+  N V+ + P  + +FAL IV  LL ++ A  IA
  S:    13 SEETEAVTTIDILVRAGINVTTASVAGDGALEIICSRGVRLLADTRLVDVADQKFDVIVLPGGIKGAECF---RDSPLLVATVRQTHNEGRLVAAICAAPALVLEHHQLFPVGNMTGFPSLKDKIAPNKWMDQRVVYDRRVNLVTSQGPGTSIDFALKIVFLLLGREKAEEIA 182
>gi|153814154|ref|ZP_01966822.1| hypothetical protein RUMTOR_00363 [Ruminococcus torques ATCC 27756] >gi|145848550|gb|EDK25468.1| hypothetical protein RUMTOR_00363 [Ruminococcus torques ATCC 27756] (159 aa)
Score = 131, Expect = 2.6e-06, Identities = 49/158 (31%), Positives = 73/158 (46%)
  Q:    33 RAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLG-KNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILY 190
           RA I VET+S   +K I       +      E+ +    + L +PGG      L + +E + N I +F  D+ KK+L    AA ++L+ELG+L  +K    P FEE L          V D +  + +    A  FAL + E L   + A  IA  I+Y
  S:     3 RAKIDVETISITGQKQINGAHKIIVEADRLFEETDFSDGDMLVLPGGMPGTLNLKE-HEGLRNLIGEF--DKKKKYLAAICAAPSILSELGILKGRKACAYPSFEEGLDCAQVVHEAAVTDGHVTTGRGMGAAIPFALKLTELLCGTEKANEIAESIVY 158
>gi|71414910|ref|XP_809540.1| hypothetical protein Tc00.1047053507927.60 [Trypanosoma cruzi strain CL Brener] >gi|70873938|gb|EAN87689.1| hypothetical protein, conserved [Trypanosoma cruzi] (198 aa)
Score = 131, Expect = 2.6e-06, Identities = 45/171 (26%), Positives = 86/171 (50%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVL-GNKKITTAPGFEEKLGK--NYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           + ++++    DI  RA I V   S  + +++ L  G KIT    ++  +   ++ +++PGG  G   L  + +   + +I++    +GK +     +  + LA +G+L G K +T  P  +EK+    ++S + +V     ++ K P  A  F L IV  LL K  A  +A ++L
  S:    13 TEEIELTCITDILRRAEIQVTVASVMESQNLILSRGLKITTDSLLKDESAAAYDGVFLPGGLPGADHLGKNAH---LKQILEEMRSQGKWYGAICASPVSALAPMGMLEGVKTVTCYPAMKEKIPSHVHWSTDPVVRCGKCLTSKGPGTAIAFGLAIVAALLTKDRALRLAKELL 184
>gi|125555600|gb|EAZ01206.1| hypothetical protein OsI_022438 [Oryza sativa (indica cultivar-group)] (493 aa)
Score = 131, Expect = 2.7e-06, Identities = 46/168 (27%), Positives = 83/168 (49%)
  Q:    22 MDIVIPYDIWTRAGIIVETVS-NEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGK--NYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           M+ VI  D+  RAG  V   S +     +    G K+     ++ +   +F+ + +PGG  G   L   R+ +++  +VK    +GK +     A +  L   G+L   K T  P F +KL    N  ++ + +D N V+ + P  A E+++++VE+L  K+ A  +A  +L
  S:   106 MEAVITVDVLRRAGADVSVASVDPGSAQVGGAWGVKLAADALLDDLADAEFDLISLPGGMPGSSNL---RDCKLLENMVKKHAGKGKLYAAICAAPAVALGSWGLLNGLKATCYPSFMDKLPSEVNTVESRVQIDGNCVTSRGPGTAMEYSVVLVEQLYGKEKADEVAGPML 274
Score = 118, Expect = 9.4e-05, Identities = 36/102 (35%), Positives = 59/102 (57%)
  Q:    89 RNERVINKIVKFAGDEGKKWLFTAGAASTVLA--ELGVLGNKKITTAPGFEEKLG-KNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILY 190
           +++++I  I K A  E  K L+ A  AS  +A    G+L  KK T+ PG   KL  ++   N +VVD N ++ + P  + EF+L IVEKL  ++ A  +A  +++
  S:   391 KSDKLIGLIKKQA--EANK-LYGAICASPAIALEPHGLLKGKKATSFPGMWNKLSDQSECKNRVVVDGNLITSQGPGTSMEFSLAIVEKLFGRERAVELAKTMVF 492
>gi|118403904|ref|NP_001072131.1| Parkinson disease protein 7 [Sus scrofa] >gi|67038668|gb|AAY63803.1| DJ-1 protein [Sus scrofa] (189 aa)
Score = 131, Expect = 2.8e-06, Identities = 50/175 (28%), Positives = 84/175 (48%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLD-KFNALYIPGGK-GCQRLLTDRNERVINKIVKFAGDEGKKWLFTA---GAASTVLAELGVLGNKKITTAPGFEEKLGK----NYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNI 184
           R  ++ +  + +M+ VIP D+  RAGI V       K  +       I     +E    +  ++ + +PGG  G Q L        +  I+K    E +K L  A   G  + +  E+G     K+TT P  ++K+      +YS+N +  D   ++ + P  +FEFAL IVE L  K++A  +
  S:     5 RALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQNL---SESAAVKDILK--EQEKRKGLIAAICAGPTALLAHEIGF--GSKVTTHPLAKDKMMNGSHYSYSENRVEKDGLILTSRGPGTSFEFALAIVEALAGKEVADQV 181
>gi|62319406|dbj|BAD94736.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein [Arabidopsis thaliana] (134 aa)
Score = 131, Expect = 2.9e-06, Identities = 39/127 (30%), Positives = 69/127 (54%)
  Q:    63 IEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLG-KNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           +++V    F+ + +PGG  G QR  +   E+++N + K A +  K +     + + V    G+L  KK TT P   +KL  K++ ++ +VVD N ++ ++P  A EF+L IVEK   ++ A  +    L
  S:     8 LDEVAEKSFDLIVLPGGLNGAQRFAS--CEKLVNMLRKQA-EANKPYGGICASPAYVFEPNGLLKGKKATTHPVVSDKLSDKSHIEHRVVVDGNVITSRAPGTAMEFSLAIVEKFYGREKALQLGKATL 133
>gi|31543380|ref|NP_009193.2| Parkinson disease protein 7 [Homo sapiens] >gi|183227678|ref|NP_001116849.1| Parkinson disease protein 7 [Homo sapiens] >gi|56404943|sp|Q99497|PARK7_HUMAN Protein DJ-1 (Oncogene DJ1) (Parkinson disease protein 7) >gi|34810587|pdb|1UCF|A Chain A, The Crystal Structure Of Dj-1, A Protein Related To Male Fertility And Parkinson's Disease >gi|34810588|pdb|1UCF|B Chain B, The Crystal Structure Of Dj-1, A Protein Related To Male Fertility And Parkinson's Disease >gi|34810650|pdb|1P5F|A Chain A, Crystal Structure Of Human Dj-1 >gi|37927769|pdb|1Q2U|A Chain A, Crystal Structure Of Dj-1RS AND IMPLICATION ON FAMILIAL Parkinson's Disease >gi|39654550|pdb|1PS4|A Chain A, Crystal Structure Of Dj-1 >gi|134105362|pdb|2OR3|A Chain A, Pre-Oxidation Complex Of Human Dj-1 >gi|134105363|pdb|2OR3|B Chain B, Pre-Oxidation Complex Of Human Dj-1 >gi|2460318|gb|AAC12806.1| RNA-binding protein regulatory subunit [Homo sapiens] >gi|5731801|emb|CAB52550.1| Parkinson disease (autosomal recessive, early onset) 7 [Homo sapiens] >gi|14198257|gb|AAH08188.1| Parkinson disease (autosomal recessive, early onset) 7 [Homo sapiens] >gi|30038760|dbj|BAA09603.2| DJ-1 protein [Homo sapiens] >gi|119591997|gb|EAW71591.1| Parkinson disease (autosomal recessive, early onset) 7 [Homo sapiens] >gi|189065215|dbj|BAG34938.1| unnamed protein product [Homo sapiens] (189 aa)
Score = 131, Expect = 2.9e-06, Identities = 50/175 (28%), Positives = 84/175 (48%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLD-KFNALYIPGGK-GCQRLLTDRNERVINKIVKFAGDEGKKWLFTA---GAASTVLAELGVLGNKKITTAPGFEEKLGK----NYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNI 184
           R  ++ +  + +M+ VIP D+  RAGI V       K  +       I     +E    +  ++ + +PGG  G Q L        + +I+K    E +K L  A   G  + +  E+G     K+TT P  ++K+       YS+N +  D   ++ + P  +FEFAL IVE L  K++A  +
  S:     5 RALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQNL---SESAAVKEILK--EQENRKGLIAAICAGPTALLAHEIGF--GSKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSRGPGTSFEFALAIVEALNGKEVAAQV 181
>gi|165761271|pdb|3B36|A Chain A, Structure Of M26l Dj-1 (192 aa)
Score = 131, Expect = 2.9e-06, Identities = 50/175 (28%), Positives = 84/175 (48%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLD-KFNALYIPGGK-GCQRLLTDRNERVINKIVKFAGDEGKKWLFTA---GAASTVLAELGVLGNKKITTAPGFEEKLGK----NYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNI 184
           R  ++ +  + +M+ VIP D+  RAGI V       K  +       I     +E    +  ++ + +PGG  G Q L        + +I+K    E +K L  A   G  + +  E+G     K+TT P  ++K+       YS+N +  D   ++ + P  +FEFAL IVE L  K++A  +
  S:     8 RALVILAKGAEEMETVIPVDVLRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQNL---SESAAVKEILK--EQENRKGLIAAICAGPTALLAHEIGF--GSKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSRGPGTSFEFALAIVEALNGKEVAAQV 184
>gi|11513902|pdb|1G2I|A Chain A, Crystal Structure Of A Novel Intracellular Protease From Pyrococcus Horikoshii At 2 A Resolution >gi|11513903|pdb|1G2I|B Chain B, Crystal Structure Of A Novel Intracellular Protease From Pyrococcus Horikoshii At 2 A Resolution >gi|11513904|pdb|1G2I|C Chain C, Crystal Structure Of A Novel Intracellular Protease From Pyrococcus Horikoshii At 2 A Resolution (166 aa)
Score = 131, Expect = 2.9e-06, Identities = 43/152 (28%), Positives = 78/152 (51%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEE---KLGKNYSDNNIVVDKNFVSFKSP 161
           ++  + + E  D++++ PY      G  V   S E+  +I  + G  +      +KVN ++F+AL +PGG+  +R+    NE+ ++ I +    EGK  + +      +L   GVL  +K T+ PG ++     G  + D  +VVD N+VS + P
  S:     2 KVLFLTANEFEDVELIYPYHRLKEEGHEVYIASFERG-TITGKHGYSVKVDLTFDKVNPEEFDALVLPGGRAPERVRL--NEKAVS-IARKXFSEGKP-VASICHGPQILISAGVLRGRKGTSYPGIKDDXINAGVEWVDAEVVVDGNWVSSRVP 151
>gi|42543006|pdb|1J42|A Chain A, Crystal Structure Of Human Dj-1 >gi|16751471|dbj|BAB71782.1| DJ-1 [Homo sapiens] (189 aa)
Score = 131, Expect = 3.0e-06, Identities = 50/175 (28%), Positives = 84/175 (48%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLD-KFNALYIPGGK-GCQRLLTDRNERVINKIVKFAGDEGKKWLFTA---GAASTVLAELGVLGNKKITTAPGFEEKLGK----NYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNI 184
           R  ++ +  + +M+ VIP D+  RAGI V       K  +       I     +E    +  ++ + +PGG  G Q L        + +I+K    E +K L  A   G  + +  E+G     K+TT P  ++K+       YS+N +  D   ++ + P  +FEFAL IVE L  K++A  +
  S:     5 RALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQNL---SESAAVKEILK--EQENRKGLIAAICAGPTALLAHEIGC--GSKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSRGPGTSFEFALAIVEALNGKEVAAQV 181
>gi|165761274|pdb|3B38|A Chain A, Structure Of A104v Dj-1 (192 aa)
Score = 131, Expect = 3.0e-06, Identities = 50/175 (28%), Positives = 84/175 (48%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLD-KFNALYIPGGK-GCQRLLTDRNERVINKIVKFAGDEGKKWLFT---AGAASTVLAELGVLGNKKITTAPGFEEKLGK----NYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNI 184
           R  ++ +  + +M+ VIP D+  RAGI V       K  +       I     +E    +  ++ + +PGG  G Q L        + +I+K    E +K L     AG  + +  E+G     K+TT P  ++K+       YS+N +  D   ++ + P  +FEFAL IVE L  K++A  +
  S:     8 RALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQNL---SESAAVKEILK--EQENRKGLIAVICAGPTALLAHEIGF--GSKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSRGPGTSFEFALAIVEALNGKEVAAQV 184
>gi|165761145|pdb|2RK3|A Chain A, Structure Of A104t Dj-1 (197 aa)
Score = 130, Expect = 3.2e-06, Identities = 50/175 (28%), Positives = 84/175 (48%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLD-KFNALYIPGGK-GCQRLLTDRNERVINKIVKFAGDEGKKWLFT---AGAASTVLAELGVLGNKKITTAPGFEEKLGK----NYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNI 184
           R  ++ +  + +M+ VIP D+  RAGI V       K  +       I     +E    +  ++ + +PGG  G Q L        + +I+K    E +K L     AG  + +  E+G     K+TT P  ++K+       YS+N +  D   ++ + P  +FEFAL IVE L  K++A  +
  S:     5 RALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQNL---SESAAVKEILK--EQENRKGLIATICAGPTALLAHEIGF--GSKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSRGPGTSFEFALAIVEALNGKEVAAQV 181
>gi|116873688|ref|YP_850469.1| PfpI family intracellular peptidase [Listeria welshimeri serovar 6b str. SLCC5334] >gi|116742566|emb|CAK21690.1| unnamed protein product [Listeria welshimeri serovar 6b str. SLCC5334] (173 aa)
Score = 130, Expect = 3.3e-06, Identities = 39/152 (25%), Positives = 72/152 (47%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSDNNIVVDKNFVSFKSP 161
           ++  + S +  D+++  P      AG  V  V+ E KK    + G  +T   + + V  + ++ + +PGG    +L   R + V+N +  F  DE KK +     A  VL   G+L    +T+ PG ++ +   G  + D  +V D + +S + P
  S:     7 KVIALVSEDFEDLELWYPVLRLREAGASVHLVAEEAKKVYHGKYGVPVTSDYDFDSVRAEDYDGILVPGGWSPDKL--RRFDSVLNLVRAF--DEAKKPIGQICHAGWVLVSAGILEGVNVTSTPGIKDDMTNAGAIWHDEPVVTDGHIISSRRP 157
>gi|50513593|pdb|1SOA|A Chain A, Human Dj-1 With Sulfinic Acid (189 aa)
Score = 130, Expect = 3.3e-06, Identities = 50/175 (28%), Positives = 84/175 (48%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLD-KFNALYIPGGK-GCQRLLTDRNERVINKIVKFAGDEGKKWLFTA---GAASTVLAELGVLGNKKITTAPGFEEKLGK----NYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNI 184
           R  ++ +  + +M+ VIP D+  RAGI V       K  +       I     +E    +  ++ + +PGG  G Q L        + +I+K    E +K L  A   G  + +  E+G     K+TT P  ++K+       YS+N +  D   ++ + P  +FEFAL IVE L  K++A  +
  S:     5 RALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQNL---SESAAVKEILK--EQENRKGLIAAIXAGPTALLAHEIGF--GSKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSRGPGTSFEFALAIVEALNGKEVAAQV 181
>gi|114690169|ref|XP_521268.2| PREDICTED: similar to DJ-1 isoform 2 [Pan troglodytes] (189 aa)
Score = 130, Expect = 3.3e-06, Identities = 50/180 (27%), Positives = 87/180 (48%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLD-KFNALYIPGGK-GCQRLLTDRNERVINKIVKFAGDEGKKWLFTA---GAASTVLAELGVLGNKKITTAPGFEEKLGK----NYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           R  ++ +  + +M+ VIP D+  RAGI V       K  +       I     +E    +  ++ + +PGG  G Q L        + +I+K    E +K L  A   G  + +  E+G     K+TT P  ++K+       YS+N +  D   ++ + P  +FEFAL IVE L  K++A  + + ++
  S:     5 RALVILAKGAEEMETVIPVDVMRRAGIKVTIAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQNL---SESAAVKEILK--EQENRKGLIAAICAGPTALLAHEIGF--GSKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSRGPGTSFEFALAIVEALNGKEVAAQVKSPLV 186
>gi|62751849|ref|NP_001015572.1| Parkinson disease (autosomal recessive, early onset) 7 [Bos taurus] >gi|75040204|sp|Q5E946|PARK7_BOVIN Protein DJ-1 (Parkinson disease protein 7 homolog) >gi|59858513|gb|AAX09091.1| DJ-1 protein [Bos taurus] (189 aa)
Score = 130, Expect = 3.4e-06, Identities = 50/175 (28%), Positives = 86/175 (49%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLD-KFNALYIPGGK-GCQRLLTDRNERVINKIVKFAGDEGKKWLFTA---GAASTVLAELGVLGNKKITTAPGFEEKLGK----NYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNI 184
           R  ++ +  + +M+ VIP D+  RAGI V       K  +       I     +E    +  ++ + +PGG  G Q L        + +I+K    E +K L  A   G  + +  E+G     K+TT P  ++K+      +YS+N +  D   ++ + P  +FEFAL IVE L+ K++A  +
  S:     5 RALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQNL---SESAAVKEILK--EQEKRKGLIAAICAGPTALLAHEIGF--GSKVTTHPLAKDKMMNGSHYSYSENRVEKDGLILTSRGPGTSFEFALKIVEVLVGKEVADQV 181
>gi|33358055|pdb|1PE0|A Chain A, Crystal Structure Of The K130r Mutant Of Human Dj-1 >gi|33358056|pdb|1PE0|B Chain B, Crystal Structure Of The K130r Mutant Of Human Dj-1 (197 aa)
Score = 130, Expect = 3.5e-06, Identities = 50/175 (28%), Positives = 83/175 (47%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLD-KFNALYIPGGK-GCQRLLTDRNERVINKIVKFAGDEGKKWLFTA---GAASTVLAELGVLGNKKITTAPGFEEKLGK----NYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNI 184
           R  ++ +  + +M+ VIP D+  RAGI V       K  +       I     +E    +  ++ + +PGG  G Q L        + +I+K    E +K L  A   G  + +  E+G     K+TT P   +K+       YS+N +  D   ++ + P  +FEFAL IVE L  K++A  +
  S:     5 RALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQNL---SESAAVKEILK--EQENRKGLIAAICAGPTALLAHEIGF--GSKVTTHPLARDKMMNGGHYTYSENRVEKDGLILTSRGPGTSFEFALAIVEALNGKEVAAQV 181
>gi|73670483|ref|YP_306498.1| PfpI peptidase. cysteine peptidase. MEROPS family C56 [Methanosarcina barkeri str. Fusaro] >gi|72397645|gb|AAZ71918.1| PfpI peptidase. Cysteine peptidase. MEROPS family C56 [Methanosarcina barkeri str. Fusaro] (166 aa)
Score = 130, Expect = 3.7e-06, Identities = 43/145 (29%), Positives = 69/145 (47%)
  Q:    21 DMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSDNNIVVDKNFVSFKSP--FHAF 165
           D+++  PY      GI    V++ KK  I  + G +I      + +N + +  L I GGKG +++  D +   I +   F  +   K +        V+   GV+  +K T  PG  + +   G  Y D  +V+D NFVS +SP   HAF
  S:    13 DLELFYPYHRLKEEGITTH-VASMKKGPIKGKQGYEINVDIAFKDINPENYQILVISGGKGPEKMRLDEHALEITR--HFFTE--NKPVAAICHGPQVIVSAGVIKGRKATCWPGIRDDIIAAGALYEDKEVVIDGNFVSSRSPADLHAF 157
>gi|50812271|ref|NP_390580.2| hypothetical protein BSU27020 [Bacillus subtilis subsp. subtilis str. 168] >gi|37999917|sp|O06006|YRAA_BACSU Uncharacterized protein yraA >gi|32468798|emb|CAB14644.2| yraA [Bacillus subtilis subsp. subtilis str. 168] (169 aa)
Score = 130, Expect = 3.8e-06, Identities = 44/152 (28%), Positives = 67/152 (44%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSDNNIVVDKNFVSFKSP 161
           +IA++ + +  D++   P   +  AG  V  +  E  K +  + G K+   + I  V+   F+AL IPGG     L  D       K    A  E KK +F       VL +  +L  K IT      + L   G NY D  +VV  N V+ ++P
  S:     4 KIAVLVTDQFEDIEYTSPVKAYEEAGYSVVAIDLEAGKEVTGKHGEKVKIDKAISDVDASDFDALLIPGGFSPDLLRADDRPGEFAK----AFVENKKPVFAICHGPQVLIDTDLLKGKDITGYRSIRKDLINAGANYKDAEVVVSHNIVTSRTP 154
>gi|114552471|ref|XP_001158259.1| PREDICTED: similar to DJ-1 isoform 6 [Pan troglodytes] >gi|114552473|ref|XP_001158312.1| PREDICTED: similar to DJ-1 isoform 7 [Pan troglodytes] >gi|114552475|ref|XP_001158372.1| PREDICTED: similar to DJ-1 isoform 8 [Pan troglodytes] >gi|114552477|ref|XP_001158424.1| PREDICTED: similar to DJ-1 isoform 9 [Pan troglodytes] >gi|114552479|ref|XP_001158489.1| PREDICTED: similar to DJ-1 isoform 10 [Pan troglodytes] >gi|75048709|sp|Q95LI9|PARK7_CERAE Protein DJ-1 (Parkinson disease protein 7 homolog) >gi|16751469|dbj|BAB71781.1| DJ-1 [Chlorocebus aethiops] (189 aa)
Score = 130, Expect = 3.9e-06, Identities = 50/175 (28%), Positives = 84/175 (48%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLD-KFNALYIPGGK-GCQRLLTDRNERVINKIVKFAGDEGKKWLFTA---GAASTVLAELGVLGNKKITTAPGFEEKLGK----NYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNI 184
           R  ++ +  + +M+ VIP D+  RAGI V       K  +       I     +E    +  ++ + +PGG  G Q L        + +I+K    E +K L  A   G  + +  E+G     K+TT P  ++K+       YS+N +  D   ++ + P  +FEFAL IVE L  K++A  +
  S:     5 RALVILAKGAEEMETVIPVDVMRRAGIKVTIAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQNL---SESAAVKEILK--EQENRKGLIAAICAGPTALLAHEIGF--GSKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSRGPGTSFEFALAIVEALNGKEVAAQV 181
>gi|77956903|ref|ZP_00820976.1| COG0693: Putative intracellular protease/amidase [Yersinia bercovieri ATCC 43970] (196 aa)
Score = 130, Expect = 3.9e-06, Identities = 47/167 (28%), Positives = 80/167 (47%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVET--VSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL-GKNYSDNNIVVDK--NFVSFKSPFHAFEFALLIVEKLLNKQIATNIA 185
           S + + V   D+  RAGI V T  V+++    I    G ++     +  V   KF+ + +PGG KG +     R+  ++   V+   +EG+       A + VL    +     +T  P  ++K+    + D  +V D+  N V+ + P  A +FAL IV  LL ++ A  IA
  S:    13 SEETEAVTTIDVLVRAGIEVTTASVASDGALEIVCSRGVRLLADTRLVDVADQKFDVVVLPGGIKGAECF---RDSPLLVATVRQTHNEGRLVAAICAAPALVLEHHNLFPVGNMTGYPALKDKISATKWMDQRVVYDRRVNLVTSQGPGTAIDFALKIVFLLLGREKAAEIA 182
>gi|193506759|pdb|3CYF|A Chain A, Crystal Structure Of E18n Dj-1 (197 aa)
Score = 129, Expect = 4.0e-06, Identities = 50/175 (28%), Positives = 84/175 (48%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLD-KFNALYIPGGK-GCQRLLTDRNERVINKIVKFAGDEGKKWLFTA---GAASTVLAELGVLGNKKITTAPGFEEKLGK----NYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNI 184
           R  ++ +  + +M+ VIP D+  RAGI V       K  +       I     +E    +  ++ + +PGG  G Q L        + +I+K    E +K L  A   G  + +  E+G     K+TT P  ++K+       YS+N +  D   ++ + P  +FEFAL IVE L  K++A  +
  S:     5 RALVILAKGAEEMNTVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQNL---SESAAVKEILK--EQENRKGLIAAIXAGPTALLAHEIGF--GSKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSRGPGTSFEFALAIVEALNGKEVAAQV 181
>gi|182414589|ref|YP_001819655.1| DJ-1 family protein [Opitutus terrae PB90-1] >gi|177841803|gb|ACB76055.1| DJ-1 family protein [Opitutus terrae PB90-1] (202 aa)
Score = 129, Expect = 4.1e-06, Identities = 41/170 (24%), Positives = 76/170 (44%)
  Q:    21 DMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILY 190
           +++ + P D+  RAG  V   +      +  ++G  +     +  +    F+ + +PGG G + L  D   RV   +V+   +    WL    AA TVL + G+L  ++ T       +L    +   +VVD N ++ +    A +F L +V KL  ++ A  I+  I +
  S:    37 EIEAIAPIDLLRRAGASVTVAALGDTLHVTGRTGVTVHADTTLAALPEQAFDCVVLPGGPGTKVLRGD--PRVRTWVVR--QNARGAWLAAICAAPTVLHDAGLLNGRRYTAHFSVAAELPALLAHERVVVDGNLITSRGAGTAVDFGLALVSKLFGEEKAREISAAICF 202
>gi|78486121|ref|YP_392046.1| DJ-1 [Thiomicrospira crunogena XCL-2] >gi|78364407|gb|ABB42372.1| DJ-1/PfpI family protein [Thiomicrospira crunogena XCL-2] (185 aa)
Score = 129, Expect = 4.1e-06, Identities = 47/171 (27%), Positives = 80/171 (46%)
  Q:     6 VSNIRIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLL 176
           +S  ++ I  +    +++ V   D+  RA I V T S +  ++I    G ++     +E V    F+ + +PGG  G   L  D     + K V  AG     ++    AA  VL   G+L  K+ T+ PG  ++    G  Y +  +VVD   ++ + P  A  FAL ++E L+
  S:     1 MSQKKVLIPLAQGCEEIEAVTLIDLLVRAEIEVVTASLDDNRTITASRGVQLIAQTTLESVLKTPFDLVVLPGGLPGADHLNKDLRLHQLLKDVLVAGG----YVGAICAAPKVLVSAGLLEGKQATSFPGVIDQHPAEGMTYLNEPVVVDGQIITSRGPGTAIAFALTLIEMLV 171
>gi|157150538|ref|YP_001450714.1| 4-methyl-5(beta-hydroxyethyl)-thiazole monophosphate synthesis protein [Streptococcus gordonii str. Challis substr. CH1] >gi|157075332|gb|ABV10015.1| 4-methyl-5(beta-hydroxyethyl)-thiazole monophosphate synthesis protein [Streptococcus gordonii str. Challis substr. CH1] (182 aa)
Score = 129, Expect = 4.3e-06, Identities = 49/182 (26%), Positives = 85/182 (46%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGK-NYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILYT 191
           ++A++ +    +++ +   D+  RA I    +  E+   +   S      ++ + + NLD ++ + +PGG      L D ++ ++  + K    E  KW+    AA   L + GVL NKK T   G EE +   NY    +V D   ++ + P  A  FA  IVEKL     A ++   +LYT
  S:     3 KVAVILANGFEEIEALTVVDVLRRANIACHILGFEQ---VVTGSHGISVQADRLWQGNLDDYDMVVLPGGMPGSANLRD-DQDLMKALTKM--QEEDKWIAAICAAPIALEKAGVLENKKFTCYDGVEESIKSGNYLKETVVTDGKLITSRGPSTALAFAYTIVEKLGGD--ADSLRQGMLYT 177
>gi|170574881|ref|XP_001893007.1| DJ-1 family protein [Brugia malayi] >gi|158601189|gb|EDP38158.1| DJ-1 family protein [Brugia malayi] (187 aa)
Score = 129, Expect = 4.5e-06, Identities = 44/161 (27%), Positives = 79/161 (49%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQ 179
           + +M+ VIP D+  RAG+ V       K ++       IT  + + +V  +KF+ + +PGG      L   +E  +  I++   + G +++    AA   L   G+     +T+ P  + KL   G  YS++ +V   + V+ + P  A EFAL +VE L+  +
  S:    14 AEEMETVIPVDVLRRAGVEVTIAGLLGKNTVKCSRQVMITPDKALFEVADNKFDVVILPGGLQGANSLAASDE--VGTILRTQYESG-RYIAAICAAPIALKSHGIAPGILLTSHPSVKPKLVEGGYKYSEDRVVTTDHIVTSRGPGTALEFALKLVELLVGTE 174
>gi|165761146|pdb|2RK4|A Chain A, Structure Of M26i Dj-1 (197 aa)
Score = 129, Expect = 4.6e-06, Identities = 50/175 (28%), Positives = 84/175 (48%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLD-KFNALYIPGGK-GCQRLLTDRNERVINKIVKFAGDEGKKWLFTA---GAASTVLAELGVLGNKKITTAPGFEEKLGK----NYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNI 184
           R  ++ +  + +M+ VIP D+  RAGI V       K  +       I     +E    +  ++ + +PGG  G Q L        + +I+K    E +K L  A   G  + +  E+G     K+TT P  ++K+       YS+N +  D   ++ + P  +FEFAL IVE L  K++A  +
  S:     5 RALVILAKGAEEMETVIPVDVIRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQNL---SESAAVKEILK--EQENRKGLIAAICAGPTALLAHEIGF--GSKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSRGPGTSFEFALAIVEALNGKEVAAQV 181
>gi|55820988|ref|YP_139430.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Streptococcus thermophilus LMG 18311] >gi|116627760|ref|YP_820379.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis protein [Streptococcus thermophilus LMD-9] >gi|55736973|gb|AAV60615.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Streptococcus thermophilus LMG 18311] >gi|116101037|gb|ABJ66183.1| Putative intracellular protease/amidase [Streptococcus thermophilus LMD-9] (182 aa)
Score = 129, Expect = 4.6e-06, Identities = 47/181 (25%), Positives = 92/181 (50%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGK-NYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKL--LNKQIATNIANDILY 190
           ++A++ +    +++ + P D++ RAG     +  E   S+    G ++T     +  NLD+++ + +PGG      L D ++ +I  + + A  +  K++    AA  VL   G+L  +K T  PG EE++   ++  + +VVD N V+ +    A  FA  +V+ L    +Q+A  +  D L+
  S:     3 KVAVVFADGFEEIEALSPVDVFRRAGFDCSMLGLESA-SVTGSHGIQVTMDGVFDG-NLDEYDLVVLPGGMPGSTKLRD-HQALIASLQEVA--KAGKYVAAICAAPIVLERAGLLEGRKFTCFPGVEEQIASGDHQTDLVVVDDNIVTSRGAGTALAFAYALVDLLGGDGQQLAHTMVYDRLF 181
>gi|149695427|ref|XP_001495448.1| PREDICTED: similar to Parkinson disease protein 7 [Equus caballus] (189 aa)
Score = 129, Expect = 4.7e-06, Identities = 50/175 (28%), Positives = 84/175 (48%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLD-KFNALYIPGGK-GCQRLLTDRNERVINKIVKFAGDEGKKWLFTA---GAASTVLAELGVLGNKKITTAPGFEEKLGK----NYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNI 184
           R  ++ +  + +M+ VIP D+  RAGI V       K  +       I     +E       ++ + +PGG  G Q L        + +I+K    E +K L  A   G  + +  E+G     K+TT P  ++K+      +YS+N +  D   ++ + P  +FEFAL IVE L  K++A  +
  S:     5 RALVILAKGAEEMETVIPVDVMRRAGIKVTIAGLAGKDPVQCSRDVVICPDASLEDAKKQGPYDVVVLPGGNLGAQNL---SESAAVKEILK--EQEKRKGLIAAICAGPTALLAHEIGF--GSKVTTHPQAKDKIMNGSHYSYSENRVEKDGLILTSRGPGTSFEFALAIVEALSGKEVADQV 181
>gi|18978091|ref|NP_579448.1| intracellular protease [Pyrococcus furiosus DSM 3638] >gi|3024389|sp|Q51732|PFPI_PYRFU Intracellular protease 1 (Intracellular protease I) >gi|1373331|gb|AAB04694.1| protease I >gi|18893884|gb|AAL81843.1| intracellular protease; (PfpI) [Pyrococcus furiosus DSM 3638] (166 aa)
Score = 129, Expect = 4.7e-06, Identities = 45/153 (29%), Positives = 77/153 (50%)
  Q:     9 IRIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSDNNIVVDKNFVSFKSP 161
           ++I  + + E  D++++ PY      G  V   S EK   I  + G  +      ++VN D+F+AL +PGG+  +R+    NE+ + +I +    EGK  + T      +L   GVL  +K T+  G  + +   G  + D  +VVD N+VS + P
  S:     1 MKILFLSANEFEDVELIYPYHRLKEEGHEVYIASFEKG-VITGKHGYSVKVDLTFDEVNPDEFDALVLPGGRAPERVRL--NEKAV-EIARKMFTEGKP-VATICHGPQILISAGVLKGRKGTSYIGIRDDMINAGVEWIDREVVVDGNWVSSRHP 151
>gi|193506758|pdb|3CY6|A Chain A, Crystal Structure Of E18q Dj-1 (197 aa)
Score = 129, Expect = 4.8e-06, Identities = 50/175 (28%), Positives = 83/175 (47%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLD-KFNALYIPGGK-GCQRLLTDRNERVINKIVKFAGDEGKKWLFTA---GAASTVLAELGVLGNKKITTAPGFEEKLGK----NYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNI 184
           R  ++ +  + +M  VIP D+  RAGI V       K  +       I     +E    +  ++ + +PGG  G Q L        + +I+K    E +K L  A   G  + +  E+G     K+TT P  ++K+       YS+N +  D   ++ + P  +FEFAL IVE L  K++A  +
  S:     5 RALVILAKGAEEMQTVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQNL---SESAAVKEILK--EQENRKGLIAAICAGPTALLAHEIGF--GSKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSRGPGTSFEFALAIVEALNGKEVAAQV 181
>gi|77979405|ref|ZP_00834824.1| COG0693: Putative intracellular protease/amidase [Yersinia intermedia ATCC 29909] (198 aa)
Score = 128, Expect = 5.3e-06, Identities = 47/167 (28%), Positives = 80/167 (47%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVET--VSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL-GKNYSDNNIVVDK--NFVSFKSPFHAFEFALLIVEKLLNKQIATNIA 185
           S + + V   D+  RAGI V T  V+++    I    G ++     +  V   KF+ + +PGG KG +     R+  ++   V+   +EG+       A + VL    +     +T  P  ++K+    + D  +V D+  N V+ + P  A +FAL IV  LL ++ A  IA
  S:    13 SEETEAVTTIDVLVRAGIKVTTASVASDGALEIVCSRGVRLLADTRLVDVADQKFDVVVLPGGIKGAECF---RDSPLLIATVRQTHNEGRLVAAICAAPALVLEHHNLFPVGNMTGFPALKDKIDATKWMDQRVVYDRRVNLVTSQGPGTAIDFALKIVFLLLGREKAEEIA 182
>gi|167748633|ref|ZP_02420760.1| hypothetical protein ANACAC_03406 [Anaerostipes caccae DSM 14662] >gi|167651947|gb|EDR96076.1| hypothetical protein ANACAC_03406 [Anaerostipes caccae DSM 14662] (184 aa)
Score = 128, Expect = 5.3e-06, Identities = 53/165 (32%), Positives = 77/165 (46%)
  Q:    29 DIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYI-PGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGK-NYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILYTKK 193
           D+  RAGI V  VS    K I      ++       +V L+   A+Y+ PGG      L  R    + K++K A D GK +L    AA TVL + G L  KK T  PG E+ LG+  Y   ++VVD   ++ +    A  F   + E LL  +    +   I+Y +K
  S:    22 DMLRRAGIEVIMVSVGPSKMITGSHHIEVEADCMFHEV-LEPEGAMYVLPGGMPGTIAL--REHEGLAKLLKKAYDNGK-YLAAICAAPTVLGKYGFLDGKKATCYPGQEDGLGEAEYVTESVVVDGRVITSRGMGTAIPFVGKLAELLLGTEAKEKLLESIIYEEK 184
>gi|149194370|ref|ZP_01871467.1| DJ-1 [Caminibacter mediatlanticus TB-2] >gi|149135545|gb|EDM24024.1| DJ-1 [Caminibacter mediatlanticus TB-2] (183 aa)
Score = 128, Expect = 5.3e-06, Identities = 50/161 (31%), Positives = 80/161 (49%)
  Q:    29 DIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKN--YSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           D+  R G+ V  V+      I+     ++    +IE VN+D+ + + +PGG  G   L  D  E V N + +   D+  K++    AA   L E GVL +K  T  PG+EE + K    +D  +V DKN ++ K P  A  F L IV+K   +++   +   +L
  S:    22 DVMRRGGLEV-IVAGVGGDVIYGAHNVRVIPDTKIELVNVDELDLVVLPGGLPGAINLAKD--EYVQNLLKEM--DKKGKYVGAICAAPYALKEAGVLKDK-YTAYPGWEENIKKEGYVADAKVVEDKNVLTSKGPGTAICFGLEIVKKFSGEEVYKQLKEGLL 179
>gi|77974317|ref|ZP_00829858.1| COG0693: Putative intracellular protease/amidase [Yersinia frederiksenii ATCC 33641] (196 aa)
Score = 128, Expect = 5.5e-06, Identities = 47/167 (28%), Positives = 81/167 (48%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVET--VSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL-GKNYSDNNIVVDK--NFVSFKSPFHAFEFALLIVEKLLNKQIATNIA 185
           S + + V   DI  RAGI V T  V+++    I    G ++     +  V  +KF+ + +PGG KG +     R+  ++   V+   +EG+       A + VL    +     +T  P  ++K+    + D  +V D+  N V+ + P  + +FAL IV  LL ++ A  IA
  S:    13 SEETEAVTTIDILVRAGIQVTTASVASDGALEIVCSRGVRLLADARLVDVADEKFDVVVLPGGIKGAECF---RDSPLLVATVQQTHNEGRLVAAICAAPALVLEHHNLFPVGNMTGFPALKDKITATKWMDQRVVYDRRVNLVTSQGPGTSIDFALKIVFLLLGREKAEEIA 182
>gi|194466994|ref|ZP_03072981.1| ThiJ/PfpI domain protein [Lactobacillus reuteri 100-23] >gi|194454030|gb|EDX42927.1| ThiJ/PfpI domain protein [Lactobacillus reuteri 100-23] (170 aa)
Score = 128, Expect = 5.9e-06, Identities = 40/122 (32%), Positives = 63/122 (51%)
  Q:    54 GTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGK-----NYSDNNIVVDKN--FVSFKSPFHAFEFALLIVEKL 175
           G ++TC E +    LD ++ +  PGG+G  + L D N++++  + K   +   KW     AA   LA  G+L N   T  PG  E++ K     N+ D+  VVD +   ++ + P  A  FA  I E L
  S:    26 GIELTCDEVMSDRLLD-YDVVAFPGGRGGAQKLRD-NDKLMKLMQKRNAE--NKWDAAMCAAPIALARYGLLDNHNYTCFPGINEEIAKVAPTANFEDDITVVDNDGKIITSRGPATALAFAYQIAEVL 150
>gi|183212531|gb|ACC54928.1| Parkinson disease 7 protein [Xenopus borealis] (161 aa)
Score = 128, Expect = 6.3e-06, Identities = 49/157 (31%), Positives = 76/157 (48%)
  Q:    33 RAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLD-KFNALYIPGGK-GCQRLLTDRNERVINKIVKFAGDEGKKWLFTA-GAASTVLAELGVLGNKKITTAPGFEEKLGK----NYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           RAGI V       K  +       +     +E+      ++ + +PGG  G Q L       V+ +++K    E KK L  A  A  T L   GV   K ITT P  ++K+       YS++ +V D+N ++ + P  +FEFAL IV  LL K++A  +   +L
  S:     2 RAGIKVTVAGLSGKDPVQCSRDVMLCPDTSLEEARTQGPYDVVVLPGGNLGAQNL---SESPVVKEVLK--EQEAKKGLIAAICAGPTALTVHGVGIGKTITTHPLAKDKIVNPDKYKYSEDRVVKDENLITSRGPGTSFEFALEIVCTLLGKEVAEQVKTPLL 160
>gi|57086915|ref|XP_536733.1| PREDICTED: similar to DJ-1 protein isoform 1 [Canis familiaris] >gi|73956704|ref|XP_858995.1| PREDICTED: similar to DJ-1 protein isoform 5 [Canis familiaris] >gi|73956706|ref|XP_859031.1| PREDICTED: similar to DJ-1 protein isoform 6 [Canis familiaris] (189 aa)
Score = 128, Expect = 6.3e-06, Identities = 50/175 (28%), Positives = 84/175 (48%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLD-KFNALYIPGGK-GCQRLLTDRNERVINKIVKFAGDEGKKWLFTA---GAASTVLAELGVLGNKKITTAPGFEEKLGK----NYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNI 184
           R  ++ +  + +M+ VIP D+  RAGI V       K  +       I     +E    +  ++ + +PGG  G Q L        + +I+K    E +K L  A   G  + +  E+G     K+TT P  ++K+      +YS+N +  D   ++ + P  +FEFAL IVE L  K +A  +
  S:     5 RALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVIICPDASLEDAKKEGPYDVVILPGGNLGAQNLC---ESAAVKEILK--EQENRKGLIAAICAGPTALLAHEIGF--GSKVTTHPLAKDKMMNGSHYSYSENRVEKDGLILTSRGPGTSFEFALAIVEALSGKDVADQV 181
>gi|169608628|ref|XP_001797733.1| hypothetical protein SNOG_07399 [Phaeosphaeria nodorum SN15] >gi|160701685|gb|EAT84865.2| hypothetical protein SNOG_07399 [Phaeosphaeria nodorum SN15] (236 aa)
Score = 128, Expect = 6.3e-06, Identities = 52/173 (30%), Positives = 85/173 (49%)
  Q:    13 IMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKF---------NALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTA-PGFEEKL---GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIA 185
           I+ +  S +++ V PYD+ TRAG  V++V  + K   +      +    +    NL  F         + L +PGG  G +   T  N  V+  I  F      K++    A +T L   G+   KKI T+ P   +++   G  YS+  +VVD   V+ + P  A  F+L IVE ++ K+    +A
  S:    49 ILIADGSEEIEFVTPYDVLTRAGFEVQSVGVDLKNEGYAHMTRNVRIVPD--HTNLTSFPHQLAHEHYDILILPGGGPGAKTFST--NPSVLQLIKSFV--RSGKFVAAICAGTTALVAAGI--EKKIVTSHPSVMQEIKGAGWEYSEERVVVDGKVVTSRGPGTALLFSLTIVEVMVGKEKRDEVA 227
>gi|55741460|ref|NP_065594.2| Parkinson disease protein 7 [Mus musculus] >gi|56404944|sp|Q99LX0|PARK7_MOUSE Protein DJ-1 (Parkinson disease protein 7 homolog) >gi|12805429|gb|AAH02187.1| Parkinson disease (autosomal recessive, early onset) 7 [Mus musculus] >gi|54792586|dbj|BAA29063.2| DJ-1 [Mus musculus] >gi|74150475|dbj|BAE32271.1| unnamed protein product [Mus musculus] >gi|74226952|dbj|BAE27118.1| unnamed protein product [Mus musculus] >gi|123246552|emb|CAM19230.1| Parkinson disease (autosomal recessive, early onset) 7 [Mus musculus] >gi|148682949|gb|EDL14896.1| Parkinson disease (autosomal recessive, early onset) 7, isoform CRA_a [Mus musculus] >gi|148682950|gb|EDL14897.1| Parkinson disease (autosomal recessive, early onset) 7, isoform CRA_a [Mus musculus] (189 aa)
Score = 128, Expect = 6.6e-06, Identities = 51/175 (29%), Positives = 87/175 (49%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLD-KFNALYIPGGK-GCQRLLTDRNERVINKIVKFAGDEGKKWLFTA---GAASTVLAELGVLGNKKITTAPGFEEKL--GKNYSDNNIVVDKN--FVSFKSPFHAFEFALLIVEKLLNKQIATNI 184
           R  ++ +  + +M+ VIP D+  RAGI V       K  +       I     +E       ++ + +PGG  G Q L       ++ +I+K    E +K L  A   G  + +  E+G     K+TT P  ++K+  G +YS +   V+K+   ++ + P  +FEFAL IVE L+ K +A  +
  S:     5 RALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVMICPDTSLEDAKTQGPYDVVVLPGGNLGAQNL---SESPMVKEILK--EQESRKGLIAAICAGPTALLAHEVGF--GCKVTTHPLAKDKMMNGSHYSYSESRVEKDGLILTSRGPGTSFEFALAIVEALVGKDMANQV 181
>gi|115435296|ref|NP_001042406.1| Os01g0217500 [Oryza sativa (japonica cultivar-group)] >gi|56201611|dbj|BAD73058.1| putative 4-methyl-5(B-hydroxyethyl)-thiazol monophosphate biosynthesis enzyme [Oryza sativa Japonica Group] >gi|113531937|dbj|BAF04320.1| Os01g0217500 [Oryza sativa (japonica cultivar-group)] (395 aa)
Score = 128, Expect = 6.7e-06, Identities = 45/172 (26%), Positives = 81/172 (47%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVETVSNEKKK-SIFLQSGTKITCSEEIEKVNLD----KFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILY 190
           + +M+++   D+  RA   V   S E     I  + G +I     +++   D     F+ + +PGG    + ++  NE+++  + K A    K +     A + VL   G+L  KK     G +E       ++ +VVD N ++      A EFA+  VEKLL + +A  +A  +L+
  S:   226 TEEMELITIIDVLRRADADVVVASAENAGVEIVARHGMRIVADTTLDEAAADDQTSSFDLIILPGGTPGAKTMSS-NEKLVTLLKKQAA-ASKPYGAIGAATAHVLEPHGLLEGKKAADQDGGDE------CESRVVVDGNVITSGGTGTAMEFAVAAVEKLLGRDVAQRVAEGLLF 394
>gi|162418304|ref|YP_001607435.1| hypothetical protein YpAngola_A3069 [Yersinia pestis Angola] >gi|162351119|gb|ABX85067.1| DJ-1 family protein [Yersinia pestis Angola] (196 aa)
Score = 128, Expect = 6.7e-06, Identities = 48/167 (28%), Positives = 79/167 (47%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVET--VSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKN-YSDNNIVVDK--NFVSFKSPFHAFEFALLIVEKLLNKQIATNIA 185
           S + + V   DI  RAGI V T  V+ +    I    G ++     +  V   KF+ + +PGG KG +     R+  ++   V+   +EG+       A + VL    +     +T  P  ++K+  N + D  +V D+  N V+ + P    +FAL IV  LL ++ A  IA
  S:    13 SEETEAVTTIDILVRAGINVTTASVAGDGALEIICSRGVRLLADTRLVDVADQKFDVIVLPGGIKGAECF---RDSPLLVATVRQTHNEGRLVAAICAAPALVLEHHQLFPVGNMTGFPSLKDKIAPNKWMDQRVVYDRRVNLVTSQGPGTFIDFALKIVFLLLGREKAEEIA 182
>gi|134046082|ref|YP_001097568.1| ThiJ/PfpI domain-containing protein [Methanococcus maripaludis C5] >gi|132663707|gb|ABO35353.1| ThiJ/PfpI domain protein [Methanococcus maripaludis C5] (171 aa)
Score = 127, Expect = 7.0e-06, Identities = 48/155 (30%), Positives = 82/155 (52%)
  Q:    21 DMDIVIPYDIWTRAGIIVETVSNE--KKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAG--AASTVLAELGVLGNKKITTAPGFE-----EKLGKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKL 175
           D ++  P  ++    I  + VS    + K +    G  +T ++ IE+VN + F+A+ I GG G +  L + NE+++  + +F     K+   TA    +  VLA+ G+L  KK+T  P  E     ++ G  Y D  ++VD   ++ ++P  A EF L I E L
  S:    14 DEELFEPLQVFQSKNIATQVVSTTIGQHKGVM---GKVMTTTKTIEEVNSNDFDAIVIVGGGGSRDFLWN-NEKLLELLKEF----NKQGKVTAAICISPAVLAQAGLLNGKKVTVFPDDESIAVLQQNGAIYLDEAVIVDGKVITGRNPDAAKEFGLKIAEAL 169
