>gi|26553523|ref|NP_757457.1| heat-inducible transcription repressor [Mycoplasma penetrans HF-2] >gi|38372374|sp|Q8EWX9|HRCA_MYCPE Heat-inducible transcription repressor hrcA >gi|26453529|dbj|BAC43861.1| heat-inducible transcription repressor [Mycoplasma penetrans HF-2] (338 aa)
Score = 1522, Expect = 4.4e-167, Identities = 338/338 (100%), Positives = 338/338 (100%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEKGWK 338
           MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEKGWK
  S:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEKGWK 338
>gi|31544558|ref|NP_853136.1| heat-inducible transcription repressor [Mycoplasma gallisepticum R] >gi|31541403|gb|AAP56704.1| HrcA [Mycoplasma gallisepticum R] (362 aa)
Score = 635, Expect = 2.6e-64, Identities = 145/333 (43%), Positives = 223/333 (66%)
  Q:     3 EITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPN-ISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEK 335
           ++T+RQ  +LK I+ +Y++TA  VGSK+++EKY  N +S+AT+RN+M+ LEK   +EK HTS+GR+P+  GY++YE N ++  I+ E LK KL  +   R  SID VIE+S + I+  T LP +  +  +  LLKR+D+++IN  +A++++++S G + K  I +++     D+S C++IFNDRL+D P  E+  K+ ++K I++ KV EYEFV+Q ++  IF I  K    + G   L+  PEF D  KL EIL +LE+TSIWEQI+F Q +TG  ++ITFG ++  E I  A T +   EQNK ++ +V P R++Y KIKGLL  +K + EK
  S:    17 KLTERQILILKAIINEYISTATAVGSKIILEKYFNNEVSSATIRNEMSVLEKEKYIEKPHTSAGRIPTIKGYQYYEANLAETKIS-ERLKQKLMAILNKRYHSIDEVIEQSVEFINNVTNLPSVITKFKSYDLLKRMDLIKINNNTAIILIVSSSGEVIKKTIKYQNSIQYNDVSTCVQIFNDRLVDTPFIELKEKLTAIKEIVRTKVHEYEFVMQRIVNYIFDINEKSTINIKGTKKLVIHPEFHDHNKLSEILNLLENTSIWEQISFMQQKTG-KSVITFGQDIGIEGISVASTLIE-TEQNKHQIAIVGPNRMEYGKIKGLLNILKEQVEK 347
>gi|46576415|sp|Q7NBC5|HRCA_MYCGA Heat-inducible transcription repressor hrcA (349 aa)
Score = 635, Expect = 3.1e-64, Identities = 145/333 (43%), Positives = 223/333 (66%)
  Q:     3 EITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPN-ISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEK 335
           ++T+RQ  +LK I+ +Y++TA  VGSK+++EKY  N +S+AT+RN+M+ LEK   +EK HTS+GR+P+  GY++YE N ++  I+ E LK KL  +   R  SID VIE+S + I+  T LP +  +  +  LLKR+D+++IN  +A++++++S G + K  I +++     D+S C++IFNDRL+D P  E+  K+ ++K I++ KV EYEFV+Q ++  IF I  K    + G   L+  PEF D  KL EIL +LE+TSIWEQI+F Q +TG  ++ITFG ++  E I  A T +   EQNK ++ +V P R++Y KIKGLL  +K + EK
  S:     4 KLTERQILILKAIINEYISTATAVGSKIILEKYFNNEVSSATIRNEMSVLEKEKYIEKPHTSAGRIPTIKGYQYYEANLAETKIS-ERLKQKLMAILNKRYHSIDEVIEQSVEFINNVTNLPSVITKFKSYDLLKRMDLIKINNNTAIILIVSSSGEVIKKTIKYQNSIQYNDVSTCVQIFNDRLVDTPFIELKEKLTAIKEIVRTKVHEYEFVMQRIVNYIFDINEKSTINIKGTKKLVIHPEFHDHNKLSEILNLLENTSIWEQISFMQQKTG-KSVITFGQDIGIEGISVASTLIE-TEQNKHQIAIVGPNRMEYGKIKGLLNILKEQVEK 334
>gi|13507863|ref|NP_109812.1| heat-inducible transcription repressor [Mycoplasma pneumoniae M129] >gi|2495332|sp|P75351|HRCA_MYCPN Heat-inducible transcription repressor hrcA >gi|1673678|gb|AAB95678.1| HrcA-like protein [Mycoplasma pneumoniae M129] (351 aa)
Score = 627, Expect = 2.4e-63, Identities = 138/335 (41%), Positives = 221/335 (65%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDE--NLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIK--SKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDE--VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEK 335
           MK +T RQ ++LK I+ +Y+A   PVGSK++ +KY  N+S  T+RN+MA LEK G L+KNH SSGR+PS  GY++Y K  +K   ND+  NLK +LR +   +  +ID +IE   K I+E   LP++    +++ +LK+ID++ +++  A+++++++ GN+ K  I + +    +DI +C+RIFNDR+ID    +IA  +D +K II+ KV EY++V+ E++ ++F  +   +  K V+G   L   PEF + E+L  IL +LE TS+W+Q+AF  NQ    T ITFGD+  +  E++  A T +N   ++K +L +V PTR+DY K+K LL  +K E E+
  S:     1 MKNLTTRQAQILKAIINEYIAYPVPVGSKLLTKKYFKNLSGGTLRNEMAVLEKEGYLKKNHISSGRIPSQLGYQYYVKLLTK---NDDKSNLKTRLRAIILQKHKTIDEIIELGVKFINEMVNLPVVLTHFSSDEVLKKIDLIMLDQSCALLLLVSASGNVFKKTISYANQRQFEDIMVCVRIFNDRIIDTRFCDIAQHLDVLKEIIRSKVHEYQYVIDEILFKLFNFEEFQQARKQVYGIHYLAQQPEFANQERLTRILNLLEDTSVWQQMAF-MNQNNQTTNITFGDKLGLEGEEVSVASTLINTTNESKHQLAIVGPTRMDYQKVKALLLTLKEEIEE 337
>gi|12045057|ref|NP_072867.1| heat-inducible transcription repressor [Mycoplasma genitalium G37] >gi|1351507|sp|P47447|HRCA_MYCGE Heat-inducible transcription repressor hrcA >gi|3844803|gb|AAC71423.1| heat-inducible transcription repressor HrcA, putative [Mycoplasma genitalium G37] >gi|166078679|gb|ABY79297.1| heat-inducible transcription repressor HrcA, putative [synthetic Mycoplasma genitalium JCVI-1.0] (343 aa)
Score = 613, Expect = 1.0e-61, Identities = 140/335 (41%), Positives = 218/335 (65%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKS-KMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEK 335
           MK +T RQ ++LK I+ +Y+A A PVGSK++ +KY  N+S  T+RN+MA LEK G L+KNH SSGRVPS  GY++Y K  +     ++ LK +LR+V   +  +ID VIE   K I+E   LP++    +++ +LK+ID++ ++K  A+ +++++ G + K  I + +    +DI IC+RIFNDR+ID    EI  +++ +K II+ KV EY++V+ E++ ++F +   +  K ++G   L   PEF + EKL +IL +LE TS+W+Q+AF  NQT   T I FGD++  ++I  A T +N   + K +L +V PTR+DY KIK LL  +K E EK
  S:     1 MKNLTPRQAQILKAIINEYIAYAIPVGSKLLTKKYFKNLSGGTLRNEMAALEKKGFLKKNHISSGRVPSQIGYQYYVKVLNVSNTTND-LKTRLRSVILQQHKTIDEVIELGVKFINEIINLPVVLTNFSSDEVLKKIDLIILDKSFALFLLVSASGKVFKKTISYANQRQFEDIVICVRIFNDRIIDTRFSEINNQLEVLKEIIRTKVHEYQYVIDEILFKLFDLDQIEANKKIYGIQYLAKQPEFANQEKLTKILNLLEDTSVWQQMAFI-NQTNQKTNIVFGDQLGFKEISVASTLINTTSEAKHQLAIVGPTRMDYQKIKALLTTLKEEIEK 334
>gi|13357983|ref|NP_078257.1| heat-inducible transcription repressor [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|170761971|ref|YP_001752505.1| heat-inducible transcription repressor HrcA [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171920371|ref|ZP_02931701.1| heat-inducible transcription repressor HrcA [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|183508509|ref|ZP_02958037.1| heat-inducible transcription repressor HrcA [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186701754|ref|ZP_02971439.1| heat-inducible transcription repressor HrcA [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|189028275|sp|B1AJ61|HRCA_UREP2 Heat-inducible transcription repressor hrcA >gi|10720040|sp|Q9PQ68|HRCA_UREPA Heat-inducible transcription repressor hrcA >gi|11356859|pir||F82892 heat-inducible transcription repressor UU421 [imported] - Ureaplasma urealyticum >gi|6899410|gb|AAF30832.1|AE002139_5 heat-inducible transcription repressor [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168827548|gb|ACA32810.1| heat-inducible transcription repressor HrcA [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171902803|gb|EDT49092.1| heat-inducible transcription repressor HrcA [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|182675939|gb|EDT87844.1| heat-inducible transcription repressor HrcA [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186701027|gb|EDU19309.1| heat-inducible transcription repressor HrcA [Ureaplasma parvum serovar 6 str. ATCC 27818] (357 aa)
Score = 529, Expect = 5.5e-52, Identities = 126/333 (37%), Positives = 212/333 (63%)
  Q:     3 EITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYIN-DENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQI---KSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEK 335
           +++ RQK++LK IV++Y  +A PV SK++++K   + S+AT+RN+M FLEK GL+EK H S GRVPS  GY FY KN      N  +N K++L  + + R  +ID ++  +  II+E+T+LP +  + +++ LLKRID+V+IN  SA+V+++TS  N+  + I    ++   D+  C  + ++RL+D  +  I++K+D +  I++ K++E E+   +++ R+F     K  +    +G   L    EF+D +KL ++L +LE ++IW+QIA  +   G    I  G+E+ HE +  A T +N+   N  ++ +V PTR+DY+KIK LL+F+K E EK
  S:    15 KLSDRQKKVLKSIVDEYTISATPVSSKLLVQKEFKDQSSATIRNEMMFLEKNGLIEKQHISGGRVPSLKGYDFYNKNLINKNNNVSDNFKMRLHKILSKRYSNIDEILNAAVSIINETTQLPAVVTKTSSDELLKRIDLVKINDNSALVLIVTSSENILTHSIKLDKNTKFNDLQTCFSVLDERLVDTKLSLISSKLDLIVDIVRNKLEEVEYYFSKIVHRVFDFYAYKPNIDSKTYGVKYLTKHSEFEDQQKLNDLLNLLEDSTIWQQIALNKKTDGLAK-IMLGNEIGHEHLAIATTQINLANTNH-QITVVGPTRMDYAKIKALLDFLKIEIEK 349
>gi|160915811|ref|ZP_02078019.1| hypothetical protein EUBDOL_01827 [Eubacterium dolichum DSM 3991] >gi|158432287|gb|EDP10576.1| hypothetical protein EUBDOL_01827 [Eubacterium dolichum DSM 3991] (336 aa)
Score = 487, Expect = 4.4e-47, Identities = 110/331 (33%), Positives = 202/331 (61%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKI-ENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDE---VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFE 334
           +T+RQ ++ K IV+ +  TA PVGSK +++    + S+AT+RN+MA LE++GLLEK HTSSGR+PS+ GY+FY ++  +  + D+++K  L+ VF++R  SI+ ++++SC I+S+ T L  + +   +   LL+ I ++ + ++SA+ I +T  G+      HF  D  ++DI  C  + ND+L   PI ++  ++  ++ ++   V  +E + +  +    +  ++ +    GQS++L  PEF D EKLKE++++LE +S++ QIA   N  G N  I  G E   V  +++    +   I +  + +L++V PTR+ Y+++  L+E++    E
  S:     2 LTERQIKIFKAIVDVFTKTAEPVGSKALMDVLDFSCSSATIRNEMAALEEIGLLEKTHTSSGRIPSSKGYRFYVEHLMEKQL-DDSVKNSLQKVFSERHYSIEEIVKKSCDILSQMTSLTSVVLGPESRSQLLQHIQLIPLTQRSAVAIFVTDHGHTENKTFHFNTDVSIEDIKTCTDLLNDKLSGTPICDVVDRMREIEPLLASHVARHEVLFEAFVNAFMRFATENV-YCSGQSNMLYQPEFADIEKLKELMKMLEDSSLFRQIA---NHEG-NMAIEIGGEHELVQVDNVAVISSKFRIGDNEQGELMVVGPTRMQYNRVVALMEYMSKVIE 330
>gi|66880189|ref|ZP_00405173.1| COG1420: Transcriptional regulator of heat shock gene [Mycoplasma genitalium G-37] (265 aa)
Score = 486, Expect = 4.8e-47, Identities = 108/265 (40%), Positives = 174/265 (65%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKS-KMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIW 265
           MK +T RQ ++LK I+ +Y+A A PVGSK++ +KY  N+S  T+RN+MA LEK G L+KNH SSGRVPS  GY++Y K  +     ++ LK +LR+V   +  +ID VIE   K I+E   LP++    +++ +LK+ID++ ++K  A+ +++++ G + K  I + +    +DI IC+RIFNDR+ID    EI  +++ +K II+ KV EY++V+ E++ ++F +   +  K ++G   L   PEF + EKL +IL +LE TS+W
  S:     1 MKNLTPRQAQILKAIINEYIAYAIPVGSKLLTKKYFKNLSGGTLRNEMAALEKKGFLKKNHISSGRVPSQIGYQYYVKVLNVSNTTND-LKTRLRSVILQQHKTIDEVIELGVKFINEIINLPVVLTNFSSDEVLKKIDLIILDKSFALFLLVSASGKVFKKTISYANQRQFEDIVICVRIFNDRIIDTRFSEINNQLEVLKEIIRTKVHEYQYVIDEILFKLFDLDQIEANKKIYGIQYLAKQPEFANQEKLTKILNLLEDTSVW 265
>gi|167755874|ref|ZP_02428001.1| hypothetical protein CLORAM_01391 [Clostridium ramosum DSM 1402] >gi|167704813|gb|EDS19392.1| hypothetical protein CLORAM_01391 [Clostridium ramosum DSM 1402] (350 aa)
Score = 482, Expect = 1.7e-46, Identities = 107/334 (32%), Positives = 192/334 (57%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKI-ENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKID-SMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSH-EDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEKGW 337
           +T RQ  + K IV++++ TA PVGSK ++ KY    S+AT+RN+M+FLE+ G LEK HTSSGRVPS  GY+FY  N +K  + DE +K ++  +F+DR   ++ +I ESC+++SE T L  + +  +++E  L++I++V +N      I+IT+ G +   +     +  + D+  C+ + ND LI  PI ++A +++  +K ++  K+KE+E +    +E   +  S  +    G+ ++L  PE+ D  KL+ I+   E++ +W  +    ++ G    I     ++  ED+          E+ K  + ++ PTR+ Y K+  L+E+I    E+ +
  S:     6 LTARQLLVFKCIVDEFIETAEPVGSKALMTKYQLPYSSATIRNEMSFLEEYGYLEKTHTSSGRVPSVEGYRFYVDNLAKRDL-DEGIKNQVAQIFSDRHRGLNEIIHESCEMLSELTHLTSVVLGPDSSEDTLQQINIVPLNDNRVTAIIITNQGYVENKVFDLNRNHKIDDLVSCVAVMNDLLIGTPIDQVAFRLERDVKPVLSAKIKEHEELFNAFLEAFVRFASSNV-YFSGKENMLYQPEYNDVNKLRRIVSAFENSQVWNALQPLSDEEGVTVRIGSDSPINEIEDVSVISASFRTGERTKGSISVIGPTRMPYEKVVSLVEYISRNIEEAF 340
>gi|110005393|emb|CAK99716.1| putative transcription repressor transcription regulator protein [Spiroplasma citri] (348 aa)
Score = 474, Expect = 1.3e-45, Identities = 107/335 (31%), Positives = 208/335 (62%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENN-TEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTL-ITFGDEV--SHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEKGWK 338
           +TQRQ+ +LK IVE+Y  TA PVGSK ++   + + S+AT+RN+ A LEK G LEK H SSGR+PST GY++Y  N      N +++K ++  +F +R MSI+ +++++ +I+SE T L  + +  N  E LLK+I+++ I++  A+V+ + ++G++   +     +S + D+ I + +FN RL +  I +I TK + ++ I++++VK YE++L++ +  +  I      T HG   +L  PE+ + E++K++++++E+ S ++    +QN    N + I  G+E   +++D+    T   +++  +  + +V P R++Y K+  +LE++     + ++
  S:     2 LTQRQENILKVIVEEYTKTAQPVGSKAIMASPLIDSSSATIRNECAILEKEGFLEKEHASSGRIPSTKGYRYYVDNLMVEK-NIDDIKNRIEALFVNRNMSINDILDQTGQILSEMTNLTTVVVGTNFQEKLLKKIELLPISETQAVVVFVLTNGHVENKMFTIDKNSSMNDLKISVELFNTRLENTKITDIPTKFEVIRPILEQQVKHYEYILKQFVNALTSIVKPSYST-HGIQYMLQNPEYNNPERIKQVIRLIETISPFDYFKKQQNNPNENLVSIQIGNETGFNNDDMALLTTTYKVDDMQEGGIALVGPKRLEYDKLYEVLEWLAYRIREAYQ 338
>gi|50365235|ref|YP_053660.1| heat inducible transcription repressor [Mesoplasma florum L1] >gi|61213414|sp|Q6F147|HRCA_MESFL Heat-inducible transcription repressor hrcA >gi|50363791|gb|AAT75776.1| heat inducible transcription repressor [Mesoplasma florum L1] (342 aa)
Score = 468, Expect = 5.9e-45, Identities = 124/326 (38%), Positives = 200/326 (61%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMI--KIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSI--WEQIAFKQNQTGSNTLITFGDEVSHE--DIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFI 329
           +++RQ ++LK IV +Y+ T   V SK + E     +S+AT+RND A LE++  LEK HTSSGRVPST GY++Y  +  +    +E+LK  L+++   R   I+ V+E++ +IISE TK+  I  K   N+E+++K+ID++ +++  A VI I S+G +   + + KD S L D+SI I+IF+D L+D P+KEI   I  ++  ++  VK Y+ +L+  +  I Q K    K + G  ++L  PEF DT+KL++++ I+E+ S   W  +++  NQ         G+E+S +  DI   +T +   EQ  T L +V P RVDYS+   L+  I
  S:     2 LSERQAKILKVIVSEYIKTNQAVSSKRIQELLNIKVSSATIRNDSAALEEMNFLEKQHTSSGRVPSTKGYRYYVDHLMEFDDYNESLKENLKSILFQRGTKIENVLEQASQIISEMTKMTAIVTKQNLNSELMVKKIDLIPLSETMASVIFILSNGEMQNQLFNLKDIS-LSDLSISIKIFSDCLVDTPVKEIENNISLIRPNLETTVKNYDLILETFMSNILQTKESK-KEIVGMKNMLENPEFNDTDKLRKVINIMENMSPFDWFDVSYSSNQKMIQISTKIGEEISEDLSDISIVETAIK-TEQGSTMLTLVGPKRVDYSQANQLINLI 330
>gi|83319975|ref|YP_424351.1| heat-inducible transcription repressor HrcA [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|108935927|sp|P71498|HRCA_MYCCT Heat-inducible transcription repressor hrcA >gi|83283861|gb|ABC01793.1| heat-inducible transcription repressor HrcA [Mycoplasma capricolum subsp. capricolum ATCC 27343] (340 aa)
Score = 441, Expect = 8.2e-42, Identities = 124/326 (38%), Positives = 196/326 (60%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYIND-ENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLP--MIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSI--WEQIAFKQNQTGSNTLITFGDEVS--HEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFI 329
           +T+RQ ++L+ IVE+++ T  PVGSK ++E     IS+AT+RN+ A LE  G LEK HTSSGR PST GY++Y  N  K    D   LK+ L  +   R   ID  I  + +IISE TK+   +IK +N   + LK+I+++ +++  A V+ I SDG++   + + KD S L D+ I I++F+D L+D  + EI   ++ +K  +   +K+Y++VL   I  I + K++  K  HG   +L  PEF DT KLK  ++++E  S   W  IA++ N+  +   I  G+E+   ++DI    T+L I   + T L +V P RVDY+++  L+  I
  S:     2 LTKRQVKILQTIVEEFIKTNQPVGSKRILELLDIKISSATIRNESAILEHEGYLEKQHTSSGRTPSTKGYRYYVDNIMKLDSADYTRLKIYLNQLLDLRKYDIDKTINYASEIISELTKMTAVVIKKQNIKNIKLKKIELILLSEFLASVLFIFSDGDVQNKMFNLKDIS-LSDLKIAIKLFSDFLVDVKLDEIDQYLNDLKHQLSLSIKQYDYVLNTFINTILESKNEQ-KETHGMRYMLENPEFNDTNKLKNAVKLVEQLSPFDWFNIAYESNKNMNKIAIKIGNEIDQINDDISMIATELKIG-NSSTVLTLVGPKRVDYNQVNQLMNLI 331
>gi|42561141|ref|NP_975592.1| heat-inducible transcription repressor HrcA [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|61213465|sp|Q6MT04|HRCA_MYCMS Heat-inducible transcription repressor hrcA >gi|42492639|emb|CAE77234.1| heat-inducible transcription repressor HrcA [Mycoplasma mycoides subsp. mycoides SC str. PG1] (340 aa)
Score = 437, Expect = 2.7e-41, Identities = 123/326 (37%), Positives = 196/326 (60%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYIND-ENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLP--MIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSI--WEQIAFKQNQTGSNTLITFGDEVS--HEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFI 329
           +T RQ ++L+ IVE+++ T  PVGSK ++E     IS+AT+RN+ A LE  G LEK HTSSGR PST GY++Y  N  K    D   LK+ L  +   R   ID  I  + +IISE TK+   +IK +N  ++ LK+I+++ +++  A V+ I SDG++   + + KD + L D+ I I++F+D L+D  + EI   ++ +K  +   +K+Y++VL   I  I + K++  K  HG   +L  PEF DT KLK  ++++E  S   W  IA++ N+  +   I  G+E+   ++DI    T+L I   + T L +V P RVDY+++  L+  I
  S:     2 LTNRQIKILQTIVEEFIKTNQPVGSKRILELLNMKISSATIRNESATLEHEGYLEKQHTSSGRTPSTKGYRYYVDNIMKLDSADYTRLKIYLNQLLDLRKYDIDKTINYASEIISELTKMTAVVIKKQNIKDIKLKKIELILLSEFLASVLFIFSDGDVQNKMFNLKDVA-LSDLKIAIKLFSDVLVDVKLDEIDQYLNDLKHQLFLSIKQYDYVLNTFINTILESKNEQ-KETHGMRYMLENPEFNDTNKLKNAVKLVEQLSPFDWFNIAYESNKNMNKIAIKIGNEIDQINDDISMIATELKIG-NSSTVLTLVGPKRVDYNQVNQLMNLI 331
>gi|1575014|gb|AAB09428.1| unknown [Mycoplasma capricolum] (334 aa)
Score = 412, Expect = 1.9e-38, Identities = 116/313 (37%), Positives = 186/313 (59%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYIND-ENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIEN-NTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSI--WEQIAFKQNQTGSNTLITFGDEVS--HEDIVFAQTDLNINEQNKTKLVMVAPTR 316
           +T+RQ ++L+ IVE+++ T  PVGSK ++E     IS+AT+RN+ A LE  G LEK HTSSGR PST GY++Y  N  K    D   LK+ L  +   R   ID  I  + +IISE TK+  + I++ N + +  +I+++ +++  A V+ I SDG++   + + KD S L D+ I I++F+D L+D  + EI   ++ +K  +   +K+Y++VL   I  I + K++  K  HG   +L  PEF DT KLK  ++++E  S   W  IA++ N+  +   I  G+E+   ++DI    T+L I   + T L +V P R
  S:     2 LTKRQVKILQTIVEEFIKTNQPVGSKRILELLDIKISSATIRNESAILEHEGYLEKQHTSSGRTPSTKGYRYYVDNIMKLDSADYTRLKIYLNQLLDLRKYDIDKTINYASEIISELTKMTAVVIKSKNIKNIKLKIELILLSEFLASVLFIFSDGDVQNKMFNLKDIS-LSDLKIAIKLFSDFLVDVKLDEIDQYLNDLKHQLSLSIKQYDYVLNTFINTILESKNEQ-KETHGMRYMLENPEFNDTNKLKNAVKLVEQLSPFDWFNIAYESNKNMNKIAIKIGNEIDQINDDISMIATELKIG-NSSTVLTLVGPKR 317
>gi|126652837|ref|ZP_01724982.1| heat-inducible transcription repressor [Bacillus sp. B14905] >gi|126590373|gb|EAZ84493.1| heat-inducible transcription repressor [Bacillus sp. B14905] (342 aa)
Score = 406, Expect = 1.0e-37, Identities = 98/334 (29%), Positives = 196/334 (58%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPY-INDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEV-LLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDS-MKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLI-TFGDEVSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEKGW 337
           +T RQ ++L+ I++D++ +A PVGS+ + +K     S AT+RN+MA LE+LG LEK HTSSGRVPS  GY+FY  +   P  IN  +++ +++++F DR + ++ +I +S  I+SE T    I +  + +   +KR  +V ++  +A+ I++T++G++   + +   D    D+   + I NDRLI   ++E+   +++ + +++++ V+  +  +  L+    Q     I    G++++   PEF D  K++ IL ++E+TS  + + F  N++G +  I +   ++  E+     T  +I +  +  + ++ PTR+DY ++  LL+ I+ +  + +
  S:     2 LTNRQLQILQVIIDDFILSAQPVGSRQISKKQGITFSPATIRNEMADLEELGYLEKTHTSSGRVPSEKGYRFYVDHLLSPQGINSRDIQ-QIQSIFNDRLVEVEHIIRKSANILSELTSYTSILLGPDVQRHRVKRFSIVPLSSDTAVAIIVTNNGHVENRLFNLPPDFTASDLEKMVNILNDRLIGVSLEELHKSLEAEVLAVLQQHVRSADDFIHALVTATMQNPESKI-FYGGKTNMFNQPEFHDLNKVRMILDLMETTSQVQSL-FHPNESGIHIRIGSENKQLEMENCSVITTTYSIGDDQQGAIAIIGPTRMDYKRVVALLDVIRLDLTQAF 336
>gi|3122229|sp|Q45550|HRCA_BACST Heat-inducible transcription repressor hrcA >gi|2104799|emb|CAA70594.1| repressor protein of class I heat shock genes [Geobacillus stearothermophilus] (344 aa)
Score = 404, Expect = 1.6e-37, Identities = 94/330 (28%), Positives = 197/330 (59%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNT-EVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKI-DSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSH-EDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEF 333
           +T+RQ  +L+ I++D++ +  PVGS+ + +K+   +S+AT+RN+MA LE+LG +EK H SSGRVPS  GY++Y  +   P    ++   K++++FA+R   ++ V+++S +I+S+ T    I +     E  LKRI ++ +N+Q+A+ I++T  G++  ++I         D+   + IFN+RLI  P+ ++  KI   +  ++++ ++ Y+ +LQ ++E +  I  +      G++++L  PEF D +K++ +++++E    + ++  K N+ G    I   +++S  E+        +I ++    + ++ PTR++YS++  +L  + ++ 
  S:     2 LTERQLLILQVIIDDFIRSGQPVGSRTLSKKHEIALSSATIRNEMADLEELGYIEKTHVSSGRVPSEKGYRYYVDHLLSPQRLTKDDIQKIKSIFAERIYELEKVVQKSAQILSDLTNYTSIALGPAVKENKLKRIQIIPLNQQTAVAIIVTDTGHVENHVITVPASVNPSDLEKMVNIFNERLIGVPLVDLKDKIYKKVADVLRKHIRNYDSMLQTIVETL-DIPQEEKMFFAGKTNMLNQPEFNDIQKIRPLMKMIEQEKDFYRLLRKHNRKGIQVTIGRENQLSEMENCSLITATYSIGDEQLGTIAILGPTRMEYSRVITILNRVASDL 333
>gi|118479484|ref|YP_896635.1| heat-inducible transcription repressor [Bacillus thuringiensis str. Al Hakam] >gi|166219851|sp|A0RIT5|HRCA_BACAH Heat-inducible transcription repressor hrcA >gi|118418709|gb|ABK87128.1| heat-inducible transcription repressor HrcA [Bacillus thuringiensis str. Al Hakam] (338 aa)
Score = 397, Expect = 1.0e-36, Identities = 97/335 (28%), Positives = 190/335 (56%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMI----KIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKI-DSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVS-HEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEKGWK 338
           +T+RQ  +L+ I++D++ +A PVGS+ + +K     S+AT+RN+MA LE+LG +EK H+SSGRVPS  GY+FY  +   P    ++  ++++++FA+R    + + ++S +I+SE T    I    K+  N    LK + +V +++Q+A+ I++T  G++    I   +   L D+   + I N++L   P+ E+  KI   + ++++  V  Y+  ++ +++  FQ+         G++++L+ PEF D  K++ +L ++++ + +  I  +  Q G    I   +  +  ED        +I E+    + ++ PTR+ YS++  LL+    +F  G K
  S:     2 LTERQLLILQTIIDDFIGSAQPVGSRTLAKKDAITFSSATIRNEMADLEELGFIEKTHSSSGRVPSEKGYRFYVDHLLAPQNLPKDEIVQIKDLFAERIFEAEKIAQQSAQILSELTNYTAIVLGPKLSTNK---LKNVQIVSLDRQTAVAIIVTDTGHVQSKTITVPESVDLSDLEKMVNILNEKLSGVPMSELHNKIFKEIVTVLRGYVHNYDSAIK-MLDGTFQVPLSEKIYFGGKANMLSQPEFHDIHKVRSLLTMIDNEAEFYDI-LRHKQVGIQVKIGRENSATAMEDCSLISATYSIGEEQLGTIAILGPTRMQYSRVISLLQLFTRQFTDGLK 337
>gi|52141186|ref|YP_085642.1| heat-inducible transcription repressor [Bacillus cereus E33L] >gi|61213350|sp|Q634M5|HRCA_BACCZ Heat-inducible transcription repressor hrcA >gi|51974655|gb|AAU16205.1| heat-inducible transcription repressor [Bacillus cereus E33L] (338 aa)
Score = 397, Expect = 1.1e-36, Identities = 97/335 (28%), Positives = 190/335 (56%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMI----KIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKI-DSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVS-HEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEKGWK 338
           +T+RQ  +L+ I++D++ +A PVGS+ + +K     S+AT+RN+MA LE+LG +EK H+SSGRVPS  GY+FY  +   P    ++  ++++++FA+R    + + ++S +I+SE T    I    K+  N    LK + +V +++Q+A+ I++T  G++    I   +   L D+   + I N++L   P+ E+  KI   + ++++  V  Y+  ++ +++  FQ+         G++++L+ PEF D  K++ +L ++++ + +  I  +  Q G    I   +  +  ED        +I E+    + ++ PTR+ YS++  LL+    +F  G K
  S:     2 LTERQLLILQTIIDDFIGSAQPVGSRTLAKKDAITFSSATIRNEMADLEELGFIEKTHSSSGRVPSEKGYRFYVDHLLAPQNLPKDEIVQIKDLFAERIFEAEKIAQQSAQILSELTNYTAIVLGPKLSTNK---LKNVQIVPLDRQTAVAIIVTDTGHVQSKTITVPESVDLSDLEKMVNILNEKLSGVPMSELHNKIFKEIVTVLRGYVHNYDSAIK-MLDGTFQVPLSEKIYFGGKANMLSQPEFHDIHKVRSLLTMIDNEAEFYDI-LRHKQVGIQVKIGRENSATAMEDCSLISATYSIGEEQLGTIAILGPTRMQYSRVISLLQLFTRQFTDGLK 337
>gi|163942072|ref|YP_001646956.1| heat-inducible transcription repressor [Bacillus weihenstephanensis KBAB4] >gi|163864269|gb|ABY45328.1| heat-inducible transcription repressor HrcA [Bacillus weihenstephanensis KBAB4] (338 aa)
Score = 396, Expect = 1.5e-36, Identities = 98/335 (29%), Positives = 187/335 (55%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMI----KIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKI-DSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLI-TFGDEVSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEKGWK 338
           +T+RQ  +L+ IV+D++ +A PVGS+ + +K     S AT+RN+MA LE+LG +EK H+SSGRVPS  GY+FY  +   P     +  ++++++FA+R    + + ++S +I+SE T    I    K+  N    LK + +V +++Q+A+ I++T  G++    I   +   L D+   + I N++L   P+ E+  KI   + ++++  V  Y+  ++ +++  FQ+         G++++L+ PEF D  K++ +L ++++ + +  I  +  Q G    I       + ED        +I E+    + ++ PTR+ YS++  LL+    +F  G K
  S:     2 LTERQLLILQTIVDDFIGSAQPVGSRTLAKKDEITFSPATIRNEMADLEELGFIEKTHSSSGRVPSEKGYRFYVDHLLAPQNLPTDEIVQIKDLFAERIFEAEKIAQQSAQILSELTNYTAIVLGPKLSTNK---LKNVQIVPLDRQTAVAIIVTDTGHVQSKTITVPESVDLSDLEKMVNILNEKLSGIPMAELHNKIFKEIVTVLRGYVHNYDSAIK-MLDGTFQVPLSEKIYFGGKANMLSQPEFHDIHKVRSLLTMIDNEAAFYDI-LRHKQVGIQVKIGRENSSTAMEDCSLISATYSIGEEQLGTIAILGPTRMQYSRVISLLQLFTRQFTDGLK 337
>gi|56421041|ref|YP_148359.1| heat-inducible transcription repressor [Geobacillus kaustophilus HTA426] >gi|61213221|sp|Q5KWZ5|HRCA_GEOKA Heat-inducible transcription repressor hrcA >gi|56380883|dbj|BAD76791.1| transcriptional repressor of class I heat shock genes [Geobacillus kaustophilus HTA426] (344 aa)
Score = 395, Expect = 2.1e-36, Identities = 96/330 (29%), Positives = 189/330 (57%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKI-ENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDS-MKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEV-SHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEF 333
           +T RQ  +L+ I++D++ +  PVGS+ + +K+    S+AT+RN+MA LE+LG +EK H SSGRVPS  GY++Y  +   P         K+R+VFA+R   ++ ++++S +I+SE T    I +     E  LK++ +V +N+Q+A+ IV+T  G++   ++         D+   + IFN+RL   P+ ++  K+++ +  +++  ++ Y+ VL  LIE +   + + +    G++++L  PEF D +K++ +L I+E      ++  KQ Q G    I   +E+   E+        ++ ++    + ++ PTR++YS++  +L  + ++ 
  S:     2 LTDRQLLILQVIIDDFIRSGQPVGSRTLSKKHQIAFSSATIRNEMADLEELGYIEKTHISSGRVPSEKGYRYYVDHLLPPQRLTRADIQKIRSVFAERIYELEKLMQKSAQILSELTNYTSIALGPTFKESKLKQMQIVPLNEQTAVAIVVTDTGHVENRVVTIPSSMDAGDLEKMVNIFNERLNGVPLIDLKEKMETEVADVLRRHIRNYDSVLNTLIETLDAPEEEKV-FFAGKANMLNQPEFSDIQKVRPLLDIIEQEKDIYRLLRKQTQKGVRVSIGHENELRGMENCSLITATYSVGDEPLGAIAILGPTRMEYSRVITVLNRVASDL 333
>gi|49481356|ref|YP_038371.1| heat-inducible transcription repressor [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|166995900|ref|ZP_02262360.1| heat-inducible transcription repressor [Bacillus cereus AH820] >gi|167634622|ref|ZP_02392942.1| heat-inducible transcription repressor HrcA [Bacillus anthracis str. A0442] >gi|170687324|ref|ZP_02878541.1| heat-inducible transcription repressor HrcA [Bacillus anthracis str. A0465] >gi|196034463|ref|ZP_03101872.1| heat-inducible transcription repressor HrcA [Bacillus cereus W] >gi|196039294|ref|ZP_03106600.1| heat-inducible transcription repressor HrcA [Bacillus cereus NVH0597-99] >gi|61213443|sp|Q6HDK5|HRCA_BACHK Heat-inducible transcription repressor hrcA >gi|49332912|gb|AAT63558.1| heat-inducible transcription repressor [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|167530074|gb|EDR92809.1| heat-inducible transcription repressor HrcA [Bacillus anthracis str. A0442] >gi|170668519|gb|EDT19265.1| heat-inducible transcription repressor HrcA [Bacillus anthracis str. A0465] >gi|195993005|gb|EDX56964.1| heat-inducible transcription repressor HrcA [Bacillus cereus W] >gi|196029921|gb|EDX68522.1| heat-inducible transcription repressor HrcA [Bacillus cereus NVH0597-99] (338 aa)
Score = 393, Expect = 3.2e-36, Identities = 97/335 (28%), Positives = 189/335 (56%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMI----KIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKI-DSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVS-HEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEKGWK 338
           +T+RQ  +L+ I++D++ +A PVGS+ + +K     S+AT+RN+MA LE+LG +EK H+SSGRVPS  GY+FY  +   P     +  ++++++FA+R    + + ++S +I+SE T    I    K+  N    LK + +V +++Q+A+ I++T  G++    I   +   L D+   + I N++L   P+ E+  KI   + ++++  V  Y+  ++ +++  FQ+         G++++L+ PEF D  K++ +L ++++ + +  I  +  Q G    I   +  +  ED        +I E+    + ++ PTR+ YS++  LL+    +F  G K
  S:     2 LTERQLLILQTIIDDFIGSAQPVGSRTLAKKDEITYSSATIRNEMADLEELGFIEKTHSSSGRVPSEKGYRFYVDHLLAPQNLPNDEIVQIKDLFAERIFEAEKIAQQSAQILSELTNYTAIVLGPKLSTNK---LKNVQIVPLDRQTAVAIIVTDTGHVQSKTITVPESVDLSDLEKMVNILNEKLSGVPMSELHNKIFKEIVTVLRGYVHNYDSAIK-MLDGTFQVPLSEKIYFGGKANMLSQPEFHDIHKVRSLLTMIDNEAEFYDI-LRHKQVGIQVKIGRENSATAMEDCSLISATYSIGEEQLGTIAILGPTRMQYSRVISLLQLFTRQFTDGLK 337
>gi|7387777|sp|O69266|HRCA_BACSH Heat-inducible transcription repressor hrcA >gi|3646488|emb|CAA76661.1| heat shock protein [Bacillus sphaericus] (343 aa)
Score = 393, Expect = 3.5e-36, Identities = 97/334 (29%), Positives = 193/334 (57%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPY-INDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEV-LLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDS-MKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLI-TFGDEVSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEKGW 337
           +T RQ ++L+ I++D++ +A PVGS+ + +K     S AT+RN+MA LE+LG LEK HTSSGRVPS  GY+FY  +   P  IN  +++ +++++F DR + ++ +I +S  I+SE T    I +  + +   +KR  +V ++  +A+ I++T++G++   + +   D    D+   + I NDRLI   ++E+   +++ + +++++ V+  +            I  K      G++++   PEF D  K++ IL ++E+TS  + + F  N++G +  I +   ++  E+     T  +I +  +  + ++ PTR+DY ++  LL+ I+ +  + +
  S:     2 LTNRQLQILQVIIDDFILSAQPVGSRQISKKQGITFSPATIRNEMADLEELGYLEKTHTSSGRVPSEKGYRFYVDHLLSPQGINSRDIQ-QIQSIFNDRLVEVEHIIRKSANILSELTSYTSILLGPDVQRHRVKRFSIVPLSSDTAVAIIVTNNGHVENRLFNLPPDFTASDLEKMVNILNDRLIGVSLEELHKSLEAEVLAVLQQHVQSADDFYPRTRNSDNAIIQKAKIFYGGKTNMFNQPEFHDLNKVRMILDLMETTSQVQSL-FHPNESGIHIRIGSENKQLEMENCSVITTTYSIGDDQQGAIAIIGPTRMDYKRVVALLDVIRLDLTQAF 337
>gi|30022395|ref|NP_834026.1| heat-inducible transcription repressor [Bacillus cereus ATCC 14579] >gi|168135743|ref|ZP_02578972.1| heat-inducible transcription repressor [Bacillus cereus B4264] >gi|38372301|sp|Q818E7|HRCA_BACCR Heat-inducible transcription repressor hrcA >gi|29897953|gb|AAP11227.1| Heat-inducible transcription repressor hrcA [Bacillus cereus ATCC 14579] (338 aa)
Score = 393, Expect = 3.6e-36, Identities = 97/335 (28%), Positives = 189/335 (56%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMI----KIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKI-DSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLI-TFGDEVSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEKGWK 338
           +T+RQ  +L+ I++D++ +A PVGS+ + +K     S+AT+RN+MA LE+LG +EK H+SSGRVPS  GY+FY  +   P        ++++++FA+R    + + ++S +I+SE T    I    K+  N    LK + +V +++Q+A+ I++T  G++    I   +   L D+   + I N++L   P++E+  KI   + ++++  V  Y+  ++ +++  FQ+         G++++L+ PEF D +K++ +L ++++ + +  I  +  Q G    I       + ED        +I E+    + ++ PTR+ YS++  LL+    +F  G K
  S:     2 LTERQLLILQTIIDDFIGSAQPVGSRTLAKKDEITFSSATIRNEMADLEELGFIEKTHSSSGRVPSEKGYRFYVDHLLAPQNLPNAEIVQIKDLFAERIFEAEKIAQQSAQILSELTNYTAIVLGPKLSTNK---LKNVQIVPLDRQTAVAIIVTDTGHVQSKTITVPESVDLSDLEKMVNILNEKLSGVPMEELHNKIFKEIVTVLRGYVHNYDSAIK-MLDGTFQVPLSEKIYFGGKANMLSQPEFHDIQKVRSLLTMIDNEAEFYDI-LRHKQVGIQVKIGRENSSTAMEDCSLISATYSIGEEQLGTIAILGPTRMQYSRVISLLQLFTRQFTDGLK 337
>gi|168140307|ref|ZP_02583536.1| heat-inducible transcription repressor [Bacillus cereus G9842] (338 aa)
Score = 392, Expect = 3.9e-36, Identities = 96/335 (28%), Positives = 190/335 (56%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMI----KIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKI-DSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGD-EVSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEKGWK 338
           +T+RQ  +L+ I++D++ +A PVGS+ + +K     S+AT+RN+MA LE+LG +EK H+SSGRVPS  GY+FY  +   P        ++++++FA+R    + + ++S +I+SE T    I    K+  N    LK + +V +++Q+A+ I++T  G++    I   +   L D+   + + N++L   P++E+  KI   + ++++  V  Y+  ++ +++  FQ+         G++++L+ PEF D +K++ +L ++++ + +  I  +  Q G    I   +   + ED        +I E+    + ++ PTR+ YS++  LL+    +F  G K
  S:     2 LTERQLLILQTIIDDFIGSAQPVGSRTLAKKDEITFSSATIRNEMADLEELGFIEKTHSSSGRVPSEKGYRFYVDHLLAPQNLPNAEIVQIKDLFAERIFEAEKIAQQSAQILSELTNYTAIVLGPKLSTNK---LKNVQIVPLDRQTAVAIIVTDTGHVQSKTITVPESVDLSDLEKMVNVLNEKLSGVPMEELHNKIFKEIVTVLRGYVHNYDSAIR-MLDGTFQVPLSEKIYFGGKANMLSQPEFHDIQKVRSLLTMIDNEAEFYDI-LRHKQVGIQVKIGRENTSTAMEDCSLISATYSIGEEQLGTIAILGPTRMQYSRVISLLQLFTRQFTDGLK 337
>gi|167938595|ref|ZP_02525670.1| heat-inducible transcription repressor [Bacillus cereus AH1134] (338 aa)
Score = 392, Expect = 4.0e-36, Identities = 97/335 (28%), Positives = 188/335 (56%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMI----KIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKI-DSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLI-TFGDEVSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEKGWK 338
           +T+RQ  +L  I++D++ +A PVGS+ + +K     S+AT+RN+MA LE+LG +EK H+SSGRVPS  GY+FY  +   P        ++++++FA+R    + + ++S +I+SE T    I    K+  N    LK + +V +++Q+A+ I++T  G++    I   +   L D+   + I N++L   P++E+  KI   + ++++  V  Y+  ++ +++  FQ+         G++++L+ PEF D +K++ +L ++++ + +  I  +  Q G    I       + ED        +I E+    + ++ PTR+ YS++  LL+    +F  G K
  S:     2 LTERQLLILHTIIDDFIGSAQPVGSRTLAKKDEITFSSATIRNEMADLEELGFIEKTHSSSGRVPSEKGYRFYVDHLLAPQNLPNAEIVQIKDLFAERIFEAEKIAQQSAQILSELTNYTAIVLGPKLSTNK---LKNVQIVPLDRQTAVAIIVTDTGHVQSKTITVPESVDLSDLEKMVNILNEKLSGVPMEELHNKIFKEIVTVLRGYVHNYDSAIK-MLDGTFQVPLSEKIYFGGKANMLSQPEFHDIQKVRSLLTMIDNEAEFYDI-LRHKQVGIQVKIGRENSSTAMEDCSLISATYSIGEEQLGTIAILGPTRMQYSRVISLLQLFTRQFTDGLK 337
>gi|47458946|ref|YP_015808.1| heat-inducible transcription repressor [Mycoplasma mobile 163K] >gi|61213452|sp|Q6KIH9|HRCA_MYCMO Heat-inducible transcription repressor hrcA >gi|47458274|gb|AAT27597.1| heat inducible transcriptional repressor protein [Mycoplasma mobile 163K] (332 aa)
Score = 392, Expect = 4.1e-36, Identities = 117/332 (35%), Positives = 194/332 (58%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKD--DSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDY----SKIKGLLEFIKNEFEK 335
           + +++ E+L  I++ Y+ +  PV SK +I +Y   +S+AT+RN MA LE  G LEK HTSSGR+PS +GYKF+ ++ SK   N E L+ KL+ +F+ R +SIDV ++E+ K I+E   L ++   N    +LK I ++E+N  SA +I++TS G +    I   +  D  L+D+ I IR+F +RLI+  +  +  K  ++K I+ + +K YE +LQ  I  +F+ ++K    V+G+S+++   E  D   L +IL ++E+ SIW  I  K  +       T   +V + +I      + +N   K ++ ++   R+DY    S I  L  FIK +F K
  S:     3 MKEKRDEILLKIIDLYIKSGQPVSSKQLISEYKLAVSSATIRNIMADLENEGFLEKTHTSSGRIPSISGYKFFAEH-SKSKTN-ELLESKLKEIFSKRYLSIDVTLDEAAKAINEIIGLTLVTSSNVNTEVLKSIQLIELNNYSATIILVTSTGQVANKTIDLTNFQDIKLEDVRIAIRLFKERLINTSLINLREKALALKPILSKYIKNYETILQSFIGNVFEFENK--NHVYGKSNIIK-QEGIDRLHLTQILDLIENNSIWNMIESKVEEDE-----TLKIDVRNSNISLISKKIFVNNTTK-EISVIGSNRMDYISAKSAIALLESFIKPKFSK 329
>gi|75763928|ref|ZP_00743562.1| Heat-inducible transcription repressor hrcA [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|74488585|gb|EAO52167.1| Heat-inducible transcription repressor hrcA [Bacillus thuringiensis serovar israelensis ATCC 35646] (338 aa)
Score = 391, Expect = 5.4e-36, Identities = 96/335 (28%), Positives = 190/335 (56%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMI----KIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKI-DSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGD-EVSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEKGWK 338
           +T+RQ  +L+ I++D++ +A PVGS+ + +K     S+AT+RN+MA LE+LG +EK H+SSGRVPS  GY+FY  +   P        ++++++FA+R    + + ++S +I+SE T    I    K+  N    LK + +V +++Q+A+ I++T  G++    I   +   L D+   + + N++L   P++E+  KI   + ++++  V  Y+  ++ +++  FQ+         G++++L+ PEF D +K++ +L ++++ + +  I  +  Q G    I   +   + ED        +I E+    + ++ PTR+ YS++  LL+    +F  G K
  S:     2 LTERQLLILQTIIDDFIGSAQPVGSRTLAKKDEITFSSATIRNEMADLEELGFIEKTHSSSGRVPSEKGYRFYVDHLLAPQNLPNAEIVQIKDLFAERIFEAEKIAQQSAQILSELTNYTAIVLGPKLSTNK---LKNVQIVPLDRQTAVAIIVTDTGHVQSKTITVPESVDLSDLEKMVNVLNEKLSGVPMEELHNKIFKEIVTVLRGYVHNYDSAIK-MLDGTFQVPLSEKIYFGGKANMLSQPEFHDIQKVRSLLTMIDNEAEFYDI-LRHKQVGIQVKIGRENTSTAMEDCSLISATYSIGEEQLGTIAILGPTRMQYSRVISLLQLFTRQFTDGLK 337
>gi|30264387|ref|NP_846764.1| heat-inducible transcription repressor [Bacillus anthracis str. Ames] >gi|47529838|ref|YP_021187.1| heat-inducible transcription repressor [Bacillus anthracis str. 'Ames Ancestor'] >gi|49187211|ref|YP_030463.1| heat-inducible transcription repressor [Bacillus anthracis str. Sterne] >gi|65321689|ref|ZP_00394648.1| COG1420: Transcriptional regulator of heat shock gene [Bacillus anthracis str. A2012] >gi|165872036|ref|ZP_02216676.1| heat-inducible transcription repressor HrcA [Bacillus anthracis str. A0488] >gi|167638568|ref|ZP_02396844.1| heat-inducible transcription repressor HrcA [Bacillus anthracis str. A0193] >gi|170707363|ref|ZP_02897817.1| heat-inducible transcription repressor HrcA [Bacillus anthracis str. A0389] >gi|177653308|ref|ZP_02935560.1| heat-inducible transcription repressor HrcA [Bacillus anthracis str. A0174] >gi|190566892|ref|ZP_03019808.1| heat-inducible transcription repressor HrcA [Bacillus anthracis Tsiankovskii-I] >gi|38372312|sp|Q81LS0|HRCA_BACAN Heat-inducible transcription repressor hrcA >gi|30259045|gb|AAP28250.1| heat-inducible transcription repressor HrcA [Bacillus anthracis str. Ames] >gi|47504986|gb|AAT33662.1| heat-inducible transcription repressor HrcA [Bacillus anthracis str. 'Ames Ancestor'] >gi|49181138|gb|AAT56514.1| heat-inducible transcription repressor HrcA [Bacillus anthracis str. Sterne] >gi|164712167|gb|EDR17704.1| heat-inducible transcription repressor HrcA [Bacillus anthracis str. A0488] >gi|167513416|gb|EDR88786.1| heat-inducible transcription repressor HrcA [Bacillus anthracis str. A0193] >gi|170127607|gb|EDS96480.1| heat-inducible transcription repressor HrcA [Bacillus anthracis str. A0389] >gi|172081590|gb|EDT66662.1| heat-inducible transcription repressor HrcA [Bacillus anthracis str. A0174] >gi|190561883|gb|EDV15852.1| heat-inducible transcription repressor HrcA [Bacillus anthracis Tsiankovskii-I] (338 aa)
Score = 389, Expect = 1.0e-35, Identities = 96/335 (28%), Positives = 188/335 (56%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMI----KIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKI-DSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVS-HEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEKGWK 338
           +T+RQ  +L+ I++D++ +A PVGS+ + +K     S+AT+RN+MA LE+LG +EK H+SSGRVPS  GY+FY  +   P     +  ++++++F +R    + + ++S +I+SE T    I    K+  N    LK + +V +++Q+A+ I++T  G++    I   +   L D+   + I N++L   P+ E+  KI   + ++++  V  Y+  ++ +++  FQ+         G++++L+ PEF D  K++ +L ++++ + +  I  +  Q G    I   +  +  ED        +I E+    + ++ PTR+ YS++  LL+    +F  G K
  S:     2 LTERQLLILQTIIDDFIGSAQPVGSRTLAKKDEITYSSATIRNEMADLEELGFIEKTHSSSGRVPSEKGYRFYVDHLLAPQNLPNDEIVQIKDLFVERIFEAEKIAQQSAQILSELTNYTAIVLGPKLSTNK---LKNVQIVPLDRQTAVAIIVTDTGHVQSKTITVPESVDLSDLEKMVNILNEKLSGVPMSELHNKIFKEIVTVLRGYVHNYDSAIK-MLDGTFQVPLSEKIYFGGKANMLSQPEFHDIHKVRSLLTMIDNEAEFYDI-LRHKQVGIQVKIGRENSATAMEDCSLISATYSIGEEQLGTIAILGPTRMQYSRVISLLQLFTRQFTDGLK 337
>gi|47569312|ref|ZP_00239996.1| heat-inducible transcription repressor HrcA [Bacillus cereus G9241] >gi|47553983|gb|EAL12350.1| heat-inducible transcription repressor HrcA [Bacillus cereus G9241] (338 aa)
Score = 388, Expect = 1.1e-35, Identities = 96/335 (28%), Positives = 188/335 (56%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMI----KIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKI-DSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVS-HEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEKGWK 338
           +T+RQ  +L+ I++D++ +A PVGS+ + +K     S+AT+RN+MA LE+LG +EK H+SSGRVPS  GY+FY  +   P     +  ++++++FA+R    + + ++S +I+SE T    I    K+  N    LK + +V +++Q+A+ I++T  G++    I   +   L D+   + I N++L   P+ E+  KI   + ++++  V  Y+  ++ +++  FQ+         G++++L+ PEF D  K++ +L ++++ + +  I  +  Q G    I   +  +  ED        +I E+    + ++ PTR+ Y ++  LL+    +F  G K
  S:     2 LTERQLLILQTIIDDFIGSAQPVGSRTLAKKDEITFSSATIRNEMADLEELGFIEKTHSSSGRVPSEKGYRFYVDHLLAPQNLPNDEIVQIKDLFAERIFEAEKIAQQSAQILSELTNYTAIVLGPKLSTNK---LKNVQIVPLDRQTAVAIIVTDTGHVQSKTITVPESVDLSDLEKMVNILNEKLSGVPMSELHNKIFKEIVTVLRGYVHNYDSAIK-MLDGTFQVPLSEKIYFGGKANMLSQPEFHDIHKVRSLLTMIDNEAEFYDI-LRHKQVGIQVKIGRENSATAMEDCSLISATYSIGEEQLGTIAILGPTRMQYFRVISLLQLFTRQFTDGLK 337
>gi|168161095|ref|ZP_02596328.1| heat-inducible transcription repressor [Bacillus cereus H3081.97] (338 aa)
Score = 388, Expect = 1.2e-35, Identities = 96/335 (28%), Positives = 189/335 (56%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMI----KIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKI-DSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVS-HEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEKGWK 338
           +T+RQ  +L+ I++D++ +A PVGS+ + +K     S+AT+RN+MA LE+LG +EK H+SSGRVPS  GY+FY  +   P     +  ++++++FA+R    + + ++S +I+SE T    I    K+  N    LK + +V +++Q+A+ I++T  G++    I   +   L D+   + I N++L   P+ E+  KI   + ++++  V  Y+  ++ +++  FQ+         G++++L+ PEF D +K++ +L ++++ + +  I  +  Q G    I   +  +  ED        +I E+    + ++ PTR+ YS++  LL+    +   G K
  S:     2 LTERQLLILQTIIDDFIGSAQPVGSRTLAKKDEITFSSATIRNEMADLEELGFIEKTHSSSGRVPSEKGYRFYVDHLLAPQNLPNDEIVQIKDLFAERIFEAEKIAQQSAQILSELTNYTAIVLGPKLSTNK---LKNVQIVPLDRQTAVAIIVTDTGHVQSKTITVPESVDLSDLEKMVNILNEKLSGVPMSELHNKIFKEIVTVLRGYVHNYDSAIK-ILDGTFQVPLSEKIYFGGKANMLSQPEFHDVQKVRSLLTMIDNEAEFYDI-LRHKQVGIQVKIGRENSATAMEDCSLISATYSIGEEQLGTIAILGPTRMQYSRVISLLQLFTRQITDGLK 337
>gi|15828613|ref|NP_325973.1| heat-inducible transcription repressor [Mycoplasma pulmonis UAB CTIP] >gi|21263732|sp|Q98R68|HRCA_MYCPU Heat-inducible transcription repressor hrcA >gi|14089555|emb|CAC13315.1| HEAT-INDUCIBLE TRANSCRIPTION REPRESSOR [Mycoplasma pulmonis] (347 aa)
Score = 388, Expect = 1.3e-35, Identities = 116/337 (34%), Positives = 192/337 (56%)
  Q:     2 KEITQRQKE--LLKYIVEDYVATANPVGSKVVIEK-YMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEKGWK 338
           KEI    K+  L K IVE Y+ T  P+GSK ++E+ Y    S+AT+RN M   E++GLLEK+H SSGR+PST G K+Y K  +     D +LK +L+ +F  R ++ID  IE + K ISE   L M+    N+   LK I +V ++K  +++I++ S G +    +  KD  +L D+ I +RIF +RLID  + E+  K  ++K I+K  ++ YE +LQE I  IF  +      V+G+ +++   + +  E L +I++++ESTSIW+ I     +  +  +    D  S     F    ++I+ + + ++ +V   ++DY+K K  L  I++  E+  K
  S:     6 KEIKLETKKTILFKNIVELYLRTGKPIGSKFLVEQDYGLGKSSATIRNMMHEFEEIGLLEKSHISSGRIPSTLGLKYYVKYLANS--EDSDLKKQLKKLFFQRKLTIDETIELAAKSISEIVGLTMVTSTENSFETLKSIQLVLLDKNESIIIIVLSSGKVISKKLAMKDSIVLDDLRIAVRIFKERLIDTKVSELHEKTLALKPILKISIQNYEDILQEFIINIFDFEVSQTNNVYGKKNIILARDIK-REDLTKIIKLIESTSIWQTIEDNLEEEENIKIEIRPDNSS-----FLSKKISIDNKIR-EISVVGSKKMDYAKAKSALMLIEDLVEENKK 336
>gi|166986433|ref|ZP_02257686.1| heat-inducible transcription repressor [Bacillus cereus AH187] (338 aa)
Score = 387, Expect = 1.7e-35, Identities = 96/335 (28%), Positives = 189/335 (56%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMI----KIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKI-DSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVS-HEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEKGWK 338
           +T+RQ  +L+ I++D++ +A PVGS+ + +K     S+AT+RN+MA LE+LG +EK H+SSGRVPS  GY+FY  +   P     +  ++++++FA+R    + + ++S +I+SE T    I    K+  N    LK + +V +++Q+A+ I++T  G++    I   +   L D+   + I N++L   P+ E+  KI   + ++++  V  Y+  ++ +++  FQ+         G++++L+ PEF D +K++ +L ++++ + +  I  +  Q G    I   +  +  ED        +I E+    + ++ PTR+ YS++  LL+    +   G K
  S:     2 LTERQLLILQTIIDDFIGSAQPVGSRTLAKKDEITFSSATIRNEMADLEELGFIEKTHSSSGRVPSEKGYRFYVDHLLAPQNLPNDEIVQIKDLFAERIFEAEKIAQQSAQILSELTNYTAIVLGPKLSTNK---LKNVQIVPLDRQTAVAIIVTDTGHVQSKTITVPESVDLSDLEKMVNILNEKLSGVPMSELHNKIFKEIVTVLRGYVHNYDSAIK-ILDGTFQVPLSEKIYFGGKANMLSQPEFHDIQKVRSLLTMIDNEAEFYDI-LRHKQVGIQVKIGRENSATAMEDCSLISATYSIGEEQLGTIAILGPTRMQYSRVISLLQLFTRQITDGLK 337
>gi|42783443|ref|NP_980690.1| heat-inducible transcription repressor [Bacillus cereus ATCC 10987] >gi|61213504|sp|Q730L9|HRCA_BACC1 Heat-inducible transcription repressor hrcA >gi|42739372|gb|AAS43298.1| heat-inducible transcription repressor HrcA [Bacillus cereus ATCC 10987] (338 aa)
Score = 387, Expect = 1.8e-35, Identities = 96/335 (28%), Positives = 188/335 (56%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMI----KIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKI-DSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLI-TFGDEVSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEKGWK 338
           +T+RQ  +L+ I++D++ +A PVGS+ + +K     S+AT+RN+MA LE+LG +EK H+SSGRVPS  GY+FY  +   P     +  ++++++FA+R    + + ++S +I+SE T    I    K+  N    LK + +V +++Q+A+ I++T  G++    I   +   L D+   + I N++L   P+ E+  KI   + ++++  V  Y+  ++ +++  FQ+         G++++L+ PEF D +K++ +L ++++ + +  I  +  Q G    I       + ED        +I E+    + ++ PTR+ YS++  LL+    +   G K
  S:     2 LTERQLLILQTIIDDFIGSAQPVGSRTLAKKDEITFSSATIRNEMADLEELGFIEKTHSSSGRVPSEKGYRFYVDHLLAPQNLPNDEIVQIKDLFAERIFEAEKIAQQSAQILSELTNYTAIVLGPKLSTNK---LKNVQIVPLDRQTAVAIIVTDTGHVQSKTITVPESVDLSDLEKMVNILNEKLSGVPMSELHNKIFKEIVTVLRGYVHNYDSAIK-ILDGTFQVPLSEKIYFGGKANMLSQPEFHDIQKVRSLLTMIDNEAEFYDI-LRHKQVGIQVKIGRENSSTAMEDCSLISATYSIGEEQVGTIAILGPTRMQYSRVISLLQLFTRQITDGLK 337
>gi|152976746|ref|YP_001376263.1| heat-inducible transcription repressor [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|189028256|sp|A7GT10|HRCA_BACCN Heat-inducible transcription repressor hrcA >gi|152025498|gb|ABS23268.1| heat-inducible transcription repressor HrcA [Bacillus cereus subsp. cytotoxis NVH 391-98] (343 aa)
Score = 386, Expect = 2.4e-35, Identities = 94/333 (28%), Positives = 191/333 (57%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMI----KIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKI-DSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDE---VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEKG 336
           +T+RQ  +L+ I++D++ +A PVGS+ + +K     S+AT+RN+MA LE+LG +EK H+SSGR+PS  GY+FY  +   P        ++++++FA+R    + V ++S +I+SE T    I    K+  N    LK + ++ + +++A+ I++T  G++    I   +   L D+   + I N++L   P+ E+  KI   + +++ + V  Y+  ++ +++  FQ+         G++++LA PEF D +K++ +L+++++ + +  I  ++ Q G    +  G E   ++ ED        ++ E+    + ++ PTR+ Y+++  LL+     F +G
  S:     2 LTERQLLILQTIIDDFIGSAQPVGSRTLAKKDEITFSSATIRNEMADLEELGFIEKTHSSSGRIPSEKGYRFYVDHLLAPQRLSAEEIVQIKDLFAERIFEAEKVAQQSAQILSELTNYTAIVLGPKLSTNK---LKNVQIIPLGRKTAVAIIVTDTGHVQSKTITVPESVDLSDLEKMVNILNEKLFGVPMVELHNKIVKEVVTVLHKYVHNYDSAMK-ILDGTFQVPLSEKIYFGGKANMLAQPEFHDIQKVRSLLEMIDNEAEFYDI-LRKKQVGIQ--VNIGRENSSMAMEDCSLISATYSVGEEQLGTIAILGPTRMHYARVITLLQLFTKHFTEG 335
>gi|32129644|sp|Q9F1W4|HRCA_BACTR Heat-inducible transcription repressor hrcA >gi|12082115|dbj|BAB20746.1| HrcA [Geobacillus thermoglucosidasius] (344 aa)
Score = 381, Expect = 7.4e-35, Identities = 92/330 (27%), Positives = 194/330 (58%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMI----KIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKI-DSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVS-HEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEF 333
           +T RQ  +L+ I++D++ +  PVGS+ + +K+  ++S+AT+RN+MA LE+LG +EK H SSGRVPS  GY++Y  +   P    +    K++++FA+R   ++ V+++S +I+S+ T    I     +++N    LKRI ++ +NKQ+A+ I++T  G++  ++I         D+   + I N+RLI  P+ ++  KI   +  +++  +  Y+ +L+ + + +  I  +      G++++L  PEF D +K++ +++++E    + ++  K N+ G    I   +++S  E+        +I ++    + ++ PTR++YS++  +L  + ++ 
  S:     2 LTDRQLLILQVIIDDFIRSGQPVGSRALSKKHEISLSSATIRNEMADLEELGYIEKTHASSGRVPSEKGYRYYVDHLLSPQRLTQEDIQKIKSIFAERIYDLEKVVQKSAQILSDLTNYTSIALGPAVKDNK---LKRIQIIPLNKQTAVAIIVTDTGHVKNHVITVPASVDPSDLEKMVNILNERLIGVPLIDLKDKIYKEVADVLRMHIHNYDSMLKTIADTL-DIPQEEKMFFAGKTNMLNQPEFSDIQKVRSLMKMIEQEKDFYRLLRKHNRKGIQVTIGRENQLSGMENCSLITATYSIGKEQLGTIAILGPTRMEYSRVITILNRVASDL 333
>gi|15613907|ref|NP_242210.1| heat-inducible transcription repressor [Bacillus halodurans C-125] >gi|20138371|sp|Q9KD74|HRCA_BACHD Heat-inducible transcription repressor hrcA >gi|10173960|dbj|BAB05063.1| transcriptional repressor of class I heat-shock genes [Bacillus halodurans C-125] (343 aa)
Score = 381, Expect = 8.7e-35, Identities = 98/332 (29%), Positives = 180/332 (54%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTK-LPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKID-SMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDE---VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEK 335
           +T RQ  +L+ IV+DY+ +A PVGS+ + ++     S AT+RN+MA LE+LG LEK H+S+GR+PS  GY++Y  +   P+   +  +  +  +F  R   ++  I++S +I+S  T+ + ++      E  LK I M+ +   S +VI +T  G +    +H        D+   + I N+RL    + ++  K++  +  +++  V  YE VL +L+E+ F+ +        G+++LL+ PEF+D EK+K+IL ILE   +  Q+      +G    +  G E    + ED+       +I  ++   + +V PTR++Y +   ++E +  +  K
  S:     2 LTDRQLLILQAIVDDYIRSAEPVGSRSISKREDITFSPATIRNEMADLEELGFLEKPHSSAGRIPSQKGYRYYVDHLLMPHRLTKKERHYIHELFTKRIQEVEQAIQQSAQILSSMTRYISVVLGPEMFETKLKSIHMIPLTAHSVVVIFVTDTGYVENQTMHLPHSVNPVDLEKTVNILNERLAGVSLFQLREKLNKEVADVLRFHVTNYELVL-DLLEKTFEAEKSEKVFYGGKTNLLSQPEFRDVEKIKQILTILEQDDVMHQMI---RSSGEQIQVRIGHENNVEAFEDLSVITASYSIGGKHMGTIGIVGPTRMEYRRTISVVEHLSKDLTK 334
>gi|124523591|ref|ZP_01697600.1| heat-inducible transcription repressor HrcA [Bacillus coagulans 36D1] >gi|124495463|gb|EAY43159.1| heat-inducible transcription repressor HrcA [Bacillus coagulans 36D1] (342 aa)
Score = 380, Expect = 1.2e-34, Identities = 98/329 (29%), Positives = 189/329 (57%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNT-EVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKI-DSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSH-EDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNE 332
           +T RQ  +L+ I++D++ +A PVGS+ + +K   + S+AT+RN+MA LE+LG +EK HTSSGRVPS  GY++Y  +   P         +L ++FA++   ++ ++++S +I+SE T    I +     +  LK + +V +N+++A+ I+IT  G +    I   +     ++   + IFN+RL + PI ++  KI   +  I++   + YE +L+ +I    + +   I  V G++++L  PEF D EK++ +L ++E    +  +  K+  +G +  I   +++S   D        +I  Q   K+ ++ PTR++YS++  +++F+ N+
  S:     2 LTDRQLLILQVIIDDFIRSAQPVGSRTLSKKNGISFSSATIRNEMADLEELGFIEKTHTSSGRVPSEKGYRYYVDHLLSPQKLGPADISQLHSIFAEKIDEMEELVKKSAQILSEMTNYTAILLGPEVKDTKLKNMQIVPLNEKTAVAIMITDTGRVENKTISLPEGFRPGELEKMVNIFNERLANVPIPDLRDKIYKEVADILRSHTENYESILKTVISMFNENRHDKI-FVGGKANILNQPEFHDLEKVRPLLDMIEREDSFYDLV-KRVPSGIHVKIGKENQISEMADCSMITATYSIGNQPVGKIAILGPTRMEYSRVISIVDFLSND 331
>gi|149182769|ref|ZP_01861233.1| heat-inducible transcription repressor [Bacillus sp. SG-1] >gi|148849535|gb|EDL63721.1| heat-inducible transcription repressor [Bacillus sp. SG-1] (342 aa)
Score = 376, Expect = 2.8e-34, Identities = 98/333 (29%), Positives = 189/333 (56%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNT-EVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKI-DSMKSIIKEKVKEYEFVLQELIERI-FQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQIL-ESTSIWEQIAFKQNQTGSNTLITFGDEVS-HEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEKG 336
           +T RQ  +L+ I++D++ +A PVGS+ + +K   + S+AT+RN+MA LE+ G +EK HTSSGR+PS  GY++Y  +   P   ++     +R++FA+R   ++ V+E S KI+SE T    I +     E  LK+I ++ I++++A+ I++T  G++   +          D+   + I N+RL   P+ E+  KI   +  ++K+ ++ Y+ +L  L+  +   +  K+     G++++L  PEF D +K++ +L ++ +   I+E I  K    G N  I   + V+  E+        ++ ++    + ++ PTR++YS++  LL F+ ++  K 
  S:     2 LTDRQLLILQVIIDDFIRSAQPVGSRSLSKKEEISFSSATIRNEMADLEEFGFIEKPHTSSGRIPSEKGYRYYVDHLLSPVQLEKKDVKTIRSIFAERIYEMEKVVERSAKILSELTNYTAIVLGPEVKENKLKKIQIIPISQETAVAIIVTDTGHVQNRMFTIPKAINSGDLEKLVNILNERLAGVPVTELNDKIFKEVAQLLKQHIENYDLMLHSLVNTMDLPVNEKLF--FGGKTNMLNQPEFHDIQKVRLLLNMIDQEDGIYEMI--KHLPNGLNVKIGKENNVTAMENCSLITASYSVADEKVGSIAILGPTRMEYSRVISLLNFLSDDMSKA 335
>gi|163762992|ref|ZP_02170056.1| Methyltransferase type 11 [Bacillus selenitireducens MLS10] >gi|160356925|gb|EDP83574.1| Methyltransferase type 11 [Bacillus selenitireducens MLS10] (342 aa)
Score = 374, Expect = 5.2e-34, Identities = 96/332 (28%), Positives = 185/332 (55%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKP-YINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNT-EVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKID-SMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDE---VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEK 335
           +T+RQ  +LK I++DYV+ A PVGS+ V ++   + S AT+RN+M+ LE +G LEK H+SSGR+PS  GY+ Y  +   P  ++ E++   +++V   R   ++ V+  S K++SE T    I +     E  L++I ++ I+ + A+ I++T  G++    +HF +     D+   + I NDRL   P+ ++   +   + +++K+ V  +E +L  +   +F+  ++      G++++LA PEF D E++++IL I E   +  ++ F+ +Q G    I  G+E      +D            Q    + ++ PTR++Y ++  ++E++  +  K
  S:     2 LTERQLLILKAIIDDYVSHAEPVGSRSVSKRDDIHFSPATIRNEMSDLEDMGFLEKTHSSSGRIPSHKGYRHYVDHLLSPGQLSKEDIG-NIQDVLRSRFHELEEVVRHSAKLLSELTNYTSIVLGPEMFESKLRQIQLIPISDKQAVAIIVTDTGHVENQTVHFPERINPDDLEKVVNILNDRLRGVPLYKLNEALSKEIHAVMKQYVNRHEAMLN-VFHEVFRQHAREKVYFSGKTNILAQPEFNDVERVRKILNIFEEDQLVSKL-FRSDQEGMT--IRIGEENHFAPFDDCTIITATYEAGGQYLGTVGILGPTRMEYPRVISIMEYLATDLSK 334
>gi|89101067|ref|ZP_01173906.1| heat-inducible transcription repressor [Bacillus sp. NRRL B-14911] >gi|89084210|gb|EAR63372.1| heat-inducible transcription repressor [Bacillus sp. NRRL B-14911] (343 aa)
Score = 368, Expect = 2.6e-33, Identities = 95/330 (28%), Positives = 190/330 (57%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNT-EVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKI-DSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILES-TSIWEQIAFKQNQTGSNTLITFGDEVS-HEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEF 333
           +T RQ  + + IV+D++ +A PVGS+ + +K   + S+AT+RN+MA LE+LG +EK HTSSGRVPS  GY++Y  +   P   ++     ++++FA+R   ++ ++++S +I+SE T    I +     E  L++I +V +NK +A+ I++T  G++   +    ++    +I   + I N+RL   PI  +  KI   +  ++++ V  Y+ +L    + I ++ +       G++++L+ PEF D  K++ ++ ++E   SI++ I  +++++G N  I   +E S  E+        ++  +    + ++ PTR++YS++  LL+ I  + 
  S:     2 LTDRQLLIFQVIVDDFIRSAQPVGSRSLSKKEEISFSSATIRNEMADLEELGFIEKTHTSSGRVPSEKGYRYYVDHLLSPQKLNQQDIFTIKSLFAERIYELEKIVQKSARIMSELTSYTSIVLGPAVKENKLRKIQIVPLNKDTAIAIIVTDTGHVENKMFSIPENIHPGEIEKLVNILNERLAGVPIDNLNDKIYKEVAVLLRQHVNHYDLLLYSFAD-ILKLSANEKLFFGGKTNMLSQPEFHDINKIRNLMNMIEQEESIYDLI--RKDKSGINIKIGRENENSAMENCSLITATYSMGAEQLGTIAVLGPTRMEYSRVISLLQIISADL 332
>gi|138896079|ref|YP_001126532.1| heat-inducible transcription repressor [Geobacillus thermodenitrificans NG80-2] >gi|134267592|gb|ABO67787.1| Repressor protein of class I heat shock genes [Geobacillus thermodenitrificans NG80-2] (333 aa)
Score = 367, Expect = 3.7e-33, Identities = 91/319 (28%), Positives = 180/319 (56%)
  Q:    15 IVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKI-ENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDS-MKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVS-HEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEF 333
           I++D++ +  PVGS+ + +K+  + S+AT+RN+MA LE+LG +EK H SSGRVPS  GY++Y  +   P         K+R+VFA+R   ++ ++++S +I+S+ T    I +     E  LKR+ ++ + +Q+A+ IV+T  G++   +I         D+   + I N+RL   P+ ++  KI++ +  +++  ++ Y+ +L  LI+ +  I  +      G++++   PEF D +K++ +L I+E      ++  KQ+Q G    I   +E+S  E+        +I ++    + ++ PTR++YS++  +L  +  + 
  S:     2 IIDDFIRSGQPVGSRTLSKKHQISFSSATIRNEMADLEELGYIEKTHISSGRVPSEKGYRYYVDHLLPPQRLTRTDIQKIRSVFAERIYELEKLVQKSAQILSDLTNYTSIALGPAFKESKLKRMQIIPLTEQTAVAIVVTDTGHVENRVITVPTTVNAGDLEKMVNILNERLNGVPLIDLKEKIETEVADVLRRHIRNYDSILNTLIDTL-DIPEEEKMFFAGKTNMFNQPEFSDIQKVRPLLNIIEQEKDIYRLLRKQSQKGVRVSIGRENELSGMENCSLITATYSIGDEPFGTIAILGPTRMEYSRVITVLNRVATDL 322
>gi|56963422|ref|YP_175153.1| heat-inducible transcription repressor [Bacillus clausii KSM-K16] >gi|61213282|sp|Q5WHG3|HRCA_BACSK Heat-inducible transcription repressor hrcA >gi|56909665|dbj|BAD64192.1| heat-inducible transcription repressor HrcA [Bacillus clausii KSM-K16] (342 aa)
Score = 363, Expect = 8.7e-33, Identities = 90/332 (27%), Positives = 182/332 (54%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKI-ENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDS-MKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEV-SHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEK 335
           +T+RQ  +L  IV+DYV +A PVGS+ + ++     S AT+RN+MA LE+LG LEK H+S+GRVPS  GY++Y  +   P+      +  L  +   R  +++ V +ES +I+SE T    I +   +    L+ I ++ ++ Q A+VI+++ +G++   ++   ++    D+   + + N+RL+  P+  +  K+++ +  + K  +  YE +L  L + +     + +    G+++L+  PEFQD EK++ + + LE  ++ ++    Q   G +  I   +E+ + E          I+ ++   L ++ PTR++Y ++  +++ +  +  K
  S:     2 LTERQLLVLHAIVDDYVRSAEPVGSRSISKREDIPYSPATIRNEMADLEELGFLEKPHSSAGRVPSQQGYRYYVDHLLSPHRLTVAERAGLSRLTTARLQAMEEVFQESARILSEMTSYVSIVLGPESINERLRHIQIIPMSNQKAVVILVSENGHVENRLVQVDENVTPSDLERTVNLLNERLVGTPLSSLQRKLNTELAQLFKAHINNYEHILHMLQQSMVPASGEKL-FFSGKTNLMEQPEFQDVEKMRLLYKALEEENLLQKWLRAQQTDGLHVSIGQENELEAFESCSVITASYAIDGRHVGTLGVIGPTRMEYKRMIKVVDSLSKDLTK 335
>gi|148377822|ref|YP_001256698.1| heat-inducible transcription repressor [Mycoplasma agalactiae PG2] >gi|148291868|emb|CAL59259.1| Heat-inducible transcription repressor hrcA [Mycoplasma agalactiae PG2] (335 aa)
Score = 362, Expect = 1.3e-32, Identities = 105/332 (31%), Positives = 182/332 (54%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHF-KDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKTK-LVMVAPTRVDYSKIKGLLEFIK---NEFEK 335
           +T   K +LKY VE ++    PV S+ ++E +  N S+A VR  M  LEK G LEK HTSSGRVPS  GY++Y         +    K +++++FA R +SI+  +EE+ KII+ES  + ++  ENN    LK + +V ++ +  +V++  S    T N I+  K+   + D++I  ++FN RL++  +  +A+   ++  I+ E +K YE +L+E I ++F         ++G+++++   E    + LK IL  +E+ SIWE I  + +    N  I    + S     F    L   + NK K + +V   R++Y+K    LE ++   NE+++
  S:     9 LTADLKTVLKYTVEMFIEDGVPVSSQALLENFKLNFSSAKVRYLMNDLEKYGFLEKTHTSSGRVPSAKGYEYYAMYLVN--FDTNAFKERIKDIFARRRVSIENTVEEAAKIITESIGVTLVTTENNENATLKNLQLVPLSDREGIVLITDSYNKTTTNNININKEMYSMNDLAIATKVFNQRLVNSSLINLASSAKALWPILSESIKNYETLLEEYINQVFHFAFVNKNNIYGRNNIILADEISRQDLLK-ILHKIENESIWEIIDSEISDQNRNIKIAICSDHS----TFIAKKL---QNNKIKEISLVGTNRMNYAKGISALEILEELINEYDE 335
>gi|52081098|ref|YP_079889.1| heat-inducible transcription repressor [Bacillus licheniformis ATCC 14580] >gi|52786476|ref|YP_092305.1| heat-inducible transcription repressor [Bacillus licheniformis ATCC 14580] >gi|81609043|sp|Q65H52|HRCA_BACLD Heat-inducible transcription repressor hrcA >gi|52004309|gb|AAU24251.1| transcriptional regulator [Bacillus licheniformis ATCC 14580] >gi|52348978|gb|AAU41612.1| HrcA [Bacillus licheniformis DSM 13] (343 aa)
Score = 360, Expect = 2.0e-32, Identities = 95/333 (28%), Positives = 183/333 (54%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKP-YINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENN-TEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKI-DSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDI---VFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEKG 336
           +T RQ  +L+ IV D++ +A PVGS+ + +K     S+AT+RN+MA LE+LG +EK H+SSGR+PS  GY++Y  +   P  ++  +L + + ++F ++   ++  +++S +++S+ T    I +    +E  LK+I +V I  + A+ I++T+ G++    I+F  +  L D+   + I N+RL   PI E+  +I   +   +K  ++ Y+ +L  L   +            G+ ++L  PEF D +++K +L ++E     ++I      T S   I  G E  +E++           +  +    + ++ PTR+DYS++ GLL+ + ++  K 
  S:     2 LTNRQLLILQVIVNDFIRSAQPVGSRTLSKKEDITFSSATIRNEMADLEELGFIEKTHSSSGRIPSEKGYRYYVDHLLSPGKLSKTDLNI-IHSIFKEKIFELEKAVQKSAQVLSDLTNYTSIVLGPRLSENHLKQIQIVPIQPKKAVAILVTNTGHVENKTINFPAEVDLSDLEKLVNILNERLRGVPISELKDRIFKEVVIFLKSHIQNYDTILHALGATLDSSVQTDRLFFGGKINMLNQPEFHDIDRVKSLLSLIEKE---QEILRLFQSTESGITIKIGKENDYEEMENCSLITATYTVGSKQIGSIAVIGPTRMDYSRVVGLLQHVSSDLSKA 336
>gi|90961552|ref|YP_535468.1| heat-inducible transcription repressor [Lactobacillus salivarius UCC118] >gi|123086798|sp|Q1WUF0|HRCA_LACS1 Heat-inducible transcription repressor hrcA >gi|90820746|gb|ABD99385.1| Heat-inducible transcription repressor [Lactobacillus salivarius UCC118] (350 aa)
Score = 357, Expect = 5.1e-32, Identities = 95/332 (28%), Positives = 176/332 (53%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIE-NNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKT---VHGQSSLLAVPEFQDTEKLKEILQIL--ESTSIWEQIAFKQNQTGSNTL-ITFGDEVSHE---DIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEK 335
           +T+RQ  +L+ I+ DY     P+GSK + E+    +S+AT+RN+MA LEK G + K H+SSGR+PS  GY++Y  N  KP   D      ++++F +    +D +IE S KI+S+ T    I +    +++ L+   MV +     MVI++ SDG++   I +  ++   + +   IR+ ND+L+   + E+ +K+  ++ ++ + +++ +      I+    I  K IK    + G+ +LL      + E++K +  ++  ES  I   +    N    + + +  GDE+S     D        N+    +  + ++ PT + YSK+ GL+E  + E  K
  S:     2 LTERQLLILETIIRDYTDLGQPIGSKTLQEQLPIRVSSATIRNEMAVLEKQGFITKEHSSSGRIPSLKGYRYYVDNLVKPVKIDSKSVRSIQSLFGNEYRRVDEIIEMSAKILSDLTNYTAITLRPEASDLKLEGFRMVPLGNGQVMVILVASDGSVESQIYNLPNNIDGESLEAVIRLINDKLVGSSLSEVTSKLQELQPLLTKYIEKSD----GFIDVFGGILDKAIKEQFYIGGRRNLLNFANGNNLEQIKSLYSLIDDESDKIGGLVDNTTNPHDHHGISVKIGDEMSDRLLLDYSLVSATYNVGSHGRGMIAILGPTNMPYSKMIGLVEVFQKELTK 339
>gi|154686809|ref|YP_001421970.1| heat-inducible transcription repressor [Bacillus amyloliquefaciens FZB42] >gi|166219850|sp|A7Z6W3|HRCA_BACA2 Heat-inducible transcription repressor hrcA >gi|154352660|gb|ABS74739.1| HrcA [Bacillus amyloliquefaciens FZB42] (343 aa)
Score = 356, Expect = 6.5e-32, Identities = 97/334 (29%), Positives = 187/334 (55%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPY-INDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENN-TEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKI-DSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVH-GQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTL-ITFGDEVSHEDI---VFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEKGW 337
           +T RQ  +L+ I+ D++ +A PVGS+ + +K     S+AT+RN+MA LE+LG +EK H+SSGR+PS  GY++Y  +   P  +   +L L + ++F ++   ++  +++S +I+S+ T    I +    +E  LK+I +V I    A+ I++T+ G++    I+F     L DI   + I NDRL   P+ E+  +I   + + +++ +  Y+ +L+ L    F   + + K    G+ ++L  PEF D E+++ +L ++E     EQ   K  Q+    + I  G E  +E++           ++ +    + ++ PTR++YS++  LL+ + ++  K +
  S:     2 LTNRQLLILQVIINDFIQSAQPVGSRTLSKKDEITFSSATIRNEMADLEELGFIEKTHSSSGRIPSEKGYRYYVDHLLSPVKLTKTDLDL-IHSIFKEKIFELEKTVQKSAQILSDLTNYTSIVLGPTLSENYLKQIQIVPIQPDKAVAILVTNTGHVENRTINFPAKVDLADIEKLVNILNDRLAGVPMDELNERIFKEVVTYLRQHIANYDSILESL-RSTFHPAAHVEKLFFGGKINMLNQPEFHDIERVRSLLSLIEK----EQDVLKLFQSSKAGISIKIGKENDYEEMENCSLITATYTVDTKQIGSIAIIGPTRMNYSRVVSLLQHVTSDLSKAF 337
>gi|157693049|ref|YP_001487511.1| heat-inducible transcription repressor [Bacillus pumilus SAFR-032] >gi|167017209|sp|A8FFD4|HRCA_BACP2 Heat-inducible transcription repressor hrcA >gi|157681807|gb|ABV62951.1| heat shock protein transcription repressor [Bacillus pumilus SAFR-032] (343 aa)
Score = 355, Expect = 7.6e-32, Identities = 88/330 (26%), Positives = 180/330 (54%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENN-TEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKI-DSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEV-SHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEF 333
           +T RQ  +L+ I+ D++ +A PVGS+ + +K     S+AT+RN+MA LE+LG +EK H+SSGR+PS  GY++Y  +   P     N  + +++ F ++   ++  +++S +I+S+ T    I +    +E  LK+I +V +    A+ I+IT  G++    I F +   + DI   + I N RL   P+ ++  ++   +  +++  +K+Y+ +L  L       +++      G+ ++L  PEF D ++++ ++ ++E  +   Q+ F  NQ G    I   + + + E+        +I++++   + ++ PTR+DY ++  LL  +  + 
  S:     2 LTNRQLLILQVIINDFIRSAQPVGSRTLSKKEDITFSSATIRNEMADLEELGFIEKTHSSSGRIPSEKGYRYYVDHLLSPRKLSSNELVLIQSAFQEKIFELEKTVQKSAEILSDLTNYTSIVLGPKLSENRLKQIQLVPVQPNKAVAIMITDSGHVENKTITFSEHLDVSDIEKLMNILNSRLAGVPMDQLKDRMYKEVVMLLRTHLKDYDHILDALGNTFTSTQNESKLFFGGKINMLNQPEFHDIDRIRSLMMLIEQKNDVMQL-FHPNQQGITIKIGSENNLEAMENCSLITATYSIDQKSLGSIAVIGPTRMDYGRVVSLLHHVSKDL 333
>gi|54019979|ref|YP_115525.1| heat-inducible transcription repressor [Mycoplasma hyopneumoniae 232] >gi|71893369|ref|YP_278815.1| heat-inducible transcription repressor [Mycoplasma hyopneumoniae J] >gi|72080352|ref|YP_287410.1| heat-inducible transcription repressor [Mycoplasma hyopneumoniae 7448] >gi|123645350|sp|Q4A902|HRCA_MYCH7 Heat-inducible transcription repressor hrcA >gi|123646045|sp|Q4AAT9|HRCA_MYCHJ Heat-inducible transcription repressor hrcA >gi|61213330|sp|Q602E0|HRCA_MYCH2 Heat-inducible transcription repressor hrcA >gi|53987152|gb|AAV27353.1| heat-inducible transcription repressor [Mycoplasma hyopneumoniae 232] >gi|71851496|gb|AAZ44104.1| heat-inducible transcription repressor [Mycoplasma hyopneumoniae J] >gi|71913476|gb|AAZ53387.1| heat-inducible transcription repressor [Mycoplasma hyopneumoniae 7448] (335 aa)
Score = 355, Expect = 7.7e-32, Identities = 87/268 (32%), Positives = 162/268 (60%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQI 268
           M ++  ++++ LK IVE+++ T   +GS  + + Y    S + +R  M  LEK G LEK+H+SSGR+P+  G+++Y +  S  +  +ENL  KL+++FA R ++I+  I E+ K+ISES    +I   NN    L  I++ +I++   +++V++S GN+    I F +    +D+ I IR+F +RLI+ P+ EI++K+  +K  +++++K  + +L   +E+IF  + +    ++ ++SL+   E     KL ++L I+E  SIWE +
  S:     1 MPKLDSKKEKYLKQIVENFIKTGESIGSLNLKQSYGIKKSPSYLRAIMNQLEKEGFLEKSHSSSGRIPTLQGFQYYAEFLS--FDENENLANKLKDLFARRRINIENTISEAVKLISESVGTTLIATTNNENERLMSINLTQISQNEGIIVVVSSSGNVENKKITFSEQIPRQDVKIAIRLFQERLINTPLLEISSKLAILKQELEKQIKHSDELLHHFMEKIFNFQVQNKSNIYNKNSLILDKEISRA-KLVDLLYIIEKKSIWEML 265
>gi|16800580|ref|NP_470848.1| heat-inducible transcription repressor [Listeria innocua Clip11262] >gi|47095428|ref|ZP_00233038.1| heat-inducible transcription repressor HrcA [Listeria monocytogenes str. 1/2a F6854] >gi|153179525|ref|ZP_01932744.1| heat-inducible transcription repressor HrcA [Listeria monocytogenes F6900] >gi|153183830|ref|ZP_01934647.1| heat-inducible transcription repressor HrcA [Listeria monocytogenes J0161] >gi|153190918|ref|ZP_01938229.1| heat-inducible transcription repressor HrcA [Listeria monocytogenes J2818] >gi|20138254|sp|Q92BN6|HRCA_LISIN Heat-inducible transcription repressor hrcA >gi|16413985|emb|CAC96743.1| transcription repressor of class I heat-shock gene HrcA [Listeria innocua] >gi|47016249|gb|EAL07172.1| heat-inducible transcription repressor HrcA [Listeria monocytogenes str. 1/2a F6854] >gi|126943482|gb|EBA21203.1| heat-inducible transcription repressor HrcA [Listeria monocytogenes J0161] >gi|127765486|gb|EBA25834.1| heat-inducible transcription repressor HrcA [Listeria monocytogenes J2818] >gi|133733010|gb|EBA34708.1| heat-inducible transcription repressor HrcA [Listeria monocytogenes F6900] (345 aa)
Score = 354, Expect = 1.2e-31, Identities = 95/330 (28%), Positives = 181/330 (54%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVI-EKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKI-ENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKID-SMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTS--------IWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEF 333
           +T+RQ  + + I++ +  T  PVGSK ++ EK +P  S+AT+RN+M  LE+ G +EK H+SSGRVPS  GY+FY     +P   D++ +  +R+ F++    ++ +I+ S  ++S+ T    I +    T+  L     V IN   AM+I+IT  G++  +++   + + L DI   + I N+RL+   + ++  +I   +K ++ + V+ YE  +    +   Q   + +    G++++L  PEF D  K++E+L ++E           I + +  K  +  +N+L+        ED        NI  +    +V++ PTR++YS++ GL++ +  + 
  S:     2 LTERQLLIFRAIIDHFTWTIQPVGSKNLLKEKSLP-YSSATIRNEMGVLEEYGFIEKTHSSSGRVPSEKGYRFYVDYLLQPKKLDKSDRQMIRSFFSENYYEMEGLIQNSALMLSDLTNYTSILLGPEATKNHLSGFRFVPINNFQAMLILITDQGHVDNHLVTIPEGTTLSDIERMVNILNERLVGLSLDDLKVQIPMEVKELLGKHVRNYESFMHVFSDSFAQASQQKV-YFGGKTNILNQPEFHDINKVREMLHLMEEEQDVYELFRDIPDGLQVKIGRENNNSLM--------EDCSIITATYNIAGERVGGIVLLGPTRMEYSRMMGLVDVMSRDL 332
>gi|16803515|ref|NP_465000.1| heat-inducible transcription repressor [Listeria monocytogenes EGD-e] >gi|46907703|ref|YP_014092.1| heat-inducible transcription repressor [Listeria monocytogenes str. 4b F2365] >gi|47093482|ref|ZP_00231245.1| heat-inducible transcription repressor HrcA [Listeria monocytogenes str. 4b H7858] >gi|153166881|ref|ZP_01927349.1| heat-inducible transcription repressor HrcA [Listeria monocytogenes FSL N1-017] >gi|153174602|ref|ZP_01930103.1| heat-inducible transcription repressor HrcA [Listeria monocytogenes FSL N3-165] >gi|153196254|ref|ZP_01940662.1| heat-inducible transcription repressor HrcA [Listeria monocytogenes 10403S] >gi|153202310|ref|ZP_01943939.1| heat-inducible transcription repressor HrcA [Listeria monocytogenes HPB2262] >gi|167014721|ref|ZP_02277254.1| heat-inducible transcription repressor [Listeria monocytogenes FSL J1-194] >gi|167454075|ref|ZP_02320298.1| heat-inducible transcription repressor [Listeria monocytogenes FSL J2-064] >gi|10720044|sp|Q9S5A6|HRCA_LISMO Heat-inducible transcription repressor hrcA >gi|61213490|sp|Q71ZJ5|HRCA_LISMF Heat-inducible transcription repressor hrcA >gi|5689037|dbj|BAA82787.1| HrcA [Listeria monocytogenes] >gi|16410904|emb|CAC99553.1| transcription repressor of class I heat-shock gene HrcA [Listeria monocytogenes] >gi|46880972|gb|AAT04269.1| heat-inducible transcription repressor HrcA [Listeria monocytogenes str. 4b F2365] >gi|47018158|gb|EAL08928.1| heat-inducible transcription repressor HrcA [Listeria monocytogenes str. 4b H7858] >gi|127634536|gb|EBA23922.1| heat-inducible transcription repressor HrcA [Listeria monocytogenes 10403S] >gi|133727287|gb|EBA28985.1| heat-inducible transcription repressor HrcA [Listeria monocytogenes FSL N1-017] >gi|133730206|gb|EBA31904.1| heat-inducible transcription repressor HrcA [Listeria monocytogenes FSL N3-165] >gi|133735593|gb|EBA37291.1| heat-inducible transcription repressor HrcA [Listeria monocytogenes HPB2262] (345 aa)
Score = 353, Expect = 1.4e-31, Identities = 95/330 (28%), Positives = 181/330 (54%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVI-EKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKI-ENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKID-SMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTS--------IWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEF 333
           +T+RQ  + + I++ +  T  PVGSK ++ EK +P  S+AT+RN+M  LE+ G +EK H+SSGRVPS  GY+FY     +P   D++ +  +R+ F++    ++ +I+ S  ++S+ T    I +    T+  L     V IN   AM+I+IT  G++  +++   + + L DI   + I N+RL+   + ++  +I   +K ++ + V+ YE  +    +   Q   + +    G++++L  PEF D  K++E+L ++E           I + +  K  +  +N+L+        ED        NI  +    +V++ PTR++YS++ GL++ +  + 
  S:     2 LTERQLLIFRAIIDHFTWTIQPVGSKNLLKEKGLP-YSSATIRNEMGVLEEYGFIEKTHSSSGRVPSEKGYRFYVDYLLQPKKLDKSDRQMIRSFFSENYYEMEGLIQNSALMLSDLTNYTSILLGPEATKNHLSGFRFVPINNFQAMLILITDQGHVDNHLVTIPEGTTLSDIERMVNILNERLVGLSLDDLKVQIPMEVKELLGKHVRNYESFMHVFSDSFAQASQQKV-YFGGKTNILNQPEFHDINKVREMLHLMEEEQDVYELFRDIPDGLQVKIGRENNNSLM--------EDCSIITATYNIAGERVGGIVLLGPTRMEYSRMMGLVDVMSRDL 332
>gi|167214475|ref|ZP_02284782.1| heat-inducible transcription repressor [Listeria monocytogenes FSL R2-503] (348 aa)
Score = 353, Expect = 1.4e-31, Identities = 95/330 (28%), Positives = 181/330 (54%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVI-EKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKI-ENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKID-SMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTS--------IWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEF 333
           +T+RQ  + + I++ +  T  PVGSK ++ EK +P  S+AT+RN+M  LE+ G +EK H+SSGRVPS  GY+FY     +P   D++ +  +R+ F++    ++ +I+ S  ++S+ T    I +    T+  L     V IN   AM+I+IT  G++  +++   + + L DI   + I N+RL+   + ++  +I   +K ++ + V+ YE  +    +   Q   + +    G++++L  PEF D  K++E+L ++E           I + +  K  +  +N+L+        ED        NI  +    +V++ PTR++YS++ GL++ +  + 
  S:     5 LTERQLLIFRAIIDHFTWTIQPVGSKNLLKEKGLP-YSSATIRNEMGVLEEYGFIEKTHSSSGRVPSEKGYRFYVDYLLQPKKLDKSDRQMIRSFFSENYYEMEGLIQNSALMLSDLTNYTSILLGPEATKNHLSGFRFVPINNFQAMLILITDQGHVDNHLVTIPEGTTLSDIERMVNILNERLVGLSLDDLKVQIPMEVKELLGKHVRNYESFMHVFSDSFAQASQQKV-YFGGKTNILNQPEFHDINKVREMLHLMEEEQDVYELFRDIPDGLQVKIGRENNNSLM--------EDCSIITATYNIAGERVGGIVLLGPTRMEYSRMMGLVDVMSRDL 335
>gi|159507390|gb|ABW97715.1| HrcA [Bacillus megaterium] (356 aa)
Score = 353, Expect = 1.6e-31, Identities = 90/332 (27%), Positives = 184/332 (55%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKI-ENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKI-DSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIV---FAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEK 335
           +T RQ  +L+ I++D++ +A PVGS+ + +K   N S+AT+RN+M+ LE+LG +EK HTSSGRVPS  GY++Y  +   P     +    +R+VFA+R + ++ ++++S +I+S+ T L  I +        LK++ ++ +  QSA+ I++T  G++    I         DI   + I N++LI   I ++  K+   + +++K  ++ YE  + +++  + ++       V G++++ A PEF D  K++ +  I+E    + ++    N+ G +  +  G E    ++V         +   +    + ++ PTR++Y+++  LL  + ++  +
  S:     2 LTDRQLLILQVIIDDFIRSAQPVGSRTLSKKEEFNFSSATIRNEMSDLEELGFIEKTHTSSGRVPSEKGYRYYVDHLVSPQHLKASDVSTVRSVFAERIVELEQLVQKSAQILSDLTSLTSIVLGPKAVSHKLKQLQILPLTAQSAVAIIVTDTGHVESRTITLPSSIQPSDIEKMVNILNEKLIGVRITDLHDKMYKEVATLLKSHIQGYEQTM-DILNDVLKLNMNGKLVVGGKTNMFAQPEFHDLNKIRGLFNIIEHEQQFYKL-LSPNEAGIH--VKIGHENKLNEMVGCSLITASYSFGHEQLGTIAILGPTRMEYARVISLLTLLSSDMSQ 334
>gi|167217569|ref|ZP_02287205.1| heat-inducible transcription repressor [Listeria monocytogenes FSL J1-175] (351 aa)
Score = 352, Expect = 1.7e-31, Identities = 92/330 (27%), Positives = 179/330 (54%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKI-ENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKID-SMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTS--------IWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEF 333
           +T+RQ  + + I++ +  T  PVGSK ++++     S+AT+RN+M  LE+ G +EK H+SSGRVPS  GY+FY     +P   D++ +  +R+ F++    ++ +I+ S  ++S+ T    I +    T+  L     V IN   AM+I+IT  G++  +++   + + L DI   + I N+RL+   + ++  +I   +K ++ + V+ YE  +    +   Q   + +    G++++L  PEF D  K++E+L ++E           I + +  K  +  +N+L+        ED        NI  +    +V++ PTR++YS++ GL++ +  + 
  S:     8 LTERQLLIFRAIIDHFTWTIQPVGSKNLLKEKGLPYSSATIRNEMGVLEEYGFIEKTHSSSGRVPSEKGYRFYVDYLLQPKKLDKSDRQMIRSFFSENYYEMEGLIQNSALMLSDLTNYTSILLGPEATKNHLSGFRFVPINNFQAMLILITDQGHVDNHLVTIPEGTTLSDIERMVNILNERLVGLSLDDLKVQIPMEVKELLGKHVRNYESFMHVFSDSFAQASQQKV-YFGGKTNILNQPEFHDINKVREMLHLMEEEQDVYELFRDIPDGLQVKIGRENNNSLM--------EDCSIITATYNIAGERVGGIVLLGPTRMEYSRMMGLVDVMSRDL 338