>gi|115468368|ref|NP_001057783.1| Os06g0531200 [Oryza sativa (japonica cultivar-group)] >gi|113595823|dbj|BAF19697.1| Os06g0531200 [Oryza sativa (japonica cultivar-group)] (434 aa)
Score = 127, Expect = 7.1e-06, Identities = 45/164 (27%), Positives = 81/164 (49%)
  Q:    22 MDIVIPYDIWTRAGIIVETVS-NEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGK--NYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIA 185
           M+ VI  D+  RAG  V   S +     +    G K+     ++ +   +F+ + +PGG  G   L   R+ +++  +VK    +GK +     A +  L   G+L   K T  P F +KL    N  ++ + +D N V+ + P  A E+++++VE+L  K+ A  +A
  S:    60 MEAVITVDVLRRAGADVSVASVDPGSAQVGGAWGVKLAADALLDDLADAEFDLISLPGGMPGSSNL---RDCKLLENMVKKHAGKGKLYAAICAAPAVALGSWGLLNGLKATCYPSFMDKLPSEVNAVESRVQIDGNCVTSRGPGTAMEYSVVLVEQLYGKEKADEVA 224
Score = 117, Expect = 1.1e-04, Identities = 36/102 (35%), Positives = 59/102 (57%)
  Q:    89 RNERVINKIVKFAGDEGKKWLFTAGAASTVLA--ELGVLGNKKITTAPGFEEKLG-KNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILY 190
           +++++I  I K A  E  K L+ A  AS  +A    G+L  KK T+ PG   KL  ++   N +VVD N ++ + P  + EF+L IVEKL  ++ A  +A  +++
  S:   332 KSDKLIGLIKKQA--EANK-LYGAICASPAIALEPHGLLKGKKATSFPGMWNKLSDQSECKNRVVVDGNLITSQGPGTSMEFSLAIVEKLFGRERAVELAKTMVF 433
>gi|18404397|ref|NP_564626.1| DJ-1 family protein [Arabidopsis thaliana] >gi|7769869|gb|AAF69547.1|AC008007_22 F12M16.18 [Arabidopsis thaliana] >gi|15810459|gb|AAL07117.1| unknown protein [Arabidopsis thaliana] >gi|20259561|gb|AAM14123.1| unknown protein [Arabidopsis thaliana] (438 aa)
Score = 127, Expect = 7.3e-06, Identities = 44/183 (24%), Positives = 84/183 (45%)
  Q:     7 SNIRIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYS--DNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           S  ++ I  +  +   + V+  D+  R G  V   S E +  +    G K+     +  +    F+ + +PGG  G + L   +N + + K+VK    +G+       A +      G+L  KK T  P F EKL    +  ++ + +D   V+ + P    EF++ +VE+LL K+ A  ++  ++
  S:    51 STKKVLIPVAHGTEPFEAVVMIDVLRRGGADVTVASVENQVGVDACHGIKMVADTLLSDITDSVFDLIMLPGGLPGGETL---KNCKPLEKMVKKQDTDGRLNAAICCAPALAFGTWGLLEGKKATCYPVFMEKLAACATAVESRVEIDGKIVTSRGPGTTMEFSVTLVEQLLGKEKAVEVSGPLV 233
Score = 122, Expect = 2.9e-05, Identities = 40/171 (23%), Positives = 82/171 (47%)
  Q:    19 SNDMDIVIPYDIWTRA--GIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL-GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           S +M+ V   D+  RA   ++V  + N  +  +      K+     +++   + ++ + +PGG G        +E+++N + K A +  K +     + + V    G+L  KK T  P    KL  +++ ++ ++VD N ++ + P  + EFAL IVEK   ++    ++   L
  S:   268 SEEMEAVAIIDVLKRAKANVVVAALGNSLE--VVASRKVKLVADVLLDEAEKNSYDLIVLPGGLGGAEAFAS-SEKLVNMLKKQA-ESNKPYGAICASPALVFEPHGLLKGKKATAFPAMCSKLTDQSHIEHRVLVDGNLITSRGPGTSLEFALAIVEKFYGREKGLQLSKATL 437
>gi|148544735|ref|YP_001272105.1| DJ-1 family protein [Lactobacillus reuteri F275] >gi|184154087|ref|YP_001842428.1| putative 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein [Lactobacillus reuteri F275] >gi|148531769|gb|ABQ83768.1| DJ-1 family protein [Lactobacillus reuteri F275] >gi|183225431|dbj|BAG25948.1| putative 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein [Lactobacillus reuteri F275] (190 aa)
Score = 127, Expect = 7.8e-06, Identities = 40/122 (32%), Positives = 63/122 (51%)
  Q:    54 GTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGK-----NYSDNNIVVDKN--FVSFKSPFHAFEFALLIVEKL 175
           G ++TC E +    LD ++ +  PGG+G  + L D N+R++  + K   +   KW     AA   LA  G+L N   T  PG  E++ K     N+ ++  VVD +   ++ + P  A  FA  I E L
  S:    46 GIELTCDEVMSDRLLD-YDVVAFPGGRGGAQKLRD-NDRLMKLMQKRNAE--NKWDAAMCAAPIALARYGLLDNHNYTCFPGINEEIAKVAPTANFEEDITVVDNDGKIITSRGPATALAFAYQIAEVL 170
>gi|154175067|ref|YP_001407863.1| DJ-1 family protein [Campylobacter curvus 525.92] >gi|112803406|gb|EAU00750.1| DJ-1 family protein [Campylobacter curvus 525.92] (185 aa)
Score = 127, Expect = 8.2e-06, Identities = 42/129 (32%), Positives = 67/129 (51%)
  Q:    62 EIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKN----YSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILY 190
           E+ ++ LD   A+ +PGG    + L D  E  + +I++   D GK  +    AA   LA+ GVL     T  PGFE  +  +     SD N++ D N ++ + P  A EFAL IV++L       ++ + +LY
  S:    57 ELREIELD---AIVLPGGLPGAQNLADSKE--LGEILRRFDDNGK-LICAICAAPMALAKAGVL-KGAFTCYPGFETNVRSDKNGYISDKNVICDHNIITSRGPATAMEFALEIVKELNGTSSYESVRDGLLY 182
>gi|53791962|dbj|BAD54224.1| putative 4-methyl-5(B-hydroxyethyl)-thiazol monophosphate biosynthesis enzyme [Oryza sativa Japonica Group] (394 aa)
Score = 127, Expect = 8.4e-06, Identities = 45/164 (27%), Positives = 81/164 (49%)
  Q:    22 MDIVIPYDIWTRAGIIVETVS-NEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGK--NYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIA 185
           M+ VI  D+  RAG  V   S +     +    G K+     ++ +   +F+ + +PGG  G   L   R+ +++  +VK    +GK +     A +  L   G+L   K T  P F +KL    N  ++ + +D N V+ + P  A E+++++VE+L  K+ A  +A
  S:    20 MEAVITVDVLRRAGADVSVASVDPGSAQVGGAWGVKLAADALLDDLADAEFDLISLPGGMPGSSNL---RDCKLLENMVKKHAGKGKLYAAICAAPAVALGSWGLLNGLKATCYPSFMDKLPSEVNAVESRVQIDGNCVTSRGPGTAMEYSVVLVEQLYGKEKADEVA 184
Score = 116, Expect = 1.4e-04, Identities = 36/102 (35%), Positives = 59/102 (57%)
  Q:    89 RNERVINKIVKFAGDEGKKWLFTAGAASTVLA--ELGVLGNKKITTAPGFEEKLG-KNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILY 190
           +++++I  I K A  E  K L+ A  AS  +A    G+L  KK T+ PG   KL  ++   N +VVD N ++ + P  + EF+L IVEKL  ++ A  +A  +++
  S:   292 KSDKLIGLIKKQA--EANK-LYGAICASPAIALEPHGLLKGKKATSFPGMWNKLSDQSECKNRVVVDGNLITSQGPGTSMEFSLAIVEKLFGRERAVELAKTMVF 393
>gi|167769950|ref|ZP_02442003.1| hypothetical protein ANACOL_01291 [Anaerotruncus colihominis DSM 17241] >gi|167667941|gb|EDS12071.1| hypothetical protein ANACOL_01291 [Anaerotruncus colihominis DSM 17241] (180 aa)
Score = 127, Expect = 8.6e-06, Identities = 45/164 (27%), Positives = 76/164 (46%)
  Q:    21 DMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLG-KNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNI 184
           +++ +   D+  RA + V+TV    +K I    G  + C    ++  +D    + +PGG  G   L       V+ + V +A   G  WL    AA ++L   G+L   + T  PGF+++LG    S + +  D  FV+ +    A +F L +VE L +   A  I
  S:    12 EIEALAAVDVLRRARLEVQTVGVGGRK-ITGSHGITVVCDLVDDEARIDGLEMVVLPGGVPGTPNL---EASPVVQRFVDYAAQNGL-WLAAICAAPSILGHKGLLDGLEATANPGFQDQLGAARLSGDYVCADGRFVTARGMGVAVDFGLKLVEVLTDAARAGEI 172
>gi|165761282|pdb|3B3A|A Chain A, Structure Of E163kR145E DJ-1 (192 aa)
Score = 126, Expect = 9.0e-06, Identities = 49/175 (28%), Positives = 84/175 (48%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLD-KFNALYIPGGK-GCQRLLTDRNERVINKIVKFAGDEGKKWLFTA---GAASTVLAELGVLGNKKITTAPGFEEKLGK----NYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNI 184
           R  ++ +  + +M+ VIP D+  RAGI V       K  +       I     +E    +  ++ + +PGG  G Q L        + +I+K    E +K L  A   G  + +  E+G     K+TT P  ++K+       YS+N +  D   ++ + P  +F+FAL IVE L  K++A  +
  S:     8 RALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQNL---SESAAVKEILK--EQENRKGLIAAICAGPTALLAHEIGF--GSKVTTHPLAKDKMMNGGHYTYSENEVEKDGLILTSRGPGTSFKFALAIVEALNGKEVAAQV 184
>gi|148985843|ref|ZP_01818937.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein, putative [Streptococcus pneumoniae SP3-BS71] >gi|148992474|ref|ZP_01822169.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein, putative [Streptococcus pneumoniae SP9-BS68] >gi|168489812|ref|ZP_02714011.1| DJ-1 family protein [Streptococcus pneumoniae SP195] >gi|168492963|ref|ZP_02717106.1| DJ-1 family protein [Streptococcus pneumoniae CDC3059-06] >gi|147921989|gb|EDK73113.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein, putative [Streptococcus pneumoniae SP3-BS71] >gi|147928791|gb|EDK79804.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein, putative [Streptococcus pneumoniae SP9-BS68] >gi|183571779|gb|EDT92307.1| DJ-1 family protein [Streptococcus pneumoniae SP195] >gi|183576962|gb|EDT97490.1| DJ-1 family protein [Streptococcus pneumoniae CDC3059-06] (184 aa)
Score = 126, Expect = 9.0e-06, Identities = 45/167 (26%), Positives = 81/167 (48%)
  Q:     9 IRIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEK-LGKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKL 175
           +++A+M +    +++ +   D+  RA I  + V  E++ +    S      ++ +   NL  ++ + +PGG      L D N+ +I ++  F   EGKK L    AA   L +  +L NK+ T   G +E+ L  +Y    +VVD    + + P  A  FA  +VE+L
  S:     2 VKVAVMLAQGFEEIEALTVVDVLRRANITCDMVGFEEQVT---GSHAIQVRADHVFDGNLSDYDMIVLPGGMPGSAHLRD-NQTLIQELQSFE-QEGKK-LAAICAAPIALNQAEILKNKRYTCYDGVQEQILDGHYVKETVVVDGQLTTSRGPSTALAFAYELVEQL 163
>gi|167974708|ref|ZP_02556985.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|168337201|ref|ZP_02693816.1| predicted intracellular protease [Ureaplasma urealyticum serovar 10] >gi|168807410|ref|ZP_02828469.1| predicted intracellular protease [Ureaplasma urealyticum serovar 2] >gi|188524493|ref|ZP_02558407.2| conserved hypothetical protein [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|188530881|ref|ZP_02546668.2| predicted intracellular protease [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gi|195867637|ref|ZP_03079639.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|188997805|gb|EDU66902.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|195659612|gb|EDX52992.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|195660694|gb|EDX53949.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (187 aa)
Score = 126, Expect = 9.8e-06, Identities = 56/172 (32%), Positives = 82/172 (47%)
  Q:     8 NIRIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKG--CQRLLTDR----NERVINKIVKFAGD-----EGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKN-YSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLL-NKQ 179
           N  + I+    +ND ++        +AG  V  +S  K+  I +QS  KI C+E IEK NL KFN L +   +    Q+++         + I K+ KF  D     E  K+L     A   L EL +L + K T      +KLGKN   D NIV D   ++      A +   +I   +  NKQ
  S:     2 NKMVGIIVPQYANDYELATFNLFLKKAGFYVTLISLTKQLIIQMQSMNKIVCNELIEKCNLSKFNFLILISSQNLTLQKIIKTSFILTQSQKIPKLNKFLNDFFNLKEDNKYLIAINDAPLYLNELNLLKDFKFTCNNTLNKKLGKNCLCDKNIVQDCCLITANDSICALKIVEIITNTMCENKQ 186
>gi|187735447|ref|YP_001877559.1| DJ-1 family protein [Akkermansia muciniphila ATCC BAA-835] >gi|187425499|gb|ACD04778.1| DJ-1 family protein [Akkermansia muciniphila ATCC BAA-835] (187 aa)
Score = 126, Expect = 1.0e-05, Identities = 50/182 (27%), Positives = 87/182 (47%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEE--IEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPG------FEEKLGKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILYT 191
           ++AI+ +    +++++ P DI  R  + V     +  K +   S  ++T S +  ++K++ DK +AL +PGG G   +L D  E VI+ + K    E  K +    AA  VLA+ G++ ++ +T  P         E       D N+V+D N ++   P  A  F   I E L        +   + YT
  S:     3 KVAILAAPGFEEIELMAPLDILRRLNMDVVLAGVQSDKVV---STHEVTVSTDTMLDKLHADKLDALILPGGAG-SWVLRDTPE-VIHLVKKM--HEAGKLVAAICAAPIVLAKAGLVRDRNVTAYPAQDVYRELNEAGAHIVKDENVVLDGNMLTANGPGAAMLFGYSIGEYLGEDLQVAQLKEQMCYT 185
>gi|154147989|ref|YP_001407156.1| protein ThiJ [Campylobacter hominis ATCC BAA-381] >gi|153803998|gb|ABS51005.1| protein ThiJ [Campylobacter hominis ATCC BAA-381] (182 aa)
Score = 126, Expect = 1.0e-05, Identities = 49/181 (27%), Positives = 87/181 (48%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILY 190
           ++A++ +    + + V   D+  R GI    V  +    I    G KI    +  +  +  F+ + +PGG     +L+ ++E+    + +F  D+ K  +    AA  VL   GVL N   T  PGFE+K+   G     +N+V D+N ++ + P  A EFAL IV+ L  + +   +   +L+
  S:     3 KVAVILADGYEESEAVTLIDVLRRGGIKSVVVGYDGINVIGAH-GIKIVADTDFSEFKVSDFDMILLPGGFKNNEILS-KSEKFHKILREF--DDKKLKIGAICAAPWVLGSAGVLKNS-YTCYPGFEKKINLAGFAGDKSNVVRDENVMTSRGPATAMEFALAIVKDLAGENVYNEVKAGLLF 181
>gi|165761148|pdb|2RK6|A Chain A, Structure Of E163k Dj-1 (192 aa)
Score = 126, Expect = 1.0e-05, Identities = 49/175 (28%), Positives = 84/175 (48%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLD-KFNALYIPGGK-GCQRLLTDRNERVINKIVKFAGDEGKKWLFTA---GAASTVLAELGVLGNKKITTAPGFEEKLGK----NYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNI 184
           R  ++ +  + +M+ VIP D+  RAGI V       K  +       I     +E    +  ++ + +PGG  G Q L        + +I+K    E +K L  A   G  + +  E+G     K+TT P  ++K+       YS+N +  D   ++ + P  +F+FAL IVE L  K++A  +
  S:     8 RALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQNL---SESAAVKEILK--EQENRKGLIAAIXAGPTALLAHEIGF--GSKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSRGPGTSFKFALAIVEALNGKEVAAQV 184
>gi|159904725|ref|YP_001548387.1| ThiJ/PfpI domain-containing protein [Methanococcus maripaludis C6] >gi|159886218|gb|ABX01155.1| ThiJ/PfpI domain protein [Methanococcus maripaludis C6] (183 aa)
Score = 126, Expect = 1.0e-05, Identities = 50/155 (32%), Positives = 82/155 (52%)
  Q:    21 DMDIVIPYDIWTRAGI---IVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAG--AASTVLAELGVLGNKKITTAPGFE-----EKLGKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKL 175
           D ++  P  ++    I   +V TV  + K  +    G  +T ++ IE+VN + F+A+ I GG G +  L + NE++I  + +F     K+   TA    +  VLA+ G+L  KK T  P  E     ++ G  Y D  ++VD   ++ ++P  A EF L I E L
  S:    26 DEELFEPLQVFQSKNIATQVVSTVIGQHKGVM----GKVMTTTKTIEEVNPNDFDAILIVGGGGSRDFLWN-NEKLIELLKEF----NKQGKVTAAICISPAVLAQAGLLNGKKATVFPDDESIAVLQQNGAIYLDEAVIVDGKVITGRNPNAAKEFGLKIAEAL 181
>gi|193506761|pdb|3CZ9|A Chain A, Crystal Structure Of E18l Dj-1 (197 aa)
Score = 125, Expect = 1.3e-05, Identities = 50/175 (28%), Positives = 83/175 (47%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLD-KFNALYIPGGK-GCQRLLTDRNERVINKIVKFAGDEGKKWLFTA---GAASTVLAELGVLGNKKITTAPGFEEKLGK----NYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNI 184
           R  ++ +  + +M  VIP D+  RAGI V       K  +       I     +E    +  ++ + +PGG  G Q L        + +I+K    E +K L  A   G  + +  E+G     K+TT P  ++K+       YS+N +  D   ++ + P  +FEFAL IVE L  K++A  +
  S:     5 RALVILAKGAEEMLTVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQNL---SESAAVKEILK--EQENRKGLIAAICAGPTALLAHEIGF--GSKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSRGPGTSFEFALAIVEALNGKEVAAQV 181
>gi|71026949|ref|XP_763118.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein [Theileria parva strain Muguga] >gi|68350071|gb|EAN30835.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein, putative [Theileria parva] (216 aa)
Score = 125, Expect = 1.3e-05, Identities = 46/171 (26%), Positives = 81/171 (47%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG----KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTA-PGFEEKL---GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           + D+++V   D+  RAG+ V   S     ++ L  GTK+T  +++  +    F+ + +PGG      C       N   + +++K     G+ +     + + V  + G+L +K    A PGFE KL   GK      + V  N V+ + P  A EF+L +VE L   +    +   +L
  S:    41 TEDIELVTLVDVLRRAGVSVVVASVSDSLNLVLAHGTKLTADDKVTNLTQKTFDLIAVPGGLVGATNCA------NSVGLVRMLKDQKSSGRLYAAICASPALVFGDCGLLDDKTSAVAFPGFESKLPLVGK----GRVHVSHNCVTSQGPGTALEFSLKLVELLCGVEAKNKLTKSML 209
>gi|157693539|ref|YP_001488001.1| C56 family peptidase [Bacillus pumilus SAFR-032] >gi|157682297|gb|ABV63441.1| C56 family peptidase [Bacillus pumilus SAFR-032] (174 aa)
Score = 125, Expect = 1.3e-05, Identities = 37/157 (23%), Positives = 73/157 (46%)
  Q:     5 KVSNIRIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSDNNIVVDKNFVSFKSP 161
           ++S+ ++  + S +  D+++  P       G  V  V  +       + G      ++   +  D+++A+ +PGG    +L   R   V+N +  F  DE  K +     A  VL   G+L  KK+T+ PG ++ +   G ++ D  +V D + +S + P
  S:     2 RLSDKKVIALVSDDFEDLELWYPVLRLREEGATVHLVGEKANHEYIGKYGVPAVSDKDFYSIQADEYDAVLVPGGWAPDKL--RRYPEVLNIVRSF--DEKAKPIGQICHAGWVLISAGILQGKKVTSTPGIKDDMTNAGADWFDEAVVTDGHIISSRRP 157
>gi|21536528|gb|AAM60860.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein, putative [Arabidopsis thaliana] (438 aa)
Score = 125, Expect = 1.4e-05, Identities = 43/183 (23%), Positives = 84/183 (45%)
  Q:     7 SNIRIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYS--DNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           S  ++ I  +  +   + V+  D+  R G  V   S E +  +    G K+     +  +    F+ + +PGG  G + L   +N + + ++VK    +G+       A +      G+L  KK T  P F EKL    +  ++ + +D   V+ + P    EF++ +VE+LL K+ A  ++  ++
  S:    51 STKKVLIPVAHGTEPFEAVVMIDVLRRGGADVTVASVENQVGVDACHGIKMVADTLLSDITDSVFDLIMLPGGLPGGETL---KNCKPLERMVKKQDTDGRLNAAICCAPALAFGTWGLLEGKKATCYPVFMEKLAACATAVESRVEIDGKIVTSRGPGTTMEFSVTLVEQLLGKEKAVEVSGPLV 233
Score = 120, Expect = 5.5e-05, Identities = 40/171 (23%), Positives = 82/171 (47%)
  Q:    19 SNDMDIVIPYDIWTRA--GIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL-GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           S +M+ V   D+  RA   ++V  + N  +  +      K+     +++   + ++ + +PGG G        +E+++N + K A +  K +     + + V    G+L  KK T  P    KL  +++ ++ ++VD N ++ + P  + EFAL IVEK   ++    ++   L
  S:   268 SEEMEAVAIIDVLKRAKANVVVAALGNSLE--VVASRKVKLVADVLLDEAEKNLYDLIVLPGGLGGAEAFAS-SEKLVNMLKKQA-ESNKPYGAICASPALVFEPHGLLKGKKATAFPAMCSKLTDQSHIEHRVLVDGNLITSRGPGTSLEFALAIVEKFYGREKGLQLSKATL 437
>gi|183601046|ref|ZP_02962539.1| hypothetical protein PROSTU_04667 [Providencia stuartii ATCC 25827] >gi|188019384|gb|EDU57424.1| hypothetical protein PROSTU_04667 [Providencia stuartii ATCC 25827] (197 aa)
Score = 125, Expect = 1.4e-05, Identities = 48/171 (28%), Positives = 90/171 (52%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVE--TVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLA--ELGVLGNKKITTAPGFEEKLGKN-YSDNNIVVDK--NFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           S +++ V   D+  RAGI V   +V+++    I    G +I     I KV  + F+A+ +PGG KG +   T R+  ++ +  +    +GK       A + VL   +L  +GN  +T  P  + ++  N + D  +  D+  N ++ + P   F+FAL ++E L+ + IA  +A+ ++
  S:    13 SEEIETVTTADLLVRAGIKVTLASVTDDGSIEITASRGVRIVADTPIIKVADEPFDAIVLPGGVKGAE---TFRDSPLVVEKARRMHLDGKIVAAICAAPALVLEYHQLFPIGN--MTGYPTMKNQIAANKWVDKRVYFDERVNLLTSQGPATTFDFALKLIELLVGRDIAGKVASQLI 186
>gi|172056574|ref|YP_001813034.1| PfpI family intracellular peptidase [Exiguobacterium sibiricum 255-15] >gi|171989095|gb|ACB60017.1| intracellular protease, PfpI family [Exiguobacterium sibiricum 255-15] (170 aa)
Score = 125, Expect = 1.5e-05, Identities = 42/152 (27%), Positives = 70/152 (46%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIF-LQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFE---EKLGKNYSDNNIVVDKNFVSFKSP 161
           ++A++ +    D++   P D    AG  V  +  EK   +   Q   K+T    I++ +   F+AL IPGG     L  D  +R +    +F  D  KK +F+      ++    ++  +K+T         E  G +Y D  +VVD NFVS + P
  S:     4 KVAVVLADHFEDVEFTGPVDALKEAGHEVTVIGTEKGAELVGKQEEAKVTVDVTIDETSSSDFDALLIPGGFSPDLLRED--DRFVTFTEEF--DTSKKPIFSICHGPQLMINAKIVKGRKMTGYKSIRIDLENAGVSYEDKEVVVDDNFVSSRQP 155
>gi|108996375|ref|XP_001096631.1| PREDICTED: similar to DJ-1 protein isoform 2 [Macaca mulatta] (189 aa)
Score = 125, Expect = 1.5e-05, Identities = 46/175 (26%), Positives = 78/175 (44%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLD-KFNALYIPGGK-GCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGK----NYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNI 184
           R  ++ +  + +M+ VIP D+  RAGI V       K  +       I     +E    +  ++ + +PGG  G Q L      + +         EG       G  + +  E+G     K+TT P  ++K+       YS+N +  D   ++ + P  +FEFAL IVE L  K++A  +
  S:     5 RALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQNLSESLQPKQVYP--SLERKEGIFLFLFLGPTALLAHEIGF--GSKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSRGPGTSFEFALAIVEALNGKEVAAQV 181
>gi|167933376|ref|ZP_02520451.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein (thiJ) [Borrelia burgdorferi ZS7] (134 aa)
Score = 124, Expect = 1.5e-05, Identities = 39/122 (31%), Positives = 60/122 (49%)
  Q:    71 FNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEK-LGKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILYTK 192
           F+ + +PGG  G   L    N + ++ I+K    +GK       +   VLA  G+LG  K T  PG E+  L   + D N+V   NF++ K    +FEFA  ++E +  KQI  ++    L  K
  S:    13 FDLIILPGGMPGATNLF---NSKELDLILKDMNSKGKFIAAICASPVVVLAAKGLLGFNKFTCYPGLEKNVLDGEFVDENVVRSNNFITSKGVGTSFEFAFTLLEMVKGKQIMEDVKKATLLCK 133
>gi|78777413|ref|YP_393728.1| DJ-1 [Sulfurimonas denitrificans DSM 1251] >gi|78497953|gb|ABB44493.1| DJ-1 [Sulfurimonas denitrificans DSM 1251] (185 aa)
Score = 124, Expect = 1.5e-05, Identities = 50/163 (30%), Positives = 76/163 (46%)
  Q:    29 DIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKN-YSDNNIVV-DKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILYT 191
           D+  R  I V   S   KK +    G  +    EI+ V++     + +PGG KG   L  D N + I KI+    D   K +    AA   L   GVL     T  P  E ++ ++ +SD  +VV D+N ++ + P  A  F L IV+KL  K+    + + +L T
  S:    22 DVLRRGDIEVIVASLGSKKEVRGAHGVVVLADVEIQSVDVSALEMIVLPGGWKGTLALRDDENVQKILKIM----DRDAKLIGAICAAPLALHSAGVL-KHNYTCYPSVEAQIREDGFSDKEMVVQDENVITSRGPATAMCFGLQIVKKLSGKEKFEEVKSALLAT 182
>gi|15828946|ref|NP_326306.1| hypothetical protein MYPU_4750 [Mycoplasma pulmonis UAB CTIP] >gi|14089889|emb|CAC13648.1| conserved hypothetical protein [Mycoplasma pulmonis] (186 aa)
Score = 124, Expect = 1.5e-05, Identities = 38/113 (33%), Positives = 60/113 (53%)
  Q:    61 EEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGD--EGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYSDN-NIVVDKNFVSFKSPFHAFEFALLIVE 173
           +++ KV+   ++A++I GGK  +RL  D+      K +KF  D     K LF    AS VL + G++  +K    P   +K GKN+++   IV DKN  +    F +FE    IV+
  S:    57 KDLSKVSHKDYDAIFILGGKNVRRLADDQ------KTLKFIKDFYTSGKDLFVLCFASNVLFDSGIINEEKYVGYPLQNQKRGKNFTETIGIVRDKNLFTGAGAFSSFELGFTIVD 166
>gi|77962952|ref|ZP_00826767.1| COG0693: Putative intracellular protease/amidase [Yersinia mollaretii ATCC 43969] (196 aa)
Score = 124, Expect = 1.6e-05, Identities = 47/167 (28%), Positives = 79/167 (47%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVET--VSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL-GKNYSDNNIVVDK--NFVSFKSPFHAFEFALLIVEKLLNKQIATNIA 185
           S + + V   DI  RAGI V T  V+ +    I    G ++     +  V   KF+ + +PGG KG +     R+  ++   V+   +EG+       A + VL    +     +T  P  ++K+    + D  +V D+  N V+ + P  + +FAL IV  LL ++ A  IA
  S:    13 SEETEAVTTIDILVRAGIEVTTASVAGDGALEITCSRGVRLLADTRLVDVADQKFDVVVLPGGIKGAECF---RDSPLLVATVRQTHNEGRLVAAICAAPALVLEHHNLFPVGNMTGFPALKDKINATKWMDQRVVYDRRVNLVTSQGPGTSIDFALKIVFLLLGREKAEEIA 182
>gi|163799546|ref|ZP_02193453.1| intracellular protease, PfpI family [Methanococcus voltae A3] >gi|158973553|gb|EDP41021.1| intracellular protease, PfpI family [Methanococcus voltae A3] (172 aa)
Score = 124, Expect = 1.9e-05, Identities = 42/120 (35%), Positives = 66/120 (55%)
  Q:    54 GTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITT---APGFEE--KLGKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVE 173
           G KIT ++ IE+V    ++++ + GG G +  L + NE ++  + +F  D  KK +     +  VLA  GVL +K  T    A   EE  K G N  D+ +VVD N ++ K P  A EF + ++E
  S:    47 GRKITTNKTIEQVKSSDYDSIIVVGGSGSRDYLWN-NETLLKLVNEFNDD--KKVVSAICISPVVLAHAGVLKDKNATVFEDAESIEEMKKAGVNLLDDGVVVDGNIITAKGPQFAKEFGMKVLE 168
>gi|150403493|ref|YP_001330787.1| PfpI family intracellular peptidase [Methanococcus maripaludis C7] >gi|150034523|gb|ABR66636.1| intracellular protease, PfpI family [Methanococcus maripaludis C7] (171 aa)
Score = 123, Expect = 2.0e-05, Identities = 47/155 (30%), Positives = 82/155 (52%)
  Q:    21 DMDIVIPYDIWTRAGIIVETVSNE--KKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGA--ASTVLAELGVLGNKKITTAPGFE-----EKLGKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKL 175
           D ++  P  ++    I  + VS +  + K +    G  +T ++ IE++N + F+A+ I GG G +  L + NE+++  + +F     K+   TA    +  VLA+ G+L  KK T  P  E     ++ G  Y D  ++VD   ++ ++P  A EF L I E L
  S:    14 DEELFEPLQVFQSKNIATQVVSTKIGQHKGVM---GKVMTTTKTIEEINPNDFDAIVIVGGGGSRDFLWN-NEKLLELLKEF----NKQGKITAAICISPAVLAQAGLLTGKKATVYPDDESISVLQQNGAIYLDEAVIVDGKVITGRNPDAAKEFGLKIAEAL 169
>gi|189220230|ref|YP_001940870.1| Putative intracellular protease/amidase [Methylokorus infernorum V4] >gi|189187088|gb|ACD84273.1| Putative intracellular protease/amidase [Methylacidiphilum infernorum V4] (192 aa)
Score = 123, Expect = 2.2e-05, Identities = 42/170 (24%), Positives = 86/170 (50%)
  Q:    21 DMDIVIPYDIWTRA-------GIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTD-RNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYSD--NNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILY 190
           +++ V+P D+  RA       G++   +S  +K         ++    ++E V  ++F+ + +PGG +G + L  D R + ++ K V+ AG    +W+    AA   L + G+  + K+T  P   +   +   D  + +VVD   ++ K+   A EFA  ++ +LL ++    +    L+
  S:    14 EIEAVVPIDLLRRAKIEVVVAGVLPGVISGSRK--------IRLIPDYDLEDVLEEEFDCIILPGGAEGAENLKKDVRIKELLEKQVR-AG----RWVAAICAAPGCLVQFGLFPSAKMTCHPSLWDDFPQESLDRYSGVVVDGQLITAKAAGRAVEFAFEVIRRLLGEEAVEEVNRSFLF 181
>gi|20093847|ref|NP_613694.1| intracellular protease/amidase [Methanopyrus kandleri AV19] >gi|19886776|gb|AAM01624.1| Predicted intracellular protease/amidase [Methanopyrus kandleri AV19] (179 aa)
Score = 123, Expect = 2.3e-05, Identities = 44/179 (24%), Positives = 84/179 (46%)
  Q:    11 IAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYSD---NNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           IA++      ++++     + +R G+  + V  E++       G ++     +  V  D +  + + GG     L+  R+   ++ +     D G     ++GA   VLAE GVL  +K TT PGFE +L  N ++     +V D N V+ + P  A +  L +V +L    +A ++A  ++
  S:     2 IAVLVDDGFEELELGAVVSVLSRGGLDWDLVGVEERAEGM--GGMEVGVDSTVWDVEGDDYEGVVVLGGSAPTTLIGYRH--CLDLVRSVESDGGMVVGLSSGA--LVLAEAGVLRGRKATTYPGFEAELKVNGAEPVPKGVVRDGNVVTSRGPAFAIDACLEVVRELCGDHMANSVARQLI 177
>gi|116331015|ref|YP_800733.1| DJ-1/PfpI family intracellular protease [Leptospira borgpetersenii serovar Hardjo-bovis JB197] >gi|116124704|gb|ABJ75975.1| Transcription regulator, DJ-1/PfpI family intracellular protease [Leptospira borgpetersenii serovar Hardjo-bovis JB197] (178 aa)
Score = 123, Expect = 2.4e-05, Identities = 44/158 (27%), Positives = 76/158 (48%)
  Q:    22 MDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGK--KWLFTAGAASTVLAELGVLGNK-KITTAPGFEEKLGKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQ 179
           M+ VI  D+  RAG+ V T ++ K+  +    G  +     ++ VNL  F+ + +PGG G  ++L         KI  F  +  K  KW+    AA ++L    +L ++ + T  PG        Y+ + + +    V+   P  AFEF+L +V+ L  K+
  S:    12 MEAVIIVDVLRRAGVEV-TSASLKEGPVKASRGIYLLADTTLDAVNLKDFDMIVLPGGAGGTKVLG-----ADPKIADFLQEAKKENKWIGAICAAPSILVHQNILTSEDRFTAFPGIVSDT-SGYTGSRLEISGKIVTSIGPGSAFEFSLELVKILCGKE 165
>gi|116754546|ref|YP_843664.1| rubredoxin-type Fe(Cys)4 protein [Methanosaeta thermophila PT] >gi|116665997|gb|ABK15024.1| Rubredoxin-type Fe(Cys)4 protein [Methanosaeta thermophila PT] (284 aa)
Score = 123, Expect = 2.5e-05, Identities = 43/158 (27%), Positives = 76/158 (48%)
  Q:    21 DMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGA--ASTVLAELGVLGNKKITTAPG-FEEKLGKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNK 178
           + ++ IP + + R+G+ V+  S     +  + SG  +    ++   +L K+ A+   GG G + L   ++   +N + K A D+G   +  A    A  +LA  G+L NK  T A   +  +   NY D  +V D   ++ + P  + EFA  IV  LL +
  S:    55 ERELNIPKEAFERSGLDVDVASKGVTTATSM-SGESVAIDVDVRNADLSKYRAVVFVGGIGVEELNLHKDSDYVN-LAKSAHDKG---IIVAAICLAPNILASAGLLANKNATCADSTYLVQKNVNYIDAPVVRDGTIITGRDPDASAEFAETIVSALLEE 210
>gi|16924002|ref|NP_476484.1| Parkinson disease protein 7 [Rattus norvegicus] >gi|56404680|sp|O88767|PARK7_RAT Protein DJ-1 (Parkinson disease protein 7 homolog) (Contraception-associated protein 1) (Protein CAP1) (Fertility protein SP22) >gi|5478755|gb|AAD43956.1|AF157511_1 fertility protein SP22 [Rattus norvegicus] >gi|5478757|gb|AAD43957.1|AF157512_1 fertility protein SP22 [Rattus norvegicus] >gi|3250916|emb|CAA07434.1| CAP1 [Rattus norvegicus] >gi|149024696|gb|EDL81193.1| rCG30883, isoform CRA_a [Rattus norvegicus] >gi|149024697|gb|EDL81194.1| rCG30883, isoform CRA_a [Rattus norvegicus] >gi|149024698|gb|EDL81195.1| rCG30883, isoform CRA_a [Rattus norvegicus] (189 aa)
Score = 122, Expect = 2.8e-05, Identities = 51/175 (29%), Positives = 87/175 (49%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLD-KFNALYIPGGK-GCQRLLTDRNERVINKIVKFAGDEGKKWLFTA---GAASTVLAELGVLGNKKITTAPGFEEKL--GKNYSDNNIVVDKN--FVSFKSPFHAFEFALLIVEKLLNKQIATNI 184
           R  ++ +  + +M+ VIP DI  RAGI V       K  +       I     +E+      ++ + +PGG  G Q L       ++ +I+K    E +K L  A   G  + +  E+G     K+T+ P  ++K+  G +YS +   V+K+   ++ + P  +FEFAL IVE L  K +A  +
  S:     5 RALVILAKGAEEMETVIPVDIMRRAGIKVTVAGLAGKDPVQCSRDVVICPDTSLEEAKTQGPYDVVVLPGGNLGAQNL---SESALVKEILK--EQENRKGLIAAICAGPTALLAHEVGF--GCKVTSHPLAKDKMMNGSHYSYSESRVEKDGLILTSRGPGTSFEFALAIVEALSGKDMANQV 181
>gi|114552483|ref|XP_001158093.1| PREDICTED: similar to DJ-1 isoform 3 [Pan troglodytes] (199 aa)
Score = 122, Expect = 3.0e-05, Identities = 50/175 (28%), Positives = 84/175 (48%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLD-KFNALYIPGGK-GCQRLLTDRNERVINKIVKFAGDEGKKWLFTA---GAASTVLAELGVLGNKKITTAPGFEEKLGK--------------NYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNI 184
           R  ++ +  + +M+ VIP D+  RAGI V       K  +       I     +E    +  ++ + +PGG  G Q L        + +I+K    E +K L  A   G  + +  E+G     K+TT P  ++K+                 YS+N +  D   ++ + P  +FEFAL IVE L  K++A  +
  S:     5 RALVILAKGAEEMETVIPVDVMRRAGIKVTIAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQNL---SESAAVKEILK--EQENRKGLIAAICAGPTALLAHEIGF--GSKVTTHPLAKDKMMNGGCHLFCFYFAGHYTYSENRVEKDGLILTSRGPGTSFEFALAIVEALNGKEVAAQV 191
>gi|194015748|ref|ZP_03054364.1| intracellular protease 1 (Intracellular protease I) [Bacillus pumilus ATCC 7061] >gi|194013152|gb|EDW22718.1| intracellular protease 1 (Intracellular protease I) [Bacillus pumilus ATCC 7061] (174 aa)
Score = 122, Expect = 3.1e-05, Identities = 38/157 (24%), Positives = 71/157 (45%)
  Q:     5 KVSNIRIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSDNNIVVDKNFVSFKSP 161
           ++SN ++    S +  D+++  P       G  V  V  +       + G       +   +  D+++A+ +PGG    +L   R   V++ +  F  DE  K +     A  VL   G+L  KK+T+ PG ++ +   G ++ D  +V D + VS + P
  S:     2 RLSNKKVIAFVSDDFEDLELWYPVLRLREEGATVHLVGEKADHEYIGKYGVPAVSDADFYSIQADEYDAVLVPGGWAPDKL--RRYPEVLDIVRTF--DEKAKPIGQICHAGWVLISAGILQGKKVTSTPGIKDDMTNAGADWFDEAVVTDGHLVSSRRP 157
>gi|189462955|ref|ZP_03011740.1| hypothetical protein BACCOP_03657 [Bacteroides coprocola DSM 17136] >gi|189430237|gb|EDU99221.1| hypothetical protein BACCOP_03657 [Bacteroides coprocola DSM 17136] (182 aa)
Score = 122, Expect = 3.1e-05, Identities = 51/169 (30%), Positives = 78/169 (46%)
  Q:    21 DMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL-GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           +M+ + P D+  R G+ V+TVS   +K++       I      E +  +    + +PGG  G   L  D +  +   I+ FA     K L    AA  V  + G+L  KK T  PGF++ L G  Y+ N + V  NF+  K P  A  FA  I+EK    + A  +   +L
  S:    14 EMEAMFPLDVMRRGGLNVKTVSVTGEKTVVSSHQVPIVADMLFEDLKEEDVEMVVLPGGLPGATNL--DAHAGLDKLIMSFAA--AGKPLAAICAAPMVYGKRGLLKGKKATCYPGFDKYLEGAEYTGNMVEVVDNFILGKGPGAAPAFAFAILEKYAGAEKALEVKKGML 180
>gi|150008183|ref|YP_001302926.1| ThiJ family intracellular protease [Parabacteroides distasonis ATCC 8503] >gi|149936607|gb|ABR43304.1| putative ThiJ family intracellular protease [Parabacteroides distasonis ATCC 8503] (181 aa)
Score = 122, Expect = 3.1e-05, Identities = 50/169 (29%), Positives = 77/169 (45%)
  Q:    21 DMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL-GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           +M+     DI  R GI  +TVS    + +      + T      +++L   +AL +PGG  G   L    N   + +++     EG+  +    AA  VL  LG+L  +K T  PGFE KL G   +   + VD N V+ + P   F F L +V  L    +A  +A  +L
  S:    14 EMEATGTVDILRRGGIDTKTVSITDDRKVIGAHNMEYTADATFTEIDLSDADALILPGGMPGASNL---NNSEPVKEVLLQQYREGR-IVAAICAAPMVLGGLGLLKGRKATCYPGFEPKLIGATVTGEAVEVDGNVVTGRGPGLVFNFGLALVSVLKGDAVAEEVAAGLL 180
>gi|45358122|ref|NP_987679.1| hypothetical protein MMP0559 [Methanococcus maripaludis S2] >gi|44920879|emb|CAF30115.1| Family of unknown function ThiJ/PfpI [Methanococcus maripaludis S2] (172 aa)
Score = 122, Expect = 3.1e-05, Identities = 46/155 (29%), Positives = 78/155 (50%)
  Q:    21 DMDIVIPYDIWTRAGIIVETVSNE--KKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFE-----EKLGKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKL 175
           D ++  P  ++    I  + VS    + K +    G  +T ++ IE VN D F+A+ I GG G +  L + NE+++  + +F  +   K       +  VLA+ G+L  KK T  P  E     ++ G  Y D  +++D   ++ ++P  A EF L I E L
  S:    15 DEELFEPLQVFQSKNIATQVVSTTTGQHKGVL---GRVMTTTKTIEGVNPDDFDAIVIVGGGGSRDYLWN-NEKLLELLKEF--NSMGKITAAICISPAVLAQAGLLTGKKATVFPDDEAIAVLQQKGAIYLDEAVILDGTVITGRNPDAAKEFGLKIAEAL 170
>gi|74317863|ref|YP_315603.1| putative protease [Thiobacillus denitrificans ATCC 25259] >gi|74057358|gb|AAZ97798.1| putative protease [Thiobacillus denitrificans ATCC 25259] (181 aa)
Score = 122, Expect = 3.2e-05, Identities = 43/158 (27%), Positives = 77/158 (48%)
  Q:    21 DMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGK-NYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNK 178
           +++ V   D+  RAG+ V  V+  K   +    G ++     +++   D ++ + +PGG      L D + RV++ + K A     K+     AA  VLAE G+L  K+ T+ PGF + +         +V D   ++ + P  A +FAL +VE L+ +
  S:    14 ELEAVTIIDLLRRAGVEV-IVAGLKPGVVKASRGVQLVPDVTLDQALADAYDMVVLPGGMPGAAHLKD-DVRVVDLLKKMA--SAGKYTAAICAAPMVLAEAGLLRGKQATSYPGFLDGVPDVTLRAEAVVQDGTVLTSRGPGTAMDFALQLVETLVGR 168
>gi|49476735|ref|YP_036763.1| ThiJ/PfpI family protein [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|49328291|gb|AAT58937.1| ThiJ/PfpI family protein [Bacillus thuringiensis serovar konkukian str. 97-27] (190 aa)
Score = 122, Expect = 3.2e-05, Identities = 48/172 (27%), Positives = 87/172 (50%)
  Q:     9 IRIAIMCSIESNDMDIVIPYDIWTRAGII-------VETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQI 180
           ++IAI+C     D+D+ +P+D+  R  ++       V+ +  E+       SG +I  +E I   +L   +A+    GKG Q L   +N++ IN I     D  K+ + +  + S +L    +L  KK TT P   E+L   G +  + + V + N  +    F A E +  I+  L+N+++
  S:     1 MKIAIVCFDNFTDIDVFLPWDLLNRVRLVGGISDWDVQLLGTEETH--ISMSGLRIPMTESIS--DLPSADAVIFASGKGIQDLY--KNQQYINSI---HIDPQKQLIGSMCSGSLLLGAKKLLTGKKATTYPSAVEQLKEFGVDVIEKSFVNEGNISTAAGCFAAQELSAWIIRTLINEEM 173
>gi|168266578|ref|ZP_02688543.1| intracellular protease, PfpI family protein [Listeria monocytogenes FSL J2-071] (173 aa)
Score = 122, Expect = 3.2e-05, Identities = 37/152 (24%), Positives = 72/152 (47%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSDNNIVVDKNFVSFKSP 161
           ++  + S +  D+++  P      AG  V  V+ E KK    + G  +T   + + V  + ++ + +PGG    +L   R + V+N +  F  D+ KK +     A  VL   G+L    +T+ PG ++ +   G  + +  +V D + +S + P
  S:     7 KVIALVSEDFEDLELWYPVLRLREAGASVHLVAEEAKKVYHGKYGVPVTSDYDFDSVRAEDYDGILVPGGWSPDKL--RRFDSVLNLVRAF--DKAKKPIGQICHAGWVLVSAGILDGVNVTSTPGIKDDMTNAGAIWHNEPVVTDGHIISSRRP 157
>gi|149003439|ref|ZP_01828328.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein, putative [Streptococcus pneumoniae SP14-BS69] >gi|149010563|ref|ZP_01831934.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein, putative [Streptococcus pneumoniae SP19-BS75] >gi|168484463|ref|ZP_02709415.1| DJ-1 family protein [Streptococcus pneumoniae CDC1873-00] >gi|147758622|gb|EDK65620.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein, putative [Streptococcus pneumoniae SP14-BS69] >gi|147765044|gb|EDK71973.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein, putative [Streptococcus pneumoniae SP19-BS75] >gi|172042335|gb|EDT50381.1| DJ-1 family protein [Streptococcus pneumoniae CDC1873-00] (184 aa)
Score = 122, Expect = 3.2e-05, Identities = 44/167 (26%), Positives = 81/167 (48%)
  Q:     9 IRIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEK-LGKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKL 175
           +++A+M +    +++ +   D+  RA I  + V  E++ +    S      ++ +   +L  ++ + +PGG      L D N+ +I ++  F   EGKK L    AA   L +  +L NK+ T   G +E+ L  +Y    +VVD    + + P  A  FA  +VE+L
  S:     2 VKVAVMLAQGFEEIEALTVVDVLRRANITCDMVGFEEQVT---GSHAIQVRADHVFDGDLSDYDMIVLPGGMPGSAHLRD-NQTLIQELQSFE-QEGKK-LAAICAAPIALNQAEILKNKRYTCYDGVQEQILDGHYVKETVVVDGQLTTSRGPSTALAFAYELVEQL 163
>gi|15902757|ref|NP_358307.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein, putative [Streptococcus pneumoniae R6] >gi|116516953|ref|YP_816201.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein, putative [Streptococcus pneumoniae D39] >gi|148990417|ref|ZP_01821583.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein, putative [Streptococcus pneumoniae SP6-BS73] >gi|149021674|ref|ZP_01835705.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein, putative [Streptococcus pneumoniae SP23-BS72] >gi|168486182|ref|ZP_02710690.1| DJ-1 family protein [Streptococcus pneumoniae CDC1087-00] >gi|168490901|ref|ZP_02715044.1| DJ-1 family protein [Streptococcus pneumoniae CDC0288-04] >gi|169833282|ref|YP_001694267.1| 4-methyl-5 [Streptococcus pneumoniae Hungary19A-6] >gi|182683723|ref|YP_001835470.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein, putative [Streptococcus pneumoniae CGSP14] >gi|15458304|gb|AAK99517.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein [Streptococcus pneumoniae R6] >gi|116077529|gb|ABJ55249.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein, putative [Streptococcus pneumoniae D39] >gi|147924322|gb|EDK75415.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein, putative [Streptococcus pneumoniae SP6-BS73] >gi|147930135|gb|EDK81121.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein, putative [Streptococcus pneumoniae SP23-BS72] >gi|168995784|gb|ACA36396.1| 4-methyl-5 [Streptococcus pneumoniae Hungary19A-6] >gi|182629057|gb|ACB90005.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein, putative [Streptococcus pneumoniae CGSP14] >gi|183570770|gb|EDT91298.1| DJ-1 family protein [Streptococcus pneumoniae CDC1087-00] >gi|183574600|gb|EDT95128.1| DJ-1 family protein [Streptococcus pneumoniae CDC0288-04] (184 aa)
Score = 122, Expect = 3.2e-05, Identities = 44/167 (26%), Positives = 81/167 (48%)
  Q:     9 IRIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEK-LGKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKL 175
           +++A+M +    +++ +   D+  RA I  + V  E++ +    S      ++ +   +L  ++ + +PGG      L D N+ +I ++  F   EGKK L    AA   L +  +L NK+ T   G +E+ L  +Y    +VVD    + + P  A  FA  +VE+L
  S:     2 VKVAVMLAQGFEEIEALTVVDVLRRANITCDMVGFEEQVT---GSHAIQVRADHVFDGDLSDYDMIVLPGGMPGSAHLRD-NQTLIQELQSFE-QEGKK-LAAICAAPIALNQAEILKNKRYTCYDGVQEQILDGHYVKETVVVDGQLTTSRGPSTALAFAYELVEQL 163
>gi|79326279|ref|NP_001031787.1| DJ-1 family protein [Arabidopsis thaliana] (437 aa)
Score = 121, Expect = 3.4e-05, Identities = 45/181 (24%), Positives = 91/181 (50%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPG-FEEKLGKNYSDN-NIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILY 190
           R+ I  +  S  +++V   D+  RA + V   S E+   I    GTKI   + I +     ++ + +PGG  G +RL   +  +++ K+++   + G+ +  T  ++STVL + G+L  K+ T  P   +E + +   +   +V+D N ++        +F+L IV KL     A +++  +++
  S:   253 RVLIPVANGSEAVELVSIADVLRRAKVDVTVSSVERSLRITAFQGTKIITDKLIGEAAESSYDLIILPGGHTGSERL---QKSKILKKLLREQHESGRIYGAT-NSSSTVLHKHGLLKEKRTTVYPSESDEPMNQQMIEGAEVVIDGNVITSLGLATVTKFSLAIVSKLFGHARARSVSEGLVH 432
Score = 118, Expect = 7.6e-05, Identities = 39/150 (26%), Positives = 73/150 (48%)
  Q:    40 TVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYS-DNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           + + +KK  +   SGT++     I K     ++ + +PGG  G  RL   R+  ++ KI+K   ++ + +   + A +  L   G+L  K+ T  P F  KL   ++   NI +     + + P  +F+FAL + E+L  +  A +I   +L
  S:    80 SATTKKKLEVEGSSGTRLLADVLISKCADQVYDLVALPGGMPGAVRL---RDCEILEKIMKRQAEDKRLYGAISMAPAITLLPWGLLTRKRTTGHPAFFGKLPTFWAVKTNIQISGELTTSRGPGTSFQFALSLAEQLFGETTAKSIEEFLL 228
>gi|123443358|ref|YP_001007332.1| hypothetical protein YE3150 [Yersinia enterocolitica subsp. enterocolitica 8081] >gi|122090319|emb|CAL13185.1| 4-methyl-5(B-hydroxyethyl)-thiazol monophosphate biosynthesis enzyme [Yersinia enterocolitica subsp. enterocolitica 8081] (198 aa)
Score = 121, Expect = 3.4e-05, Identities = 47/167 (28%), Positives = 79/167 (47%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVET--VSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL-GKNYSDNNIVVDK--NFVSFKSPFHAFEFALLIVEKLLNKQIATNIA 185
           S + + V   DI  RAGI V T  V+++    I    G ++     +  V   KF+ + +PGG KG +     R+  ++   V+    EG+       A + VL    +     +T  P  ++K+    + D  +V D+  N V+ + P  + +FAL IV  LL ++ A  IA
  S:    13 SEETEAVTTIDILVRAGINVTTTSVASDGALEIVCSRGVRLLADTRLVDVADQKFDVVVLPGGIKGAECF---RDSPLLVATVEQTHKEGRLVAAICAAPALVLEHHKLFPVGNMTGFPALKDKIDSTKWMDQRVVYDRRVNLVTSQGPGTSIDFALKIVFLLLGREKAEEIA 182
>gi|154687100|ref|YP_001422261.1| YraA [Bacillus amyloliquefaciens FZB42] >gi|154352951|gb|ABS75030.1| YraA [Bacillus amyloliquefaciens FZB42] (169 aa)
Score = 121, Expect = 3.7e-05, Identities = 41/152 (26%), Positives = 69/152 (45%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSDNNIVVDKNFVSFKSP 161
           +IA++ + +  D++   P + +  AG  V T+  E  K +  + G K+   + I   +  +F+AL IPGG     L  D       K    A  E +K +F       +L +  +L  K IT      + L   G +Y D  +VV  N V+ ++P
  S:     4 KIAVLMTDQFEDIEYTSPAEAFKEAGHSVVTIDLEAGKEVTGKHGEKVKIDQAISDADAKEFDALLIPGGFSPDLLRGDDRPGEFTK----AFVENQKPVFAICHGPQLLIDTDLLKGKDITGFRSIRKDLINAGAHYKDEEVVVSHNIVTSRTP 154
>gi|154687229|ref|YP_001422390.1| hypothetical protein RBAM_028280 [Bacillus amyloliquefaciens FZB42] >gi|154353080|gb|ABS75159.1| conserved hypothetical protein [Bacillus amyloliquefaciens FZB42] (174 aa)
Score = 121, Expect = 3.7e-05, Identities = 41/169 (24%), Positives = 79/169 (46%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNK 178
           ++  + S +  D+++  P       G IV  +  E  +S   + G   T   + + + + +++A+ +PGG    +L   R   V++ I     +E KK +     A  VL   G+L  KK+T+ PG ++ +   G  + D  +V D + VS + P    ++A    + L +K
  S:     7 KVIALVSDDFEDLELWYPVYRLREEGAIVHLIGEEAGRSYKGKYGVPATADYDFKSLIIQEYDAVLVPGGWAPDKL--RRYPEVLDIIRTM--NEQKKPIGQICHAGWVLISAGILAGKKVTSTPGIKDDMTNAGAQWLDEAVVTDGHIVSSRRPPDLPQYAKAFADLLASK 174
>gi|117924316|ref|YP_864933.1| DJ-1 family protein [Magnetococcus sp. MC-1] >gi|117608072|gb|ABK43527.1| DJ-1 family protein [Magnetococcus sp. MC-1] (183 aa)
Score = 121, Expect = 3.8e-05, Identities = 49/169 (28%), Positives = 84/169 (49%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGK-GCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL--GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNK 178
           R+ I  +  S +M+ +   +I  RA I   T++   +  I    G+ I     +E V    F+ + +PGG+ G   L  D + R ++ +++    EGK ++    AA T+LA  G+L  KK T  P   + L   +  + + +V D N ++   P  A +FAL +VE L+ K
  S:     4 RVLIPIAPGSEEMEAITIVNILRRAQIDC-TLAGTVEGPIRCSRGSVIVPDTTLEAVMDMPFDLIALPGGQPGTTHL--DEDPR-MHTLLQRMHAEGK-FITAICAAPTILAHAGLLTGKKATCYPTLLDTLHGAETVAIHGVVCDGNIITSTGPGTAMDFALTLVETLVGK 170
>gi|152992160|ref|YP_001357881.1| 4-methyl-5(beta-hydroxyethyl)-thiazole monophosphate synthesis protein [Sulfurovum sp. NBC37-1] >gi|151424021|dbj|BAF71524.1| 4-methyl-5(beta-hydroxyethyl)-thiazole monophosphate synthesis protein [Sulfurovum sp. NBC37-1] (186 aa)
Score = 121, Expect = 3.8e-05, Identities = 46/159 (28%), Positives = 80/159 (50%)
  Q:    21 DMDIVIPYDIWTRAGIIVET--VSNEKKKSIFL-QSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKN--YSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQ 179
           +++ V   D+  R GI V    + +E +  + L  +G  +     I+ V  D F+ + +PGG G    L + N RV   + +F   + KK +    AA   L + GVLG ++ T  PG  E++      +D  +V D N ++ + P  A  F L IV++L+ ++
  S:    14 ELEAVALIDVMRRGGIEVRVAYLEDEMQSDLVLGANGITVKADTSIKNVISDDFDMMVLPGGWGGTYALAE-NTRVQELLREF---KAKKIVGAMCAAPFALKQAGVLG-ERYTAYPGAVEEIDHPGYVADEKVVEDGNVMTSQGPGTAVCFGLAIVKRLVGEE 172
>gi|16801421|ref|NP_471689.1| hypothetical protein lin2358 [Listeria innocua Clip11262] >gi|16804295|ref|NP_465780.1| hypothetical protein lmo2256 [Listeria monocytogenes EGD-e] >gi|46908489|ref|YP_014878.1| PfpI family intracellular peptidase [Listeria monocytogenes str. 4b F2365] >gi|47094478|ref|ZP_00232155.1| intracellular protease, PfpI family [Listeria monocytogenes str. 4b H7858] >gi|47097155|ref|ZP_00234721.1| intracellular protease, PfpI family [Listeria monocytogenes str. 1/2a F6854] >gi|153168166|ref|ZP_01928176.1| hypothetical protein LMHG_02156 [Listeria monocytogenes FSL N1-017] >gi|153175521|ref|ZP_01930879.1| hypothetical protein LMIG_00907 [Listeria monocytogenes FSL N3-165] >gi|153185040|ref|ZP_01935667.1| hypothetical protein LMOG_01588 [Listeria monocytogenes J0161] >gi|153191805|ref|ZP_01938959.1| hypothetical protein LMPG_02202 [Listeria monocytogenes J2818] >gi|153203368|ref|ZP_01944675.1| hypothetical protein LMSG_02251 [Listeria monocytogenes HPB2262] >gi|167015355|ref|ZP_02277888.1| intracellular protease, PfpI family protein [Listeria monocytogenes FSL J1-194] >gi|167214973|ref|ZP_02285280.1| intracellular protease, PfpI family protein [Listeria monocytogenes FSL R2-503] >gi|167218162|ref|ZP_02287798.1| intracellular protease, PfpI family protein [Listeria monocytogenes FSL J1-175] >gi|167405103|ref|ZP_02309868.1| intracellular protease, PfpI family protein [Listeria monocytogenes FSL J2-003] >gi|167454755|ref|ZP_02320978.1| intracellular protease, PfpI family protein [Listeria monocytogenes FSL J2-064] >gi|16411726|emb|CAD00334.1| lmo2256 [Listeria monocytogenes] >gi|16414881|emb|CAC97585.1| lin2358 [Listeria innocua] >gi|46881761|gb|AAT05055.1| intracellular protease, PfpI family [Listeria monocytogenes str. 4b F2365] >gi|47014460|gb|EAL05427.1| intracellular protease, PfpI family [Listeria monocytogenes str. 1/2a F6854] >gi|47017146|gb|EAL08002.1| intracellular protease, PfpI family [Listeria monocytogenes str. 4b H7858] >gi|126942254|gb|EBA19995.1| hypothetical protein LMOG_01588 [Listeria monocytogenes J0161] >gi|127764676|gb|EBA25201.1| hypothetical protein LMPG_02202 [Listeria monocytogenes J2818] >gi|133726413|gb|EBA28111.1| hypothetical protein LMHG_02156 [Listeria monocytogenes FSL N1-017] >gi|133729440|gb|EBA31138.1| hypothetical protein LMIG_00907 [Listeria monocytogenes FSL N3-165] >gi|133734669|gb|EBA36367.1| hypothetical protein LMSG_02251 [Listeria monocytogenes HPB2262] (173 aa)
Score = 121, Expect = 4.1e-05, Identities = 37/152 (24%), Positives = 72/152 (47%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSDNNIVVDKNFVSFKSP 161
           ++  + S +  D+++  P      AG  V  V+ E KK    + G  +T   + + V  + ++ + +PGG    +L   R + V+N +  F  D+ KK +     A  VL   G+L    +T+ PG ++ +   G  + +  +V D + +S + P
  S:     7 KVIALVSEDFEDLELWYPVLRLREAGASVHLVAEEAKKVYHGKYGVPVTSDYDFDSVRAEDYDGILVPGGWSPDKL--RRFDSVLNLVRAF--DKAKKPIGQICHAGWVLVSAGILEGVNVTSTPGIKDDMTNAGAIWHNEPVVTDGHIISSRRP 157
>gi|123421899|ref|XP_001306078.1| DJ-1 family protein [Trichomonas vaginalis G3] >gi|121887632|gb|EAX93148.1| DJ-1 family protein [Trichomonas vaginalis G3] (192 aa)
Score = 121, Expect = 4.1e-05, Identities = 43/170 (25%), Positives = 82/170 (48%)
  Q:    22 MDIVIPYDIWTRAGI---IVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAE-LGVLGNKKITTAPGFE---EKLGKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILYT 191
           M++V P D+  RAG+   I    +NE +  +    G KI      + +  + F+ +  PGG      LT+  + +  + +K     GK       A+  VLA+  G++  +K    PG +   E+ G   + + +  D N ++ + P  + +F + +VE L +K+ A  IA + + +
  S:    17 MEVVCPVDLLRRAGVDVKIAAACTNEIQ--VEASFGIKIVADVMFDSIKNETFDLVIAPGGMSGPDNLTNNQDTI--EFIKRHDMAGKLVAAICAASGYVLAKACGIMKGRKGCRYPGLDTPIEEAGGELTTDIVTRDGNVITSRGPGTSLQFGIALVEALFSKEKAQEIAKNAILS 189
>gi|150019134|ref|YP_001311388.1| DJ-1 family protein [Clostridium beijerinckii NCIMB 8052] >gi|149905599|gb|ABR36432.1| DJ-1 family protein [Clostridium beijerinckii NCIMB 8052] (183 aa)
Score = 121, Expect = 4.1e-05, Identities = 40/121 (33%), Positives = 65/121 (53%)
  Q:    70 KFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGK-NYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILY 190
           +++ + IPGG      L D +ERVI K VK    +GK  +    A   VL   G+   + IT+ PG+E++L    Y ++ +VVDKN V+ + P  A  FA  +++ L       +I++ +LY
  S:    60 EYDLVVIPGGIPGATNLRD-DERVI-KFVKKQNKDGK-LIGAICAGPIVLGRAGITEGRNITSYPGYEDELPNCEYLEDAVVVDKNIVTSRGPATAMAFAYKLLDILGYGNKVESISSGMLY 178
>gi|150400176|ref|YP_001323943.1| PfpI family intracellular peptidase [Methanococcus vannielii SB] >gi|150012879|gb|ABR55331.1| intracellular protease, PfpI family [Methanococcus vannielii SB] (171 aa)
Score = 121, Expect = 4.4e-05, Identities = 44/125 (35%), Positives = 71/125 (56%)
  Q:    54 GTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAG--AASTVLAELGVLGNKKITTAPGFE-----EKLGKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNK 178
           G +IT ++ +++V    F+A+ I GG G ++ L + N+ +   ++K   +EGK    TA    +  +LA+ G+L NKK T     E     +K G  Y D N+++D   V+ K+P  A EF   I+ KLL K
  S:    46 GKRITTTKTLDEVKTSDFDAIVIVGGSGSRKYLWNNNKLI--DLLKEFNNEGK---ITAAICISPAILAQAGLLKNKKATVFLDDEAILELQKNGAIYIDENVIIDGKVVTGKNPESAREFGNAIL-KLLEK 171
>gi|154496577|ref|ZP_02035273.1| hypothetical protein BACCAP_00869 [Bacteroides capillosus ATCC 29799] >gi|150274210|gb|EDN01301.1| hypothetical protein BACCAP_00869 [Bacteroides capillosus ATCC 29799] (203 aa)
Score = 120, Expect = 4.6e-05, Identities = 47/170 (27%), Positives = 78/170 (45%)
  Q:    21 DMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEI---EKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYSDN--NIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILY 190
           + + ++P D+  RAG  V+ V  +    + +     +T   +I   E  + +    L +PGG G    +  +N   +  I K A D G  WL    AA TVLA  G L  +K    PG E+++G         +V D   ++ ++   AFEF L +VE    +Q    + N + +
  S:    33 EAEALVPLDLLRRAGAQVKLVGLD---GLEVTGSHGVTVKADITMDEAHDPEDMEMLVLPGGLGGVEAI-QKNLFALALIQK-AYDRGC-WLCAICAAPTVLARAGCLDRRKAVCYPGMEDEMGSAVVQKGAQVVTDGRIITGEAAGSAFEFGLRLVEAACGRQAMERVRNAVHF 201
>gi|33358046|pdb|1PDV|A Chain A, Crystal Structure Of Human Dj-1, P 31 2 1 Space Group >gi|33358047|pdb|1PDW|A Chain A, Crystal Structure Of Human Dj-1, P 1 21 1 Space Group >gi|33358048|pdb|1PDW|B Chain B, Crystal Structure Of Human Dj-1, P 1 21 1 Space Group >gi|33358049|pdb|1PDW|C Chain C, Crystal Structure Of Human Dj-1, P 1 21 1 Space Group >gi|33358050|pdb|1PDW|D Chain D, Crystal Structure Of Human Dj-1, P 1 21 1 Space Group >gi|33358051|pdb|1PDW|E Chain E, Crystal Structure Of Human Dj-1, P 1 21 1 Space Group >gi|33358052|pdb|1PDW|F Chain F, Crystal Structure Of Human Dj-1, P 1 21 1 Space Group >gi|33358053|pdb|1PDW|G Chain G, Crystal Structure Of Human Dj-1, P 1 21 1 Space Group >gi|33358054|pdb|1PDW|H Chain H, Crystal Structure Of Human Dj-1, P 1 21 1 Space Group (197 aa)
Score = 120, Expect = 4.8e-05, Identities = 49/175 (28%), Positives = 82/175 (46%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLD-KFNALYIPGGK-GCQRLLTDRNERVINKIVKFAGDEGKKWLFTA---GAASTVLAELGVLGNKKITTAPGFEEKLGK----NYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNI 184
           R  ++ +  + + + VIP D+  RAGI V       K  +       I     +E    +  ++ + +PGG  G Q L        + +I+K    E +K L  A   G  + +  E+G     K+TT P  ++K        YS+N +  D   ++ + P  +FEFAL IVE L  K++A  +
  S:     5 RALVILAKGAEEXETVIPVDVXRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQNL---SESAAVKEILK--EQENRKGLIAAICAGPTALLAHEIGF--GSKVTTHPLAKDKXXNGGHYTYSENRVEKDGLILTSRGPGTSFEFALAIVEALNGKEVAAQV 181
>gi|153196996|ref|ZP_01941295.1| hypothetical protein LMRG_01575 [Listeria monocytogenes 10403S] >gi|127633451|gb|EBA22863.1| hypothetical protein LMRG_01575 [Listeria monocytogenes 10403S] (173 aa)
Score = 120, Expect = 5.0e-05, Identities = 37/152 (24%), Positives = 72/152 (47%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSDNNIVVDKNFVSFKSP 161
           ++  + S +  D+++  P      AG  V  V+ E KK    + G  +T   + + V  + ++ + +PGG    +L   R + V+N +  F  D+ KK +     A  VL   G+L    +T+ PG ++ +   G  + +  +V D + +S + P
  S:     7 KVIALVSEDFEDLELWYPVLRLREAGASVHLVAEEAKKIYHGKYGVPVTSDYDFDSVRAEDYDGILVPGGWSPDKL--RRFDSVLNLVRAF--DKAKKPIGQICHAGWVLVSAGILEGVNVTSTPGIKDDMTNAGAIWHNEPVVTDGHIISSRRP 157
>gi|157754004|ref|XP_001680714.1| Hypothetical protein CBG07015 [Caenorhabditis briggsae AF16] >gi|187033694|emb|CAP27329.1| C. briggsae CBR-DJR-1.2 protein [Caenorhabditis briggsae] (192 aa)
Score = 120, Expect = 5.1e-05, Identities = 47/172 (27%), Positives = 85/172 (49%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVETVSNEKK-------KSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILY 190
           + + +++IP D+ TR  I V   S E K       K +    G +I  S   + V   K++ + IPGG G  +L  +     +  ++K     G   +    A  TVL   G++ ++ +T     ++KL   G  +S++ +VV    ++ + P  AFEFAL IVE +   + A ++   + +
  S:    14 AEESEVIIPGDVLTRGDIQVVYASLEGKCPKTGMMKPVKCAKGAEIMPSAAFDDVKDKKYDIVIIPGGPGSSKLAENS---CVGSLLKDQFKSGG-LIGAICAGPTVLLSHGIMVDE-VTGHYTVKDKLVDGGYKFSEDRVVVSGKVITSQGPGTAFEFALKIVEIMQGAEKAESLKKPLCF 190
>gi|160895267|ref|ZP_02076039.1| hypothetical protein CLOL250_02827 [Clostridium sp. L2-50] >gi|156863146|gb|EDO56577.1| hypothetical protein CLOL250_02827 [Clostridium sp. L2-50] (181 aa)
Score = 120, Expect = 5.1e-05, Identities = 43/162 (26%), Positives = 76/162 (46%)
  Q:    29 DIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLG-KNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILY 190
           D+  RA +    V+ + + ++    G  +   E+I  +  D  + + +PGG  G   L+   NE+V N +      E  +++    AA T     G+L +K+ T  PG E  L     S  N+V D   ++ +    A +F L +VE L +++ A  +A  I+Y
  S:    22 DLLRRAKVDCLMVAADDQDTVTGSHGITVKMDEKISALT-DDADMIVLPGGMPGVTNLIA--NEKVKNLVC--GQYEAGRYVAAICAAPTAFGVFGILKDKEATCYPGMEAGLHCAKVSYENVVTDGKVITSRGMGTAIDFGLKLVEILTDRETAEKLAAAIVY 180
>gi|194398431|ref|YP_002037449.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein, putative [Streptococcus pneumoniae G54] >gi|194358098|gb|ACF56546.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein, putative [Streptococcus pneumoniae G54] (184 aa)
Score = 120, Expect = 5.2e-05, Identities = 44/167 (26%), Positives = 80/167 (47%)
  Q:     9 IRIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEK-LGKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKL 175
           +++A+M +    +++ +   D+  RA I  + V  E++ +    S      ++ +   +L  ++ + +PGG      L D N+ +I ++  F   EGKK L    AA   L +  +L NK+ T   G +E+ L   Y    +VVD    + + P  A  FA  +VE+L
  S:     2 VKVAVMLAQGFEEIEALTVVDVLRRANITCDMVGFEEQVT---GSHAIQVRADHVFDGDLSDYDMIVLPGGMPGSAHLRD-NQTLIQELQSFE-QEGKK-LAAICAAPIALNQAEILKNKRYTCYDGVQEQILDGXYVKETVVVDGQLTTSRGPSTALAFAYELVEQL 163
>gi|162447689|ref|YP_001620821.1| PfpI family intracellular peptidase [Acholeplasma laidlawii PG-8A] >gi|161985796|gb|ABX81445.1| intracellular protease, PfpI family [Acholeplasma laidlawii PG-8A] (173 aa)
Score = 119, Expect = 5.9e-05, Identities = 40/156 (25%), Positives = 75/156 (48%)
  Q:     6 VSNIRIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAG--DEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSDNNIVVDKNFVSFKSP 161
           + N  I  + S + +D++   P      AG  V+  S  K ++   + G         ++V++ K++ + IPGG     L      R + K++ F    +E KK + +   A  VL+  G+L    +T+ PG ++ +   G  + D  +VVDK+ V+ + P
  S:     2 LKNKHILTIVSNDYDDLEFHYPLIRLKEAGATVDIASEIKGQTYKGKYGLSTVSDLSFDEVDITKYDGIIIPGGWAPDYL------RRLPKVLDFIRYLNEHKKIIGSICHAGWVLSSAGILKGVTLTSTPGIKDDMMYAGATWVDKPVVVDKHIVTARRP 156
>gi|29347781|ref|NP_811284.1| putative protease/amidase [Bacteroides thetaiotaomicron VPI-5482] >gi|29339682|gb|AAO77478.1| putative protease/amidase [Bacteroides thetaiotaomicron VPI-5482] (192 aa)
Score = 119, Expect = 6.1e-05, Identities = 42/144 (29%), Positives = 76/144 (52%)
  Q:    32 TRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDR-NERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITT---APGFEEKLGKNYS----DNNIVVDKNFVSFKSPFHAFEFALLIVEKL 175
           T  G  VE V+    + +       +   + I+++++D+++AL IPGG        +   E+++N I +F  D  KKW+ T    +  + + GVL ++K TT       ++K+ +++        IVVD N ++   P  A   ALL++EKL
  S:    28 TDFGCDVEVVTGGFNEKVISSFNIPVLVDKTIDEISVDEYDALAIPGGFEVFGFYEEAYEEKLLNLIRQF--DARKKWIATVCVGALPVGKSGVLKDRKATTYHLGGAVKQKVLQSFGAIIVHEPIVVDDNIITSYGPQTASGVALLLLEKL 177
>gi|91772113|ref|YP_564805.1| ThiJ/PfpI [Methanococcoides burtonii DSM 6242] >gi|91711128|gb|ABE51055.1| ThiJ/PfpI [Methanococcoides burtonii DSM 6242] (174 aa)
Score = 119, Expect = 6.2e-05, Identities = 46/155 (29%), Positives = 81/155 (52%)
  Q:    21 DMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL------GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKL 175
           D + + P  ++  +G  V   SN  KK+  +  G K++    I  VN+D ++A+ I GG G ++ L D  E  + +IV+ A ++G K +     A  VLA  G+L   K+TT    EE +         Y D +++VD N ++ + P  A ++   +++ L
  S:    18 DEEFLKPKKVFEDSGAKVTVASNTTKKAKGVL-GKKVSPDISISDVNIDDYDAISITGGGGAKQYLWDNKE--LQEIVRKANEQG-KIIGAICIAPVVLANAGLL-EGKMTTVFKNEETVKILKDNDAKYRDKDVMVDGNIITGRDPNAANKYGQAVIKAL 173
>gi|125597442|gb|EAZ37222.1| hypothetical protein OsJ_020705 [Oryza sativa (japonica cultivar-group)] (413 aa)
Score = 119, Expect = 6.3e-05, Identities = 35/120 (29%), Positives = 64/120 (53%)
  Q:    70 KFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGK--NYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           +F+ + +PGG  G   L   R+ +++  +VK    +GK +     A +  L   G+L   K T  P F +KL    N  ++ + +D N V+ + P  A E+++++VE+L  K+ A  +A  +L
  S:    75 EFDLISLPGGMPGSSNL---RDCKLLENMVKKHAGKGKLYAAICAAPAVALGSWGLLNGLKATCYPSFMDKLPSEVNAVESRVQIDGNCVTSRGPGTAMEYSVVLVEQLYGKEKADEVAGPML 194
Score = 117, Expect = 1.0e-04, Identities = 36/102 (35%), Positives = 59/102 (57%)
  Q:    89 RNERVINKIVKFAGDEGKKWLFTAGAASTVLA--ELGVLGNKKITTAPGFEEKLG-KNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILY 190
           +++++I  I K A  E  K L+ A  AS  +A    G+L  KK T+ PG   KL  ++   N +VVD N ++ + P  + EF+L IVEKL  ++ A  +A  +++
  S:   311 KSDKLIGLIKKQA--EANK-LYGAICASPAIALEPHGLLKGKKATSFPGMWNKLSDQSECKNRVVVDGNLITSQGPGTSMEFSLAIVEKLFGRERAVELAKTMVF 412
>gi|23098158|ref|NP_691624.1| hypothetical protein OB0703 [Oceanobacillus iheyensis HTE831] >gi|22776383|dbj|BAC12659.1| hypothetical conserved protein [Oceanobacillus iheyensis HTE831] (170 aa)
Score = 119, Expect = 6.7e-05, Identities = 41/151 (27%), Positives = 70/151 (46%)
  Q:    11 IAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTD-RNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSDNNIVVDKNFVSFKSP 161
           IA++ +    ++++  P   +  AG  V+ +SNE  K+I  ++G KI   + I  V+   ++AL +PGG     L  D +N       +K       K +F        L E  +L  K +T+     + L   G    D  +VVD N V+ ++P
  S:     5 IAVLVTDMVEEIELTDPVKAYKEAGHTVDIISNEGNKTINGKNGDKIEADKGINDVDPSAYDALLVPGGFSPDLLRIDPKNGEFAKAFMK-----DNKPVFAICHGPQFLVETDLLKGKTLTSFVSVRKDLENAGATVKDEEVVVDGNLVTSRTP 154
>gi|89073145|ref|ZP_01159684.1| Putative 4-methyl-5(B-hydroxyethyl)-thiazol monophosphate biosynthesis enzyme [Photobacterium sp. SKA34] >gi|89051098|gb|EAR56555.1| Putative 4-methyl-5(B-hydroxyethyl)-thiazol monophosphate biosynthesis enzyme [Photobacterium sp. SKA34] (205 aa)
Score = 119, Expect = 6.9e-05, Identities = 46/189 (24%), Positives = 90/189 (47%)
  Q:     1 MIKHKVSNIRIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNL--DKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKN-YSDNNIVVDKN--FVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           M++   +  R+A+  +  S +M+ +    I  RAG  V   S  +  ++ L+    I    ++  +N+  + F+ + +PGG KG + L   R+  ++ + VK    +GK         + +     +  +  +T  P F+ ++  +      +V DKN   ++ + P  A EFAL IV +L NK  A  +A  ++
  S:     1 MLEPITTTPRVAVCLAPGSEEMEAINTIAILKRAGFEVTIASTAEDGALILEGSRGIKLVADVPLINVADEPFDCVVLPGGLKGAEHL---RDSPLVVEFVKQHHYDGKLIAAICATPAVMFIPHQLFTHSIMTCHPAFQHQIPTHQLRVKRVVYDKNTRLLTSQGPGTAQEFALEIVSQLENKAKAAEVAEPMV 192
>gi|2108267|emb|CAA63466.1| yraA [Bacillus subtilis] (154 aa)
Score = 119, Expect = 7.3e-05, Identities = 43/147 (29%), Positives = 63/147 (42%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSDNNIVVDKNFV 156
           +IA++ + +  D++   P   +  AG  V  +  E  K +  + G K+   + I  V+   F+AL IPGG     L  D       K    A  E KK +F       VL +  +L  K IT      + L   G NY D  +VV  N V
  S:     4 KIAVLVTDQFEDIEYTSPVKAYEEAGYSVVAIDLEAGKEVTGKHGEKVKIDKAISDVDASDFDALLIPGGFSPDLLRADDRPGEFAK----AFVENKKPVFAICHGPQVLIDTDLLKGKDITGYRSIRKDLINAGANYKDAEVVVSHNIV 149
>gi|72016210|ref|XP_784692.1| PREDICTED: similar to DJ-1 [Strongylocentrotus purpuratus] >gi|115941753|ref|XP_001191288.1| PREDICTED: similar to DJ-1 [Strongylocentrotus purpuratus] (130 aa)
Score = 118, Expect = 7.9e-05, Identities = 35/101 (34%), Positives = 53/101 (52%)
  Q:    89 RNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKN----YSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           R E   + I+   G  G K L   G  + +   +GV   K IT+ PG +EKL  +    YS++ +V D   ++ + P  AFEFAL IVE+L  ++    I   +L
  S:    25 RAEGPYDVILLPGGGPGAKNLCEVGPTALMTHNIGV--KKTITSHPGVKEKLENSGLFTYSEDRVVRDGKLITSRGPGTAFEFALAIVEQLKGQETVNKIIPPML 127
>gi|42781746|ref|NP_978993.1| thiJ/pfpI family protein [Bacillus cereus ATCC 10987] >gi|42737669|gb|AAS41601.1| thiJ/pfpI family protein [Bacillus cereus ATCC 10987] (190 aa)
Score = 118, Expect = 8.4e-05, Identities = 48/172 (27%), Positives = 84/172 (48%)
  Q:     9 IRIAIMCSIESNDMDIVIPYDIWTRAGII-------VETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQI 180
           ++IAI+C     D+D+ +P+D+  R  ++       V+ +  EK       SG +I  +  I   +L   +A+    GKG Q L   +N+  IN I     D  ++ + +  + S +L    +L  KK TT P   E+L   G    + + V + N  +    F A E +  I+  LLN+++
  S:     1 MKIAIVCFDNFTDIDVFLPWDLLNRVRLVGGISDWDVQLLGTEKTH--ISMSGLRIPMTASI--FDLPSADAVIFASGKGVQDLY--KNQEYINSI---HVDPQRQLIGSMCSGSLLLGAKKLLTGKKATTYPSAVEQLKEFGVEVIEKSFVNEGNISTAAGCFAAQELSAWIIRTLLNEEM 173
>gi|74212240|dbj|BAE40278.1| unnamed protein product [Mus musculus] (189 aa)
Score = 118, Expect = 8.9e-05, Identities = 50/175 (28%), Positives = 86/175 (49%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLD-KFNALYIPGGK-GCQRLLTDRNERVINKIVKFAGDEGKKWLFTA---GAASTVLAELGVLGNKKITTAPGFEEKL--GKNYSDNNIVVDKN--FVSFKSPFHAFEFALLIVEKLLNKQIATNI 184
           R  ++ +  + +M+ VIP D+  RAGI V       K  +       I     +E       ++ + +PGG  G Q L       ++ +I+K    E +K L  A   G  + +  E+G     K+TT    ++K+  G +YS +   V+K+   ++ + P  +FEFAL IVE L+ K +A  +
  S:     5 RALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVMICPDTSLEDAKTQGPYDVVVLPGGNLGAQNL---SESPMVKEILK--EQESRKGLIAAICAGPTALLAHEVGF--GCKVTTHTLAKDKMMNGSHYSYSESRVEKDGLILTSRGPGTSFEFALAIVEALVGKDMANQV 181
>gi|54020354|ref|YP_115641.1| hypothetical protein mhp127 [Mycoplasma hyopneumoniae 232] >gi|53987527|gb|AAV27728.1| conserved hypothetical protein [Mycoplasma hyopneumoniae 232] >gi|144227532|gb|AAZ44335.2| conserved hypothetical protein [Mycoplasma hyopneumoniae J] >gi|144575345|gb|AAZ53626.2| conserved hypothetical protein [Mycoplasma hyopneumoniae 7448] (178 aa)
Score = 118, Expect = 9.1e-05, Identities = 31/118 (26%), Positives = 62/118 (52%)
  Q:    69 DKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIAN 186
           D F+A++IPGG   Q  L  ++ + I  + +F      K +F    A   + EL +  N + ++ P       +   D+ + +D+N++S ++   + +FA +++EKL +K++A  I N
  S:    61 DDFDAVFIPGGFAAQ--LFRKDSKSIQLVSEFFAQ--NKHIFAICDAPNAIFELKLAENYQFSSYPNQHNSKIRLRQDSLVTIDRNYISARNAASSADFAFVVIEKLGSKELAQKIRN 174
>gi|71893600|ref|YP_279046.1| hypothetical protein MHJ_0244 [Mycoplasma hyopneumoniae J] >gi|72080591|ref|YP_287649.1| hypothetical protein MHP7448_0252 [Mycoplasma hyopneumoniae 7448] (189 aa)
Score = 118, Expect = 9.2e-05, Identities = 31/118 (26%), Positives = 62/118 (52%)
  Q:    69 DKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIAN 186
           D F+A++IPGG   Q  L  ++ + I  + +F      K +F    A   + EL +  N + ++ P       +   D+ + +D+N++S ++   + +FA +++EKL +K++A  I N
  S:    72 DDFDAVFIPGGFAAQ--LFRKDSKSIQLVSEFFAQ--NKHIFAICDAPNAIFELKLAENYQFSSYPNQHNSKIRLRQDSLVTIDRNYISARNAASSADFAFVVIEKLGSKELAQKIRN 185
>gi|156370244|ref|XP_001628381.1| predicted protein [Nematostella vectensis] >gi|156215356|gb|EDO36318.1| predicted protein [Nematostella vectensis] (192 aa)
Score = 117, Expect = 1.1e-04, Identities = 31/105 (29%), Positives = 58/105 (55%)
  Q:    71 FNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL----GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKL 175
           ++A+ +PGG  G Q L        + +I++   + G+         + +LA  GV G K++T+ P F++K+    G  YS++ +V D N ++ + P  AFEF + +V  +
  S:    70 YDAVILPGGLTGAQNLAKSDQ---VGQILREQYEAGRIVAAICAGPTALLAH-GVGGGKRVTSYPSFKDKMTGKYGYTYSEDRVVRDGNLITSRGPGTAFEFGIELVRAI 175
>gi|148997116|ref|ZP_01824770.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein, putative [Streptococcus pneumoniae SP11-BS70] >gi|149007690|ref|ZP_01831307.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein, putative [Streptococcus pneumoniae SP18-BS74] >gi|168575467|ref|ZP_02721403.1| DJ-1 family protein [Streptococcus pneumoniae MLV-016] >gi|147756816|gb|EDK63856.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein, putative [Streptococcus pneumoniae SP11-BS70] >gi|147760845|gb|EDK67816.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein, putative [Streptococcus pneumoniae SP18-BS74] >gi|183578608|gb|EDT99136.1| DJ-1 family protein [Streptococcus pneumoniae MLV-016] (184 aa)
Score = 117, Expect = 1.1e-04, Identities = 43/167 (25%), Positives = 81/167 (48%)
  Q:     9 IRIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEK-LGKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKL 175
           +++A++ +    +++ +   D+  RA I  + V  E++ +    S      ++ +   +L  ++ + +PGG      L D N+ +I ++  F   EGKK L    AA   L +  +L NK+ T   G +E+ L  +Y    +VVD    + + P  A  FA  +VE+L
  S:     2 VKVAVILAQGFEEIEALTVVDVLRRANITCDMVGFEEQVT---GSHAIQVRADHVFDGDLSDYDMIVLPGGMPGSAHLRD-NQTLIQELQSFE-QEGKK-LAAICAAPIALNQAEILKNKRYTCYDGVQEQILDGHYVKETVVVDGQLTTSRGPSTALAFAYELVEQL 163
>gi|52081611|ref|YP_080402.1| intracellular protease [Bacillus licheniformis ATCC 14580] >gi|52786992|ref|YP_092821.1| YraA [Bacillus licheniformis ATCC 14580] >gi|52004822|gb|AAU24764.1| probable intracellular protease [Bacillus licheniformis ATCC 14580] >gi|52349494|gb|AAU42128.1| YraA [Bacillus licheniformis DSM 13] (174 aa)
Score = 117, Expect = 1.1e-04, Identities = 40/152 (26%), Positives = 71/152 (46%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFE---EKLGKNYSDNNIVVDKNFVSFKSP 161
           ++  + S E  D+++  P       G IV  +  +       + G       E++ VN+++++A+ +PGG    +L   R   V+  I  F  +E KK +     A  VL   G+L  +K+T+ PG +   E  G  + +   VVD + VS + P
  S:     7 KVIALVSDEFEDLELWYPVLRLKEEGAIVHFIGEKADHEYKGKYGVPAVSDYELKSVNIEEYDAVLVPGGWAPDKL--RRYPEVLEMIRWF--NERKKPIGQICHAGWVLISAGILEGRKVTSTPGIKDDMENAGAIWVNEAAVVDGHIVSSRRP 157
>gi|42781363|ref|NP_978610.1| DJ-1/PfpI family protein [Bacillus cereus ATCC 10987] >gi|42737285|gb|AAS41218.1| DJ-1/PfpI family [Bacillus cereus ATCC 10987] (193 aa)
Score = 117, Expect = 1.1e-04, Identities = 42/131 (32%), Positives = 72/131 (54%)
  Q:    56 KITCS--------EEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITT--APGFEEK-----LGKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIAN 186
           K+TC+        + ++ + LD+F+AL IPGG        D   +    +++    + +K + +   AS  L + G+L  KK TT   P  E K      G    ++ IV D N ++  +P  AF+ A L++EKL +KQ A ++ +
  S:    45 KLTCTWNFTIIPEKTVDNIQLDEFDALAIPGGFEEAGFYRDAYSKEFLHVIQHFHVK-QKPIASICVASLALGKSGILIGKKATTYSHPTSERKEQLKNFGAKVQNDLIVQDGNIITSSNPGTAFDVAFLLLEKLTSKQNAKHVKD 189
>gi|15900697|ref|NP_345301.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein, putative [Streptococcus pneumoniae TIGR4] >gi|111658145|ref|ZP_01408842.1| hypothetical protein SpneT_02000670 [Streptococcus pneumoniae TIGR4] >gi|14972281|gb|AAK74941.1| putative 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein [Streptococcus pneumoniae TIGR4] (184 aa)
Score = 117, Expect = 1.1e-04, Identities = 43/167 (25%), Positives = 81/167 (48%)
  Q:     9 IRIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEK-LGKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKL 175
           +++A++ +    +++ +   D+  RA I  + V  E++ +    S      ++ +   +L  ++ + +PGG      L D N+ +I ++  F   EGKK L    AA   L +  +L NK+ T   G +E+ L  +Y    +VVD    + + P  A  FA  +VE+L
  S:     2 VKVAVILAQGFEEIEALTVVDVLRRANITCDMVGFEEQVT---GSHAIQVRADHVFDGDLSDYDMIVLPGGMPGSAHLRD-NQTLIQELQSFE-QEGKK-LAAICAAPIALNQAEILKNKRYTCYDGVQEQILDGHYVKETVVVDGQLTTSRGPSTALAFAYELVEQL 163
>gi|187466257|emb|CAQ52056.1| Parkinson disease (autosomal recessive, early onset) 7 [Mus musculus] (188 aa)
Score = 117, Expect = 1.1e-04, Identities = 52/175 (29%), Positives = 91/175 (52%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSE-EIEKVNLD-KFNALYIPGGK-GCQRLLTDRNERVINKIVKFAGDEGKKWLFTA---GAASTVLAELGVLGNKKITTAPGFEEKL--GKNYSDNNIVVDKN--FVSFKSPFHAFEFALLIVEKLLNKQIATNI 184
           R  ++ +  + +M+ VIP D+  RAG +  TV+    K     S   + C +  +E       ++ + +PGG  G Q L       ++ +I+K    E +K L  A   G  + +  E+G     K+TT P  ++K+  G +YS +   V+K+   ++ + P  +FEFAL IVE L+ K +A  +
  S:     5 RALVILAKGAEEMETVIPVDVMRRAGKV--TVAGLAGKDPVQCSRDVMICPDTSLEDAKTQGPYDVVVLPGGNLGAQNL---SESPMVKEILK--EQESRKGLIAAICAGPTALLAHEVGF--GCKVTTHPLAKDKMMNGSHYSYSESRVEKDGLILTSRGPGTSFEFALAIVEALVGKDMANQV 180
>gi|27468478|ref|NP_765115.1| hypothetical protein SE1560 [Staphylococcus epidermidis ATCC 12228] >gi|57867324|ref|YP_188982.1| ThiJ/PfpI family protein [Staphylococcus epidermidis RP62A] >gi|81674024|sp|Q5HN59|Y1413_STAEQ Uncharacterized protein SERP1413 >gi|81843573|sp|Q8CRV8|Y1560_STAES Uncharacterized protein SE_1560 >gi|27316025|gb|AAO05159.1|AE016749_105 conserved hypothetical protein [Staphylococcus epidermidis ATCC 12228] >gi|57637982|gb|AAW54770.1| ThiJ/PfpI family protein [Staphylococcus epidermidis RP62A] (172 aa)
Score = 117, Expect = 1.2e-04, Identities = 43/166 (25%), Positives = 71/166 (42%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKL 175
           ++AI+ + E  D+++  P +    AG   E + +     +  + G K+T    I     + ++AL IPGG     L  D   R       F  ++   +    G    VL +   L  + IT      + L   G N  D ++VVD N V+ + P    +F   IV+KL
  S:     4 KVAIILADEFEDIELTSPKEALENAGFETEVIGDTANHEVVGKHGEKVTVDVSIADAKPENYDALLIPGGFSPDHLRGDEEGRYGTFAKYFTKNDVPTFAICHG--PLVLVDTDDLKGRTITGVINVRKDLSNAGANVVDESVVVDNNIVTSRVPDDLDDFNREIVKKL 170
>gi|194539427|ref|YP_002074478.1| protein ThiJ [Vibrio sp. Ex25] >gi|151937982|gb|EDN56826.1| protein ThiJ [Vibrio sp. Ex25] (199 aa)
Score = 117, Expect = 1.2e-04, Identities = 41/171 (23%), Positives = 85/171 (49%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNL--DKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYSDNNIV---VDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           + +M+ V   D+  RAG  V   S     S+ +++   +T + + + V++  D+F+A+ + GG G   +   R+  V+ +I+K    EGK       A + VL    +     +T  P F+  + +    +  V   ++ N ++ + P  A EFA+ ++ +L  K+ A ++A  ++
  S:    13 TEEMEAVTVIDMMVRAGYDVTVASAAFDGSLTMKASRGVTLTADCKLVDIADDEFDAIALSGGVGGAEIF--RDSTVMIEILKQHIYEGKLVAAICAAPALVLQHHDLFPQSLMTCHPSFQSHIPEEKWRSKRVTFDINHNLITSQGPGTALEFAMEVIIQLSGKKHAWSVAEPMI 186
>gi|171911857|ref|ZP_02927327.1| proteinase I [Verrucomicrobium spinosum DSM 4136] (193 aa)
Score = 116, Expect = 1.3e-04, Identities = 44/170 (25%), Positives = 79/170 (46%)
  Q:     6 VSNIRIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEK---KKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNER-VINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKL 175
           + N R+AI+ +     +++  P     +AG  V  VS +    +    L+ G        ++ VN   F+AL +PGG      L  R+ R  +N +  FA  E  K +     A  +L E G++  + +T+ P  +  +   G N+ D  +VVD   V+ + P    +F    +E++
  S:     5 LENKRVAILATDGFEQVELEEPMHALKQAGATVSIVSPKAGTVQGMNHLEKGDNFNVDLTLDSVNASDFDALVLPGGLANPDTL--RSTRDAVNFVRDFA--EAGKPICAICHAPWILIEAGLVAGRTLTSWPAIQSDVHNAGGNWVDQPVVVDNGLVTSRKPDDLTQFIAKTIEEI 177
>gi|2911060|emb|CAA17570.1| putative protein [Arabidopsis thaliana] >gi|3297826|emb|CAA19884.1| putative protein [Arabidopsis thaliana] >gi|7270351|emb|CAB80119.1| putative protein [Arabidopsis thaliana] (334 aa)
Score = 116, Expect = 1.4e-04, Identities = 40/157 (25%), Positives = 73/157 (46%)
  Q:    28 YDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNI 184
           +D+  RAG  V   S E+K  +   SGT++     I K     ++ + +PGG  G  RL   R+  ++ KI+K   ++ + +   + A +  L   G+L  K++ T    +          NI +     + + P  +F+FAL + E+L  +  A +I
  S:   115 FDVLRRAGADVTVASVEQKLEVEGSSGTRLLADVLISKCADQVYDLVALPGGMPGAVRL---RDCEILEKIMKRQAEDKRLYGAISMAPAITLLPWGLLTRKRLPTFWAVK---------TNIQISGELTTSRGPGTSFQFALSLAEQLFGETTAKSI 260
>gi|146312123|ref|YP_001177197.1| ThiJ/PfpI domain-containing protein [Enterobacter sp. 638] >gi|145318999|gb|ABP61146.1| ThiJ/PfpI domain protein [Enterobacter sp. 638] (185 aa)
Score = 116, Expect = 1.4e-04, Identities = 42/182 (23%), Positives = 87/182 (47%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVL-GNKKITTAPGFEEKLGKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIAT-NIANDILYT 191
           ++A++ +    + + +I  DI  R  I VE ++  + +++       +     + +     ++A+ +PGG +G   L   ++   + + +    + GK       AA+ VL   G+L G + + +   ++      Y D  +V D+N +S K   HAF+FAL +  +LL+ +    + A+ I YT
  S:     3 KVAVLLAPGFEEAEAIITIDILRRMHIDVEMLACAESRAVVSYHDIPMVADSTLRERMDTLYDAVVLPGGPQGSVNLAASQD---VIRFISMHDEAGKLICPICSAAARVLGGNGLLKGRRYVCSGDLWQSVTDGEYIDAPVVEDQNLLSGKGLGHAFDFALTLAARLLDDETPVRDHADHIYYT 184