>gi|16079603|ref|NP_390427.1| heat-inducible transcription repressor [Bacillus subtilis subsp. subtilis str. 168] >gi|140723|sp|P25499|HRCA_BACSU Heat-inducible transcription repressor hrcA >gi|143057|gb|AAA22526.1| ORF39 >gi|1303806|dbj|BAA12462.1| YqeS [Bacillus subtilis] >gi|2634995|emb|CAB14491.1| transcriptional regulator [Bacillus subtilis subsp. subtilis str. 168] (343 aa)
Score = 351, Expect = 2.4e-31, Identities = 93/333 (27%), Positives = 181/333 (54%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENN-TEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKI-DSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTL-ITFGDEVSHEDI---VFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEKG 336
           +T RQ  +L+ I+ D++ +A PVGS+ + +K     S+AT+RN+MA LE+LG +EK H+SSGRVPS  GY++Y  +   P    ++   ++ ++F ++   ++  +++S +I+S+ T    I +    +E  LK+I ++ I    A+ I++T+ G++    I+F     L DI   + I NDRL   P+ E+  +I   +   +++ +K Y+ +L  L                G+ ++L  PEF D  +++ +L ++E     EQ   K  Q+    + I  G E  +E++          +++++    + ++ PTR++YS++  LL+ + ++  K 
  S:     2 LTNRQLLILQVIINDFIKSAQPVGSRTLSKKDEITFSSATIRNEMADLEELGFIEKTHSSSGRVPSEKGYRYYVDHLLSPVKLTKSDLDQIHSIFKEKIFELEKTVQKSAQILSDLTNYTSIVLGPKLSENYLKQIQIIPIQPDMAVAILVTNTGHVENKTINFPTKMDLSDIEKLVNILNDRLSGVPMDELNERIFKEVVMYLRQHIKNYDNILDALRSTFHSTNHVEKLFFGGKINMLNQPEFHDITRVRSLLSLIEK----EQDVLKLVQSPHTGISIKIGKENDYEEMENCSLITASYSVDQKQIGSIAIIGPTRMNYSRVVSLLQHVTSDLSKA 336
>gi|7387779|sp|O87775|HRCA_LACSK Heat-inducible transcription repressor hrcA >gi|3688417|emb|CAA06939.1| HrcA protein [Lactobacillus sakei] (352 aa)
Score = 350, Expect = 3.5e-31, Identities = 88/332 (26%), Positives = 167/332 (50%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKI-ENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQIL-ESTSIWEQIAFKQNQTGSNTLITFGDEVSHE---DIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEK 335
           +T+RQ  +LK I+  +  +  PVGSK ++ +   ++S+AT+RNDMA LE +GL+EK H+SSGRVPS  GY++Y  +  +P + +      ++  F      ID ++ +S  I+S  T    I +     E+ L    +V +     M I++TS G +   +    +     ++   IR+ ND LI  P+  ++ K+ +    +  +          + + + +  S+    V GQS+LL   E  D  +LK I  I+ +S  + + +     +  S   +  GDE++++   +      + ++ E  +  + ++ PT + +S++ GLL+  + E  K
  S:     2 LTERQLMILKEIIRLFTESGQPVGSKKLMSELPMHVSSATIRNDMADLENVGLIEKTHSSSGRVPSMKGYRYYLDHLIQPAVLNPMDVATVQQSFGRHYHKIDEIVSQSANILSNLTSYTAITLGPEMAEIRLTGFRLVPLGNHQVMAIIVTSAGTVDNQVFTIPNAISGDELEKAIRVVNDHLIGLPLTVVSQKLKTEVPALLMQYMGSPGGFLNIFDDVLKQASQERLYVGGQSNLLNFSELTDVSQLKSIYNIINQSDDLAKLLELSPGEANSQVQVRLGDEMTNDLLKNYSLMTVNYDVGEHGQGLIALLGPTSMPHSRMIGLLDLFREELAK 338
>gi|29375874|ref|NP_815028.1| heat-inducible transcription repressor [Enterococcus faecalis V583] >gi|46576518|sp|Q835R9|HRCA_ENTFA Heat-inducible transcription repressor hrcA >gi|29343336|gb|AAO81098.1| heat-inducible transcription repressor HrcA [Enterococcus faecalis V583] (347 aa)
Score = 347, Expect = 7.6e-31, Identities = 91/330 (27%), Positives = 168/330 (50%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNT-EVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSH---EDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEF 333
           IT+RQ+ +L+ I+++Y  T  PVGSK ++E  + + S+AT+RNDM  LE+ GLL K H+SSGR+PS AGY++Y  +  +P   +EN   ++R  F      I+ +I +S +I+SE T      +     E  L    MV +N +  + I++T  GN+   +         +D+    +I ND+L+  P+  +  ++ +   +I  +  +    +  L + +     +    V G+ +LL     QD E+LK +   ++++     +      T +  +   G E+ +   ED+        ++   K  + ++ PT + YSKI GL++  ++E 
  S:     2 ITERQQNILRLIIQNYTNTGLPVGSKKLMEDGIAS-SSATIRNDMKALEEYGLLAKTHSSSGRIPSMAGYRYYVDHLLQPTQVEENELRRIRQSFGKEFHEINDIIRQSAEILSELTSYTAFSLGPEVKERKLTGFRMVPLNDRQVLAIIVTDKGNVENQVFAIPAAVSSQDLEKMTQIINDKLVGQPLLTVYHRLRTEIPMILHRYFQTPEGMMNLFDEMLGHAFEEKVFVGGRMNLLDFGIKQDIEQLKSVYSFMQNSDELTHLLNGSATTENPIVFRIGSEIGNNLLEDMSMITATYEVSGHGKGTIALLGPTSMPYSKIFGLVDTFRHEL 334
>gi|81428849|ref|YP_395849.1| heat-inducible transcription repressor [Lactobacillus sakei subsp. sakei 23K] >gi|123755826|sp|Q38W91|HRCA_LACSS Heat-inducible transcription repressor hrcA >gi|78610491|emb|CAI55542.1| Transcriptional regulator of heat-shock/chaperone genes [Lactobacillus sakei subsp. sakei 23K] (352 aa)
Score = 340, Expect = 4.7e-30, Identities = 87/332 (26%), Positives = 165/332 (49%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKI-ENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQIL-ESTSIWEQIAFKQNQTGSNTLITFGDEVSHE---DIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEK 335
           +T+RQ  +LK I+  +  +  PVGSK ++ +   ++S+AT+RNDMA LE +GL+EK H+SSGRVPS  GY++Y  +  +P + +      ++  F      ID ++ +S  I+S  T    I +      + L    +V +     M I++TS G +   +    +     ++   IR+ ND LI  P+  ++ K+      +  +          + + + +  S+    V GQS+LL   E  D  +LK I  I+ +S  + + +     +  S   +  G+E++++   +      + ++ E  +  + ++ PT + YS++ GLL+  + E  K
  S:     2 LTERQLMILKEIIRLFTESGQPVGSKKLMSELPMHVSSATIRNDMADLENVGLIEKTHSSSGRVPSMKGYRYYLDHLIQPAVLNPMDVATVQQSFGRHYHKIDEIVSQSANILSNLTSYTAITLGPEMAAIRLTGFRLVPLGNHQVMAIIVTSAGTVDNQVFTIPNAISGDELEKAIRVVNDHLIGLPLTVVSQKLKIEVPALLMQYMGSPGGFLNIFDDVLKQASQERLYVGGQSNLLNFSELTDVSQLKSIYNIINQSDDLAKLLELSPGEANSQVQVRLGNEMTNDLLKNYSLMTVNYDVGEHGQGLIALLGPTSMPYSRMIGLLDLFREELAK 338
>gi|116629477|ref|YP_814649.1| heat-inducible transcription repressor [Lactobacillus gasseri ATCC 33323] >gi|122273585|sp|Q044B1|HRCA_LACGA Heat-inducible transcription repressor hrcA >gi|116095059|gb|ABJ60211.1| heat-inducible transcription repressor HrcA [Lactobacillus gasseri ATCC 33323] (352 aa)
Score = 339, Expect = 6.1e-30, Identities = 94/332 (28%), Positives = 179/332 (53%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTE-VLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFV------LQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQIL-ESTSIWEQIAFK-----QNQTGSNTLITFGDEVSH---EDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEK 335
           +T+RQ+ +LK I+ D+  +  PVGSK V+ +    +S+ATVRN+MA LE+ GLLEK H+SSGR+PSTAGY++Y  +   P     ++  ++          ++ +++E+ KI+S+ T          T  V +    +V ++    M I++T DGN+   I      +  ++I   +R+ ND+L+  P+        S+  ++ +++ ++         + +L++ + +  +     V GQ +LL+  E  D  K+K + +++ ++ +I   I F      +N + S   +  G E+     ED        ++ +  K  + ++ PT + YS++ GLLE+ +NE  K
  S:     2 LTERQELILKTIIMDFTQSHEPVGSKTVMNQLPVKVSSATVRNEMAALEEKGLLEKTHSSSGRIPSTAGYRYYLDHLINPVKIPASVYNRIIYQLDQPFQQVNEIVQEAAKILSDLTNYTAFAAGPETRSVKVTGFRIVPLSSHQVMAILVTDDGNVKNQIYTLPHHTNGEEIEKAVRLINDQLVGKPLS-------SVNEVLLKRIADHLVAGGSAPEILDLLQDVIKDAASEQMYVDGQINLLSNYESDDLAKVKSLYKLIDQNDAISSLIGFNPKDEIKNDSKSKVQVKLGSELQSDLLEDYSLLTAQYSVGKYGKGTIALLGPTNMPYSQMIGLLEYFRNELAK 342
>gi|116872906|ref|YP_849687.1| heat-inducible transcription repressor [Listeria welshimeri serovar 6b str. SLCC5334] >gi|123463778|sp|A0AIS6|HRCA_LISW6 Heat-inducible transcription repressor hrcA >gi|116741784|emb|CAK20908.1| hrcA [Listeria welshimeri serovar 6b str. SLCC5334] (345 aa)
Score = 338, Expect = 7.0e-30, Identities = 93/330 (28%), Positives = 180/330 (54%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVI-EKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKI-ENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKID-SMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTS--------IWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEF 333
           +T+RQ  + + I++ +  T  PVGSK ++ EK +P  S+AT+RN+M  LE+ G +EK H+SSGRVPS  GY+FY     +    D++ +  +R+ F++    ++ +I+ S  ++S+ T    I +    T+  L     V IN   AM+I+IT  G++  +++   + + L DI   + I N+RL+   + ++  +I   +K ++ + V+ YE  +    +   Q   + +    G++++L  PEF D  K++E+L ++E           I + +  K  +  +N+L+        ED        NI  +    +V++ PTR++Y+++ GL++ +  + 
  S:     2 LTERQLLIFRAIIDHFTWTIQPVGSKNLLKEKGLP-YSSATIRNEMGVLEEYGFIEKTHSSSGRVPSEKGYRFYVDYLLQLKKLDKSDRQMIRSFFSENYYEMEGLIQNSALMLSDLTNYTSILLGPEATKNHLSGFRFVPINNFQAMLILITDQGHVDNHLVTIPEGTTLSDIERMVNILNERLVGLSLDDLKVQIPMEVKELLGKHVRNYESFMHVFSDSFAQASQQKV-YFGGKTNILNQPEFHDINKVREMLHLMEEEQDVYELFRDIPDGLQVKIGRENNNSLM--------EDCSIITATYNIAGERVGGIVLLGPTRMEYNRMMGLVDVMSRDL 332
>gi|121534798|ref|ZP_01666618.1| heat-inducible transcription repressor HrcA [Thermosinus carboxydivorans Nor1] >gi|121306593|gb|EAX47515.1| heat-inducible transcription repressor HrcA [Thermosinus carboxydivorans Nor1] (341 aa)
Score = 336, Expect = 1.3e-29, Identities = 88/326 (26%), Positives = 169/326 (51%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTK-LPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATK-IDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSH---EDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFI 329
           + +R++++L+ I++DY++TA PVGS+ +  KY   +S AT+RN+MA LE LG LE+ HTS+GR+PS  GY+FY      P    E     +   +  +   ++ V +E+ KI+S  T+ + ++     ++   K +  + ++++ A+++V++  G +   II   +    +++       N+RL       I +  +  +K  I      +E  L E I+    ++ K      G + +L  PEF+D +K++ +L +LE   +   I   +   G   ++T G E  +    D    Q    ++ Q    + ++ PTR++Y +I  +LEF+
  S:     1 MDERKRKILQAIIDDYISTAEPVGSRTIARKYNLGVSPATIRNEMADLELLGYLEQPHTSAGRIPSAKGYRFYVDCLLAPQPLSEKEIALIERWYQTKVRRLEEVFQETAKILSRITRNISLVLAPQLSQCAFKYMQFLPLDERRAILVVVSDTGFVENKIIEIPEGIGFQELQKIAGAINERLAGLAFDRIKSSLLREIKHDIIPNRALFETAL-EFIKDALAVERKDRVYTGGTTQVLDQPEFRDVDKVRGLLAMLEEEQLLVDILHMRESDG--VVVTIGGENKYTGIHDCSMVQATYRVDGQVVGTVAVLGPTRMEYGRIMSVLEFM 328
>gi|42519353|ref|NP_965283.1| heat-inducible transcription repressor [Lactobacillus johnsonii NCC 533] >gi|61213520|sp|Q74IT4|HRCA_LACJO Heat-inducible transcription repressor hrcA >gi|41583641|gb|AAS09249.1| heat-inducible transcription repressor hrcA [Lactobacillus johnsonii NCC 533] (352 aa)
Score = 332, Expect = 3.9e-29, Identities = 98/332 (29%), Positives = 176/332 (53%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTE-VLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLID---CPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQIL-ESTSIWEQIAFK-----QNQTGSNTLITFGDEVSH---EDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEK 335
           +T+RQ+ +LK I+ D+  T  PVGSK V+ +    +S+ATVRN+MA LE+ GLLEK H+SSGR+PSTAGY++Y  +   P     ++  ++          ++ +++E+ KI+S+ T          T  V +    +V ++    M I++T DGN+   I      +  ++I   +R+ ND+L+      I E+  K  +   I +    E   +LQ++I+      +     V GQ +LL+  E  D  K+K + +++ ++ ++   I F      +N + S   +  G E+     E+        ++ +  K  + ++ PT + YS++ GLLE+ +NE  K
  S:     2 LTERQELILKTIIMDFTQTHEPVGSKTVMNQLPVKVSSATVRNEMAVLEEKGLLEKTHSSSGRIPSTAGYRYYLDHLINPVKIPTSVYNQIVYQLDRPFQQVNEIVQEAAKILSDLTNYTAFAAGPETHSVKVTGFRIVPLSSHQVMAILVTDDGNVKNQIYTLPHHTNGEEIEKAVRLINDQLVGKSLSSINEVLLKRIADHLIARGSAPEILDLLQDVIKD----AASEQMYVDGQINLLSNYENDDLTKIKSLYKLIDQNDALSSLIGFNPEDELKNDSSSKVQVKLGSELPSDLLENYSLLTAQYSVGKYGKGTIALLGPTNMPYSQMIGLLEYFRNELAK 342
>gi|23099425|ref|NP_692891.1| heat-inducible transcription repressor [Oceanobacillus iheyensis HTE831] >gi|38372371|sp|Q8EPW3|HRCA_OCEIH Heat-inducible transcription repressor hrcA >gi|22777654|dbj|BAC13926.1| transcriptional repressor of class I heat-shock genes [Oceanobacillus iheyensis HTE831] (342 aa)
Score = 328, Expect = 1.0e-28, Identities = 93/329 (28%), Positives = 176/329 (53%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIE-KYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNT-EVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDS-MKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHE---DIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNE 332
           +T+RQ  +L+ I++D++ TA+P+GS+ + + +Y+P  SAAT+RN+MA LE LG LEK HTSSGR+PS  GY++Y  +   P +N     + LR          + V++ + +++SE T    I +     E  LK+I ++ ++  +A+ I++TS G++        +     D+   + I NDRL   PI  +   I + +  ++   + ++E    +L+   F  +  +     G+S++L  PEF D +K++    ++E     ++IA     T     ++ G+E   E   D+       ++ +     + ++ PTR++Y K+  L++ I +E
  S:     2 LTERQLIILQVIIDDFIETAHPIGSRALSKSEYLP-YSAATIRNEMADLEDLGFLEKTHTSSGRIPSEKGYRYYVDHLIGP-MNQHEAGI-LRKYTDGEFFEFEQVVQMTAEVLSELTNYTSIILGPEMFEATLKQIQVLTLSDHTAVAILVTSTGHVEHRSFALPEGIASSDLEKLVNILNDRLKGVPIIRLGEVISTEVAQLMHRYMDDFEASF-DLLRAFFMNEHPVKLYFGGKSNILMQPEFNDVDKIRSFYALIEQE---DEIANLLKNTHQGIKVSIGNENKVEAIKDLSLITASYHVGDNLMGTIALLGPTRMEYKKVISLMKGISDE 329
>gi|116514290|ref|YP_813196.1| heat-inducible transcription repressor [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|122274978|sp|Q049W4|HRCA_LACDB Heat-inducible transcription repressor hrcA >gi|116093605|gb|ABJ58758.1| heat-inducible transcription repressor HrcA [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (347 aa)
Score = 323, Expect = 4.1e-28, Identities = 88/332 (26%), Positives = 172/332 (51%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKL-PMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSM---KSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSI-WEQIAFKQNQTGSNTLITFGDEVSHE---DIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEK 335
           +T+RQ+ +LK I++D+  T  PVGSK V+ +    +S+AT+RN+MA LE+ GL+EK H+SSGRVPST GY++Y  N  +P    E +  ++   F      +D +++E+ +I+S+ T      +   +  V +    +V +  +  M I++ SDG++   +          ++    R+ ND+L+   + EI  +         I+ +   E+     EL+E + +  +     V GQ +LL   E  D + +K + +++ S+S+  E I    + +     +  G E+ ++   D      + ++    +  + ++ P  + YS++ GL+E+ + E  +
  S:     2 LTKRQELILKTIIQDFTKTHEPVGSKTVMNQLSIKVSSATIRNEMAVLEEHGLIEKTHSSSGRVPSTEGYRYYLDNLVQPLQLPEEMYNQIGYQFDQPFNQVDEIVKEAARILSDLTDYTAFAEGPEDKNVSITGFRIVPLAPRQVMAILVISDGSVKNQLYTLPRHISGDEVEQAARLINDQLVGKNLSEINKQTFEQLYSSQIVGKNAPEF----LELLESVIKDAASEQMYVDGQLNLLNNIENSDLKAIKSLYELINSSSLAGELIDLSDSPSHYPVHVRLGAELENDLLKDFSLVMAEYSVGRYGRGTIALLGPRHMPYSEMIGLMEYFRQELAR 337
>gi|58337528|ref|YP_194113.1| heat-inducible transcription repressor [Lactobacillus acidophilus NCFM] >gi|38257943|sp|Q84BU6|HRCA_LACAC Heat-inducible transcription repressor hrcA >gi|29466784|dbj|BAC66858.1| HrcA protein [Lactobacillus acidophilus] >gi|58254845|gb|AAV43082.1| inducible transcription repressor HrcA [Lactobacillus acidophilus NCFM] (349 aa)
Score = 321, Expect = 6.9e-28, Identities = 84/332 (25%), Positives = 176/332 (53%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKL-PMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKV-KEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTL---ITFGDEVSHE---DIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEK 335
           +T+RQ+ +LK I+ D+  T  PVGSK V+ +    +S+AT+RN+MA LE  GL+EK H+SSGR+PS+ GY++Y  N  +P    E++   + +        ++ +++E+ +I+S+ T      +     +V +    +V ++ +  M I++TSDGN+   +     +   ++I   + + ND+L+   + EI   +  +  + K ++  E+   L  L+E + +  +     V GQ +LL      + + ++ + ++++  +++  +   +  +        +  G E+ ++   +      + N+    K  + ++ PT + YS++ GLLE+ +NE  K
  S:     2 LTERQELILKTIIMDFTQTHEPVGSKTVMNQLPIKVSSATIRNEMAVLEDQGLIEKTHSSSGRIPSSEGYRYYLDNLVEPLKLPESVYNTIGSQLDRPFHQVNEIVQEAARILSDLTNYTAFAEGPEKRDVKVTGFRIVPLSSRQVMAILVTSDGNVQNQVYALPHNIYGEEIEKAVHMINDQLVGKSLNEINVSL--LSELAKSELGGEHVTELLSLVEDVLKDAASEQMYVDGQINLLNNTSEHNVKDIRSLYELIDHDNLFSNLMDSKADSKDKNYPIKVKLGSELPNDLLKNYSLLTAEYNVGSHGKGTIALLGPTNMPYSQMIGLLEYFRNELAK 339
>gi|104774200|ref|YP_619180.1| heat-inducible transcription repressor [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|103423281|emb|CAI98116.1| Heat-inducible transcription repressor HrcA [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] (360 aa)
Score = 320, Expect = 8.6e-28, Identities = 89/332 (26%), Positives = 174/332 (52%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMI-KIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSM---KSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSN--TLITFGDEVSHE---DIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEK 335
           +T+RQ+ +LK I++D+  T  PVGSK V+ +    +S+AT+RN+MA LE+ GL+EK H+SSGRVPST GY++Y  N  +P    E +  ++   F      +D +++E+ KI+S+ T    I +      V +    +V +  +  M I++ SDG++   +          ++    R+ ND+L+   + EI  +         I+ +   E+     EL+E + +  +     V GQ +LL   E  D + +K + +++ S+S+  ++    + + S+    +  G E+ ++   D      + ++    +  + ++ P  + YS++ GL+E+ + E  +
  S:    14 LTKRQELILKTIIQDFTKTHEPVGSKTVMNQLSIKVSSATIRNEMAVLEEHGLIEKTHSSSGRVPSTEGYRYYLDNLVQPLQLPEEVYNQIGYQFDQPFNQVDEIVKEAAKILSDLTDYTAIAEGPEAKNVSITGFRIVPLAPRQVMAILVISDGSVKNQLYTLPRHISGDEVEQVARLINDQLVGKNLSEINKQTFEQLYRSQIVGKNAPEF----LELLEAVIKDAASEQMYVDGQLNLLNNIENSDLKAIKSLYELINSSSLAGELISSYSDSPSHYPVHVRLGAELENDLLKDFSLVMAEYSVGRYGRGMIALLGPRHMPYSEMIGLMEYFRQELAR 350
>gi|147677210|ref|YP_001211425.1| transcriptional regulator of heat shock gene [Pelotomaculum thermopropionicum SI] >gi|189028267|sp|A5D3X8|HRCA_PELTS Heat-inducible transcription repressor hrcA >gi|146273307|dbj|BAF59056.1| transcriptional regulator of heat shock gene [Pelotomaculum thermopropionicum SI] (348 aa)
Score = 320, Expect = 9.5e-28, Identities = 92/333 (27%), Positives = 170/333 (51%)
  Q:     3 EITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTE-VLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEF--VLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDI---VFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEK 335
           ++  R++++L  IV DY+ATA PVGS+ + +KY   +S AT+RN+MA LE++G +E+ HTS+GR+PS  GY++Y     K        +  +R  +  +   +  VI+++ +++S+ T    + +    E    K I +V ++   AMVIV+  +G +   +I   +     D+    R+ N +L    ++ I  ++  MK I  E  +      +  ELI+     K +    + G  ++L  PEF D EK+K +L ILE   +   +      +     +  G E+ HEDI          ++  +    L ++ PTR++Y+K+  +++F+     +
  S:     2 KLDDRKQKVLLAIVHDYIATAEPVGSRTIAKKYKLGVSPATIRNEMADLEEMGYIEQPHTSAGRIPSERGYRYYVDYLMKRQELSREEEELIRREYEAKVRDVGQVIQKTGQLLSQLTNYTAVVLSPQIESSRFKYIQLVSMHPSQAMVIVVMDNGIVHNRMIEVPESITCADMETISRVLNAKLRGLTMESI--RLTLMKEIYFELARHKHILDLAMELIQDSLLHKVEDKIYLGGVFNMLNQPEFHDVEKVKTLLGILEQEKLLRDL-ITSGGSEEGVTVRIGGEIMHEDIRECSMVTAPYSVCGRKIGSLGVLGPTRMEYAKVVSVVDFMTKNLSQ 337
>gi|78043787|ref|YP_359273.1| heat-inducible transcription repressor HrcA [Carboxydothermus hydrogenoformans Z-2901] >gi|123576951|sp|Q3AF11|HRCA_CARHZ Heat-inducible transcription repressor hrcA >gi|77995902|gb|ABB14801.1| heat-inducible transcription repressor HrcA [Carboxydothermus hydrogenoformans Z-2901] (341 aa)
Score = 320, Expect = 1.1e-27, Identities = 99/326 (30%), Positives = 173/326 (53%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFY-EKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNT-EVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEF--VLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSH---EDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFI 329
           I +R++++L  IV+DY++TA PVGS+ + +KY   IS AT+RN+MA LE++G LE+ HTS+GR+PS  GY++Y +    KP ++ E  +  +R V+ D+  SI  ++E++ K++S  T+   + +     +V LK + +V +     ++I++  DG L         D   +D+     I N +L     ++I   +  +K I  E  +      +  ELI  + Q   +    + G  +L   PEF++ EK+K +L ILE      +I F Q   G N  +  G E++    ED             +   + ++ PTR++Y+K    +EF+
  S:     2 IDERKRKILMAIVQDYISTAEPVGSRTIAKKYDLGISPATIRNEMADLEEMGYLEQPHTSAGRIPSVLGYRYYVDYLMEKPSLSREEEEF-IRKVYEDKINSIGDLLEKTGKVLSSLTRYTAVVLSPEAGKVPLKHLQLVLLQPGKVLLIIVLEDGTLHHRAFEVPGDITAQDLEKVSAILNAKLYGVNPEKIRYSL--IKEIYYELAQHQNLINITLELISNLNQDNQEHKIILGGLINLFNQPEFKNVEKVKTLLSILEQEEKIREI-FSQLNVGVN--VKIGSELNLKEIEDCSMIAAGYFSYGNSVGFIGVLGPTRMEYAKTVATVEFL 328
>gi|162447410|ref|YP_001620542.1| transcription repressor of heat shock proteins [Acholeplasma laidlawii PG-8A] >gi|189028255|sp|A9NFN6|HRCA_ACHLI Heat-inducible transcription repressor hrcA >gi|32129639|sp|Q8L3A0|HRCA_ACHLA Heat-inducible transcription repressor hrcA >gi|21205839|gb|AAM43820.1|AF281816_1 HrcA [Acholeplasma laidlawii] >gi|161985517|gb|ABX81166.1| transcription repressor of heat shock proteins [Acholeplasma laidlawii PG-8A] (342 aa)
Score = 317, Expect = 1.9e-27, Identities = 94/335 (28%), Positives = 173/335 (51%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNT-EVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKT---VHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHE---DIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEKGWK 338
           I+ RQK +LK I++ Y     PVGSK ++     N S+AT+R DMA LE+LG LEK HTSSGRVPS  GY++Y ++      +   +   +  VF+ + +  +  I+E+ K++++ T    + +  +  +  +KRI+MV +  + A+++++T  G++    IH  DD  + DI   I   +D L +  +++ A K+   +  I E + ++     ++I+   +  SK       + G ++    PEF D   +K  + +++   I + I      T     + FG ++  +    +        I+ + K  + +V P+R+ Y K+  LLE+I     K +K
  S:     2 ISSRQKLILKAIIDMYSEKGEPVGSKALMALPYLNYSSATLRYDMAVLEELGFLEKMHTSSGRVPSERGYRYYIEHLVTRDNDVTEVFPLIDEVFSKKALGREHTIKEALKLLTDLTSYTAVAVGPDILQSHIKRIEMVPLGLKDAVMLIVTDTGHVQHQQIHISDDMRMDDIKEVIHTLDDLLKNRTLED-ALKVLKEEYAISE-LNQFMSYQSQIIDSFIEAFSKFASDSFYLSGMTNAFEQPEFNDVSHMKRFIDMMDRREIVKLIG-----TAEGISVRFGSDMEIKPLNQMTIISIPYQIDSKQKGTIALVGPSRMSYQKVIPLLEYIAANLAKLYK 336
>gi|148543936|ref|YP_001271306.1| heat-inducible transcription repressor [Lactobacillus reuteri F275] >gi|184153332|ref|YP_001841673.1| heat-inducible transcription repressor [Lactobacillus reuteri F275] >gi|167017210|sp|A5VJE5|HRCA_LACRF Heat-inducible transcription repressor hrcA >gi|148530970|gb|ABQ82969.1| heat-inducible transcription repressor HrcA [Lactobacillus reuteri F275] >gi|183224676|dbj|BAG25193.1| heat-inducible transcription repressor [Lactobacillus reuteri F275] (350 aa)
Score = 316, Expect = 3.0e-27, Identities = 90/332 (27%), Positives = 156/332 (46%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTE-VLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKT---VHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSH----EDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEK 335
           +TQRQK++L+ IV  Y +T  PVGSK + EK    +S+ATVRN+MA LE   L+ K H+SSGR+PS  GY++Y  N   P    +N  + ++N   +    ID +I  S  I+S  T      ++   E V L    +V +     + I++T  G +         D     +   IR+ ND+L+  P+ E+  +   +K  I  +V  Y       ++    + S+  +    V G+ +LL      D   ++ +  +L+       I      + +   +  G E+S     +D        N+ +  +  + ++ PTR+ YS+  G++   + E  K
  S:     2 LTQRQKKILQAIVRQYTSTGQPVGSKHLAEKLPFKVSSATVRNEMAVLEDNDLILKEHSSSGRIPSKRGYRYYVDNLLDPQAVTDNDLVVIQNSLGNGFQKIDEIISHSADILSNLTSYTAFTLKPEQESVRLSGFRVVPLGNHKVIAILVTDSGEVENQSFTLPPDIDTDAMQAVIRMINDQLVGLPLSEVVKR---LKDDIPLQVLHYMHSPDGFLDIFDNVLSQAARERFFVGGRLNLLDFASTHDPHAIQSLYGLLDKNDNLSNILDSTLTSDNGVNVKIGQEISKNKLLDDYSLITASYNVEQYGRGIIAVLGPTRMPYSRTIGIVNAFRQELAK 338
>gi|167630496|ref|YP_001680995.1| heat-inducible transcription repressor hrca [Heliobacterium modesticaldum Ice1] >gi|167593236|gb|ABZ84984.1| heat-inducible transcription repressor hrca [Heliobacterium modesticaldum Ice1] (347 aa)
Score = 314, Expect = 4.6e-27, Identities = 87/325 (26%), Positives = 175/325 (53%)
  Q:     3 EITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFY-EKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNT-EVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQ---ELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDI---VFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLE 327
           ++  R++++L  I++DYV+TA PVGS+ +  KY   +S AT+RN+M+ LE+LGL+E+ +TSSGR+PS  GY+++ +    +  +N E L+ K++   ++R   ++ +++++  +++E T    + +     +   ++I    +    A+ +V+TS G +   I+   +    +D+     + N+RL    + ++     S+   + E +K+ + VL    ELI+      S     + G  ++   PEF+D EKL+ +L ILE      ++     + G +  I  G E  HE +          +++ +    + ++ PTR++YSK   ++E
  S:     2 QMNDRKQKVLWAIIQDYVSTAEPVGSRTIARKYDLGVSPATIRNEMSDLEELGLIEQPYTSSGRIPSDYGYRYFVDCLMERETLNPEELR-KVKRAMSERLQEVNSIMQQTTNLLAELTNYTAVALGPQVGKTTFQQIHFFPVMPTKAVAVVVTSAGVMENKILDIPESMTPEDLQKVSVMINERLQGLTMAQVRA---SLCMELNEALKKQKQVLSRSLELIDEALHGDSGERFFLAGMMNIFKQPEFKDVEKLQNLLGILEQHQTMRELMHDHPEPGIH--IKIGAENRHEGVRNCSMVTASYHLDGEVLGVIGLIGPTRMEYSKAVAVVE 328
>gi|194467753|ref|ZP_03073739.1| heat-inducible transcription repressor HrcA [Lactobacillus reuteri 100-23] >gi|194452606|gb|EDX41504.1| heat-inducible transcription repressor HrcA [Lactobacillus reuteri 100-23] (350 aa)
Score = 314, Expect = 4.8e-27, Identities = 90/332 (27%), Positives = 155/332 (46%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTE-VLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKT---VHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSH----EDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEK 335
           +TQRQK++L+ IV  Y +T  PVGSK + EK    +S+ATVRN+MA LE   L+ K H+SSGR+PS  GY++Y  N   P    +N  + ++N        ID +I  S  I+S  T      ++   E V L    +V +     + I++T  G +         D     +   IR+ ND+L+  P+ E+  +   +K  I  +V  Y       ++    + S+  +    V G+ +LL      D   ++ +  +L+       I      + +   +  G E+S     +D        N+ +  +  + ++ PTR+ YS+  G++   + E  K
  S:     2 LTQRQKKILQAIVRQYTSTGQPVGSKHLAEKLPFKVSSATVRNEMAVLEDNDLILKEHSSSGRIPSKQGYRYYVDNLLDPQAVTDNDLVVIQNSLGTGFQKIDEIISHSADILSNLTSYTAFTLKPEQESVRLSGFRVVPLGNHKVIAILVTDSGEVENQSFTLPPDIDTDAMQAVIRMINDQLVGLPLSEVVKR---LKDDIPLQVLHYMHSPDGFLDIFDNVLSQAARERFFVGGRLNLLDFASTHDPHAIQSLYGLLDKNDNLSNILDSTLTSDNGVNVKIGQEISKNKLLDDYSLITASYNVEQYGRGIIAVLGPTRMPYSRTIGIVNAFRQELAK 338
>gi|133930485|gb|ABO43814.1| HrcA [Lactobacillus reuteri] (350 aa)
Score = 313, Expect = 5.5e-27, Identities = 90/332 (27%), Positives = 155/332 (46%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTE-VLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKT---VHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSH----EDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEK 335
           +TQRQK++L+ IV  Y +T  PVGSK + EK    +S+ATVRN+MA LE   L+ K H+SSGR+PS  GY++Y  N   P    +N  + ++N        ID +I  S  I+S  T      ++   E V L    +V +     + I++T  G +         D     +   IR+ ND+L+  P+ E+  +   +K  I  +V  Y       ++    + S+  +    V G+ +LL      D   ++ +  +L+       I      + +   +  G E+S     +D        N+ +  +  + ++ PTR+ YS+  G++   + E  K
  S:     2 LTQRQKKILQAIVRQYTSTGQPVGSKHLAEKLPFKVSSATVRNEMAVLEDNDLILKEHSSSGRIPSKRGYRYYVDNLLDPQAVTDNDLVVIQNSLGTGFQKIDEIISHSADILSNLTSYTAFTLKPEQESVRLSGFRVVPLGNHKVIAILVTDSGEVENQSFTLPADIDTDALQAVIRMINDQLVGLPLSEVVKR---LKDDIPLQVLHYMHSPDGFLDIFDNVLSQAARERFFVGGRLNLLDFASTHDPHAIQSLYGLLDKNDNLSNILDSTLTSDNGVNVKIGQEISKNKLLDDYSLITASYNVEQYGRGIIAVLGPTRMPYSRTIGIVNAFRQELAK 338
>gi|163791140|ref|ZP_02185559.1| heat-inducible transcription repressor [Carnobacterium sp. AT7] >gi|159873612|gb|EDP67697.1| heat-inducible transcription repressor [Carnobacterium sp. AT7] (345 aa)
Score = 313, Expect = 6.1e-27, Identities = 87/332 (26%), Positives = 166/332 (50%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPY-INDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENN-TEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHE---DIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEK 335
           +T+RQ  +LK I+  Y +   P+GSK ++ +   N S+AT+RN+M  LE+LG +EK H+SSGRVPS  GY+FY      P  I  ++L + +++   ++   +D ++ +S +++S+ T    I +     E +L    +V +N    M I++T  G++   ++       + ++   +RIFN++L+  P+ E+  ++ +   ++  K       L    E IF    +    V G+ ++L      + EK K I  +++ T     +        +   +  G E+++E   +         I   N   + ++ PT + YSK+ GL++  +NE  K
  S:     2 LTERQILILKSIIRLYTSYETPIGSKTLMNEADINFSSATIRNEMGRLEELGFIEKTHSSSGRVPSLKGYRFYVDYLVHPAKIQKKDLAV-IKDALGNQFRQLDEIVFQSAELLSQLTSYTAITLGPEIKESILTGFRLVPLNDYQVMAILVTDKGHVENQVVAIPKSMDVNELEKIVRIFNEQLVGLPLMEVFKRLKTEIPLLLNKYVRTNDGLINTFEDIFLKAGQDRMHVGGRMNILDFSNELNVEKFKSIYSLMDGTHDLSSLVIPST---TGITVKIGTELNNELFNEFSLITASYEIEGYNSGVIALLGPTNMPYSKMIGLVDVFRNELSK 334
>gi|69249347|ref|ZP_00604943.1| Negative regulator of class I heat shock protein [Enterococcus faecium DO] >gi|68194197|gb|EAN08725.1| Negative regulator of class I heat shock protein [Enterococcus faecium DO] (347 aa)
Score = 313, Expect = 6.4e-27, Identities = 88/330 (26%), Positives = 170/330 (51%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRID---MVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSH---EDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEF 333
           +T+RQ ++L+ I++ Y ++  PVGSK ++ + +   S+AT+RNDM  LE  GLL K H+SSGR+PS  GY++Y  +  KP    E+  L +R         I+ +I++S +I+SE T      +    E+  +R+    +V +N +  + IV+T  GN+   +    +    +++   ++I NDRL+  P+  +  K+ +   +I  K  +    + +L + +     +    V GQ +LL     QD ++ K +   ++ +    Q+    +   SN  I  G E+ +   +++   Q    I+   +  + ++ PT + YS++ GL++  + E 
  S:     2 LTKRQNDILRLIIQHYTSSGVPVGSKTLMSEGV-KASSATIRNDMKALEDEGLLLKTHSSSGRIPSALGYRYYVDHLLKPARVAEDDLLLIRQSLGREFHEINEIIKQSAEILSELTSYTTFSL--GPEIKDRRLTGFRIVPLNNRQIIAIVVTDMGNVESQVFTLPEYMGSQELEKMVQIVNDRLVGDPLMTVYHKLRTEIPMILHKYFQTTEGMSQLFDTVLGHVFEDKVYVSGQMNLLDYEPRQDLDQFKSMFSFMKDSDGLTQMITPMD---SNIHIKIGAELGNDLLQNMSMIQASYEIDGHGRGTIALLGPTSMPYSRMFGLVDVYRREL 331
>gi|51891640|ref|YP_074331.1| heat-inducible transcriptional repressor [Symbiobacterium thermophilum IAM 14863] >gi|61213388|sp|Q67S56|HRCA_SYMTH Heat-inducible transcription repressor hrcA >gi|51855329|dbj|BAD39487.1| heat-inducible transcriptional repressor [Symbiobacterium thermophilum IAM 14863] (341 aa)
Score = 311, Expect = 1.2e-26, Identities = 89/332 (26%), Positives = 174/332 (52%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNF--SKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKL-PMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQE---LIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHE---DIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEK 335
           I  R+ ++L+ I+EDYVATA PVGS+ +  KY   +S AT+RN+M+ LE+LG LE+ HTS+GR+PS  GY++Y       +P IN    +L +R+ F  +   +D ++ E+ +++SE+T L  +I      + + K I +V +    A++I IT  G +   ++       + ++     + ++ L    ++ ++    +++S+ +E +  Y  +L++    +E+  +   +      G S +L  PEF+D +KL+ +L  LE       +    ++      I  G+E+      D         + ++   K+ ++ P R++Y K+  +L  I +   +
  S:     2 IDDRKNKVLQAIIEDYVATAEPVGSRTIARKYNLGVSPATIRNEMSDLEELGYLEQPHTSAGRIPSNLGYRYYVDCLMPERP-INPAEQEL-IRSTFQRKIRELDTLVRETARLLSETTHLTAVISGPQFEKAVFKEIRIVPLGNDRALLIYITDSGLVENQVVEVPLQVTMLELQQVAELLSEHLRGRRVETLSRT--ALQSLHRE-LSRYGTLLEQALHFLEQKLEPGDRHRLYFGGTSHMLDQPEFRDVQKLRGVLSFLEQEEAVAAV-LGLDRLTEGVEIQIGEEIRLRELADCSVVTATYRVGDRIIGKMGVIGPRRMEYPKVVSILNAIASHLSE 336
>gi|109646200|ref|ZP_01370120.1| heat-inducible transcription repressor HrcA [Desulfitobacterium hafniense DCB-2] >gi|109644149|gb|EAT53702.1| heat-inducible transcription repressor HrcA [Desulfitobacterium hafniense DCB-2] (347 aa)
Score = 310, Expect = 1.3e-26, Identities = 85/327 (25%), Positives = 172/327 (52%)
  Q:     3 EITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKI-ENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKT-----VHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFI 329
           ++ +R+K++L+ IV+DY++TA PVGS+ +  K+   IS AT+RN+M+ +E+LGL+E+ HTS+GR+PS AGY++Y     +     +++K  +      R   I  VI  S K++SE T L  I I  +  +    ++  +      A+++V+  +G +   I+   ++   +++     +FN ++    ++E+  K D +  I  E  ++  F++   +E +  + S   +      + G  ++L  PEF+D EK++ + QI E  +   ++   Q +  + T+          D         I+ +    + ++ PTR+DY K   +++++
  S:     4 QMDERKKKILRAIVQDYISTAEPVGSRTIARKFDLGISPATIRNEMSDMEELGLIEQPHTSAGRIPSDAGYRYYVDCLLEKSSIADDVKDVIEKETTKRIAEIQTVIAHSSKLLSELTHLTSIVIGPDKGKSAFNQMHFLPYEPGKAIMVVVKENGVVENQIVEIGENVTAEELQRIANVFNHKMRGHSMEEV--KRDMLHEIYSELTRQ-RFLIDNALELLSAVLSNSPEESSKVYLGGTLNMLNQPEFRDVEKIRNLFQIFEEGAQIIKVLHPQKEGLAVTIGGENKLKELRDCSIITGTYWIDGEPLGTIGLIGPTRMDYGKAMAMVDYM 333
>gi|110801931|ref|YP_699316.1| heat-inducible transcription repressor [Clostridium perfringens SM101] >gi|123341621|sp|Q0SRE1|HRCA_CLOPS Heat-inducible transcription repressor hrcA >gi|110682432|gb|ABG85802.1| heat-inducible transcription repressor HrcA [Clostridium perfringens SM101] (339 aa)
Score = 308, Expect = 2.2e-26, Identities = 91/335 (27%), Positives = 189/335 (56%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEK---NFSKPYINDENLKLKLRNVFADRTM-SIDVVIEESCKIISESTKLP-MIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQ-IKSKMIKTV--HGQSSLLAVPEFQDTEKLKEILQIL-ESTSIWEQIAFKQNQTGSNTLITFGDEV---SHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEKGWK 338
           I  R+ ++L+ I++DY++T  PVGS+ + +KY   +S+AT+RN+MA LE +G LE+ HTS+GR+PS+ GY+ Y      F +    +E L   +RN   D T+  +D +I+++  ++SE TK+  ++K  +  +  +K I +++++  S + +++T +G +   +I  K   I +++    +I  +RL +  I++I  ++ S    +   +  YE ++  ++  +++ +K      V   G  ++   PE+ +  K KEIL++L +  SI E I+   + T     +  GDE+     ++        ++ +++   + ++ P R++YSK+  ++  +  E  +  K
  S:     2 IDDRKLQILRAIIQDYISTGEPVGSRTIAKKYNLGVSSATIRNEMADLEDMGFLEQPHTSAGRIPSSRGYRLYVDRMIEFERLSSEEEGL---IRNSIIDGTLYEVDKIIKQTSALLSELTKMTCIVKAPSVHKSFVKSIQLLKVDDVSILCVLVTDNGVIRNTVIKVKSVPISEELIKISKIITERLKNLTIEQINLEVISN---LNRALNGYEDIVNAVLPALYESLKGDETSEVFLEGTINIFNYPEYNNIHKAKEILELLHDKKSISELISDSDDMT-----VKIGDEIFVPEAKECSIISAGYHVGDRSLGTIALIGPRRINYSKVLSIMTEVMKELNETLK 337
>gi|18311017|ref|NP_562951.1| heat-inducible transcription repressor [Clostridium perfringens str. 13] >gi|168208737|ref|ZP_02634362.1| heat-inducible transcription repressor HrcA [Clostridium perfringens B str. ATCC 3626] >gi|168212928|ref|ZP_02638553.1| heat-inducible transcription repressor HrcA [Clostridium perfringens CPE str. F4969] >gi|21263711|sp|Q8XIS9|HRCA_CLOPE Heat-inducible transcription repressor hrcA >gi|18145699|dbj|BAB81741.1| heat-inducible transcriptional repressor [Clostridium perfringens str. 13] >gi|170713047|gb|EDT25229.1| heat-inducible transcription repressor HrcA [Clostridium perfringens B str. ATCC 3626] >gi|170715640|gb|EDT27822.1| heat-inducible transcription repressor HrcA [Clostridium perfringens CPE str. F4969] (339 aa)
Score = 308, Expect = 2.3e-26, Identities = 91/335 (27%), Positives = 189/335 (56%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEK---NFSKPYINDENLKLKLRNVFADRTM-SIDVVIEESCKIISESTKLP-MIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQ-IKSKMIKTV--HGQSSLLAVPEFQDTEKLKEILQIL-ESTSIWEQIAFKQNQTGSNTLITFGDEV---SHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEKGWK 338
           I  R+ ++L+ I++DY++T  PVGS+ + +KY   +S+AT+RN+MA LE +G LE+ HTS+GR+PS+ GY+ Y      F +    +E L   +RN   D T+  +D +I+++  ++SE TK+  ++K  +  +  +K I +++++  S + +++T +G +   +I  K   I +++    +I  +RL +  I++I  ++ S    +   +  YE ++  ++  +++ +K      V   G  ++   PE+ +  K KEIL++L +  SI E I+   + T     +  GDE+     ++        ++ +++   + ++ P R++YSK+  ++  +  E  +  K
  S:     2 IDDRKLQILRAIIQDYISTGEPVGSRTIAKKYNLGVSSATIRNEMADLEDMGFLEQPHTSAGRIPSSRGYRLYVDRMIEFERLSSEEEGL---IRNSIIDGTLYEVDKIIKQTSALLSELTKMTCIVKAPSVHKSFVKSIQLLKVDDVSILCVLVTDNGVIRNTVIKVKSVPISEELIKISKIITERLKNLTIEQINLEVISN---LNRALSGYEDIVNAVLPALYESLKGDETSEVFLEGTINIFNYPEYNNIHKAKEILELLHDKKSISELISDSDDMT-----VKIGDEIFVPEAKECSIISAGYHVGDKSLGTIALIGPRRINYSKVLSIMTEVMKELNETLK 337
>gi|116495049|ref|YP_806783.1| heat-inducible transcription repressor [Lactobacillus casei ATCC 334] >gi|122263534|sp|Q038N1|HRCA_LACC3 Heat-inducible transcription repressor hrcA >gi|116105199|gb|ABJ70341.1| heat-inducible transcription repressor HrcA [Lactobacillus casei ATCC 334] (348 aa)
Score = 307, Expect = 2.8e-26, Identities = 84/332 (25%), Positives = 169/332 (50%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKI-ENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDS-MKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILEST--SIWEQIAFKQNQTGSNTLITFGDEVSHEDIV---FAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEK 335
           +T+RQ  +LK I+  +  +  PVGSK ++++   ++S+AT+RNDMA LE  GL+ K H+SSGRVPST GY++Y  +  +P     +    ++     R   +D ++ +S +I+S  T    I +      + L    +V +     M I++T++GN+   +          ++   IRI ND+L+  P+ ++A ++ + + S++ + +   +  L ++   + +  +     V G+ +L+      D  +LK+I+ ++++    + E +     QT     +  G E+   D+          ++       + ++ PT++ YSK+ GLL+  + E  K
  S:     2 LTKRQLLVLKEIIRLFTESGQPVGSKTLMQELPVHVSSATIRNDMAALEDAGLITKTHSSSGRVPSTQGYRYYLDHLVEPVRVSRHDLATIKQELGQRYSKMDEIVAQSAQILSNLTSYTAISLGPEVNNIKLTGFRLVPLGNHQVMAILVTNNGNVENQVFTVPPSISFDELEKAIRIVNDQLVGLPLVQVAQRLRTDVPSMLMQYLTSPDGFL-DIFGNVLKSAASERFYVGGRLNLMDYLGDSDIHELKKIMSLIDADHGDLTELLGGPIRQTPVQ--VRLGPELKPIDLANLSLITASYDVGGHGTGMIALLGPTQMPYSKMIGLLDVFREELAK 337
>gi|118444757|ref|YP_878568.1| heat-inducible transcription repressor [Clostridium novyi NT] >gi|118135213|gb|ABK62257.1| heat-inducible transcription repressor HrcA [Clostridium novyi NT] (354 aa)
Score = 307, Expect = 3.2e-26, Identities = 89/323 (27%), Positives = 177/323 (54%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSK--PYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLP-MIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKT---VHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQN---QTGSNTLITFGDE---VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLL 326
           I  R+ ++L+ I++DY+ T  PVGS+ + +KY   IS+AT+RN+M+ LE++GL+E+ HTSSGR PS  GY+ Y     K      +E +K+K   +  +    +D ++++S +++SE T L  ++K  +     ++ I ++ I+K + + ++IT +G +  N+I    D     +       N++L +  I++I  ++ +    +K  +  YE +   +I  +++  +K   +     G +++   PE+ D EK ++ L +L++  +  ++  ++    Q G+N  I+ G E      +D      + +   Q    + ++ PTR+ YSK   LL