>gi|167344439|ref|ZP_02290280.1| intracellular protease, PfpI family protein [Listeria monocytogenes FSL J1-208] (173 aa)
Score = 116, Expect = 1.5e-04, Identities = 36/152 (23%), Positives = 72/152 (47%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSDNNIVVDKNFVSFKSP 161
           ++  + S +  D+++  P      AG  V  V+ E KK    + G  +T   + + V  + ++ + +PGG    +L   R + V++ +  F  D+ KK +     A  VL   G+L    +T+ PG ++ +   G  + +  +V D + +S + P
  S:     7 KVIALVSEDFEDLELWYPVLRLREAGASVHLVAEEAKKVYHGKYGVPVTSDYDFDSVRAEDYDGILVPGGWSPDKL--RRFDSVLDLVRAF--DKAKKPIGQICHAGWVLVSAGILEGVNVTSTPGIKDDMTNAGAIWHNEPVVTDGHIISSRRP 157
>gi|125597440|gb|EAZ37220.1| hypothetical protein OsJ_020703 [Oryza sativa (japonica cultivar-group)] (137 aa)
Score = 115, Expect = 1.7e-04, Identities = 40/117 (34%), Positives = 65/117 (55%)
  Q:    74 LYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLA--ELGVLGNKKITTAPGFEEKLG-KNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILY 190
           L + GG G  +    +++++I  I K A  E  K L+ A  AS  +A    G+L  KK T+ PG   KL  ++   N +VVD N ++ + P  + EF+L IVEKL  ++ A  +A  +++
  S:    21 LNVKGGLGGAQAYA-KSDKLIGLIKKQA--EANK-LYGAICASPAIALEPHGLLKGKKATSFPGMWNKLSDQSECKNRVVVDGNLITSQGPGTSMEFSLAIVEKLFGRERAVELAKTMVF 136
>gi|156975557|ref|YP_001446464.1| hypothetical protein VIBHAR_03289 [Vibrio harveyi ATCC BAA-1116] >gi|156527151|gb|ABU72237.1| hypothetical protein VIBHAR_03289 [Vibrio harveyi ATCC BAA-1116] (199 aa)
Score = 115, Expect = 1.7e-04, Identities = 43/172 (25%), Positives = 85/172 (49%)
  Q:     8 NIRIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNL--DKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYSDNNIV---VDKNFVSFKSPFHAFEFALLIVEKLLNKQ 179
           N +I +  +  + +M+ V   D+  RAG  V   S +   ++ +++   +T + + + V++  D+F+A+ + GG G     T R+  ++ +I+K    EGK       A + VL    +     +T  P F+  + ++      V   V+ N ++ + P  A EFA+ I+ KL  K+
  S:     2 NKKILVPIAPGTEEMEAVTVIDLMVRAGYDVTVASADFDGALTMKASRGVTLTADCKLVDIADDEFDAIVLSGGVGGAE--TFRDSTIMIEILKQHMYEGKLVAAICAAPALVLQHHNLYPEALMTCHPSFQSHIPEDKWRAKRVTMDVNHNLLTSQGPGTALEFAMEIIIKLSGKE 176
>gi|126330567|ref|XP_001362447.1| PREDICTED: similar to CAP1 protein [Monodelphis domestica] (189 aa)
Score = 115, Expect = 1.7e-04, Identities = 42/166 (25%), Positives = 75/166 (45%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLD-KFNALYIPGGK-GCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGK----NYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNI 184
           + +M+ VIP D+  RAGI V       K  +       I   E +E       ++ + +PGG  G Q L     E  + K +    ++ K  +    A  T L    +    K+TT P  ++K+       Y+++ +  D N ++ + P  +FEF L I+ +L+ K +   +
  S:    14 AEEMETVIPVDLMRRAGIKVVLAGLSGKDPVQCSRDVFICPDESLEDAKKQGPYDVIVLPGGNLGAQNLC----ESPVVKTLLKEQEKNKGLIAAVCAGPTALLAHEIGFGSKVTTHPLAKDKMMNGSHYTYTESRVEKDGNILTSRGPGTSFEFGLAIIAELMGKSVVDQV 181
>gi|20091359|ref|NP_617434.1| intracellular protease I [Methanosarcina acetivorans C2A] >gi|19916492|gb|AAM05914.1| intracellular protease I [Methanosarcina acetivorans C2A] (166 aa)
Score = 115, Expect = 1.7e-04, Identities = 43/145 (29%), Positives = 71/145 (48%)
  Q:    21 DMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSDNNIVVDKNFVSFKSP--FHAF 165
           D+++  PY      GI    V++ KK  I  + G +IT     + VN   ++ + I GGKG +++  D++     +IVK    + K  + +      VL    V+  +K T   G  + +   G  Y D+ +VVD N VS ++P   HAF
  S:    13 DLELFYPYHRLKEEGITTH-VASMKKGPITGKHGYEITADIAFKDVNSADYDIIVISGGKGPEKMRLDKDAL---EIVKNFFKKNKP-VASICHGPQVLVSADVIKGRKATCWIGIRDDIIAAGAQYEDSEVVVDGNLVSSRNPGDLHAF 157
>gi|167523805|ref|XP_001746239.1| predicted protein [Monosiga brevicollis MX1] >gi|163775510|gb|EDQ89134.1| predicted protein [Monosiga brevicollis MX1] (188 aa)
Score = 115, Expect = 1.7e-04, Identities = 50/176 (28%), Positives = 82/176 (46%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKV---------NLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKN--YSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIA 185
           R  ++ +  + +M+ VI  D+  RA + V            L+S   ITCS  +  V             F+ L +PGG G    L D +  +   +   +       L    AA+TVLA+  +   K+ T+ PG  + +  +  YS++ +VVD N ++ + P    EFAL IV  LL +     +A
  S:     8 RALVLLAPGAEEMETVITVDVLRRAKLEVVLAG--------LESADPITCSRNVVLVPDMALAAAQASGPFDVLVLPGGAGGAAALRD-SATLTAALTCLS-------LSLLAAATTVLAKHNIGAGKRATSHPGVADDVRSHFQYSEDRVVVDGNLITSRGPGTTMEFALAIVRHLLGEAAVQTVA 178
>gi|52142841|ref|YP_083988.1| thiJ/PfpI family protein [Bacillus cereus E33L] >gi|196040255|ref|ZP_03107556.1| thiJ/pfpI family protein [Bacillus cereus NVH0597-99] >gi|196043566|ref|ZP_03110804.1| thiJ/pfpI family protein [Bacillus cereus 03BB108] >gi|51976310|gb|AAU17860.1| thiJ/PfpI family protein [Bacillus cereus E33L] >gi|196025875|gb|EDX64544.1| thiJ/pfpI family protein [Bacillus cereus 03BB108] >gi|196028740|gb|EDX67346.1| thiJ/pfpI family protein [Bacillus cereus NVH0597-99] (190 aa)
Score = 115, Expect = 1.8e-04, Identities = 47/172 (27%), Positives = 86/172 (50%)
  Q:     9 IRIAIMCSIESNDMDIVIPYDIWTRAGII-------VETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQI 180
           ++IAI+C     D+D+ +P+D+  R  ++       V+ +  E+       SG +I  +  I   +L   +A+    GKG Q L   +N++ IN I     D  K+ + +  + S +L    +L  KK TT P   E+L   G +  + + V + N  +    F A E +  I+  L+N+++
  S:     1 MKIAIVCFDNFTDIDVFLPWDLLNRVRLVGGISDWDVQLLGTEETH--ISMSGLRIPMTGSIS--DLPSADAVIFASGKGIQDLY--KNQQYINSI---HIDPQKQLIGSMCSGSLLLGAKKLLTGKKATTYPSAVEQLKEFGVDVIEKSFVKEGNISTAAGCFAAQELSAWIIRTLINEEM 173
>gi|148379015|ref|YP_001253556.1| DJ-1/PfpI family protein [Clostridium botulinum A str. ATCC 3502] >gi|153932182|ref|YP_001383399.1| DJ-1/PfpI family protein [Clostridium botulinum A str. ATCC 19397] >gi|153937372|ref|YP_001386946.1| DJ-1/PfpI family protein [Clostridium botulinum A str. Hall] >gi|148288499|emb|CAL82578.1| putative protease I [Clostridium botulinum A str. ATCC 3502] >gi|152928226|gb|ABS33726.1| DJ-1/PfpI family protein [Clostridium botulinum A str. ATCC 19397] >gi|152933286|gb|ABS38785.1| DJ-1/PfpI family protein [Clostridium botulinum A str. Hall] (194 aa)
Score = 115, Expect = 1.8e-04, Identities = 42/128 (32%), Positives = 69/128 (53%)
  Q:    57 ITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDR-NERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITT---APGFEEK----LGKN-YSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNI 184
           +T    + +VN+D+F+AL IPGG        D  +E  +N I +F  D+ +K + +    +  + + GVL N+  TT     G  +K     G N   D  +VVDKN ++  +P  AF  A  ++E L +K+   N+
  S:    54 VTPEMHVSEVNIDEFDALAIPGGFEEAGFYEDAYSEDFLNIIREF--DKARKTIASICVGALPIGKSGVLVNRNATTYNLGNGRRQKQLSEFGANVLRDEPVVVDKNIITSYNPSTAFHVAFKLLELLTSKENCVNV 188
>gi|167765299|ref|ZP_02437412.1| hypothetical protein BACSTE_03687 [Bacteroides stercoris ATCC 43183] >gi|167696927|gb|EDS13506.1| hypothetical protein BACSTE_03687 [Bacteroides stercoris ATCC 43183] (181 aa)
Score = 115, Expect = 1.9e-04, Identities = 52/150 (34%), Positives = 79/150 (52%)
  Q:    29 DIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNA--LYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL-GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNK 178
           D+  RAG+ VE ++    + +    G  + C + I  VN D F+A  + +PGG      L ++ + +   I++FA  E  K +    AA  VL +LG+L  KK T  PGFE+ L G + +   +  D N ++ K P  A EFAL +VE L  K
  S:    22 DVMRRAGLNVEMITVTPDEIVKGAHGVPVLCDKNI--VNCDFFDADLILLPGGMPGAATL-EKCDDLRRLILRFA--EENKPIAAICAAPMVLGKLGLLKGKKATCYPGFEQYLEGADCTGAMVEKDGNVITGKGPGAAMEFALAVVELLQGK 169
>gi|50365079|ref|YP_053504.1| putative intracellular protease/amidase [Mesoplasma florum L1] >gi|50363635|gb|AAT75620.1| putative intracellular protease/amidase [Mesoplasma florum L1] (181 aa)
Score = 115, Expect = 1.9e-04, Identities = 46/180 (25%), Positives = 81/180 (45%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNY-SDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           ++AI+      + + ++  DI  R+ IIV+  + E K          +     I+ +N   ++ + IPGG G   L    NE ++N I  F  ++  K +    AA  +L   G++ + KI   P   + L K    + + ++DKN V+  S      FAL I+E L  K+    I   ++
  S:     3 KVAIILHKNFEESEAIVTIDILRRSEIIVDIYNIENKDFQVGSHNIIVKTEYNIQSLNSQNYDGIVIPGGPGVNELFD--NEILLNLIKDF--NDKNKMVSAICAAPQILGLAGIIDDIKIVKFPTSNKYLEKALVQEKDSIIDKNIVTGSSIGTVVPFALNIIEYLQGKEQKEKIRQQLV 179
>gi|47568298|ref|ZP_00239000.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Bacillus cereus G9241] >gi|47554991|gb|EAL13340.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Bacillus cereus G9241] (193 aa)
Score = 115, Expect = 1.9e-04, Identities = 41/131 (31%), Positives = 73/131 (55%)
  Q:    56 KITCS--------EEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITT--APGFEEK-----LGKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIAN 186
           K+TC+        + ++ + LD+F+AL IPGG        D   R  + +++    + +K + +   AS  L + G+L  KK TT   P  + K      G    ++ IV D N ++  +P  AF+ A L++EKL +K+ A ++ +
  S:    45 KLTCTWNFTVIPEKTVDDIQLDEFDALAIPGGFEEAGFYRDAYSREFSHVIQHFYAK-QKPIASICVASLTLGKSGILTGKKATTYSHPTSKRKEQLKNFGAIIQNDLIVQDGNIITSSNPGTAFDVAFLLLEKLTSKKNAEHVKD 189
>gi|118390157|ref|XP_001028069.1| DJ-1 family protein [Tetrahymena thermophila SB210] >gi|89309839|gb|EAS07827.1| DJ-1 family protein [Tetrahymena thermophila SB210] (191 aa)
Score = 115, Expect = 1.9e-04, Identities = 43/172 (25%), Positives = 87/172 (50%)
  Q:    21 DMDIVIPYDIWTRAG--IIVETVSNEKKKSIFL-QSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTA-PGFEEKLGKNYSDN-NIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILYTK 192
           +++ +   D++ R G  IIV ++ N+ +  +    +G +I C + +E+V    F+ +  PGG    + L+D   +++ + +K   ++ K +     A   +  + G L ++   T  PGF +KL      N ++VV    V+ KS   A +F L ++  L  +Q   ++   ++YTK
  S:    17 EIEAITVIDLFRRIGADIIVASILNKSEGLVVKGANGIQIICDKNLEEVIDQDFDMIVCPGGMPGAQYLSDC--QILIQRLKKQKEQDKYYAAICAAPFVIFEKHGFLNSQVAGTCHPGFADKLANQTKVNLDVVVSGKCVTSKSAGTAMDFGLQLLRLLYPEQQVLDVLKKLVYTK 191
>gi|153828191|ref|ZP_01980858.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Vibrio cholerae 623-39] >gi|148876280|gb|EDL74415.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Vibrio cholerae 623-39] (205 aa)
Score = 115, Expect = 1.9e-04, Identities = 41/176 (23%), Positives = 76/176 (43%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYSDNNIV---VDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIA 185
           RI +  +  S +M+ VI  D   RAG  V   +   K  +    G  +T  + +E  + + F+AL +PGG G  +   D    ++  ++     +GK         + V A+       ++T  P F E +         V     ++ ++ + P  A EFAL ++  L   ++A ++A
  S:     8 RILVPVANGSEEMETVIIVDTLVRAGFQVTMAAVGDKLQVQGSRGVWLTAEQTLEACSAEAFDALALPGGVGGAQAFADST--LLLALIDAFSQQGKLVAAICATPALVFAKQQKFVGARMTCHPNFFEHIPSERLSRQRVCYYATQHLLTSQGPGTALEFALAMIALLAGVELAQHVA 184
>gi|153217421|ref|ZP_01951172.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Vibrio cholerae 1587] >gi|124113556|gb|EAY32376.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Vibrio cholerae 1587] (201 aa)
Score = 115, Expect = 1.9e-04, Identities = 41/176 (23%), Positives = 76/176 (43%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYSDNNIV---VDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIA 185
           RI +  +  S +M+ VI  D   RAG  V   +   K  +    G  +T  + +E  + + F+AL +PGG G  +   D    ++  ++     +GK         + V A+       ++T  P F E +         V     ++ ++ + P  A EFAL ++  L   ++A ++A
  S:     4 RILVPVANGSEEMETVIIVDTLVRAGFQVTMAAVGDKLQVQGSRGVWLTAEQTLEACSAEAFDALALPGGVGGAQAFADST--LLLALIDAFSQQGKLVAAICATPALVFAKQQKFVGARMTCHPNFFEHIPSERLSRQRVCYYATQHLLTSQGPGTALEFALAMIALLAGVELAQHVA 180
>gi|153833963|ref|ZP_01986630.1| protein ThiJ [Vibrio harveyi HY01] >gi|148869701|gb|EDL68682.1| protein ThiJ [Vibrio harveyi HY01] (199 aa)
Score = 115, Expect = 2.0e-04, Identities = 44/182 (24%), Positives = 89/182 (48%)
  Q:     8 NIRIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNL--DKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYSDNNIV---VDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           N +I +  +  + +M+ V   D+  RAG  V   S +   ++ +++   +T + + + V++  D+F+A+ + GG G     T R+  ++ +I+K    EGK       A + VL    +     +T  P F+  + ++      V   V+ N ++ + P  A EFA+ I+ KL  K+    +A  ++
  S:     2 NKKILVPIAPGTEEMEAVTVIDLMVRAGYDVTVASADFDGALTMKASRGVTLTADCKLVDIADDEFDAIVLSGGVGGAE--TFRDSTIMIEILKQHMYEGKLVAAICAAPALVLQHHNLYPEALMTCHPSFQSHIPEDKWRAKRVTMDVNHNLLTSQGPGTALEFAMEIIIKLSGKKHGWMVAEPLI 186
>gi|125743203|gb|ABN54799.1| DJ-1 [Carassius auratus] (148 aa)
Score = 115, Expect = 2.0e-04, Identities = 42/146 (28%), Positives = 67/146 (45%)
  Q:    23 DIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLD-KFNALYIPGGK-GCQRLLTDRNERVINKIVKFAGDEGKKWLFTA-GAASTVLAELGVLGNKKITTAPGFEEKLGK----NYSDNNIVVDKNFVSFKSPFHAFEFA 168
           + VIP D+  RAGI V       K+ +       I     +E       ++ + +PGG  G Q L        + +++K    EG+K L  A  A  T L   G+     +TT PG ++K+       YS+  +  D N ++ + P  +FEFA
  S:     1 ETVIPVDVMRRAGIAVTVAGLAGKEPVQCSRDVMICPDSSLEDARKQGPYDVVLLPGGLLGAQNL---SESPAVKEVLK--DQEGRKGLIAAICAGPTALLAHGIAYGSTVTTHPGAKDKMMAGDHYKYSEARVQKDSNVITSRGPGTSFEFA 148
>gi|118478041|ref|YP_895192.1| ThiJ/PfpI family protein [Bacillus thuringiensis str. Al Hakam] >gi|118417266|gb|ABK85685.1| ThiJ/PfpI family protein [Bacillus thuringiensis str. Al Hakam] (190 aa)
Score = 115, Expect = 2.1e-04, Identities = 47/172 (27%), Positives = 86/172 (50%)
  Q:     9 IRIAIMCSIESNDMDIVIPYDIWTRAGII-------VETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQI 180
           ++IAI+C     D+D+ +P+D+  R  ++       V+ +  E+       SG +I  +  I   +L   +A+    GKG Q L   +N++ IN I     D  K+ + +  + S +L    +L  KK TT P   E+L   G +  + + V + N  +    F A E +  I+  L+N+++
  S:     1 MKIAIVCFDNFTDIDVFLPWDLLNRVRLVGGISDWDVQLLGTEETH--ISMSGLRIPMTGSIS--DLPSADAVIFASGKGIQDLY--KNQQYINSI---HIDPQKQLIGSMCSGSLLLGAKKLLTGKKATTYPSAVEQLKEFGVDVIEKSFVNEGNISTAAGCFAAQELSAWIIRTLINEEM 173
>gi|114321713|ref|YP_743396.1| DJ-1 family protein [Alkalilimnicola ehrlichei MLHE-1] >gi|114228107|gb|ABI57906.1| DJ-1 family protein [Alkalilimnicola ehrlichei MLHE-1] (192 aa)
Score = 114, Expect = 2.2e-04, Identities = 48/168 (28%), Positives = 81/168 (48%)
  Q:    21 DMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAG--AASTVLAELGVLGNKKITTAPG-FEEKLGKNYSDNN-IVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDI 188
           +++ V   D+  RAGI V T S + +  +    G  +     +++     F+ + +PGG +G +RL  D  +RV   + K A  E     FTA   A   VLA  G+L  ++ T  PG  ++  G        +VVD + V+ + P  A +FAL ++E L  +  A  +   +
  S:    14 ELEAVTVIDLLRRAGIDVVTASLDGE-PVRASRGVTLVADTHLDEALRRDFDMVVLPGGAEGARRLGED--DRVTELLRKLADSE----RFTAAICAGPKVLAGAGLLEGRQATAFPGALDDVPGVELRGGEPVVVDASVVTSRGPGTAMDFALRLIELLAGEAQAAEVEQQL 179
>gi|153801056|ref|ZP_01955642.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Vibrio cholerae MZO-3] >gi|124123410|gb|EAY42153.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Vibrio cholerae MZO-3] (205 aa)
Score = 114, Expect = 2.2e-04, Identities = 41/176 (23%), Positives = 74/176 (42%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYSDNNIV---VDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIA 185
           RI +  +  S +M+ VI  D   RAG  V   +   K  +    G  +T  + +E  + + F+AL +PGG G  +   D    +   ++     +GK         + V A+       ++T  P F E +         V     ++ ++ + P  A EFAL ++  L   ++A  +A
  S:     8 RILVPVAHGSEEMETVIIVDTLVRAGFQVTMAAVGDKLQVQGSRGVWLTAEQTLEACSAEAFDALALPGGVGGAQAFADSTPLL--ALIDAFSQQGKLVAAICATPALVFAKQQKFVGARMTCHPNFFEHIPSERLSRQRVCYYATQHLLTSQGPGTALEFALAMIALLAGAELAQQVA 184
>gi|116328289|ref|YP_798009.1| DJ-1/PfpI family intracellular protease [Leptospira borgpetersenii serovar Hardjo-bovis L550] >gi|116121033|gb|ABJ79076.1| Transcription regulator, DJ-1/PfpI family intracellular protease [Leptospira borgpetersenii serovar Hardjo-bovis L550] (178 aa)
Score = 114, Expect = 2.3e-04, Identities = 43/158 (27%), Positives = 75/158 (47%)
  Q:    22 MDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGK--KWLFTAGAASTVLAELGVLGNK-KITTAPGFEEKLGKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQ 179
           M+ VI  D+  RAG+ V T ++ K+  +    G  +     ++ VNL  F+ + +PG  G  ++L         KI  F  +  K  KW+    AA ++L    +L ++ + T  PG        Y+ + + +    V+   P  AFEF+L +V+ L  K+
  S:    12 MEAVIIVDVLRRAGVEV-TSASLKEGPVKASRGIYLLADTTLDAVNLKDFDMIVLPGRAGGTKVLG-----ADPKIADFLQEAKKENKWIGAICAAPSILVHQNILTSEDRFTAFPGIVSDT-SGYTGSRLEISGKIVTSIGPGSAFEFSLELVKILCGKE 165
>gi|183219940|ref|YP_001837936.1| ThiJ/PfpI family peptidase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] >gi|189910064|ref|YP_001961619.1| Transcription regulator, DJ-1/PfpI family intracellular protease [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] >gi|167774740|gb|ABZ93041.1| Transcription regulator, DJ-1/PfpI family intracellular protease [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] >gi|167778362|gb|ABZ96660.1| Putative peptidase, ThiJ/PfpI family [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] (188 aa)
Score = 114, Expect = 2.3e-04, Identities = 48/164 (29%), Positives = 78/164 (47%)
  Q:    21 DMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEE-IEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVL-GNKKITTAPGFEEKL---GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNI 184
           +M+ +I  D+  R    VE VS  K K   + S   I  S+    ++N+D+F+A+ +PGG  G + L+ D     I KI+       KK +    AA  VL +  ++ GN   T  P  ++     G  Y+ N I    +  +   P  AF FAL ++E    K++   +
  S:    15 EMEAIILIDVLRRGN--VEVVSASKTKEPVVASRNTIHISDTTFSEINVDEFDAIVLPGGMNGTKNLMADTE---IQKILSIF-HSSKKHIGAICAAPAVLRKWDIISGNDPYTAFPSTDDLAKGKGGRYTGNRIESFHHIHTSVGPGSAFAFALYLLELFEGKEVMERV 178
>gi|82545607|ref|YP_409554.1| hypothetical protein SBO_3229 [Shigella boydii Sb227] >gi|81247018|gb|ABB67726.1| conserved hypothetical protein [Shigella boydii Sb227] (186 aa)
Score = 114, Expect = 2.3e-04, Identities = 42/152 (27%), Positives = 73/152 (48%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSG-TKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGD--EGKKWLFTAGAASTVLAELGVLGNKKITTAPGF---EEKLGKNYSDNNIVVDKN-FVSFKSP 161
           +IA++ S E  D +   P D + +AG  V T+  +  K++  + G   +T  + I++V   +F+AL +PGG     L  D      N+ V F  D     K +F       +L    V+  +K+T         +  G  + D  +VVDK+  V+ ++P
  S:    18 KIAVLISDEFEDSEFTSPADEFRKAGHEVITIEKQAGKTVKGKKGEASVTIDKSIDEVTPAEFDALLLPGGHSPDYLRGD------NRFVTFTRDFVNSGKPVFAICHGPQLLISADVIRGRKLTAVKPIIIDVKNAGAEFYDQEVVVDKDQLVTSRTP 170
>gi|167750889|ref|ZP_02423016.1| hypothetical protein EUBSIR_01873 [Eubacterium siraeum DSM 15702] >gi|167656068|gb|EDS00198.1| hypothetical protein EUBSIR_01873 [Eubacterium siraeum DSM 15702] (180 aa)
Score = 114, Expect = 2.5e-04, Identities = 44/151 (29%), Positives = 68/151 (45%)
  Q:    21 DMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL-GKNYSDNNIVVDKNFVSFKSPFHAFEFALLI 171
           + + + P DI  R G  V TV     K       T I    + + +  DK   + +PGG      L      V+   +KF  D  KK +    AA +++ +L +L  KK T  PGFE+ L G  ++ + + +D N V+ K    A EF L +
  S:    12 ETEAIAPIDILKRFGKEVVTVGIGGGKITGAHGITVIADITDSDVIMTDKVEMIVLPGGM--PGTLNLEKSPVVQAAIKFCADN-KKAIGAICAAPSIIGKLELLKGKKATCFPGFEQFLEGAMFTGDLVNIDDNIVTAKGAGAAVEFGLAL 160
>gi|154493585|ref|ZP_02032905.1| hypothetical protein PARMER_02925 [Parabacteroides merdae ATCC 43184] >gi|154086795|gb|EDN85840.1| hypothetical protein PARMER_02925 [Parabacteroides merdae ATCC 43184] (181 aa)
Score = 114, Expect = 2.6e-04, Identities = 49/169 (28%), Positives = 74/169 (43%)
  Q:    21 DMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL-GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           +M+ +   DI  R GI V TVS      +       +T    +    L+  +AL +PGG      L D     + + +     EG+  +    AA  VL  LG+L  +K T  PGFE KL G N +   + V  N ++ K P     F L +V  + N  +A  +A  +L
  S:    14 EMEALGTVDILRRGGIEVTTVSITTDPVVIGAHNVPVTADTTLNNALLNDADALILPGGMPGASNLND--SETVKEALLGQYREGR-IVAAICAAPMVLGGLGLLKGRKATCYPGFEPKLIGANVTGEAVEVSDNVITGKGPGLVMNFGLALVAAIKNDAVAEEVAAGLL 180
>gi|91223418|ref|ZP_01258683.1| 4-methyl-5(B-hydroxyethyl)-thiazol monophosphate biosynthesis enzyme [Vibrio alginolyticus 12G01] >gi|91191504|gb|EAS77768.1| 4-methyl-5(B-hydroxyethyl)-thiazol monophosphate biosynthesis enzyme [Vibrio alginolyticus 12G01] (199 aa)
Score = 114, Expect = 2.6e-04, Identities = 40/171 (23%), Positives = 85/171 (49%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNL--DKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYSDNNIV---VDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           + +M+ V   D+  RAG  V   S     S+ +++   +T + + + V++  D+F+A+ + GG G   +   R+  V+ +I+K    EGK       + + VL    +     +T  P F+  + +    +  V   ++ N ++ + P  A EFA+ ++ +L  K+ A ++A  ++
  S:    13 TEEMEAVTVIDMMVRAGYDVTVASAAFDGSLRMKASRGVTLTADCKLVDIADDEFDAIALSGGVGGAEIF--RDSTVMIEILKQHIYEGKLVAAICASPALVLQHHNLFPQSLMTCHPSFQSHIPEEKWRSKRVTFDINHNLITSQGPGTALEFAMEVIIQLSGKKHAWSVAEPMI 186
>gi|19705181|ref|NP_602676.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >gi|19713122|gb|AAL93975.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] (200 aa)
Score = 113, Expect = 2.9e-04, Identities = 47/154 (30%), Positives = 80/154 (51%)
  Q:    36 IIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKF---NALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLG---KNYS----DNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           I VET+S   K+SI    G ++   + I + N++ F   +AL IPGG G      D +  +  K++K+   E  K +    +A   L E   + +KK+TT     ++     KNY+    +  IV+D N  +   P +A E +  ++EKL +K+    I N++ 
  S:    38 IKVETIS--YKESIKCTWGGELRAEKIITEDNVENFYEYDALVIPGGFGKANFFKDNDNEIFKKLIKYF-SENNKVIVAICSAVINLLETTYIRDKKVTTYLLDNKRYFNQLKNYNIIPVEEEIVIDNNLFTCSGPGNALELSFRVLEKLTSKENVKIIQNNMF 198
>gi|168178441|ref|ZP_02613105.1| DJ-1/PfpI family protein [Clostridium botulinum NCTC 2916] >gi|182671231|gb|EDT83205.1| DJ-1/PfpI family protein [Clostridium botulinum NCTC 2916] (194 aa)
Score = 113, Expect = 2.9e-04, Identities = 42/128 (32%), Positives = 68/128 (53%)
  Q:    57 ITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDR-NERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITT---APGFEEK----LGKN-YSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNI 184
           +T    + +VN+D+F+AL IPGG        D  +E   N I +F  D+ +K + +    +  + + GVL N+  TT     G  +K     G N   D  +VVDKN ++  +P  AF  A  ++E L +K+   N+
  S:    54 VTPEMHVSEVNIDEFDALAIPGGFEEAGFYEDAYSEDFFNIIREF--DKARKTIASICVGALPIGKSGVLVNRNATTYNLGNGRRQKQLSEFGANVLRDEPVVVDKNIITSYNPSTAFHVAFKLLELLTSKENCVNV 188
>gi|168182877|ref|ZP_02617541.1| DJ-1/PfpI family protein [Clostridium botulinum Bf] >gi|182673928|gb|EDT85889.1| DJ-1/PfpI family protein [Clostridium botulinum Bf] (194 aa)
Score = 113, Expect = 3.0e-04, Identities = 43/128 (33%), Positives = 69/128 (53%)
  Q:    57 ITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDR-NERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITT---APGFEEK----LGKN-YSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNI 184
           +T    + +VN+D+F+AL IPGG        D   E  +N I +F  D+  K + +    +  + + GVL N+  TT     G  +K     G N  +D  IV+DKN ++  +P  AF+ A  ++E L +K+   NI
  S:    54 VTPEMHVSEVNIDEFDALAIPGGFEEAGFYEDAYGEDFLNIIREF--DKAGKTIASICVGALPIGKSGVLVNRNATTYNLGNGKRQKQLSEFGANVLADKPIVIDKNIITSYNPSTAFDVAFKLLEILTSKENCVNI 188
>gi|30262639|ref|NP_845016.1| thiJ/pfpI family protein [Bacillus anthracis str. Ames] >gi|47527946|ref|YP_019295.1| thiJ/pfpI family protein [Bacillus anthracis str. 'Ames Ancestor'] >gi|49185481|ref|YP_028733.1| thiJ/pfpI family protein [Bacillus anthracis str. Sterne] >gi|65319960|ref|ZP_00392919.1| COG0693: Putative intracellular protease/amidase [Bacillus anthracis str. A2012] >gi|165868702|ref|ZP_02213362.1| thiJ/pfpI family protein [Bacillus anthracis str. A0488] >gi|167637878|ref|ZP_02396157.1| thiJ/pfpI family protein [Bacillus anthracis str. A0193] >gi|170704510|ref|ZP_02894976.1| thiJ/pfpI family protein [Bacillus anthracis str. A0389] >gi|177649255|ref|ZP_02932257.1| thiJ/pfpI family protein [Bacillus anthracis str. A0174] >gi|190565493|ref|ZP_03018413.1| thiJ/pfpI family protein [Bacillus anthracis Tsiankovskii-I] >gi|30257271|gb|AAP26502.1| thiJ/pfpI family protein [Bacillus anthracis str. Ames] >gi|47503094|gb|AAT31770.1| thiJ/pfpI family protein [Bacillus anthracis str. 'Ames Ancestor'] >gi|49179408|gb|AAT54784.1| thiJ/pfpI family protein [Bacillus anthracis str. Sterne] >gi|164715428|gb|EDR20945.1| thiJ/pfpI family protein [Bacillus anthracis str. A0488] >gi|167514427|gb|EDR89794.1| thiJ/pfpI family protein [Bacillus anthracis str. A0193] >gi|170130311|gb|EDS99172.1| thiJ/pfpI family protein [Bacillus anthracis str. A0389] >gi|172084329|gb|EDT69387.1| thiJ/pfpI family protein [Bacillus anthracis str. A0174] >gi|190563520|gb|EDV17485.1| thiJ/pfpI family protein [Bacillus anthracis Tsiankovskii-I] (190 aa)
Score = 113, Expect = 3.0e-04, Identities = 47/172 (27%), Positives = 87/172 (50%)
  Q:     9 IRIAIMCSIESNDMDIVIPYDIWTRAGII-------VETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQI 180
           ++IAI+C     D+D+ +P+D+  R  ++       V+ +    K++    SG +I  +  I   +L   +A+    GKG Q L   +N++ IN I     D  K+ + +  + S +L    +L  KK TT P   E+L   G +  + + V + N  +    F A E +  I+  L+N+++
  S:     1 MKIAIVCFDNFTDIDVFLPWDLLNRVRLVGGISDWDVQLLGT--KETHISMSGLRIPMTGSIS--DLPSADAVIFASGKGIQDLY--KNQQYINSI---HIDPQKQLIGSMCSGSLLLGAKKLLTGKKATTYPSAVEQLKEFGVDVIEKSFVNEGNISTAAGCFAAQELSAWIIRTLINEEM 173
>gi|166993276|ref|ZP_02259736.1| ThiJ/PfpI family protein [Bacillus cereus AH820] (190 aa)
Score = 113, Expect = 3.0e-04, Identities = 47/172 (27%), Positives = 86/172 (50%)
  Q:     9 IRIAIMCSIESNDMDIVIPYDIWTRAGII-------VETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQI 180
           ++IAI+C     D+D+ +P+D+  R  ++       V+ +  E+       SG +I  +  I   +L   +A+    GKG Q L   +N++ IN I     D  K+ + +  + S +L    +L  KK TT P   E+L   G +  + + V + N  +    F A E +  I+  L+N+++
  S:     1 MKIAIVCFDNFTDIDVFLPWDLLNRVRLVGGISDWDVQLLGTEETHISL--SGLRIPMTGSIS--DLPSADAVIFASGKGIQDLY--KNQQYINSI---HIDPQKQLIGSMCSGSLLLGAKKLLTGKKATTYPSAVEQLKEFGVDVIEKSFVNEGNISTAAGCFAAQELSAWIIRTLINEEM 173
>gi|161502948|ref|YP_001570060.1| hypothetical protein SARI_01010 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] >gi|160864295|gb|ABX20918.1| hypothetical protein SARI_01010 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] (185 aa)
Score = 113, Expect = 3.0e-04, Identities = 42/181 (23%), Positives = 80/181 (44%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKN-YSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILY 190
           ++A++ +    + + ++  DI  R  I VET++  + +++       +     + +     F+A+ +PGG      L D N  VI  + +     GK       AA+ VL   G+L  ++   +    + + +  Y D  +V D N +S K   H F+FAL +  +LL    +     D +Y
  S:     3 KVAVLLAPGFEEAEAIVTIDILRRLHIDVETLACAESRAVVSYHDIPMVADNTLSERQQALFDAVVLPGGPQGSANLAD-NPAVIAFVARHDA-AGKLICPICSAAARVLGAHGLLKGRRYVCSGELWKAVQEGIYVDAPVVEDGNLISGKGLGHVFDFALTLAARLLEDDASVREQADHIY 182
>gi|54302174|ref|YP_132167.1| intracellular protease/amidase [Photobacterium profundum SS9] >gi|46915595|emb|CAG22367.1| hypothetical intracellular protease/amidase [Photobacterium profundum SS9] (198 aa)
Score = 113, Expect = 3.3e-04, Identities = 35/114 (30%), Positives = 62/114 (54%)
  Q:    62 EIEKVNLDKFNALYIPGGKGCQRLLTDR-NERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEK------LGKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKL 175
           ++ +++ + F+AL IPGG        D  +ER+++ I  F  D   K + +    +  +A+ GVL  +  TT    E++      +G N     +V+DKN ++ +SP  A + A  +VEKL
  S:    59 QLSEIDSNDFDALAIPGGMSRAGFYEDAYDERLLSLIRDF--DSQDKLIASVCVGALPIAKSGVLNGRNGTTYHLSEKRQAQMKEMGVNIIQQPVVIDKNIITSRSPSAAMDVAFTVVEKL 177
>gi|153836834|ref|ZP_01989501.1| protein ThiJ [Vibrio parahaemolyticus AQ3810] >gi|149749980|gb|EDM60725.1| protein ThiJ [Vibrio parahaemolyticus AQ3810] (199 aa)
Score = 113, Expect = 3.4e-04, Identities = 42/161 (26%), Positives = 80/161 (49%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNL--DKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYSDNNIV---VDKNFVSFKSPFHAFEFALLIVEKLLNKQ 179
           + +M+ V   D+  RAG  V   S     ++ +++   +T + + + V++  D+F+A+ + GG G     T R+  V+ +I+K    EGK       A + VL    +  +  +T  P F+  + ++      V   V+ N ++ + P  A EFA+ I+ KL  K+
  S:    13 TEEMEAVTVIDLMVRAGYDVTVASAAFDGALTMKASRGVTLTADCKLVDIADDEFDAIVLSGGVGGAE--TFRDSTVMIEILKQHMYEGKLVAAICAAPALVLQHHNLYPDALMTCHPSFQSHIPEDKWRAKRVTMDVNHNLLTSQGPGTALEFAMEIIIKLSGKE 176
>gi|161506909|ref|YP_001576863.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein [Lactobacillus helveticus DPC 4571] >gi|160347898|gb|ABX26572.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein [Lactobacillus helveticus DPC 4571] (194 aa)
Score = 113, Expect = 3.5e-04, Identities = 40/120 (33%), Positives = 63/120 (52%)
  Q:    56 KITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGK-----NYSDNNIVVDK--NFVSFKSPFHAFEFALLIVEKL 175
           K+TC + +++  LD ++ +  PGG      L D +E++ + +VK    E  KW     AA   LA  GVL + + T  PG EE+  K     ++S+   V DK    ++ + P  A+ FA  I E L
  S:    48 KLTCDKVVDESLLD-YDLVAFPGGMTGSANLRD-DEKLRDLMVK--RHEAGKWDAAMCAAPRALARYGVLKDAEFTCYPGIEEECEKYDPSAHFSERITVTDKEHKVLTSRGPVTAWAFAYAIAEAL 170
>gi|73662934|ref|YP_301715.1| hypothetical protein SSP1625 [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|82582358|sp|Q49WT1|Y1625_STAS1 Uncharacterized protein SSP1625 >gi|72495449|dbj|BAE18770.1| conserved hypothetical protein [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (172 aa)
Score = 112, Expect = 3.8e-04, Identities = 40/166 (24%), Positives = 73/166 (43%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKL 175
           ++AI+ + E  D+++  P +    AG   E + + +K  +  + G K+T    I     + ++AL IPGG     L  D   R       F  ++   +    G    +L +   L  + IT      + L   G +  D ++V+D N V+ + P    +F   I++KL
  S:     4 KVAIILADEFEDIELTSPKEALENAGFETEVIGDTEKHELVGKHGEKVTVDVSIADAKPENYDALLIPGGFSPDHLRGDEEGRYGTFTKYFTQNDVPTFAICHG--PLLLVDTDDLKGRTITGVINVRKDLSNAGAHVVDESVVIDNNIVTSRVPDDLDDFNREIIKKL 170
>gi|88704400|ref|ZP_01102114.1| ThiJ/PfpI family protein [gamma proteobacterium KT 71] >gi|88701451|gb|EAQ98556.1| ThiJ/PfpI family protein [Congregibacter litoralis KT71] (224 aa)
Score = 112, Expect = 3.8e-04, Identities = 39/173 (22%), Positives = 77/173 (44%)
  Q:     9 IRIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAG--AASTVLAELGVLGNKKITT---APGFEEKLGKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIA 181
           + +A+M       +D   P +++ +AG  V TV+ E++    + SG+ +    + +  +  + + L +PGG G   LLTD         + F  +     ++       S +L   G+L  K  TT   +  F E  G       +VVD   ++        +FA  +++++L + +A
  S:     1 MSVAVMVFDRITQLDATAPIEVFAKAGWTVFTVAPERR---LVTSGSGLKIMPDYDYESAPQADILCVPGGGGVNPLLTD------TATLNFVRETAASAIYVTSVCTGSLILGAAGLLRGKHATTHWASHHFLESFGAIPVKERVVVDGRLITGGGVTAGVDFAFTVLDEVLGRDVA 169
>gi|170757168|ref|YP_001780652.1| DJ-1/PfpI family protein [Clostridium botulinum B1 str. Okra] >gi|169122380|gb|ACA46216.1| DJ-1/PfpI family protein [Clostridium botulinum B1 str. Okra] (194 aa)
Score = 112, Expect = 3.8e-04, Identities = 40/128 (31%), Positives = 69/128 (53%)
  Q:    57 ITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDR-NERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITT---APGFEEK----LGKN-YSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNI 184
           +T    + +VN+D+F+AL +PGG        D  +E  +N I +F  D+ +K + +    +  + + GVL ++  TT     G  +K     G N   D  +VVDKN ++  +P  AF  A  ++E L +K+   N+
  S:    54 VTPEMHVSEVNIDEFDALAVPGGFEEAEFYEDAYSEDFLNIIREF--DKARKTIASICVGALPIGKSGVLVDRNATTYNLGNGRRQKQLSEFGANVLRDEPVVVDKNIITSYNPSTAFHVAFKLLELLTSKENCVNV 188
>gi|184156037|ref|YP_001844377.1| 4-methyl-5(beta-hydroxyethyl)-thiazole monophosphate biosynthesis protein [Lactobacillus fermentum IFO 3956] >gi|183227381|dbj|BAG27897.1| 4-methyl-5(beta-hydroxyethyl)-thiazole monophosphate biosynthesis protein [Lactobacillus fermentum IFO 3956] (194 aa)
Score = 112, Expect = 4.1e-04, Identities = 40/166 (24%), Positives = 78/166 (46%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKV--NLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL------GKNYSDNNIVVDK-NFVSFKSPFHAFEFALLIVEKL 175
           ++A+M +    +++ + P D++ R GI    V  + ++ +       +TC   + +V   L  F+ +  PGG G  + L D ++R++  + +    +  +W     AA    A  G+L     T  PG E+        G+ + D  +V +K   ++ + P  A  FA  I + L
  S:     3 KVAVMIAPGCEEIEALTPVDVFRRLGIETTMVGLDDRQ-VMGAHQIALTCDTSLAEVGEGLLGFDCVVFPGGSGGAKALRD-DDRLMQLMQR--RQQAGEWNAAMCAAPIAFARYGLLDGHDYTCFPGIEQTTTQVAPSGRFHEDITVVDEKGKLITSRGPATALAFAYCIADAL 173
>gi|157369325|ref|YP_001477314.1| hypothetical protein Spro_1082 [Serratia proteamaculans 568] >gi|157321089|gb|ABV40186.1| DJ-1 family protein [Serratia proteamaculans 568] (196 aa)
Score = 112, Expect = 4.1e-04, Identities = 43/171 (25%), Positives = 83/171 (48%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVET--VSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL-GKNYSDNNIVVDK--NFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           S +++ V   D+  RAG+ V T  V+ +   +I    G K+     +  +  + F+A+ +PGG KG +     R+  ++ + V+    +G        A + VL    +     +T  PG +E++    + +  +V D   N ++ + P  + EFAL +++ LL K  A  IA  ++
  S:    13 SEEIEAVTTIDLLVRAGVKVTTASVAGDGDLTIVCSRGVKLLADAPLVSIVDEPFDAIVLPGGLKGAECF---RDSPLLVEKVRQMHLQGNIVAAICAAPALVLQHHDLFPIGNMTGFPGLKEQIPADQWIEKRVVFDPRVNLLTSQGPGTSMEFALKLIDLLLGKAKAAEIAAQLV 186
>gi|67484652|ref|XP_657546.1| 4-methyl-5(B-hydroxyethyl)-thiazol monophosphate biosynthesis enzyme, putative [Entamoeba histolytica HM-1:IMSS] >gi|56474843|gb|EAL52199.1| 4-methyl-5(B-hydroxyethyl)-thiazol monophosphate biosynthesis enzyme, putative [Entamoeba histolytica HM-1:IMSS] (184 aa)
Score = 112, Expect = 4.2e-04, Identities = 43/175 (24%), Positives = 81/175 (46%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-------KGCQRLLTDRNERVI-NKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYS-DNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILYTKK 193
           S +++ V   DI  RA I V T +           G KI   + + + N ++++ + IPGG        G Q L+    E++  N+ V               + + VL   G++  +K T  P F+ KL    +    +VVD + ++ ++P  A EF+L I+ +L  ++    +   ++ + K
  S:    11 SEELEAVTIIDILARAKIQVTTATINSNLETACSRGVKIMADKFLSECN-EQYDVIAIPGGLPGADNLAGSQLLIQKIKEQLAANRFVAA----------ICASPAIVLEGNGIIEGRKCTAYPSFQPKLANQSAVHQRVVVDNHLITSQAPGSAIEFSLEIIRQLKGEEAMREVEKPLVLSFK 183
>gi|160890805|ref|ZP_02071808.1| hypothetical protein BACUNI_03250 [Bacteroides uniformis ATCC 8492] >gi|156859804|gb|EDO53235.1| hypothetical protein BACUNI_03250 [Bacteroides uniformis ATCC 8492] (184 aa)
Score = 112, Expect = 4.4e-04, Identities = 51/151 (33%), Positives = 78/151 (51%)
  Q:    29 DIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNA--LYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL-GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQ 179
           D+  RAG+ VE V+    + +       + C + +  VN D F+A  + +PGG      L    E + N +++FA ++  K +    AA  VL +LG+L  KK T  PGFE+ L G   +   +  D N ++ K P  A EFAL +VE L  K+
  S:    22 DVMRRAGLNVEMVTVTPDEIVTGAHDVPVLCDKNV--VNCDFFDAELVLLPGGMPGASTLEKCGE-LRNLVLRFAQEQ--KPIAAICAAPMVLGKLGLLKGKKATCYPGFEQYLEGAECTGAPVERDGNIITGKGPGAAMEFALAVVELLQGKE 170
>gi|54301840|ref|YP_131833.1| ThiJ/PfpI family thiamine biogenesis protein [Photobacterium profundum SS9] >gi|46915260|emb|CAG22033.1| putative ThiJ/PfpI-family thiamine biogenesisprotein [Photobacterium profundum SS9] (195 aa)
Score = 112, Expect = 4.6e-04, Identities = 46/166 (27%), Positives = 79/166 (47%)
  Q:    11 IAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGK-NYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLL 176
           +A++ +    + + V+  DI  R  I V  +S  +  ++     T+IT  + ++      ++A+ +PGG KG   L    N  VI+  +K   +E K       + + VLA   +LG    TT  G ++K     + D  +VVD  F+S K    +FEFA  + + LL
  S:     6 VAVLLADGFEEGEAVVFIDIMRRLDIKVTVLSCMETTALNTYFETRITADDILKNCYDTMYDAVMMPGGPKGTDNL--SANPMVID-FLKRHINEDKYICALCSSGAKVLAAHQLLGLHYYTTGAGLDKKFDDGQFLDQKVVVDGQFISGKGLGVSFEFAFTVAKYLL 170
>gi|70732675|ref|YP_262438.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein, putative [Pseudomonas fluorescens Pf-5] >gi|68346974|gb|AAY94580.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein, putative [Pseudomonas fluorescens Pf-5] (183 aa)
Score = 111, Expect = 4.9e-04, Identities = 36/138 (26%), Positives = 65/138 (47%)
  Q:    20 NDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGK-GCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEK-LGKNYSDNNIVVDKNFVS 157
           +D+  V   D+  RA + V   S E ++ +    GT++T    +  V   +F+ + +PGG  G Q L      + + +++K     G+ +   A A +  L   GVL  +++T  P      LG  + D  +VVD N ++
  S:    14 DDLQSVTLIDVLRRAEVEVLAASVEGRRMLTCARGTRLTADAMLVDVLAQRFDLIVLPGGAVGAQHLAA---HQPLQQLLKDQAAAGRLFAGIAEAPALALQAYGVLRQRRMTCLPSASHHLLGCTFVDQPVVVDGNCIT 150
>gi|74313690|ref|YP_312109.1| hypothetical protein SSON_3299 [Shigella sonnei Ss046] >gi|187730021|ref|YP_001881930.1| intracellular peptidase, PfpI family [Shigella boydii CDC 3083-94] >gi|73857167|gb|AAZ89874.1| conserved hypothetical protein [Shigella sonnei Ss046] >gi|187427013|gb|ACD06287.1| intracellular peptidase, PfpI family [Shigella boydii CDC 3083-94] (172 aa)
Score = 111, Expect = 5.0e-04, Identities = 42/152 (27%), Positives = 73/152 (48%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSG-TKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGD--EGKKWLFTAGAASTVLAELGVLGNKKITTAPGF---EEKLGKNYSDNNIVVDKN-FVSFKSP 161
           +IA++ S E  D +   P D + +AG  V T+  +  K++  + G   +T  + I++V   +F+AL +PGG     L  D      N+ V F  D     K +F       +L    V+  +K+T         +  G  + D  +VVDK+  V+ ++P
  S:     4 KIAVLISDEFEDSEFTSPADEFRKAGHEVITIEKQAGKTVKGKKGEASVTIDKSIDEVTPAEFDALLLPGGHSPDYLRGD------NRFVTFTRDFVNSGKPVFAICHGPQLLISADVIRGRKLTAVKPIIIDVKNAGAEFYDQEVVVDKDQLVTSRTP 156
>gi|82778467|ref|YP_404816.1| hypothetical protein SDY_3332 [Shigella dysenteriae Sd197] >gi|81242615|gb|ABB63325.1| conserved hypothetical protein [Shigella dysenteriae Sd197] (186 aa)
Score = 111, Expect = 5.2e-04, Identities = 41/152 (26%), Positives = 73/152 (48%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSG-TKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGD--EGKKWLFTAGAASTVLAELGVLGNKKITTAPGF---EEKLGKNYSDNNIVVDKN-FVSFKSP 161
           +IA++ + E  D +   P D + +AG  V T+  +  K++  + G   +T  + I++V   +F+AL +PGG     L  D      N+ V F  D     K +F       +L    V+  +K+T         +  G  + D  +VVDK+  V+ ++P
  S:    18 KIAVLITDEFEDSEFTSPADEFRKAGHEVITIEKQAGKTVKGKKGEASVTIDKSIDEVTPAEFDALLLPGGHSPDYLRGD------NRFVTFTRDFVNSGKPVFAICHGPQLLISADVIRGRKLTAVKPIIIDVKNAGAEFYDQEVVVDKDQLVTSRTP 170
>gi|15803695|ref|NP_289729.1| hypothetical protein Z4512 [Escherichia coli O157:H7 EDL933] >gi|15833288|ref|NP_312061.1| hypothetical protein ECs4034 [Escherichia coli O157:H7 str. Sakai] >gi|12517761|gb|AAG58289.1|AE005544_3 orf, hypothetical protein [Escherichia coli O157:H7 EDL933] >gi|606093|gb|AAA57956.1| ORF_o186 [Escherichia coli] >gi|13363507|dbj|BAB37457.1| hypothetical protein [Escherichia coli O157:H7 str. Sakai] (186 aa)
Score = 111, Expect = 5.2e-04, Identities = 41/152 (26%), Positives = 73/152 (48%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSG-TKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGD--EGKKWLFTAGAASTVLAELGVLGNKKITTAPGF---EEKLGKNYSDNNIVVDKN-FVSFKSP 161
           +IA++ + E  D +   P D + +AG  V T+  +  K++  + G   +T  + I++V   +F+AL +PGG     L  D      N+ V F  D     K +F       +L    V+  +K+T         +  G  + D  +VVDK+  V+ ++P
  S:    18 KIAVLITDEFEDSEFTSPADEFRKAGHEVITIEKQAGKTVKGKKGEASVTIDKSIDEVTPAEFDALLLPGGHSPDYLRGD------NRFVTFTRDFVNSGKPVFAICHGPQLLISADVIRGRKLTAVKPIIIDVKNAGAEFYDQEVVVDKDQLVTSRTP 170
>gi|163790390|ref|ZP_02184821.1| intracellular protease, PfpI family protein [Carnobacterium sp. AT7] >gi|159874294|gb|EDP68367.1| intracellular protease, PfpI family protein [Carnobacterium sp. AT7] (172 aa)
Score = 111, Expect = 5.2e-04, Identities = 37/156 (23%), Positives = 71/156 (45%)
  Q:     6 VSNIRIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAG--DEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSDNNIVVDKNFVSFKSP 161
           V N +I  + S +  D+++  P      AG  V  V+ +K+     + G  +T     E +  + ++ + +PGG    +L      R   K+++F    D+ KK +     A  VL   G+L    +T+ PG ++ +   G  + D   + D + +S + P
  S:     3 VENKKIIALVSDDFEDLELWYPVLRLREAGATVHLVAEKKETVYHGKYGVPVTSDYSFEDIIKENYDGILVPGGWSPDKL------RRFPKVIEFVQYFDQQKKPIGQICHAGWVLISAGILNGVNVTSTPGIKDDMTNAGAIWHDVPAITDGHIISSRRP 157
>gi|32267343|ref|NP_861375.1| 4-methyl-5(beta-hydroxyethyl)-thiazole monophosphate synthesis protein ThiJ [Helicobacter hepaticus ATCC 51449] >gi|32263396|gb|AAP78441.1| 4-methyl-5(beta-hydroxyethyl)-thiazole monophosphate synthesis protein ThiJ [Helicobacter hepaticus ATCC 51449] (189 aa)
Score = 111, Expect = 5.5e-04, Identities = 46/168 (27%), Positives = 81/168 (48%)
  Q:    21 DMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDI 188
           ++++V   DI  RAG+ V   S +  K +       I     + ++ ++ FNA+ + GG  G Q L    NE +   +  F  ++  K +    A+  VL + GVL   + T  PG E ++   GKN +   +V + N ++   P  A  FAL IV++L   + A  +  ++
  S:    14 EIELVSVADILRRAGVRVVVASLDSHKRVLGAHHIVIEADSALPELEMEHFNAIVLAGGYNGMQNLAN--NELIKLWLTTFKQEQ--KLIAAICASPIVLDKAGVL-EGEFTCYPGCENQINMQGKNRNAEAVVKNGNIITSVGPATANVFALTIVKELCGGEKAQELYEEL 180
>gi|171853867|emb|CAM11829.1| Putative intracellular protease/amidase [Candidatus Phytoplasma australiense] (180 aa)
Score = 111, Expect = 5.5e-04, Identities = 38/161 (23%), Positives = 69/161 (42%)
  Q:    21 DMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEE-KLGKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIA 181
           D + ++   +  R  + + T +      +   SG ++       K++   ++ L IPGG    +++ ++   ++  I KF      K +    AA   L +L +L     T  P  +   LG    D   V+  NFV+ +SP   F+F   +VEKL  +  A
  S:    13 DCEALVTRALLKRINLPLNTATPNSSLEVVSSSGLQVKADYHFSKMDPSNYDFLVIPGGPYVAQII-EKETFLLELIQKFVFS--NKIIGAICAAPMFLGKLDLLKEHSFTCFPNCQHFILGSYLPDKKAVISGNFVTSRSPITVFDFVFTLVEKLKGESTA 171
>gi|62319084|dbj|BAD94229.1| hypothetical protein [Arabidopsis thaliana] (147 aa)
Score = 111, Expect = 5.6e-04, Identities = 34/129 (26%), Positives = 65/129 (50%)
  Q:    61 EEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL-GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           +E EK   + ++ + +PGG G        +E+++N + K A +  K +     + + V    G+L  KK T  P    KL  +++ ++ ++VD N ++ + P  + EFAL IVEK   ++    ++   L
  S:    22 DEAEK---NSYDLIVLPGGLGGAEAFAS-SEKLVNMLKKQA-ESNKPYGAICASPALVFEPHGLLKGKKATAFPAMCSKLTDQSHIEHRVLVDGNLITSRGPGTSLEFALAIVEKFYGREKGLQLSKATL 146
>gi|73670754|ref|YP_306769.1| intracellular protease [Methanosarcina barkeri str. Fusaro] >gi|72397916|gb|AAZ72189.1| intracellular protease [Methanosarcina barkeri str. Fusaro] (180 aa)
Score = 111, Expect = 5.6e-04, Identities = 45/155 (29%), Positives = 76/155 (49%)
  Q:    21 DMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITT--APGFEEKL---GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKL 175
           D +  +P  ++  +G+ V TV+ E KK+     G  I     I    +D ++A+ I GG G ++ L D   + +  +VK A D+ KK +     +  VLA  G+L +K+ T   +P    +L   G  Y D  +VV    ++ + P  A  F   ++E L
  S:    22 DEECFVPKQLFEASGVKV-TVAAESKKTAKGMLGGTIKPDIAISDARIDDYDAIVISGGSGSRKYLWD--SKALQALVKEA-DDLKKVISAICISPVVLARTGILKDKESTVFKSPDTVRELKEHGAIYLDREVVVSGRVITGRDPASADVFGKAVLEAL 177
>gi|124520577|ref|ZP_01695707.1| intracellular protease, PfpI family [Bacillus coagulans 36D1] >gi|124497533|gb|EAY45091.1| intracellular protease, PfpI family [Bacillus coagulans 36D1] (171 aa)
Score = 111, Expect = 6.0e-04, Identities = 40/152 (26%), Positives = 72/152 (47%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFE---EKLGKNYSDNNIVVDKN-FVSFKSP 161
           +IA++ + E  D +   P   +  AG  +  +  E  K++  + GT+I   + I+ V++  F+AL IPGG    +L  D  +R +  + +F   + KK +F       +L     L  +  T         E  G N+ D  +VV +N  V+ ++P
  S:     4 KIAVLVTNEVEDSEYTEPVKAYKEAGHEIVNIEMEAGKTVKGKHGTEIHIDKGIDDVSVGDFDALLIPGGFSPDQLRAD--DRFVQFVKQFM--DSKKPVFAICHGPQLLITAKALEGRSATGYKSIRVDMEYAGANFRDEEVVVCQNQLVTSRTP 155
>gi|115461240|ref|NP_001054220.1| Os04g0671700 [Oryza sativa (japonica cultivar-group)] >gi|70663940|emb|CAE03602.2| OSJNBb0004A17.4 [Oryza sativa (japonica cultivar-group)] >gi|90265250|emb|CAH67703.1| H0624F09.11 [Oryza sativa (indica cultivar-group)] >gi|113565791|dbj|BAF16134.1| Os04g0671700 [Oryza sativa (japonica cultivar-group)] >gi|125592020|gb|EAZ32370.1| hypothetical protein OsJ_015853 [Oryza sativa (japonica cultivar-group)] (387 aa)
Score = 111, Expect = 6.0e-04, Identities = 44/166 (26%), Positives = 84/166 (50%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKK----------KSIFLQS-----GTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSD----NNIVVDKNFVSFKSPFHAFEFALLIVEKL 175
           ++ ++C     D + ++P+      G+ V+     KK          + I  Q+     G     +   ++VN+++++ L IPGG+  + L  D  E+V++ + KF+  + KK + +      +LA  GV+ N+K T  P  +  L   G  + +    +   VD N V+  +     EF  L V+ L
  S:     5 KVLLLCGDYMEDYEAMVPFQALQAYGVSVDAACPGKKAGDSCRTAVHQGIGHQTYAESRGHNFALNASFDEVNINEYDGLVIPGGRAPEYLAMD--EKVLDLVRKFS--DAKKPIASVCHGQLILAAAGVVQNRKCTAYPAVKPVLVAAGAKWEEADTMDKCTVDGNLVTAVAYDAHPEFISLFVKAL 188
Score = 87, Expect = 3.3e-01, Identities = 34/129 (26%), Positives = 62/129 (48%)
  Q:     7 SNIRIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEK---------------KKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPG 135
           SN RI  +C     D ++++P+      G  V+ V  +K                ++   + G     +   + V+   ++AL IPGG+  + L    N++VI+ +VK   D+ K  + +      +L+  GVL  +K T  P 
  S:   195 SNKRILFLCGDYMEDYEVMVPFQSLQALGCHVDAVCPDKGAGEKCPTAIHDFEGDQTYSEKPGHDFALTASFDNVDASSYDALVIPGGRAPEYLAL--NDKVIS-LVKGFMDKAKP-VASICHGQQILSAAGVLQGRKCTAYPA 334
>gi|90579841|ref|ZP_01235649.1| Putative 4-methyl-5(B-hydroxyethyl)-thiazol monophosphate biosynthesis enzyme [Vibrio angustum S14] >gi|90438726|gb|EAS63909.1| Putative 4-methyl-5(B-hydroxyethyl)-thiazol monophosphate biosynthesis enzyme [Vibrio angustum S14] (205 aa)
Score = 110, Expect = 6.5e-04, Identities = 43/180 (23%), Positives = 83/180 (46%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNL--DKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL-GKNYSDNNIVVDKN--FVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           R+A+  +  S +M+ +    I  RAG  V   S  +  ++ L+    I    ++  +N+  + F+ + +PGG +G +     R+  ++ + VK    +GK         + +     +  +  +T  P F+  +         +V DKN   ++ + P  A EFAL IV +L NK  A  +A  ++
  S:    10 RVAVCLAPGSEEMEAINTIAILKRAGFKVTIASTAEDGALILEGSRGIKLVADVPLINVADEPFDCVVLPGGLQGAEHF---RDSPLVVEFVKQHHYDGKLIAAICATPAVMFISHQLFTHSIMTCHPAFQNHIPAHQLRVKRVVYDKNTRLLTSQGPGTAQEFALEIVTQLENKAKAAEVAEPMV 192
>gi|70726085|ref|YP_252999.1| hypothetical protein SH1084 [Staphylococcus haemolyticus JCSC1435] >gi|82582345|sp|Q4L7I2|Y1084_STAHJ Uncharacterized protein SH1084 >gi|68446809|dbj|BAE04393.1| unnamed protein product [Staphylococcus haemolyticus JCSC1435] (172 aa)
Score = 110, Expect = 6.7e-04, Identities = 40/166 (24%), Positives = 71/166 (42%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKL 175
           ++AI+ S E  D+++  P +    AG   E + +     +  + G K+     I     + ++ L IPGG     L  D   R       F  ++   +    G    +L +   L  + +T      + L   G N  D ++VVDKN V+ ++P    +F   IV++L
  S:     4 KVAIILSNEFEDIELTSPKEAIEEAGFETEIIGDTANAEVVGKHGEKVIVDVSIADAKPEDYDGLLIPGGFSPDHLRGDAEGRYGTFAKYFTKNDVPAFAICHGP--QILIDTDDLNGRTLTAVLNVRKDLSNAGANVVDESVVVDKNIVTSRTPDDLDDFNREIVKQL 170
>gi|172057044|ref|YP_001813504.1| PfpI family intracellular peptidase [Exiguobacterium sibiricum 255-15] >gi|171989565|gb|ACB60487.1| intracellular protease, PfpI family [Exiguobacterium sibiricum 255-15] (176 aa)
Score = 110, Expect = 6.8e-04, Identities = 36/157 (22%), Positives = 73/157 (46%)
  Q:     5 KVSNIRIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSDNNIVVDKNFVSFKSP 161
           +++  +I  + S +  D+++  P       G  V+ V  +  +    + G  I   +  +++N   ++A+ +PGG      L  R + V+  +  F  +E K+ +     A  VL   GVL    +T+ PG ++ +   G  + D  +VVD + +S + P
  S:     3 RLAGKKIIQLVSNDFEDLELWYPVHRLREEGATVDIVGEKAGEKYIGKYGVPIVSDKTFDEINPADYDAILVPGGWSPD--LLRRFDSVLTMVRHF--NETKQPIGQICHAGWVLISAGVLKGINVTSTPGIKDDMTNAGATWHDEPVVVDGHIISSRRP 158
>gi|57235061|ref|YP_180868.1| DJ-1 family protein [Dehalococcoides ethenogenes 195] >gi|57225509|gb|AAW40566.1| DJ-1 family protein [Dehalococcoides ethenogenes 195] (180 aa)
Score = 110, Expect = 6.9e-04, Identities = 44/180 (24%), Positives = 86/180 (47%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL-GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           R A++ +    +++     DI  RA + V+ V   K        G +I     I+++    +  L +PGG     +   +++RV+ ++++ A  EGK +L    A   VL+  GV+  K++   PG +  L G    D  + V+   ++ +SP  A +FAL +++     Q A  + +++L
  S:     3 RFAVLLAEGFEEIEFCTITDILRRADLEVKIVG-LKNGLTGGSRGIRIMPDLGIDELKSSDYEVLVLPGGNP-GFINMGKDQRVL-ELIRSAHAEGK-YLAAICAGPAVLSRAGVINGKEVAIYPGVKHLLKGCTACDLRVKVEGKLITGRSPQAAMDFALTLMDMFAKPQAAKVVRDEML 179
>gi|15642306|ref|NP_231939.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Vibrio cholerae O1 biovar eltor str. N16961] >gi|153821498|ref|ZP_01974165.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Vibrio cholerae B33] >gi|194533223|ref|YP_002068641.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Vibrio cholerae MO10] >gi|9656873|gb|AAF95452.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Vibrio cholerae O1 biovar El Tor str. N16961] >gi|125619275|gb|EAZ47804.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Vibrio cholerae MO10] >gi|126520991|gb|EAZ78214.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Vibrio cholerae B33] (205 aa)
Score = 110, Expect = 7.0e-04, Identities = 40/176 (22%), Positives = 75/176 (42%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYSDNNIV---VDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIA 185
           RI +  +  S +M+ VI  D   RAG  V   +   K  +    G  +T  + +E  + + F+AL +PGG G  +   D     +  ++     +GK         + V A+       ++T  P F + +         V     ++ ++ + P  A EFAL ++  L   ++A ++A
  S:     8 RILVPVAHGSEEMETVIIVDTLVRAGFQVTMAAVGDKLQVQGSRGVWLTAEQTLEACSAEAFDALALPGGVGGAQAFADST--ALLALIDAFSQQGKLVAAICATPALVFAKQQKFVGARMTCHPNFFDHIPSERLSRQRVCYYATQHLLTSQGPGTALEFALAMIALLAGVELAQHVA 184
>gi|121586209|ref|ZP_01676000.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Vibrio cholerae 2740-80] >gi|121726750|ref|ZP_01679968.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Vibrio cholerae V52] >gi|147675570|ref|YP_001217819.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Vibrio cholerae O395] >gi|153221349|ref|ZP_01952327.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Vibrio cholerae MAK 757] >gi|153817858|ref|ZP_01970525.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Vibrio cholerae NCTC 8457] >gi|121549621|gb|EAX59645.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Vibrio cholerae 2740-80] >gi|121630784|gb|EAX63168.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Vibrio cholerae V52] >gi|124119696|gb|EAY38439.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Vibrio cholerae MAK 757] >gi|126511566|gb|EAZ74160.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Vibrio cholerae NCTC 8457] >gi|146317453|gb|ABQ21992.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Vibrio cholerae O395] (201 aa)
Score = 110, Expect = 7.0e-04, Identities = 40/176 (22%), Positives = 75/176 (42%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYSDNNIV---VDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIA 185
           RI +  +  S +M+ VI  D   RAG  V   +   K  +    G  +T  + +E  + + F+AL +PGG G  +   D     +  ++     +GK         + V A+       ++T  P F + +         V     ++ ++ + P  A EFAL ++  L   ++A ++A
  S:     4 RILVPVAHGSEEMETVIIVDTLVRAGFQVTMAAVGDKLQVQGSRGVWLTAEQTLEACSAEAFDALALPGGVGGAQAFADST--ALLALIDAFSQQGKLVAAICATPALVFAKQQKFVGARMTCHPNFFDHIPSERLSRQRVCYYATQHLLTSQGPGTALEFALAMIALLAGVELAQHVA 180
>gi|161598543|ref|YP_001573924.1| hypothetical protein pEDINA_p52 [Staphylococcus aureus] >gi|27531776|dbj|BAC54544.1| unnamed protein product [Staphylococcus aureus] (172 aa)
Score = 110, Expect = 7.6e-04, Identities = 40/166 (24%), Positives = 72/166 (43%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKL 175
           ++AI+ + E  D+++  P +    AG   E + +  K+ +  + G K+T    I     + ++AL IPGG     L  D   R       F  +    +    G    +L +   L  + IT      + L   G +  D ++VVD N V+ + P    +F   I+++L
  S:     4 KVAIILADEFEDIELTSPKEALENAGFETEIIGDTAKQELVGKHGEKVTVDISISDAKPENYDALLIPGGFSPDHLRGDEEGRYGTFTKYFTQNNVPTFAICHG--PLLLVDTDHLNGRTITGVINVRKDLSNAGAHVVDESVVVDNNIVTSRVPDDLDDFNREIIKQL 170
>gi|153938279|ref|YP_001390376.1| DJ-1/PfpI family protein [Clostridium botulinum F str. Langeland] >gi|152934175|gb|ABS39673.1| DJ-1/PfpI family protein [Clostridium botulinum F str. Langeland] (194 aa)
Score = 110, Expect = 7.6e-04, Identities = 41/128 (32%), Positives = 69/128 (53%)
  Q:    57 ITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDR-NERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITT---APGFEE----KLGKN-YSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNI 184
           +T    + +VN+D+F+AL IPGG        D  +E  +N I +F  D+ +K + +    +  + + GVL N+  TT     G  +    + G N   D  +VVDKN ++  +P  AF  A  ++E L +K+   N+
  S:    54 VTPEMHVSEVNIDEFDALAIPGGFEEAGFYEDAYSEDFLNIIREF--DKAEKTIASICVGALPIGKSGVLVNRNATTYNLGNGRRQNQLSEFGANVLRDKPVVVDKNIITSYNPSTAFHVAFKLLELLTSKENCVNV 188
>gi|119469330|ref|ZP_01612269.1| proteinase [Alteromonadales bacterium TW-7] >gi|119447194|gb|EAW28463.1| proteinase [Alteromonadales bacterium TW-7] (192 aa)
Score = 110, Expect = 7.8e-04, Identities = 44/167 (26%), Positives = 79/167 (47%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQS---GTKITCSEEIEKVNLDKFNALYIPGGK-GCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLL 176
           +IAI+ +      ++  P D    AG  +E VS ++ +         G K++  + +   N   ++AL +PGG      L  D++ +    I  F G E  K +     A  +LAE+  L ++ IT+ P  +  L   G N+ +  + VD+  V+ +SP     F    +E++L
  S:    14 KIAILATDGFEQSELFSPRDALLNAGAEIEIVSIKEGQITGWNEDKWGEKVSVDKLVTNTNSADYDALMLPGGLFNPDSLRQDKHAKAF--IDGFFGAEKNKPVAAICHAPWLLAEINKLRDRTITSFPSIKSDLMNAGANWVNEEVCVDRGLVTSRSPEDLDAFNAKFIEEVL 185
>gi|90412401|ref|ZP_01220405.1| hypothetical intracellular protease/amidase [Photobacterium profundum 3TCK] >gi|90326663|gb|EAS43062.1| hypothetical intracellular protease/amidase [Photobacterium profundum 3TCK] (199 aa)
Score = 109, Expect = 8.4e-04, Identities = 34/114 (29%), Positives = 61/114 (53%)
  Q:    62 EIEKVNLDKFNALYIPGGKGCQRLLTDR-NERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEK------LGKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKL 175
           ++ +++++ F+AL IPGG        D  +ER+++ I  F  D   K + +    +  +A+ GVL  +  TT    E++      +G N     +V+D N ++ +SP  A   A  +VEKL
  S:    59 QLSEIDINHFDALVIPGGMSRAGFYEDAYDERLLSLIRDF--DSQGKLIASVCVGAIPIAKSGVLNGRNGTTYHLSEKRQTQMKEMGVNIIQQPVVIDNNIITSRSPSAAMNVAFAVVEKL 177
>gi|34557642|ref|NP_907457.1| monophosphate synthesisprotein [Wolinella succinogenes DSM 1740] >gi|34483359|emb|CAE10357.1| MONOPHOSPHATE SYNTHESISPROTEIN [Wolinella succinogenes] (185 aa)
Score = 109, Expect = 8.4e-04, Identities = 43/171 (25%), Positives = 81/171 (47%)
  Q:    21 DMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYSDNNIVVDKNFV-SFKSPFHAFEFALLIVEKLLNKQIATNIANDILYT 191
           +++ V   D+  RAG  V     +    +  Q G  I    ++E +     + + +PGG G    L   +  ++  +V+ A  + +K +    AA   L+E+GV+   + T  PG +EK+ +     ++VV+ + + + + P  A  FAL +VEKL  K     +A  +L +
  S:    16 ELEAVTIIDVLRRAGARVVVAGLDSTDLVQSQGGIFIRPDSKMELIEPQNIDMIVLPGGWGGTVALA--SHPLVRSMVE-ALHKRQKPIGAICAAPYALSEIGVI-EGQYTCYPGIQEKIQRGEFVESLVVESDHIFTSQGPATALPFALALVEKLFGKAQRDEVARAMLVS 183
>gi|160883178|ref|ZP_02064181.1| hypothetical protein BACOVA_01147 [Bacteroides ovatus ATCC 8483] >gi|156111403|gb|EDO13148.1| hypothetical protein BACOVA_01147 [Bacteroides ovatus ATCC 8483] (183 aa)
Score = 109, Expect = 8.9e-04, Identities = 54/151 (35%), Positives = 77/151 (50%)
  Q:    29 DIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNA--LYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL-GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQ 179
           D   RAG+ VE VS    + +       + C    E  N D F+A  L +PGG      L D++E +   I+ FA  +GK  +    AA  VL +LG+L  KK T  P FE+ L G    + ++V D N ++   P  A EFAL IV+ L+ K+
  S:    22 DTLRRAGLNVEIVSVTPDEIVVGAHDVSVLCDINFE--NCDFFDAELLLLPGGMPGAATL-DKHEGLRKLILDFAA-KGKP-IAAICAAPMVLGKLGLLKGKKATCYPSFEQYLDGAECVNAHVVRDGNIITGMGPGAAMEFALTIVDLLVGKE 170
>gi|33357755|pdb|1OI4|A Chain A, Crystal Structure Of Yhbo From Escherichia Coli >gi|33357756|pdb|1OI4|B Chain B, Crystal Structure Of Yhbo From Escherichia Coli (193 aa)
Score = 109, Expect = 9.0e-04, Identities = 41/152 (26%), Positives = 73/152 (48%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSG-TKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGD--EGKKWLFTAGAASTVLAELGVLGNKKITTAPGF---EEKLGKNYSDNNIVVDKN-FVSFKSP 161
           +IA++ + E  D +   P D + +AG  V T+  +  K++  + G   +T  + I++V   +F+AL +PGG     L  D      N+ V F  D     K +F       +L    V+  +K+T         +  G  + D  +VVDK+  V+ ++P
  S:    25 KIAVLITDEFEDSEFTSPADEFRKAGHEVITIEKQAGKTVKGKKGEASVTIDKSIDEVTPAEFDALLLPGGHSPDYLRGD------NRFVTFTRDFVNSGKPVFAICHGPQLLISADVIRGRKLTAVKPIIIDVKNAGAEFYDQEVVVDKDQLVTSRTP 177
>gi|39938623|ref|NP_950389.1| hypothetical protein PAM137 [Onion yellows phytoplasma OY-M] >gi|39721732|dbj|BAD04222.1| conserved hypothetical protein [Onion yellows phytoplasma OY-M] (180 aa)
Score = 109, Expect = 9.6e-04, Identities = 38/168 (22%), Positives = 71/168 (42%)
  Q:    21 DMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNY-SDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDI 188
           D + ++   +  R  + + T +   +  +   SG  +     +  +N  +++ L IPGG    +++ ++   ++  I KF   +  K +    AA   L +L +L N   T  P     +   Y  D   V+   FV+ +SP   F+F   +VE L  K  A    N +
  S:    13 DCEALVTRALLNRVALPLTTATLNPQLEVMSSSGLCVKADANLATINPLEYDFLVIPGGPYVAQII-EKETFLLKLIQKFV--DANKVIGAICAAPMFLGKLDLLKNHPFTCFPSCNHFIEGTYLPDQKAVISDKFVTSRSPITVFDFVFALVEVLKGKAFAFAFKNSL 178
>gi|163727669|ref|ZP_02135155.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Vibrio fischeri MJ11] >gi|161399471|gb|EDQ23754.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Vibrio fischeri MJ11] (193 aa)
Score = 109, Expect = 9.7e-04, Identities = 47/180 (26%), Positives = 85/180 (47%)
  Q:     1 MIKHKVSNIRIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKN-YSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQI 180
           M KH      +A++ +    + + V+  DI  R  I V+ +S  +  ++     T+I+    ++      ++A+ +PGG KG   L    N  VI+  +K   ++ K       + + VLA   +L  +  TT  G E+K     + D  +VVD  F+S K    +FEFA  + + LL++ +
  S:     6 MTKH------VAVLLADGFEEGEAVVFIDIMRRLDIKVDVLSCMETTALETYFETRISADYTLKDKKDVLYDAVMMPGGPKGTDNL--SANSMVID-FLKRHIEKDKYICALCSSGAKVLAANHLLNGRNYTTGGGLEKKFTDGCFQDKKVVVDGRFISGKGLGVSFEFAFTVAKHLLSENV 178
>gi|89109918|ref|AP_003698.1| predicted intracellular protease [Escherichia coli W3110] >gi|90111548|ref|NP_417622.2| predicted intracellular protease [Escherichia coli str. K-12 substr. MG1655] >gi|110643394|ref|YP_671124.1| hypothetical protein ECP_3241 [Escherichia coli 536] >gi|157155250|ref|YP_001464627.1| PfpI family intracellular peptidase [Escherichia coli E24377A] >gi|157162638|ref|YP_001459956.1| PfpI family intracellular peptidase [Escherichia coli HS] >gi|168708727|ref|ZP_02741004.1| hypothetical protein EschericoliO157_13849 [Escherichia coli O157:H7 str. EC4045] >gi|168718123|ref|ZP_02750400.1| hypothetical protein EschericcoliO157_10272 [Escherichia coli O157:H7 str. EC4206] >gi|168734687|ref|ZP_02766964.1| hypothetical protein EschecoliO157_06520 [Escherichia coli O157:H7 str. EC4115] >gi|168749253|ref|ZP_02774275.1| intracellular peptidase, PfpI family [Escherichia coli O157:H7 str. EC4113] >gi|168754132|ref|ZP_02779139.1| intracellular peptidase, PfpI family [Escherichia coli O157:H7 str. EC4401] >gi|168762117|ref|ZP_02787124.1| intracellular peptidase, PfpI family [Escherichia coli O157:H7 str. EC4501] >gi|168769569|ref|ZP_02794576.1| intracellular peptidase, PfpI family [Escherichia coli O157:H7 str. EC4486] >gi|168773182|ref|ZP_02798189.1| intracellular peptidase, PfpI family [Escherichia coli O157:H7 str. EC4196] >gi|168781295|ref|ZP_02806302.1| intracellular peptidase, PfpI family [Escherichia coli O157:H7 str. EC4076] >gi|168791527|ref|ZP_02816534.1| hypothetical protein EschercoliO157_03580 [Escherichia coli O157:H7 str. EC4042] >gi|168797752|ref|ZP_02822759.1| intracellular peptidase, PfpI family [Escherichia coli O157:H7 str. EC508] >gi|170018595|ref|YP_001723549.1| PfpI family intracellular peptidase [Escherichia coli ATCC 8739] >gi|170082690|ref|YP_001732010.1| intracellular protease [Escherichia coli str. K12 substr. DH10B] >gi|188495363|ref|ZP_03002633.1| intracellular peptidase, PfpI family [Escherichia coli 53638] >gi|191168042|ref|ZP_03029842.1| intracellular peptidase, PfpI family [Escherichia coli B7A] >gi|191172173|ref|ZP_03033716.1| intracellular peptidase, PfpI family [Escherichia coli F11] >gi|193062094|ref|ZP_03043190.1| intracellular peptidase, PfpI family [Escherichia coli E22] >gi|193067397|ref|ZP_03048365.1| intracellular peptidase, PfpI family [Escherichia coli E110019] >gi|194427724|ref|ZP_03060271.1| intracellular peptidase, PfpI family [Escherichia coli B171] >gi|194433787|ref|ZP_03066062.1| intracellular peptidase, PfpI family [Shigella dysenteriae 1012] >gi|194438809|ref|ZP_03070895.1| intracellular peptidase, PfpI family [Escherichia coli 101-1] >gi|195938373|ref|ZP_03083755.1| intracellular protease [Escherichia coli O157:H7 str. EC4024] >gi|6686354|sp|P45470|YHBO_ECOLI Protein yhbO >gi|85675949|dbj|BAE77199.1| predicted intracellular protease [Escherichia coli W3110] >gi|87082219|gb|AAC76187.2| predicted intracellular protease [Escherichia coli str. K-12 substr. MG1655] >gi|110344986|gb|ABG71223.1| hypothetical protein YhbO (hypothetical protease) [Escherichia coli 536] >gi|157068318|gb|ABV07573.1| intracellular peptidase, PfpI family [Escherichia coli HS] >gi|157077280|gb|ABV16988.1| intracellular peptidase, PfpI family [Escherichia coli E24377A] >gi|169753523|gb|ACA76222.1| intracellular protease, PfpI family [Escherichia coli ATCC 8739] >gi|169890525|gb|ACB04232.1| predicted intracellular protease [Escherichia coli str. K12 substr. DH10B] >gi|187770819|gb|EDU34663.1| intracellular peptidase, PfpI family [Escherichia coli O157:H7 str. EC4196] >gi|188016331|gb|EDU54453.1| intracellular peptidase, PfpI family [Escherichia coli O157:H7 str. EC4113] >gi|188490562|gb|EDU65665.1| intracellular peptidase, PfpI family [Escherichia coli 53638] >gi|189001020|gb|EDU70006.1| intracellular peptidase, PfpI family [Escherichia coli O157:H7 str. EC4076] >gi|189358500|gb|EDU76919.1| intracellular peptidase, PfpI family [Escherichia coli O157:H7 str. EC4401] >gi|189361449|gb|EDU79868.1| intracellular peptidase, PfpI family [Escherichia coli O157:H7 str. EC4486] >gi|189367569|gb|EDU85985.1| intracellular peptidase, PfpI family [Escherichia coli O157:H7 str. EC4501] >gi|189379723|gb|EDU98139.1| intracellular peptidase, PfpI family [Escherichia coli O157:H7 str. EC508] >gi|190901911|gb|EDV61660.1| intracellular peptidase, PfpI family [Escherichia coli B7A] >gi|190907483|gb|EDV67079.1| intracellular peptidase, PfpI family [Escherichia coli F11] >gi|192932314|gb|EDV84912.1| intracellular peptidase, PfpI family [Escherichia coli E22] >gi|192959354|gb|EDV89789.1| intracellular peptidase, PfpI family [Escherichia coli E110019] >gi|194414232|gb|EDX30507.1| intracellular peptidase, PfpI family [Escherichia coli B171] >gi|194418050|gb|EDX34144.1| intracellular peptidase, PfpI family [Shigella dysenteriae 1012] >gi|194422281|gb|EDX38282.1| intracellular peptidase, PfpI family [Escherichia coli 101-1] (172 aa)
Score = 109, Expect = 9.8e-04, Identities = 41/152 (26%), Positives = 73/152 (48%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSG-TKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGD--EGKKWLFTAGAASTVLAELGVLGNKKITTAPGF---EEKLGKNYSDNNIVVDKN-FVSFKSP 161
           +IA++ + E  D +   P D + +AG  V T+  +  K++  + G   +T  + I++V   +F+AL +PGG     L  D      N+ V F  D     K +F       +L    V+  +K+T         +  G  + D  +VVDK+  V+ ++P
  S:     4 KIAVLITDEFEDSEFTSPADEFRKAGHEVITIEKQAGKTVKGKKGEASVTIDKSIDEVTPAEFDALLLPGGHSPDYLRGD------NRFVTFTRDFVNSGKPVFAICHGPQLLISADVIRGRKLTAVKPIIIDVKNAGAEFYDQEVVVDKDQLVTSRTP 156
>gi|28210309|ref|NP_781253.1| protease I [Clostridium tetani E88] >gi|28202745|gb|AAO35190.1| protease I [Clostridium tetani E88] (176 aa)
Score = 109, Expect = 1.0e-03, Identities = 40/161 (24%), Positives = 73/161 (45%)
  Q:     1 MIKHKVSNIRIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGK--KWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSDNNIVVDKNFVSFKSP 161
           M K K++  R+ ++     +D+++  P       G  V  V +   K    + G  +   +  ++V+  +F+ + +PGG    +L      R  N + K  GD  K  K L T      V    GV+ + K+T      + +   G NY D+ + VD+N ++ +SP
  S:     1 MTKLKLTGKRMIMLAEEGFDDLELWYPVIRLREEGCEVVIVGSGTSKIYKGKHGIPVDVDKNADEVSSKEFDGIIVPGGWAPDKL------RRYNSVKKLVGDFAKENKLLATICHGGWVFISAGVIKDYKMTCVNAIIDDVKNAGANYIDSEVAVDRNLITSRSP 160
>gi|24114444|ref|NP_708954.1| hypothetical protein SF3194 [Shigella flexneri 2a str. 301] >gi|30064493|ref|NP_838664.1| hypothetical protein S3411 [Shigella flexneri 2a str. 2457T] >gi|24053623|gb|AAN44661.1| orf, conserved hypothetical protein [Shigella flexneri 2a str. 301] >gi|30042752|gb|AAP18475.1| hypothetical protein S3411 [Shigella flexneri 2a str. 2457T] (186 aa)
Score = 109, Expect = 1.0e-03, Identities = 41/152 (26%), Positives = 73/152 (48%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSG-TKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGD--EGKKWLFTAGAASTVLAELGVLGNKKITTAPGF---EEKLGKNYSDNNIVVDKN-FVSFKSP 161
           +IA++ + E  D +   P D + +AG  V T+  +  K++  + G   +T  + I++V   +F+AL +PGG     L  D      N+ V F  D     K +F       +L    V+  +K+T         +  G  + D  +VVDK+  V+ ++P
  S:    18 KIAVLITDEFEDSEFTSPADEFRKAGHEVITIEKQAGKTVKGKKGEASVTIDKSIDEVTPAEFDALLLPGGHSPDYLRGD------NRFVTFTRDFVNSGKPVFAICHGPQLLISADVIRGRKLTAVKPIIIDVKNAGVEFYDQEVVVDKDQLVTSRTP 170
>gi|168786036|ref|ZP_02811043.1| intracellular peptidase, PfpI family [Escherichia coli O157:H7 str. EC869] >gi|189374094|gb|EDU92510.1| intracellular peptidase, PfpI family [Escherichia coli O157:H7 str. EC869] (172 aa)
Score = 109, Expect = 1.0e-03, Identities = 41/152 (26%), Positives = 73/152 (48%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSG-TKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGD--EGKKWLFTAGAASTVLAELGVLGNKKITTAPGF---EEKLGKNYSDNNIVVDKN-FVSFKSP 161
           +IA++ + E  D +   P D + +AG  V T+  +  K++  + G   +T  + I++V   +F+AL +PGG     L  D      N+ V F  D     K +F       +L    V+  +K+T         +  G  + D  +VVDK+  V+ ++P
  S:     4 KIAVLITDEFEDSEFTSPADEFRKAGHEVITIEKQAGKTVKGKKGEASVTIDKSIDEVTPAEFDALLLPGGHSPDYLRGD------NRFVTFTRDFVNSGKPVFAICHGPQLLISADVIRGRKLTAVKPIIIDVKNAGAEFYDQEVVVDKDQLVTSRTP 156
>gi|157347768|emb|CAO22224.1| unnamed protein product [Vitis vinifera] (386 aa)
Score = 109, Expect = 1.0e-03, Identities = 41/144 (28%), Positives = 73/144 (50%)
  Q:     7 SNIRIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKK---------------KSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFE-------------EKLGKNYSDNNIV 150
           S+ RI  +C     D ++++P+  +      V+ V  +KK               ++   + G   T +   E +N+  ++AL IPGG+  + L    NE+VI  + +F   E  K + +      +LA  GVL  KK T  P  +             E + + ++D N+V
  S:   194 SDKRILFLCGDYMEDYEVMVPFQSFQALECHVDAVCPKKKAGETCPTAIHDFEGDQTYSEKPGHDFTLTATFEDLNIPSYDALVIPGGRAPEYLAL--NEKVIALVKEFM--EAGKPVASICHGQQILAAAGVLKGKKCTAYPAVKLNVVLSGATWLEPEPIDRCFTDGNLV 361
>gi|20807466|ref|NP_622637.1| putative intracellular protease/amidase [Thermoanaerobacter tengcongensis MB4] >gi|20515992|gb|AAM24241.1| putative intracellular protease/amidase [Thermoanaerobacter tengcongensis MB4] (168 aa)
Score = 109, Expect = 1.0e-03, Identities = 39/166 (23%), Positives = 75/166 (45%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKL 175
           R+AI+      + +++ PY      G  V  V  EK K    + G  +  +   ++V  D ++A+ IPGG     +   R +  +N + +    + +K +        ++A    L  K++T+    ++ L   G  Y D  +V+D N ++ ++P     F   I+EKL
  S:     3 RVAILIENLYEEPELLYPYYRLKEEGYEVHLVGTEKDKVYTGKYGYPMKSTHASKEVKADDYDAVVIPGGYSPDHM--RRCQDTVNFVKEMC--QQQKIIAAICHGPWMMASSCDLKGKRVTSFFSIKDDLINAGAQYVDEEVVIDGNLITSRTPNDLVAFVKAIIEKL 167
>gi|125594906|gb|EAZ34965.1| hypothetical protein OsJ_018448 [Oryza sativa (japonica cultivar-group)] (406 aa)
Score = 109, Expect = 1.1e-03, Identities = 44/172 (25%), Positives = 82/172 (47%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLG-----------------NKKITTAPGFEEKLGKNYSD-NNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILY 190
           S +M+I++  D+  RA + V   S EK  SI      +I   + I   +  +++ + +PGG  G +RL       V+ K++K     G+  ++ AG     +  L  LG                 +K +T  P    +L     D + +V+D N ++        +F+L I++K      A  +AN +++
  S:   216 SEEMEIIMLTDVLRRANVNVVLASVEKSTSIVGSQRMRIVADKCISDASALEYDLIILPGGPAGAERL---HKSSVLKKLLKEQKQTGR--MYEAGFTPGDILGLKTLGILYSLAWKITAIEIVDQDKTVTAHPSIVNQLTCEVIDRSKVVIDGNLITGMGLGTVIDFSLAIIKKFFGHGRAKGVANGMVF 401
Score = 90, Expect = 1.7e-01, Identities = 40/180 (22%), Positives = 73/180 (40%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           ++ +  ++ + +M+ VI   +  RAG  V   S E    +    G+ I   + I       F+ + +PGG  G  RL   R+  ++ +I     +E + +     A + VL   G+   KK++                         + + P  AF+FAL  VE+L     A ++ N +L
  S:    26 KVLLPIAMGTEEMEAVILAGVLRRAGADVTLASVEDGLEVEASRGSHIVADKRIAACADQVFDLVALPGGMPGSVRL---RDSVILQRITVRQAEEKRLYGAICAAPAVVLMPWGLHKRKKVS---------------------GELTTSRGPGTAFQFALSFVEQLFGPCKAEDMDNTLL 182
>gi|52842194|ref|YP_095993.1| ThiJ/PfpI family intracellular protease [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] >gi|52629305|gb|AAU28046.1| intracellular protease, ThiJ/PfpI family [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] (198 aa)
Score = 109, Expect = 1.1e-03, Identities = 45/139 (32%), Positives = 73/139 (52%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQS-----------------GTKITCSEEIEKVNLDKFNALYIPGGKGC--QRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEE----KLGKNYSD---NNIVVDKNFVS 157
           + D+++  PY        +++TVS  K K  F+Q+                 G     + +  K+ L  ++AL IPGG+    QRL    N+ ++  I  F   +  K +        +LAE G+L +KK TT  GF E    K G ++ D   + +VVD   V+
  S:    19 NEDLEVYFPYQAMLMNNYLIDTVSPGKNKGDFIQTAVHDLDKPHLQSYTEKLGHLFPITADFSKITLKDYDALIIPGGRAAEYQRL----NKDILAIIRHF--HDADKPIACICHGIQILAEAGILEDKKCTTV-GFCEPDVRKAGGHFIDTGMDGVVVDGKLVT 176
>gi|123246551|emb|CAM19229.1| Parkinson disease (autosomal recessive, early onset) 7 [Mus musculus] (175 aa)
Score = 108, Expect = 1.1e-03, Identities = 47/164 (28%), Positives = 81/164 (49%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLD-KFNALYIPGGK-GCQRLLTDRNERVINKIVKFAGDEGKKWLFTA---GAASTVLAELGVLGNKKITTAPGFEEKL--GKNYSDNNIVVDKN--FVSFKSPFHAFEFALLIVE 173
           R  ++ +  + +M+ VIP D+  RAGI V       K  +       I     +E       ++ + +PGG  G Q L       ++ +I+K    E +K L  A   G  + +  E+G     K+TT P  ++K+  G +YS +   V+K+   ++ + P  +FEFAL IV+
  S:     5 RALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVMICPDTSLEDAKTQGPYDVVVLPGGNLGAQNL---SESPMVKEILK--EQESRKGLIAAICAGPTALLAHEVGF--GCKVTTHPLAKDKMMNGSHYSYSESRVEKDGLILTSRGPGTSFEFALAIVD 170
>gi|170759401|ref|YP_001786417.1| DJ-1/PfpI family protein [Clostridium botulinum A3 str. Loch Maree] >gi|169406390|gb|ACA54801.1| DJ-1/PfpI family protein [Clostridium botulinum A3 str. Loch Maree] (194 aa)
Score = 108, Expect = 1.1e-03, Identities = 42/128 (32%), Positives = 68/128 (53%)
  Q:    57 ITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDR-NERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITT---APGFEEK----LGKN-YSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNI 184
           +T    + +VN+D+F+AL IPGG        D  +E  +N I +F  D+  K + +    +  + + GVL ++  TT     G  +K     G N   D  +VVDKN ++  +P  AF  A  ++E L +K+   NI
  S:    54 VTPEMHVSEVNIDEFDALAIPGGFEEAGFYEDAYSEDFLNIIKEF--DKAGKTIASICVGALPIGKSGVLVDRNATTYNLGNGRRQKQLSEFGANVLRDEPVVVDKNIITSYNPSTAFHVAFKLLELLTSKENCVNI 188
>gi|150008001|ref|YP_001302744.1| ThiJ family intracellular protease [Parabacteroides distasonis ATCC 8503] >gi|149936425|gb|ABR43122.1| putative ThiJ family intracellular protease [Parabacteroides distasonis ATCC 8503] (190 aa)
Score = 108, Expect = 1.1e-03, Identities = 47/162 (29%), Positives = 76/162 (46%)
  Q:    29 DIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL-GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILY 190
           D+  R G+ V  VS    + +       +      E+ +    +AL +PGG  G   L    +   + ++VK   +EG   +    A   VL  LG+L  K+ T  P FE  + G   +DN +  D N ++ K P   FEF L I+  L +++IA  +A+ +LY
  S:    22 DVLRRGGVRVMMVSITGDRLVIGAHDIPVMADYLFEEADFSCVDALILPGGIPGSNHLNAHAH---LKELVKEKTEEGV-LIGAICAGPMVLGGLGLLKGKRATCFPFFEPTMVGAIPTDNGVEQDGNIITSKGPGFMFEFGLTILRNLKDEEIALEVADALLY 181