  S:     5 IDSRKIKILQAIIQDYIITGEPVGSRTIAKKYDLGISSATIRNEMSDLEEMGLIEQLHTSSGRKPSDMGYRLYVDKLIKLPTLTQEEEIKIK-SQLITEALYEVDEIVKKSIELLSELTNLTCIVKTTSPRNSYIRLIQLLNIDKNNILAVIITQNGMINNNVIKVNKDISNNVLQKLSNFLNEKLRNLTIQDINLEVINE---LKHGLTGYEDIFDAIITALYETLNKSDNSEIYCKGATNIFNYPEYNDIEKARQFLALLDNKKVLNELLKQEENLVQDGTNVSISIGRENLIKDAQDCSILSANYSFKNQVLGTIGVIGPTRMQYSKTISLL 335
>gi|150390800|ref|YP_001320849.1| heat-inducible transcription repressor HrcA [Alkaliphilus metalliredigens QYMF] >gi|167017208|sp|A6TSM2|HRCA_ALKMQ Heat-inducible transcription repressor hrcA >gi|149950662|gb|ABR49190.1| heat-inducible transcription repressor HrcA [Alkaliphilus metalliredigens QYMF] (343 aa)
Score = 306, Expect = 4.4e-26, Identities = 90/320 (28%), Positives = 166/320 (51%)
  Q:     3 EITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENN-TEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKT---VHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSH---EDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKI 322
           ++ +R+ ++L+ I++DY+ TA PVGS+ + +KY   +S AT+RN+MA LE +G L + +TS+GR+PS  GY+ Y  +  +   N    + ++R+   +R   I+ +++ S KI+S+ T    I +     EV LK I ++ +++   + I+IT  G + K ++   +    + IS    + N RL    IK I  +          ++++       +I ++FQ   ++ K    +HG +++   PEF D  K K  L +LE   +  Q+    +  G N   T G E  +   ++         I+E     + ++ PTR+DYS +
  S:     2 QLNERKLKILQAIIQDYIYTAEPVGSRSLSKKYDLQVSPATIRNEMADLEDMGYLIQPYTSAGRIPSDKGYRLYVDHLLQLEKNMVIQRDQIRSDLLNRFGEIEQLLQYSSKILSQLTNYTTIALAPQIKEVRLKHIQLIPMDEHHLLGIIITDTGLIKKTVLQVPEGLDAEAISKISEVINGRLQGVAIKGIPGEFTEE---FTHELEQLSHGFDSVIPKMFQTLEELDKIELFLHGTTNIFNFPEFNDIFKAKSFLSMLEEKELISQLILSSSHKGMNA--TIGSENIYKEAKEYSLVTATYKIDEDVIGFVSIIGPTRMDYSNV 323
>gi|126700080|ref|YP_001088977.1| heat-inducible transcription repressor [Clostridium difficile 630] >gi|145952900|ref|ZP_01801908.1| hypothetical protein CdifQ_04002868 [Clostridium difficile QCD-32g58] >gi|168694089|ref|ZP_02726366.1| heat-inducible transcription repressor [Clostridium difficile QCD-37x79] >gi|168713034|ref|ZP_02745311.1| heat-inducible transcription repressor [Clostridium difficile QCD-63q42] >gi|168725178|ref|ZP_02757455.1| heat-inducible transcription repressor [Clostridium difficile QCD-76w55] >gi|168729717|ref|ZP_02761994.1| heat-inducible transcription repressor [Clostridium difficile QCD-97b34] >gi|196126607|ref|ZP_03118356.1| heat-inducible transcription repressor [Clostridium difficile ATCC 43255] >gi|196159107|ref|ZP_03119668.1| heat-inducible transcription repressor [Clostridium difficile CIP 107932] >gi|123363005|sp|Q182F0|HRCA_CLOD6 Heat-inducible transcription repressor hrcA >gi|115251517|emb|CAJ69350.1| heat-inducible transcription repressor [Clostridium difficile 630] (339 aa)
Score = 305, Expect = 5.5e-26, Identities = 99/327 (30%), Positives = 173/327 (52%)
  Q:     3 EITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENN--TEVLLKRIDMVEINKQSAMVIVITSDG-----NLTKNIIHFKDDSILKDISICIRIFNDRLIDCPI-KEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIK-----TVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHE---DIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFI 329
           E+ +R+  +LK IV+DY+ TA  +GS+ + +++   +SAAT+RN+MA LE+LG L + HTS+GRVPS  GYK Y  +       D+N K+ +          I  +I E+ K++S+ T    + +  +   + ++K I +V +N  + ++IV+T  G     NLT N+  + D S L  IS       D L    + K I    D++ + IK ++ EY  ++ EL+     + S M +     +++G +++ + PEF D  K K  L +LE       I   +     N  I  G +   E   D        N++     ++  + PTR+DY++I  ++ ++
  S:     2 ELNERKLNILKAIVKDYIETAEAIGSRTISKRHDLGVSAATIRNEMADLEELGYLIQPHTSAGRVPSEKGYKLYVNSLMSKSELDDNDKILIEQCMNHNINHIKELIHETSKLLSQLTNYTTVAVTKSLINQSVIKHIQLVAMNDNNILLIVVTDKGDLKKANLTTNV--YLDQSKLNLIS-------DNLTRKLLGKSITDLDDNLIAFIKYEISEYSGLIDELLN---ALNSNMKEEDFSLSLNGATNIFSYPEFNDVLKAKSFLNMLEKKETIADIIKSKGIQKDNLNIIIGSDNDCELAQDCSIVTATYNVDRDLVGRISFIGPTRMDYARIYSIINYM 332
>gi|110798985|ref|YP_696715.1| heat-inducible transcription repressor [Clostridium perfringens ATCC 13124] >gi|168215662|ref|ZP_02641287.1| heat-inducible transcription repressor HrcA [Clostridium perfringens NCTC 8239] >gi|123049678|sp|Q0TNS5|HRCA_CLOP1 Heat-inducible transcription repressor hrcA >gi|110673632|gb|ABG82619.1| heat-inducible transcription repressor HrcA [Clostridium perfringens ATCC 13124] >gi|182382300|gb|EDT79779.1| heat-inducible transcription repressor HrcA [Clostridium perfringens NCTC 8239] (339 aa)
Score = 303, Expect = 8.1e-26, Identities = 90/335 (26%), Positives = 189/335 (56%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEK---NFSKPYINDENLKLKLRNVFADRTM-SIDVVIEESCKIISESTKLP-MIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQ-IKSKMIKTV--HGQSSLLAVPEFQDTEKLKEILQIL-ESTSIWEQIAFKQNQTGSNTLITFGDEV---SHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEKGWK 338
           I  R+ ++L+ I++DY++T  PVGS+ + +KY   +S+AT+RN+MA LE +G LE+ HTS+GR+PS+ GY+ Y      F +    +E L   +R+   D T+  +D +I+++  ++SE TK+  ++K  +  +  +K I +++++  S + +++T +G +   +I  K   I +++    +I  +RL +  I++I  ++ S    +   +  YE ++  ++  +++ +K      V   G  ++   PE+ +  K KEIL++L +  SI E I+   + T     +  GDE+     ++        ++ +++   + ++ P R++YSK+  ++  +  E  +  K
  S:     2 IDDRKLQILRAIIQDYISTGEPVGSRTIAKKYNLGVSSATIRNEMADLEDMGFLEQPHTSAGRIPSSRGYRLYVDRMIEFERLSSEEEGL---IRSSIIDGTLYEVDKIIKQTSALLSELTKMTCIVKAPSVHKSFVKSIQLLKVDDVSILCVLVTDNGVIRNTVIKVKSVPISEELIKISKIITERLKNLTIEQINLEVISN---LNRALSGYEDIVNAVLPALYESLKGDETSEVFLEGTINIFNYPEYNNIHKAKEILELLHDKKSISELISDSDDMT-----VKIGDEIFVPEAKECSIISAGYHVGDRSLGTIALIGPRRINYSKVLSIMTEVMKELNETLK 337
>gi|116748476|ref|YP_845163.1| heat-inducible transcription repressor HrcA [Syntrophobacter fumaroxidans MPOB] >gi|166220407|sp|A0LH26|HRCA_SYNFM Heat-inducible transcription repressor hrcA >gi|116697540|gb|ABK16728.1| heat-inducible transcription repressor HrcA [Syntrophobacter fumaroxidans MPOB] (348 aa)
Score = 303, Expect = 8.6e-26, Identities = 83/328 (25%), Positives = 175/328 (53%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKI-ENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKT--------VHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFK--QNQTGSNTLI-TFGDEVSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEF 328
           M ++++R + +L+ +V DY+ T  PVGS+ + ++Y  N+S+AT+RN MA LE++G L + HTS+GR+P+  G +FY  +  +    +E  +  +R  F +    +  ++  + +++S   +   + +    T  L KRI+ + +     MV++++  G +   ++ ++ D   +++    R  ND L D P+ E+       K  + E++++ + +  +L  R  +I  ++ +         + G+++LL  PEF D ++++ IL   E  S   ++  +  +N TG   ++ T  D     +I    +     +     + ++ P R+DYS+I  ++EF
  S:     1 MSDLSKRDQHVLEAVVTDYIHTGEPVGSRTISKRYGVNVSSATIRNVMADLEEMGFLHQPHTSAGRIPTERGLRFYLDSIMQFKALEEREREMIREAFRNELPDVKELLRRTSRVLSRFCRQAGVVLWPKLTLTLFKRIEFIRLRAHQIMVLLVSKTGLVHHTLVEWEQDIGQEELDKYSRYLNDLLEDMPLGEV-------KQRVLEEMRDEKVLFDQLYSRALKITDRVFQQNLESSDVYIEGRTNLLNNPEFADVDRMRRILDAFEDKSRIIRLLDRTLRNSTGVQIILGTENDLQELNEISLISSPYRRGDTLLGVMGVIGPLRMDYSRIIPVVEF 333
>gi|160931243|ref|ZP_02078644.1| hypothetical protein CLOLEP_00080 [Clostridium leptum DSM 753] >gi|156869721|gb|EDO63093.1| hypothetical protein CLOLEP_00080 [Clostridium leptum DSM 753] (344 aa)
Score = 301, Expect = 1.4e-25, Identities = 88/327 (26%), Positives = 184/327 (56%)
  Q:     3 EITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPY-INDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIE-NNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLID--CPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKT---VHGQSSLLAVPEFQDTEKLKEILQILEST-SIWEQIAFKQNQTGSNTLITFGDEVSHEDIV---FAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFI 329
           E+  R+ ++L+ ++E Y+ T  PVGSK + E    ++S+AT+RN+MA L +LGLLE+ HTS+GR+P+  GY+ Y     +P  ++DE ++  +    ++     D+++E++ ++++E TK   I     N +  ++RI +V+    +AM+++ TS G +   +  F+ + +L   S  +R+F++ L +    +  +    D +KS     + E   ++  +   + Q   +++KT   + G+++LL +PE++  + +K +L  LE    + + I  ++ + G    +  G E +  +++         ++  Q +  L ++ PTR+DY KI   L+++
  S:     2 ELGARKLKILQAVIEAYIQTGEPVGSKALCELLDVSVSSATIRNEMASLSELGLLEQPHTSAGRIPTQFGYRLYINELMRPKPLSDEEMRY-IDGYLSEYADDPDLLLEKAAEMLAEMTKYAAISTTPTNRDATIQRIQLVQTGPHTAMLVLTTSTGAVKSKL--FRTNYLLN--SDILRMFSNVLNEKMGSVHLLNVTPDFIKS-TAFSIGELSLMMAPVFVALGQACREVLKTNVLLEGRTNLLYLPEYE-VDSVKRLLHFLEQRGELAKLIGAQKEKLG----VLIGGESNQPEMIDTSVVMVRYSMGRQTRGTLGVIGPTRMDYPKIVSNLQYL 328
>gi|28378662|ref|NP_785554.1| heat-inducible transcription repressor [Lactobacillus plantarum WCFS1] >gi|38258041|sp|Q88VL8|HRCA_LACPL Heat-inducible transcription repressor hrcA >gi|28271498|emb|CAD64403.1| heat-inducible transcription repressor HrcA [Lactobacillus plantarum WCFS1] (347 aa)
Score = 301, Expect = 1.6e-25, Identities = 83/335 (24%), Positives = 172/335 (51%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKP-YINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENN-TEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKT---VHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHE---DIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEK 335
           M  +T+RQ  +LK IV DY    NPVGSK ++++    +S+AT+RN+MA LE LGL+ K H SSGR+PS  GY++Y  +  KP  ++ ++LK+ +++        ID ++ +S  I+S+ T      +     +  L    +V +     M I++T++G++         D    ++   +R  +D+L+  P++++   +  +   I  K+ +Y       ++    + SK       V G+ +L    + Q  ++L+ +  +L+ T   +++A      G    +  G+E++++   +        ++++  +  + ++ PT + YS++ GL+   + E  +
  S:     1 MITLTERQSLILKAIVRDYTEGGNPVGSKSLVQELPIKVSSATIRNEMARLEDLGLIVKTHLSSGRIPSIKGYRYYVDHILKPEKVDGKDLKV-IQHSLGGEFHKIDEIVAQSADILSQLTSYTTFTLRPELKDSRLSGFRLVPLGNHQVMAILVTNNGDVENQTFTIPSDITGDELEPVVRFIDDQLVGLPLQDV---LRQLTHEIPLKLAQYLQDPDGFLDIFGSVLSKAASERFYVGGKLNLFNYTDQQSPKELQSLYSLLDQT---DRLANVIGPPGQRIQVRIGNEITNDLLKNYSLITATYDVDQHGQGVIALLGPTAMPYSRMIGLMGAFQRELAR 336
>gi|116333937|ref|YP_795464.1| heat-inducible transcription repressor [Lactobacillus brevis ATCC 367] >gi|116099284|gb|ABJ64433.1| heat-inducible transcription repressor HrcA [Lactobacillus brevis ATCC 367] (345 aa)
Score = 300, Expect = 2.0e-25, Identities = 82/332 (24%), Positives = 167/332 (50%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENN-TEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKT---VHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHE---DIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEK 335
           ++ RQ  +L+ +V D+  T  PVGSK + ++   ++S+AT+RN+MA LE+ GL++K H+SSGR+PS  GY++Y  +  KP     N    +++        ID +I +S  I+S  T      ++    +  L    +V + K+  M I++T  G++        +      +   +R+ ND+L+   + E+  K   +++ I  K+  Y       ++    + ++  +    V G+ +LL   +  D + LK +  +++ T   + IA    Q   N  +  G+E++++   +        ++++  K  + ++ PTR+ YS++ G++   + E  K
  S:     2 LSDRQMMILRAVVRDFTNTGVPVGSKALAKQLPIHVSSATIRNEMAALEEQGLIKKTHSSSGRIPSVEGYRYYVDHLVKPDPLRPNDIDVIQSSLGGDFHKIDEIISQSATILSNLTSYTAFTLKPELKDSRLSGFRLVPLGKRQVMAILVTDSGDVENQTFDVSEAVSGDQLEAVVRLINDQLVGLTLPEVLQK---LRTDIPMKITNYMQSPAGFLDIFGDVLTRAAQERFYVGGRLNLLNFSQDSDVDSLKSLYSLIDKT---DDIANVLGQPSDNISVQIGNEMTNDALRNFSLITATYDVDQHGKGMIAILGPTRMPYSRMLGIVGAFREELAK 334
>gi|77917727|ref|YP_355542.1| heat-inducible transcription repressor HrcA [Pelobacter carbinolicus DSM 2380] >gi|77543810|gb|ABA87372.1| heat-inducible transcription repressor HrcA [Pelobacter carbinolicus DSM 2380] (357 aa)
Score = 300, Expect = 2.0e-25, Identities = 82/327 (25%), Positives = 166/327 (50%)
  Q:     2 KEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLP-MIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKT-------VHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDI---VFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEF 328
           +E+++R +++L+ I+EDY+ +  PVGS+ +  ++   +S ATVRN MA LE++G LE  HTS+GRVP+  GY+FY  +  +        +  +R+ ++ R + ++ ++ E+ +I+S+++    ++ + + T  + +RID V ++ +  +V+ ++  G +   II         ++       N       I+EI       K  I   + E + +   L+ R  Q+ S  ++        + G S++L  PEF D  ++K +++  +  ++   +  K +Q      I  G    + DI          +        L ++ PTR+ YS +  L++F
  S:    14 EELSERCRQILEAIIEDYILSGEPVGSRALTRRHNIALSPATVRNVMADLEEMGYLESPHTSAGRVPTEKGYRFYLDSLLRIKQLSPRKRQSIRDHYSHRGLRMEELLREAGRILSDTSSYTGVVMVPHLTSTICRRIDFVRLSARRILVVFVSQTGIVEHKIIESDVPLSETELQEATNYLNQNFSGLAIQEI-------KQHIVAHMAEEKAIYDTLLRRTLQLSSLALEDDLGGQIFIEGASNILDQPEFNDLNRMKRLMRTFDQKNLLVDLLHK-SQLTEGVQIYIGSPDHYSDIEGCSLVTASFSSRWGATGTLGIIGPTRMPYSTVIPLVDF 343
>gi|153953534|ref|YP_001394299.1| heat-inducible transcription repressor [Clostridium kluyveri DSM 555] >gi|146346415|gb|EDK32951.1| HrcA [Clostridium kluyveri DSM 555] (346 aa)
Score = 297, Expect = 4.5e-25, Identities = 93/330 (28%), Positives = 183/330 (55%)
  Q:     3 EITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSK-PYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKL-PMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDI-SICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKT---VHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDE---VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNE 332
           EI +R+  +L+ IV DY+ TA PVGS+ + +KY   +S+AT+RN+M+ LE++G LE+ H+SSGR+PS  GY+ Y     + P +  E L +    +       +D +I+++  ++SE TKL  ++K  +  +  +K I ++ I     +++VI  D  + KN +     +I  D+ +    I N RL +   ++I  K+    + ++  +K YE +   +I  +++  + +  +   + G +++   PE++D EK K  L +L++    ++++   N + SN  +  G+E      E+     +  ++N +   ++ ++ PTR+ YSK+  +LE +  E
  S:     2 EIDERKIRILQAIVNDYINTAEPVGSRTIAKKYNLGVSSATIRNEMSDLEEMGYLEQLHSSSGRIPSNKGYRLYVDELMQIPNLTPEELYIIKSQIIDATLFEVDKIIKQAINLLSELTKLTSIVKAPSIKKGYIKHIQLINIESSKNILLVIIVDSGIIKNNLIKVGKAITDDVLAKLSNILNARLKNLTAEQINLKV---INDLRIDLKGYEGIFNNIISALYESLNSVDNSQIYMQGTTNIFNYPEYKDIEKAKGFLSMLDNK---DKVSGLLN-SASNISVKIGEENYIEGAENCSVICSVYSLNGRPIGEIGVIGPTRMPYSKVISILENVVKE 333
>gi|39995142|ref|NP_951093.1| heat-inducible transcription repressor HrcA [Geobacter sulfurreducens PCA] >gi|61213518|sp|Q74H61|HRCA_GEOSL Heat-inducible transcription repressor hrcA >gi|39981904|gb|AAR33366.1| heat-inducible transcription repressor HrcA [Geobacter sulfurreducens PCA] (342 aa)
Score = 296, Expect = 5.4e-25, Identities = 79/328 (24%), Positives = 174/328 (53%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENN-TEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKT------VHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFK-QNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKTKLV-MVAPTRVDYSKIKGLLEF 328
           M +I++R K +L+ I+EDY+ TA PVGS+ V +++   +S ATVRN MA LE++G L   HTS+GRVP+   Y+ Y  +       D+  + ++R  +A+    I  V+ E+ +++S  +    I +    +  + + I+ V++  +  +VI++  +G +   +I   ++   +++       N+ L+  P+ ++ T+       I E+++  + +  +L+ R  Q+  + +        + GQ+++L  PEF D+ +++++ +  E  +    +  +  N  G    I     +S  + +   T   +  +N   ++ ++ PTR+ Y+K+  ++++
  S:     1 MTDISERNKLILEAIIEDYITTAEPVGSRAVTKRHGLTLSPATVRNVMADLEEMGYLVSPHTSAGRVPTDKAYRLYVDSLLAVRRIDKVERERIRKRYAEAGRDIGAVLHETSRLLSSVSHYTGIVLAPRFSATIFRHIEFVKLGGRRILVILVADNGTVQNRLIESDEEFSSEELIRMSNYLNELLVGVPVGQVRTR-------ILEEMRNEKVLYDKLLARALQLSEQSLNDDGAQIFIEGQTNILEQPEFADSRRMRDLFRAFEEKNQLVGLLDRCLNAQGVQIFIGAETHLSQMEGLSIITSTYLTGKNTLGVLGVIGPTRMGYAKVIPIVDY 330
>gi|154498800|ref|ZP_02037178.1| hypothetical protein BACCAP_02791 [Bacteroides capillosus ATCC 29799] >gi|150272190|gb|EDM99394.1| hypothetical protein BACCAP_02791 [Bacteroides capillosus ATCC 29799] (353 aa)
Score = 296, Expect = 6.1e-25, Identities = 92/333 (27%), Positives = 172/333 (51%)
  Q:     3 EITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTE-VLLKRIDMVEINKQSAMVIVITSDGNLTKN-IIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEY---EFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLI---TFGDEVSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEK 335
           ++T R+K +L+ I++ Y+ +A P+GSK + E    +IS+AT+RN+MA LE +G LE+ HTS+GR+PS  GY+ Y       Y        ++      +   +D VI+++ +I+S+ T+ P   + +  E V +KR D++ + + SA +IV+ +D N+ +N ++    D     + +   + N    +  ++EI  ++  M+         Y     V+   IE + +++ + + T  G + LL  PE++  EK + ++  L   +   +    ++   S  LI      D +    +V A  D  I E  +  + +V PTR+DY+KI   L ++     K
  S:     2 DLTDRKKRILRVIIDHYIESAEPIGSKTIAESSGLDISSATIRNEMADLEAMGYLEQPHTSAGRIPSPKGYRLYVNELMDDYRLSLQETQRINQALRMKMQELDRVIDQAGRIVSQLTQYPAFALSSGMERVTIKRFDLLMVER-SAFIIVVMTDTNVIRNRLVRLPTDLSEPQLQLLNTLLNTTFTNLTLEEITPEL--MRVAQHAAGDSYGLISLVVSFAIEVLEELEHRKVHTA-GIAHLLEHPEYRSLEKAQTLMSYLSEDNDPSRFPVPKDNPMS-ILIGPENVADALKDTSVVVASYD--IGEGMRGVIGVVGPTRMDYAKITARLSYLAQGLSK 335
>gi|78224717|ref|YP_386464.1| heat-inducible transcription repressor HrcA [Geobacter metallireducens GS-15] >gi|78195972|gb|ABB33739.1| heat-inducible transcription repressor HrcA [Geobacter metallireducens GS-15] (343 aa)
Score = 294, Expect = 8.9e-25, Identities = 78/325 (24%), Positives = 170/325 (52%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISE-STKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKT------VHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFK-QNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKTKLV-MVAPTRVDYSKIKGLLEF 328
           +++R K++L+ I+EDY+ TA PVGS+ V  ++  N+S ATVRN MA LE++GLL   HTS+GRVP+   Y+FY  +       D+  + ++R  +      +  V+ E+ +++S  S  + ++     +   L+ ++ V++  +  + I++  +G +   +I  +++    D+       N+ L   P+ ++ T+       I E+++  + +   L  R  ++  + I        + GQ+++L  PEF D  ++K++ +  E  +    +  +  +  G    I     ++H + +   T   ++ +N   ++ ++ PTR+ Y K+  ++++
  S:     5 LSERNKKILEAIIEDYIVTAEPVGSRAVTRRHGLNLSPATVRNAMADLEEMGLLTSPHTSAGRVPTDRAYRFYVDSLLAVGRIDKAERERIRKRYTGAGRDMGAVLHETTRLLSSVSHYMGIVLAPRFSSTTLRHMEFVKLGGRRILAILVADNGAVQNRLIESEEEFAEADLVRMSNYLNELLQGLPVAQVRTR-------ILEEMRNEKVLYDTLFSRALKLSEQTIVEGSAQIFMEGQTNILDQPEFADVGRMKDVFRAFEEKNQLVNLLDRCISAQGVQIFIGSETHLNHMEGLSVITSAYVSGKNTLGVLGVIGPTRMGYGKVIPIVDY 331
>gi|167769482|ref|ZP_02441535.1| hypothetical protein ANACOL_00816 [Anaerotruncus colihominis DSM 17241] >gi|167668450|gb|EDS12580.1| hypothetical protein ANACOL_00816 [Anaerotruncus colihominis DSM 17241] (352 aa)
Score = 294, Expect = 1.1e-24, Identities = 97/329 (29%), Positives = 166/329 (50%)
  Q:     7 RQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIE-NNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIF-NDRLIDCPIKEIAT-KIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHE---DIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEK 335
           R+ ++L  IVE Y+ T  PV SK++ EK    +S+AT+RNDMA L ++GLLE+ HTS+GRVPS  GY+ Y     +     +  + ++  +F  R    D ++E++ + +++ T    +        V +KRI++V    ++ +V+VI ++G + KN +   D  +  ++   +  F N RL+  P+ EI+   ++S+   + E    +  VL  + E   +I      T  G ++LL   EF D    +E+L  + S S    +   ++       I+ G E S     D     T   I EQN   + ++ P R+DY+KI   LE+      K
  S:    16 RKLKILTAIVETYIETGEPVSSKMLTEKLGLQVSSATIRNDMAALFEMGLLEQPHTSAGRVPSHLGYRIYVDQLMRCEPLSDEERREIDALFNVRDPDPDKLLEDAAEALADYTNCATVSTTITPRTVQVKRIEIVPAGARTVVVLVIATNG-VIKNKVCRVDFRLTNELVGFLNQFANGRLVGKPVSEISQYYVNSIAVTLGEYSAPFVPVLATIYELCREISEGQFYT-SGGANLLGYKEFGDIA--RELLLTMNSRSDLLGVLASRDDA---VFISIGKENSKSELADTSVVVTHYKIGEQNSGAIGVIGPVRMDYAKIIPHLEYFSQTLGK 343
>gi|125973839|ref|YP_001037749.1| heat-inducible transcription repressor HrcA [Clostridium thermocellum ATCC 27405] >gi|196253036|ref|ZP_03151679.1| heat-inducible transcription repressor HrcA [Clostridium thermocellum DSM 4150] >gi|166220390|sp|A3DF27|HRCA_CLOTH Heat-inducible transcription repressor hrcA >gi|125714064|gb|ABN52556.1| heat-inducible transcription repressor HrcA [Clostridium thermocellum ATCC 27405] >gi|196197532|gb|EDX92386.1| heat-inducible transcription repressor HrcA [Clostridium thermocellum DSM 4150] (351 aa)
Score = 292, Expect = 1.9e-24, Identities = 84/332 (25%), Positives = 172/332 (51%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKL-PMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEF-VLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDI---VFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEK 335
           + +R+K +L+ I++DY++TA PVGS+ V  K+   +S+AT+RN+MA LE++G L + HTS+GR+PS  GY+FY     K           +++    +   +  ++++    +S+ TK   M  +      +LK + +V + K  A+V+VIT+ G +  ++I+  +  + + +     IFN++L    I +I   +     ++    ++    VL  + + I QI    +  + G  ++L  PEF + E+ +E L+++    +  ++    N      +I  G E   E++       T     +     + ++ PTR++YSK+   + ++K++ ++
  S:     3 LDERKKRILQSIIDDYISTAEPVGSRTVARKHELGLSSATIRNEMADLEEMGYLTQPHTSAGRIPSDKGYRFYVDQLMKQSELTMEEIYSIKSAMDTKINELSQLLKQVSVAMSKITKYASMAALPEKKNSVLKAVQVVPVEKGKALVVVITNSGTIKNSLINISETVLPEHLVYVSNIFNEKLSGLTIGQINMPVIREIELLMGPSQDILMPVLNGVTDCIEQIDKSEV-FLEGAINMLNYPEFSNVERAREFLKLMVEKDLISRVLKDANSEKDKIVIKIGHENDIEEMKECSLITTTYTAGDVVIGTIGIIGPTRMEYSKVLAAINYMKSKMKE 338
>gi|172056817|ref|YP_001813277.1| heat-inducible transcription repressor HrcA [Exiguobacterium sibiricum 255-15] >gi|171989338|gb|ACB60260.1| heat-inducible transcription repressor HrcA [Exiguobacterium sibiricum 255-15] (345 aa)
Score = 290, Expect = 2.9e-24, Identities = 85/332 (25%), Positives = 172/332 (51%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTE-VLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIF--QIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEV---SHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSK----IKGLLEFIKNEFEK 335
           +T RQ  +L+ IV+DY+ TA PVGS+ + ++     S+AT+RN+MA LE++GL+EK HTS+GR+PS  GY+FY  +  +P          L+++FA      D +I  +  ++SE T    + +    E   L  ++++ + +   +++++T  G++    +   +    +  S  +   N  L   P++++  ++       + +  E   +L + ++ +   Q + + +  + G++++   PEFQD  KL+ +L+++E         F      +  LIT G E    + +D    +   +++  +   L ++ P R+DY++    I  LL+  + E  K
  S:     2 LTDRQLLILRAIVDDYIKTAQPVGSRTLSKRSDVTFSSATIRNEMADLEEMGLIEKPHTSAGRIPSELGYRFYVDHLIRPESISPQEAKALKSLFAHSVNENDRLIRHTADLLSELTHYTTLVLGPKEEGQRLHHLELIPLAEGRVVIVLVTETGHVEHKTLQLAEALSREAASRLMERLNQTLRGTPLRQLRLRLLEEIRRFRSEHSEQTTLLSKALDIVLTDQHEERPLIYLGGKANMFDQPEFQDVAKLRPVLELIEQQEAL--FDFLSPSLDNQILITIGSENNVDALKDCSVIRAHYSVDGVSLGTLALIGPKRMDYNRGINSIIHLLQAFQTELRK 341
>gi|15894562|ref|NP_347911.1| heat-inducible transcription repressor [Clostridium acetobutylicum ATCC 824] >gi|267490|sp|P30727|HRCA_CLOAB Heat-inducible transcription repressor hrcA >gi|15024208|gb|AAK79251.1|AE007640_6 Transcriptional regulator of heat shock genes, HrcA [Clostridium acetobutylicum ATCC 824] >gi|144829|gb|AAA23244.1| ORF (343 aa)
Score = 290, Expect = 3.1e-24, Identities = 94/327 (28%), Positives = 173/327 (52%)
  Q:     3 EITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFY-EKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLP-MIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKT---VHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVS---HEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSK-IKGLLEFI 329
           E+ +R+ ++L+ I+ DY+    PVGS+ + +KY   IS+AT+RN+MA LE++G +E+ HTSSGR PS  GY+ Y ++    P ++ E   L    +       ID +++++  ++SE TKL  ++K  +  +  +K I ++ I     + + IT  G +  +II  K +     +     I N +L    I++I  ++ +    IK+ ++EY  +   ++  ++ I  +   T     G  ++   PEF+D EK KE L +++   I + +    N +G  T +  G+E S     D     +    N +    + ++ PTR+ YSK IK ++E +
  S:     2 EMEERKLKILQAIINDYINNGEPVGSRTIAKKYNLGISSATIRNEMADLEEMGYIEQLHTSSGRKPSDKGYRLYVDRLMEIPSMSVEEEMLIKAKIIDSALYEIDKLVKQAMSLVSEMTKLTCVVKSLSARKSYIKSISLINIEPNMILCVFITDSGMIKNSIIRVKSNIENSSLERIANILNSKLKGLTIEQINLEVINN---IKKDLREYGHIFDCIMPNLYDILREADSTEVYKEGTMNIFNYPEFKDIEKAKEFLSVIDDRRILDTLF---NASGGVT-VNIGNENSIKEARDFSVVSSVYKYNGRPLGTIGIIGPTRIPYSKVIKVIMEVV 330
>gi|150015714|ref|YP_001307968.1| heat-inducible transcription repressor [Clostridium beijerinckii NCIMB 8052] >gi|189028262|sp|A6LRN2|HRCA_CLOB8 Heat-inducible transcription repressor hrcA >gi|149902179|gb|ABR33012.1| heat-inducible transcription repressor HrcA [Clostridium beijerinckii NCIMB 8052] (342 aa)
Score = 288, Expect = 4.5e-24, Identities = 83/319 (26%), Positives = 173/319 (54%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTM-SIDVVIEESCKIISESTKLP-MIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRI---FNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKT---VHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDE---VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKI 322
           I  R+  +L+ I+ DY+ T +PVGS+ + + Y   I +AT+RN+MA LE +G LE+ H S+GR+PS+ GY+ Y        +      L+++    D  M  +D +++++  ++SE TKL  +I+  +     +K I +++++  + + + +T  G +  +I+  K ++ + ++    RI    N+RL++  I+EI  ++ +    +K+ +  YE +   L+  +++  +    T   + G +++   PE+ D +K KE+L +L       ++   Q+    N  ++ GDE       D      + +  ++   K+ ++ P R++YSK+
  S:     3 IDDRKIRILQAIINDYIRTGDPVGSRTIAKNYNLGIGSATIRNEMADLEDMGYLEQPHASAGRIPSSKGYRLYVDQLMDNQMLTVEEDLRIKQYIIDSAMLEVDKIVKQTSALLSELTKLTCVIETPSVKRSFIKSIQLIKVDDHNLVSVFLTDTGVIKNHIM--KLNNRVPEVETLTRINEVINNRLVNLSIQEINLEVINN---LKKDLGAYEEIFNALLPILYETLNSADSTEVFMEGTTNIFNYPEYNDIDKAKEMLSLLNDKEALMELFNPQD----NITVSIGDENYKPQARDCSIISAEYSFKDRPIGKIGLIGPRRINYSKV 323
>gi|83589447|ref|YP_429456.1| heat-inducible transcription repressor HrcA [Moorella thermoacetica ATCC 39073] >gi|123752970|sp|Q2RKX6|HRCA_MOOTA Heat-inducible transcription repressor hrcA >gi|83572361|gb|ABC18913.1| heat-inducible transcription repressor HrcA [Moorella thermoacetica ATCC 39073] (344 aa)
Score = 287, Expect = 7.0e-24, Identities = 85/332 (25%), Positives = 168/332 (50%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKI-ENNTEVLLKRIDMVEIN-KQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFV-----------LQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDI---VFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEK 335
           + +R++++L  +++DY+ T  PVGS+ +  +Y   +S AT+RN+MA LE++GLLE+ HTS+GR+PS  GY++Y      P       +  +R  +  + + I+ V+ E+ ++ISE T    I +  +     L+ + ++ I     A+++ +TS G +   ++   +    +D++   R+ N RL    ++++   +  +  I +E  +    V             E  ER+++         +G  ++L  PEF+D ++++EIL  L+      +I      TG    I  G E   E I           +  +   K+ ++ PTR+ YS+   +L  + +   +
  S:     3 MDERKQKVLAAVIQDYILTGEPVGSRTIARRYNLGVSPATIRNEMADLEEMGLLEQPHTSAGRIPSDQGYRYYVDCLMPPAHLTPEEEEYVRRRYNQKMLEIEQVLAETTRLISEMTSYAAIALGPDQGRASLEEVQVLPIQVANKALLVAVTSTGVVEHRVLTIPEGVTPEDLNRISRVLNARLQGRALEDLRQMV--LSDIYQELAQHRNLVNLVRDLLQQLLSLESGERVYR---------NGTLNILNQPEFKDLDRVREILSFLDQDEALRRIFMTTPSTG--LTIRIGQENKIEGIDKCSVVTISYAVEGKIMGKVGLLGPTRMQYSRAISVLRCVADALSQ 337
>gi|119513265|ref|ZP_01632307.1| heat-inducible transcription repressor [Nodularia spumigena CCY9414] >gi|61213580|sp|Q84B70|HRCA_NODSP Heat-inducible transcription repressor hrcA >gi|28976132|gb|AAO39777.2| putative heat transcriptional repressor protein [Nodularia spumigena] >gi|119462079|gb|EAW43074.1| heat-inducible transcription repressor [Nodularia spumigena CCY9414] (365 aa)
Score = 284, Expect = 1.3e-23, Identities = 99/317 (31%), Positives = 173/317 (54%)
  Q:     3 EITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYIND--------ENLKLKLRNVFADRTMSIDVVIEESCKIISE-STKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKD---------DSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEY-EFV---LQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILEST--SIWEQIAFKQNQT----GSNTLITFGDEVSHEDIVFAQTDLNINEQNKTKLV------MVAPTRVDY 319
           ++T RQ+ +L   V  Y+ATA PVGSK ++++Y   +S+AT+RN M  LEK GLL + HTS+GR+PS +GY+ Y      P + D        + ++L L+N       S++ V++ + +I++  S  + +I +   T  +L+ + +++I     M+IV+T D      +++            D I  ++ I     N  L    + E+AT +D   S + ++ + Y EF+   + EL  R     +  I  V G + +L  PEF   ++++ I+Q+LE     +W  I F + +T     S   +  G E   E I   +T   I    +  L+      ++ PTR+DY
  S:     4 QLTNRQQHILWATVRHYIATAEPVGSKALVDEYDLGVSSATIRNVMGVLEKSGLLYQPHTSAGRIPSDSGYRIYVDQLITPGLRDAARTDVLAKEVELALQNRLHWEDWSLEAVLQGAAQILATVSGCISLITMPQTTTAILRHLQLMQIEANKIMLIVVTDDYETHSKLMNLSPTEEEAKLDADGIDHELKIVSNFLNTHLRGRSLLELAT-LDW--SDLDQEFQRYGEFLKGSVTELTRRHLTPTTTQI-MVRGVAEVLRQPEFSQLQQVQTIIQLLEEEQDQLWRLI-FAEPETEEAGKSKVTVRIGTENPLEPI---RTCTLITSTYRRGLLPVGSVGVLGPTRLDY 346
>gi|71894368|ref|YP_278476.1| heat-inducible transcription repressor [Mycoplasma synoviae 53] >gi|71851156|gb|AAZ43765.1| heat-inducible transcription repressor [Mycoplasma synoviae 53] (340 aa)
Score = 284, Expect = 1.3e-23, Identities = 95/323 (29%), Positives = 169/323 (52%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILK--DISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNK-TKLVMVAPTRVDYSKIK 323
           MK++ ++ +E+LK +V  Y+   N + S ++++ Y    S A VR  M  LE  GLL K   SSGR P+  G ++Y K  S  +  D  L   L  +F +R  +I   IEE  K ++  T    +    +  ++LK I++ E+++  A +I++ S+G +    I   ++  +K  D+ I + IF D LIDC + ++  +I  +K I+ EK+ +YE V++  ++ I  I  K    ++G+ +++   +    E + EIL ILE  SIW+ +     +  SN        ++ +   F++    I+E N  T++ +VAP   D + IK
  S:     1 MKQLKKQHEEILKAVVGAYLTQKNEISSALLVKNYGIKFSPAKVRYLMTALEDEGLLVKETKSSGRKPTNKGLEYYAKFLSNAF--DLKLINNLEKIFLNRKDNIYNTIEEVTKELASLTGATFVTKFKDPNLILKSINLFEVSESLATIILVVSNGEVLSRKIDIPENKAIKISDLKIAMNIFQDNLIDCKLIDLEKRILLLKDILAEKIIQYEDVIESYVKSILGIGIK--SQIYGRENIILSRKIA-REDVNEILNILEKNSIWDAL-----EKNSNDFEEIRISINSKGAFFSK---RIDENNNLTEISVVAPNESDSNSIK 313
>gi|164686296|ref|ZP_02210326.1| hypothetical protein CLOBAR_02734 [Clostridium bartlettii DSM 16795] >gi|164601898|gb|EDQ95363.1| hypothetical protein CLOBAR_02734 [Clostridium bartlettii DSM 16795] (347 aa)
Score = 283, Expect = 2.0e-23, Identities = 92/327 (28%), Positives = 176/327 (53%)
  Q:     3 EITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFY-EKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTE-VLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKS--KMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFG---DEVSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFI 329
           E+ +R+ ++LK +V+DY+ TA  VGS+ + +K+   +SAAT+RN+MA LE+LG L + HTS+GRVP+  GYK Y +       +ND + ++  + V ++    I  +I E+ K++S+ T    I      +  ++K I +V + + S ++I++T  G++ K+ I  K       ++I       +L    I +I    +++ + IK ++ EY  ++ +L+  +    S   +  T++G +++L  PEF D  K +  L +LE+     +I   +     NT I  G   D    +D         ++ +   ++  + PTR+DYS+I  ++ ++
  S:    11 ELNERKMKILKAVVKDYIETAEAVGSRTISKKHNLGVSAATIRNEMADLEELGYLVQPHTSAGRVPTEKGYKLYVDLLMGTNELNDSDKEIIEKCVESNMN-HIQSLIHETSKMLSQLTNYTTIGTTRLVKPSVIKHIQLVSMGEHSILLIIVTDTGDIKKSDIPTKKYLDQAKLNIISDNLTRKLGGKSITDID---NNLIAFIKYEIGEYSSIVDKLLSVLNSNVSDDDVSITLNGVTNILDYPEFNDVLKARSFLDMLETKETVAKIIQSKGILKDNTNIIIGSDNDCQQAQDCSVVTATYKVDNEQIGRISFIGPTRMDYSRIYSIINYM 340
>gi|189425887|ref|YP_001953064.1| heat-inducible transcription repressor HrcA [Geobacter lovleyi SZ] >gi|189422146|gb|ACD96544.1| heat-inducible transcription repressor HrcA [Geobacter lovleyi SZ] (344 aa)
Score = 283, Expect = 2.0e-23, Identities = 88/325 (27%), Positives = 162/325 (49%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNF----SKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKT------VHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQ--TDLNINEQNKTKLV-MVAPTRVDYSKIKGLLEF 328
           ++QR +++L+ IVEDY+ATA PVGS  V  ++  ++S+ATVRN MA LE+LGLL   HTS+GR+P+  G++FY  +     +  +   + +  + R    + T   D++ E S  + S S    ++     T  + ++I+ V++  +  + I++T  G +   II    D + +D+       N  L    I ++  KI +   + K +         +++ R   +  + +        + GQS +   PEF D  K++EI Q  E      Q+     Q      I  G E   +++      T   + + N   L+ ++ PTR+ YS +  ++++
  S:     6 LSQRSRQILEAIVEDYIATAEPVGSSAVARRHALSLSSATVRNVMASLEELGLLASPHTSAGRIPTDKGFRFYVDSLVGLRTITHTEKKEILKRCRETGGNLT---DLLREASRTLSSLSNYTGIVVAPRFTTGMFRQIEFVKLGARRILAILVTCSGAVQNRIIETDQDFMPEDLVRMSNYLNSTLEGLSISQVREKILAEMELEKNR-------YDQMMTRALSLSRQALPDEQDEVYITGQSRIFEQPEFNDVTKMREIFQAFEEKGRLVQLLGNCMQ-AQGVQIFIGSETPLKEMAGMSLITSTYMTDVNTIGLMGVIGPTRMGYSSVIPIVDY 332
>gi|116492660|ref|YP_804395.1| heat-inducible transcription repressor [Pediococcus pentosaceus ATCC 25745] >gi|122265876|sp|Q03FR9|HRCA_PEDPA Heat-inducible transcription repressor hrcA >gi|116102810|gb|ABJ67953.1| heat-inducible transcription repressor HrcA [Pediococcus pentosaceus ATCC 25745] (346 aa)
Score = 282, Expect = 2.2e-23, Identities = 78/330 (23%), Positives = 162/330 (49%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIE-NNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSH---EDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEF 333
           +T R+  +L+ IV +Y     P+GSK ++      +S+AT+RNDMA LE++GL+EK H+SSGR+PS  GY++Y  +   P   +++   +++         +D ++  S +++S  T    + ++ +  +  L    MV +     M+I+++S+G++T            + +   +RI NDRLI   + ++   + +    I E        + ++ E +    S+    + G+ ++L   +  D   ++ +L +       +Q+        S+  +  GDE+S+   +D        ++  + K  + ++ PT + YSK  GLL+  +++ 
  S:     2 LTDRELLILEEIVREYTENGQPIGSKTLMNNLPVKVSSATIRNDMAKLEEMGLIEKMHSSSGRIPSLMGYRYYVDHLLSPKKLNQSEAQQIQKGLGMHFREVDDIVRTSAEMLSNLTHYTALTLKPDQKDATLDGFRMVPLGGNQVMLILVSSNGDVTSQQFSIPRGMNSETVERVLRIMNDRLIGETLDQVYYHLKTDIPKIVEHYLHSNDGIIDIFENVVAQSSQDRYFIGGKLNILNFSKNVDVSSIRGLLTLFNEN---DQLDGLLGNNQSDLDVKIGDELSNALLKDFSLITATYDVGSRGKGLIAILGPTSMQYSKTLGLLDTFRDQL 332
>gi|158320266|ref|YP_001512773.1| heat-inducible transcription repressor HrcA [Alkaliphilus oremlandii OhILAs] >gi|158140465|gb|ABW18777.1| heat-inducible transcription repressor HrcA [Alkaliphilus oremlandii OhILAs] (343 aa)
Score = 282, Expect = 2.3e-23, Identities = 98/332 (29%), Positives = 177/332 (53%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNF----SKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNT-EVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQI---KSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKTK---LVMVAPTRVDYSKI--------KGLLEFIKNEFEK 335
           + +R+ ++L+ I+EDY+ TA PVGS+ + +KY   +S AT+RN+M+ LE+LGL+ + HTS+GR+PS  GY+ Y   F    +   I +  L+L + N  A+    I+ +++ S K++S+ T    + +  +  E  LK I +V I+  + + I++T  G + K +I   D        +     ND+L    IK I T   S+  I+ E++  +  V+  ++  IF+     S +    +G  ++   PE+ D  K K  L++LE   +   +    +  G    ++ G E  +E+           ++N T    L ++ PTR+DYS +        K + + +KN + K
  S:     2 LNERKLKILQAIIEDYIETAEPVGSRTLSKKYDLGVSPATIRNEMSDLEELGLIIQPHTSAGRIPSDKGYRLYVDQFMSLKNSAKIKNGYLELDILNKVAE----IEQILQYSSKLLSQVTNYTTVAVTPHVKESKLKHIQLVPIDSINMLAIIVTDSGIVKKPVIRMNDSVSESGFQMMSNFLNDKLHGLTIKNIET---SLFHILNEEIIHFSNVMDTIVPEIFKSLEESSDIDMFFNGAMNIFNFPEYNDIFKAKSFLELLEEKELLSSLITSFDSEGLR--VSIGSENIYEEAKDCSLVTATYKENDTILGWLSVIGPTRMDYSGVVSVMAEVSKSINDLLKNRYNK 343
>gi|182418304|ref|ZP_02949599.1| heat-inducible transcription repressor HrcA [Clostridium butyricum 5521] >gi|182377686|gb|EDT75230.1| heat-inducible transcription repressor HrcA [Clostridium butyricum 5521] (343 aa)
Score = 282, Expect = 2.6e-23, Identities = 85/330 (25%), Positives = 179/330 (54%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNF--SKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLP-MIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICI-RIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKT---VHGQSSLLAVPEFQDTEKLKEILQIL-ESTSIWEQIAFKQNQTGSNTLITFGDE---VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEF 333
           I  R+ ++L+ I+ DY+ T +PVGS+ + + Y   I +ATVRN+MA LE LG LE+ H S+GR+PS+ GY+ Y      S+    +ENL++K + +     + +D +++++  ++SE TKL  +I+  +  +  +K I +++++  + + + +T  G +  +I+    +    D+   I  + N RL    I++I  ++ +    +K+ + +YE +   ++  +++  +    +   + G +++   PE+ D  K KE+L +  +  SI E           +  I+ GDE      ++      + ++ ++   K+ ++ P R+DYS++  +L  +  E 
  S:     3 IDDRKIKILQAIINDYIRTGDPVGSRTIAKNYDLGIGSATVRNEMADLEDLGYLEQPHASAGRIPSSKGYRLYVDKLMESQRLTAEENLRIK-QYIVDSAMLEVDKIVKQTSSLLSELTKLTCVIEAPSVKKSFIKSIQLIKVDNHNIVSVFLTDTGLIKNHIMKLNSNVPTIDVLNRINEVVNSRLSGLSIEQINLEVINN---LKKDLGQYEEIFNAILPLLYETLNAADSSEVFMEGTTNIFNYPEYNDINKAKEMLSLFNDKDSIMELF-----NPSDDITISIGDENYKPQAKECSIISAEYSLGDRPVGKIGLIGPRRIDYSRVITILSQVVKEL 334
>gi|118726515|ref|ZP_01575139.1| heat-inducible transcription repressor HrcA [Clostridium cellulolyticum H10] >gi|118664063|gb|EAV70701.1| heat-inducible transcription repressor HrcA [Clostridium cellulolyticum H10] (348 aa)
Score = 281, Expect = 2.8e-23, Identities = 88/332 (26%), Positives = 179/332 (53%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENN-TEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICI-RIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTV-------HGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHE---DIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEK 335
           +  R+ ++L+ I++DY+ +A PVGS+ + +K+   +S+AT+RN+MA LE++GLLE+ +TS+GR+PS  GY+ Y     K    +E    K+R+    R   +  +I  +  ++++ TK   + +  +  + +LK + +V I    A+VI++T D N+ +N +    +S+     I I  + N++L    ++ + +       I+ EK ++   +   LI+ I     ++I T+        G +++L  PEF++ +K KE L IL+   +   +        +  +I  G+E + E   D        ++       + ++ PTR++YS++   + +I+N+  +
  S:     3 LDDRKLKILQAIIDDYIYSAEPVGSRTIAKKHELGLSSATIRNEMADLEEMGLLEQPYTSAGRIPSDRGYRLYVDQLMKIDELNECEIEKIRSDMNIRINELSQLIRSASAVMAKITKYTSMAVSPHMKKSVLKSVQVVPIESGKALVIIVT-DANIVRNNLIRIPESVTPAFLIQISNMLNEQLKGFTLEMLKS------DILNEKFEKLTALPFRLIKPILDGIEELIITIDNPEVYLEGATNILNFPEFKEVDKAKEFLNILDEKKLVSDLLTNSVNDNNEIIIHIGNENAMEGIKDCSLVTASYSVGNHVIGTIGIIGPTRMEYSRVVSSMNYIRNKINQ 339