>gi|187778153|ref|ZP_02994626.1| hypothetical protein CLOSPO_01745 [Clostridium sporogenes ATCC 15579] >gi|187775081|gb|EDU38883.1| hypothetical protein CLOSPO_01745 [Clostridium sporogenes ATCC 15579] (194 aa)
Score = 108, Expect = 1.2e-03, Identities = 40/122 (32%), Positives = 68/122 (55%)
  Q:    63 IEKVNLDKFNALYIPGGKGCQRLLTDR-NERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITT---APGFEE----KLGKN-YSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNI 184
           + +VN+D+F+AL IPGG        D  N+  +N I +F  D+  K + +    +  + + GVL ++  TT     G  +    K G N  +D +IV+DKN ++  +P  AF  A  ++E L +K+   N+
  S:    60 VSEVNIDEFDALAIPGGFEEAGFYEDAYNKDFLNIIREF--DKSGKTIASICVGALPIGKSGVLVDRNATTYNLGNGKRQNQLSKFGANVLADTSIVIDKNIITSYNPSTAFHVAFKLLELLTSKENCVNV 188
>gi|87121708|ref|ZP_01077595.1| putative protease [Marinomonas sp. MED121] >gi|86162959|gb|EAQ64237.1| putative protease [Marinomonas sp. MED121] (201 aa)
Score = 108, Expect = 1.2e-03, Identities = 48/171 (28%), Positives = 84/171 (49%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCS---EEIEKV------------NLDK---FNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL-GKNY-SDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           S D++ +   D+  R G+ V   S      I    G+KI       E+E               LD+   F+A+ +PGG  G + L   R+  ++  I++              A + VL   G + +K+ T  PGFE+ L G  Y +D  +V+D+N ++ + P  A  F+L ++  L+  +    +A  +L
  S:    12 SEDIEAITIIDVLRRGGVEVVVASVHDSLQITAARGSKIEADVLLSELETYVFEDGSHYSVGEALDENVMFDAIALPGGIPGAEHL---RDSELLVDILEKHDIHDAILAAICAAPALVLGTHGFVMDKQATCYPGFEDGLTGAQYVADQPVVMDENIMTSQGPATAMVFSLSLLANLIGYEKTQEVAAGLL 200
>gi|150423934|gb|EDN15874.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Vibrio cholerae AM-19226] (205 aa)
Score = 108, Expect = 1.2e-03, Identities = 40/176 (22%), Positives = 75/176 (42%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYSDNNIV---VDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIA 185
           RI +  +  S +M+ VI  D   RAG  V   +   K  +    G  +T  + +E+ + + F+AL +PGG    +   D    +   ++     +GK         + V A+       ++T  P F E +         V     ++ ++ + P  A EFAL ++  L   ++A ++A
  S:     8 RILVPVANGSEEMETVIIVDTLVRAGFQVTMAAVGDKLQVQGSRGVWLTAEQTLEECSAEAFDALALPGGVAGAQAFADSTPLL--ALIDAFSQQGKLVAAICATPALVFAKQQKFVGARMTCHPNFFEHIPPERLSRQRVCYYATQHLLTSQGPGTALEFALAMIALLAGLELAQHVA 184
>gi|12044879|ref|NP_072689.1| DJ-1/PfpI family protein [Mycoplasma genitalium G37] >gi|1722956|sp|P47275|Y029_MYCGE Uncharacterized protein MG029 >gi|3844639|gb|AAC71245.1| DJ-1/PfpI family protein [Mycoplasma genitalium G37] >gi|166078930|gb|ABY79548.1| DJ-1/PfpI family protein [synthetic Mycoplasma genitalium JCVI-1.0] (186 aa)
Score = 108, Expect = 1.2e-03, Identities = 43/181 (23%), Positives = 84/181 (46%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTA-PGFEEKLGKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILY 190
           +I ++   E ND++      +++    I  T  +   K I   +G  +  +  +  +NL +F+A+YIPGG G  + L D++E+++  I  F  +    +LF       VL + G++   +I ++ P     + +N S   + V    ++ +S   A EFA +IV   L       + +  L+
  S:     3 KILVIVYPEMNDVEYTNVMVVFSFIKTIQTTCYHHSLKKITASNGV-VEVNNIVNTINLSEFDAVYIPGGIGATKHL-DKDEKLLKTINYFKVN--NLYLFAICDTPNVLFKHGIITKDEIYSSFPNPNLVMSENRSTAKVTVANKLITARSAGCALEFATVIVCTFLKDNTLNELVHKRLF 180
>gi|111610240|gb|ABH11617.1| putative 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein [Lactobacillus helveticus CNRZ32] (194 aa)
Score = 108, Expect = 1.2e-03, Identities = 40/120 (33%), Positives = 62/120 (51%)
  Q:    56 KITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGK-----NYSDNNIVVDK--NFVSFKSPFHAFEFALLIVEKL 175
           K+TC + ++   LD ++ +  PGG      L D +E++ + +VK    E  KW     AA   LA  GVL + + T  PG EE+  K     ++S+   V DK    ++ + P  A+ FA  I E L
  S:    48 KLTCDKVVDDSLLD-YDLVAFPGGMTGSANLRD-DEKLRDLMVK--RHEDGKWDAAMCAAPRALARYGVLKDAEFTCYPGIEEECEKYDPSAHFSERITVTDKEHKVLTSRGPATAWAFAYAIAEAL 170
>gi|21229379|ref|NP_635301.1| protease I [Methanosarcina mazei Go1] >gi|20907968|gb|AAM32973.1| protease I [Methanosarcina mazei Go1] (199 aa)
Score = 108, Expect = 1.2e-03, Identities = 45/155 (29%), Positives = 73/155 (47%)
  Q:    21 DMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFE-----EKLGKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKL 175
           D +  +P  ++  AG  V TV+ E + +     G  I     I +  +D ++A+ I GG G ++ L D +   +  +VK A D  KK +     +  VLA  GVL  K+ T     +     EK G  Y D ++VV    V+ + P  A  F   +++ L
  S:    41 DEECFVPKQVFESAGAKV-TVAAESENTAKGALGGTIKPDIRISEARIDDYDAIVISGGGGSRKYLWDNH--YLRGLVKEA-DSRKKVISAICISPVVLARAGVLKGKESTVFNSPDTVTELEKYGAVYQDRDVVVSGRVVTGRDPKSAEAFGKAVLKAL 196
>gi|123476946|ref|XP_001321643.1| DJ-1 family protein [Trichomonas vaginalis G3] >gi|121904473|gb|EAY09420.1| DJ-1 family protein [Trichomonas vaginalis G3] (187 aa)
Score = 108, Expect = 1.3e-03, Identities = 40/176 (22%), Positives = 83/176 (47%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVS-NEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAE-LGVLGNKKITTAPGFEEKL---GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIA 185
           ++ ++ +     M++V P D+  RAG  V+  +   +   +    G KI    + + V  + F+ +  PGG    + L   ++ V  + +K     GK       A   VLA+  G++  +K    PG +  +   G   + + +  D N ++ + P  + +F L ++E L++K+ A ++A
  S:     3 KVLVLAATGFEPMELVNPTDLLRRAGADVKVAAVGTQGLQVDAAHGVKIVADVKFDAVKNETFDLIIAPGGMPGTKNLAANHDVV--EFIKRHDKAGKLVGAICAAPGFVLAQACGIMKGRKGCGYPGCDNAIAETGGELTTDAVTRDGNVITSRGPGTSQQFGLALIEALISKEKAHDVA 181
>gi|83857205|ref|ZP_00950733.1| proteinase [Croceibacter atlanticus HTCC2559] >gi|83848572|gb|EAP86441.1| proteinase [Croceibacter atlanticus HTCC2559] (193 aa)
Score = 108, Expect = 1.3e-03, Identities = 45/172 (26%), Positives = 85/172 (49%)
  Q:     4 HKVSNIRIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGT---KITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKL 175
           +K  N R+AI+ +    + ++  P +     G  V+ VS E  K     +G    + T  + ++ V+   +NAL +PGG     +L  R+++ I+ I  F   +  K +     A  +L E  V+  +K+T+    +  L   G N+ D  +VVD+ FV+ ++P     F   ++E++
  S:     9 NKKMNKRVAILATNGFEESELKSPLEAMKNEGFTVDIVSQESGKIKAWDNGNWSNEYTVDKTLDNVSASDYNALMLPGGVINPDILR-RDDKAISFIKDFF--KQSKPVAAICHAPQLLIEADVVKGRKLTSFNSIKTDLVNAGANWVDEEVVVDEGFVTSRNPDDLPAFNAKLIEEV 183
>gi|66879841|ref|ZP_00404831.1| COG0693: Putative intracellular protease/amidase [Mycoplasma genitalium G-37] (191 aa)
Score = 108, Expect = 1.4e-03, Identities = 43/181 (23%), Positives = 84/181 (46%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTA-PGFEEKLGKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILY 190
           +I ++   E ND++      +++    I  T  +   K I   +G  +  +  +  +NL +F+A+YIPGG G  + L D++E+++  I  F  +    +LF       VL + G++   +I ++ P     + +N S   + V    ++ +S   A EFA +IV   L       + +  L+
  S:     8 KILVIVYPEMNDVEYTNVMVVFSFIKTIQTTCYHHSLKKITASNGV-VEVNNIVNTINLSEFDAVYIPGGIGATKHL-DKDEKLLKTINYFKVN--NLYLFAICDTPNVLFKHGIITKDEIYSSFPNPNLVMSENRSTAKVTVANKLITARSAGCALEFATVIVCTFLKDNTLNELVHKRLF 185
>gi|169335731|ref|ZP_02862924.1| hypothetical protein ANASTE_02151 [Anaerofustis stercorihominis DSM 17244] >gi|169258469|gb|EDS72435.1| hypothetical protein ANASTE_02151 [Anaerofustis stercorihominis DSM 17244] (177 aa)
Score = 107, Expect = 1.5e-03, Identities = 33/134 (24%), Positives = 62/134 (46%)
  Q:    57 ITCS--EEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILY 190
           ITC+  +   ++  + + AL +PGG   + +  + + +V N I  F+  +  K++    A  T+L   G L NK  T      E  G  Y D  +V D   ++ +S     +F   I+++L+ ++       +I Y
  S:    46 ITCTNLKPFSQIKEEDYEALILPGGP--EYVAIEASTKVQNLIKSFSKKD--KYMCAICAGPTILGRAGYLKNKNYTCFTSMNEDFGGTYIDKYVVTDGKIITGRSAAATIDFGFAILKELMGEKAEKETKEEIYY 177
>gi|86159462|ref|YP_466247.1| peptidase C56, PfpI [Anaeromyxobacter dehalogenans 2CP-C] >gi|85775973|gb|ABC82810.1| peptidase C56, PfpI [Anaeromyxobacter dehalogenans 2CP-C] (188 aa)
Score = 107, Expect = 1.5e-03, Identities = 46/161 (28%), Positives = 72/161 (44%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTK----ITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSDNNIVVDKNFVSFKSP--FHAFEFALL 170
           RIA +      D ++ +P+D   +AG     V  EK K I    G K     T       V  D F+A+ +PGG     L TD +   + ++V+ A   GK  +        +L E   +  K +T+ P  +  L   G  + D  +V D N ++ + P    AF  A+L
  S:     3 RIAFIADDLFEDSELRVPWDRLRQAGHETVLVGLEKGKQI---RGKKQRETFTTDAAARDVTADDFDAVVVPGGYSPDHLRTDMD---MVRLVRTAFTAGKP-VAAVCHGPWMLVEADAIDGKTVTSWPSLKTDLINAGARWVDRQVVEDGNVITSRKPDDLEAFSDAIL 165
>gi|110807022|ref|YP_690542.1| hypothetical protein SFV_3183 [Shigella flexneri 5 str. 8401] >gi|110616570|gb|ABF05237.1| conserved hypothetical protein [Shigella flexneri 5 str. 8401] (172 aa)
Score = 107, Expect = 1.6e-03, Identities = 41/152 (26%), Positives = 73/152 (48%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSG-TKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGD--EGKKWLFTAGAASTVLAELGVLGNKKITTAPGF---EEKLGKNYSDNNIVVDKN-FVSFKSP 161
           +IA++ + E  D +   P D + +AG  V T+  +  K++  + G   +T  + I++V   +F+AL +PGG     L  D      N+ V F  D     K +F       +L    V+  +K+T         +  G  + D  +VVDK+  V+ ++P
  S:     4 KIAVLITDEFEDSEFTSPADEFRKAGHEVITIEKQAGKTVKGKKGEASVTIDKSIDEVTPAEFDALLLPGGHSPDYLRGD------NRFVTFTRDFVNSGKPVFAICHGPQLLISADVIRGRKLTAVKPIIIDVKNAGVEFYDQEVVVDKDQLVTSRTP 156
>gi|156935677|ref|YP_001439593.1| hypothetical protein ESA_03543 [Enterobacter sakazakii ATCC BAA-894] >gi|156533931|gb|ABU78757.1| hypothetical protein ESA_03543 [Enterobacter sakazakii ATCC BAA-894] (172 aa)
Score = 107, Expect = 1.6e-03, Identities = 41/152 (26%), Positives = 73/152 (48%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSG-TKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGD--EGKKWLFTAGAASTVLAELGVLGNKKITTAPGF---EEKLGKNYSDNNIVVDKN-FVSFKSP 161
           +IA++ + E  D +   P   + +AG  V T+  E  K++  + G  K+T  + I++V+   F+AL +PGG     L  D      ++ V F  D     K +F       +L    V+  +K+T         +  G  + D  +VVDK+  V+ ++P
  S:     4 KIAVLITDEFEDSEFTSPAAEYRKAGHEVITIEKEAGKTVTGKQGEAKVTIDKAIDEVSPADFDALLLPGGHSPDSLRGD------DRFVTFTRDFVNTGKPVFAICHGPQLLISADVIRGRKLTAVKPIVIDVKNAGAEFHDQEVVVDKDQLVTSRTP 156
>gi|194537041|ref|YP_002072190.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Vibrio cholerae V51] >gi|125621654|gb|EAZ49984.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Vibrio cholerae V51] (205 aa)
Score = 107, Expect = 1.7e-03, Identities = 39/176 (22%), Positives = 75/176 (42%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYSDNNIV---VDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIA 185
           RI +  +  S +M+ VI  D   RAG  V   +   K  +    G  +T  + +E  + + F+AL +PGG G  +   D    ++  ++     +GK         + V  +       ++T  P F + +         V     ++ ++ + P  A EFAL ++  L   ++A ++A
  S:     8 RILVPVANGSEEMETVIIVDTLVRAGFQVTMAAVGDKLQVQGSRGVWLTAEQTLEACSAEAFDALALPGGVGGAQAFADST--LLLALIDAFSQQGKLVAAICATPALVFTKQQKFVGARMTCHPNFFDHIPSERLSRQRVCYYATQHLLTSQGPGTALEFALAMIALLAGVELAQHVA 184
>gi|194683482|emb|CAR44281.1| DJ-1/PfpI-family protein [Proteus mirabilis HI4320] (193 aa)
Score = 107, Expect = 1.7e-03, Identities = 48/171 (28%), Positives = 84/171 (49%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVK-FAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGK-NYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQI 180
           ++A++ +    + + V+  DI  R  I V+ +S      +     TKI+    + +     ++A+ +PGG KG  RL    N  VI+ I +  A D+    L ++GA   VLA   +L  +  +T     +K    +Y D ++VVD  F+S K    +FEFA  + + LL+  +
  S:     3 QVAVLLADGFEEGEAVVFIDIMRRLDIHVDVLSCMDTLVLNTYFNTKISADYLLTEKFTHSYDAVMMPGGPKGTDRLCA--NSLVIDFIKRHIAQDKYICALCSSGA--KVLAAHHLLEGRYYSTGDKLADKYDDGHYLDQDVVVDGKFISAKGLGVSFEFAFTVAKYLLSDNV 172
>gi|170683857|ref|YP_001745426.1| PfpI family intracellular peptidase [Escherichia coli SMS-3-5] >gi|170521575|gb|ACB19753.1| intracellular peptidase, PfpI family [Escherichia coli SMS-3-5] (172 aa)
Score = 107, Expect = 1.7e-03, Identities = 41/152 (26%), Positives = 72/152 (47%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSG-TKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGD--EGKKWLFTAGAASTVLAELGVLGNKKITTAPGF---EEKLGKNYSDNNIVVDKN-FVSFKSP 161
           +IA++ S E  D +   P D + +AG  V T+  +  K++  + G   +   + I++V   +F+AL +PGG     L  D      N+ V F  D     K +F       +L    V+  +K+T         +  G  + D  +VVDK+  V+ ++P
  S:     4 KIAVLISDEFEDSEFTSPADEFRKAGHEVITIEKQAGKTVKGKKGEASVAIDKSIDEVTPAEFDALLLPGGHSPDYLRGD------NRFVTFTRDFVNSGKPVFAICHGPQLLISADVIRGRKLTAVKPIIIDVKNAGAEFYDQEVVVDKDQLVTSRTP 156
>gi|156937189|ref|YP_001434985.1| PfpI family intracellular peptidase [Ignicoccus hospitalis KIN4/I] >gi|156566173|gb|ABU81578.1| intracellular protease, PfpI family [Ignicoccus hospitalis KIN4/I] (176 aa)
Score = 107, Expect = 1.8e-03, Identities = 37/152 (24%), Positives = 75/152 (49%)
  Q:     9 IRIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITC--SEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSDNNIVVDKNFVSFKS 160
           +R  I+     ++ ++V+PY ++   G  V+  S +  + +  + G K+    ++   ++  D+++A+ I GG    ++  D N   + + V+   ++G K + +      VL   GV   KK+T + G  + L   G    D  +V+D N VS K+
  S:     1 MRAVILVGPMVDEYEVVVPYSLFKAYGFEVDIASFKAGEEVVGKRGVKLELVPNKSFSELKADEYDAVIIAGGYAPDKVRRDEN---VKRFVREMYEKG-KLVLSICHGGWVLISAGVAKGKKVTGSKGIWDDLRNAGAEPVDEPLVIDGNVVSVKT 153
>gi|150401159|ref|YP_001324925.1| PfpI family intracellular peptidase [Methanococcus aeolicus Nankai-3] >gi|150013862|gb|ABR56313.1| intracellular protease, PfpI family [Methanococcus aeolicus Nankai-3] (175 aa)
Score = 107, Expect = 1.8e-03, Identities = 50/155 (32%), Positives = 79/155 (50%)
  Q:    21 DMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAP---GFEEKL--GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKL 175
           D ++  P  I+ +  I  + VS  K +   +  G KIT +  I++++   +  + I GG G +  L + N  +IN +  F   E  K +     +  VLA   +L NK+ T  P     EE L  G  Y D  +VVDKN ++ K+P +A +F + IVE L
  S:    14 DEELFEPLHIFNKNNIDFDVVSTTKGEHTGMLGG-KITTTTNIDEIDEKDYCGIVIVGGSGSKEYLWNNNN-LINLVKSFY--ENNKIVSAICISPAVLAISNILKNKRATVFPSNDAIEELLKGGAIYIDEGVVVDKNIITAKNPDYATDFGIKIVELL 169
>gi|28899138|ref|NP_798743.1| 4-methyl-5(B-hydroxyethyl)-thiazol monophosphate biosynthesis enzyme [Vibrio parahaemolyticus RIMD 2210633] >gi|28807362|dbj|BAC60627.1| 4-methyl-5(B-hydroxyethyl)-thiazol monophosphate biosynthesis enzyme [Vibrio parahaemolyticus RIMD 2210633] (199 aa)
Score = 106, Expect = 1.9e-03, Identities = 41/161 (25%), Positives = 79/161 (49%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNL--DKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYSDNNIV---VDKNFVSFKSPFHAFEFALLIVEKLLNKQ 179
           + +M+ V   D+  RAG  V   S     ++ +++   +T + + + V++  D+F+A+ + GG G     T R+  V+ +I+K    E K       A + VL    +  +  +T  P F+  + ++      V   V+ N ++ + P  A EFA+ I+ KL  K+
  S:    13 TEEMEAVTVIDLMVRAGYDVTVASAAFDGALTMKASRGVTLTADCKLVDIADDEFDAIVLSGGVGGAE--TFRDSTVMIEILKQHMYESKLVAAICAAPALVLQHHNLYPDALMTCHPSFQSHIPEDKWRAKRVTMDVNHNLLTSQGPGTALEFAMEIIIKLSGKE 176
>gi|146340883|ref|YP_001205931.1| putative intracellular proteinase [Bradyrhizobium sp. ORS278] >gi|146193689|emb|CAL77706.1| putative intracellular proteinase [Bradyrhizobium sp. ORS278] (186 aa)
Score = 106, Expect = 1.9e-03, Identities = 42/166 (25%), Positives = 81/166 (48%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVS---NEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGD--EGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKL 175
           RIAI+ +      ++ +P D  ++AG  VE VS    E K       G  +   + +++     ++A+ +PGG+    LL     R+  K ++F  D    KK +     A  +L E G+   +K+T+    +  +   G  + D  +VVD+  ++ ++P     F+  I+E++
  S:     7 RIAILATNGFEQSELEVPRDRLSQAGATVEIVSLAPGEIKGWDQKDWGRPVKVDKTLDQAQASDYDAIVLPGGQINPDLL-----RLEPKALQFIKDIFNAKKIVAAVCHAPWLLIETGIAKGRKMTSYKSIKTDVANAGAQWQDAEVVVDQGVITSRNPGDLEAFSAKIIEEV 175
>gi|167045806|gb|ABZ10474.1| DJ-1 protein (predicted) [Callithrix jacchus] (173 aa)
Score = 106, Expect = 1.9e-03, Identities = 45/159 (28%), Positives = 77/159 (48%)
  Q:    22 MDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLD-KFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTA---GAASTVLAELGVLGNKKITTAPGFEEKL--GKNY--SDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQI 180
           M+ +I  D+  RAG+ V       K  +       I     +E    +  +  L +PGG G  + L++     + +I+K    E +K L  A   G  + +  E+G     K+TT P  ++K+  G +Y  S+N +  D   ++ + P  +FEF L IVE L  K++
  S:     1 METLILVDVMRRAGVKVTVAGLAGKDPVQCSRDVMICPDASLEDAKKEGPYEMLVLPGGNGGAQNLSE--SAAVKEILK--EQENRKGLMAAICAGPTALLAHEIGF--GSKVTTHPLAKDKMMNGGHYTHSENRVEKDGLILTSRGPGTSFEFVLAIVEALNGKEV 161
>gi|168158822|ref|ZP_02594055.1| ThiJ/PfpI family protein [Bacillus cereus H3081.97] (190 aa)
Score = 106, Expect = 1.9e-03, Identities = 45/172 (26%), Positives = 85/172 (49%)
  Q:     9 IRIAIMCSIESNDMDIVIPYDIWTRAGII-------VETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQI 180
           ++IAI+C     D+D+ +P+D+  R  ++       V+ +  E  +S    SG +I  +  I  +     +A+    GKG + L   +N++ IN I     D  ++ + +  + S +L    +L  KK TT P    +L   G +  + + V + N  +    F A E +  I+  LLN+++
  S:     1 MKIAIVCFDNFTDIDVFLPWDLLNRVRLVGGISDWDVQLLGTE--QSHISMSGLRIPMTGSISDIPFA--DAVIFASGKGVKDLY--KNQQYINSI---HVDPQRQLIGSMCSGSLLLGAKKLLTGKKATTYPSAVAQLKEFGVDVIEKSFVNEGNISTAAGCFAAQELSAWIIRTLLNEEM 173
>gi|23097478|ref|NP_690944.1| general stress protein 18 [Oceanobacillus iheyensis HTE831] >gi|22775701|dbj|BAC11979.1| general stress protein 18 (GSP18) [Oceanobacillus iheyensis HTE831] (172 aa)
Score = 106, Expect = 1.9e-03, Identities = 49/152 (32%), Positives = 71/152 (46%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSG-TKITCSEEIEKVNLDKFNALYIPGG------KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYSDNNIVVDKN-FVSFKSP 161
           RIA + +    D++   P   +  AG  V T+  EK K+I  +S  T +T  E I+ VN + F+AL+IPGG      +G  R +T     +  K    A   G + L TA +    L   G  G K I       E  G    D  +VV +N  V+ + P
  S:     4 RIATVITDMFEDVEFTDPVQSFKEAGHEVITIEKEKGKTIKGKSNDTSVTIDESIDNVNPENFDALFIPGGFSPDILRGDDRFVTFAKHFMDEKKPVMAICHGPQLLITARS----LEGRGATGYKSIQVD---MEYAGAKVKDEEVVVCQNQLVTSRQP 156
>gi|62180507|ref|YP_216924.1| hypothetical protein SC1937 [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|62128140|gb|AAX65843.1| putative intracellular protease/amidase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] (185 aa)
Score = 106, Expect = 2.0e-03, Identities = 40/167 (23%), Positives = 78/167 (46%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKN-YSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLL 176
           ++A++ +    +++ ++  DI  R  I VET++  + +++       +     + +     F+A+ +PGG +G   L    N  VI  + +     GK       AA+ VL   G+L  ++   +    + + +  Y D  +V D N +S K   H F+FAL +  +LL
  S:     3 KVAVLLAPGFEEVEAIVTLDILRRLHIDVETLACAESRAVVSYHDIPMVADSTLSERQQALFDAVVLPGGPQGSANLAA--NPAVIAFVARHDA-AGKLICPICSAAARVLGAHGLLKGRRYVCSGDLWKAVPEGVYVDAPVVEDGNLISGKGLGHVFDFALTLSARLL 168
>gi|120555856|ref|YP_960207.1| PfpI family intracellular peptidase [Marinobacter aquaeolei VT8] >gi|120325705|gb|ABM20020.1| intracellular protease, PfpI family [Marinobacter aquaeolei VT8] (195 aa)
Score = 106, Expect = 2.1e-03, Identities = 46/151 (30%), Positives = 79/151 (52%)
  Q:     6 VSNIRIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQS---------------GTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAP--GFEEKL-GKNYSDNNIVVDKNFV 156
           +SN ++ ++    + D + ++P+   T  G  V  V  EKK    +++               G     + + +KV +D +  L IPGG+G + L    NERVI +IV+   + GK  + +    + +LA  GVL  ++ +  P  G + K+ G  Y D  I VD+  V
  S:     3 MSNKKLLLLAGDFTEDYETMVPFQALTMLGYEVHAVCPEKKSGDSVKTAIHDFEGDQTYTEKPGHNFALNYDFDKVQVDDYAGLVIPGGRGPEYLRL--NERVI-EIVQAFNNAGKP-IASVCHGAQILAAAGVLEGRECSAYPACGPDVKMAGGRYMD--IPVDQAHV 165
>gi|56963813|ref|YP_175544.1| ThiJ/PfpI family intracellular protease [Bacillus clausii KSM-K16] >gi|56910056|dbj|BAD64583.1| ThiJ/PfpI family intracellular protease [Bacillus clausii KSM-K16] (174 aa)
Score = 106, Expect = 2.2e-03, Identities = 38/152 (25%), Positives = 66/152 (43%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFE---EKLGKNYSDNNIVVDKNFVSFKSP 161
           R+      E  D+++  P       G  V     E  K+   + G   T +    + + D+F+ + +PGG    +L   R    ++ I +   D+ KK +     A  VL   G+L  K++T+ PG     E  G  + D  +VVD + +S + P
  S:     7 RVLAAVDAEFEDLELWYPVIRLQEEGADVVFAGAEANKTYIGKYGVPATSTIAFNEASTDEFDGVLVPGGWAPDKL--RRYPEFLSFIKEM--DKQKKPIGQICHAGWVLISAGILNGKRVTSTPGIRDDMENAGAIWHDEPVVVDGHVISSRRP 157
>gi|161506162|ref|YP_001573274.1| hypothetical protein SARI_04353 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] >gi|160867509|gb|ABX24132.1| hypothetical protein SARI_04353 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] (172 aa)
Score = 106, Expect = 2.3e-03, Identities = 41/152 (26%), Positives = 72/152 (47%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSG-TKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGD--EGKKWLFTAGAASTVLAELGVLGNKKITTAPGF---EEKLGKNYSDNNIVVDKN-FVSFKSP 161
           +IA++ + E  D +   P   + +AG  V T+  E  K++  + G   +T  + I+ V  D+F+AL +PGG     L  D      ++ V F  D     K +F       +L    V+  +K+T         +  G  + D  +VVDK+  V+ ++P
  S:     4 KIAVLITDEFEDSEFTSPAAEFRQAGHEVITIEKEAGKTVKGKKGEASVTIDKAIDDVRPDEFDALLLPGGHSPDHLRGD------SRFVDFTRDFVNSGKPVFAICHGPQLLISADVIRGRKLTAVKPIIIDVKNAGAEFYDQEVVVDKDQLVTSRTP 156
>gi|168239166|ref|ZP_02664224.1| putative intracellular protease/amidase [Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480] >gi|194737043|ref|YP_002114966.1| ThiJ/PfpI domain protein [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|194712545|gb|ACF91766.1| ThiJ/PfpI domain protein [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] (185 aa)
Score = 106, Expect = 2.3e-03, Identities = 40/171 (23%), Positives = 78/171 (45%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKN-YSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQI 180
           ++A++ +    + + ++  DI  R  I VET++  + +++       +     + +     F+A+ +PGG +G   L    N  VI  + +     GK       AA+ VL   G+L  ++   +    + + +  Y D  +V D N +S K   H F+FAL +  +LL   +
  S:     3 KVAVLLAPGFEEAEAIVTLDILRRLHIDVETLACAESRAVVSYHDIPMVADSTLSERQQALFDAVVLPGGPQGSANLAA--NPAVIAFVARHDA-AGKLICPICSAAARVLGAHGLLKGRRYVCSGDLWKAVPEGVYVDAPVVEDGNLISGKGLGHVFDFALTLSARLLGDDV 172
>gi|72390093|ref|XP_845341.1| hypothetical protein, conserved [Trypanosoma brucei TREU927] >gi|62360439|gb|AAX80853.1| hypothetical protein, conserved [Trypanosoma brucei] >gi|70801876|gb|AAZ11782.1| hypothetical protein, conserved [Trypanosoma brucei] (197 aa)
Score = 105, Expect = 2.5e-03, Identities = 49/171 (28%), Positives = 85/171 (49%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLA--ELGVLGN-KKITTAPGFEEKLGKN--YSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           + D+++    DI  RA   V   S  +  ++ L  G  +     I+  + + ++ +++PGG  G   L      + I + V+ AG    KW + A  AS V++   +G+L + K IT  PG ++K+  +  +S + +V     ++   P  A  FAL IV  L  K IA  +A D+L
  S:    12 TEDIELSCITDILRRANFQVTVSSVMESTTVRLCRGLVLIADSLIKDESGEGYDGVFLPGGLPGADYLGKSVALKKILEDVRAAG----KW-YGAICASPVVSFEPMGLLRDVKTITCYPGLKDKVPSHVQWSADPVVRCGKCLTSMGPGTAIAFALSIVTVLATKDIAEKLAKDLL 183
>gi|194681499|emb|CAR40366.1| DJ-1/PfpI family protein [Proteus mirabilis HI4320] (205 aa)
Score = 105, Expect = 2.6e-03, Identities = 43/171 (25%), Positives = 83/171 (48%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVETVSNEKKKS---IFLQSGTKITCSEEIEKVNLDKFNALYIPGGK-GCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLG-KNYSDNNIVVDK--NFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           S + ++V   D+  RAGI V   S E       I    G K+     + +V    ++A+ +PGG  G + L   R+  ++ + V+    E +       A + +L    +     +T  PG ++K+  K + D  +  D+  N ++ ++P    +FAL I+E+L  K +A ++A  ++
  S:    13 SEETEVVTTADLLVRAGIKVILASAEDDVDDLVITCSRGIKLIADVPLVRVVDHHYDAIILPGGLIGAETL---RDSPLVVEKVRRMHSENRLVAAICAAPAIILESHNLFPIGNMTGFPGLKDKIEPKKWVDYRVYFDERVNLITSQAPATTIDFALKIIERLKGKAVAADVAKQLV 187
>gi|54297905|ref|YP_124274.1| hypothetical protein lpp1960 [Legionella pneumophila str. Paris] >gi|53751690|emb|CAH13112.1| hypothetical protein [Legionella pneumophila str. Paris] (198 aa)
Score = 105, Expect = 2.6e-03, Identities = 40/120 (33%), Positives = 61/120 (50%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQS-----------------GTKITCSEEIEKVNLDKFNALYIPGGKGC--QRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEE 138
           + D+++  PY        +++TVS  K K  F+Q+                 G     + +  K+ L  ++AL IPGG+    QRL    N+ ++  I  F   E  K +        +LAE G+L NKK TT  GF E
  S:    19 NEDLEVYFPYQAMLMNNYLIDTVSPGKNKGDFIQTAVHDLDKPHLQSYTEKLGHLFPITADFSKITLKDYDALIIPGGRAAEYQRL----NKDILAIIRHF--HETNKPIACICHGIQILAEAGILENKKCTTV-GFCE 150
>gi|196234444|ref|ZP_03133270.1| intracellular protease, PfpI family [Chthoniobacter flavus Ellin428] >gi|196221500|gb|EDY16044.1| intracellular protease, PfpI family [Chthoniobacter flavus Ellin428] (188 aa)
Score = 105, Expect = 2.6e-03, Identities = 43/175 (24%), Positives = 75/175 (42%)
  Q:     1 MIKHKVSNIRIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQ---SGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGD--EGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKL 175
           M   K+    +AI+ +      ++  P      AG  V  VS +  K   +     G +     +++K + D F+AL IPGG     L+     R     V+FA    E  K +        VL E G++  +++T+ P  +  +   G  + D  +VVD   V+ + P     F   ++E+ 
  S:     1 MSTQKLEQKHVAILAADGFEQAELEEPMHALKDAGAQVSIVSPKAGKIQGMHHADKGDQFKVDLQLDKADCDDFDALLIPGG-----LMNPDELRSTPAAVEFAKSFAEAGKPIAAICHGPWVLIEAGLVKGRRLTSWPAIQSDIKNAGGKWVDEEVVVDNGLVTSRKPDDIPAFNAKVIEEF 178
>gi|91212571|ref|YP_542557.1| hypothetical protein UTI89_C3580 [Escherichia coli UTI89] >gi|91074145|gb|ABE09026.1| conserved hypothetical protein [Escherichia coli UTI89] (186 aa)
Score = 105, Expect = 2.6e-03, Identities = 40/152 (26%), Positives = 71/152 (46%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSG-TKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGD---EGKKWLFTAGAASTVLAELGVLGNKKITTAPGF--EEKLGKNYSDNNIVVDKN-FVSFKSP 161
           +IA++ + E  D +   P D + +AG  V T+  +  K++  + G   +   + I++V   +F+AL +PGG     L  D      N+ V F  D    GK           +++   +LG K     P     +  G  + D  +VVDK+  V+ ++P
  S:    18 KIAVLITDEFEDSEFTSPADEFRKAGHEVITIEKQAGKTVKGKKGEASVAIDKSIDEVTPAEFDALLLPGGHSPDYLRGD------NRFVTFTRDFVNSGKPVFAICHGPQLLISADVILGRKLTAVKPIVIDVKNAGAEFYDQEVVVDKDQLVTSRTP 170
>gi|153003685|ref|YP_001378010.1| PfpI family intracellular peptidase [Anaeromyxobacter sp. Fw109-5] >gi|152027258|gb|ABS25026.1| intracellular protease, PfpI family [Anaeromyxobacter sp. Fw109-5] (189 aa)
Score = 105, Expect = 2.7e-03, Identities = 45/166 (27%), Positives = 73/166 (43%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSI-FLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAAST-------VLAELGVLGNKKITTAPGFEEKL---GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKL 175
           RIA +      D ++ +PYD    AG  V  V  E+ K I   Q   K+T     + V   + +AL IPGG     L T  +      +V+   D     +F AG           +L E   +  + +T+ P  +  L   G  + D  +V D N ++ ++P     F+  I+ +L
  S:     3 RIAFIVDDMFEDSELRVPYDRLRDAGHEVIVVGLEQGKRIEGKQKKEKLTVERAAKDVRAQELDALVIPGGYSPDHLRTSID------MVRLTRD-----MFVAGKPVAAVCHGPWMLVEADAIDGRTVTSWPSLKTDLINAGARWVDREVVEDGNLITSRNPGDLAAFSSAILRQL 168
>gi|188586773|ref|YP_001918318.1| ThiJ/PfpI domain protein [Natranaerobius thermophilus JW/NM-WN-LF] >gi|179351460|gb|ACB85730.1| ThiJ/PfpI domain protein [Natranaerobius thermophilus JW/NM-WN-LF] (202 aa)
Score = 105, Expect = 2.8e-03, Identities = 44/166 (26%), Positives = 76/166 (45%)
  Q:    28 YDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYSDNNIVVDK------NFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILYTKK 193
           YD   R    V+T+S E  + +  + G K+      +     +++ L IPGG G +  +  +N ++++ I K   +EG     +    S +LAE G+L  KK TT      KL  +Y +  +V D+      NF++          A  +VE+L   +I+      + Y  K
  S:    37 YDSEDRTPFQVDTIS-ETGEQVECRHGLKVQPDRSFQTSG--QYDILVIPGGLGVRWQV--KNSKLLDWIRK--QNEGTMLTTSVCTGSILLAEAGLLKGKKATTHHENLTKLASSYPEVTVVRDQKVVDEGNFITSAGISAGINMAFQVVERLFGAEISQQTQEFMEYNLK 201
>gi|71894041|ref|YP_278149.1| hypothetical protein MS53_0016 [Mycoplasma synoviae 53] >gi|71850829|gb|AAZ43438.1| conserved hypothetical protein [Mycoplasma synoviae 53] (181 aa)
Score = 105, Expect = 2.8e-03, Identities = 31/114 (27%), Positives = 55/114 (48%)
  Q:    66 VNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGF---EEKLGKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQ 179
           VNL  + A+++PGGK C       N+ +I KI  F   +  KW+F    A   L    ++  +  T+ P     E +   NY +  +VV +  ++ KS +++   A  I+  L  ++
  S:    58 VNLKDYQAVFVPGGKACFSF--KDNKEIIKKIRHFFDKD--KWVFAICDAPNALRYNNLIKEQNYTSFPSAWSKELRSNSNYQNKGVVVFEKLITAKSSYYSQHLAFEIIRTLFGEK 170
>gi|54294875|ref|YP_127290.1| hypothetical protein lpl1954 [Legionella pneumophila str. Lens] >gi|53754707|emb|CAH16194.1| hypothetical protein [Legionella pneumophila str. Lens] (194 aa)
Score = 105, Expect = 3.1e-03, Identities = 46/139 (33%), Positives = 71/139 (51%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQS-----------------GTKITCSEEIEKVNLDKFNALYIPGGKGC--QRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEE----KLGKNYSD---NNIVVDKNFVS 157
           + D+++  PY        +++TVS  K K  F+Q+                 G     + +  K+ L  + AL IPGG+    QRL  D     I  I++   D  K  +        +LAE G+L +KK TT  GF E    K G ++ D   + +VVD   V+
  S:    15 NEDLEVYFPYQAMLMNNYLIDTVSPGKNKGDFIQTAVHDLDKPHLQSYTEKLGHLFPITADFSKITLKDYFALIIPGGRAAEYQRLNKD-----ILAIIRHFHDTNKP-IACICHGIQILAEAGILEDKKCTTV-GFCEPDVRKAGGHFIDTGMDGVVVDGKLVT 172
>gi|169189559|ref|ZP_02849558.1| intracellular protease, PfpI family [Paenibacillus sp. JDR-2] >gi|169003749|gb|EDS50614.1| intracellular protease, PfpI family [Paenibacillus sp. JDR-2] (176 aa)
Score = 104, Expect = 3.2e-03, Identities = 42/163 (25%), Positives = 69/163 (42%)
  Q:    13 IMCSIESNDMDIVIPYDIWT--RAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFE---EKLGKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKL 175
           ++C +E    D+ + Y ++    AG  V     EK K    + G         ++VN      L +PGG    +L   R  +V+  + +   D   K +     A  VL    +L  +K+T+ PG     E  G  + D  +VVD N +S + P     +A   V+ L
  S:     9 VICLLEDEFEDLELWYPVYRVREAGATVLYAGPEKGKKHIGKYGVPAVADLSFDEVNSADIAGLLVPGGWAPDKL--RRYPKVLQLVQEL--DAAGKPIGQICHAGWVLISAKILQGRKVTSTPGIRDDMENAGAEWFDEAVVVDGNLISARRPPDLPPYAKAFVDAL 172
>gi|167552426|ref|ZP_02346179.1| putative intracellular protease/amidase [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] (185 aa)
Score = 104, Expect = 3.2e-03, Identities = 40/167 (23%), Positives = 77/167 (46%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKN-YSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLL 176
           ++A++ +    + + ++  DI  R  I VET++  + +++       +     + +     F+A+ +PGG +G   L    N  VI  + +     GK       AA+ VL   G+L  ++   +    + + +  Y D  +V D N +S K   H F+FAL +  +LL
  S:     3 KVAVLLAPGFEEAEAIVTLDILRRLHIDVETLACAESRAVVSYHDIPMVADSTLSERQQALFDAVVLPGGPQGSANLAA--NPAVIAFVARHDA-AGKLICPICSAAARVLGAHGLLKGRRYVCSGDLWKAVPEGVYVDAPVVEDGNLISGKGLGHVFDFALTLSARLL 168
>gi|16765272|ref|NP_460887.1| putative intracellular protease/amidase [Salmonella typhimurium LT2] >gi|56413150|ref|YP_150225.1| putative intracellular protease/amidase [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|167560471|ref|ZP_02353474.1| putative intracellular protease/amidase [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853] >gi|167994240|ref|ZP_02575332.1| putative intracellular protease/amidase [Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701] >gi|168234000|ref|ZP_02659058.1| putative intracellular protease/amidase [Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191] >gi|168259787|ref|ZP_02681760.1| putative intracellular protease/amidase [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] >gi|194471204|ref|ZP_03077188.1| ThiJ/PfpI domain protein [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|16420468|gb|AAL20846.1| putative intracellular protease/amidase [Salmonella typhimurium LT2] >gi|56127407|gb|AAV76913.1| putative intracellular protease/amidase [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|194457568|gb|EDX46407.1| ThiJ/PfpI domain protein [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] (185 aa)
Score = 104, Expect = 3.2e-03, Identities = 40/167 (23%), Positives = 77/167 (46%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKN-YSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLL 176
           ++A++ +    + + ++  DI  R  I VET++  + +++       +     + +     F+A+ +PGG +G   L    N  VI  + +     GK       AA+ VL   G+L  ++   +    + + +  Y D  +V D N +S K   H F+FAL +  +LL
  S:     3 KVAVLLAPGFEEAEAIVTLDILRRLHIDVETLACAESRAVVSYHDIPMVADSTLSERQQALFDAVVLPGGPQGSANLAA--NPAVIAFVARHDA-AGKLICPICSAAARVLGAHGLLKGRRYVCSGDLWKAVPEGVYVDAPVVEDGNLISGKGLGHVFDFALTLSARLL 168
>gi|16760879|ref|NP_456496.1| hypothetical protein STY2140 [Salmonella enterica subsp. enterica serovar Typhi str. CT18] >gi|29141429|ref|NP_804771.1| hypothetical protein t0946 [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] >gi|25304393|pir||AG0747 conserved hypothetical protein STY2140 [imported] - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) >gi|16503176|emb|CAD05682.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Typhi] >gi|29137056|gb|AAO68620.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Typhi Ty2] (185 aa)
Score = 104, Expect = 3.2e-03, Identities = 40/167 (23%), Positives = 77/167 (46%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKN-YSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLL 176
           ++A++ +    + + ++  DI  R  I VET++  + +++       +     + +     F+A+ +PGG +G   L    N  VI  + +     GK       AA+ VL   G+L  ++   +    + + +  Y D  +V D N +S K   H F+FAL +  +LL
  S:     3 KVAVLLAPGFEEAEAIVTLDILRRLHIDVETLACAESRAVVSYHDIPMVADSTLSERQQALFDAVVLPGGPQGSANLAA--NPAVIAFVARHDA-AGKLICPICSAAARVLGAHGLLKGRRYVCSGDLWKAVPEGVYVDAPVVEDGNLISGKGLGHVFDFALTLSARLL 168
>gi|91223042|ref|ZP_01258308.1| putative transcriptional regulator [Vibrio alginolyticus 12G01] >gi|91191855|gb|EAS78118.1| putative transcriptional regulator [Vibrio alginolyticus 12G01] (228 aa)
Score = 104, Expect = 3.2e-03, Identities = 38/155 (24%), Positives = 73/155 (47%)
  Q:    38 VETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYS------DNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILYTK 192
           V T+S   +K+I  + G KI     I   +L + + L +        L+ +++     K    A D    W+ +  + + +LAE G+L  KK TT  G E    ++Y       D N V+D   ++      +++ AL ++  + ++  A  +A+ I Y++
  S:    68 VLTISVSDQKTITTEEGLKIGVDAWIG--DLPELDVLVLTSSYDMDALIENKDLIHFIKTTSKAAD----WMASNCSGAYLLAEAGLLNGKKATTWAGGENGFQRDYPAVKVQVDQNFVIDDGVITSNGSLVSYQAALKLLHLMTSESKAQEVADAIQYSR 222
>gi|73662227|ref|YP_301008.1| putative intracellular protease amidase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|82582372|sp|Q49YS0|Y918_STAS1 Uncharacterized protein SSP0918 >gi|72494742|dbj|BAE18063.1| putative intracellular protease amidase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (172 aa)
Score = 104, Expect = 3.3e-03, Identities = 39/166 (23%), Positives = 70/166 (42%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKL 175
           ++AI+ + E  D+++  P +    AG     + ++    +  + GTK+     I     + F+ L IPGG     L  D   R       F  ++   +    G    +L +   L  + +T      + L   G    D ++VVDKN V+ ++P    +F   IV +L
  S:     4 KVAIILTNEFEDIELTSPKEAIEEAGHETVVIGDQANSEVVGKHGTKVAVDVSIADAKPEDFDGLLIPGGFSPDHLRGDAEGRYGTFAKYFTKNDVPAFAICHG--PQILIDTDDLNGRTLTAVLNVRKDLANAGAQVVDESVVVDKNIVTSRTPDDLDDFNREIVNQL 170
>gi|158289535|ref|XP_311236.4| AGAP000705-PA [Anopheles gambiae str. PEST] >gi|157018563|gb|EAA06896.4| AGAP000705-PA [Anopheles gambiae str. PEST] (224 aa)
Score = 104, Expect = 3.3e-03, Identities = 48/172 (27%), Positives = 85/172 (49%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVETVSNEK------KKSIFLQSGTKITCSEEIEKVNLDKF-NALYIPGG-KGCQRL--------LTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVL-GNKKITTAPGFEEKL---GKNYSD------NNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILY 190
           S +M++VI  D+  R         N +       + + +++ T +    E +    D   +A+ +PGG +G + +        L +R  RV             K +    AA TVLA  G L   +++T+ P F EKL   G  + +        +V D+N ++   P   F+F L I   L+ +++A  +A  +LY
  S:    38 SEEMELVITVDVLRRCNAEGTAAGNTEPLVACCSRGVNVKADTTLQAYVEQQAATDDGLPDAIILPGGLEGAKAMAQAPAVGALLERQARV------------GKLVAAICAAPTVLAAHGKLFAGRRLTSYPSFREKLQADGYRWEEPAAGGLGRVVRDENLITSLGPATTFDFGLAIGAALVGQEVADKVAAGLLY 223
>gi|16762036|ref|NP_457653.1| hypothetical protein STY3452 [Salmonella enterica subsp. enterica serovar Typhi str. CT18] >gi|16766567|ref|NP_462182.1| putative intracellular proteinase [Salmonella typhimurium LT2] >gi|29143525|ref|NP_806867.1| hypothetical protein t3189 [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] >gi|56415204|ref|YP_152279.1| hypothetical protein SPA3138 [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|62181780|ref|YP_218197.1| hypothetical protein SC3210 [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|161616275|ref|YP_001590240.1| hypothetical protein SPAB_04080 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|167544125|ref|ZP_02339697.1| hypothetical protein Sentent_12658 [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23] >gi|167552081|ref|ZP_02345834.1| hypothetical protein Sentente_16442 [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] >gi|167558136|ref|ZP_02351146.1| hypothetical protein Sententeri_15017 [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853] >gi|167990166|ref|ZP_02571266.1| hypothetical protein Sententer_01000002_0100001900 [Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701] >gi|168221400|ref|ZP_02646632.1| hypothetical protein Senterenterica_13476 [Salmonella enterica subsp. enterica serovar Agona str. SL483] >gi|168227783|ref|ZP_02653014.1| hypothetical protein Sententeric_18562 [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433] >gi|168231878|ref|ZP_02656936.1| hypothetical protein Sententerica_12910 [Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191] >gi|168237972|ref|ZP_02663030.1| hypothetical protein Senteenterica_17418 [Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480] >gi|168243105|ref|ZP_02668037.1| hypothetical protein Senterienterica_15792 [Salmonella enterica subsp. enterica serovar Heidelberg str. SL486] >gi|168262718|ref|ZP_02684691.1| hypothetical protein Salmentericaenterica_16665 [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] >gi|168463506|ref|ZP_02697423.1| intracellular peptidase, PfpI family [Salmonella enterica subsp. enterica serovar Newport str. SL317] >gi|168477370|ref|ZP_02706393.1| hypothetical protein Salmoentericaenterica_22174 [Salmonella enterica subsp. enterica serovar Virchow str. SL491] >gi|168819660|ref|ZP_02831660.1| hypothetical protein Salentericaenterica_09753 [Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537] >gi|194442389|ref|YP_002042529.1| intracellular peptidase, PfpI family [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194448703|ref|YP_002047301.1| intracellular peptidase, PfpI family [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194472814|ref|ZP_03078798.1| intracellular peptidase, PfpI family [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|194736340|ref|YP_002116221.1| intracellular peptidase, PfpI family [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|25322928|pir||AI0899 conserved hypothetical protein STY3452 [imported] - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) >gi|16421827|gb|AAL22141.1| putative intracellular proteinase [Salmonella typhimurium LT2] >gi|16504339|emb|CAD07791.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Typhi] >gi|29139159|gb|AAO70727.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Typhi Ty2] >gi|56129461|gb|AAV78967.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|62129413|gb|AAX67116.1| putative intracellular proteinase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|161365639|gb|ABX69407.1| hypothetical protein SPAB_04080 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|194401052|gb|ACF61274.1| intracellular peptidase, PfpI family [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194407007|gb|ACF67226.1| intracellular peptidase, PfpI family [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194459178|gb|EDX48017.1| intracellular peptidase, PfpI family [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|194711842|gb|ACF91063.1| intracellular peptidase, PfpI family [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|195633257|gb|EDX51671.1| intracellular peptidase, PfpI family [Salmonella enterica subsp. enterica serovar Newport str. SL317] (172 aa)
Score = 104, Expect = 3.3e-03, Identities = 41/152 (26%), Positives = 72/152 (47%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSG-TKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGD--EGKKWLFTAGAASTVLAELGVLGNKKITTAPGF---EEKLGKNYSDNNIVVDKN-FVSFKSP 161
           +IA++ + E  D +   P   + +AG  V T+  E  K++  + G   +T  + I+ V  D+F+AL +PGG     L  D      ++ V F  D     K +F       +L    V+  +K+T         +  G  + D  +VVDK+  V+ ++P
  S:     4 KIAVLITDEFEDSEFTSPAAEFRQAGHEVITIEKEAGKTVKGKKGEASVTIDKAIDDVRPDEFDALLLPGGHSPDYLRGD------SRFVDFTRDFVNSGKPVFAICHGPQLLISADVIRGRKLTAVKPIIIDVKNAGAEFYDQEVVVDKDQLVTSRTP 156
>gi|190571776|ref|YP_001966455.1| ORF22 [Lactococcus lactis] >gi|108736175|gb|ABG00304.1| ORF22 [Lactococcus lactis] (167 aa)
Score = 104, Expect = 3.4e-03, Identities = 42/160 (26%), Positives = 81/160 (50%)
  Q:    11 IAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTV------LAELGVLGNKKITTAPGFEEKL---GKNYSDNNIVVDKNFVSFKSP--FHAFEFALL 170
           +A++ +    D++   P +    AG  V T+S EK  ++  + GT+I   + I++V+   F+AL+IPGG    +L  D+      + V+F     K +L T    +++      + + G++  + +T     +  L   G    D ++V+D N ++ + P    AF  A L
  S:     5 VAVLVTNLVEDVEYTEPVEALKSAGHEVTTISFEKG-TVEGKHGTQINVDKSIDEVSPQDFDALFIPGGFSPDQLRADQ------RFVEFT----KFFLATNKLTASICHGPQLMIQTGLVHGRTMTAYLTVQPDLYYAGARIEDKDVVIDGNLITSREPKDIPAFNDAFL 164
>gi|124485740|ref|YP_001030356.1| hypothetical protein Mlab_0918 [Methanocorpusculum labreanum Z] >gi|124363281|gb|ABN07089.1| ThiJ/PfpI domain protein [Methanocorpusculum labreanum Z] (183 aa)
Score = 104, Expect = 3.5e-03, Identities = 48/152 (31%), Positives = 71/152 (46%)
  Q:    21 DMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGA---ASTVLAELGVLGNKKIT--TAPGFEEKLGKNYSD---NNIVVDKNFVSFKSPFHAFEFALLIV 172
           DM   +P  I    G+   T S     + +   G  +       +VN   F+ + I GG GCQ  L  RNE++I+ I    G  GK     A A   A  +LAE G+L  KK T    P     L  + ++   + +V D + V+ ++PF A EF   I+
  S:    27 DMGYTVPKRILEEQGVECLTAST-IHGTCYGMHGEIVESDFSFSEVNPADFDGIVIDGGIGCQDELW-RNEKLID-ITNKIGVSGK----LAAAICLAPVILAEAGLLAGKKATCLQTPATLRVLTLDKAEIVQDKVVADGSIVTAQTPFDAEEFGRAIL 179
>gi|153809136|ref|ZP_01961804.1| hypothetical protein BACCAC_03446 [Bacteroides caccae ATCC 43185] >gi|149128469|gb|EDM19688.1| hypothetical protein BACCAC_03446 [Bacteroides caccae ATCC 43185] (183 aa)
Score = 104, Expect = 3.5e-03, Identities = 53/151 (35%), Positives = 74/151 (49%)
  Q:    29 DIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNA--LYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL-GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQ 179
           D   R G+ VE VS    + +       + C  +I   N D F+A  L +PGG      L D++E +   I+ FA     K +    AA  VL +LG+L  KK T  P FE+ L G    D  +V D N ++   P  A EFAL IV+ L+ K+
  S:    22 DTLRRGGLNVEIVSVTPDEIVVGAHDVSVLC--DINFDNCDFFDAELLLLPGGMPGAATL-DKHEGLRRLILDFAAK--NKPIAAICAAPMVLGKLGLLKGKKATCYPSFEQYLEGAECIDAPVVRDGNIITGMGPGAAMEFALTIVDLLVGKE 170
>gi|125550179|gb|EAY96001.1| hypothetical protein OsI_017234 [Oryza sativa (indica cultivar-group)] (423 aa)
Score = 104, Expect = 3.6e-03, Identities = 35/122 (28%), Positives = 63/122 (51%)
  Q:    54 GTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSD----NNIVVDKNFVSFKSPFHAFEFALLIVEKL 175
           G     +   ++VN+++++ L IPGG+  + L  D  E+V++ + KF+  + KK + +      +LA  GV+ N+K T  P  +  L   G  + +    +   VD N V+  +     EF  L V+ L
  S:   100 GHNFALNASFDEVNINEYDGLVIPGGRAPEYLAMD--EKVLDLVRKFS--DAKKPIASVCHGQLILAAAGVVQNRKCTAYPAVKPVLVAAGAKWEEADTMDKCTVDGNLVTAVAYDAHPEFISLFVKAL 224
Score = 87, Expect = 3.3e-01, Identities = 34/129 (26%), Positives = 62/129 (48%)
  Q:     7 SNIRIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEK---------------KKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPG 135
           SN RI  +C     D ++++P+      G  V+ V  +K                ++   + G     +   + V+   ++AL IPGG+  + L    N++VI+ +VK   D+ K  + +      +L+  GVL  +K T  P 
  S:   231 SNKRILFLCGDYMEDYEVMVPFQSLQALGCHVDAVCPDKGAGEKCPTAIHDFEGDQTYSEKPGHDFALTASFDNVDASSYDALVIPGGRAPEYLAL--NDKVIS-LVKGFMDKAKP-VASICHGQQILSAAGVLQGRKCTAYPA 370
>gi|124005113|ref|ZP_01689955.1| transcriptional regulator, AraC family; protease, putative [Microscilla marina ATCC 23134] >gi|123989365|gb|EAY28926.1| transcriptional regulator, AraC family; protease, putative [Microscilla marina ATCC 23134] (254 aa)
Score = 104, Expect = 3.7e-03, Identities = 46/169 (27%), Positives = 82/169 (48%)
  Q:    21 DMDIVIPYDIW------TRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYSDNNI------VVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           + ++  P D++       + G+ V T++ + K +I    G KI       K  L K + L +P  +    L TD  +  +   VK   D+  +++ +    + VLA+ G+L N   TT PG  EK  + +   NI      V D  +++      +FE AL +V+ L  K+ A  +A  ++
  S:    51 NTELTAPIDMFQHTIFHAKPGMRVFTIA-KSKAAITTFEGVKILPDYSYTKDKLPKIDVLVVPSAE--HHLDTDLKDTTMINFVKKV-DKEARYVTSHCDGAFVLAQAGLLDNVASTTFPGDVEKYRQRFPKLNILDKVWFVHDGKYITSAGGARSFEAALYLVQLLYGKKAADGVAKGLV 227
>gi|153825985|ref|ZP_01978652.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Vibrio cholerae MZO-2] >gi|149740302|gb|EDM54443.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Vibrio cholerae MZO-2] (205 aa)
Score = 104, Expect = 3.8e-03, Identities = 39/176 (22%), Positives = 74/176 (42%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYSDNNIV---VDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIA 185
           RI +  +  S +M+ VI  D   RAG  V   +   K  +    G  +T  + +E  + + F+AL +PGG    +   D    +   ++     +GK         + V A+       ++T  P F + +         V     ++ ++ + P  A EFAL ++  L   ++A ++A
  S:     8 RILVPVAHGSEEMETVIIVDTLVRAGFQVTMAAVGDKLQVQGSRGVWLTAEQTLEACSAEAFDALALPGGVAGAQAFADSTPLL--ALIDAFSQQGKLVAAICATPALVFAKQQKFVGARMTCHPNFFDHIPSERLSRQRVCYYATQHLLTSQGPGTALEFALAMIALLAGVELAQHVA 184
>gi|161613508|ref|YP_001587473.1| hypothetical protein SPAB_01228 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|167543716|ref|ZP_02339288.1| hypothetical protein Sentent_10566 [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23] >gi|168241566|ref|ZP_02666498.1| hypothetical protein Senterienterica_08046 [Salmonella enterica subsp. enterica serovar Heidelberg str. SL486] >gi|168820762|ref|ZP_02832762.1| hypothetical protein Salentericaenterica_15361 [Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537] >gi|194451529|ref|YP_002045985.1| ThiJ/PfpI domain protein [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|161362872|gb|ABX66640.1| hypothetical protein SPAB_01228 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|194409833|gb|ACF70052.1| ThiJ/PfpI domain protein [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] (185 aa)
Score = 104, Expect = 3.9e-03, Identities = 40/167 (23%), Positives = 77/167 (46%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKN-YSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLL 176
           ++A++ +    + + ++  DI  R  I VET++  + +++       +     + +     F+A+ +PGG +G   L    N  VI  + +     GK       AA+ VL   G+L  ++   +    + + +  Y D  +V D N +S K   H F+FAL +  +LL
  S:     3 KVAVLLAPGFEEAEAIVTLDILRRLHIDVETLACAESRAVVSYHDIPMVADSTLSERQQALFDAVVLPGGPQGSANLAA--NPAVIAFVARHDA-AGKFICPICSAAARVLGAHGLLKGRRYVCSGDLWKAVPEGVYVDAPVVEDGNLISGKGLGHVFDFALTLSARLL 168
>gi|11498880|ref|NP_070109.1| intracellular protease (pfpI) [Archaeoglobus fulgidus DSM 4304] >gi|6136633|sp|O28987|Y1281_ARCFU Uncharacterized protein AF_1281 >gi|2649300|gb|AAB89965.1| intracellular protease (pfpI) [Archaeoglobus fulgidus DSM 4304] (168 aa)
Score = 104, Expect = 3.9e-03, Identities = 39/153 (25%), Positives = 74/153 (48%)
  Q:     9 IRIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSDNNIVVDKNFVSFKSP 161
           +R+ I+   E  D+++  P       G+ V+  S+  +  +  + G ++      E V ++ +  L IPGGK  +R+    NER + +IVK   + GK           +++ + V G +++T+  G  + L   G  Y D  +VVD N ++ + P
  S:     1 MRVLILAENEFEDLELFYPLYRLREEGLEVKVASSSLEVRVG-KKGYQVRPDLTYEDVKVEDYAGLVIPGGKSPERVRI--NERAV-EIVKDFLELGKPVAAICHGPQLLISAMAVKG-RRMTSWIGIRDDLIAAGALYEDRPVVVDGNVITSRMP 151
>gi|26246430|ref|NP_752469.1| hypothetical protein c0535 [Escherichia coli CFT073] >gi|91209493|ref|YP_539479.1| hypothetical protein UTI89_C0447 [Escherichia coli UTI89] >gi|117622684|ref|YP_851597.1| hypothetical protein APECO1_1587 [Escherichia coli APEC O1] >gi|26106828|gb|AAN79013.1|AE016756_196 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Escherichia coli CFT073] >gi|91071067|gb|ABE05948.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Escherichia coli UTI89] >gi|115511808|gb|ABI99882.1| 4-methyl-5(beta-hydroxyethyl)-thiazole monophosphate synthesis [Escherichia coli APEC O1] (198 aa)
Score = 104, Expect = 4.0e-03, Identities = 40/171 (23%), Positives = 83/171 (48%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVET--VSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL-GKNYSDNNIVVDK--NFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           S + + V   D+  R GI V T  V+++   +I    G K+     + +V   +++ + +PGG KG +     R+  ++ + VK     G+       A +TVL    +     +T  P  ++K+  + + D  +V D     ++ + P  A +F L I++ L+ ++ A  +A+ ++
  S:    15 SEETEAVTTIDLLVRGGIKVTTASVASDGNLAITCSRGVKLLADAPLVEVADGEYDVIVLPGGIKGAECF---RDSTLLVETVKQFHRSGRIVAAICAAPATVLVPHDIFPIGNMTGFPTLKDKIPAEQWQDKRVVWDARVKLLTSQGPGTAIDFGLKIIDLLVGREKAHEVASQLV 188
>gi|51597403|ref|YP_071594.1| ThiJ/PfpI-family thiamine biogenesis protein [Yersinia pseudotuberculosis IP 32953] >gi|170023230|ref|YP_001719735.1| ThiJ/PfpI domain-containing protein [Yersinia pseudotuberculosis YPIII] >gi|186896511|ref|YP_001873623.1| ThiJ/PfpI domain-containing protein [Yersinia pseudotuberculosis PB1/+] >gi|51590685|emb|CAH22327.1| ThiJ/PfpI-family thiamine biogenesis protein [Yersinia pseudotuberculosis IP 32953] >gi|169749764|gb|ACA67282.1| ThiJ/PfpI domain protein [Yersinia pseudotuberculosis YPIII] >gi|186699537|gb|ACC90166.1| ThiJ/PfpI domain protein [Yersinia pseudotuberculosis PB1/+] (192 aa)
Score = 104, Expect = 4.0e-03, Identities = 49/180 (27%), Positives = 83/180 (46%)
  Q:     1 MIKHKVSNIRIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVK-FAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKN-YSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQI 180
           M KH      +A++ +    + + VI  DI  R  I V+ +S E   ++     T I+    +       ++A+ +PGG KG   L    N +VI  + +  A D+    L ++GA   VLA   +L  +  +T     +K     Y D ++VVD  F++ K    +FEFA  +   LL+  +
  S:     1 MTKH------VAVLLAHGFEEAEAVIFIDIMRRLDIRVDILSCEATTALSTYFETPISADALLSDRLDHHYDAVMMPGGPKGTDSLTA--NPQVIAFLRRHIAQDKYICALCSSGA--KVLAAHHLLAGRTYSTGDKLADKFADGVYLDQDVVVDGKFITAKGLGVSFEFAFTVARHLLSDNL 173
>gi|153950360|ref|YP_001399912.1| DJ-1/PfpI family protein [Yersinia pseudotuberculosis IP 31758] >gi|152961855|gb|ABS49316.1| DJ-1/PfpI family protein [Yersinia pseudotuberculosis IP 31758] (192 aa)
Score = 104, Expect = 4.0e-03, Identities = 49/180 (27%), Positives = 83/180 (46%)
  Q:     1 MIKHKVSNIRIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVK-FAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKN-YSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQI 180
           M KH      +A++ +    + + VI  DI  R  I V+ +S E   ++     T I+    +       ++A+ +PGG KG   L    N +VI  + +  A D+    L ++GA   VLA   +L  +  +T     +K     Y D ++VVD  F++ K    +FEFA  +   LL+  +
  S:     1 MTKH------VAVLLAHGFEEAEAVIFIDIMRRLDIRVDILSCEATTALSTYFETPISADALLSDRLDHHYDAVMMPGGPKGTDSLTA--NPQVIAFLRRHIAQDKYICALCSSGA--KVLAAHHLLAGRTYSTGDKLADKFADGVYLDQDVVVDGKFITAKGLGVSFEFAFTVARHLLSDNL 173
>gi|157158639|ref|YP_001461607.1| hypothetical protein EcE24377A_0456 [Escherichia coli E24377A] >gi|157159946|ref|YP_001457264.1| hypothetical protein EcHS_A0496 [Escherichia coli HS] >gi|170681670|ref|YP_001742561.1| protein ThiJ [Escherichia coli SMS-3-5] >gi|187731173|ref|YP_001879134.1| protein ThiJ [Shigella boydii CDC 3083-94] >gi|191166737|ref|ZP_03028564.1| protein ThiJ [Escherichia coli B7A] >gi|191173484|ref|ZP_03035011.1| protein ThiJ [Escherichia coli F11] >gi|193065190|ref|ZP_03046263.1| protein ThiJ [Escherichia coli E22] >gi|193068657|ref|ZP_03049618.1| protein ThiJ [Escherichia coli E110019] >gi|194428824|ref|ZP_03061359.1| protein ThiJ [Escherichia coli B171] >gi|194438891|ref|ZP_03070976.1| protein ThiJ [Escherichia coli 101-1] >gi|157065626|gb|ABV04881.1| protein ThiJ [Escherichia coli HS] >gi|157080669|gb|ABV20377.1| protein ThiJ [Escherichia coli E24377A] >gi|170519388|gb|ACB17566.1| protein ThiJ [Escherichia coli SMS-3-5] >gi|187428165|gb|ACD07439.1| protein ThiJ [Shigella boydii CDC 3083-94] >gi|190903248|gb|EDV62970.1| protein ThiJ [Escherichia coli B7A] >gi|190906193|gb|EDV65805.1| protein ThiJ [Escherichia coli F11] >gi|192927164|gb|EDV81785.1| protein ThiJ [Escherichia coli E22] >gi|192958020|gb|EDV88462.1| protein ThiJ [Escherichia coli E110019] >gi|194413127|gb|EDX29414.1| protein ThiJ [Escherichia coli B171] >gi|194422185|gb|EDX38187.1| protein ThiJ [Escherichia coli 101-1] (196 aa)
Score = 104, Expect = 4.0e-03, Identities = 40/171 (23%), Positives = 83/171 (48%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVET--VSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL-GKNYSDNNIVVDK--NFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           S + + V   D+  R GI V T  V+++   +I    G K+     + +V   +++ + +PGG KG +     R+  ++ + VK     G+       A +TVL    +     +T  P  ++K+  + + D  +V D     ++ + P  A +F L I++ L+ ++ A  +A+ ++
  S:    13 SEETEAVTTIDLLVRGGIKVTTASVASDGNLAITCSRGVKLLADAPLVEVADGEYDVIVLPGGIKGAECF---RDSTLLVETVKQFHRSGRIVAAICAAPATVLVPHDIFPIGNMTGFPTLKDKIPAEQWQDKRVVWDARVKLLTSQGPGTAIDFGLKIIDLLVGREKAHEVASQLV 186
>gi|16121153|ref|NP_404466.1| ThiJ/PfpI-family thiamine biogenesis protein [Yersinia pestis CO92] >gi|22127106|ref|NP_670529.1| ThiJ/PfpI-family thiamine biogenesis protein [Yersinia pestis KIM] >gi|45443278|ref|NP_994817.1| ThiJ/PfpI-family thiamine biogenesis protein [Yersinia pestis biovar Microtus str. 91001] >gi|108806422|ref|YP_650338.1| ThiJ/PfpI-family thiamine biogenesis protein [Yersinia pestis Antiqua] >gi|108813207|ref|YP_648974.1| ThiJ/PfpI-family thiamine biogenesis protein [Yersinia pestis Nepal516] >gi|145597972|ref|YP_001162048.1| ThiJ/PfpI-family thiamine biogenesis protein [Yersinia pestis Pestoides F] >gi|150260141|ref|ZP_01916869.1| ThiJ/PfpI-family thiamine biogenesis protein [Yersinia pestis CA88-4125] >gi|162420568|ref|YP_001607706.1| ThiJ/PfpI-family thiamine biogenesis protein [Yersinia pestis Angola] >gi|165925042|ref|ZP_02220874.1| DJ-1/PfpI family protein [Yersinia pestis biovar Orientalis str. F1991016] >gi|165937384|ref|ZP_02225948.1| DJ-1/PfpI family protein [Yersinia pestis biovar Orientalis str. IP275] >gi|166010222|ref|ZP_02231120.1| DJ-1/PfpI family protein [Yersinia pestis biovar Antiqua str. E1979001] >gi|166212805|ref|ZP_02238840.1| DJ-1/PfpI family protein [Yersinia pestis biovar Antiqua str. B42003004] >gi|167399910|ref|ZP_02305428.1| DJ-1/PfpI family protein [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167418840|ref|ZP_02310593.1| DJ-1/PfpI family protein [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167425377|ref|ZP_02317130.1| DJ-1/PfpI family protein [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167468333|ref|ZP_02333037.1| DJ-1/PfpI family protein [Yersinia pestis FV-1] >gi|21960163|gb|AAM86780.1|AE013924_3 hypothetical [Yersinia pestis KIM] >gi|45438146|gb|AAS63694.1| ThiJ/PfpI-family thiamine biogenesis protein [Yersinia pestis biovar Microtus str. 91001] >gi|108776855|gb|ABG19374.1| ThiJ/PfpI-family thiamine biogenesis protein [Yersinia pestis Nepal516] >gi|108778335|gb|ABG12393.1| ThiJ/PfpI-family thiamine biogenesis protein [Yersinia pestis Antiqua] >gi|115346632|emb|CAL19515.1| ThiJ/PfpI-family thiamine biogenesis protein [Yersinia pestis CO92] >gi|145209668|gb|ABP39075.1| ThiJ/PfpI-family thiamine biogenesis protein [Yersinia pestis Pestoides F] >gi|149289549|gb|EDM39626.1| ThiJ/PfpI-family thiamine biogenesis protein [Yersinia pestis CA88-4125] >gi|162353383|gb|ABX87331.1| DJ-1/PfpI family protein [Yersinia pestis Angola] >gi|165914858|gb|EDR33471.1| DJ-1/PfpI family protein [Yersinia pestis biovar Orientalis str. IP275] >gi|165923242|gb|EDR40393.1| DJ-1/PfpI family protein [Yersinia pestis biovar Orientalis str. F1991016] >gi|165990708|gb|EDR43009.1| DJ-1/PfpI family protein [Yersinia pestis biovar Antiqua str. E1979001] >gi|166206097|gb|EDR50577.1| DJ-1/PfpI family protein [Yersinia pestis biovar Antiqua str. B42003004] >gi|166962834|gb|EDR58855.1| DJ-1/PfpI family protein [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167050618|gb|EDR62026.1| DJ-1/PfpI family protein [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167055777|gb|EDR65561.1| DJ-1/PfpI family protein [Yersinia pestis biovar Mediaevalis str. K1973002] (192 aa)
Score = 104, Expect = 4.0e-03, Identities = 49/180 (27%), Positives = 83/180 (46%)
  Q:     1 MIKHKVSNIRIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVK-FAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKN-YSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQI 180
           M KH      +A++ +    + + VI  DI  R  I V+ +S E   ++     T I+    +       ++A+ +PGG KG   L    N +VI  + +  A D+    L ++GA   VLA   +L  +  +T     +K     Y D ++VVD  F++ K    +FEFA  +   LL+  +
  S:     1 MTKH------VAVLLAHGFEEAEAVIFIDIMRRLDIRVDILSCEATTALSTYFETPISADALLSDRLDHHYDAVMMPGGPKGTDSLTA--NPQVIAFLRRHIAQDKYICALCSSGA--KVLAAHHLLAGRTYSTGDKLADKFADGAYLDQDVVVDGKFITAKGLGVSFEFAFTVARHLLSDNL 173
>gi|167755273|ref|ZP_02427400.1| hypothetical protein CLORAM_00778 [Clostridium ramosum DSM 1402] >gi|167705323|gb|EDS19902.1| hypothetical protein CLORAM_00778 [Clostridium ramosum DSM 1402] (186 aa)
Score = 104, Expect = 4.1e-03, Identities = 46/158 (29%), Positives = 81/158 (51%)
  Q:    18 ESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGK-GCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL-GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKL 175
           ES  + IV   D+  RAGI   T    ++    +Q G  I   ++I    +  ++ L +PGG+ G   L    N  VI ++V++  + GK +L    + + VL++  V+  K +T   G+ +KL G  + D  +V D+N ++ + P  ++ FA  I+E L
  S:    17 ESETVTIV---DLLRRAGIECHTFGFAEQYVRGMQ-GMMIKV-DKIFSDEIKNYDMLVLPGGRPGGVNL--GANPLVI-EMVQYYNENGK-YLAAICSGTIVLSKARVIDGKNVTGYTGYADKLVGGEFVDKVVVFDQNIITSQGPATSYPFAFKIIEVL 167
>gi|149183509|ref|ZP_01861936.1| general stress protein 18 [Bacillus sp. SG-1] >gi|148848781|gb|EDL63004.1| general stress protein 18 [Bacillus sp. SG-1] (163 aa)
Score = 104, Expect = 4.1e-03, Identities = 43/141 (30%), Positives = 67/141 (47%)
  Q:    21 DMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSG-TKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFE------EKLGKNYSDNNIVVDKN-FVSFKSP 161
           D++   P D +   G  V T+  E  K++  + G  K+T  + I+ VN D+F+AL++PGG    +L  D  ER +     F   E        G    + A+   L  K  T   GF+      E  G  Y D  +VV K+  V+ ++P
  S:     4 DVEYTKPADAFKEEGHTVVTIEKESGKTVEGKQGEAKVTIDKGIDNVNPDEFDALFLPGGFSPDQLRAD--ERFVQFTKSFMDSEKPVMAICHGPQLLLTAK--TLDGKDAT---GFKSIKVDMEYAGATYKDQEVVVFKDQLVTSRNP 145
>gi|89901540|ref|YP_524011.1| peptidase C56, PfpI [Rhodoferax ferrireducens T118] >gi|89346277|gb|ABD70480.1| Peptidase C56, PfpI [Rhodoferax ferrireducens T118] (193 aa)
Score = 103, Expect = 4.1e-03, Identities = 34/126 (26%), Positives = 59/126 (46%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQS---------------GTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPG 135
           +I ++C     D + ++P+      G  V  V  +KK   ++ +               G +   +     VN   ++AL IPGG+G + L    N RV++   +FA D GK        A  + A  G++  K+I+  P 
  S:     4 KILMLCGDYGEDYETMVPFQTLLAVGCSVHAVCPDKKAGDYVMTAIHDFEGAQTYSEKPGHRFALNTNFSDVNTANYDALLIPGGRGPEYLRL--NARVLSITKEFA-DAGKPIAAVCHGAQLLAAVPGIIRGKRISAYPA 141
>gi|148255686|ref|YP_001240271.1| putative intracellular proteinase [Bradyrhizobium sp. BTAi1] >gi|146407859|gb|ABQ36365.1| putative intracellular proteinase [Bradyrhizobium sp. BTAi1] (186 aa)
Score = 103, Expect = 4.2e-03, Identities = 40/166 (24%), Positives = 83/166 (50%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVS---NEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGD--EGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKL 175
           +IAI+ +      ++ +P D   +AG  V+ +S    + K       G  +   + +++ +   ++A+ +PGG+    LL     R+  K +KF  D  E KK +     A  +L E G+   +K+T+    +  +   G ++ D  +VVD+  ++ ++P     F+  I+E++
  S:     7 KIAILATNGFEQAELEVPRDRLKQAGATVDVISLAAGQIKGWDQKDWGRPVKVDKTLDQASASDYDAIVLPGGQINPDLL-----RLEPKALKFIKDIFEAKKIVAAVCHAPWLLIETGIAKGRKMTSYKSIKTDVVNAGADWQDEAVVVDQGVITSRNPGDLEAFSAKIIEEV 175
>gi|171920980|ref|ZP_02696358.3| conserved hypothetical protein [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|171903007|gb|EDT49296.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 13 str. ATCC 33698] (143 aa)
Score = 103, Expect = 4.3e-03, Identities = 46/129 (35%), Positives = 64/129 (49%)
  Q:    51 LQSGTKITCSEEIEKVNLDKFNALYIPGGKG--CQRLLTDR----NERVINKIVKFAGD-----EGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKN-YSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLL-NKQ 179
           +QS  KI C+E IEK NL KFN L +   +    Q+++         + I K+ KF  D     E  K+L     A   L EL +L + K T      +KLGKN   D NIV D   ++      A +   +I   +  NKQ
  S:     1 MQSMNKIVCNELIEKCNLSKFNFLILISSQNLTLQKIIKTSFILTQSQKIPKLNKFLNDFFNLKEDNKYLIAINDAPLYLNELNLLKDFKFTCNNTLNKKLGKNCLCDKNIVQDCCLITANDSICALKIVEIITNTMCENKQ 142
>gi|168227601|ref|ZP_02652832.1| putative intracellular protease/amidase [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433] (185 aa)
Score = 103, Expect = 4.3e-03, Identities = 40/167 (23%), Positives = 77/167 (46%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKN-YSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLL 176
           ++A++ +    + + ++  DI  R  I VET++  + +++       +     + +     F+A+ +PGG +G   L    N  VI  + +     GK       AA+ VL   G+L  ++   +    + + +  Y D  +V D N +S K   H F+FAL +  +LL
  S:     3 KVAVLLAPGFEEAEAIVTLDILRRLYIDVETLACAESRAVVSYHDIPMVADSTLSERQQALFDAVVLPGGPQGSANLAA--NPAVIAFVARHDA-AGKLICPICSAAARVLGAHGLLKGRRYVCSGDLWKAVPEGVYVDAPVVEDGNLISGKGLGHVFDFALTLSARLL 168
>gi|59714169|ref|YP_206944.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Vibrio fischeri ES114] >gi|59482417|gb|AAW88056.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Vibrio fischeri ES114] (193 aa)
Score = 103, Expect = 4.4e-03, Identities = 44/166 (26%), Positives = 79/166 (47%)
  Q:    11 IAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKN-YSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLL 176
           +A++ +    + + V+  DI  R  I V+ +S  +  ++     T+I+    ++      ++A+ +PGG KG   L    N  VI+  +K   ++ K       + + VLA   +L  +  TT  G E+K     + D  +VVD  F+S K    +FEFA  + + LL
  S:    10 VAVLLADGFEEGEAVVFIDIMRRLDIKVDVLSCMETTALETYFETRISADYTLKDKKDVLYDAVMMPGGPKGTDNL--SANSMVID-FLKCHIEKDKYICALCSSGAKVLAANHLLNGRNYTTGGGLEKKFTDGCFQDKKVVVDGKFISGKGLGVSFEFAFTVAKYLL 174
>gi|84501149|ref|ZP_00999384.1| putative intracellular protease, PfpI family protein [Oceanicola batsensis HTCC2597] >gi|84391216|gb|EAQ03634.1| putative intracellular protease, PfpI family protein [Oceanicola batsensis HTCC2597] (186 aa)
Score = 103, Expect = 4.4e-03, Identities = 42/170 (24%), Positives = 77/170 (45%)
  Q:     6 VSNIRIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQS---GTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKL 175
           +   RI I+ +      ++ +P D  + AG  V  VS + +          G        +  V+ D ++A+ +PGG+    +L  + E V  + VK   + GK  +        +L E GV+  +K+T+ P  +  L   G  + D+ +V DK  V+ + P     F   I+E++
  S:     4 IKQARIIILSTDGFEQSELEVPRDKLSAAGATVHVVSPDGETIRGWDKTDWGQDAEVDHAVSDVSPDDYDAIVLPGGQINPDILRTKPEAV--EFVKKMHNAGKV-VAAICHGPWMLVEAGVVKGRKVTSFPSIKTDLVNAGGQWEDSEVVTDKGIVTSRKPDDLDAFVSKIIEEV 176
>gi|148359551|ref|YP_001250758.1| intracellular protease [Legionella pneumophila str. Corby] >gi|148281324|gb|ABQ55412.1| intracellular protease [Legionella pneumophila str. Corby] (194 aa)
Score = 103, Expect = 4.5e-03, Identities = 40/120 (33%), Positives = 60/120 (50%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQS-----------------GTKITCSEEIEKVNLDKFNALYIPGGKGC--QRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEE 138
           + D+++  PY        +++TVS  K K  F+Q+                 G     + +  K+ L  ++AL IPGG+    QRL  D    ++  I  F   E  K +        +LAE G+L NKK TT  GF E
  S:    15 NEDLEVYFPYQAMLMNNYLIDTVSPGKNKGDFIQTAVHDLDKPHLQSYTEKLGHLFPITADFSKITLKDYDALIIPGGRAAEYQRLSKD----ILAIIRHF--HETNKPIACICHGIQILAEAGILENKKCTTV-GFCE 146
>gi|119509804|ref|ZP_01628948.1| Peptidase C56, PfpI [Nodularia spumigena CCY9414] >gi|119465539|gb|EAW46432.1| Peptidase C56, PfpI [Nodularia spumigena CCY9414] (365 aa)
Score = 103, Expect = 4.6e-03, Identities = 45/166 (27%), Positives = 78/166 (46%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAG---IIVETVSNE--KKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKL 175
           ++AI+      D++  IP     +AG   +++ +  NE  K K   L      T +E I      KF+A+ IPGG    ++   RN   + + V+ A  +GK W+        +L E  +L  +K T      + +   G NY D  +VVD+N ++ + P     F   ++ +L
  S:    12 KVAILIENGVEDIEFTIPCHSLKQAGMEVVVLGSRMNERYKGKRGKLSVQPDATTTEAIA----GKFDAVVIPGGMAPDKM--RRNPNTV-RFVQEAMQQGK-WVAAVCHGPQLLIEGDLLKGRKATGFSAIRKDMINAGANYLDEPLVVDRNLITSREPGDLAIFTTALLSRL 177
>gi|194535810|ref|YP_002070977.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Vibrio cholerae RC385] >gi|150420604|gb|EDN12895.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Vibrio cholerae RC385] (205 aa)
Score = 103, Expect = 4.7e-03, Identities = 38/176 (21%), Positives = 75/176 (42%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYSDNNIV---VDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIA 185
           RI +  +  S +M+ VI  D   RAG  V   +  +   +    G  +T  + ++ ++ + F+AL +PGG G  +   D    +   ++     +GK         + V A+       ++T  P F + +         V     ++ ++ + P  A EFAL ++  L   ++A  +A
  S:     8 RILVPIANGSEEMESVIIVDTLVRAGFQVTMAAIGEDLQVQGSRGVWLTAQQTLDALSAEDFDALALPGGVGGAQAFADSTPLL--ALIDAFSQQGKLVAAICATPALVFAKQQKFVGARMTCHPNFFDHIPSERLSRQRVCYYATQHLLTSQGPSTALEFALAMIALLAGAELAQQVA 184
>gi|148323539|gb|EDK88789.1| possible intracellular protease/amidase [Fusobacterium nucleatum subsp. polymorphum ATCC 10953] (200 aa)
Score = 103, Expect = 4.8e-03, Identities = 45/157 (28%), Positives = 76/157 (48%)
  Q:    36 IIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKF---NALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLG--KNYS----DNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILYTK 192
           I VET+S   K+SI    G ++   + I + N++ F   + L IPGG G      D+N ++  K++K+  +  K  +    A   +L    + G K  T     +      KNY+    +  IV D N  +   P +A E +  ++EKL + +   NI  D ++ K
  S:    38 IKVETIS--YKESIKCTWGGELRAEKIITEDNVEDFFDYDVLIIPGGFGKANFFKDKNNKIFKKLIKYFFENNKIIVAICSAVINLLESTYIRGKKVTTYLLDNKRYFNQLKNYNVIPIEEEIVEDNNLFTCSGPGNALELSFRLLEKLTSNE-NVNIIKDNMFLK 200
>gi|117625449|ref|YP_858772.1| hypothetical protein APECO1_3277 [Escherichia coli APEC O1] >gi|115514573|gb|ABJ02648.1| conserved hypothetical protein [Escherichia coli APEC O1] (172 aa)
Score = 103, Expect = 4.8e-03, Identities = 40/152 (26%), Positives = 71/152 (46%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSG-TKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGD---EGKKWLFTAGAASTVLAELGVLGNKKITTAPGF--EEKLGKNYSDNNIVVDKN-FVSFKSP 161
           +IA++ + E  D +   P D + +AG  V T+  +  K++  + G   +   + I++V   +F+AL +PGG     L  D      N+ V F  D    GK           +++   +LG K     P     +  G  + D  +VVDK+  V+ ++P
  S:     4 KIAVLITDEFEDSEFTSPADEFRKAGHEVITIEKQAGKTVKGKKGEASVAIDKSIDEVTPAEFDALLLPGGHSPDYLRGD------NRFVTFTRDFVNSGKPVFAICHGPQLLISADVILGRKLTAVKPIVIDVKNAGAEFYDQEVVVDKDQLVTSRTP 156
>gi|108996385|ref|XP_001096409.1| PREDICTED: similar to DJ-1 protein isoform 1 [Macaca mulatta] (153 aa)
Score = 103, Expect = 4.9e-03, Identities = 33/114 (28%), Positives = 57/114 (50%)
  Q:    71 FNALYIPGGK-GCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGK----NYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNI 184
           ++ + +PGG  G Q L       V++ + K    +G       G  + +  E+G     K+TT P  ++K+       YS+N +  D   ++ + P  +FEFAL IVE L  K++A  +
  S:    31 YDVVVLPGGNLGAQNL--SEQASVLDALTKGRNRDGIFLFLFLGPTALLAHEIGF--GSKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSRGPGTSFEFALAIVEALNGKEVAAQV 145
>gi|38703865|ref|NP_308505.2| hypothetical protein ECs0478 [Escherichia coli O157:H7 str. Sakai] >gi|168706116|ref|ZP_02738393.1| hypothetical protein EschericoliO157_01205 [Escherichia coli O157:H7 str. EC4045] >gi|168717565|ref|ZP_02749842.1| hypothetical protein EschericcoliO157_07043 [Escherichia coli O157:H7 str. EC4206] >gi|168735420|ref|ZP_02767697.1| hypothetical protein EschecoliO157_10318 [Escherichia coli O157:H7 str. EC4115] >gi|168749886|ref|ZP_02774908.1| protein ThiJ [Escherichia coli O157:H7 str. EC4113] >gi|168756966|ref|ZP_02781973.1| protein ThiJ [Escherichia coli O157:H7 str. EC4401] >gi|168761630|ref|ZP_02786637.1| protein ThiJ [Escherichia coli O157:H7 str. EC4501] >gi|168768375|ref|ZP_02793382.1| protein ThiJ [Escherichia coli O157:H7 str. EC4486] >gi|168776270|ref|ZP_02801277.1| protein ThiJ [Escherichia coli O157:H7 str. EC4196] >gi|168783290|ref|ZP_02808297.1| protein ThiJ [Escherichia coli O157:H7 str. EC4076] >gi|168786271|ref|ZP_02811278.1| protein ThiJ [Escherichia coli O157:H7 str. EC869] >gi|168794208|ref|ZP_02819215.1| hypothetical protein EschercoliO157_18154 [Escherichia coli O157:H7 str. EC4042] >gi|168800307|ref|ZP_02825314.1| protein ThiJ [Escherichia coli O157:H7 str. EC508] >gi|195938509|ref|ZP_03083891.1| hypothetical protein EscherichcoliO157_19122 [Escherichia coli O157:H7 str. EC4024] >gi|187768290|gb|EDU32134.1| protein ThiJ [Escherichia coli O157:H7 str. EC4196] >gi|188015911|gb|EDU54033.1| protein ThiJ [Escherichia coli O157:H7 str. EC4113] >gi|188999389|gb|EDU68375.1| protein ThiJ [Escherichia coli O157:H7 str. EC4076] >gi|189355968|gb|EDU74387.1| protein ThiJ [Escherichia coli O157:H7 str. EC4401] >gi|189362519|gb|EDU80938.1| protein ThiJ [Escherichia coli O157:H7 str. EC4486] >gi|189367959|gb|EDU86375.1| protein ThiJ [Escherichia coli O157:H7 str. EC4501] >gi|189373534|gb|EDU91950.1| protein ThiJ [Escherichia coli O157:H7 str. EC869] >gi|189377388|gb|EDU95804.1| protein ThiJ [Escherichia coli O157:H7 str. EC508] (196 aa)
Score = 103, Expect = 4.9e-03, Identities = 40/171 (23%), Positives = 83/171 (48%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVET--VSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL-GKNYSDNNIVVDK--NFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           S + + V   D+  R GI V T  V+++   +I    G K+     + +V   +++ + +PGG KG +     R+  ++ + VK     G+       A +TVL    +     +T  P  ++K+  + + D  +V D     ++ + P  A +F L I++ L+ ++ A  +A+ ++
  S:    13 SEETEAVTTIDLLIRGGIKVTTASVASDGNLAITCSRGVKLLADAPLVEVADGEYDVIVLPGGIKGAECF---RDSTLLVETVKQFHRSGRIVAAICAAPATVLVPHDIFPIGNMTGFPTLKDKIPAEQWQDKRVVWDARVKLLTSQGPGTAIDFGLKIIDLLVGREKAHEVASQLV 186
>gi|15800154|ref|NP_286166.1| hypothetical protein Z0527 [Escherichia coli O157:H7 EDL933] >gi|12513280|gb|AAG54774.1|AE005221_11 4-methyl-5(beta-hydroxyethyl)-thiazole monophosphate synthesis [Escherichia coli O157:H7 EDL933] >gi|13359935|dbj|BAB33901.1| 4-methyl-5(beta-hydroxyethyl)-thiazole monophosphate synthesis [Escherichia coli O157:H7 str. Sakai] (198 aa)
Score = 103, Expect = 4.9e-03, Identities = 40/171 (23%), Positives = 83/171 (48%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVET--VSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL-GKNYSDNNIVVDK--NFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           S + + V   D+  R GI V T  V+++   +I    G K+     + +V   +++ + +PGG KG +     R+  ++ + VK     G+       A +TVL    +     +T  P  ++K+  + + D  +V D     ++ + P  A +F L I++ L+ ++ A  +A+ ++
  S:    15 SEETEAVTTIDLLIRGGIKVTTASVASDGNLAITCSRGVKLLADAPLVEVADGEYDVIVLPGGIKGAECF---RDSTLLVETVKQFHRSGRIVAAICAAPATVLVPHDIFPIGNMTGFPTLKDKIPAEQWQDKRVVWDARVKLLTSQGPGTAIDFGLKIIDLLVGREKAHEVASQLV 188
>gi|85057864|ref|YP_456780.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Aster yellows witches'-broom phytoplasma AYWB] >gi|84789969|gb|ABC65701.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme [Aster yellows witches'-broom phytoplasma AYWB] (180 aa)
Score = 103, Expect = 4.9e-03, Identities = 37/168 (22%), Positives = 72/168 (42%)