>gi|148657565|ref|YP_001277770.1| heat-inducible transcription repressor HrcA [Roseiflexus sp. RS-1] >gi|166220402|sp|A5UYW7|HRCA_ROSS1 Heat-inducible transcription repressor hrcA >gi|148569675|gb|ABQ91820.1| heat-inducible transcription repressor HrcA [Roseiflexus sp. RS-1] (359 aa)
Score = 281, Expect = 3.1e-23, Identities = 75/327 (22%), Positives = 172/327 (52%)
  Q:     3 EITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTK-LPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQEL---IERIFQIKSKMIKTVH--GQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKTKLV----MVAPTRVDYSKIKGLLEFI 329
           ++T R++ +LK  +++++ ++ PV S +++ KY  N+S ATVRN++A LE+LG L   HTS+GRVP+ AGY+++ +N           +  +R+ F      +D  I+ +  +++ + +   ++      +  LK ++++ I++ +A+++++  DG + +  +        +++S C    N+R  D P++ I   +   ++  +E       V Q L   ++ + Q    +   +H  G   +L  PEF   E+++ +++IL+S      +   +  + S   +  G E S++++   +  + ++     ++V    ++ PTR+ Y +    + +I
  S:     4 DLTDRRRLILKLAIQEFIESSQPVASDLLVRKYRLNVSPATVRNELAALEELGYLTHLHTSAGRVPTDAGYRYFVENLMDRTPLSATEQRTIRHQFYQVRSELDQWIQLAGAVLARTAQNASVVTPPRAQQARLKHLELIAIHETTALMVLVLHDGTIRQQTLTLDVAMTQEELSRCAAQINERCCDAPVERIEEVLKQERA--QEPPGGNALVCQVLDLVVKAMHQFNEHISSDIHSDGLIEILNQPEFSRVERVRRMVEILQSGRALGTL-IPRALSSSGVQVVIGGEHSYDEM--REYSVVLSRYGGGEIVGVLGVIGPTRMAYPRAISAVRYI 335
>gi|32129642|sp|Q93R29|HRCA_TETHA Heat-inducible transcription repressor hrcA >gi|15277197|dbj|BAB63288.1| HrcA [Tetragenococcus halophilus] (345 aa)
Score = 279, Expect = 6.1e-23, Identities = 86/330 (26%), Positives = 161/330 (48%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKI-ENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHE---DIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEF 333
           +TQRQ  +L  I+ +Y     P+GSK ++E+ +   S+AT+RN+M  LE+ GLL K H+SSGR+PS  GY++Y     +P    ++    ++         I+ +IE+S KI+S+ T    + I  + +   L    MV +N +  + I++T  GN+   +         +D+   +RI ND+LI  P+  +  ++ +   +I  K  +    + +L   +     +    V GQ +LL   + Q+ ++ K +L +  S  + E ++ K         I  G E+ ++   D+   Q +  I +     + ++    + YSK+  LL+  + E 
  S:     2 LTQRQDNILHQIIHNYTNLGKPIGSKTLMEEGIA-ASSATIRNEMKTLEEYGLLVKPHSSSGRIPSLKGYRYYVDYLLEPEKLKKSEVDVMQQSLGKDFHEINDIIEQSAKILSKLTSYTALSIGPDVSNRKLTGFKMVPLNNRQVIAIIVTDKGNVENQVFSIPKSVDSEDLEKMVRIINDKLIGEPLLIVYQRLGTEIPMILHKYFQTTEGILDLFNNMLSEAFEEKIFVGGQMNLLNSDQIQNIDQFKSMLFMENSKQLNELLSTKDQPIQ----IRIGSELGNDLLSDMSLIQANYEIKDHGNGTIALLGSASMPYSKMLSLLDVFRQEL 330
>gi|167465890|ref|ZP_02330979.1| heat-inducible transcription repressor HrcA [Paenibacillus larvae subsp. larvae BRL-230010] (250 aa)
Score = 278, Expect = 6.4e-23, Identities = 75/248 (30%), Positives = 137/248 (55%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKP-YINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVL---LKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEK 251
           +++RQ+ +L  IVEDY+ +A P+GS+ + ++   + S AT+RN+M+ LE++G LE+ HTS+GR+PS  GY++Y  +  +   ++   L + ++  FA +   ++ VI+    ++S  T    I +    EV    LK + ++ IN  +A+ I+IT+ G++    +   +     DI   + + ND+L + P+ E  +K+ S  S    KV         +IE + Q        V G +++L  PEF+D +K
  S:     2 LSERQRMILSAIVEDYIRSAEPIGSRSISKRDDVSYSPATIRNEMSDLEEMGYLEQPHTSAGRIPSHKGYRYYVDHLVREGNLSSHELDV-VKMFFAGKVQEMESVIQHVAGVLSGLTNYTSIVL--GPEVFSSTLKHLQIIPINIHTAVAIMITNTGHVENKTVTIPEGMSFSDIEKVVNVLNDKLKNVPLIEFKSKLYSEVSSELAKVTAGYTEWLSMIEGVLQNDETNRIYVSGATNMLMQPEFKDVDK 250
>gi|39939192|ref|NP_950958.1| heat-inducible transcription repressor [Onion yellows phytoplasma OY-M] >gi|61213478|sp|Q6YPL9|HRCA_ONYPE Heat-inducible transcription repressor hrcA >gi|39722301|dbj|BAD04791.1| heat-inducible transcription repressor [Onion yellows phytoplasma OY-M] (342 aa)
Score = 276, Expect = 1.1e-22, Identities = 94/335 (28%), Positives = 167/335 (49%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIE----NNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHF---KDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKT---VHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSH-EDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEK 335
           M  ++ R+K +LK +VE+Y     PVGSK++        ++AT+R DM  LEK G L+KNHTSSGRVPS  GY +Y  +      +   +   +  V   +      VI+E+  +++  T    + I     NN+++   +ID + +N   A++++IT  GN+    I     K+ SI  D+   +++ ND L D  + E A  I S     K+ + +Y    ++LI    ++ S          G S +L  PE  + E +K+ + +LE     E +    NQ   +   + G +++  +D +      ++N   K ++ +V P+ + Y K+  +LE++     K
  S:     2 MNMLSDRKKLILKAVVENYSQKGQPVGSKLLTHLPYLKFASATIRYDMVQLEKEGFLQKNHTSSGRVPSFKGYTYYLNHLLTRDHDVACMFESIDKVIQKKRFCKGQVIKEALSLLNNLTNYTAMAIGSDIFNNSKI--NKIDFIPLNSTQAVILIITDKGNVQHQNISLDQTKEISIY-DLKDVVQVVNDLLTDKFLSEAANIIQS--DFFKQTIAKYICFQEQLIALFMEVFSSFASENLYFSGVSKMLEKPELSNPEIIKKFMGLLERK---ELLKIMLNQDSLSFKFSDGLQLTPLKDCMILSIPFDVNPNEKGRIAVVGPSWMKYPKVIPILEYLAVHLSK 339
>gi|114567100|ref|YP_754254.1| heat-inducible transcription repressor HrcA [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|122317906|sp|Q0AWM1|HRCA_SYNWW Heat-inducible transcription repressor hrcA >gi|114338035|gb|ABI68883.1| heat-inducible transcription repressor HrcA [Syntrophomonas wolfei subsp. wolfei str. Goettingen] (341 aa)
Score = 276, Expect = 1.1e-22, Identities = 92/331 (27%), Positives = 166/331 (50%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTK------LPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQ---ELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNK----TKLVMVAPTRVDYSKIKGLLEFIKNEFE 334
           + +R++ +L  I+ DYV TA PVGS+ +++K+   ISAATVRN+MA LE +G LE+ HTS+GR+PS  G+++Y     +     E     L+ +F       + VI      +S+ T+      +P +K         + + ++ +++  A+++++   G +   II   +    +D+     +FN   I   ++E+     S   +I+E + +   ++    E I+ + Q        V G  ++L  PEF+D +KLK IL +LE      QI     + G    I  G E   E+I   +  L +          K+ ++ P R++Y K  G +E +++  E
  S:     3 LDERKRNILGSIIRDYVETAEPVGSRAMVKKHDLKISAATVRNEMADLEDMGYLEQPHTSAGRIPSERGFRYYVDCMMEKEPPGEREYALLQQLFEQNIEDWEQVILGIAHFLSQMTRYTSFVIVPAVKFTE-----FRNLQLLPLDQGKALLLLVCDMGVIMHRIISIPEFISSQDLQAITGLFNQAFIGKRLEEVKR---SDLQLIRENLSQRRQIIDNALEAIDNLLQNSRDEKVMVSGALNILNEPEFKDMDKLKRILNVLEEDDSLRQII--PGELGEAVDIKIGRENPLEEI--KEMSLVVAGYKSFGELGKIGVIGPVRMEYWKAVGTVETVRDIIE 334
>gi|163847633|ref|YP_001635677.1| heat-inducible transcription repressor HrcA [Chloroflexus aurantiacus J-10-fl] >gi|189028261|sp|A9WEX3|HRCA_CHLAA Heat-inducible transcription repressor hrcA >gi|163668922|gb|ABY35288.1| heat-inducible transcription repressor HrcA [Chloroflexus aurantiacus J-10-fl] (372 aa)
Score = 276, Expect = 1.2e-22, Identities = 69/258 (26%), Positives = 143/258 (55%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVL-LKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIER---IFQIKSKMIKTVHGQSSLLAVPEF----------QDTEKLKEILQILES 261
           +T+R++ +LK +++++V TA PV S+ ++ KY   +S+ATVRNDMA LE+LG L   HTS GR+P+ AGY+F+ +N  +        +  +R+ F      +D  ++ +C +++ +     +      E L  K ++++ I++  A+ +++   G + +  +  +     +D+     + +D L D  +   A ++ ++ +     + E+E  L +L+ R   +F+ +++      G   +L+ PEF          +  E+L+  L+IL+S
  S:     5 LTERRQMILKLVIQEFVDTATPVASETLVRKYRLPVSSATVRNDMAALEELGFLTHPHTSGGRIPTDAGYRFFVENLMERTTLSPAEQRMIRHQFYQVRGELDQWVQLACAVLARTAHNASVATAPRAEQLRFKSLELIAIHETMALAVIVFHGGIVKQQTLPIEPGRTPEDLRRAAGLVSDLLADATLSR-AEELAAIATFNGVPLSEFERTLVDLVVRAMSVFEEQAQEQIYSDGILEMLSQPEFLPASGRDDAERAIERLRRTLEILKS 275
>gi|32129638|sp|Q8KML8|HRCA_LACSN Heat-inducible transcription repressor hrcA >gi|21912937|emb|CAC86403.1| heat shock protein [Lactobacillus sanfranciscensis] (346 aa)
Score = 276, Expect = 1.3e-22, Identities = 81/331 (24%), Positives = 157/331 (47%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKI--ENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKT---VHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFE 334
           +T+RQ  +LKYI++DY  T  P+GSK + E+   ++S+AT+RN+MA L     +EK HTSSGRVPS  GY++Y  N +KP   D      +  +       ID ++ +S  I+S  T    +    E  TE  +K + +V +     MV+++  +  +        +  I   +S+   + N +L+    +E+       +S I  ++  Y    ++ +  I  I SK+      + GQ ++      QD  K+K +  +  + +  + +  K ++  S  +    D    +D        ++      ++ ++ P R+ Y  + G+++  ++E +
  S:     2 LTERQSMILKYIIDDYSKTGVPIGSKALAEQLPIHVSSATIRNEMAVLSHQNFIEKLHTSSGRVPSNQGYRYYIDNLAKPAKLDTKRLEYISEMLDGSFQQIDEIVRQSADILSHLTDYTALTFSPELTTENTIKHLQLVNLGLNRMMVVIVMGNEQVESQSFLVTNQYIDSQLSLATNLLNQQLVGKTAREVK---QVFQSKILTELHTYLPDTKQFVRAIQAILSKIDDDHYFISGQMNMFEQNGKQDFSKIKSLYSMFNNDNGIDALLEKSSKPISVKIGAEFDNDWLKDYSIITGSYDLGNHGIGRIALIGPMRMSYPNMLGVVDAFRHELK 334
>gi|160947722|ref|ZP_02094889.1| hypothetical protein PEPMIC_01657 [Peptostreptococcus micros ATCC 33270] >gi|158446856|gb|EDP23851.1| hypothetical protein PEPMIC_01657 [Peptostreptococcus micros ATCC 33270] (344 aa)
Score = 275, Expect = 1.5e-22, Identities = 80/321 (24%), Positives = 170/321 (52%)
  Q:     2 KEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTK-LPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVS----HEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKI 322
           K +  R+ ++L  I++ Y++T+ P+GS+ + ++Y   +S+ATVRN+M+ LE+LG L K ++SSGR+PS   Y+ Y       + ++ +  +   ++ +      + + +ES KIIS+ T+ +    I +  +  +K ID++ I+  S +++++   G +   +   K     + +   +      LI+  + ++  +++ +K     K+  +   + +LI +      K    + G S++   PE+QD +K KE++  LE  +  E +    + +G    ++ G E +    +E+ + A T  +  + +K K+ ++ PTR+DY KI
  S:     7 KMLDDRKLKILYAIIDSYISTSEPIGSRTISKQYDMGVSSATVRNEMSDLEELGFLNKAYSSSGRIPSDKAYRHYVNYLLSSHFDEISKNIYGIDILSKHINEKNKIFKESAKIISDVTECITATMITDYMDCSVKSIDVINISGNSYVLVLVFDTGKVINTVFDSKTKFSTEVLQELLFYLKKYLINVKVSDLNERLEYLKLTFVSKIP-FITEISDLIGKEISKTEKSSIELEGISNIFNFPEYQDLKKAKELIHFLEDKNELEDLFL--SYSGDKIYVSIGSENNKDFLNENTIVA-TSYDFGDGSKGKIAVIGPTRMDYEKI 328
>gi|167040704|ref|YP_001663689.1| heat-inducible transcription repressor HrcA [Thermoanaerobacter sp. X514] >gi|166854944|gb|ABY93353.1| heat-inducible transcription repressor HrcA [Thermoanaerobacter sp. X514] (343 aa)
Score = 275, Expect = 1.6e-22, Identities = 86/330 (26%), Positives = 169/330 (51%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMI-KIENNTEVLLKRIDMVEINKQSAMVIVITSDG---NLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKT---VHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEF 333
           +  R+K++L  ++ DY+ TA P+GS+ + +KY   +S+AT+RN+MA LE++G LE+ HTS+GR+PS  GY+FY  +  + YIN+E       N   +     D ++++  KI++  T    + K+       +KRI ++ +     + +V+T  G   N   N+    D +I + ++    + N+++     K++    + ++  ++  + E  F+  ELI  I     ++ +T     G S +L  PE++D  K K    +L++ S+  +I   +       + +       +D+   +T   IN +    + ++ PTR+DY K+   +  +  E 
  S:     3 LDDRKKKILYAVITDYIMTAEPIGSRTIAKKYNIGLSSATIRNEMADLEEMGYLEQPHTSAGRIPSDKGYRFYVDSILRNYINNE--PPISYNTREEIIAEFDEIVKKYAKILANITHHTTVAKMPKLNPDRIKRIQLIPVASNKMIFLVVTDTGIVKNYLLNLCQNVDRTIFEFLN---NLLNEKIAGKNEKDV---FEFLQQDLRHMLGEMVFIADELINTILLSLKQLQETDIYADGTSHILDFPEYKDLSKAKNFFNLLDNKSLLNEILEPEVDFIDVRIGSENKFEEMKDLSVIKTTYKINGRVVGTIGIIGPTRMDYRKLINEINVMTKEL 331
>gi|168187877|ref|ZP_02622512.1| heat-inducible transcription repressor HrcA [Clostridium botulinum C str. Eklund] >gi|169294259|gb|EDS76392.1| heat-inducible transcription repressor HrcA [Clostridium botulinum C str. Eklund] (354 aa)
Score = 274, Expect = 2.0e-22, Identities = 88/328 (26%), Positives = 181/328 (55%)
  Q:     3 EITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSK--PYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLP-MIKIENNTEVLLKRIDMVEINKQSAMVIVITSDG---NLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKT---VHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQN---QTGSNTLITFGDE---VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLL-EFIK 330
           +I  R+ ++L+ I++DY+ T  PVGS+ + +KY   +S+AT+RN+M+ LE++GL+E+ HTSSGR PS  GY+ Y     K      +E +K+K   +       +D ++++S +++SE T L  ++K  +     ++ I ++ I+  + + ++IT +G   N    +     + +L+ +S      N +L +  I++I  ++ +    +K+ +  YE +   +I  +++  +K   +     G +++   PE+ D EK ++ L +L++  I  ++   +    Q G+N  I+ G E      ++      + +   Q    + ++ PTR+ YSK   LL +F++
  S:     4 DIDGRKIKILQAIIQDYIITGEPVGSRTIAKKYDLGVSSATIRNEMSDLEEMGLIEQLHTSSGRKPSDMGYRLYVDKLIKLPTLTQEEEIKIK-SQLITQALYEVDEIVKKSIELLSELTNLTCIVKTTSPRNSYIRLIQLLNIDDNNILAVIITQNGMINNNVIKVNKNISNDVLQKLS---NFLNRKLRNLTIQDINLEVINE---LKQGLTGYEDIFDAIITALYETLNKSDNSDIYCKGATNIFNYPEYNDVEKARQFLALLDNKKILNELLKHEENSMQDGNNISISIGRENLIKDAQNCSVLSANYSFKNQILGTIGVIGPTRMQYSKAISLLTQFVR 340
>gi|72161242|ref|YP_288899.1| heat-inducible transcription repressor [Thermobifida fusca YX] >gi|123747246|sp|Q47RP1|HRCA_THEFY Heat-inducible transcription repressor hrcA >gi|71914974|gb|AAZ54876.1| heat-inducible transcription repressor HrcA [Thermobifida fusca YX] (343 aa)
Score = 273, Expect = 2.4e-22, Identities = 88/321 (27%), Positives = 164/321 (51%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFS--KPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTK-LPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNII----HFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLIT--FGDEVSHEDI---VFAQTDLNINEQNKTKLVMVAPTRVDYSKIKG 324
           +  R+  +L+ IVEDYV+T  PVGSK + E++   +S AT+RNDM  LE+LG + + HTS+GRVP+  GY+ +    S  KP    E   ++    F    + +D ++  + ++++  T+ + +++  + T   ++ +++V +  Q  M+++IT+ G + + +I       DD +        R    + +    KE  T +  +     E+    E V+  L E +  ++    K V G ++ LA   F  +  L+++L+ LE   +  ++     + G  +++T   G E +HE +           I +Q   KL +V PTR+DY    G
  S:     8 LDDRKLAVLRAIVEDYVSTNEPVGSKALAERHKLGVSPATIRNDMVALEELGYIAQPHTSAGRVPTDKGYRLFVDRLSKVKPLSKAERRAIE---TFLSGALDLDEIVSRTVRLLAHLTRQVAIMQYPSLTRSSVQHLELVPLGPQRLMLVLITNTGRVEQRVIDGLAEVSDDVVENLRGALNRALVGKWLTEAPKEFPTVLAQLP---LEERPIAESVMSVLTESL--VEKHEGKVVFGGTANLAAMGF--SAGLRDVLEALEENVVLIRLL---GEMGDASMLTVRIGAENNHEGLQSTSIVAAGYGIGDQTLAKLGVVGPTRMDYPGTMG 327
>gi|167037804|ref|YP_001665382.1| heat-inducible transcription repressor HrcA [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|166856638|gb|ABY95046.1| heat-inducible transcription repressor HrcA [Thermoanaerobacter pseudethanolicus ATCC 33223] (343 aa)
Score = 271, Expect = 5.1e-22, Identities = 83/330 (25%), Positives = 170/330 (51%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMI-KIENNTEVLLKRIDMVEINKQSAMVIVITSDG---NLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKT---VHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEF 333
           +  R+K++L  ++ DY+ TA P+GS+ + +KY   +S+AT+RN+MA LE++G LE+ HTS+GR+PS  GY+FY  +  + YIN++       N   +     D ++++  +I++  T    + K+       +K+I ++ +     + +V+T  G   N   N+    D +I + ++    + N+++     K+I    + ++  +++ + E  F+  ELI  I     ++ +T     G S +L  PE++D  K K    +L++ S+  ++   +       + +       +D+   +T   IN +    + ++ PTR+DY K+   +  +  E 
  S:     3 LDDRKKKILYAVITDYIMTAEPIGSRTIAKKYNIGLSSATIRNEMADLEEMGYLEQPHTSAGRIPSDKGYRFYVDSILRNYINND--PPISYNTREEIIAEFDEIVKKYARILANITHHTTVAKMPKLNPDRIKKIQLIPVASNKMIFLVVTDTGIVKNYLLNLCQNVDRTIFEFLN---NLLNEKIAGKSEKDI---FEFLQQDLRQMLGEMAFIADELINTILLSLKQLQETDIYADGTSHILDFPEYKDLGKAKNFFNLLDNKSLLNEVLEPEVDFIDVRIGSENKFEEMKDLSVIKTTYKINGRVVGTIGIIGPTRMDYRKLISEINVMTKEL 331
>gi|83814235|ref|YP_446453.1| heat-inducible transcription repressor HrcA [Salinibacter ruber DSM 13855] >gi|83755629|gb|ABC43742.1| heat-inducible transcription repressor HrcA [Salinibacter ruber DSM 13855] (400 aa)
Score = 271, Expect = 5.2e-22, Identities = 85/324 (26%), Positives = 171/324 (52%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYK-FYEKNFSKPYIND---ENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENN-TEVLLKRIDMVEINKQSAMVIVITSDGNLTKNII-HFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIA---FKQNQTG-SNTLITFGDEVSHEDIVFAQTDLNINEQNKT--KLVMVAPTRVDYSKIKGLLE 327
           +++R++++L+ ++E +V TA PVGS+ + +    ++S A++RN MA LE +G L+  +TS+GRVP+  GY+ F ++    P +++   E LK+KL  + +D     D ++ ES +++S+ T L  I +    +  +L R+D+V ++  S ++ V++  G L K ++  F+ D     +   +   N+RL    + EI    +     + ++      VL E    +F    +      G  ++L+ PEFQ+ + ++ +++ +E      Q+    F+ N       ++  G E   E++      L+  +   T   L ++ P R+DY +   L+E
  S:    50 LSERERDILRLVIEQFVDTAGPVGSRSLAKDANVDLSPASIRNTMADLEDMGYLDHPYTSAGRVPTRLGYRTFVDELMDTPELSEVEQEVLKVKLARLVSD----TDELLSESTRLLSKLTNLLGIALTPRLSTAMLDRLDIVPLSG-SRLMFVLSVRGGLVKTVVLSFEPDLKRSKMDRIVSTLNERLAGLTLHEIRDTYEERLDDLPDETGLIALVLDE-ASILFSEPDEGRLQFDGTQNILSQPEFQEPDDMRHLIETIEDEDRIVQVIENLFEANPDAVGQAVVRIGSETDQEEMDAYSIVLSPYQLGDTVGSLGVIGPKRMDYGRAVALVE 379
>gi|134300338|ref|YP_001113834.1| heat-inducible transcription repressor HrcA [Desulfotomaculum reducens MI-1] >gi|172044332|sp|A4J7F6|HRCA_DESRM Heat-inducible transcription repressor hrcA >gi|134053038|gb|ABO51009.1| heat-inducible transcription repressor HrcA [Desulfotomaculum reducens MI-1] (347 aa)
Score = 269, Expect = 8.8e-22, Identities = 78/333 (23%), Positives = 175/333 (52%)
  Q:     3 EITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKL-PMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFN--------DRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIA-FKQNQTGSNTLITFGDEVSHEDI---VFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEK 335
           ++ +R++++L  I++DY+ TA PVGS+ +  KY   +S AT+RN+M+ LE++G +E+ HTS+GR+PS  GY++Y     +     E  ++ +R  + ++   +  V+  + +++++ T    ++++ +      K + MV +    A++IV+   G +   ++   +    +D+     + N        D +    IKEI  ++   +SI+       +  L+ + +R+  +    I  + G  ++L  PEF + E++K +L +LE     + I  F +++ G    I  G+E   ++I           + ++    + ++ PTR+DY+++  +++ +     +
  S:     2 KMDERKQQILLAIIKDYINTAEPVGSRTISRKYKLGVSPATIRNEMSDLEEMGYIEQPHTSAGRIPSNLGYRYYVDCLMQREQLSEEEEVTIRRGYENKVREVGEVLNRTGRMMAQLTHYTALVQMPSFRRSAYKHVQMVLMGPSQAILIVVMDTGAVHHQMMTVPESITQQDLDQISSVLNAKLQGRTMDNIRLTLIKEIYFELSKHRSIL-------DLALELMQDRVISVAEDKI-YLEGVFNILNQPEFHNVERVKILLSLLEQEDTLKDILDFTRDRQG--ITIKIGNENLRQEIQDCSMVTATYQVGDKILGTIGVLGPTRMDYARVVTVIDCMSRNLSR 337
>gi|20807434|ref|NP_622605.1| heat shock gene transcriptional regulator [Thermoanaerobacter tengcongensis MB4] >gi|22256770|sp|Q8RB70|HRCA_THETN Heat-inducible transcription repressor hrcA >gi|20515958|gb|AAM24209.1| Transcriptional regulator of heat shock gene [Thermoanaerobacter tengcongensis MB4] (343 aa)
Score = 268, Expect = 9.1e-22, Identities = 89/330 (26%), Positives = 172/330 (52%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMI-KIENNTEVLLKRIDMVEINKQSAMVIVITSDG---NLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKT---VHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHE---DIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEF 333
           +  R+K +L  +V DY+ TA P+GS+ + +KY   IS+AT+RN+MA LE++G LE+ HTS+GR+PS  GY+FY     + ++  E+L    R V  +     D ++++  KI+++ T    + K+       +KR+ ++ +     +++VIT  G   N   N+    D ++ + ++    + ND++     K I    + ++  +K+ + +  F+  ELI+ I     ++ +T     G   +L  PE++D  K K  L +L++ S+  ++            +  G E   E   ++   +T   IN++    + ++ PTR+DY ++   L  +  E 
  S:     3 LDDRKKRILFAVVTDYIMTAEPIGSRTIAKKYNMGISSATIRNEMADLEEMGYLEQPHTSAGRIPSDKGYRFYVDTILQNFMK-EDLSPPPR-VREEVIAEFDEIVKKYAKILADITHHTTVAKMPKLNPDKIKRLQLIPVASNKMIMVVITDTGIVKNYLLNLCQSVDRNVFEFLN---NLLNDKIAGKSEKAI---FNFLEKELKDTLGDMAFMADELIKTILLSLKQLQETDVYTDGTLHILDFPEYKDLNKAKNFLSLLDNKSLLNEVL---EPVDDFVDVKIGRENRFEEMRELSVIKTTYKINDRVVGTIGIIGPTRMDYRRLISELTLMTREL 331
>gi|28211655|ref|NP_782599.1| heat-inducible transcription repressor [Clostridium tetani E88] >gi|46576542|sp|Q892Q8|HRCA_CLOTE Heat-inducible transcription repressor hrcA >gi|28204097|gb|AAO36536.1| heat-inducible transcription repressor hrcA [Clostridium tetani E88] (351 aa)
Score = 268, Expect = 1.0e-21, Identities = 82/333 (24%), Positives = 179/333 (53%)
  Q:     3 EITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFS--KPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIE-NNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKT----VHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDE---VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEK 335
           E+ +R+ ++L+ I+ DY+ TA PVGS+ + +KY   +S+AT+RN+M+ LE +G LE+ H+SSGR PS  GY+ Y       +   + E   +K  ++       I+ V+ E+  I+++ TKL  + +  ++ E  +K I ++ ++  + +++++   G +  N+I       + ++    RI N +L    ++ I   +D +K ++ E+ K+YE  L++++  +++     I +    + G +++   PE+ D ++ K+ L +++     + +     ++  N  I  G E      +D         + ++    + ++ PTR+ YS++  +L  + +E +K
  S:    10 EMDKRKIKILQAIIHDYIQTAEPVGSRTIAKKYDLGVSSATIRNEMSDLEDMGYLEQLHSSSGRKPSDKGYRLYVDKLMNIQKLSSMEECAIK-THIINSALYEIEKVVREASAILADLTKLTTVVMSPSSIESYIKSIQLIGLDANTVLLVLVIDTGIIKNNVIKLHAKMTIDELVKINRILNIKLNKIRVESI--NLDFLK-VVLEEFKDYEKWLKDILPVLYETLLSGIDSNEIYLEGATNIFNYPEYNDIQRAKDFLSLIDDKDKVKNLI----KSDDNITIKIGKENFIEDAKDCTIITAVYKLKDRPLGTIGVIGPTRMPYSRVVSILSTLVDELDK 344
>gi|146296757|ref|YP_001180528.1| heat-inducible transcription repressor HrcA [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145410333|gb|ABP67337.1| heat-inducible transcription repressor HrcA [Caldicellulosiruptor saccharolyticus DSM 8903] (343 aa)
Score = 266, Expect = 1.6e-21, Identities = 92/326 (28%), Positives = 169/326 (51%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKL-PMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSI-LKDISICIRIFNDRLIDCPIKEI--ATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKT---VHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLN---INEQNKTKLVMVAPTRVDYSKIKGLLEFI 329
           + +R+K +L+ +++DY+ T  PVGS+ + +KY+  IS+AT+RN+M+ LE++G LE+ HTS+GRVPS  GY++Y     K           +R+    +   I+  +E   KIIS  T    +I   N  +  +K + ++ ++ +  ++I++T+ G L K+I+  K ++I  KD      + N +L    +++I   T +D   S+ K +      +L  +I+ + +  S    T   + G  ++   PEF D  K K  L I E   +  +I    +    +  I  G E   ED+      L+   I +     + ++ P R+ YS+   L+++I
  S:     2 LDERKKRILQAVIDDYINTGEPVGSRTIAKKYIFGISSATIRNEMSDLEEMGYLEQPHTSAGRVPSDKGYRYYVDELMKVTRLSPQEVEFIRSQLDVKFNEINEYMENIAKIISNLTNYTAVISTPNVKKSYIKHLQLLPVDSKKCILILVTNTG-LVKDILLDKPENIDSKDFIYITNVLNQKLSGLKLEDIDENTVLDIENSLGKNRT-----ILSPIIDNVLRTISAADSTEVVLSGIKNMFDFPEFNDVLKAKIFLHIFEQKDMLRKII--NSSMHDHITIRIGTENPIEDLKECSIILSTYRIGDSIAGSIGIIGPKRLKYSQTVSLIDYI 329
>gi|119716135|ref|YP_923100.1| heat-inducible transcription repressor [Nocardioides sp. JS614] >gi|166220400|sp|A1SHX8|HRCA_NOCSJ Heat-inducible transcription repressor hrcA >gi|119536796|gb|ABL81413.1| heat-inducible transcription repressor HrcA [Nocardioides sp. JS614] (337 aa)
Score = 263, Expect = 3.4e-21, Identities = 79/315 (25%), Positives = 161/315 (51%)
  Q:     6 QRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFS--KPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTK-LPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDI---VFAQTDLNINEQNKTKLVMVAPTRVDYS 320
           +R+  +L+ IVEDYVAT  PVGSK ++E++   +S ATVRNDMA LE  G + + HTS+GRVP+  GY+ +    +  KP    E   +       D  + +D V++ S +++++ T+ + +++    +   ++ I++V +     +V++I S G + + ++    +   +D++    + N   +   I + AT + ++  +  E       V+  L+E +   +S     V G ++L    +  D+  ++ +L+ LE   +  ++   +   G    +  G E  ++++       T     ++   +L +V PTR+DY+
  S:     4 ERRLAVLRAIVEDYVATEEPVGSKALVERHGLGVSPATVRNDMAALEDEGYITQPHTSAGRVPTDKGYRLFVDRLTTIKPMSTAEKRAIA---TILDGAIDLDDVVQRSVRLLAQLTRQVAVVQYPTLSRSTVRHIELVALTPTRLLVVLILSTGRVEQRLVDLAAELGEEDLADLRTVVNRAALGEIIADAATALRAL--VPAEDATPTGAVVDVLVEAMSDHRSDERIAVGGAANLARFGDSFDS-AVRPLLEALEEHVVLLKL-LGEATAGEILTVRIGHEGPYQELSSTSVVATGYGPGDEALARLGIVGPTRMDYA 317
>gi|156744297|ref|YP_001434426.1| heat-inducible transcription repressor HrcA [Roseiflexus castenholzii DSM 13941] >gi|189028269|sp|A7NS62|HRCA_ROSCS Heat-inducible transcription repressor hrcA >gi|156235625|gb|ABU60408.1| heat-inducible transcription repressor HrcA [Roseiflexus castenholzii DSM 13941] (359 aa)
Score = 261, Expect = 6.4e-21, Identities = 73/327 (22%), Positives = 172/327 (52%)
  Q:     3 EITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTK-LPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEF-------VLQELIERIFQIKSKMIKTVH--GQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKTKLV----MVAPTRVDYSKIKGLLEFI 329
           ++T R++ +LK  +++++ ++ PV S++++ KY  N+S ATVRN++A LE+LG L   HTS+GRVP+ AGY+++ +N           +  +R+ F      +D  I+ +  +++ + +   ++      +  LK ++++ I+  +A+++++  DG + +  +        +++S      N+R  D P++ +       + + +E+  E          VL  +++ + Q    +   +H  G   +L  PEF   E+++ +++IL+S      +   +  + S   +  G E S++++   +  + ++     ++V    ++ PTR+ Y +    + +I
  S:     4 DLTDRRQLILKLAIQEFIESSQPVASELLVRKYRLNVSPATVRNELAALEELGYLTHLHTSAGRVPTDAGYRYFVENLMDRTPLSATEQRTIRHQFYQVRSELDQWIQLAGAVLARTAQNASVVTPPRAQQARLKHLELISIHDTTALMVLVLHDGTIRQQTLTLDMALSQEELSRRASRINERCADAPVERVE------EFLKQERAHEPPGGDALACQVLDLIVKAMHQFNEHLNSDIHSDGLIEILNQPEFSQVERVRRMIEILQSRRALGTL-IPRALSSSGVQVVIGGEHSYDEM--REYSVVLSRYGGGEIVGVLGVIGPTRMAYPRAISAVRYI 335
>gi|22298303|ref|NP_681550.1| heat-inducible transcription repressor [Thermosynechococcus elongatus BP-1] >gi|46576559|sp|Q8DKU4|HRCA_SYNEL Heat-inducible transcription repressor hrcA >gi|22294482|dbj|BAC08312.1| tll0761 [Thermosynechococcus elongatus BP-1] (352 aa)
Score = 260, Expect = 9.1e-21, Identities = 85/284 (29%), Positives = 145/284 (51%)
  Q:     3 EITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLK--LRNVFADRTMSIDVVIEESCKIISE-STKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHF---KDDSILKD--ISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIA---FKQNQTGSNTLITFGDE 286
           E++ RQK++L   +  Y+ATA PV SK +  +Y  N+S ATVRN M  LEK GLL + HTS+GRVPS +GY+ Y     +P I D   K +  L   F  R   ++V++ ++ +++S+ S  + +I + N  E  ++ I +V ++ Q  MVI++         +I     ++D  L++  + +     N +L    + E++  ID  K  ++ +    +        R           + G + LL  PEF   E+++ +L +LE     +Q+A      +Q  S   I  G E
  S:     4 ELSDRQKQILGATINHYIATAEPVASKAIATEYNLNVSPATVRNTMLLLEKSGLLYQPHTSAGRVPSDSGYRVYVDELIQP-IPDIARKAESLLSERFIWRQQRLEVILRQAAQLLSDLSGYITLITLPNALERQIRVIQLVALDSQQVMVILVLDTYETQSALIQLEQGEEDPELRERTLQVLTNFLNHQLQGRSLVELSA-IDWQKLDLEFQTYSQQLQALLRQLRDRYSHQGTAFVISGLADLLQQPEFSQVEQVQMLLHLLEDQQ--DQLAPLITTDSQAPSQVQIRIGSE 294
>gi|84496858|ref|ZP_00995712.1| heat-inducible transcription repressor [Janibacter sp. HTCC2649] >gi|84383626|gb|EAP99507.1| heat-inducible transcription repressor [Janibacter sp. HTCC2649] (343 aa)
Score = 259, Expect = 1.0e-20, Identities = 54/159 (33%), Positives = 101/159 (63%)
  Q:     6 QRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFS--KPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTK-LPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNII 164
           +R+  +L+ IV+DYV T+ PVGSK ++E++   +SAATVRNDMA LE+ GL+   HTS+GR+P+ AGY+F+    S  KP    E   +   +   D  + +D V++ + ++++  T+ + +++  + T   ++ I++V I     +V++IT+ G + + ++
  S:     4 ERRLAVLRAIVQDYVETSEPVGSKALLERHRLGVSAATVRNDMAALEEDGLIAAPHTSAGRIPTDAGYRFFVDRISGVKPLSGAEKRAI---STLLDGAIDLDDVVDRTVRLLASLTRQVAVVQYPSLTRSSVRHIELVPIGGSRLLVVLITTTGRVEQRVL 162
>gi|167750346|ref|ZP_02422473.1| hypothetical protein EUBSIR_01320 [Eubacterium siraeum DSM 15702] >gi|167656706|gb|EDS00836.1| hypothetical protein EUBSIR_01320 [Eubacterium siraeum DSM 15702] (349 aa)
Score = 259, Expect = 1.1e-20, Identities = 86/329 (26%), Positives = 171/329 (51%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFY-EKNFSKPYINDENLKLKLRNVFAD-RTMSIDVVIEESCKIISESTKLPMIKIEN-NTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVH--GQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDE-----VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNE 332
           +  R   +L+ IV++Y+ T   VGSK++ EK    +S+AT+RN+MA LE+ G LE  HTSSGR+P+  G + Y EK  S   + DE  K ++  +F +    + D +I+ + + +++ TK  ++     N   ++ ++D++   K+  ++++ITS+GN+   +     D   + +    +  N+ L    + E++   D     + + +  Y   L  L++ +  I ++M + V   G+ +LL   +F +T    +I  IL+  +   ++    + T S   I FG E     V++  ++ A    N + +      ++ P R+DY K+   +E+  ++
  S:     1 MENRTLRILEAIVDEYIRTGEAVGSKLIAEKLDNAVSSATIRNEMAALEQQGYLEHTHTSSGRLPTYQGLRLYIEKVMSPAQLPDEE-KEEIDRIFDNIGGATDDEIIDNASRALADITKCAIVSTNTVNKFSVITKVDVIPTGKRMYVLLLITSEGNIRNRVCRLSFDLTNEQMDFFTQFVNENLKGVNLDELS---DEYIDKLTQAMGGYMMTLSPLLKAVVDISAEMQQQVEFSGEKNLLTCSDFSNT----QIATILDGKN---ELCSWLDDTFSGIQIKFGAESDTFAVTNSSLIAAS--FNKDGRKAGSFGVIGPVRLDYKKLIPYIEYFSSK 326
>gi|145621057|ref|ZP_01777059.1| heat-inducible transcription repressor HrcA [Geobacter bemidjiensis Bem] >gi|144942644|gb|EDJ77767.1| heat-inducible transcription repressor HrcA [Geobacter bemidjiensis Bem] >gi|197089229|gb|ACH40500.1| heat-inducible transcription repressor HrcA [Geobacter bemidjiensis Bem] (343 aa)
Score = 259, Expect = 1.1e-20, Identities = 78/327 (23%), Positives = 169/327 (51%)
  Q:     2 KEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNF--SKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKT------VHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDE---VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEF 328
           +++++R K +L+ ++EDY+ATA PVGS+ +   +   +S ATVRN M+ LE++GLL   HTS+GR+P+   Y+ Y  +    K    D   +++ R   A R ++ +V+ E S  + S S+ + ++   + +  +  +++ V+++ +  + I+++ +G +   ++   ++   +D+       N  L    I ++  ++  +  +  EKV+        ++ R   +  + I+       + GQ+++L  PEF DT K++EI +  E  S+   +  +    G    I  G E   +  E +    +     +     L ++ PTR+ Y ++  ++++
  S:     3 EQLSERSKRILEAVIEDYIATAEPVGSRTITRSHALALSPATVRNVMSDLEEMGLLTSPHTSAGRIPTDKAYRLYVNSILEVKNLARDNREEIRRRCRMAGRDLA-EVLKETSRLLSSTSSYMGVVMAPHLSANVFHQMEFVKLSSRRVLAILVSQNGTVQNRLLETGEEIAQEDLVRMANYLNGMLQGLTIAQVRERL--LSEMQNEKVR-----YDTMMARALTLSQQTIQADGAEIFLEGQANILEQPEFADTAKMREIFRTFEKKSMLLDLLDRSLSAGG-VQIFIGSESNLLKMEGMSLVTSTYMTGKDTVGVLGVIGPTRMGYGRVIPIVDY 331
>gi|148380913|ref|YP_001255454.1| heat-inducible transcriptional repressor HrcA [Clostridium botulinum A str. ATCC 3502] >gi|153933194|ref|YP_001385221.1| heat-inducible transcription repressor [Clostridium botulinum A str. ATCC 19397] >gi|153935482|ref|YP_001388690.1| heat-inducible transcription repressor [Clostridium botulinum A str. Hall] >gi|168179392|ref|ZP_02614056.1| heat-inducible transcriptional repressor HrcA [Clostridium botulinum NCTC 2916] >gi|148290397|emb|CAL84524.1| heat-inducible transcription repressor [Clostridium botulinum A str. ATCC 3502] >gi|152929238|gb|ABS34738.1| heat-inducible transcriptional repressor HrcA [Clostridium botulinum A str. ATCC 19397] >gi|152931396|gb|ABS36895.1| heat-inducible transcriptional repressor HrcA [Clostridium botulinum A str. Hall] >gi|182669717|gb|EDT81693.1| heat-inducible transcriptional repressor HrcA [Clostridium botulinum NCTC 2916] (343 aa)
Score = 259, Expect = 1.2e-20, Identities = 83/319 (26%), Positives = 166/319 (52%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTM-SIDVVIEESCKIISESTKLP-MIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKT---VHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKT---KLVMVAPTRVDYSKI 322
           + +R+  +L+ I++DY+ +  PVGS+ + +KY   +S+AT+RN+MA LE +G LE+ H+SSGR PS  GY+ Y           E  K+ +++   D  +  ID  I  S  I+SE TKL  ++K  +  +  L+ I +++++K + ++IVIT +  +   ++    +     +     + N +L    ++E+  +   + + +K+++  Y  +L+ ++  I++  + +      + G +++   PE+ D ++ KE L +L      E++ +      S+  +  G E   ED         +    KT    + ++ PTR+ Y KI
  S:     1 MDERKIRILQAIIKDYINSGEPVGSRTIAKKYDLGVSSATIRNEMADLEDMGYLEQIHSSSGRKPSDKGYRLYVDKLMTLTALTEREKMLIKDQAIDSALYEIDKTIRHSISILSEITKLTCLVKTPSMIKSRLRSIQIIKVDKYNLLLIVITDNAMIKNTLLRVTKEIDEGSLIKINNLLNQKLKGLNLREVNLE---LLNELKKEMTGYGDILKNILSSIYEALTDIEDAEIYMEGTTNIFNYPEYNDVDRAKEFLSMLNDREKVEELLY----VDSDIAVKIGKENFVEDAKQCSVISAVYSIGKTPIGTIGVIGPTRIPYEKI 320
>gi|148262292|ref|YP_001228998.1| heat-inducible transcription repressor HrcA [Geobacter uraniireducens Rf4] >gi|146395792|gb|ABQ24425.1| heat-inducible transcription repressor HrcA [Geobacter uraniireducens Rf4] (343 aa)
Score = 258, Expect = 1.5e-20, Identities = 85/328 (25%), Positives = 167/328 (50%)
  Q:     1 MKE-ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNF--SKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTK-LPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATK-IDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTS-IWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKTKLV-MVAPTRVDYSKIKGLLEF 328
           MKE ++ R K++L+ I+EDY+ TA PVGS+ +  ++  ++S ATVRN MA LE++G L   HTS+GR+P+   Y+FY  +    K    DE  ++  R   A +   I  V++E+ +++S ++  + ++        + + ++ V++  +  + I+++ +G +   II   +D    D++      N+ L    I ++  + I+ M+S  K +          L  +    +   +  + GQ ++L  PEF D  ++K+I +  E  S I E +       G    I     +S    +   T   +  QN   ++ ++ PTR+ Y+K+  ++++
  S:     1 MKEHLSDRGKQILEAIIEDYIVTAEPVGSRTITRRHPLSLSPATVRNVMADLEEMGFLVSPHTSAGRIPTDKAYRFYVNSLLAVKNIGRDEQEEIVRRCSLAGK--DIGEVLKETSRMLSATSHYMGIVMAPRFDSNVFRHMEFVKLGSRRILAILVSQNGTVQNRIIEADEDVSAADLTRMSNYLNELLQGLTIAQVRHRLIEEMQS-EKARYDLLLARALALSSKTLDEEDAQV-FIEGQVNILEQPEFADVGRMKDIFRTFEKKSAILELLDRAMAAEGVQIFIGSESHLSEMPGMSLITSTYVTGQNTLGVLGVIGPTRMGYAKVIPIVDY 331
>gi|168181647|ref|ZP_02616311.1| heat-inducible transcriptional repressor HrcA [Clostridium botulinum Bf] >gi|182675002|gb|EDT86963.1| heat-inducible transcriptional repressor HrcA [Clostridium botulinum Bf] (343 aa)
Score = 258, Expect = 1.6e-20, Identities = 83/319 (26%), Positives = 166/319 (52%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTM-SIDVVIEESCKIISESTKLP-MIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKT---VHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKT---KLVMVAPTRVDYSKI 322
           + +R+  +L+ I++DY+ +  PVGS+ + +KY   +S+AT+RN+MA LE +G LE+ H+SSGR PS  GY+ Y           E  K+ +++   D  +  ID  I  S  I+SE TKL  ++K  +  +  L+ I +++++K + ++IVIT +  +   ++    +     +     + N +L    ++E+  +   + + +K+++  Y  +L+ ++  I++  + +      + G +++   PE+ D ++ KE L +L      E++ +      S+  +  G E   ED         +    KT    + ++ PTR+ Y KI
  S:     1 MDERKIRILQAIIKDYINSGEPVGSRTIAKKYDLGVSSATIRNEMADLEDMGYLEQIHSSSGRKPSDKGYRLYVDKLMILTALTEQEKMLIKDQAIDSALYEIDKTIRHSISILSEITKLTCLVKTPSMIKSRLRSIQIIKVDKYNLLLIVITDNAMIKNTLLRVTKEIDEGSLIKINNLLNQKLKGLNLREVNLE---LLNELKKEMTGYGDILKNILSSIYEALTDIEDAEIYMEGTTNIFNYPEYNDVDRAKEFLSMLNDREKVEELLYAD----SDIAVKIGKENFVEDAKQCSVISAVYSIGKTPIGTIGVIGPTRIPYEKI 320
>gi|23015826|ref|ZP_00055592.1| COG1420: Transcriptional regulator of heat shock gene [Magnetospirillum magnetotacticum MS-1] (354 aa)
Score = 258, Expect = 1.6e-20, Identities = 82/328 (25%), Positives = 166/328 (50%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSK--PYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQI----------KSKMIKTVHGQSSLLA-VPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDE-----VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEF 328
           + E+ +R +E+ + IVE YV T  P+GS+ +  +   ++S AT+RN MA LE  GLL   HTS+GR+P+ AG + +     +      +E   +  +   A R+M  + V+ E+   +S  ++   + +    + +LK ++ V + +  A+V+++T DG +   ++   D   +  +       N RL           +D +K +I  ++++   +L  L +R+ +            S +I  V GQS LL  V   +D E+++ + + LE++  + ++     Q      I  G E     V+   +V A    +  E+    + ++ P R++Y++I  ++++
  S:     9 ITELNERSREIFRQIVEAYVETGEPIGSRTLSRRLTLSLSPATIRNVMADLEDFGLLYAPHTSAGRLPTQAGMRLFVNGLLEVGRMAEEERSAIDAQCRAAGRSM--EQVLGEALGALSGLSRCAGVVVAPKIQRMLKHVEFVWLGRNRALVVLVTEDGMVENRLLDLPDGVEMSTLVEAGNYLNARL-------AGRSLDEVKDVITAELEQQRSLLDSLTKRVIEAGLATWAGGDNHSALI--VRGQSHLLEDVTAVEDLERIRGLFEALETSEQFLRLV-DLTQVADGVQIFIGAESDLFGVTGCSMVVAPYR-DARERIIGAIGVIGPQRINYARIIPMVDY 341
>gi|153939746|ref|YP_001392238.1| heat-inducible transcription repressor [Clostridium botulinum F str. Langeland] >gi|152935642|gb|ABS41140.1| heat-inducible transcriptional repressor HrcA [Clostridium botulinum F str. Langeland] (343 aa)
Score = 258, Expect = 1.7e-20, Identities = 82/319 (25%), Positives = 166/319 (52%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTM-SIDVVIEESCKIISESTKLP-MIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKT---VHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKT---KLVMVAPTRVDYSKI 322
           + +R+  +L+ I++DY+ +  PVGS+ + ++Y   +S+AT+RN+MA LE +G LE+ H+SSGR PS  GY+ Y           E  K+ +++   D  +  ID  I  S  I+SE TKL  ++K  +  +  L+ I +++++K + ++IVIT +  +   ++    +     +     + N +L    ++E+  +   + + +K+++  Y  +L+ ++  I++  + +      + G +++   PE+ D ++ KE L +L      E++ +      S+  +  G E   ED         +    KT    + ++ PTR+ Y KI
  S:     1 MDERKIRILQAIIKDYINSGEPVGSRTIAKRYDLGVSSATIRNEMADLEDMGYLEQIHSSSGRKPSDKGYRLYVDKLMTLAALTEREKMLIKDQAIDSALYEIDKTIRHSISILSEITKLTCLVKTPSMIKSRLRSIQIIKVDKYNLLLIVITDNAMIKNTLLRVTKEIDEGSLIKINNLLNQKLKGLNLREVNLE---LLNELKKEMTGYGDILKNILSSIYEALTDIEDAEIYMEGTTNIFNYPEYNDVDRAKEFLSMLNDREKVEELLY----VDSDIAVKIGKENFVEDAKQCSVISAVYSIGKTPIGTIGVIGPTRIPYEKI 320
>gi|160895336|ref|ZP_02076107.1| hypothetical protein CLOL250_02895 [Clostridium sp. L2-50] >gi|156863029|gb|EDO56460.1| hypothetical protein CLOL250_02895 [Clostridium sp. L2-50] (354 aa)
Score = 255, Expect = 3.0e-20, Identities = 92/332 (27%), Positives = 173/332 (52%)
  Q:     3 EITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNII-----HFKDDSILKDISICIRIFNDRLIDCPIKEIATK-IDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQ----IAFKQNQTGSNTLITFGDEVSHEDI---VFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFE 334
           E+ +R+ ++LK IV +Y+ T  PVGS+ + +    N+S+AT+RN+M+ LE +G + + HTS+GR+P+  GY+FY  +     I  E  K  L     +R   ++ ++++  ++++ +T    +         +K I + ++  +S ++ VI  DGN+ KN +       K+D ILK  +I +  F   L    +++I  + I +MK    E     E + Q ++E I +     + T  G +++L  PE  D+   +++L   E     E+    +    N+  S+  I  GDE S ED+           + E  K  + ++ P R+DY K+  +L+ + +E +
  S:    13 ELDERKVKILKAIVSNYLETGEPVGSRTISKYTDLNLSSATIRNEMSDLEDMGYICQPHTSAGRIPTDKGYRFYVDSLMNEKIEAETEKGNL----LERVDKMEKMLKQVARVLAANTNYATLVTTPQYNNTVKFIQLSKV-AESKLLAVIMVDGNIVKNKLIDTTYDLKNDEILK-FNILLNTF---LQGAALEDINLELIQTMKMQAGEYADILENIFQGIMEAIHEADDLKVYT-SGATNMLKYPELMDSATAEKLLGTFEDIEDKEEFVKYVEEVINKDNSDIEIRIGDENSSEDLKDCSLVTATYKMPEGAKGTIGIIGPKRMDYKKVVTMLKNLTDELD 347
>gi|118579830|ref|YP_901080.1| heat-inducible transcription repressor HrcA [Pelobacter propionicus DSM 2379] >gi|118502540|gb|ABK99022.1| heat-inducible transcription repressor HrcA [Pelobacter propionicus DSM 2379] (343 aa)
Score = 255, Expect = 3.3e-20, Identities = 80/326 (24%), Positives = 163/326 (50%)
  Q:     3 EITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNF-SKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKT------VHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDE--VSHEDIVFAQTDLNINEQNKTKLV-MVAPTRVDYSKIKGLLEF 328
           +++ R +++L+ IVEDY+ATA PVGS  V  ++   +S ATVRN MA LE+LGLL   HTS+GR+P+   Y+FY  +  +   +  E  K  + +         +++ E S  + S S  + ++   + T  + + I+ + +  +  + I+++ +G++   ++   D+ I  D  + +  + + L+          I   +  I E++K+ +     L+ +  +I  + +        + GQ+ +L  PEF D  ++++I +  E      Q+   +  +     I  G E  +S    V   T   +   N   ++ ++ PTR+ YS +  ++++
  S:     4 KLSPRSRQILEAIVEDYIATAEPVGSSAVARRHAMTLSPATVRNVMANLEELGLLTSPHTSAGRIPTEKAYRFYVDSLVALRKVTREEKKQIIHSCRRSGAGLTEILKETSRALSSLSNYMGIVVAPSITSDVFRYIEFIHLGPRRVLAILVSRNGSVQNRLVE-TDEEISPDDLVKMGNYLNELMQ------GLTISQARERILEEMKKEKTQYDHLLSQALRISKQAVSVERDEIFLEGQARILDQPEFSDVTRMRDIFRAFEEKGRLLQL-LGRCMSAEGVRIFIGSEAPLSQTAGVSLITSRFVTSSNAVGMLGIIGPTRMGYSSVIPIVDY 331
>gi|154502605|ref|ZP_02039665.1| hypothetical protein RUMGNA_00418 [Ruminococcus gnavus ATCC 29149] >gi|153796797|gb|EDN79217.1| hypothetical protein RUMGNA_00418 [Ruminococcus gnavus ATCC 29149] (363 aa)
Score = 254, Expect = 3.8e-20, Identities = 86/332 (25%), Positives = 173/332 (52%)
  Q:     3 EITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLP-MIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIR-IFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIE---RIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTS-----IWEQIAFKQNQTGSNTLITFGDEV---SHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFE 334
           E+ +R+  +LK I+++Y+ T  PVGS+ + +    N+S+AT+RN+MA LE LG + + HTS+GR+PS  GY+ Y     +     E+   +LRN   +++  +D V++++ K+++ +T    M+    N+   LK I + +++ Q  +V VI  +GN+ KN I    + +  +  + +  + N  L    I++I      + + +KE+   +  V+ ++++    I  +   M     G +++   PE  D +  +EI+   E        + E +A ++N       +  GDE    + +D         + E  K  + ++ P R+DY  +   L+ +++E +
  S:    20 ELGERKLTILKAIIQNYLETGEPVGSRTLSKYTDLNLSSATIRNEMADLEDLGYIFQPHTSAGRIPSDKGYRLYVDMLME---EKEHEITELRNTMLEKSDKVDQVLKQAAKVLAVNTNYATMVSAPVNSRNTLKFIQLSQVD-QEQIVAVIVMNGNVIKNKIIQVGEVLASETLLKLNMLLNTTLNGMSIEQINL---GLIARLKEQAGIHSRVISDVLDAVAEIIHVDDDMEIYTSGATNIFKYPELSDKQSAQEIISAFEEKQQLADLVTETLASEENH---GIQVYIGDETPVKTMKDCSVVTATYELGEGMKGTIGIIGPKRMDYEHVMKTLKTLQSELD 354
>gi|86739971|ref|YP_480371.1| heat-inducible transcription repressor [Frankia sp. CcI3] >gi|123737653|sp|Q2JDK0|HRCA_FRASC Heat-inducible transcription repressor hrcA >gi|86566833|gb|ABD10642.1| heat-inducible transcription repressor HrcA [Frankia sp. CcI3] (339 aa)
Score = 254, Expect = 4.8e-20, Identities = 79/277 (28%), Positives = 155/277 (55%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFS--KPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTK-LPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHF---KDDSI---LKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYE-FVLQELIERIFQIKSKMIKTVHGQSSLLAVP-EFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTL 280
           +  R+ E+L+ IVED+V +  PVGSK + E++   +S ATVRNDM+ LE+ G + + HTS+GR+P+  GY+ +    S  KP    E   ++    F +  + +D V+  S +++++ T+ + +++  + +   ++ I++V +     ++++IT  G + + I+      DD +   L+ +  C  +   RL+D P   +A   DS +S ++  +      VL+ L+ER    + + I  + G ++L   P +F D+  L+ IL+ LE   +  ++     +TG+ T+
  S:     2 LEDRRLEVLRAIVEDFVLSNEPVGSKALAERHNLGVSPATVRNDMSALEEEGYITQPHTSAGRIPTDKGYRLFVDRLSGVKPLSRAERRAIQ---SFLEGAVDLDDVVRRSVRLLAQLTRQVAVVQYPSLSSSSIRHIEVVTLGPYRLLMVLITDTGRVEQRIVDSLVPVDDEVAGELRSVLNCA-LAGRRLVDAP-DIVAALPDSTRSELRPYLTTVAGAVLESLVER----QEERI-AMAGTANLTRSPVDFADS--LRSILEALEEQVVLMKLIGSARETGTVTV 277
>gi|56750917|ref|YP_171618.1| heat-inducible transcription repressor [Synechococcus elongatus PCC 6301] >gi|81299427|ref|YP_399635.1| heat-inducible transcription repressor [Synechococcus elongatus PCC 7942] >gi|123557317|sp|Q31QM1|HRCA_SYNP7 Heat-inducible transcription repressor hrcA >gi|61213233|sp|Q5N3M2|HRCA_SYNP6 Heat-inducible transcription repressor hrcA >gi|56685876|dbj|BAD79098.1| heat-inducible transcriptional repressor [Synechococcus elongatus PCC 6301] >gi|81168308|gb|ABB56648.1| heat-inducible transcription repressor HrcA [Synechococcus elongatus PCC 7942] (353 aa)
Score = 253, Expect = 5.9e-20, Identities = 75/260 (28%), Positives = 137/260 (52%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLK----LKLRNVFADRTMSIDVVIEESCKII-SESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICI---------RIFNDRL----------IDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILE 260
           +  +T RQ+ +L   V  YV TA PVGSK + E+Y  ++SAAT+RN M  LE+ GLL + HTS+GRVPS  GY+ Y     +P   D  L+     +L     DR  S++ ++  + +I+ S S  L +I      E  ++ + +V I     ++IV+         ++   +  + +D+                N  L          +D P+  + +++ S+  I+++ +++        +E+ +Q        V G + LL  PEF + ++++ +L++LE
  S:     3 VSRLTARQQTILSATVRHYVRTAEPVGSKALAEQYGLSVSAATIRNAMGVLERAGLLYQPHTSAGRVPSEGGYRLYVDQLMEP---DRALQRQTEQQLSQQLPDRRQSLEALLRGAAQILASLSGYLSLITFPLGLEFQVRHLQLVAIAPHQVLLIVVNDSYETQSALLTLPE--LDRDLEADQLDRQLLLLSNFLNQELQGRSLQALANLDWPV--LGSELQSLAGILQQGLQD--------LEKRWQPTPATSLLVCGLADLLRQPEFNELQQVQALLELLE 271
>gi|83594971|ref|YP_428723.1| heat-inducible transcription repressor [Rhodospirillum rubrum ATCC 11170] >gi|83577885|gb|ABC24436.1| heat-inducible transcription repressor HrcA [Rhodospirillum rubrum ATCC 11170] (352 aa)
Score = 252, Expect = 8.2e-20, Identities = 88/328 (26%), Positives = 162/328 (49%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSK--PYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIK--------TVHGQSSLLA-VPEFQDTEKLKEILQILESTSIWEQIAFKQN-QTGSNTLITFGDE---VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEF 328
           + E+ +R +++   IVE YV T  PVGS+ +  +    +S AT+RN MA LE LGLL   HTS+GR+P+ AG + +     +     ++E   +  R   A +  ++D ++ ++  ++S   +   + +   T+  LK I+ V +    AMVI+IT +G +   ++          ++      N RL    ++E        +S I+E++  +   L +L +R+ +                V GQS LLA V   +D E+++++   LE+     +I    N   G    I   +E   VS   ++ A    N  E+    + ++ PTR++Y +I  L+++
  S:    10 VTELDERSRQIFGQIVETYVETGEPVGSRTLSRRLTVALSPATIRNVMADLEDLGLLYAPHTSAGRLPTDAGLRLFVNGLMELGGLTSEERRHIDGRVQAAGK--NLDDMLSDATSLLSGLARCAGLVLAPKTDSALKHIEFVPLGPGRAMVIMITENGLVENRVLEVPQGLPPSALAEATNYLNARLTGRTLEE-------ARSEIQEELDSHRSALDDLAQRVVETGMATWSGGTRGGELIVRGQSHLLADVTALEDLERIRDLFDTLETKEQVLRILDMVNLAEGVQIFIGAENELFSVSGCSMIVAPYQ-NSREEIVGAIGVIGPTRINYRRIIPLVDY 342
>gi|85057339|ref|YP_456255.1| heat-inducible transcription repressor [Aster yellows witches'-broom phytoplasma AYWB] >gi|123518483|sp|Q2NK67|HRCA_AYWBP Heat-inducible transcription repressor hrcA >gi|84789444|gb|ABC65176.1| heat-inducible transcription repressor [Aster yellows witches'-broom phytoplasma AYWB] (344 aa)
Score = 252, Expect = 8.3e-20, Identities = 93/335 (27%), Positives = 167/335 (49%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMP--NISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIE----NNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILK--DISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKT---VHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSH-EDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEK 335
           M  ++ R+K +LK +VE+Y     PVGSK++   Y+P    ++AT+R DM  LEK G L+KNHTSSGRVPS  GY +Y  +      +   +   +  V   +      VI+E+  +++  T    + I     NN+++   +ID + +N   A++++IT  GN+    I  +    +   D+   +++ ND L D  + E A  I S     K+ + +Y    ++LI    +  S          G S +L  PE  + E +K+ + +LE     E +    NQ   +   + G +++  +D +      ++N   K ++ +V P+ + Y K+  +LE++     K
  S:     2 MNMLSDRKKLILKAVVENYSQKRQPVGSKML--TYLPYLKFASATIRYDMVQLEKEGFLQKNHTSSGRVPSFKGYVYYLNHLLTRDHDVACMFESIDKVIQKKRFCKGQVIKEALNLLNNLTNYTTMAIGSDIFNNSKI--TKIDFIPLNSAQAVILIITDKGNVQHQNISLEQTKEISIYDLKDVVQVVNDLLKDKFLSEAAHIIQS--DFFKKTIAKYICFQEQLIALFMEAFSSFASENLYFSGVSKMLEKPELNNPEIIKKFMGLLERK---ELLKIMLNQDSLSFKFSDGLQLTPLKDCMILSIPFDVNPNEKGRIAVVGPSWMKYPKVIPILEYLAVHLSK 339
>gi|113474557|ref|YP_720618.1| heat-inducible transcription repressor [Trichodesmium erythraeum IMS101] >gi|110165605|gb|ABG50145.1| heat-inducible transcription repressor HrcA [Trichodesmium erythraeum IMS101] (370 aa)
Score = 251, Expect = 9.1e-20, Identities = 84/290 (28%), Positives = 152/290 (52%)
  Q:     3 EITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTM----SIDVVIEESCKII-SESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKD-------------------DSILKDISICIRIFNDRLIDCPIKEIA-TKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTS--IWEQI-AFKQNQTGSNTLITFGDEVSHEDI 292
           ++  R + +L   V  Y+ATA PVGSK ++E+Y  ++S AT+RN M+FLEK GLL + HTS+GR+PS +GY+ Y     +P    ENL  ++  +   +       ++VV++ + +I+ S S  + ++ +   +   L+ + +V++  +  M+IV+T+       I+  K                    + I +++ I     N +L    I E++      +    ++  K  + +L+ L  R    K   I  + G +  L +PEF   E+++ I+Q+LE     +W  I      +T     +T G E   E I
  S:     6 KLNNRHQHILWATVRHYIATAEPVGSKSLVEEYNLSVSPATIRNGMSFLEKSGLLYQPHTSAGRIPSDSGYRIYVDQLIRP---SENLAFEIEELLQKQLNWPEGRLEVVLQGAAQILASLSGYITLVTMPQTSTAKLRHLQLVQVEAEKIMLIVVTNTYETQSLIMDLKTINQINDRKNLQGNSAVPNLEDIDRELQILSNFLNSQLKGRVIGELSLLDWSELDWEFEKYAKLIKNLLENLTLRCGTPKYTRI-LISGIAEALRLPEFSQLEQVQTIIQLLEEKQDKLWPLIFGSTTKKTDRQVRVTIGSENPLEPI 319
>gi|108761894|ref|YP_634843.1| heat-inducible transcription repressor HrcA [Myxococcus xanthus DK 1622] >gi|108465774|gb|ABF90959.1| heat-inducible transcription repressor HrcA [Myxococcus xanthus DK 1622] (343 aa)
Score = 250, Expect = 1.3e-19, Identities = 80/327 (24%), Positives = 157/327 (48%)
  Q:     2 KEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSK---PYINDENLKLKLRNVFADRTMSIDV--VIEESCKIISESTKLPMIKIENNTE-VLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFK----DDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHE---DIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEF 328
           +E+ +R+KE+L+ +V++Y++T  PVGS+ +  +    +S+AT+RN +A LE+LG LEK HTS+GRVP+  GY+FY     K   P   D  L      + A      D+  ++ E+ +I+   T+   + +    E  + +RI+ V + +   + I++   G +    I  +     D +LK  +    +  +  ++   + I  ++D  +++      +   +     +    + S     + G  S    PEF D E+++ + + L+       +   + Q  +   I  G E       D+    +     EQ    + ++ PTR+DY ++  L+ F
  S:     3 EELGEREKEVLRAVVQEYISTGGPVGSQQLTRRPGFEVSSATMRNVLADLEELGFLEKPHTSAGRVPTDQGYRFYVDTLVKLKDPTPRDREL------IHAGLAHEADLAEMLGEASRILHSLTRHAGVVVAPRPESAVFRRIEFVRLREDRVLAILVGQSGQVHNKAITVEFPITSDELLKASNYLSELLREVPLESARERIRAEMDQEQALYNALTAKALKLGAAATD----LASTERMLIQGTGSFFEQPEFADVERMRALFRALDEKHKLLSL-LDRVQVANEMQIFIGAESDFSAAGDVTVIASPYGNQEQVLGTVGVIGPTRMDYRRVIPLVNF 331
>gi|134098065|ref|YP_001103726.1| heat-inducible transcription repressor [Saccharopolyspora erythraea NRRL 2338] >gi|133910688|emb|CAM00801.1| putative heat-inducible transcription repressor [Saccharopolyspora erythraea NRRL 2338] (340 aa)
Score = 250, Expect = 1.3e-19, Identities = 53/163 (32%), Positives = 99/163 (60%)
  Q:     6 QRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFS--KPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISEST-KLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKD 168
           QR+ E+L+ IV DYV+T  PVGSK +++++   +S+ATVRNDMA LE+ GL+ + HTS+GR+P+  GY+ +       KP    E   ++    F D  + +D V+  S +++++ T ++ +++    T   ++ +++V I     M+++IT  G + + ++   D
  S:     5 QRRFEVLRAIVADYVSTNEPVGSKALVDRHNLGVSSATVRNDMATLEEEGLIAQPHTSAGRIPTDKGYRLFVDRLHEIKPLTGAERRAIQ---AFLDGALDLDDVMRRSVRLLAQLTQQVAVVQYPTLTRSTVRHVEVVPITPARLMLVLITDTGRVDQRMVDLGD 167
>gi|148272745|ref|YP_001222306.1| heat-inducible transcription repressor [Clavibacter michiganensis subsp. michiganensis NCPPB 382] >gi|166220389|sp|A5CRA6|HRCA_CLAM3 Heat-inducible transcription repressor hrcA >gi|147830675|emb|CAN01613.1| putative transcriptional regulator, HrcA family [Clavibacter michiganensis subsp. michiganensis NCPPB 382] (340 aa)
Score = 249, Expect = 1.6e-19, Identities = 71/317 (22%), Positives = 167/317 (52%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFS--KPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISEST-KLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQ-ELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKT-----KLVMVAPTRVDYS 320
           +++R  ++L+ IV+DYV++  PVGSK ++E++   +SAAT+RNDMA LE+  L+   HTSSGRVP+  GY+ +    +  +P    +   +   +VF   ++ +D V+  + +++++ T ++ +++  +     +K +++V ++    + ++IT  G + + ++    D     +++     N  +    + E AT+++++   ++   +    VL   L+E++  + ++  + +   S+ LA  E      +  +L+ +E   +  ++  +         ++ G E  +      +T +  +  + +     +L ++ PTR+DYS
  S:     2 VSERGLDVLRVIVQDYVSSREPVGSKSIVERHAFGVSAATIRNDMALLEEEELIAAPHTSSGRVPTDKGYRLFVDQLADVRPLTPAQRQAI---HVFLGESVDLDDVLARTVRLLAQLTNQVALVQYPSLATSHVKHVELVALSTTRVLTVLITDTGRVEQRVVELAGDPDDAFLAVMRTRINQAVGGLGLAEAATRLETLSDEVEPAQRAAASVLAGTLVEQV--LANRQERLLLAGSANLARTERDFPGSISPVLEAIEEQVVLLRLLGEMEADQHGVSVSIGRE--NAPFGLGETSVLTSGYSSSGGVLARLGVLGPTRMDYS 320
>gi|118045774|ref|ZP_01514431.1| heat-inducible transcription repressor HrcA [Chloroflexus aggregans DSM 9485] >gi|117997786|gb|EAV11970.1| heat-inducible transcription repressor HrcA [Chloroflexus aggregans DSM 9485] (376 aa)
Score = 248, Expect = 1.9e-19, Identities = 65/258 (25%), Positives = 138/258 (53%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVL-LKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIER---IFQIKSKMIKTVHGQSSLLAVPEFQDT----------EKLKEILQILES 261
           +T+R++ +LK +++++V TA PV S+ ++ KY   +S ATVRNDMA LE+LG L   HTS GR+P+  GY+F+ +N  +        +  +R+ F      +D  ++ +C +++ +     +      E L  K ++++ I++  A+ +++   G + +  +  +     +D+     + +D L D  +  +  ++ +  +     + ++E  L +L+ R    F+ +++      G   +L+ PEF             E+++  L+IL+S
  S:     5 LTERRQTILKLVIQEFVDTATPVASETLVRKYRLPVSPATVRNDMAALEELGFLTHPHTSGGRIPTDTGYRFFVENLMERTSLSPAEQRMIRHQFYQVRGELDQWVQLACAVLARTAHNASVATAPRAEQLRFKSLELISIHETMALAVIVFHGGIVKQQTLPVEPWRTPEDLRRAAGLVSDLLADATLTRV-EELATAATFNGIPLSDFERGLVDLVVRAMIAFEEQAQEQIYSDGLLEMLSQPEFSPASGRDDAERVIERMRRTLEILKS 275
>gi|145595968|ref|YP_001160265.1| heat-inducible transcription repressor [Salinispora tropica CNB-440] >gi|145305305|gb|ABP55887.1| heat-inducible transcription repressor HrcA [Salinispora tropica CNB-440] (351 aa)
Score = 248, Expect = 1.9e-19, Identities = 60/219 (27%), Positives = 124/219 (56%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFS--KPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTK-LPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKE----IATKIDSMKSIIKEKVKEYEFVLQE-LIER 222
           +  R+  +L+ IVEDYVAT  PVGSK ++E++   +S ATVRNDMA LE+ G +++ HTS+GRVP+  GY+ +    S  KP    E   ++    F    + +D V+  + +++++ T+ + +++  +     ++ +++V I+    M+++I   G + + ++      +  D+    ++ N++L+   + +    +   +D +  +++  +     VL E L+ER
  S:    14 LDDRKLAVLRAIVEDYVATQEPVGSKTLVERHQLGVSPATVRNDMAVLEEEGYIQQPHTSAGRVPTDRGYRLFVDRLSRVKPLTPAERRAIER---FLVGAVDLDDVVHRTVRLLAQLTRQVAVVQYPSLARSSVRHLELVPISTTRLMLVMIVDTGRVEQRLVELPGPILPDDVIDLRQLVNEKLVGTRLADTPPLVQALVDEVTGVLRPAMTTLSTVLLETLVER 237
>gi|78189387|ref|YP_379725.1| negative regulator of class I heat shock protein [Chlorobium chlorochromatii CaD3] >gi|123579556|sp|Q3AQP3|HRCA_CHLCH Heat-inducible transcription repressor hrcA >gi|78171586|gb|ABB28682.1| heat-inducible transcription repressor HrcA [Chlorobium chlorochromatii CaD3] (348 aa)
Score = 247, Expect = 2.7e-19, Identities = 83/328 (25%), Positives = 156/328 (47%)
  Q:     2 KEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRN---VFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDS----------MKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSH---EDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFI 329
           +E+T R++++L  I++ YV +A PVGSK +   Y   +S AT+RN MA LE+LG + + HTS+GRVP+  GY++Y          DE  K +          +  S DV++     + + S +L ++     +  L +++DMV ++    MVI+      +   ++        + +   + + N+RL    + EI   I+           +K++I        F    + ER++         + G   L+  PEFQ  EK+++++ +LE       +  + +    +  IT G E      ED+        + +   T + ++ P R+DY     +L ++
  S:     4 RELTARERQILGIIIQSYVVSAAPVGSKYIARHYNLGLSDATIRNVMAELEELGFISQPHTSAGRVPTDKGYRYYVDLIMTVKTLDEQEKQRFEQHITPLERKGTSADVLLSAVKVLGTISRQLSVVLSPTLSNALFEKLDMVLLSSTRMMVIISIQSLFVKTIVMELHMQVSRQMLDEVVDVLNERLSGLTLSEIRRSINQRLADCSCDNELKNLIVRSAGTL-FDEMPVFERLY---------ISGTEYLVEQPEFQQPEKVRDLITMLEDKFSVATLVEQHHANNPDVTITIGKEHGKRQAEDLTVLSAPYYVGDMVGT-VGILGPKRMDYEHAVRILHYM 336
>gi|163816741|ref|ZP_02208104.1| hypothetical protein COPEUT_02931 [Coprococcus eutactus ATCC 27759] >gi|158447998|gb|EDP24993.1| hypothetical protein COPEUT_02931 [Coprococcus eutactus ATCC 27759] (359 aa)
Score = 247, Expect = 3.0e-19, Identities = 89/332 (26%), Positives = 171/332 (51%)
  Q:     3 EITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNII-----HFKDDSILKDISICIRIFNDRLIDCPIKEIATK-IDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQN---QTGSNTLITFGDEVSHE---DIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFE 334
           E+ +R+  +LK IV +Y+ T  PVGS+ + +    N+S AT+RN+M+ LE++G + + H S+GRVP+ AGY+FY  +       ++    + R     R   ++ ++++  K+++ +T+   +         +K I + +++ ++ ++ VI  DGN+ KN +       K++ ILK  +I +  F   L    +++I  + I +MK    E  +  E + Q ++E I +     + T  G +++L  PE  ++   +++L  LE     E+ A       Q  S+  I  G E S E   D         + E  K  + ++ P R+DY K+  +L+ +  E +
  S:    17 ELDERKVRILKAIVSNYLETGEPVGSRTISKLADMNVSPATIRNEMSDLEEMGYICQPHASAGRVPTDAGYRFYVDSIMADREEEKAGDQEERENLLQRVDKLEKLLKQVAKVLAANTQYATLVTMPQYNNTVKFIQLSQVD-ETTLLAVIMVDGNIVKNKLIKTTYSLKNEEILK-FNILLNTF---LQGASLEDINLELIQTMKLQAGEYAEILETIFQGIMEAIHEADDLKVYT-SGTTNVLKYPELANSSSAEKLLGTLEDIEDKEEFAKHVEDVIQQDSDIQILIGQENSDENLKDCSLVTATYKMPEGAKGTIGIIGPKRMDYKKVVTMLKELTGELD 354
>gi|83313596|ref|YP_423860.1| heat-inducible transcription repressor [Magnetospirillum magneticum AMB-1] >gi|82948437|dbj|BAE53301.1| Transcriptional regulator of heat shock gene [Magnetospirillum magneticum AMB-1] (370 aa)
Score = 247, Expect = 3.1e-19, Identities = 76/328 (23%), Positives = 158/328 (48%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQI--------KSKMIKTVHGQSSLLA-VPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKTKLV----MVAPTRVDYSKIKGLLEF 328
           + E+  R +E+ + IVE YV T  P+GS+ +  +   ++S AT+RN MA LE  GLL   HTS+GR+P+ AG + +     +     E+ +  +         S++ V+ E+   +S  ++   + +    +  LK ++ V + +  A+V+++T DG +   ++   D   +  +       N RL    ++E+       K  I  ++++   +L  L +R+ +         +S     V GQS LL  V   +D E+++ + + LE++  + ++     Q      I  G E     +      +      + ++V    ++ P R++Y++I  ++++
  S:    25 ITELNDRSREIFRQIVEAYVETGEPIGSRTLSRRLTLSLSPATIRNVMADLEDFGLLYAPHTSAGRLPTQAGMRLFVNGLLEVGRMAESERSAIDAQCRAAGRSMEQVLGEALGALSGLSRCAGVVVAPKIQRTLKHVEFVWLGRNRALVVLVTEDGMVENRLLDLPDGVEMSTLVEAGNYLNARLAGRSLEEV-------KDEIAAELEQQRSLLDSLTKRVIEAGLATWAGGESHSALIVRGQSHLLEDVTAVEDLERIRSLFEALETSEQFLRLV-DLTQVADGVQIFIGAESDLFGVTGCSMVVAPYRDARERIVGAIGVIGPQRINYARIIPMVDY 357
>gi|111221443|ref|YP_712237.1| heat-inducible transcription repressor [Frankia alni ACN14a] >gi|122954435|sp|Q0RP78|HRCA_FRAAA Heat-inducible transcription repressor hrcA >gi|111148975|emb|CAJ60655.1| Heat-inducible transcription repressor hrcA [Frankia alni ACN14a] (339 aa)
Score = 245, Expect = 4.3e-19, Identities = 75/277 (27%), Positives = 154/277 (55%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFS--KPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTK-LPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHF---KDDSILKDISICIR--IFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYE-FVLQELIERIFQIKSKMIKTVHGQSSLL-AVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTL 280
           + +R+ E+L+ IVED+V +  PVGSK + E++   +S ATVRNDM+ LE+ G + + HTS+GR+P+  GY+ +    S  KP    E   ++    F +  + +D V+  S +++++ T+ + +++  + +   ++ I++V +  +  ++++IT  G + + II      D+ I  ++   +   +   RL+D P + +AT  D  +  ++  +      VL+ L++R      +    + G ++L  A  +F D+  L+ IL+ LE   +  ++     +TG+ T+
  S:     2 LEERRLEVLRAIVEDFVLSNEPVGSKALAERHNLGVSPATVRNDMSALEEEGYITQPHTSAGRIPTDKGYRLFVDRLSGVKPLSRAERRAIQ---SFLEGAVDLDDVVRRSVRLLAQLTRQVAVVQYPSLSSSSVRHIEVVTLGPRRMLMVMITDTGRVEQRIIDSLTPVDEEIAGELRATLNCALAGQRLVDAP-EVVATLPDQARPELRPCLATMTGAVLESLVDR-----PEERLAMAGTANLTRASVDFADS--LRSILEALEEQVVLMKLIGSARETGTVTV 277
>gi|186685801|ref|YP_001868997.1| heat-inducible transcription repressor HrcA [Nostoc punctiforme PCC 73102] >gi|186468253|gb|ACC84054.1| heat-inducible transcription repressor HrcA [Nostoc punctiforme PCC 73102] (376 aa)
Score = 245, Expect = 4.5e-19, Identities = 78/266 (29%), Positives = 142/266 (53%)
  Q:     3 EITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDEN---------------LKLKLRNVFADRTMSIDVVIEESCKIISE-STKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHF--------KDDSIL-KDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFV---LQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILEST--SIWEQI 268
           ++T RQ+ +L   V  Y+ATA PVGSK ++E+Y   +S+AT+RN M  LEK GLL + H S+GRVPS +GY+ Y      P +   +               +++ L+        S++ +++ + +I++  S  + +I +   T  LL+ + +V+I     M+IV+T        ++          +D  ++ +++ I     N  L    + E+A    +   + +E  +  EF+   + EL  R     +  I  V G S +L  PEF   ++++ I+ +LE     +W  I
  S:     4 QLTNRQQHILWATVRHYIATAEPVGSKALVEEYDLGVSSATIRNVMGVLEKSGLLYQPHASAGRVPSDSGYRIYVDQLITPSLRSRSVSQTDATRTETLGREIEVALQKHLQWEDRSLETLLQGAAQILATLSGCISLITMPQTTTALLRHLQLVQIEAGRIMLIVVTDGYETHSKLMDLSPIPEETQRDSEVIDRELQIVSNFLNTHLRGRSLLELANL--NWSELDQEFQRYGEFLKNSVAELTRRTLAPTATQI-MVRGVSEVLRQPEFSQLQQVQTIIHLLEEEQDQLWRLI 296
>gi|163867357|ref|YP_001608551.1| heat-inducible transcription repressor [Bartonella tribocorum CIP 105476] >gi|189028257|sp|A9ILE7|HRCA_BART1 Heat-inducible transcription repressor hrcA >gi|161016998|emb|CAK00556.1| heat-inducible transcription repressor HrcA [Bartonella tribocorum CIP 105476] (356 aa)
Score = 245, Expect = 5.0e-19, Identities = 77/328 (23%), Positives = 166/328 (50%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSK----PYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQI------KSKMIKTVHGQSSLLA-VPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDE-----VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEF 328
           +K + +R +++ ++IVE Y+    PVGS+ +       +S AT+RN M+ LE LGL+   H S+GR+P+ +G +F+   F +    P    EN++++++   A    S++  + ++ +++S+ ++   + +    E  LK I+ V ++++ A+ +++T  G +   I+H  +      ++      N  +    + E   +I  + +  +  + +       L+E    +        K+   V G+S+LL  V   +D E+L+ +   LE+     Q+       GS   I  G E     +S   +V A    +  ++    L ++ PTR++Y++I  ++++
  S:    10 LKYLDERSRDIFRHIVEAYLNDGEPVGSRNLSRLLQQTLSPATIRNVMSDLEHLGLIYAPHVSAGRMPTQSGLRFFVDAFMEAGDLPNEERENIEMQVKE--AGHAQSVEHFLVQASRVLSDLSRGAGLVLATKQEGTLKHIEFVRLDREHALAVLVTQQGEVENRIVHLPEGVTHAQLTEATNFLNAHIQGRTLSEAKEEIACLCAETRAALDDLS---HHLVETGLALLGGEGADHKIHLIVRGRSNLLEDVKAEEDLERLRHLFDDLETRESMAQL-LDLTDEGSGVRIFIGSENKLFSLSGSSLVVAPYR-DSQQRVIGALGVIGPTRLNYARIVPMVDY 346
>gi|41408261|ref|NP_961097.1| heat-inducible transcription repressor [Mycobacterium avium subsp. paratuberculosis K-10] >gi|61213513|sp|Q73XZ5|HRCA_MYCPA Heat-inducible transcription repressor hrcA >gi|41396616|gb|AAS04480.1| HrcA [Mycobacterium avium subsp. paratuberculosis K-10] (343 aa)
Score = 245, Expect = 5.2e-19, Identities = 78/319 (24%), Positives = 161/319 (50%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFS--KPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTK-LPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLI-------DCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIV---FAQTDLNINEQNKTKLVMVAPTRVDY 319
           M    +R+ E+L+ IV D+VAT  P+GSK ++E++   +S+ATVRNDMA LE  G + + HTSSGRVP+  GY+ +       KP    E  +  ++N F +  + +D V+  + +++++ T+ + +++    +   ++ ++++ +     +++VIT  G + + I+   D     ++S    +    L+          + ++A ++ S   +     +    +L+ L+E   +      + + G ++ L          L+ IL+ LE   +  ++   Q + G  T +  G E + E +V      T    ++     + ++ PTR+DY
  S:     1 MGSADERRFEVLRAIVADFVATKEPIGSKTLVERHNLGVSSATVRNDMAVLEAEGYITQPHTSSGRVPTEKGYREFVDRLDDVKPLSAAE--RRAIQN-FLESGVDLDDVLRRAVRLLAQLTRQVAIVQYPTLSSSTVRHLEVIALTPARLLMVVITDSGRVDQRIVELGDVIDDHELSRLREMLGQALVGKKLSAASVAVADLAEQLRSPDGLGDAVGRSATVLLESLVEHSEE------RLLMGGTANLTRNAADFGGSLRSILEALEEQVVVLRLLAAQQEAGKVT-VRIGHETAAEQMVGTSMVTTAYGTSDTVYGGMGVLGPTRMDY 322
>gi|89210896|ref|ZP_01189279.1| Negative regulator of class I heat shock protein [Halothermothrix orenii H 168] >gi|89159536|gb|EAR79201.1| Negative regulator of class I heat shock protein [Halothermothrix orenii H 168] (347 aa)
Score = 245, Expect = 5.3e-19, Identities = 86/319 (26%), Positives = 172/319 (53%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNF--SKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENN-TEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKE----KVKEYEFVLQELIERIFQIKSKMIKTVH--GQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTL-ITFGDEVSHED-----IVFAQTDLNINEQNKTKLVMVAPTRVDYSKI 322
           I  R++++LK IV++++ TA P+GS+ + + Y   +S+AT+RN+M+ LE +G LE+ +TS+GRVPS  GY++Y  +   ++ Y   E  K+     F     ++  ++    +++S  T+   +  E    +  ++ I ++++++++ +++++T  G +   II    +   K +      F+ +L     +E+ T  +   S I+E    ++K  E +++ + + + ++       VH  G S +L  PEF + E LK++L IL+   I  ++    N    N L +  G E   E+     IV A     I ++   KL ++ PTR+ Y  +
  S:     5 IDDRKRKILKAIVQEHILTAEPIGSRTLAKNYEFGVSSATIRNEMSDLEDMGYLEQPYTSAGRVPSDKGYRYYVDSLMETRDYPEQEIRKMLGEFTFEQ---NVQTIMSNLARMLSRLTRYTAVISEPQLKKSRIREIKLLKVSRKNLLIVLVTDTGIVNNKIISLTKEISSKQLRYLNEFFSRKLQK---RELNTLDEGFLSKIEEELLNRLKMSERIIKLIFDEMLKVAKPAELKVHLGGTSYILEQPEFNNLENLKKVLNILDHEEILGKLL---NSFSDNELKVVIGHENQLEEMHKCSIVIAT--YCIGDKPLGKLGVIGPTRMHYPMV 327
>gi|89895879|ref|YP_519366.1| hypothetical protein DSY3133 [Desulfitobacterium hafniense Y51] >gi|89335327|dbj|BAE84922.1| hypothetical protein [Desulfitobacterium hafniense Y51] (186 aa)
Score = 245, Expect = 5.4e-19, Identities = 56/181 (30%), Positives = 105/181 (58%)
  Q:     3 EITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKI-ENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFN 183
           ++ +R+K++L+ IV+DY++TA PVGS+ +  K+   IS AT+RN+M+ +E+LGL+E+ HTS+GR+PS AGY++Y     +     +++K  +      R   I  VI  S K++SE T L  I I  +  +    ++  +      A+++V+  +G +   I+   ++   +++     +FN
  S:     4 QMDERKKKILRAIVQDYISTAEPVGSRTIARKFDLGISPATIRNEMSDMEELGLIEQPHTSAGRIPSDAGYRYYVDCLLEKSSIADDVKDVIEKETTKRIAEIQTVIAHSSKLLSELTHLTSIVIGPDKGKSAFNQMHFLPYEPGKAIMVVVKENGVVENQIVEIGENVTAEELQRIANVFN 185
>gi|67922506|ref|ZP_00516015.1| Negative regulator of class I heat shock protein [Crocosphaera watsonii WH 8501] >gi|67855677|gb|EAM50927.1| Negative regulator of class I heat shock protein [Crocosphaera watsonii WH 8501] (363 aa)
Score = 244, Expect = 6.5e-19, Identities = 72/257 (28%), Positives = 143/257 (55%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKP-YINDENLKLKLRNVFADRTMSIDVVIEESCKIISE-STKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKD-----------ISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKT---VHGQSSLLAVPEFQDTEKLKEILQILE 260
           + QR +++L+  VE Y+ATA PVGSK ++ +Y  ++S+AT+RN +  LEK G L + HTS+GR+PS  GY+ Y  N   P   + + +K  L      +T + +  ++ + +I++  S  + +I +   +   L+ +  + ++ +  M++V+T D   T++I+     ++++D           ++I     N  L    + E+ + +D  +  I +    Y   L+ L++++       I T   +HG S +L  PEF   ++++ +L +LE
  S:     7 LNQRHQDILRATVEHYIATAEPVGSKTLVTEYDFSVSSATIRNTLGKLEKAGFLYQPHTSAGRIPSDFGYRIYVDNLMIPDQKSAKQIKQNLSQKLKQKTYNFETALQRATQILANLSGYIALITLPQTSPNQLRHLQFIPVSSKQVMLLVVT-DSYQTQSILVDLPATLVRDNEEAQEWLEEELNILSNFLNSELKGKSLLEL-SNLDWQQ--IDQNFVSYADFLKGLLKQLQTYLKTSISTQIMIHGVSEVLRQPEFSQLQQVQMLLHLLE 275
>gi|78187348|ref|YP_375391.1| negative regulator of class I heat shock protein [Pelodictyon luteolum DSM 273] >gi|123582804|sp|Q3B2T3|HRCA_PELLD Heat-inducible transcription repressor hrcA >gi|78167250|gb|ABB24348.1| heat-inducible transcription repressor HrcA [Pelodictyon luteolum DSM 273] (357 aa)
Score = 244, Expect = 7.1e-19, Identities = 86/330 (26%), Positives = 169/330 (51%)
  Q:     2 KEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTM-----SIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKI----------DSMKSIIKEKVKEYEFVLQE--LIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILES----TSIWEQIAFKQN---QTGSNTLITFGDEVS---HEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKN 331
           +E+  R++++L  I++ YV TA PVGS+ +   Y   +S AT+RN MA LE  G + + HTS+GR+P+  GY++Y     K    DE  K ++ + F   +M     S +V++  +  + S S +L ++     +  + +++DMV ++    MV++      +   ++  + +   + +   + + N+RL    + EI   I           ++K +I   V+  + +  E  + ER++         + G   ++  PEF+  E+++E++ ++E       + E IA KQ+     G +  I+ G E S    ED+              T L ++ P R+DY     +L ++ +
  S:     4 RELNLRERQVLGIIIQLYVVTAAPVGSRYIARNYSLGLSDATIRNVMADLEAEGYISQPHTSAGRIPTDLGYRYYVDLIMKVQRIDEEEKRRMESDFGPISMEGRGTSAEVLVSAAKVLGSISRQLSVVLSPTLSNAVFEKLDMVLLSSTRMMVVLSIQSMFVKTIVMELQHELTRQKVDEVVDLLNERLSGLTLSEIRRSITRRLAGSSCDTNLKDLI---VRSADSLFDESPIFERLY---------ISGAEYIVEQPEFKQPERVRELITMIEDKFSVARLVEDIAPKQDLKRTAGHDVSISIGRENSALQAEDLTIVSAPYYAGSMVGT-LGILGPKRMDYEHAVRVLNYMAD 347
>gi|154509294|ref|ZP_02044936.1| hypothetical protein ACTODO_01819 [Actinomyces odontolyticus ATCC 17982] >gi|153798928|gb|EDN81348.1| hypothetical protein ACTODO_01819 [Actinomyces odontolyticus ATCC 17982] (347 aa)
Score = 243, Expect = 7.5e-19, Identities = 85/315 (26%), Positives = 159/315 (50%)
  Q:     7 RQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFS--KPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISEST-KLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFK---DDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQS-SLLAVP----------EFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNI------NEQNKTKLVMVAPTRVDYSK 321
           R+ ++L+ IV  YVAT  PVGSK +    +  +S+AT+RNDMA LE+ GL+ + HTS+GRVP+  GY+ +    +  KP    E   L+    F   ++ ID V+E S +++++ T ++ +++       +LK ++++ +     +V+VIT+DG + +  +      DD  L+++   +R   D               + ++ + E          EL+  +  I S +   + GQS S + V           +F D   +  +L  LE   +  ++ F +   G++  ++ G E  H+ +  A            +      L +V P R+DY++
  S:     9 RRLDVLRAIVTQYVATREPVGSKAIAAGGL-GVSSATIRNDMAVLEEAGLIYQPHTSAGRVPTDRGYRVFVDRLAELKPMSGPERHALE---TFLAESIDIDDVVERSVRLLAQVTHQVALVQYPGARVRVLKHLEVITLAPGRVLVVVITADGEVGERSLTLHAPLDDGQLREVREHLRHHCD----------GATSATAQACVDEATASAR---PELVGTVAAIGSALTDVLSGQSESKIVVAGAANLARGALDFHD---IAPVLDALEEQVVLMRL-FAEADPGADVHVSIGAENPHDGLAEAAVVTGTYRAGAGDSVGSAHLGIVGPMRMDYAR 325
>gi|194334389|ref|YP_002016249.1| heat-inducible transcription repressor HrcA [Prosthecochloris aestuarii DSM 271] >gi|194312207|gb|ACF46602.1| heat-inducible transcription repressor HrcA [Prosthecochloris aestuarii DSM 271] (355 aa)
Score = 243, Expect = 9.0e-19, Identities = 84/331 (25%), Positives = 170/331 (51%)
  Q:     3 EITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFY-EKNFSKPYINDE---NLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKI-------DSMKSIIKEKVKEYEFVLQE--LIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQI------AFKQNQTGSNTLITFGDE--VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEF 333
           ++T R++E+L  I++ YV +A+PV S+ + + Y   +S AT+RN MA LE  G + + HTS+GRVP+  GY++Y +       I+D+   ++   LR    DR  S +V+   +  + S S +L ++     +  + +R+DMV ++    MVI+      +   ++    D   + I + + + N RL    + EI T I       D+ + ++   V+  + +  E  +++R++         + G   +++ PEF   +K+++++ ++E  +   +I         Q  T  +  IT G E   S E      T          +L ++ P R+DY+++  ++ ++ +  
  S:     5 DLTPREREVLGIIIQAYVVSASPVSSRFIAKNYNLGLSDATIRNVMADLEDAGFISQPHTSAGRVPTDKGYRYYVDLIMMVQGIDDDEKRHIDSNLRLFTIDRKDSSEVLFAAAKVLGSISQQLSVVMSPRLSLGVFERLDMVLLSSSRIMVILSIQSLFVKTIVMELDLDVSRRQIEMVVDLLNQRLSGLTLDEIRTSIAERLADCDTDQGLLNRIVRSADELFDESPVLDRLY---------IAGAEYIVSQPEFDQPQKVRDLICMIEDKTRIARIVDLDGVVVPQVMTERDVSITIGRENPASTEGDFTVVTTPYFVGNTMGRLAVLGPKRMDYARVVRVVNYMADRL 347
>gi|29832112|ref|NP_826746.1| heat-inducible transcription repressor [Streptomyces avermitilis MA-4680] >gi|46576511|sp|Q82BY5|HRCA_STRAW Heat-inducible transcription repressor hrcA >gi|29609230|dbj|BAC73281.1| putative HrcA-family heat-inducible transcriptional repressor protein [Streptomyces avermitilis MA-4680] (338 aa)
Score = 242, Expect = 9.4e-19, Identities = 60/218 (27%), Positives = 119/218 (54%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFS--KPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTK-LPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEF-----VLQELIE 221
           +++R+ E+L+ IV+DYV T  PVGSK + E++   +S ATVRNDMA LE  G + + HTS+GR+P+  GY+ +    +  KP    E  +  ++N F D  + +D V+  + +++++ T+ + +++  + T   ++ ++++ +     M+++IT  G + +                       R+IDCP     T +  +++ +  +V    F     ++Q+L E
  S:     2 LSERRLEVLRAIVQDYVGTEEPVGSKALTERHNLGVSPATVRNDMAALEDEGYIAQPHTSAGRIPTDRGYRLFVDKLAGVKPMTGPE--RRAIQN-FLDGAVDLDDVVGRTVRLLAQLTRQVAVVQYPSLTRSTVRHVELLSLAPARVMLVLITDTGRVEQ-----------------------RMIDCPAPFGETSLADLRARLNSRVAGRRFADVPQLVQDLSE 201
>gi|115377647|ref|ZP_01464842.1| heat-inducible transcription repressor HrcA [Stigmatella aurantiaca DW4/3-1] >gi|115365356|gb|EAU64396.1| heat-inducible transcription repressor HrcA [Stigmatella aurantiaca DW4/3-1] (345 aa)
Score = 242, Expect = 1.1e-18, Identities = 79/327 (24%), Positives = 166/327 (50%)
  Q:     2 KEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKN---FSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEV-LLKRIDMVEINKQSAMVIVITSDGNLTKNIIH----FKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQI----------KSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHE---DIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEF 328
           +EI  R+KE+L+ +V++Y+ T  PVGS  +  K   ++S+AT+RN +A LE+LG LEK HTS+GRVP+  GY+FY        +P   D     +  +    +  ++  ++ E+ +++   T+   + I    +  +  RI+ V + +   + +++ + G +   +I        D +LK         ++ L + P++E   +       I++++ + + +   L  +  ++          +S+ ++ + G +S L  PEF D E+++ + ++L+      Q+   + Q      I  G E       ++    +     EQ    + ++ PTR++Y ++  L+ F
  S:     3 EEIGDREKEVLRAVVQEYITTGGPVGSHQLSRKSGFDVSSATLRNVLADLEELGFLEKPHTSAGRVPTDQGYRFYVDTLVRLKEPAPRDR----EFIHAGLGQEKNVGEMLSEASRVLHSLTRHASVVITPRPDASVFHRIEFVRLREDRVLAVLVGNGGQVQNKVITVDFPITSDELLK----ASNFLSELLREVPLEEARER-------IRQEMDQEQALYNVLTSKALKLGAAATDLQTPESERVR-IEGTNSFLEQPEFADVERMRALFKMLDEKHKLLQL-LDRVQRAREMQIFIGAESEFSAAGELTVIASPYGSREQVLGSVGVIGPTRMNYQRVIPLVNF 333
>gi|159039367|ref|YP_001538620.1| heat-inducible transcription repressor [Salinispora arenicola CNS-205] >gi|157918202|gb|ABV99629.1| heat-inducible transcription repressor HrcA [Salinispora arenicola CNS-205] (340 aa)
Score = 242, Expect = 1.1e-18, Identities = 65/220 (29%), Positives = 123/220 (55%)
  Q:     3 EITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFS--KPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTK-LPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHF-----KDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQE-LIER 222
           ++  R+  +L+ IVEDYVAT  PVGSKV++E++   +S ATVRNDMA LE+ G + + HTS+GRVP+  GY+ +    S  KP    E   ++    F    + +D V+  + +++++ T+ + +++  +     ++ +++V I+    M+++I   G + + ++        DD I     +  ++   RL D P   +   +D + + ++  +     VL E L+ER
  S:     2 DLDDRKLAVLRAIVEDYVATQEPVGSKVLVERHQLGVSPATVRNDMAVLEEEGYIRQPHTSAGRVPTDRGYRLFVDRLSRVKPLTPAERRAIER---FLVGAVDLDDVVHRTVRLLAQLTRQVAVVQYPSLARSSVRHLELVPISTTRLMLVMIVDTGRVEQRLVELPGPIPPDDVIDLRQLVNEKLVGTRLADTP-PLVQALVDEVTAELRPAMATLSTVLLETLVER 226