  Q:    21 DMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNY-SDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDI 188
           D + ++   +   A + + + +   +  +   SG  +  +  +  +N  +++ L IPGG    +++    E  + ++++   D   K +    AA   L +L +L N   T  P     +   Y  D   V+   FV+ +SP   F+FA  +VE L  K  A    N +
  S:    13 DCEALVTRALLNHASLPLTSATLNPQLEVVSSSGLCVKANANLATINPLEYDFLVIPGGPYVAQII--EKETFLLQLIQIFFD-ANKVIGAICAAPMFLGKLDLLKNHPFTCFPSCNNFIEGTYLPDKKAVISDKFVTSRSPITVFDFAFALVEVLKGKDFALAFKNSL 178
>gi|152976093|ref|YP_001375610.1| ThiJ/PfpI domain-containing protein [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|152024845|gb|ABS22615.1| ThiJ/PfpI domain protein [Bacillus cereus subsp. cytotoxis NVH 391-98] (190 aa)
Score = 103, Expect = 4.9e-03, Identities = 42/176 (23%), Positives = 86/176 (48%)
  Q:     9 IRIAIMCSIESNDMDIVIPYDIWTRAGII-------VETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGK---NYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNI 184
           ++IAI+C     D+D+ +P+D+  R  ++       V+ +  EK       SG +I  +  I  +     +A+    GKG Q L   +N++ +N I     +  ++ + +  + S +L    +L  KK TT P   E+L +   +  + + V + N  +    F A + +  I+  L+N+++   +
  S:     1 MKIAIVCFDNFTDIDVFLPWDLLNRVHLVGGISDWEVQLLGTEKTH--VSMSGLRIPMTGSISDIPFT--DAVIFASGKGVQDLY--KNQQYLNNI---HVNPQRQLIGSMCSGSLLLGAKKLLTGKKATTYPSVVEQLKEFDVDVIEQSFVNEGNISTAAGCFAAQDLSAWIIRTLINEEMVGTV 177
>gi|152968950|ref|YP_001334059.1| hypothetical protein KPN_00377 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] >gi|150953799|gb|ABR75829.1| 4-methyl-5(beta-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme (thiamine biosynthesis) [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] (197 aa)
Score = 103, Expect = 5.0e-03, Identities = 41/178 (23%), Positives = 88/178 (49%)
  Q:    12 AIMC-SIESNDMDIVIPYDIWTRAGIIVET--VSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL-GKNYSDNNIVVDK--NFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           A++C +  S + + V   D+  R G+ V T  V+++   +I    G K+     + +V    F+ + +PGG KG +     R+  ++ + V+     G+       A +TVL    +     +T  P  +E +  + + D  +V D   N ++ + P  + +FAL +++ L+ ++ A  +A+ ++
  S:     5 ALICLAPGSEETEAVTTIDLLVRGGVKVTTASVASDGSLTIVCSRGAKLLADAPLVEVADGDFDIIVLPGGIKGAECF---RDSTLLVETVRQFHLSGRIVAAICAAPATVLVPHNLFPIGNMTGFPALKEHIPAEQWQDKRVVWDPRVNLLTSQGPGTSIDFALKMIDLLVGREKAYEVASQLV 186
>gi|58040061|ref|YP_192025.1| protease [Gluconobacter oxydans 621H] >gi|58002475|gb|AAW61369.1| Protease [Gluconobacter oxydans 621H] (200 aa)
Score = 103, Expect = 5.0e-03, Identities = 44/155 (28%), Positives = 74/155 (47%)
  Q:     3 KHKVSNIRIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKK---------------KSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSD---NNIVVDKNFVS 157
           K  ++  RI ++      D +I++P+ +    G  V+ VS  KK               ++   + G   T +     V  D ++AL IPGG+  ++L TD  E V++ +  F   E  K +        +LA  GV+  KKI+  P    ++   G  Y     +  V D  FV+
  S:     5 KETMAEKRILMIAGDFVEDYEIMVPFQMLLLVGHKVDVVSPGKKAGEQVVTAIHDFEGHQTYTEKRGHNFTLNATYAGVTADAYDALVIPGGRAPEQLSTD--ESVLDLVRAFV--ESGKPVAAVCHGPQLLAAAGVIKGKKISAYPACRAEVLLAGAEYQSVPMDGAVTDGQFVT 176
>gi|146313225|ref|YP_001178299.1| PfpI family intracellular peptidase [Enterobacter sp. 638] >gi|145320101|gb|ABP62248.1| intracellular protease, PfpI family [Enterobacter sp. 638] (172 aa)
Score = 103, Expect = 5.0e-03, Identities = 39/152 (25%), Positives = 70/152 (46%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSG-TKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEE--KLGKNYSDNNIVVDKN-FVSFKSP 161
           +IA++ + E  D +   P + + +AG  V T+  +  K++    G   +T  + I+ V   +F+AL +PGG     L  D  ER +     F       +    G    + AE+ V G K     P   +    G ++ D  +VVD++  V+ ++P
  S:     4 KIAVLITDEFEDSEFTSPAEAFRKAGHEVVTIDTQAGKTVKGHKGEANVTIDKSIDDVTAAEFDALLLPGGHSPDTLRGD--ERFVTFTRDFVASGKPVFAICHGPQLLISAEV-VRGRKLTAVKPIVIDLKNAGADFYDQEVVVDQDQLVTSRTP 156
>gi|118390159|ref|XP_001028070.1| DJ-1 family protein [Tetrahymena thermophila SB210] >gi|89309840|gb|EAS07828.1| DJ-1 family protein [Tetrahymena thermophila SB210] (191 aa)
Score = 103, Expect = 5.2e-03, Identities = 45/183 (24%), Positives = 90/183 (49%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAG--IIVETVSNEKKKSIFL-QSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKI--TTAPGFEEKLG-KNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILYTK 192
           RI +  +    +++ +   D++ R G  + V ++ N+ +  +    +G ++ C + +++V    F+ +  PGG    + L+D  + +I ++ K    E  K+     AA  V+ E     N +I  T  PGF +KL  K+  D ++VV    ++ KS   A +F L ++  L ++Q    +   + Y K
  S:     6 RILVPLAPSFEEIEAITVIDLFRRIGADVTVASILNKSEGLVVKGANGVQVLCDKHLDEVVNQDFDMIACPGGMPGAQHLSD-CQILIERLKK--QREQDKYYAAICAAPYVIFEKHGFLNSQIAGTCHPGFADKLSNKSKIDQDVVVTGKCITSKSAGTAMDFGLQLLRLLYSEQKVLEVLKRLAYRK 191
>gi|87122188|ref|ZP_01078071.1| putative transcriptional regulator [Marinomonas sp. MED121] >gi|86162508|gb|EAQ63790.1| putative transcriptional regulator [Marinomonas sp. MED121] (214 aa)
Score = 103, Expect = 5.2e-03, Identities = 43/155 (27%), Positives = 74/155 (47%)
  Q:    38 VETVSNEKKKSIFLQSGTKITCSEEI-EKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKK--WLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYSDNNIVVDKNFV-------SFKSPFHAFEFALLIVEKLLNKQIATNIANDILYTK 192
           V  VS  K K+I  + G  IT  + I + + LD    + +        +L +        ++KF  D+  +  W+ +  + + +LAE GVL  K  TT  G EE    +Y    +  DKNFV       S   P  +++ A  ++E+L + + +  IA  I + +
  S:    54 VVVVSATKNKTIKTEEGLTITADKTIYDPLTLD---VVIVASAYNMSPVLNNET------LIKFVEDQHGQASWMASNCSGAMILAEAGVLDGKNATTWAGGEEDFADDYPKVKVQFDKNFVIDEGVLTSNGGPV-SYQAAFALLEQLSSDEFSQEIAELIQFNR 208
>gi|168039141|ref|XP_001772057.1| predicted protein [Physcomitrella patens subsp. patens] >gi|162676658|gb|EDQ63138.1| predicted protein [Physcomitrella patens subsp. patens] (388 aa)
Score = 103, Expect = 5.3e-03, Identities = 36/141 (25%), Positives = 72/141 (51%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKK---------------KSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFE-------------EKLGKNYSDNNIV 150
           ++ ++C     D + ++P+      G  V+ V  +KK               ++   + G     +    +V +  ++AL +PGG+  + L    NE+V++ + +F  D+ KK + +      +LA  GVL  KK T  P  +             E + K ++D ++V
  S:   199 KVLMLCGDYMEDYEAMVPFQAMQALGYQVDAVCPDKKSGDTCATAVHDFEGAQTYSEKPGHNFALTATFSEVKVQDYDALVVPGGRAPEYL--SLNEKVLDLVREF--DDAKKPIASICHGQQILAAAGVLKGKKCTAYPAVKSHVVLSGGQWLEPEPISKCFTDGHLV 363
Score = 98, Expect = 1.9e-02, Identities = 32/115 (27%), Positives = 56/115 (48%)
  Q:    21 DMDIVIPYDIWTRAGIIVETVSNEKK---------------KSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPG 135
           D ++++P+      G+ V+ V   KK               ++     G     +   E V+ D ++AL +PGG+  + L  D N  V+N + KF  +   K + +      +LA  GVL +K+ T  P 
  S:    17 DYEVMVPFQALLAYGLKVDAVCPGKKAGETCATAIHDFLGHQTYSESKGHNFALTANFEDVDADSYDALVVPGGRAPEYLSLDEN--VLNLVKKF--ESAHKPIASICHGQLILAAAGVLKDKQCTAYPA 142
>gi|116618027|ref|YP_818398.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis protein [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|116096874|gb|ABJ62025.1| 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme, amidase family [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (168 aa)
Score = 102, Expect = 5.4e-03, Identities = 40/166 (24%), Positives = 74/166 (44%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKL 175
           ++A++ +    D++   P      +G  V T+S   + ++  + GTKI   + I  V    F+AL+IPGG    +L  D  ER +N    F      K LF+      ++   G++  + +T     +  L   G    +  +V+D N ++ + P     F   I++ L
  S:     4 KVAVLVTDLVEDIEFTDPVKALKESGASVTTISFSTE-AVTGKHGTKIDIDKSIGDVAPSDFDALFIPGGFSPDQLRAD--ERFVNFTKHFLAT--NKSLFSICHGPQLMIPTGLVLGRTMTAYRTVQPDLYYAGARIENKPVVIDGNLITSREPKDIPSFNEAIIDAL 167
>gi|167458011|ref|ZP_02324219.1| intracellular protease, PfpI family [Anaeromyxobacter dehalogenans 2CP-1] >gi|167415740|gb|EDR82464.1| intracellular protease, PfpI family [Anaeromyxobacter dehalogenans 2CP-1] (188 aa)
Score = 102, Expect = 5.6e-03, Identities = 45/161 (27%), Positives = 72/161 (44%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTK----ITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSDNNIVVDKNFVSFKSP--FHAFEFALL 170
           RIA +      D ++ +P+D   +AG     V  EK K I    G K     T       V  + F+AL +PGG     L TD +   + ++V+     GK  +        +L E   +  K +T+ P  +  L   G  + D  +V D+N ++ + P    AF  A+L
  S:     3 RIAFIADDLFEDSELRVPWDRLRQAGHETVLVGLEKGKQI---RGKKQRETFTTDVAARDVTAEDFDALVVPGGYSPDHLRTDMD---MVRLVRTTFTAGKP-VAAVCHGPWMLVEADAIDGKTVTSWPSLKTDLINAGARWVDREVVEDENVITSRKPDDLEAFSEAIL 165
>gi|168222916|ref|ZP_02648148.1| putative intracellular protease/amidase [Salmonella enterica subsp. enterica serovar Agona str. SL483] (185 aa)
Score = 102, Expect = 5.7e-03, Identities = 41/167 (24%), Positives = 76/167 (45%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKN-YSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLL 176
           ++A++ +    + + ++  DI  R  I VET++  + +++       +     + +     F+A+ +PGG +G   L    N  VI   V      GK       AA+ VL   G+L  ++   +    + + +  Y D  +V D N +S K   H F+FAL +  +LL
  S:     3 KVAVLLAPGFEEAEAIVTLDILRRLHIDVETLACAESRAVVSYHDIPMVADSTLSERQQALFDAVVLPGGPQGSANLAA--NPAVI-AFVACHDAAGKLICPICSAAARVLGAHGLLKGRRYVCSGDLWKAVPEGVYVDAPVVEDGNLISGKGLGHVFDFALTLSARLL 168
>gi|21229186|ref|NP_635108.1| protease I [Methanosarcina mazei Go1] >gi|20907753|gb|AAM32780.1| Protease I [Methanosarcina mazei Go1] (144 aa)
Score = 102, Expect = 5.7e-03, Identities = 33/112 (29%), Positives = 55/112 (49%)
  Q:    64 EKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKL 175
           + VN + ++ L I GGKG +++  D++   I K       E  K +        VL   GV+  +K T   G  + +   G  Y D+ +V+D NFVS +SP   + F   +++ L
  S:    33 KDVNPEDYDILVISGGKGPEKMRLDKDALEITKHFF----EKNKPVAAICHGPQVLVSAGVIKGRKATCWIGIRDDIIAAGALYEDSEVVIDGNFVSSRSPDDLYAFGREMIKLL 143
>gi|194541456|ref|YP_002076489.1| transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain [Vibrio sp. Ex25] >gi|151940011|gb|EDN58837.1| transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain [Vibrio sp. Ex25] (228 aa)
Score = 102, Expect = 5.9e-03, Identities = 38/155 (24%), Positives = 74/155 (47%)
  Q:    38 VETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYS------DNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILYTK 192
           V T+S   +K+I  + G KI     I   +  + + L +        L+ +++     +    A D    W+ +  + + +LAE G+L  KK TT  G E  L K+Y       D N VVD+  ++      +++ AL ++  + ++  A  +A+ + Y++
  S:    68 VVTISVSDQKTITTEEGLKIGVDAWIG--DQPELDVLVLTSSYDMDALIENKDLIHFIQTTSKAAD----WMASNCSGAYLLAEAGLLNGKKATTWAGGENGLQKDYPAVDVQVDQNFVVDEGVITSNGSLVSYQAALKLLHLMTSESKAQEVADALQYSR 222
>gi|163767625|ref|ZP_02174635.1| intracellular protease, PfpI family [Anaeromyxobacter sp. K] >gi|196173387|gb|ACG74360.1| intracellular protease, PfpI family [Anaeromyxobacter sp. K] (188 aa)
Score = 102, Expect = 6.1e-03, Identities = 45/161 (27%), Positives = 72/161 (44%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTK----ITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSDNNIVVDKNFVSFKSP--FHAFEFALL 170
           RIA +      D ++ +P+D   +AG     V  EK K I    G K     T       V  + F+AL +PGG     L TD +   + ++V+     GK  +        +L E   +  K +T+ P  +  L   G  + D  +V D+N ++ + P    AF  A+L
  S:     3 RIAFIADDLFEDSELRVPWDRLRQAGHETVLVGLEKGKQI---RGKKQRETFTTDVAARDVTAEDFDALVVPGGYSPDHLRTDMD---MVRLVRTTFTAGKP-VAAVCHGPWMLVEADAIDGKTVTSWPSLKTDLINAGARWVDREVVEDENVITSRKPDDLEAFSDAIL 165
>gi|73748071|ref|YP_307310.1| DJ-1 family protein [Dehalococcoides sp. CBDB1] >gi|73659787|emb|CAI82394.1| DJ-1 family protein [Dehalococcoides sp. CBDB1] (180 aa)
Score = 102, Expect = 6.5e-03, Identities = 44/180 (24%), Positives = 86/180 (47%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYS--DNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           R A++ +    +++     DI  RA + V+ V   K        G +I     I+ +    +  L +PGG     +   +++RV+ ++++ A  E  K+L    A   VL+  GV+  K++   PG +  L KN +  D  + V+   ++ +SP  A +FAL +++     Q A  + +++L
  S:     3 RFAVLLAEGFEEIEFCTITDILRRADLEVKIVG-LKNDLTGGSRGIRIMPDMHIDDLKTTDYEVLVLPGGNP-GFINMGKDQRVL-ELIRTAHAE-NKYLAAICAGPAVLSRAGVIDGKEVAIYPGVKHLL-KNCTACDLRVKVEGRLITGRSPQAAMDFALTLMDMFAKPQSAKVVRDEML 179
>gi|118476497|ref|YP_893648.1| protease I, ThiJ/PfpI family protein [Bacillus thuringiensis str. Al Hakam] >gi|118415722|gb|ABK84141.1| protease I, ThiJ/PfpI family protein [Bacillus thuringiensis str. Al Hakam] (171 aa)
Score = 102, Expect = 6.5e-03, Identities = 41/152 (26%), Positives = 74/152 (48%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSG-TKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSDNNIVVDKN-FVSFKSP 161
           +IAI+ +    D +   P + + + G  + T+  EK K++  + G ++I   + I+ V+ + F+AL+IPGG     L  D  ER ++    F   + +K +F       +L     L  + +T     E  L   G N+ D  +VV +N  V+ + P
  S:     4 KIAILITDYFEDTEYTEPAEAFKQKGYELTTIEAEKGKTVHGKQGKSEIVIDKGIDDVSPENFDALFIPGGFSPDILRAD--ERFVHFSKAFM--DAEKPVFAICHGPQLLITAQTLEGRDVTGYKSIEVDLKNAGGNFHDKEVVVCQNQLVTSRQP 156
>gi|146310552|ref|YP_001175626.1| hypothetical protein Ent638_0891 [Enterobacter sp. 638] >gi|145317428|gb|ABP59575.1| DJ-1 family protein [Enterobacter sp. 638] (197 aa)
Score = 101, Expect = 7.3e-03, Identities = 42/178 (23%), Positives = 91/178 (51%)
  Q:    12 AIMC-SIESNDMDIVIPYDIWTRAGIIVET--VSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL-GKNYSDNNIVVDK--NFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           A++C +  S + + V   D+  RAGI V T  V+++   +I    G KI     + +V    ++ + +PGG KG +     R+  ++ + V+     G+       +A+TVL    +     +T  P  ++++  + + D  +V D   N ++ + P  + +FAL I++ ++ ++ A  +A+ ++
  S:     5 ALICLAPGSEETEAVTTIDLLVRAGIAVTTASVASDGNLTITCSRGVKILADAPLVEVADGDYDVIVLPGGLKGAECF---RDSPLLVETVRQFHLSGRIVATICASAATVLVPHQLFPVGNMTGFPTLKDQIPEEQWVDKRVVWDPRVNLLTSQGPGTSIDFALKIIDLVVGREKAHEVASSLV 186
>gi|124027868|ref|YP_001013188.1| protease I [Hyperthermus butylicus DSM 5456] >gi|123978562|gb|ABM80843.1| protease I [Hyperthermus butylicus DSM 5456] (194 aa)
Score = 101, Expect = 7.6e-03, Identities = 34/121 (28%), Positives = 58/121 (47%)
  Q:    61 EEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIA 181
           E +E+  LD ++ L IPGG+  +R    R  R   +I +   ++GK  +        +LA   V+  +++T  PG ++ L   G  Y D   V+D N V+ +      E   L ++ L  K +A
  S:    75 EAVER--LDSYDVLVIPGGRSPERA---RQHREAVEIARRMAEKGKP-IIAICHGPLLLASASVIRGRRVTGYPGIKDDLVNAGAEYVDAGAVLDGNIVTVRHTSSMGEGFRLFIQLLREKGLA 192
>gi|82407737|pdb|2AB0|A Chain A, Crystal Structure Of E. Coli Protein Yajl (Thij) >gi|82407738|pdb|2AB0|B Chain B, Crystal Structure Of E. Coli Protein Yajl (Thij) (205 aa)
Score = 101, Expect = 8.0e-03, Identities = 40/171 (23%), Positives = 83/171 (48%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVET--VSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL-GKNYSDNNIVVDK--NFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           S + + V   D+  R GI V T  V+++   +I    G K+     + +V   +++ + +PGG KG +     R+  ++ + VK     G+       A +TVL    +     +T  P  ++K+  + + D  +V D     ++ + P  A +F L I++ L+ ++ A  +A+ ++
  S:    13 SEETEAVTTIDLLVRGGIKVTTASVASDGNLAITCSRGVKLLADAPLVEVADGEYDVIVLPGGIKGAECF---RDSTLLVETVKQFHRSGRIVAAICAAPATVLVPHDIFPIGNMTGFPTLKDKIPAEQWLDKRVVWDARVKLLTSQGPGTAIDFGLKIIDLLVGREKAHEVASQLV 186
>gi|89107294|ref|AP_001074.1| hypothetical protein [Escherichia coli W3110] >gi|90111131|ref|NP_414958.4| conserved protein [Escherichia coli str. K-12 substr. MG1655] >gi|170021204|ref|YP_001726158.1| DJ-1 family protein [Escherichia coli ATCC 8739] >gi|170080010|ref|YP_001729330.1| hypothetical protein ECDH10B_0380 [Escherichia coli str. K12 substr. DH10B] >gi|6686342|sp|Q46948|THIJ_ECOLI Protein thiJ >gi|85674564|dbj|BAE76204.1| conserved hypothetical protein [Escherichia coli W3110] >gi|87081736|gb|AAC73527.2| conserved protein [Escherichia coli str. K-12 substr. MG1655] >gi|169756132|gb|ACA78831.1| DJ-1 family protein [Escherichia coli ATCC 8739] >gi|169887845|gb|ACB01552.1| conserved protein [Escherichia coli str. K12 substr. DH10B] (196 aa)
Score = 101, Expect = 8.0e-03, Identities = 40/171 (23%), Positives = 83/171 (48%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVET--VSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL-GKNYSDNNIVVDK--NFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           S + + V   D+  R GI V T  V+++   +I    G K+     + +V   +++ + +PGG KG +     R+  ++ + VK     G+       A +TVL    +     +T  P  ++K+  + + D  +V D     ++ + P  A +F L I++ L+ ++ A  +A+ ++
  S:    13 SEETEAVTTIDLLVRGGIKVTTASVASDGNLAITCSRGVKLLADAPLVEVADGEYDVIVLPGGIKGAECF---RDSTLLVETVKQFHRSGRIVAAICAAPATVLVPHDIFPIGNMTGFPTLKDKIPAEQWLDKRVVWDARVKLLTSQGPGTAIDFGLKIIDLLVGREKAHEVASQLV 186
>gi|1100872|gb|AAA82704.1| ThiJ >gi|1773108|gb|AAB40180.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein [Escherichia coli] (198 aa)
Score = 101, Expect = 8.0e-03, Identities = 40/171 (23%), Positives = 83/171 (48%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVET--VSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL-GKNYSDNNIVVDK--NFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           S + + V   D+  R GI V T  V+++   +I    G K+     + +V   +++ + +PGG KG +     R+  ++ + VK     G+       A +TVL    +     +T  P  ++K+  + + D  +V D     ++ + P  A +F L I++ L+ ++ A  +A+ ++
  S:    15 SEETEAVTTIDLLVRGGIKVTTASVASDGNLAITCSRGVKLLADAPLVEVADGEYDVIVLPGGIKGAECF---RDSTLLVETVKQFHRSGRIVAAICAAPATVLVPHDIFPIGNMTGFPTLKDKIPAEQWLDKRVVWDARVKLLTSQGPGTAIDFGLKIIDLLVGREKAHEVASQLV 188
>gi|188493183|ref|ZP_03000453.1| protein thiJ [Escherichia coli 53638] >gi|188488382|gb|EDU63485.1| protein thiJ [Escherichia coli 53638] (196 aa)
Score = 101, Expect = 8.0e-03, Identities = 40/171 (23%), Positives = 83/171 (48%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVET--VSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL-GKNYSDNNIVVDK--NFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           S + + V   D+  R GI V T  V+++   +I    G K+     + +V   +++ + +PGG KG +     R+  ++ + VK     G+       A +TVL    +     +T  P  ++K+  + + D  +V D     ++ + P  A +F L I++ L+ ++ A  +A+ ++
  S:    13 SEETEAVTTIDLLVRGGIKVTTASVASDGNLAITCSRGVKLLADTPLVEVADGEYDVIVLPGGIKGAECF---RDSTLLVETVKQFHRSGRIVAAICAAPATVLVPHDIFPIGNMTGFPTLKDKIPAEQWLDKRVVWDARVKLLTSQGPGTAIDFGLKIIDLLVGREKAHEVASQLV 186
>gi|75761741|ref|ZP_00741681.1| PROTEASE I [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|168141344|ref|ZP_02584573.1| protease I, ThiJ/PfpI family protein [Bacillus cereus G9842] >gi|74490772|gb|EAO54048.1| PROTEASE I [Bacillus thuringiensis serovar israelensis ATCC 35646] (171 aa)
Score = 101, Expect = 8.0e-03, Identities = 41/152 (26%), Positives = 72/152 (47%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIF-LQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSDNNIVVDKN-FVSFKSP 161
           +IAI+ +    D +   P + + + G  + T+  EK K++   Q  +++   + I+ V+ + F+AL+IPGG     L  D  ER +     F   + KK +F       +L     L  + +T     E  L   G N+ D  +VV +N  V+ + P
  S:     4 KIAILITDYFEDTEYTEPVEAFKQKGYELTTIEMEKGKTVHGKQEKSEVVIDKNIDGVSPENFDALFIPGGFSPDILRAD--ERFVRFSKAFM--DAKKPVFAICHGPQLLITAQTLEGRDVTGYKSIEVDLKNAGGNFHDTEVVVCQNQLVTSRQP 156
>gi|157145309|ref|YP_001452628.1| hypothetical protein CKO_01049 [Citrobacter koseri ATCC BAA-895] >gi|157082514|gb|ABV12192.1| hypothetical protein CKO_01049 [Citrobacter koseri ATCC BAA-895] (185 aa)
Score = 101, Expect = 8.1e-03, Identities = 40/166 (24%), Positives = 78/166 (46%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVL-GNKKITTAPGFEEKLGKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKL 175
           ++A++ +    + + V+  DI  R  I VET++  + +++       +     +       ++A+ +PGG +G   L    + +VI+ + +     GK       AA+ VL   G+L G + + +   +E      Y D  +V D N +S K   H F+FAL++  +L
  S:     3 KVAVLLAPGFEEAEAVVTIDILRRLNIDVETLACAESRAVVSYHDIPMVADNTLAGRLDTLYDAIVLPGGPQGSANLAA--SAQVIDFVSRHDA-AGKLICPVCSAAARVLGGNGLLKGRRYVCSGDLWENVTDGEYVDAPVVEDGNLLSGKGLGHIFDFALMLAARL 167
>gi|169862577|ref|XP_001837915.1| hypothetical protein CC1G_10336 [Coprinopsis cinerea okayama7#130] >gi|116501036|gb|EAU83931.1| hypothetical protein CC1G_10336 [Coprinopsis cinerea okayama7#130] (197 aa)
Score = 101, Expect = 8.2e-03, Identities = 45/161 (27%), Positives = 74/161 (45%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIE----------KVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKN--YSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQ 179
           + +M+  I YD   RAG+ V +     +      S     CS  +           +   DK + L IPGG      ++      + K+++   D+ KK++    A S + A    L  + IT+ P     L  +  YS++ +VV    V+ + P  AF FAL +VE L  K+
  S:    12 TEEMEFTITYDTLVRAGVQVVSAFVPAQSPGASVSPPAAKCSRGVRILPDSYLDPTECGPDKHDLLVIPGGAVGAATMS--ANATVQKLIQAYLDK-KKYVGMICAGS-LAARTAKLPKQPITSHPSVRGDLEADFEYSEDPVVVSGTLVTSRGPGTAFPFALTLVELLCGKE 180
>gi|15921126|ref|NP_376795.1| protease I [Sulfolobus tokodaii str. 7] >gi|15621911|dbj|BAB65904.1| 173aa long hypothetical protease I [Sulfolobus tokodaii str. 7] (173 aa)
Score = 101, Expect = 8.2e-03, Identities = 35/153 (22%), Positives = 69/153 (45%)
  Q:     9 IRIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSDNNIVVDKNFVSFKSP 161
           +++  +   E  D++++ P+      G        E    I  + G  +      + V ++ + AL IPGG+G +R+ T    + + +  +F  D  KK +        VL   GV+  +K+T+    ++ +   G  Y D  +V D+N +S + P
  S:     1 MKVLFIVGDEYEDIELLYPFYRVIEEGYQPVIAGKEAGAKIVGKHGYSVVADIAFKDVKVEDYLALVIPGGRGPERIRTLPEVKELTR--RFFID--KKPVAAICHGPQVLISAGVIKGRKVTSVASIKDDIVAAGGEYVDAPLVEDENLISSRHP 152
>gi|167368166|ref|ZP_02302306.1| intracellular protease, PfpI family [Rhodopseudomonas palustris TIE-1] >gi|192289899|ref|YP_001990504.1| intracellular protease, PfpI family [Rhodopseudomonas palustris TIE-1] >gi|192283648|gb|ACF00029.1| intracellular protease, PfpI family [Rhodopseudomonas palustris TIE-1] (187 aa)
Score = 101, Expect = 9.0e-03, Identities = 41/166 (24%), Positives = 83/166 (50%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTK----ITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKL 175
           R+AI+ +      ++ IP D    AG  V+ VS E+ + I   SG      +   +++  V  D ++A+ +PGG+    LL    + +  K++K   D GK  +     A  +L + G+   +K+T+    ++ +   G  + D+ +V D   ++ ++P     F+  I+E++
  S:     9 RVAILATHGFEQSELEIPRDRLKAAGAQVDIVSPEQGE-IRGWSGKDWGHLVKVDKQLSAVKADDYDAIVLPGGQINPDLLRVNQDAL--KLIKSFFDAGKT-VAAVCHAPWLLIDTGIAKGRKMTSYNSIKQDVINAGAKWEDSAVVTDNGVITSRNPGDLEAFSAKIIEEM 177
>gi|125524921|gb|EAY73035.1| hypothetical protein OsI_000882 [Oryza sativa (indica cultivar-group)] (386 aa)
Score = 100, Expect = 1.0e-02, Identities = 45/172 (26%), Positives = 77/172 (44%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVETVSNEKKK-SIFLQSGTKITCSEEIEKVNLDKFNA-LYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILY 190
           + +M+++   D+  RA   V   S E     I  + G +I          L+ F+  L   GG    + ++  NE+++  + K A    K +     A + VL   G+L  KK     G +E       ++ +VVD N ++      A EFA+  VEKLL + +A  +A  +L+
  S:   226 TEEMELITIIDVLRRADADVVVASAENAGVEIVARHGMRIITER------LNTFSPRLKQQGGTPGAKTMSS-NEKLVTLLKKQAA-ASKPYGAIGAATAHVLEPHGLLEGKKAADQDGGDE------CESRVVVDGNVITSGGTGTAMEFAVAAVEKLLGRDVAQRVAEGLLF 385
>gi|116620003|ref|YP_822159.1| PfpI family intracellular peptidase [Solibacter usitatus Ellin6076] >gi|116223165|gb|ABJ81874.1| intracellular protease, PfpI family [Solibacter usitatus Ellin6076] (237 aa)
Score = 100, Expect = 1.0e-02, Identities = 40/160 (25%), Positives = 75/160 (46%)
  Q:     2 IKHKVSNIRIAIMCSIESNDMDIVIPYDIWTRAGIIVETVS--NEKKKSIFL-QSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSDNNIVVDKNFVSFKSP 161
           +  ++   RIA + +     +++VIP      AG  V+ +S  +   + + L +  +++  ++ I + N D ++ L +PGG     LL  R      + V+ A D   K + +      VLA  G+L  + +T+ PG  + L   G  + D   V D N  + + P
  S:     1 MDQRLKGRRIAALAADGFEKVELVIPMKALQAAGAKVDVISLRHGNIRGVNLHEPASRVHVNKTIAEANPDDYDGLLLPGGFINPDLL--RQSAEAREFVR-AFDRAGKPIASLCHGPWVLASAGLLQGRTLTSWPGVRDDLVNAGATWLDQEFVRDGNLATSRGP 163
>gi|90023594|ref|YP_529421.1| putative transcriptional regulator [Saccharophagus degradans 2-40] >gi|89953194|gb|ABD83209.1| ThiJ/PfpI [Saccharophagus degradans 2-40] (219 aa)
Score = 100, Expect = 1.0e-02, Identities = 27/85 (31%), Positives = 50/85 (58%)
  Q:   108 WLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYS------DNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDILYTK 192
           +L +  + + +LA+ GVL  KK TT  G E+ L K +       D N+VVD N V+      +++ AL +++ L ++  A  +A+ + Y++
  S:   123 YLASNCSGAFLLAQAGVLDGKKATTWAGGEKDLQKQFPKVNVQVDTNVVVDGNIVTSNGSLVSYQAALTLLKLLSSESKAKEVADVLQYSR 213
>gi|114552481|ref|XP_001158152.1| PREDICTED: similar to DJ-1 isoform 4 [Pan troglodytes] (169 aa)
Score = 100, Expect = 1.1e-02, Identities = 42/175 (24%), Positives = 73/175 (41%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGK----NYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNI 184
           R  ++ +  + +M+ VIP D+  RAGI V       K  +       I     +E    +             + +L ++  R           +G      AG  + +  E+G     K+TT P  ++K+       YS+N +  D   ++ + P  +FEFAL IVE L  K++A  +
  S:     5 RALVILAKGAEEMETVIPVDVMRRAGIKVTIAGLAGKDPVQCSRDVVICPDASLEDAKKES---------AAVKEILKEQENR-----------KGLIAAICAGPTALLAHEIGF--GSKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSRGPGTSFEFALAIVEALNGKEVAAQV 161
>gi|49484116|ref|YP_041340.1| ThiJ/PfpI family protein [Staphylococcus aureus subsp. aureus MRSA252] >gi|81650811|sp|Q6GFI2|Y1965_STAAR Uncharacterized protein SAR1965 >gi|49242245|emb|CAG40952.1| ThiJ/PfpI family protein [Staphylococcus aureus subsp. aureus MRSA252] (171 aa)
Score = 100, Expect = 1.1e-02, Identities = 39/166 (23%), Positives = 71/166 (42%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKL 175
           ++AI+ + E  D++   P +    AG     + +     +F + G K+T    I +   + ++AL IPGG     L  D   R       F  ++   +    G    +L +   L  + +T      + L   G +  D ++VVD N V+ + P    +F   IV++L
  S:     4 KVAIILANEFEDIEYSSPKEALENAGFNTVVIGDTANSEVFGKHGEKVTVDVGIAEAKPEDYDALLIPGGFSPDHLRGDTEGRYGTFAKYFTKNDVPTFAICHG--PQILIDTDDLKGRTLTAVLNVRKDLSNAGAHVVDESVVVDNNIVTSRVPDDLDDFNREIVKQL 170
>gi|167040018|ref|YP_001663003.1| PfpI family intracellular peptidase [Thermoanaerobacter sp. X514] >gi|166854258|gb|ABY92667.1| intracellular protease, PfpI family [Thermoanaerobacter sp. X514] (168 aa)
Score = 100, Expect = 1.1e-02, Identities = 39/166 (23%), Positives = 72/166 (43%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAG--DEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKL 175
           +IAI+      + +++ PY      G  V  +  EK K    + G  +  +   + V  + ++A+ IPGG     +      R  N  + F    D+ +K +        ++A    L  KK+T+    ++ L   G  Y D  +VVD N ++ ++P     F   I+E +
  S:     3 KIAILIENMYEEPELLYPYYRLKEEGYEVHLIGPEKDKVYTGKHGYPMKSTHASKDVKAEDYDAVIIPGGYSPDHM------RRCNDTINFVKEMDKLQKTIAAICHGPWIMASACNLKGKKVTSFFSIKDDLINAGAQYVDEEVVVDGNLITSRTPNDLVAFVKAIIETV 167
>gi|147668899|ref|YP_001213717.1| DJ-1 family protein [Dehalococcoides sp. BAV1] >gi|146269847|gb|ABQ16839.1| DJ-1 family protein [Dehalococcoides sp. BAV1] (180 aa)
Score = 100, Expect = 1.1e-02, Identities = 44/180 (24%), Positives = 86/180 (47%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKNYS--DNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           R A++ +    +++     DI  RA + V+ V   K        G +I     I+ +    +  L +PGG     +   +++RV+ ++++ A  E  K+L    A   VL+  GV+  K++   PG +  L KN +  D  + V+   ++ +SP  A +FAL +++     Q A  + +++L
  S:     3 RFAVLLAEGFEEIEFCTITDILRRADLEVKIVG-LKNDLTGGSRGIRIMPDIHIDDLKTTDYEVLVLPGGNP-GFINMGKDQRVL-ELIRTAHAE-NKYLAAICAGPAVLSRAGVIDGKEVAIYPGVKHLL-KNCTACDLRVKVEGRLITGRSPQAAMDFALTLMDMFAKPQSAKVVRDEML 179
>gi|168462532|ref|ZP_02696463.1| ThiJ/PfpI domain protein [Salmonella enterica subsp. enterica serovar Newport str. SL317] >gi|168477091|ref|ZP_02706114.1| hypothetical protein Salmoentericaenterica_20741 [Salmonella enterica subsp. enterica serovar Virchow str. SL491] >gi|195633893|gb|EDX52245.1| ThiJ/PfpI domain protein [Salmonella enterica subsp. enterica serovar Newport str. SL317] (185 aa)
Score = 100, Expect = 1.2e-02, Identities = 39/167 (23%), Positives = 76/167 (45%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGKN-YSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLL 176
           ++A++ +    + + ++  DI  R  I VET++  + +++       +     + +     F+A+ +PGG +G   L    N  VI  + +     GK       AA+ VL   G+L  ++   +    + + +  Y D  +V D N +S K   H F+F L +  +LL
  S:     3 KVAVLLAPGFEEAEAIVTLDILRRLHIDVETLACAESRAVVSYHDIPMVADSTLSERQQALFDAVVLPGGPQGSANLAA--NPAVIAFVARHDA-AGKFICPICSAAARVLGAHGLLKGRRYVCSGDLWKAVPEGVYVDAPVVEDGNLISGKGLGHVFDFGLTLSARLL 168
>gi|123472608|ref|XP_001319497.1| DJ-1 family protein [Trichomonas vaginalis G3] >gi|121902281|gb|EAY07274.1| DJ-1 family protein [Trichomonas vaginalis G3] (187 aa)
Score = 100, Expect = 1.2e-02, Identities = 41/180 (22%), Positives = 83/180 (46%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVS-NEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAE-LGVLGNKKITTAPGFE---EKLGKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           ++ ++ +     M++V P D+  RAG  V+  +   +   +    G KI        V  + ++ +  PGG  G + L  +++   + + +K     GK       A   VLA+  G++  KK    PG +    + G   + + +  D N ++ + P  + +F L ++E L++K+ A  +A   L
  S:     3 KVLVLAATGFEPMELVNPTDLLRRAGADVKVAAVGTEGLQVDAAHGIKIVADVLFADVKNETYDLVVSPGGMPGTKNLAANQD---VVEFIKRHEKAGKLVAAICAAPGFVLAQACGIMKGKKGCGYPGCDGPIAETGGEITTDAVTRDGNIITSRGPGTSQQFGLALIEALISKEKAAEVAKGAL 185
>gi|111020543|ref|YP_703515.1| protease [Rhodococcus sp. RHA1] >gi|110820073|gb|ABG95357.1| probable protease [Rhodococcus sp. RHA1] (187 aa)
Score = 100, Expect = 1.2e-02, Identities = 43/175 (24%), Positives = 78/175 (44%)
  Q:     1 MIKHKVSNIRIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNE----KKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGK-GCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKL 175
           M+   +   RIAI+ +     +++  P D   +AG   E +S +    + ++  L +    T    +  V +D ++AL +PGG     +L  +  E  ++ +  F G      +   G  +  L E GV   + +T+ P     L   G +  D  + +D N +S +SP     F   IVE+ 
  S:     1 MMAMTLQGKRIAILAADGVERVELERPRDAVHQAGGHTELLSPKTGEIQARNNDLDAAGTFTVDRAVSDVAVDDYDALLLPGGTVNPDKLRIE--EAAVSFVRDFVGSGKPVGVICHGPWT--LVEAGVAKGRTLTSYPSLRTDLRNAGADVVDEEVAIDGNLISSRSPDDLPAFCQAIVEQF 179
>gi|170767765|ref|ZP_02902218.1| protein ThiJ [Escherichia albertii TW07627] >gi|170123253|gb|EDS92184.1| protein ThiJ [Escherichia albertii TW07627] (196 aa)
Score = 99, Expect = 1.2e-02, Identities = 39/171 (22%), Positives = 82/171 (47%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVET--VSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL-GKNYSDNNIVVDK--NFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           S + + V   D+  R GI V T  V+++   +I    G K+     + +V   +++ + +PGG KG +     R+  ++ + VK     G+         +TVL    +     +T  P  ++K+  + + D  +V D     ++ + P  A +F L I++ L+ ++ A  +A+ ++
  S:    13 SEETEAVTTIDLLVRGGIKVTTASVASDGNLTITCSRGVKLLADAPLVEVADGEYDVIVLPGGIKGAECF---RDSTLLVETVKQFHRSGRIVAAICATPATVLVPHDIFPIGNMTGFPTLKDKIPAEQWQDKRVVWDARVKLLTSQGPGTAIDFGLKIIDLLVGREKAHEVASQLV 186
>gi|114552485|ref|XP_001158209.1| PREDICTED: similar to DJ-1 isoform 5 [Pan troglodytes] (155 aa)
Score = 99, Expect = 1.2e-02, Identities = 45/175 (25%), Positives = 76/175 (43%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGK-GCQRLLTDRNERVINKIVKFAGDEGKKWLFTA---GAASTVLAELGVLGNKKITTAPGFEEKLGK----NYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNI 184
           R  ++ +  + +M+ VIP D+  RAG                                   ++ + +PGG  G Q L        + +I+K    E +K L  A   G  + +  E+G     K+TT P  ++K+       YS+N +  D   ++ + P  +FEFAL IVE L  K++A  +
  S:     5 RALVILAKGAEEMETVIPVDVMRRAG---------------------------------GPYDVVVLPGGNLGAQNL---SESAAVKEILK--EQENRKGLIAAICAGPTALLAHEIGF--GSKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSRGPGTSFEFALAIVEALNGKEVAAQV 147
>gi|16081584|ref|NP_393943.1| intracellular proteinase I [Thermoplasma acidophilum DSM 1728] >gi|10639635|emb|CAC11607.1| probable intracellular proteinase I [Thermoplasma acidophilum] (186 aa)
Score = 99, Expect = 1.2e-02, Identities = 40/155 (25%), Positives = 72/155 (46%)
  Q:     9 IRIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFL-------------QSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSDNNIVVDKNFVSFKS-PFH 163
           +R+ I+       ++++ P       G  V+  + EKKK   +             + G K+      + V+  K++AL IPGG+  + +   RN++   +IVK+  ++    +     A   LA  GVL  +     P     +   G  + D   V+D N VS ++ P H
  S:     2 VRVLILTGDAGESLEVMYPLQRMKEEGFEVDVAAPEKKKIQLVVHDFEEGFDTYTEKPGYKLQADLAFKDVDPSKYDALIIPGGRAPEYI---RNDKDFIRIVKYFFEKHSP-VAELCHAPLALAAAGVLKGRTTAAYPALAPDVAIAGGQFVDGAAVIDGNLVSARAWPDH 169
>gi|74310993|ref|YP_309412.1| hypothetical protein SSON_0401 [Shigella sonnei Ss046] >gi|73854470|gb|AAZ87177.1| 4-methyl-5(beta-hydroxyethyl)-thiazole monophosphate synthesis [Shigella sonnei Ss046] (198 aa)
Score = 99, Expect = 1.3e-02, Identities = 39/171 (22%), Positives = 82/171 (47%)
  Q:    19 SNDMDIVIPYDIWTRAGIIVET--VSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGG-KGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL-GKNYSDNNIVVDK--NFVSFKSPFHAFEFALLIVEKLLNKQIATNIANDIL 189
           S + + V   D+  R GI V T  V+++   +I    G K+     + +V   +++ + +PGG KG +     R+  ++ + VK     G+       A +TVL    +     +T  P  ++K+  + + D  +V D     ++ + P  A +F L I++ L+ ++    +A+ ++
  S:    15 SEETEAVTTIDLLVRGGIKVTTASVASDGNLAITCSRGVKLLADAPLVEVADGEYDVIVLPGGIKGAECF---RDSTLLVETVKQFHRSGRIVAAICAAPATVLVPHDIFPIGNMTGFPTLKDKIPAEQWQDKRVVWDARVKLLTSQGPGTAIDFGLKIIDLLVGREKTHEVASQLV 188
>gi|75763840|ref|ZP_00743490.1| ThiJ/PfpI family protein [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|168140789|ref|ZP_02584018.1| ThiJ/PfpI domain protein [Bacillus cereus G9842] >gi|74488668|gb|EAO52234.1| ThiJ/PfpI family protein [Bacillus thuringiensis serovar israelensis ATCC 35646] (190 aa)
Score = 99, Expect = 1.3e-02, Identities = 42/176 (23%), Positives = 85/176 (48%)
  Q:     9 IRIAIMCSIESNDMDIVIPYDIWTRAGII-------VETVSNEKKKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKLGK---NYSDNNIVVDKNFVSFKSPFHAFEFALLIVEKLLNKQIATNI 184
           ++I I+C     D+D+ +P+D+  R  ++       V+ +  EK       SG +I  +  I   ++   +A+    GKG Q L   +N+  +N I     D  ++ + +  + S +L    +L  KK TT P   E+L +   +  + + V + N  +    F A + ++ I+  L+N+ +   +
  S:     1 MKIGIVCFDNFTDIDVFLPWDLLNRVRLVGGISDWNVQLLGTEKTH--ISVSGLRIPMTGSIS--DIPSADAVIFGSGKGVQNLY--KNQEYLNSI---HIDPQRQLIGSMCSGSLLLGAKKLLTGKKATTYPSVVEQLKEFEVDVIEQSFVNEGNISTAAGCFAAQDLSVWIIRTLINEDMVDTV 177
>gi|56964374|ref|YP_176105.1| general stress protein GSP18 [Bacillus clausii KSM-K16] >gi|56910617|dbj|BAD65144.1| general stress protein GSP18 [Bacillus clausii KSM-K16] (172 aa)
Score = 99, Expect = 1.3e-02, Identities = 39/152 (25%), Positives = 73/152 (48%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQSGT-KITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSDNNIVV-DKNFVSFKSP 161
           ++A++ +    D++   P +  T AG  + T+  E  K++  + G  K+T  + I+ V++D F+AL +PGG    +L  D  +R +     FA  +  K +        +L    VL  + +T        L   G  + D  +VV + N V+ ++P
  S:     4 KVAVLITDLFEDVEYTDPKESLTEAGHELVTIEKEAGKTVTGKQGNAKVTIDKSIDDVHVDDFDALLLPGGFSPDQLRAD--DRFVEFTKAFA--QAGKPIMAICHGPQLLINADVLKGRTVTGVKPIVPDLKNAGAIFKDEEVVVCNNNLVTSRTP 156
>gi|194688460|gb|ACF78314.1| unknown [Zea mays] (387 aa)
Score = 99, Expect = 1.4e-02, Identities = 39/166 (23%), Positives = 80/166 (48%)
  Q:    10 RIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEKKKSIFLQS---------------GTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPGFEEKL---GKNYSDNNIV----VDKNFVSFKSPFHAFEFALLIVEKL 175
           ++ ++C     D ++++P+      G+ V+ V   KK     ++               G   T +   +++   +++ L IPGG+  + L  D  E+V++ +  F+G   KK + +      +LA   V+ N+  T  P  +  L   G  + + + +    VD N ++  +     EF  L V+ L
  S:     5 KVLMLCGDYMEDYEVMVPFQALQAYGVSVDAVCPSKKAGDICRTAVHQLTGHQTYSETKGHNFTLNASFDEITASEYDGLVIPGGRAPEYLAMD--EKVLDLVRMFSG--AKKPIASVCHGQLILAAARVVENRTCTAFPAVKPVLVAAGAKWEEPDTMAKCTVDGNLITAATYNSHPEFISLFVKAL 188
Score = 96, Expect = 2.7e-02, Identities = 34/129 (26%), Positives = 61/129 (47%)
  Q:     7 SNIRIAIMCSIESNDMDIVIPYDIWTRAGIIVETVSNEK---------------KKSIFLQSGTKITCSEEIEKVNLDKFNALYIPGGKGCQRLLTDRNERVINKIVKFAGDEGKKWLFTAGAASTVLAELGVLGNKKITTAPG 135
           S+ RI  +C     D ++++P+      G  V+ V  +K                ++   + G   T +     V+   ++AL +PGG+  + L    N++VI+ +  FA  E  K + +      +L+  GVL  KK T  P 
  S:   195 SDKRILFLCGDYMEDYEVMVPFQALQALGCHVDAVCPDKGAGETCPTAIHDFEGDQTYSEKPGHDFTLTASFGSVDASSYDALVVPGGRAPEYLAL--NDKVISLVKAFA--ESGKPIASICHGQQILSAAGVLKGKKCTAYPA 334