>gi|49474879|ref|YP_032920.1| heat-inducible transcription repressor [Bartonella henselae str. Houston-1] >gi|61213428|sp|Q6G564|HRCA_BARHE Heat-inducible transcription repressor hrcA >gi|49237684|emb|CAF26871.1| Heat-inducible transcription repressor hrcA [Bartonella henselae str. Houston-1] (356 aa)
Score = 242, Expect = 1.1e-18, Identities = 80/328 (24%), Positives = 164/328 (50%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSK----PYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQI------KSKMIKTVHGQSSLLA-VPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDE-----VSHEDIVFAQTDLNINEQNKT--KLVMVAPTRVDYSKIKGLLEF 328
           +K + +R +++ ++IVE Y+    PVGS+ +       +S AT+RN M+ LE LGL+   H S+GR+P+ +G +F+   F +    P    EN++ +++   A    S++  + ++ +++S+ ++   + +    E  LK I+ V ++ + A+ +++T  G +   I+H  +      ++      N  +    + E   +I  + S   E     + +   L+E    +        K+   V G+S+LL  V   +D ++L+ +   LE+     Q+       GS   I  G E     +S   +V A      + Q K    L ++ PTR++Y++I  ++++
  S:    10 LKYLDERSRDIFRHIVEAYLNDGGPVGSRNLSRLLRQTLSPATIRNVMSDLEHLGLIYAPHVSAGRMPTQSGLRFFVDAFMEAGDLPNEERENIEAQVKE--AGHAQSVEHFLVQASQVLSDLSRGAGLVLATKHEGTLKHIEFVRLDGEHALAVLVTQQGGVENRIVHLPEGVTHAQLTEATNFLNAHIQGLTLSEAKEEIARLCS---ETRAALDHLSHHLVETGLALWGGEGADHKIRLIVRGRSNLLEDVKAEEDLKRLRHLFDDLETRESMAQL-LDLTDEGSGVRIFIGSENKLFSLSGSSLVVAPYR---DSQQKVIGALGVIGPTRLNYARIVPMVDY 346
>gi|119960974|ref|YP_947976.1| heat-inducible transcription repressor [Arthrobacter aurescens TC1] >gi|119947833|gb|ABM06744.1| heat-inducible transcription repressor HrcA [Arthrobacter aurescens TC1] (361 aa)
Score = 242, Expect = 1.1e-18, Identities = 50/163 (30%), Positives = 99/163 (60%)
  Q:     7 RQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFS--KPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISEST-KLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDD 169
           R+ E+L+ IVEDYV +  PVGSK ++E++   +S+AT+RNDMA LE+ GL+   HTS+GR+P+  GY+ +    S  KP    E   +   +   +    +D ++E + +++S+ T ++ +++  ++   L++ ++ V +  +  +V++I   G++ + +I    D
  S:    31 RKLEVLRAIVEDYVHSREPVGSKALVERHHLGVSSATIRNDMAVLEEEGLIAAPHTSAGRIPTDKGYRLFVDRISQVKPLSAAERRAI---HSLLEGPDEVDDILERTVRLLSQLTNQVAVVQYPHSNRALVRHVEFVLLGPKQVLVVLIADTGSVGQKVIDAGSD 193
>gi|118463562|ref|YP_881241.1| heat-inducible transcription repressor [Mycobacterium avium 104] >gi|166220392|sp|A0QEA3|HRCA_MYCA1 Heat-inducible transcription repressor hrcA >gi|118164849|gb|ABK65746.1| heat-inducible transcription repressor HrcA [Mycobacterium avium 104] (343 aa)
Score = 241, Expect = 1.3e-18, Identities = 77/319 (24%), Positives = 161/319 (50%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFS--KPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTK-LPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLI-------DCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIV---FAQTDLNINEQNKTKLVMVAPTRVDY 319
           M    +R+ E+L+ IV D++AT  P+GSK ++E++   +S+ATVRNDMA LE  G + + HTSSGRVP+  GY+ +       KP    E  +  ++N F +  + +D V+  + +++++ T+ + +++    +   ++ ++++ +     +++VIT  G + + I+   D     ++S    +    L+          + ++A ++ S   +     +    +L+ L+E   +      + + G ++ L          L+ IL+ LE   +  ++   Q + G  T +  G E + E +V      T    ++     + ++ PTR+DY
  S:     1 MGSADERRFEVLRAIVADFIATKEPIGSKTLVERHNLGVSSATVRNDMAVLEAEGYITQPHTSSGRVPTEKGYREFVDRLDDVKPLSAAE--RRAIQN-FLESGVDLDDVLRRAVRLLAQLTRQVAIVQYPTLSSSTVRHLEVIALTPARLLMVVITDSGRVDQRIVELGDVIDDHELSRLREMLGQALVGKKLSAASVAVADLAEQLRSPDGLGDAVGRSATVLLESLVEHSEE------RLLMGGTANLTRNAADFGGSLRSILEALEEQVVVLRLLAAQQEAGKVT-VRIGYETAAEQMVGTSMVTTAYGTSDTVYGGMGVLGPTRMDY 322
>gi|120404795|ref|YP_954624.1| heat-inducible transcription repressor [Mycobacterium vanbaalenii PYR-1] >gi|166220399|sp|A1TBR8|HRCA_MYCVP Heat-inducible transcription repressor hrcA >gi|119957613|gb|ABM14618.1| heat-inducible transcription repressor HrcA [Mycobacterium vanbaalenii PYR-1] (343 aa)
Score = 241, Expect = 1.4e-18, Identities = 53/168 (31%), Positives = 97/168 (57%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFS--KPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTK-LPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKD 168
           M     R+ E+L+ IV D+VAT  P+GSK ++E++   +S+ATVRNDMA LE  G + + HTSSGRVP+  GY+ +       KP    E   +     F +  + +D V+  + +++++ T+ + +++    T   ++R+++V +     +++VIT  G + + I+   D
  S:     1 MGSADDRRFEVLRAIVADFVATKEPIGSKAIVERHNLGVSSATVRNDMAVLEAEGYITQPHTSSGRVPTEKGYREFVDRLQDVKPMSGAERRAILQ---FLESGVDLDDVLRRAVRLLAQLTRQVAVVQYPTLTTSTVRRLEVVALTPARLLLVVITDTGRVDQRIVELGD 168
>gi|50955094|ref|YP_062382.1| heat-inducible transcription repressor [Leifsonia xyli subsp. xyli str. CTCB07] >gi|61213399|sp|Q6AEB9|HRCA_LEIXX Heat-inducible transcription repressor hrcA >gi|50951576|gb|AAT89277.1| transcriptional regulator, HrcA family [Leifsonia xyli subsp. xyli str. CTCB07] (339 aa)
Score = 241, Expect = 1.4e-18, Identities = 48/173 (27%), Positives = 106/173 (61%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNF--SKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISEST-KLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDIS 176
           +++R  ++L+ IV+DYV++  PVGSK ++E++   +SAAT+RNDMA LE+  L+   HTSSGR+P+  GY+ +  +   ++P    +   ++   +   +++ +D V+  + +++S+ T +  +++  + +   ++ I++V +  +  + ++IT  G + + +I   D+    DI+
  S:     2 VSERSLDVLRAIVQDYVSSCEPVGSKSIVERHSFGVSAATIRNDMALLEEEELIAAPHTSSGRIPTDKGYRLFVDHLAEARPLSPAQRTAIE---ILLGQSVDLDDVLSRTVRLLSQLTNQTAIVQYPSLSRSRIRHIELVSLAPRRLLSVLITDSGAVEQRVIELTDELAEADIA 174
>gi|121638253|ref|YP_978477.1| heat-inducible transcription repressor [Mycobacterium bovis BCG str. Pasteur 1173P2] >gi|166220393|sp|A1KL64|HRCA_MYCBP Heat-inducible transcription repressor hrcA >gi|121493901|emb|CAL72376.1| Probable heat-inducible transcriptional repressor hrcA [Mycobacterium bovis BCG str. Pasteur 1173P2] (343 aa)
Score = 241, Expect = 1.5e-18, Identities = 77/319 (24%), Positives = 156/319 (48%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFS--KPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTK-LPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRL-------IDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIV---FAQTDLNINEQNKTKLVMVAPTRVDY 319
           M    +R+ E+L+ IV D+VAT  P+GSK ++E++   +S+ATVRNDMA LE  G + + HTSSGRVP+  GY+ +       KP  + E   ++    F +  + +D V+  + +++++ T+ + +++    +   ++ ++++ +     +++VIT  G + + I+   D      ++    I    L           + ++A+++     +     +    +L+ L+E   +      + + G ++ L          L+ IL+ LE   +  ++   Q + G  T +  G E + E +V      T           + +V PTR+DY
  S:     1 MGSADERRFEVLRAIVADFVATQEPIGSKSLVERHNLGVSSATVRNDMAVLEAEGYITQPHTSSGRVPTEKGYREFVDQLEDVKPLSSAERRAIQ---SFLESGVDLDDVLRRAVRLLAQLTRQVAVVQYPTLSTSTVRHLEVIALTPARLLMVVITDSGRVDQRIVELGDVIDDHQLAQLREILGQALEGKKLSAASVAVADLASQLGGAGGLGDAVGRAATVLLESLVEHTEE------RLLLGGTANLTRNAADFGGSLRSILEALEEQVVVLRLLAAQQEAGKVT-VRIGHETASEQMVGTSMVSTAYGTAHTVYGGMGVVGPTRMDY 322
>gi|15838933|ref|NP_299621.1| heat-inducible transcription repressor [Xylella fastidiosa 9a5c] >gi|9107513|gb|AAF85141.1|AE004044_12 heat-inducible transcriptional repressor [Xylella fastidiosa 9a5c] (367 aa)
Score = 241, Expect = 1.5e-18, Identities = 81/326 (24%), Positives = 157/326 (48%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTK-LPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIK-------TVHGQSSLLAVPEFQDTEKLKEILQILEST-SIWEQIAFKQNQTGSNTLITFGDE---VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFI 329
           +  R ++LL+ ++  Y+    PVGSK + ++   +IS AT+RN +A LE+LGLL   HTS+GRVP+  GY+ +  +  +     E+   +LR   A        ++  + +I+S  T  + ++      + + + ID V ++ +  M I+I +D  +   +I  +      ++       N   I   + +I T +       K++       +++L+     + S+M+         V GQ+ L+A+ +  D ++L+E+ +I  S   I + +    N  G    I  G+E   VS EDI         + Q    L ++ P R+ Y ++  L++ +
  S:    27 LDSRSRQLLRTLISCYIQNGEPVGSKTLAQQAGLDISPATIRNILADLEELGLLNSPHTSAGRVPTAHGYRMFVDSLVQMQPPSEDDIRRLRVEMAGG--GTQALLGNASEILSAMTHFVGVVSAPRREQFVFRHIDFVPLDARQIMAILIFADNEVQNRVIEPRRVYEPGELERVSNYLNAHFIGRTLADIRTTVLCELRKAKDE-------MEQLLAHSLDLASQMLVPNDSEDIVVTGQTRLMALQDLSDMDRLRELFEIFASKREILQLLERTINAPGVRIFI--GEETGMVSMEDISLVTAPYAAHGQVLGVLGVIGPKRMAYDRVIPLVQVV 353
>gi|15609511|ref|NP_216890.1| heat-inducible transcription repressor [Mycobacterium tuberculosis H37Rv] >gi|15841886|ref|NP_336923.1| heat-inducible transcription repressor [Mycobacterium tuberculosis CDC1551] >gi|31793551|ref|NP_856044.1| heat-inducible transcription repressor [Mycobacterium bovis AF2122/97] >gi|148662206|ref|YP_001283729.1| heat-inducible transcription repressor [Mycobacterium tuberculosis H37Ra] >gi|167968748|ref|ZP_02551025.1| heat-inducible transcription repressor [Mycobacterium tuberculosis H37Ra] >gi|194544565|ref|YP_002079594.1| heat shock protein transcriptional repressor hrcA [Mycobacterium tuberculosis C] >gi|166220397|sp|A5U567|HRCA_MYCTA Heat-inducible transcription repressor hrcA >gi|54037316|sp|P64399|HRCA_MYCBO Heat-inducible transcription repressor hrcA >gi|54041371|sp|P64398|HRCA_MYCTU Heat-inducible transcription repressor hrcA >gi|2078025|emb|CAB08478.1| PROBABLE HEAT SHOCK PROTEIN TRANSCRIPTIONAL REPRESSOR HRCA [Mycobacterium tuberculosis H37Rv] >gi|13882153|gb|AAK46737.1| heat shock gene transcriptional repressor HrcA [Mycobacterium tuberculosis CDC1551] >gi|31619144|emb|CAD97256.1| PROBABLE HEAT-INDUCIBLE TRANSCRIPTIONAL REPRESSOR HRCA [Mycobacterium bovis AF2122/97] >gi|124601572|gb|EAY60582.1| heat shock protein transcriptional repressor hrcA [Mycobacterium tuberculosis C] >gi|134150664|gb|EBA42709.1| heat shock protein transcriptional repressor hrcA [Mycobacterium tuberculosis str. Haarlem] >gi|148506358|gb|ABQ74167.1| heat-inducible transcription repressor [Mycobacterium tuberculosis H37Ra] (343 aa)
Score = 241, Expect = 1.5e-18, Identities = 77/319 (24%), Positives = 156/319 (48%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFS--KPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTK-LPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRL-------IDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIV---FAQTDLNINEQNKTKLVMVAPTRVDY 319
           M    +R+ E+L+ IV D+VAT  P+GSK ++E++   +S+ATVRNDMA LE  G + + HTSSGRVP+  GY+ +       KP  + E   ++    F +  + +D V+  + +++++ T+ + +++    +   ++ ++++ +     +++VIT  G + + I+   D      ++    I    L           + ++A+++     +     +    +L+ L+E   +      + + G ++ L          L+ IL+ LE   +  ++   Q + G  T +  G E + E +V      T           + +V PTR+DY
  S:     1 MGSADERRFEVLRAIVADFVATQEPIGSKSLVERHNLGVSSATVRNDMAVLEAEGYITQPHTSSGRVPTEKGYREFVDRLEDVKPLSSAERRAIQ---SFLESGVDLDDVLRRAVRLLAQLTRQVAVVQYPTLSTSTVRHLEVIALTPARLLMVVITDSGRVDQRIVELGDVIDDHQLAQLREILGQALEGKKLSAASVAVADLASQLGGAGGLGDAVGRAATVLLESLVEHTEE------RLLLGGTANLTRNAADFGGSLRSILEALEEQVVVLRLLAAQQEAGKVT-VRIGHETASEQMVGTSMVSTAYGTAHTVYGGMGVVGPTRMDY 322
>gi|71276147|ref|ZP_00652427.1| Negative regulator of class I heat shock protein [Xylella fastidiosa Dixon] >gi|71900372|ref|ZP_00682506.1| Negative regulator of class I heat shock protein [Xylella fastidiosa Ann-1] >gi|170730626|ref|YP_001776059.1| heat-inducible transcriptional repressor [Xylella fastidiosa M12] >gi|24212659|sp|Q9PB03|HRCA_XYLFA Heat-inducible transcription repressor hrcA >gi|71163065|gb|EAO12787.1| Negative regulator of class I heat shock protein [Xylella fastidiosa Dixon] >gi|71729875|gb|EAO31972.1| Negative regulator of class I heat shock protein [Xylella fastidiosa Ann-1] >gi|167965419|gb|ACA12429.1| heat-inducible transcriptional repressor [Xylella fastidiosa M12] (349 aa)
Score = 241, Expect = 1.5e-18, Identities = 81/326 (24%), Positives = 157/326 (48%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTK-LPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIK-------TVHGQSSLLAVPEFQDTEKLKEILQILEST-SIWEQIAFKQNQTGSNTLITFGDE---VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFI 329
           +  R ++LL+ ++  Y+    PVGSK + ++   +IS AT+RN +A LE+LGLL   HTS+GRVP+  GY+ +  +  +     E+   +LR   A        ++  + +I+S  T  + ++      + + + ID V ++ +  M I+I +D  +   +I  +      ++       N   I   + +I T +       K++       +++L+     + S+M+         V GQ+ L+A+ +  D ++L+E+ +I  S   I + +    N  G    I  G+E   VS EDI         + Q    L ++ P R+ Y ++  L++ +
  S:     9 LDSRSRQLLRTLISCYIQNGEPVGSKTLAQQAGLDISPATIRNILADLEELGLLNSPHTSAGRVPTAHGYRMFVDSLVQMQPPSEDDIRRLRVEMAGG--GTQALLGNASEILSAMTHFVGVVSAPRREQFVFRHIDFVPLDARQIMAILIFADNEVQNRVIEPRRVYEPGELERVSNYLNAHFIGRTLADIRTTVLCELRKAKDE-------MEQLLAHSLDLASQMLVPNDSEDIVVTGQTRLMALQDLSDMDRLRELFEIFASKREILQLLERTINAPGVRIFI--GEETGMVSMEDISLVTAPYAAHGQVLGVLGVIGPKRMAYDRVIPLVQVV 335
>gi|167404452|ref|ZP_02309247.1| heat-inducible transcription repressor [Listeria monocytogenes FSL J2-003] (174 aa)
Score = 240, Expect = 1.7e-18, Identities = 59/172 (34%), Positives = 102/172 (59%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVI-EKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKI-ENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDI 175
           +T+RQ  + + I++ +  T  PVGSK ++ EK +P  S+AT+RN+M  LE+ G +EK H+SSGRVPS  GY+FY     +P   D++ +  +R+ F++    ++ +I+ S  ++S+ T    I +    T+  L     V IN   AM+I+IT  G++  +++   + + L DI
  S:     2 LTERQLLIFRAIIDHFTWTIQPVGSKNLLKEKGLP-YSSATIRNEMGVLEEYGFIEKTHSSSGRVPSEKGYRFYVDYLLQPKKLDKSDRQMIRSFFSENYYEMEGLIQNSALMLSDLTNYTSILLGPEATKNHLSGFRFVPINNFQAMLILITDQGHVDNHLVTIPEGTTLSDI 174
>gi|116670783|ref|YP_831716.1| heat-inducible transcription repressor [Arthrobacter sp. FB24] >gi|166219849|sp|A0JX46|HRCA_ARTS2 Heat-inducible transcription repressor hrcA >gi|116610892|gb|ABK03616.1| heat-inducible transcription repressor HrcA [Arthrobacter sp. FB24] (337 aa)
Score = 240, Expect = 1.8e-18, Identities = 49/158 (31%), Positives = 97/158 (61%)
  Q:     7 RQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFS--KPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISEST-KLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNII 164
           R+ E+L+ IVEDYV +  PVGSK ++E++   +S+AT+RNDMA LE  GL+   HTS+GR+P+  GY+ +    S  KP    E   ++      + +  +D V+E + +++S+ T ++ +++  + +  +++ I+ V +  +  ++++I   G + + +I
  S:     5 RKLEVLRAIVEDYVHSREPVGSKALVERHHLGVSSATIRNDMAALEDEGLITAPHTSAGRIPTDKGYRLFVDQISAVKPLSQAERRAIQ---TLLEGSEDLDDVLERTVRLLSQLTNQVAVVQYPHLSRAMVRHIEFVLLAPRQVLIVLIADTGKVEQRVI 162
>gi|71898352|ref|ZP_00680525.1| Negative regulator of class I heat shock protein [Xylella fastidiosa Ann-1] >gi|71731875|gb|EAO33933.1| Negative regulator of class I heat shock protein [Xylella fastidiosa Ann-1] (349 aa)
Score = 240, Expect = 1.8e-18, Identities = 79/326 (24%), Positives = 156/326 (47%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTK-LPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIK-------TVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDE---VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFI 329
           +  R ++LL+ ++  Y+    P+GSK + ++   +IS AT+RN +A LE+LGLL   HTS+GRVP+  GY+ +  +  +     E+   +LR   A        ++  + +I+S  T  + ++      + + + ID V ++ +  M I+I +D  +   +I  +      ++       N   I   + +I T +       KE+       +++L+     + S+M+         V GQ+ L+A+ +  D ++L+E+ +I  S     Q+  ++        I  G+E   VS EDI         + Q    L ++ P R+ Y ++  L++ +
  S:     9 LDSRSRQLLRTLISCYIQNGEPIGSKTLAQQAGLDISPATIRNILADLEELGLLNSPHTSAGRVPTAHGYRMFVDSLVQMQPPSEDDIRRLRVEMAGG--GTQTLLGSASEILSAMTHFVGVVSAPRREQFVFRHIDFVPLDARQIMAILIFADNEVQNRVIEPRRVYEPGELERVSNYLNAHFIGRTLADIRTTVLCELRKAKEE-------MEQLLAHSLDLASQMLVPNDSEDIVVTGQTRLMALQDLSDMDRLRELFEIFASKREILQL-LERTIDAPGVRIFIGEETGMVSMEDISLVTAPYAAHGQVLGVLGVIGPKRMAYDRVIPLVQVV 335
>gi|37521840|ref|NP_925217.1| heat-inducible transcription repressor [Gloeobacter violaceus PCC 7421] >gi|46576423|sp|Q7NIB2|HRCA_GLOVI Heat-inducible transcription repressor hrcA >gi|35212839|dbj|BAC90212.1| gll2271 [Gloeobacter violaceus PCC 7421] (360 aa)
Score = 240, Expect = 1.8e-18, Identities = 68/257 (26%), Positives = 138/257 (53%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFY-EKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISE-STKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEI-ATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILE 260
           +  R K++L   V+ Y+ TA PVGSK++ ++Y   +S+AT+RN MA LE  GLL + HTS+GR+PS +GY+ Y ++  S P    + ++  L     +R   ++ +++ + ++++  S  + +I    +  V ++ + +V I +  A+VIV+T        ++      + + +       N +L +  + ++ A  +++M         ++   L  L++R+ Q  +  +  V G   +L  PEF + E+++ I+Q+LE
  S:    14 LNPRFKQILHATVKSYIDTAEPVGSKMLTQQYNFGLSSATIRNAMAVLESWGLLFQPHTSAGRIPSDSGYRVYVDELISPPTELIQQMRAALAENLGER-QDLESLLQGATRLLATLSGCVALITAPQSVFVSVRHLQIVHIGEGRALVIVVTDALQTRSFLLDLPQPEMAEQLETLNNFLNLQLQNRRLDDLNAAAVEAMGGEF-HWYTDFLRGLIALLQRVLQPPTGQL-YVSGVGEILKQPEFAEPERIQAIVQLLE 270
>gi|148823576|ref|YP_001288330.1| heat-inducible transcription repressor [Mycobacterium tuberculosis F11] >gi|148722103|gb|ABR06728.1| heat shock protein transcriptional repressor hrcA [Mycobacterium tuberculosis F11] (343 aa)
Score = 239, Expect = 2.2e-18, Identities = 77/319 (24%), Positives = 156/319 (48%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFS--KPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTK-LPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRL-------IDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIV---FAQTDLNINEQNKTKLVMVAPTRVDY 319
           M    +R+ E+L+ IV D+VAT  P+GSK ++E++   +S+ATVRNDMA LE  G + + HTSSGRVP+  GY+ +       KP  + E   ++    F +  + +D V+  + +++++ T+ + +++    +   ++ ++++ +     +++VIT  G + + I+   D      ++    I    L           + ++A+++     +     +    +L+ L+E   +      + + G ++ L          L+ IL+ LE   +  ++   Q + G  T +  G E + E +V      T           + +V PTR+DY
  S:     1 MGSADERRFEVLRAIVADFVATQEPIGSKSLVERHNLGVSSATVRNDMAVLEAEGYITQPHTSSGRVPTEKGYREFVDRLEDVKPLSSAERRAIQ---SFLESGVDLDDVLRRAVRLLAQLTRQVAVVQYPTLSTSTVRHLEVIALTPARLLMMVITDSGRVDQRIVELGDVIDDHQLAQLREILGQALEGKKLSAASVAVADLASQLGGAGGLGDAVGRAATVLLESLVEHTEE------RLLLGGTANLTRNAADFGGSLRSILEALEEQVVVLRLLAAQQEAGKVT-VRIGHETASEQMVGTSMVSTAYGTAHTVYGGMGVVGPTRMDY 322
>gi|94970271|ref|YP_592319.1| heat-inducible transcription repressor HrcA [Acidobacteria bacterium Ellin345] >gi|94552321|gb|ABF42245.1| heat-inducible transcription repressor HrcA [Acidobacteria bacterium Ellin345] (347 aa)
Score = 239, Expect = 2.5e-18, Identities = 79/335 (23%), Positives = 162/335 (48%)
  Q:     3 EITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFS---------KPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQ---IKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIA---FKQNQTGSNTLITFGDEVSH-EDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEKGW 337
           +I +R++E+L  IVE Y++T  PVGS+ +       +SAAT+RN MA L   GLL++ HTS+GRVP+ A Y++Y K  +         +  I D    +     F +RT  +         ++S++  + +  I    +  L+ +    + +   + +V+  +G +   I+    D    ++    R  N+      ++EI  ++D  + + +E+  EY+ ++   +E +++   ++S+  + V+ + +   V +  D ++L+E+L+ LE       +        Q     ++   D + H  + V       +  +    L ++ PTR+DY      + +I   F+  W
  S:     6 QIGRREREILTAIVETYISTGEPVGSRTLSRGSREGLSAATIRNVMADLSDAGLLDQPHTSAGRVPTAAAYRYYVKGLTGEASLAPAEEGLIKDTFHGVNDMQEFMERTSHV-------LSLLSQNVGVAVAGI--GPKNALEHVHFQRLAESKVLCVVVNKNGIVRDRIMRLGKDIPQLELDAAARFLNENYRGWIMEEI--RVDLARRLDQER-SEYDRLMHS-VEELYKKGALESETTQDVYIEGTSNLVVDDHDRDRLRELLKTLEEKQRLVNLLSAYVDVRQEAVRVVVGLEDTLPHLSNFVLIGAPARVGNEVMGSLAVIGPTRIDYEHTISAVSYIARLFDHIW 343
>gi|167747090|ref|ZP_02419217.1| hypothetical protein ANACAC_01802 [Anaerostipes caccae DSM 14662] >gi|167654050|gb|EDR98179.1| hypothetical protein ANACAC_01802 [Anaerostipes caccae DSM 14662] (352 aa)
Score = 239, Expect = 2.5e-18, Identities = 88/336 (26%), Positives = 166/336 (49%)
  Q:     3 EITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLP-MIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRI-FNDRLIDCPIKEIATK-IDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSN--TLITFGDEV---SHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEKGWK 338
           ++  R++ +LK I+ +Y+ T  PVGS+ + +    N+S+AT+RN+MA LE LG + + HTS+GR+PS  GY+FY     +   +DE  +L+L      +   ++V++++   +++ ST    M+         LK + + ++++ S ++ VI +DGN+ KN I   +  +  D  + + +  N  L    +KEI  + I +MK       +  E +L+E+   I       I T  G S++L  PE    E   E+L  L       ++     ++  +    +  GDE    +  D         + E     + ++ P R+DY ++   L+ + +E    +K
  S:    12 DLNDRKRLILKAIIANYLETGEPVGSRTISKMEGLNLSSATIRNEMADLEDLGFILQPHTSAGRIPSDLGYRFYVDQLMQDRESDEEERLEL----VKKVDKMEVMLKQVANVLASSTNYATMVSAPQYKNTKLKFVQLSQVDEYS-LLAVIVADGNVVKNQIIDVEKPLANDEVLKLNVLLNSFLQGLTLKEINLELIQTMKDQAGIHSQILEKILEEIAVVIHNADQLEIYT-GGASNILKYPELGSPETATELLDALVEKKALNKLVGDTLESDDHHGIQVYIGDEAPVKNMRDCSIVTATYELEEGGTGTIGIIGPKRMDYKRVVKTLQNLTDEINDLFK 349
>gi|86607207|ref|YP_475970.1| heat-inducible transcription repressor [Synechococcus sp. JA-3-3Ab] >gi|123724535|sp|Q2JRN9|HRCA_SYNJA Heat-inducible transcription repressor hrcA >gi|86555749|gb|ABD00707.1| heat-inducible transcription repressor HrcA [Synechococcus sp. JA-3-3Ab] (392 aa)
Score = 238, Expect = 2.7e-18, Identities = 72/261 (27%), Positives = 137/261 (52%)
  Q:     3 EITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNF---------------SKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISE-STKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKD--DSILKDISICIRIFNDRL-IDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQ--IKSKMIKTVH-GQSSLLAVPEFQDTEKLKEILQILESTS 263
           E+T RQ+++L   V  Y+ATA PVGSK + + Y   +S AT+RND+A LE++GLL + HTS+GR+PS  GY+ Y  +                 +P+   + L  +L     D    +D  ++   ++++  S  + +I       V +  + ++ +     MV+V+T        ++   D  D   +D+   +++ ++ L +    K  A   D     + E+ + Y   LQ+L+  + Q  ++  + +    G + L+  PEF   ++++ + Q+LE  S
  S:     4 ELTPRQRKILWATVRRYIATAEPVGSKTLAQSYNLGVSTATIRNDLATLEQVGLLFQPHTSAGRIPSDFGYRVYVNDLLSSANMDGIPNDAPQPEPHPALQQLLDQLNRELGD---DLDSFLQRVAQLLAHLSGCIALITPPQGPVVAVHHVQLLSVGPGRVMVLVVTDSYQTHSALVSPPDWPDDRREDLEDELQLLSNFLTLKLRGKTFAELQDLSWLKLDEEFRAYSHWLQQLLRSVVQRYLRPSLGQVFSAGMTELMRQPEFSQAQRMQAVAQLLEEGS 283
>gi|21221014|ref|NP_626793.1| heat-inducible transcription repressor [Streptomyces coelicolor A3(2)] >gi|10720041|sp|Q9RDD6|HRCA_STRCO Heat-inducible transcription repressor hrcA >gi|6714769|emb|CAB66233.1| heat-inducible transcriptional repressor HrcA. [Streptomyces coelicolor A3(2)] (338 aa)
Score = 238, Expect = 3.3e-18, Identities = 80/321 (24%), Positives = 160/321 (49%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFS--KPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTK-LPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEF-----VLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKL-------------------KEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDI---VFAQTDLNINEQNKTKLVMVAPTRVDYSKIKG 324
           +++R+ ++L+ IV+DYV T  PVGSK + E++   +S ATVRNDMA LE  G + + HTS+GR+P+  GY+ +    +  KP    E  +  ++N F +  + +D V+  + +++++ T+ + +++  + T   ++ ++++ +     M+++IT  G + +                       R++DCP       +  +++ +  +V    F     ++++L E         + TV   S+LL     ++ E+L                   + +L+ LE   +  ++  +    G    I  G E +HE +              +   KL +V PTR+DY    G
  S:     2 LSERRLKVLRAIVQDYVGTEEPVGSKALTERHNLGVSPATVRNDMAALEDEGFIAQPHTSAGRIPTDKGYRLFVDKLAGVKPMTAPE--RRAIQN-FLEGAVDLDDVVARTVRLLAQLTRQVAVVQYPSLTRSTVRHVELLSLAPARLMLVLITDTGRVEQ-----------------------RMVDCPAPFGEASLADLRARLNSRVAGRRFADVPALVEDLAEPFEAEDRGTVSTV--LSTLLETLVEENEERLMIGGTANLTRFGHDFPLVIRPVLEALEEQVVLLKLLGEAKDPGVTVRI--GHENAHEGLNSTSVVSVGYGSGGEAVAKLGVVGPTRMDYPGTMG 322
>gi|118618900|ref|YP_907232.1| heat-inducible transcription repressor [Mycobacterium ulcerans Agy99] >gi|166220398|sp|A0PTU2|HRCA_MYCUA Heat-inducible transcription repressor hrcA >gi|118571010|gb|ABL05761.1| heat shock protein transcriptional repressor HrcA [Mycobacterium ulcerans Agy99] (343 aa)
Score = 238, Expect = 3.4e-18, Identities = 78/319 (24%), Positives = 154/319 (48%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFS--KPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTK-LPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRL-------IDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIV---FAQTDLNINEQNKTKLVMVAPTRVDY 319
           M    +R+ E+L+ IV D+VAT  P+GSK ++E++   +S+AT+RNDMA LE  G + + HTSSGRVP+  GY+ +       KP    E   ++    F +  + +D V+  + +++++ T+ + +++    +   ++ ++++ +     +V+VIT  G + + I+   D      +S    +    L           + + A ++     +     +    +L+ L+E   +      + + G ++ L          L+ IL+ LE   +  ++   Q + G  T +  G E   E IV      T    N+     + ++ PTR+DY
  S:     1 MGTADERRFEVLRAIVADFVATHEPIGSKSLVERHNLGVSSATIRNDMAVLEAEGYIAQPHTSSGRVPTEKGYREFVDRLDDVKPLSMVERRAIQ---GFLESGVDLDDVLRRAVRLLAQLTRQVAVVQYPTLSTSKVRHLEVIALTPARLLVVVITDSGRVDQRIVELGDVIDDHQLSQLRELLGQALEGKKLAAASVAVADFAGQLSGAGGLGDAVGRSATVLLESLVEHTEE------RLLMGGTANLTRNAADFGGSLRSILEALEEQIVVLRLLAAQQEAGKVT-VRIGHETEAEQIVGTSMVSTAYGSNDTVYGGMGVLGPTRMDY 322
>gi|166363555|ref|YP_001655828.1| heat-inducible transcription repressor [Microcystis aeruginosa NIES-843] >gi|166085928|dbj|BAG00636.1| heat-inducible transcription repressor [Microcystis aeruginosa NIES-843] (358 aa)
Score = 238, Expect = 3.5e-18, Identities = 69/258 (26%), Positives = 139/258 (53%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYIND---ENLKLKLRNVFADRTMSIDVVIEESCKIISE-STKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHF-------KDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERI---FQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILES 261
           ++ R + +LK  ++ Y+ATA PVGSK ++E+Y   +S+AT+RN +  LEK GLL + HTSSGR+PS  GY+ Y      P  +D   E +   L         S++ +++ + ++++  S  + ++ + +     L+ + +V ++ +  M+I++T        +I         K D + +++ I      ++L    + ++   +D  +  I+ +   Y   LQ+L + I    Q  +     VHG + ++  PEF   ++++ +L +LE+
  S:     7 LSDRYQHILKATIQHYIATAEPVGSKTLLEEYKFTVSSATIRNALGKLEKEGLLYQPHTSSGRIPSDWGYRLYVDELMTP--DDRIGEKIGYYLHQNAKSPAWSLESLLQRATQLLAGLSGYIAIVTLPHTLTNTLRHLQLVPVSDRQIMLIIVTDSLQTRSVMIEIPESMATDKKDGLAEELQILSNFLGEKLKGYCLADL-INLDWQQ--IEREFTRYTHFLQQLSQEIGASLQSTATPEIIVHGVAEVIRQPEFAQWQQVQMLLHLLEA 273
>gi|152967350|ref|YP_001363134.1| heat-inducible transcription repressor HrcA [Kineococcus radiotolerans SRS30216] >gi|189028265|sp|A6WDI1|HRCA_KINRD Heat-inducible transcription repressor hrcA >gi|151361867|gb|ABS04870.1| heat-inducible transcription repressor HrcA [Kineococcus radiotolerans SRS30216] (346 aa)
Score = 237, Expect = 3.7e-18, Identities = 45/161 (27%), Positives = 100/161 (62%)
  Q:     7 RQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFS--KPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTK-LPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFK 167
           R+  +L+ IVEDYV++  PVGSK ++E++   +S AT+RNDMA LE+ G + + HTS+GR+P+  GY+ +    +  KP    E   ++    F +    +D +++ + +++++ T+   +++  + +   ++ +++V +  +SA++++IT  G + + ++  +
  S:     5 RRLAVLRAIVEDYVSSHEPVGSKALVERHQLGVSPATIRNDMAVLEEEGYITQPHTSAGRIPTDKGYRLFVDRLANVKPMSPAEKRAIQ---TFLEGADDVDDIVDRTVRLLAQITRQAAVVQYPSLSRAAVRHVELVPVGGRSALLVLITDSGRVEQRVLDVR 165
>gi|111018257|ref|YP_701229.1| heat-inducible transcription repressor [Rhodococcus sp. RHA1] >gi|123046593|sp|Q0SHB5|HRCA_RHOSR Heat-inducible transcription repressor hrcA >gi|110817787|gb|ABG93071.1| heat-inducible transcription repressor HrcA [Rhodococcus sp. RHA1] (347 aa)
Score = 237, Expect = 4.0e-18, Identities = 52/168 (30%), Positives = 97/168 (57%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFS--KPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTK-LPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKD 168
           M     R+ E+L+ IV DYV+T  PVGSK ++E++   +S+ATVRNDMAFLE  G + + HTSSGRVP+  GY+ +    +  KP    E   +     F +  + +D V+    +++++ T+ + +++    +   ++ +++V +     ++++IT  G + + I+   D
  S:     1 MSSTDDRRFEVLRAIVADYVSTQEPVGSKALVERHNLGVSSATVRNDMAFLESEGYIAQPHTSSGRVPTDKGYRQFVDRIADVKPLSTAERRAIL---EFLESGVDLDDVLRRGVRLLAQLTRQVAVVQYPTLSASSVRHLEVVALTPARLLLVLITDSGRVDQRIVELGD 168
>gi|53803853|ref|YP_114295.1| heat-inducible transcription repressor HrcA [Methylococcus capsulatus str. Bath] >gi|61213337|sp|Q607A3|HRCA_METCA Heat-inducible transcription repressor hrcA >gi|53757614|gb|AAU91905.1| heat-inducible transcription repressor HrcA [Methylococcus capsulatus str. Bath] (350 aa)
Score = 237, Expect = 4.0e-18, Identities = 84/325 (25%), Positives = 167/325 (51%)
  Q:     3 EITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFY------EKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLP-MIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKS-IIKEKVKEYEFVLQ--ELIERIFQI--KSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTL----------ITFGDEVSH---EDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLE 327
           E+++R ++LLK +VE Y+    PVGS+V+       +S AT+RN MA LE+LGL+   HTS+GR+P+ +GY+ +       K   +  ++   L L+ R    D       ++E + K++SE T +  +I +     ++ + I+ + ++    + I++TSD  +   IIH        ++      FN     C  K++ +  + +++ + KE+ +  E +LQ  E+ E+      +S+    V G+++L+   E  D ++L+ + +           AF+Q ++    L          I  G+E      E         +++ +    L ++ PTR+ Y ++  L++
  S:     6 ELSERAQQLLKALVERYIGEGQPVGSRVLARD--AGLSPATIRNVMADLEELGLITSPHTSAGRLPTVSGYRLFVDSLLTVKPLHQAIVDQLWLDLESRENPRD-------LLETASKLLSELTHMACIISMPRRETLVFQHIEFLPLSDNRVLAILVTSDQEIHNKIIHTPHKFSAAELQTAANFFNAV---CGGKDMVSAREHLRAELAKERDRLSEQLLQAGEIAEQALAEGGRSRKPFLVRGETNLMDFVELADVDRLRGLFE-----------AFRQKESIVGLLDRCLESPGVKIIIGEESGFRPLEPCSLVTASYSVDNRVMGVLGVIGPTRMKYERVIPLVD 332
>gi|144897369|emb|CAM74233.1| Heat-inducible transcription repressor [Magnetospirillum gryphiswaldense MSR-1] (353 aa)
Score = 237, Expect = 4.4e-18, Identities = 81/328 (24%), Positives = 160/328 (48%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSK--PYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQ----------IKSKMIKTVHGQSSLL-AVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNI--------NEQNKTKLVMVAPTRVDYSKIKGLLEF 328
           + E+  R +E+ + IVE YV T  P+GS+ +  +    +S AT+RN MA LE  GLL   HTS+GR+P+ AG + +     +      DE   +  R     ++M  + V+ E+   +S  ++   + +    +  LK+ID V + +  A+V+++T DG +   ++    +     +       NDRL           +D ++  ++ ++      L EL  R+ +           KS +I  V GQS LL  V   +D E ++ + + LE++  + ++    N      +      +  E+ +F  T  ++         EQ    + ++ P R+++++I  ++++
  S:    11 ITELNTRSREIFRQIVEAYVHTGEPIGSRTLSRRLGVALSPATIRNVMADLEDAGLLYARHTSAGRLPTQAGMRLFVNGLLEVGGLPEDERSAIDTRCQAMGKSM--EQVLAEAIGALSGLSRCAGMVVAPKIQRALKQIDFVWLGQGRALVVLVTQDGMVENRLLDLPPEVQPSALVEAANFLNDRL-------AGRTLDDVREQVQTELDLQRHQLDELTTRVVEAGLATWSGDGAKSSLI--VRGQSHLLDDVTAVEDLESIRGLFEALETSEQFLRLLDLANMAEGVQIF-----IGSENELFGVTGCSMIVAPYRDAREQIVGAIGVIGPQRLNFARIIPMVDY 343
>gi|145223288|ref|YP_001133966.1| heat-inducible transcription repressor [Mycobacterium gilvum PYR-GCK] >gi|189028266|sp|A4T2C4|HRCA_MYCGI Heat-inducible transcription repressor hrcA >gi|145215774|gb|ABP45178.1| heat-inducible transcription repressor HrcA [Mycobacterium gilvum PYR-GCK] (343 aa)
Score = 236, Expect = 4.6e-18, Identities = 78/319 (24%), Positives = 160/319 (50%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFS--KPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTK-LPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQE---LIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQ---TDLNINEQNKTKLVMVAPTRVDY 319
           M     R+ E+L+ IV D+VAT  P+GSK +++++   +S+ATVRNDMA LE  G + + HTSSGRVP+  GY+ +       KP  + E   +     F +  + +D V+  + +++++ T+ + +++    +   ++R+++V +     ++IVIT  G + + I+   D     +++    +    L   P+   +  +  + S +  + +    V +    L+E + + + +  + + G ++ L          L+ +L+ LE   +  ++  KQ + G  T +  G E   E++  A    T      +    + ++ PTR+DY
  S:     1 MGSAEDRRFEVLRAIVADFVATKEPIGSKTLVDRHNLGVSSATVRNDMAVLEAEGYITQPHTSSGRVPTEKGYREFVDRLDDVKPMSSAERRAIL---SFLESGVDLDDVLRRAVRLLAQLTRQVAVVQYPMLSTSTVRRLEVVALTPARLLLIVITDSGRIDQRIVELGDAIDEDELTQLRDLLGQALEGKPLTTASIAVSDLASHLGGQGRLANAVGRSATVLVESLVEHREE--RLLLGGTANLTRNTADFGGSLRSLLEALEEQVVVLRLLAKQQEAGKVT-VRIGHETEAEEMAGASVVTTAYGSAGKVFGGMGVLGPTRMDY 322
>gi|62426395|ref|ZP_00381523.1| COG1420: Transcriptional regulator of heat shock gene [Brevibacterium linens BL2] (369 aa)
Score = 236, Expect = 5.5e-18, Identities = 83/313 (26%), Positives = 162/313 (51%)
  Q:     7 RQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFS--KPYINDENLKLKLRNVFA--DRTMSIDVVIEESCKIISEST-KLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNII---HFKDDSILKDISICIRI-FNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEF-----VLQELIERIFQIKSKMI---------KTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQ-----NKTKLVMVAPTRVDY 319
           R+ ++L+ IVED+VAT  PVGSK +++++   +S AT+RNDMA LE+ G + + HTS+GR+P+  GY+ +       KP    E      R +F   D    +D +++ + +++S  T ++ +I+    +   +K I++V +     +V++IT  G + + ++      DD  L+ I   +   F+ + +    K ++T   S    + +  +         V  EL   + Q+++ +          + +   ++ LA    +  EK+  IL+  E   +  ++     +      +  G E +HE   F+ T L   E      +  +L ++ PTR+DY
  S:    18 RRAQVLRAIVEDFVATNEPVGSKAIVQRHTLGVSPATIRNDMAHLEQEGYIAQPHTSAGRIPTDLGYRMFVDRIDDFKPLTQAER-----RAIFQLIDGNGDLDDMLDRTVRVLSGLTHQVALIQYPTVSRATIKHIEVVGLGPNRILVVLITDAGQVEQKVVITPGVIDDESLRGIRDEVNTEFSGQKLS---KVMSTVTPSTTGAVADGTETEPLGGANSVGAELAAALTQVRATVTDLVIATREERIIMAGTANLARSGREFGEKMAPILEAFEEQVVLLKLLTSMAEDQEEISVRIGRENTHES--FSSTSLVAAEYGHDAGSSARLAVLGPTRMDY 348
>gi|159029837|emb|CAO90891.1| hrcA [Microcystis aeruginosa PCC 7806] (358 aa)
Score = 236, Expect = 6.0e-18, Identities = 69/258 (26%), Positives = 140/258 (54%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYIND---ENLKLKLRNVFADRTMSIDVVIEESCKIISE-STKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHF-------KDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERI-FQIKSKMIK--TVHGQSSLLAVPEFQDTEKLKEILQILES 261
           ++ R + +LK  ++ Y+ATA PVGSK ++E+Y   +S+AT+RN +  LEK GLL + HTSSGR+PS  GY+ Y      P  +D   E +   L         S++ +++ + + ++  S  + ++ + +     L+ + ++ ++ +  M+I++T        +I         K+D + +++ I      ++L    + ++   I+     I+ +   Y   LQ+L + I   ++S  I    VHG + ++  PEF   ++++ +L +LE+
  S:     7 LSDRYQHILKATIQHYIATAEPVGSKTLLEEYKFTVSSATIRNALGKLEKEGLLYQPHTSSGRIPSDWGYRLYVDELMTP--DDRIGEKIGYYLHQNAKSPAWSLESLLQRATQFLAGLSGYIAIVTLPHTLTNTLRHLQLIPVSAKQIMLIIVTDSLQTRSVMIEIPESMATDKEDGLAEELQILSNFLGEKLKGYCLADL---INLDWQQIEREFTRYTHFLQQLSQEISASLQSTAIPEIIVHGVAEVIRQPEFAQWQQVQMLLHLLEA 273
>gi|158334322|ref|YP_001515494.1| heat-inducible transcription repressor [Acaryochloris marina MBIC11017] >gi|189028254|sp|B0C2W4|HRCA_ACAM1 Heat-inducible transcription repressor hrcA >gi|158304563|gb|ABW26180.1| heat-inducible transcription repressor HrcA [Acaryochloris marina MBIC11017] (367 aa)
Score = 235, Expect = 6.6e-18, Identities = 85/323 (26%), Positives = 167/323 (51%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYIN-DENLKLKLRNVFADRTMSIDVVIEESCKIISE-STKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNII---------HFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKT--VHGQSSLLAVPEFQDTEKLKEILQILESTS-----IWEQIAFKQNQTGSNTL-------ITFGDEVSHEDI---VFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLL 326
           +T RQ+++L+  V+ Y+ATA PVGSK +  +Y  +IS AT+RN M  LE+ GLL + HTS+GRVPS  GY+ Y      P       +K  L       +   +V++ ++ +I++  S  + +I +       ++ + +V++     M+I++T D   T++++             D I +++ I     N   +   ++++   +D  + + +E  K  +F+   L +   Q KS   K   V G + +L  PEF + ++ + ++ +LE        ++ ++   + + G++ +       +  G E S E I       +     E     + ++ PTR+ Y K+  L+
  S:     5 LTNRQQQVLRATVDHYIATAEPVGSKALAREYALSISPATIRNVMGRLEEEGLLFQPHTSAGRVPSDFGYRHYVDELVMPSTTLMSQIKQALDQKLRTDSWIFEVLLRDAAQILATLSGCVALITLPQAATSTIRHLHLVQVEPHRVMLILVT-DAYETQSVMMELPHSAWDEVDPDRIEQELQILSNFLNHHFVGSSLQDLVA-LDPCE-LDREFQKYTDFLKILLTDLTQQCKSLSPKNILVGGLAEVLRQPEFSELQQAQTLIHLLEDGQDLLRPLFNELMADEIKQGADVVPRSTKVNVRIGSENSLESIQAYSLVSSTYQKGELPMGSVGVLGPTRMAYEKVIALV 352
>gi|23501083|ref|NP_697210.1| heat-inducible transcription repressor [Brucella suis 1330] >gi|62289148|ref|YP_220941.1| heat-inducible transcription repressor [Brucella abortus bv. 1 str. 9-941] >gi|82699087|ref|YP_413661.1| heat-inducible transcription repressor [Brucella melitensis biovar Abortus 2308] >gi|23346952|gb|AAN29125.1| heat-inducible transcription repressor HrcA [Brucella suis 1330] >gi|62195280|gb|AAX73580.1| HrcA, heat-inducible transcription repressor [Brucella abortus biovar 1 str. 9-941] >gi|82615188|emb|CAJ10127.1| Negative regulator of class I heat shock protein [Brucella melitensis biovar Abortus 2308] (374 aa)
Score = 235, Expect = 7.8e-18, Identities = 80/328 (24%), Positives = 170/328 (51%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSK----PYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKS--------KMIKTVHGQSSLLA-VPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDE-----VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEF 328
           +  + QR +++ + IVE Y+   +PVGS+ +       +S AT+RN M+ LE LGL+   H S+GR+P+  G +F+   F +    P     +++ ++R   A  + S++ V+ E+ +++S  ++   + + N T+V LK I+ V +    A+ +++  +G++   +I          +       N  +    + E  ++   ++ + +E  +E + + QEL+ +   + S        ++I  V G+++LL  V   +D E+L+ +   LE+     Q+     + GS   I  G E     +S   +V A    +  ++    L ++ PTR++Y++I  ++++
  S:    28 LSSLDQRSRDIFRLIVETYLNDGDPVGSRNLSRLLPHTLSPATIRNVMSDLEHLGLIYAPHISAGRLPTQIGLRFFVDAFLEVGDLPPEERSSIEAQVRA--AGTSNSVESVLTEASQVLSGLSRGAGLVLTNKTDVALKHIEFVRLEPMRALAVLVMQNGDVENRVIDLPAGISTSQLIEASNFLNAHIHGHTLSEAKSE---LRKLSEETRRELDQLSQELVAKGLAVWSGAGADQPARLI--VRGRANLLENVHAQEDIERLRHLFDDLETKDGMVQL-LDLAEAGSGVRIFIGSENKLFSLSGSSLVVAPYR-DSEQRVIGALGVIGPTRLNYARIVPMVDY 364
>gi|17988059|ref|NP_540693.1| heat-inducible transcription repressor [Brucella melitensis 16M] >gi|17983808|gb|AAL52957.1| HEAT-INDUCIBLE TRANSCRIPTION REPRESSOR HRCA [Brucella melitensis 16M] (374 aa)
Score = 234, Expect = 8.1e-18, Identities = 80/328 (24%), Positives = 170/328 (51%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSK----PYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKS--------KMIKTVHGQSSLLA-VPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDE-----VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEF 328
           +  + QR +++ + IVE Y+   +PVGS+ +       +S AT+RN M+ LE LGL+   H S+GR+P+  G +F+   F +    P     +++ ++R   A  + S++ V+ E+ +++S  ++   + + N T+V LK I+ V +    A+ +++  +G++   +I          +       N  +    + E  ++   ++ + +E  +E + + QEL+ +   + S        ++I  V G+++LL  V   +D E+L+ +   LE+     Q+     + GS   I  G E     +S   +V A    +  ++    L ++ PTR++Y++I  ++++
  S:    28 LSSLDQRSRDIFRLIVETYLNDGDPVGSRNLSRLLPHTLSPATIRNVMSDLEHLGLIYAPHISAGRLPTQIGLRFFVDAFLEVGDLPPEERSSIEAQVRA--AGTSNSVESVLTEASQVLSGLSRGAGLVLTNKTDVALKHIEFVRLEPMRALAVLVMQNGDVENRVIDLPAGISTSQLIEASNFLNAHIHGHTLSEAKSE---LRKLSEETRRELDQLSQELVAKGLAVWSGAGADQPARLI--VRGRANLLENVHAQEDIERLRHLFDDLETKDGMVQL-LDLAEAGSGVRIFIGSENKLFSLSGSSLVVAPYR-DSEQRVIGALGVIGPTRLNYARIVPMVDY 364
>gi|28199256|ref|NP_779570.1| heat-inducible transcription repressor [Xylella fastidiosa Temecula1] >gi|182681982|ref|YP_001830142.1| heat-inducible transcription repressor HrcA [Xylella fastidiosa M23] >gi|32129616|sp|Q87BS6|HRCA_XYLFT Heat-inducible transcription repressor hrcA >gi|28057362|gb|AAO29219.1| heat-inducible transcriptional repressor [Xylella fastidiosa Temecula1] >gi|182632092|gb|ACB92868.1| heat-inducible transcription repressor HrcA [Xylella fastidiosa M23] (349 aa)
Score = 234, Expect = 8.3e-18, Identities = 77/326 (23%), Positives = 157/326 (48%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNF--SKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTK-LPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIK-------TVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDE---VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFI 329
           +  R ++LL+ ++  Y+    P+GSK + ++   +IS AT+RN +A LE+LGLL   HTS+GRVP+  GY+ +  +    +P   D+  +L++             ++  + +I+S  T  + ++      + + + ID V ++ +  M I+I +D  +   +I  +      ++       N   I   + +I T +       K++       +++L+     + S+M+         V GQ+ L+A+ +  D ++L+E+ +I  S     Q+  ++        I  G+E   VS EDI         + Q    L ++ P R+ Y ++  L++ +
  S:     9 LDSRSRQLLRTLISCYIQNGEPIGSKTLAQQAGLDISPATIRNILADLEELGLLNSPHTSAGRVPTAHGYRMFVDSLVQMQPPSEDDIRRLRVEMTGG----GTQTLLGSASEILSAMTHFVGVVSAPRREQFVFRHIDFVPLDARQIMAILIFADNEVQNRVIEPRRVYEPGELERVSNYLNAHFIGRTLADIRTTVLCELRKAKDE-------MEQLLAHSLDLASQMLVPNDSEDIVVTGQTRLMALQDLSDMDRLRELFEIFASKREILQL-LERTIDAPGVRIFIGEETGMVSMEDISLVTAPYAAHGQVLGVLGVIGPKRMAYDRVIPLVQVV 335
>gi|75907883|ref|YP_322179.1| heat-inducible transcription repressor [Anabaena variabilis ATCC 29413] >gi|123609940|sp|Q3MCK2|HRCA_ANAVT Heat-inducible transcription repressor hrcA >gi|75701608|gb|ABA21284.1| heat-inducible transcription repressor HrcA [Anabaena variabilis ATCC 29413] (365 aa)
Score = 234, Expect = 9.2e-18, Identities = 76/254 (29%), Positives = 137/254 (53%)
  Q:     3 EITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYIND--------ENLKLKLRNVFADRTMSIDVVIEESCKII-SESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHF---------KDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEY-EFV---LQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEIL 256
           ++T RQ+ +L   V  Y+ATA PVGSK ++E+Y   +S+AT+RN M  LEK GLL + HTS+GRVPS +GY+ Y      P + D        + ++  L+        S++++++ + +I+ S S  + +I +       ++ + +V+I     M+I++T        ++             + I +++ I     N  L    + EI+T +D   S +  + + Y EF+   + EL  R     +  I  V G + +L  PEF   +++K I+
  S:     4 QLTNRQQHILWATVRHYIATAEPVGSKALVEEYDLGVSSATIRNVMGVLEKSGLLYQPHTSAGRVPSDSGYRIYVDQLITPSLRDTTRTEVLAKEVESALQQHLQWEDWSLEILLQGAAQILASLSGCISLITMPQTNTASVRHLQLVQIETGRIMLILVTDSYETHSKLMDLPPARSETKPDPEVIDRELQIVSNFLNSHLRGRSLLEIST-LDW--SQLDREFQSYGEFLKNSVAELAHRSAAPAATQI-MVRGLAEVLRQPEFSQLQQVKTII 275
>gi|78485213|ref|YP_391138.1| negative regulator of class I heat shock protein [Thiomicrospira crunogena XCL-2] >gi|78363499|gb|ABB41464.1| heat-inducible transcription repressor HrcA [Thiomicrospira crunogena XCL-2] (342 aa)
Score = 234, Expect = 9.3e-18, Identities = 82/319 (25%), Positives = 163/319 (51%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKL-PMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQ-----IKSKMIKT----VHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITF-----GDEVSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKI 322
           +  R + L K+++  Y+    PVGS V+ +    ++S+ATVRN M+ LEK+GL+   HTS+GRVP+  G++ +  +       + +LK +++  F  +  + + ++  +  I+S  T +  ++ + N  + +L+ ID V++N +  +V+++ +D ++   II F++D     +       N+      + E+       K ++ E++ E    +  L+  I +     I+ KM K+    V G+++LL   E  D EKLK +    E  S  + +        +N +  F     G+E ++++     T      +    L +V P+R+ Y KI
  S:     3 LNDRSQLLFKHLMALYLNDGKPVGSSVLAKLPDVSVSSATVRNVMSDLEKMGLIHSPHTSAGRVPTDHGFRVFVDSILTVQPLNSSLKREIQQGFT-QAQTQEELLGSASNILSGLTGMASLVMLPNQEQEMLRHIDFVKLNNKRVLVVLVLNDQDVQNRIIEFEEDVSSSQLIQAANYLNEHFAGRYLSEV-------KKMLVERLDELRKTMDALMLSIVEATDQVIEQKMQKSAPYFVSGKTNLLNYDELADAEKLKALFHSFEEHS--DMLGLLNKSMQANGVQVFIGSECGNE-TYQNCSVITTPYEREGEVMGVLGVVGPSRMPYDKI 325
>gi|54023392|ref|YP_117634.1| heat-inducible transcription repressor [Nocardia farcinica IFM 10152] >gi|61213315|sp|Q5YZX1|HRCA_NOCFA Heat-inducible transcription repressor hrcA >gi|54014900|dbj|BAD56270.1| putative transcriptional repressor [Nocardia farcinica IFM 10152] (347 aa)
Score = 234, Expect = 9.9e-18, Identities = 80/313 (25%), Positives = 160/313 (51%)
  Q:     7 RQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFS--KPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTK-LPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTV--HGQSSLLA---------VPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQ---TDLNINEQNKTKLVMVAPTRVDY 319
           R+ E+L+ IV DYVAT  P+GSK ++E++   +S+ATVRNDMA LE  G + + HTSSGR+P+  GY+ +    S  KP    E   +     F +  + +D V+    +++++ T+ + +++    +   ++ I++V +N    +++VIT  G + + I+         D+S  +R      +D            + +      +  E   Q+L + + ++ + +++T+  H +  L+            +F     L+++L+ LE   +  ++     Q G+ T +  G+E   E++  A    T   ++      + ++ PTR+DY
  S:    11 RRFEVLRAIVADYVATKEPIGSKTLVERHNLGVSSATVRNDMAVLEAEGYITQPHTSSGRIPTDKGYRQFVDRISEVKPLSAAERRAILQ---FLESGVDLDDVLRRGVRLLAQLTRQVAVVQYPTVSASTVRHIEVVALNPARLLLVVITDTGRVDQRIVELGAVVDDDDLS-ALRALLGAAMDG---------KRLAAASAAVAELPESAPQQLRDVLIRVSTVLVETLVEHPEERLVLGGTANLTRNAADFGLPGSLRQVLEALEEQVVVLKLLAAAQQPGTVT-VRIGEETQVEEMRSASVVTTGYGVSGSVLGGMGVLGPTRMDY 326
>gi|154482573|ref|ZP_02025021.1| hypothetical protein EUBVEN_00240 [Eubacterium ventriosum ATCC 27560] >gi|149736598|gb|EDM52484.1| hypothetical protein EUBVEN_00240 [Eubacterium ventriosum ATCC 27560] (348 aa)
Score = 233, Expect = 1.1e-17, Identities = 79/336 (23%), Positives = 170/336 (50%)
  Q:     3 EITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYIND----ENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLP-MIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRI-FNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQ---IKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTS-IWEQIAFKQNQTGSNTLITFGDEV-SHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEKGWK 338
           E+ +R++++L  ++ +Y+ T  PVGS+ + +    N+S+AT+RN+M+ LE+LG + + HTS+GR+P+  GY+FY  N  K  + +    E    +  ++   +   ++ +++   K+++ +T    M+         +K + +  + ++S +  V++   ++   I+    D + ++I + + +  N  L    I+EI   +    + +  +  E+E V+ E+++ I +    + +M     G +++   PE  D E+  ++L  LE  S + E I     +TG    I     V S +D         + +  K  + ++ P R+DY K+   L  +K +    +K
  S:     2 ELNERKEKILDAVIRNYLETGEPVGSRTISKYTDLNLSSATIRNEMSDLEELGYIVQPHTSAGRIPTDKGYRFYVDNILKDRMAELDEREKKVTEKEDLLIQKVDKVETLLQNMAKMLATNTNYATMVSTPKAQTNRIKFVQLSVLEEKSLLCTVVSDKNHVVNKIVKVSKD-VNQEIVVRLNVALNTVLAGLSIEEINLGV---MTTLASQAGEFESVVSEVLKAITEAIATEEQMKIYTSGATNIFKYPELSDKERASQLLTTLEEKSQLTELINEGDEETGIQVYIGSESPVQSMKDCSVVTATYELEDGFKGTIGIIGPKRMDYEKVVDALRNVKEQLSDTFK 344
>gi|158313943|ref|YP_001506451.1| heat-inducible transcription repressor [Frankia sp. EAN1pec] >gi|158109348|gb|ABW11545.1| heat-inducible transcription repressor HrcA [Frankia sp. EAN1pec] (339 aa)
Score = 233, Expect = 1.1e-17, Identities = 69/277 (24%), Positives = 154/277 (55%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFS--KPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTK-LPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFK---DDSILKDISICIR--IFNDRLIDCPIKEIATKI-DSMKSIIKEKVKEY-EFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTL 280
           + +R+ E+L+ IVED+V +  PVGSK + E++   +S ATVRNDM+ LE+ G + + HTS+GR+P+  GY+ +    S  KP    E   ++    F +  + +D V+  S +++++ T+ + +++  + +   ++ I++V +N    ++++IT  G + + ++      DD ++ ++   +   +   R++D    E+A  + ++++  ++  +      VL+ L+ER    + + +      +   +  +F D+  L+ IL+ LE   +  ++     +TG+ T+
  S:     2 LEERRLEVLRAIVEDFVLSNEPVGSKTLAERHALGVSPATVRNDMSALEEEGYITQPHTSAGRIPTDKGYRLFVDRLSGVKPLSRAERRAIQ---SFLEGAVDLDDVVRRSVRLLAQLTRQVAVVQYPSLSSSSVRHIEIVTLNPNRLLLVLITDTGRVEQRVVDIPTPVDDGVVGELRGLLNGSLRGRRVVDA--TEVAADLPETVRPDLRPHLTTLTTVVLEALLER----QEERVALAGTANLTRSSVDFADS--LRFILEALEEQVVLLKLIGSARETGTVTV 277
>gi|118472363|ref|YP_888777.1| heat-inducible transcription repressor [Mycobacterium smegmatis str. MC2 155] >gi|166220394|sp|A0R0T9|HRCA_MYCS2 Heat-inducible transcription repressor hrcA >gi|118173650|gb|ABK74546.1| heat-inducible transcription repressor HrcA [Mycobacterium smegmatis str. MC2 155] (343 aa)
Score = 233, Expect = 1.2e-17, Identities = 79/319 (24%), Positives = 158/319 (49%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFS--KPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTK-LPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIK------EKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFA---QTDLNINEQNKTKLVMVAPTRVDY 319
           M     R+ E+L+ IV D+VAT  P+GSK ++E++   +S+ATVRNDMA LE  G + + HTSSGRVP+  GY+ +       KP  + E  +  + N F +  + +D V+  + +++++ T+ + +++    +   ++ +++V +     +++VIT  G + + I+   D     ++S    +    +   P+ + +  +  + S +       + V     VL E +     ++    + + G ++ L          L+ +L+ LE   +  ++   Q + G  T +  G E   E +  A    T    + +    + +V PTR+DY
  S:     1 MGSADDRRFEVLRAIVADFVATKEPIGSKTLVERHNLGVSSATVRNDMAVLEAEGYITQPHTSSGRVPTEKGYREFVDRIDNVKPLSSSE--RRAILN-FLESGVDLDDVLRRAVRLLAQLTRQVAIVQYPTLSTSSVRHLEVVALTPARLLLVVITDTGRVDQRIVELGDAIDEHELSKLRDMLGQAMEGKPLAQASIAVSDLASHLNGSDRLGDAVGRAATVLVETL-----VEHTEERLLLGGTANLTRNTADFGGSLRSVLEALEEQVVVLRLLAAQQEAGKVT-VRIGHETEAEQMAGASVVSTAYGSSGKVYGGMGVVGPTRMDY 322
>gi|161618160|ref|YP_001592047.1| heat-inducible transcription repressor [Brucella canis ATCC 23365] >gi|163842441|ref|YP_001626845.1| heat-inducible transcription repressor [Brucella suis ATCC 23445] >gi|189023422|ref|YP_001934190.1| Negative regulator of class I heat shock protein [Brucella abortus S19] >gi|189028258|sp|A9M7B7|HRCA_BRUC2 Heat-inducible transcription repressor hrcA >gi|189028259|sp|B0CJ31|HRCA_BRUSI Heat-inducible transcription repressor hrcA >gi|54037315|sp|P64397|HRCA_BRUSU Heat-inducible transcription repressor hrcA >gi|54041370|sp|P64396|HRCA_BRUME Heat-inducible transcription repressor hrcA >gi|161334971|gb|ABX61276.1| heat-inducible transcription repressor HrcA [Brucella canis ATCC 23365] >gi|163673164|gb|ABY37275.1| heat-inducible transcription repressor HrcA [Brucella suis ATCC 23445] >gi|189018994|gb|ACD71716.1| Negative regulator of class I heat shock protein [Brucella abortus S19] (356 aa)
Score = 233, Expect = 1.3e-17, Identities = 80/328 (24%), Positives = 170/328 (51%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSK----PYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKS--------KMIKTVHGQSSLLA-VPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDE-----VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEF 328
           +  + QR +++ + IVE Y+   +PVGS+ +       +S AT+RN M+ LE LGL+   H S+GR+P+  G +F+   F +    P     +++ ++R   A  + S++ V+ E+ +++S  ++   + + N T+V LK I+ V +    A+ +++  +G++   +I          +       N  +    + E  ++   ++ + +E  +E + + QEL+ +   + S        ++I  V G+++LL  V   +D E+L+ +   LE+     Q+     + GS   I  G E     +S   +V A    +  ++    L ++ PTR++Y++I  ++++
  S:    10 LSSLDQRSRDIFRLIVETYLNDGDPVGSRNLSRLLPHTLSPATIRNVMSDLEHLGLIYAPHISAGRLPTQIGLRFFVDAFLEVGDLPPEERSSIEAQVRA--AGTSNSVESVLTEASQVLSGLSRGAGLVLTNKTDVALKHIEFVRLEPMRALAVLVMQNGDVENRVIDLPAGISTSQLIEASNFLNAHIHGHTLSEAKSE---LRKLSEETRRELDQLSQELVAKGLAVWSGAGADQPARLI--VRGRANLLENVHAQEDIERLRHLFDDLETKDGMVQL-LDLAEAGSGVRIFIGSENKLFSLSGSSLVVAPYR-DSEQRVIGALGVIGPTRLNYARIVPMVDY 346
>gi|50842399|ref|YP_055626.1| heat-inducible transcription repressor [Propionibacterium acnes KPA171202] >gi|61213397|sp|Q6A998|HRCA_PROAC Heat-inducible transcription repressor hrcA >gi|50840001|gb|AAT82668.1| heat-inducible transcription repressor HrcA [Propionibacterium acnes KPA171202] (339 aa)
Score = 233, Expect = 1.3e-17, Identities = 75/316 (23%), Positives = 158/316 (50%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFS--KPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISEST-KLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDS-MKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNIN----EQNKTKLVMVAPTRVDY 319
           +  R+ ++LK IV DYV++  PVGSK ++E++   +S ATVRNDMA LE+ G +   HTS+GR+P+  GY+ +    +  KP    E   ++    F    + +D ++  + +++++ T ++ +++    T   ++ +++V ++    ++++I S G++ + I+           ++  R+ N+ L+   + E A  ++  +  +   +      V+  ++E I  +       V G  +L A     +T  ++ +L+ LE   +  ++   +   G    +T      + D+ F  T L  +    E   + L +V P R+DY
  S:     2 LDDRKLDVLKAIVTDYVSSKEPVGSKALVERHGLRVSPATVRNDMAVLEEEGYITHPHTSAGRIPTDKGYRLFVDRIATLKPLSAPERRAIQ---AFMTGAVDLDDIVRRTVRLLAQITHQVAIMQYPVATTGTIRHLELVSLSTDRILIVLIMSSGSVEQQIVELPGHDEQSLAALRTRL-NETLVGLTVAEAADSLNRFLDDLGPAEGPRAASVIATVLE-ILAVDPSARVVVAGVPNLTAFGAQWET-AVRPVLEALEEQVVLMRL-LGEATAGEAGEVTVRIGAENTDVPFQSTSLVASTYGPEDALSSLGVVGPIRMDY 318
>gi|7387775|sp|O52163|HRCA_STRAL Heat-inducible transcription repressor hrcA >gi|2921168|gb|AAC62528.1| HrcA [Streptomyces albus G] (338 aa)
Score = 232, Expect = 1.5e-17, Identities = 48/161 (29%), Positives = 97/161 (60%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFS--KPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTK-LPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNII 164
           +++R+ E+L+ IV+DYV T  PVGSK + E++   +S ATVRNDMA LE  G + + HTS+G +P+  GY+ +    +  KP    E   +   + F D+ + +D V+  + ++++  T+ + +++  + T   ++ ++++ +     M+++IT  G + + +I
  S:     2 LSERRLEVLRAIVQDYVGTEEPVGSKALTERHRLGVSPATVRNDMAALEDEGYIAQPHTSAGPIPTDKGYRLFVDRLADVKPMTAPERRAI---HHFLDQAVDLDDVVARTVRLLAHVTRQVAVVQYPSLTRSTVRHVELLSMAPARLMLVLITDTGRVEQRMI 162
>gi|145220119|ref|YP_001130828.1| heat-inducible transcription repressor HrcA [Prosthecochloris vibrioformis DSM 265] >gi|189028268|sp|A4SFR7|HRCA_PROVI Heat-inducible transcription repressor hrcA >gi|145206283|gb|ABP37326.1| heat-inducible transcription repressor HrcA [Prosthecochloris vibrioformis DSM 265] (357 aa)
Score = 232, Expect = 1.5e-17, Identities = 83/332 (25%), Positives = 159/332 (47%)
  Q:     2 KEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTM-----SIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKI----------DSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGS-------NTLITFGDEVS---HEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEF 333
           +E++ R++++L  I++ YV TA PVGS+ +   Y   +S AT+RN MA LE  G + + HTS+GR+P+  GY++Y     K    DE+ K ++   +    M     S DV++  +  +   S +L ++     ++ + +R+DMV ++    MVI+      +   ++    +   K I     + N+RL    + EI   I           ++K +I        F    + ER++         + G   ++  PEF+  E+++E++ ++E      ++  K             +  I+ G E S    ED+    T          +L ++ P R+DY     +L ++ +  
  S:     4 RELSLRERQVLGIIIQSYVVTAAPVGSRYIARNYSLGLSDATIRNVMADLEDEGYIHQPHTSAGRIPTDLGYRYYVDLIMKVQRIDEDEKRRMETDYGQIAMEHPGTSRDVLLSAAKVLGCISRQLSVVLSPTLSDAVFERLDMVLLSSTRMMVILSIHSLFVKTIVMELPLEVSRKMIEEVSNVINERLAGLTLSEIRRSIAHRLAGSHGDGALKDLIVRSAGSL-FDESPIFERLY---------ISGTEYIVDQPEFKQPERVRELITMIEDKFSVARLVEKSGHMSEALRPSDMDVTISIGSENSTREAEDLTIVSTPYYAGNM-VGRLGILGPKRMDYEHAVRVLNYMADSL 349
>gi|49473733|ref|YP_031775.1| heat-inducible transcription repressor [Bartonella quintana str. Toulouse] >gi|61213422|sp|Q6G1E5|HRCA_BARQU Heat-inducible transcription repressor hrcA >gi|49239236|emb|CAF25556.1| Heat-inducible transcription repressor hrcA [Bartonella quintana str. Toulouse] (356 aa)
Score = 232, Expect = 1.7e-17, Identities = 79/328 (24%), Positives = 160/328 (48%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKP--YINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQI------KSKMIKTVHGQSSLLA-VPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDE-----VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEF 328
           +K + +R +++ ++IVE Y+    PVGS+ +       +S AT+RN M+ LE LGL+   H S+GR+P+ +G +F+   F +     N+E   ++ +   A    S++  + ++ +I+S+ ++   + + +  E  LK I+ V ++ Q A+ +++T  G +   I+H         ++      N  +    + E   +I  + S   E     + +   L+E    +        K+   V G+S+LL  V   +D E+L+ +   LE+     Q+       G    I  G E     +S   +V A    +  ++    L ++ PTR++Y++I  ++ +
  S:    10 LKYLDERSRDIFRHIVEAYLNDGEPVGSRNLSRLLRQTLSPATIRNVMSDLEHLGLIYAPHVSAGRMPTQSGLRFFVDAFMEAGDLPNEERESIEAQVKEAGHAQSVEHFLVQASQILSDLSRGAGLVLASKYEGTLKHIEFVRLDGQQALAVLVTQQGEVENRIVHLPKGVTHAQLTEATNFLNAHIQGRTLSEAKEEIARLCS---ETRAALDHLSHHLVETGLALWGGEDADHKIHLIVRGRSNLLEDVKAEEDLERLRHLFDDLETRESMAQL-LDLTDEGPGVRIFIGSENKLFSLSGSSLVVAPYR-DSQQRVIGALGVIGPTRLNYARIVPMVNY 346
>gi|73662484|ref|YP_301265.1| heat-inducible transcriptional repressor [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|123642711|sp|Q49Y24|HRCA_STAS1 Heat-inducible transcription repressor hrcA >gi|72494999|dbj|BAE18320.1| Heat-inducible transcriptional repressor [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (326 aa)
Score = 231, Expect = 1.8e-17, Identities = 82/326 (25%), Positives = 161/326 (49%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKL-KLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIE-NNTEVLLKRIDMVEINKQSAMVIVITSDGNLTK----NIIHFKDDSILKDISICIRIFNDRLIDCPIKEIAT--KIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFI 329
           I+ RQ  +L  IVEDYV    P+GSK +IE++  N+S AT+RN+M  LE L L+EK HTSSGR PS +G ++Y     +   + +  K+ +L+++  +    +   + +    +S +++   + +  N+ + ++  I ++  N    +++V+ + G++      + +   +D + K  +     +N+        E+    K D+ K  IK+ +   +         IF         + G+  L+      +   ++ ILQ +ES  I  Q+  + + T  N  I    E S  DI    ++ +I+++ K ++ ++ PT ++Y  +  LL  I
  S:     2 ISDRQLSILNAIVEDYVDLGQPIGSKTLIERHKLNVSPATIRNEMKQLEDLELIEKTHTSSGRYPSESGIRYYVNQLLQETSHQQQTKMQRLKDLVIENHYDLSSTLSDFANELSIASQYTTLVMRPNHKQDIINNIHLIRANAYLVIMVVVFTSGHVEHLHLASEVPLSNDELTKISNFVTAKYNEWNNHRFENELNAFVKSDTEKDFIKDMLNMIDIHFDNQSNGIF---------MGGKVKLIDALNESNVSSIQPILQYIESNKI-TQLLDEMSNTSINVKIGHEIESSLSDISIVTSEYHIDDRLKGQIAVIGPTAMNYQNVIRLLNTI 325
>gi|153007313|ref|YP_001381638.1| heat-inducible transcription repressor HrcA [Anaeromyxobacter sp. Fw109-5] >gi|152030886|gb|ABS28654.1| heat-inducible transcription repressor HrcA [Anaeromyxobacter sp. Fw109-5] (354 aa)
Score = 231, Expect = 1.8e-17, Identities = 72/326 (22%), Positives = 155/326 (47%)
  Q:     3 EITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSK---PYINDENLKLKLRNVFADRTMSIDVVIEESCKII-SESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIK-------TVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDE---VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEF 328
           E+ +R++E+L+ +V+DY+ T  PV S+ ++ ++    S ATVR+ M+ LE LG LEK H SSGR+P+  GY+ Y  +  K   P   D +   +L    +D    +  ++E +  ++ S S    ++         +++++ V + +   + + ++  G +T  ++  +      D+       N+++    +   A  + +++  I + ++  +  L EL+++   +  +           V G+ S L  PEF +  K + +L+         ++   +  T     I  G E    +  D+          +     L +V PTR++Y+++  L++ 
  S:     7 ELDRREREVLRALVQDYIHTGEPVASQPLLARHELECSPATVRSVMSDLEALGFLEKPHASSGRIPTERGYRLYVDSLLKVRPPSPQDRDRIERLAQAASD----VGRLLEGTADLLHSLSHHAGVVTTPRPRVDPVRQVEFVRLRENRVLAVFVSEAGIVTNKLVQLEFPMPAADLERAANYLNEKI--HALSHAAETLGAVREQILQDMRADQSALHELLQKALSLAEQTFDGPGEERVLVDGEESFLDAPEFANVRKARALLRAFAEKDRILRV-LDRVLTSQEVQIFIGAESEFAAVPDVSVVAAPYGRGDHVLGTLAVVGPTRMNYARVIPLVDL 339
>gi|160880445|ref|YP_001559413.1| heat-inducible transcription repressor HrcA [Clostridium phytofermentans ISDg] >gi|189028263|sp|A9KKU2|HRCA_CLOPH Heat-inducible transcription repressor hrcA >gi|160429111|gb|ABX42674.1| heat-inducible transcription repressor HrcA [Clostridium phytofermentans ISDg] (345 aa)
Score = 231, Expect = 2.1e-17, Identities = 80/325 (24%), Positives = 167/325 (51%)
  Q:     3 EITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLP-MIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRI-FNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSK---MIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLIT--FGDEV---SHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLE 327
           ++  R+ ++L+ I+ +Y+ T  PVGS+ + +    N+S+AT+RN+M+ LE+LG + + HTS+GR+PS  GY+ Y     +  + +      +R++  ++   ++ ++++  ++++ +T    M+         +K + + E++    + I++  +GN+ KN I    + + K+  + + I  N  L    + EI     ++   +KE+  E+  V+ ++++ + Q  S+   +     G +++L  PE  D EK  E+L  LE       +   +  +G N  I    G+E    S +D         I E    K+ ++ P R+DY K+   L+
  S:     2 QLDDRKLKILQAIIRNYLETGEPVGSRTISKYTDLNLSSATIRNEMSDLEELGYIIQPHTSAGRIPSDKGYRLYVDTMMEDKVTEVE---NMRDMLLEKADKMETLLQQVARLLAVNTNYATMVTSPQYRSRKVKFLQVSEVDTTQILTIIVL-EGNIVKNKIIAIAEPLDKETLLKLNIVLNTFLQGLDLSEINL---ALIRQMKEQAAEHSSVVSDILDAVAQAISEEDDIQIFTSGATNILKYPELNDMEKASELLYTLEEKKQLTNLMNNEVSSGENRGIQVYIGNETPVDSMKDCAVVTATYQIEEGVYGKIGIIGPKRMDYEKVVSTLQ 329
>gi|167053527|ref|ZP_02279925.1| heat-inducible transcription repressor [Listeria monocytogenes FSL F2-515] (208 aa)
Score = 230, Expect = 2.3e-17, Identities = 55/174 (31%), Positives = 100/174 (57%)
  Q:    40 SAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKI-ENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKID-SMKSIIKEKVKEYE 213
           S+AT+RN+M  LE+ G +EK H+SSGRVPS  GY+FY     +P   D++ +  +R+ F++    ++ +I+ S  ++S+ T    I +    T+  L     V IN   AM+I+IT  G++  +++   + + L DI   + I N+RL+   + ++  +I   +K ++ + V+ YE
  S:     4 SSATIRNEMGVLEEYGFIEKTHSSSGRVPSEKGYRFYVDYLLQPKKLDKSDRQMIRSFFSENYYEMEGLIQNSALMLSDLTNYTSILLGPEATKNHLSGFRFVPINNFQAMLILITDQGHVDNHLVTIPEGTTLSDIERMVNILNERLVGLSLDDLKVQIPMEVKELLGKHVRNYE 179
>gi|16329402|ref|NP_440130.1| heat-inducible transcription repressor [Synechocystis sp. PCC 6803] >gi|3122221|sp|P72795|HRCA_SYNY3 Heat-inducible transcription repressor hrcA >gi|1651883|dbj|BAA16810.1| CIRCE binding repressor [Synechocystis sp. PCC 6803] (378 aa)
Score = 230, Expect = 2.3e-17, Identities = 68/257 (26%), Positives = 134/257 (52%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKN-FSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISE-STKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHF-------KDDSILKDISICIRIFNDRLIDCPIKEIA----TKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILE 260
           +  R +++L+  V+ Y+ATA PVGS  + ++Y   +S+AT+RN +  LEK GLL + H S+GRVPS +GY+ Y  N  +        +K +L N         + +I+   +I++  S  + +I       V L+ + ++ +     ++I++T   +     +         ++  + ++++I     N +L    + E++     ++D   SI  + +K     LQ+ I+ + Q +      VHG S ++  PEF   E+++ +L +LE
  S:     7 LNDRHQQILRATVQHYIATAEPVGSHTLAQEYQFAVSSATIRNALGQLEKAGLLYQPHVSAGRVPSDSGYRIYVDNLLTWSDRQSRTVKQRLENEINGDNWHFEALIQRMGQILAGLSGYIALITFPQTETVQLRHLQLMLLPSHQILIILVTDSYHTHSATLDLPAAMEAKEEGELEQELAIFSNFLNAQLRGKNLSELSHLNWQELDQKFSIYADFLKG----LQQQIKPLLQRRMAGPLVVHGVSKVIQQPEFSQLEQVQMLLSLLE 272
>gi|15924572|ref|NP_372106.1| heat-inducible transcriptional repressor [Staphylococcus aureus subsp. aureus Mu50] >gi|15927162|ref|NP_374695.1| heat-inducible transcriptional repressor [Staphylococcus aureus subsp. aureus N315] >gi|148268066|ref|YP_001247009.1| heat-inducible transcription repressor HrcA [Staphylococcus aureus subsp. aureus JH9] >gi|150394134|ref|YP_001316809.1| heat-inducible transcription repressor HrcA [Staphylococcus aureus subsp. aureus JH1] >gi|156979900|ref|YP_001442159.1| heat-inducible transcriptional repressor [Staphylococcus aureus subsp. aureus Mu3] >gi|166220404|sp|A7X2Y4|HRCA_STAA1 Heat-inducible transcription repressor hrcA >gi|189028271|sp|A6U254|HRCA_STAA2 Heat-inducible transcription repressor hrcA >gi|189028272|sp|A5ITB0|HRCA_STAA9 Heat-inducible transcription repressor hrcA >gi|56749870|sp|P68792|HRCA_STAAM Heat-inducible transcription repressor hrcA >gi|56749871|sp|P68793|HRCA_STAAN Heat-inducible transcription repressor hrcA >gi|56749872|sp|P68794|HRCA_STAAU Heat-inducible transcription repressor hrcA >gi|487327|dbj|BAA06357.1| ORF37 [Staphylococcus aureus] >gi|13701380|dbj|BAB42674.1| Heat-inducible transcriptional repressor [Staphylococcus aureus subsp. aureus N315] >gi|14247353|dbj|BAB57744.1| Heat-inducible transcriptional repressor [Staphylococcus aureus subsp. aureus Mu50] >gi|147741135|gb|ABQ49433.1| heat-inducible transcription repressor HrcA [Staphylococcus aureus subsp. aureus JH9] >gi|149946586|gb|ABR52522.1| heat-inducible transcription repressor HrcA [Staphylococcus aureus subsp. aureus JH1] >gi|156722035|dbj|BAF78452.1| Heat-inducible transcriptional repressor [Staphylococcus aureus subsp. aureus Mu3] (325 aa)
Score = 230, Expect = 2.4e-17, Identities = 86/326 (26%), Positives = 161/326 (49%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKL-KLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIE-NNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIK------SKMIKTVH-------------GQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEV--SHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFI 329
           IT RQ  +L  IVEDYV    PVGSK +IE++  N+S AT+RN+M  LE L  +EK H+SSGR PS  G+++Y     +   + +  KL +L  +  +    +   +      +S  ++   + +  N+ + ++  + ++  N    +++++ S G++    +H   D         I   ND            K++++ + +  K+ E+   LQ+ I    Q +      +K+I T++             G+  L+      +   ++ ILQ +ES  I E +   Q+ +  N  +  G+E+  S  DI    +  + +E  K ++ ++ PT + Y  +  LL  I
  S:     2 ITDRQLSILNAIVEDYVDFGQPVGSKTLIERHNLNVSPATIRNEMKQLEDLNYIEKTHSSSGRSPSQLGFRYYVNRLLEQTSHQKTNKLRRLNQLLVENQYDVSSALTYFADELSNISQYTTLVVHPNHKQDIINNVHLIRANPNLVIMVIVFSSGHVEH--VHLASD---------IPFSND------------KLNTISNFVTNKLTEFNQNLQDDIVSFVQSEQEEIFINKLINTMNNHISNQSNSIYMGGKVKLIDALNESNVSSIQPILQYIESNRIAELL---QDISSPNINVKIGNEIDDSLSDISIVTSQYHFDETLKGQIAVIGPTAMHYQNVIQLLNRI 324
>gi|17231536|ref|NP_488084.1| heat-inducible transcription repressor [Nostoc sp. PCC 7120] >gi|21263718|sp|Q8YPZ6|HRCA_ANASP Heat-inducible transcription repressor hrcA >gi|17133179|dbj|BAB75743.1| heat-inducible transcriptional repressor [Nostoc sp. PCC 7120] (365 aa)
Score = 230, Expect = 2.4e-17, Identities = 75/254 (29%), Positives = 137/254 (53%)
  Q:     3 EITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYIND--------ENLKLKLRNVFADRTMSIDVVIEESCKII-SESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHF---------KDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEY-EFV---LQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEIL 256
           ++T RQ+ +L   V  Y+ATA PVGSK ++E+Y   +S+AT+RN M  LEK GLL + HTS+GRVPS +GY+ Y      P + D        + ++  L+        S++++++ + +I+ S S  + +I +       ++ + +++I     M+I++T        ++             + I +++ I     N  L    + EI+T +D   S +  + + Y EF+   + EL  R     +  I  V G + +L  PEF   +++K I+
  S:     4 QLTNRQQHILWATVRHYIATAEPVGSKALVEEYDLGVSSATIRNVMGVLEKSGLLYQPHTSAGRVPSDSGYRIYVDQLITPSLRDTTRAEVLAKEVESALQQHLQWEDWSLEILLQGAAQILASLSGCISLITMPQTNTASVRHLQLMQIETGRIMLILVTDSYETHSKLMDLPPARSETKPDPEVIDRELQIVSNFLNSHLRGRSLLEIST-LDW--SQLDREFQSYGEFLKNSVAELAHRSAAPAATQI-MVRGLAEVLRQPEFSQLQQVKTII 275
>gi|21674306|ref|NP_662371.1| heat-inducible transcription repressor HrcA [Chlorobium tepidum TLS] >gi|28201811|sp|Q8KCD6|HRCA_CHLTE Heat-inducible transcription repressor hrcA >gi|21647479|gb|AAM72713.1| heat-inducible transcription repressor HrcA [Chlorobium tepidum TLS] (356 aa)
Score = 230, Expect = 2.4e-17, Identities = 67/259 (25%), Positives = 137/259 (52%)
  Q:     2 KEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRT-----MSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKT--------VHGQSSLLAVPEFQDTEKLKEILQILE 260
           +++T R++++L  I++ YV +A PVGS+ +   Y   +S AT+RN MA LE  G + + HTS+GRVP+  GY++Y          DE  K  + + F++R       S +V+   +  + S S +L ++     +  + +R+D+V++     MV++      +   ++    +   + I   + + N+RL    ++EI       +S I +++ +++   +EL+  I      +           V G  +++  PEF+  EK+++I+ ++E
  S:     4 RDLTLRERQVLGIIIQSYVVSAMPVGSRTIARNYNLGLSDATIRNVMADLEADGFISQPHTSAGRVPTDKGYRYYVDLIMNVSRIDEEEKRMIDDRFSNRNSELKGTSAEVLGTAARVLGSISRQLAVVLPPRLSNAVFERLDIVQLASSRIMVVIAIQSLFVKTIVMELNAEISRQKIDAVVDVLNERLPGLTLEEI-------RSTIAQRLSDFKGS-EELMNSIVSSADTLFDESSILEQLYVSGTENIVDQPEFKQPEKVRDIITMIE 267
>gi|148240632|ref|YP_001226019.1| heat-inducible transcription repressor HrcA [Synechococcus sp. WH 7803] >gi|166220408|sp|A5GP57|HRCA_SYNPW Heat-inducible transcription repressor hrcA >gi|147849171|emb|CAK24722.1| Heat-inducible transcription repressor HrcA [Synechococcus sp. WH 7803] (331 aa)
Score = 230, Expect = 2.6e-17, Identities = 80/329 (24%), Positives = 164/329 (49%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFY-EKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKL-PMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDC---PIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSH---EDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFI 329
           M+ + +RQ+E+L+  V  YV T  PVGSK +++++    S+ATVR+ M  LE+ GLL + H S+GR+PS  GY+ Y +    KP     +L+ +L  + + R  ++D ++++  + +++ T L  +I +   +E  L  I +V  +++  +++++ +D + T ++        +  ++   R  +D+L        + +  ++ +    ++E +           E  F   S     VHG S L+A PEF D+ K+  +L +++        AF  +  G +  +  G E  H    D    Q+     +    ++ +V P R+ Y+  +  ++ +
  S:     1 MELLPRRQQEVLQATVHHYVDTIEPVGSKTLVQRFGLQASSATVRSAMGALEQKGLLVQPHPSAGRIPSPRGYRHYVDCLLPKPGAAVHHLEQELTQL-SLRWAALDDLLQQLTRRLTDFTGLMSLITLPQPSEQRLHAIRLVPTDER--LLVMLVADSSQTHHLNLRLPHGSVHQVAALERWTDDQLHQSGQISWESLPQQLQTCGQALREALHNE--------EGRFISPSDQSAHVHGVSRLVAQPEFSDSTKVAPLLDLMDCNP----AAFIPSGPGHDDWVWIGGEHPHTALSDCSVIQSSYRDGQGGVGQVALVGPMRMAYATARAAVQCV 322
>gi|119485352|ref|ZP_01619680.1| heat-inducible transcription repressor [Lyngbya sp. PCC 8106] >gi|119457108|gb|EAW38234.1| heat-inducible transcription repressor [Lyngbya sp. PCC 8106] (369 aa)
Score = 230, Expect = 2.8e-17, Identities = 91/324 (28%), Positives = 162/324 (50%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKP--YINDENLKLKLRNVFADRTMSIDVVIEESCKIISE-STKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRI--------------------FNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKT---VHGQSSLLAVPEFQDTEKLKEILQILESTS--IWEQIAFKQNQTGSNTLITFGDEVSHEDI---VFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLE 327
           +++RQ  +L   +  Y+ATA PVGSK ++E++   +S AT+RN+M  LEK GLL + HTS+GR+PS +GY+ Y      P   I  +  +L LR     +  SI+ ++  + +I+S  S  + +I +   T   L+ + +V +     M++V+T        I+ F       ++++   I                     N +L    + E++T +D   S +  K + Y  ++++L++ +     K   T     G S +L +PEF   ++++ IL +LE     +W  I F+  +      +  G E   E I            N      + M+ PTR+ Y     L+E
  S:     7 LSERQHHILWATIRHYIATAEPVGSKALVEEFNLKVSPATIRNNMGTLEKAGLLYQPHTSAGRIPSDSGYRIYVDRMITPSDTIASQVTQL-LREQLDAKNWSIEAILRGAAQILSTLSGYITLITMPQTTSDNLRHLQLVSMEPGKIMLVVVTDSYQTQSIIMEFPQVDHPLEVAVNELISSLSEDEELLEQELQILSNFLNTQLRGQALNELST-LDW--SELDRKFERYANLIRKLLDDLSLRTQKPEYTRIQFSGISEVLRLPEFSQLQQVQTILHLLEDQQEKLWPLI-FQTPEQEQRVTVRIGAENPLEPIQCCSLISRQYYRNNIPVGSVGMLGPTRMMYENAIALVE 356
>gi|189499814|ref|YP_001959284.1| heat-inducible transcription repressor HrcA [Chlorobium phaeobacteroides BS1] >gi|189495255|gb|ACE03803.1| heat-inducible transcription repressor HrcA [Chlorobium phaeobacteroides BS1] (352 aa)
Score = 230, Expect = 2.8e-17, Identities = 80/331 (24%), Positives = 169/331 (51%)
  Q:     3 EITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPY-INDENLKLKLRN---VFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKI-------DSMKSIIKEKVKEYEFVLQE--LIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQ------TGSNTLITFGDE---VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEF 333
           ++++R++++L  I++ YV  A+PVGS+ +   Y   +S AT+RN MA LE  G + + HTS+GRVP+  GY++Y     +   I+DE +    RN   +  D   S D++   +  + S S +L ++     +  L +R+D+V ++    MV++      +   ++    +   + I   I + N RL    ++EI   I       D  + ++   V   + +  +  ++ER++         + G   ++  PEF   +K+++++ ++E  +   ++  K+ +      +G +  I+ G E    + ED     T   +      +L ++ P R+DY ++  L+ ++ +  
  S:     5 DLSERERQVLSIIIQAYVMNASPVGSRYIARNYNLGLSDATIRNVMADLEDAGYISQPHTSAGRVPTDKGYRYYVDLIMRVQGIDDEEINRIDRNFRLLKYDPKDSADILQAAAKVLGSISQQLSVVISPRLSNALFERLDLVVLSSSRIMVVLSIQSLFVRTIVMELSLEVSRQQIDNVIDLLNQRLSGLTLREIRNSISRRLADCDKDRELLNMIVGSADNLFDDTPVLERLY---------IAGAEHIVNQPEFDQPQKVRDLVCMIEDKNRMVELLEKEGRVKPVTSSGMDVSISIGRENSATTAEDFTVVTTPYYVG-NTIGRLGVLGPKRMDYERVVRLVNYMADRL 347
>gi|34497063|ref|NP_901278.1| heat-inducible transcription repressor [Chromobacterium violaceum ATCC 12472] >gi|34102920|gb|AAQ59284.1| heat-inducible transcription repressor transcription regulator protein [Chromobacterium violaceum ATCC 12472] (348 aa)
Score = 230, Expect = 2.8e-17, Identities = 80/319 (25%), Positives = 161/319 (50%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNI--SAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLR-NVFADRTMSIDVVIEESCKIISESTKLP-MIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDT-EKLKEILQILE-STSIWEQIAFKQNQTGSNTLITFGDE---VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKI 322
           + +R + LLK ++E Y+A   PV SK +    +P +  S+ATVRN +A LE +GL+   HTS+GRVP+  GY+ +          DE  + +L  N+  D    I   ++ +  ++SE T    ++     ++V  ++I+ + ++++  ++I++T DG++  +++  + D    ++       N       +  +A +++S    ++  + E      +L ++    +S+ +  V G S LL V +  D   +L+E+  + E  T + + +A  +   G N  I  G+E   ++ ++         IN Q    L +V PTR+ Y ++
  S:    10 MNERAQHLLKALIERYIADGQPVASKTL--SLLPGVELSSATVRNVLADLENMGLIASPHTSAGRVPTARGYRLFVDRLLTIRPLDELSRHELEANLQPDSPQRI---VQAASSLLSELTSFAGVVLTPQRSDVAFRQIEFLRLSERRVLMILVTLDGDVQNHLLVTERDYTPSELIEAGNFINQHYAGQGLSAVAQRVESELKQLQGDIAELMAAAVKLGQQTLAKRSEDV-VVSGGSRLLQVHDLSDDLSRLRELFGVFERKTELLKLLAQGREAQGVNIFI--GEESGVMTLDECSVVTAPYCINGQVVGTLGVVGPTRMAYERV 329
>gi|46576430|sp|Q7NXL8|HRCA_CHRVO Heat-inducible transcription repressor hrcA (340 aa)
Score = 230, Expect = 2.9e-17, Identities = 80/319 (25%), Positives = 161/319 (50%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNI--SAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLR-NVFADRTMSIDVVIEESCKIISESTKLP-MIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDT-EKLKEILQILE-STSIWEQIAFKQNQTGSNTLITFGDE---VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKI 322
           + +R + LLK ++E Y+A   PV SK +    +P +  S+ATVRN +A LE +GL+   HTS+GRVP+  GY+ +          DE  + +L  N+  D    I   ++ +  ++SE T    ++     ++V  ++I+ + ++++  ++I++T DG++  +++  + D    ++       N       +  +A +++S    ++  + E      +L ++    +S+ +  V G S LL V +  D   +L+E+  + E  T + + +A  +   G N  I  G+E   ++ ++         IN Q    L +V PTR+ Y ++
  S:     2 MNERAQHLLKALIERYIADGQPVASKTL--SLLPGVELSSATVRNVLADLENMGLIASPHTSAGRVPTARGYRLFVDRLLTIRPLDELSRHELEANLQPDSPQRI---VQAASSLLSELTSFAGVVLTPQRSDVAFRQIEFLRLSERRVLMILVTLDGDVQNHLLVTERDYTPSELIEAGNFINQHYAGQGLSAVAQRVESELKQLQGDIAELMAAAVKLGQQTLAKRSEDV-VVSGGSRLLQVHDLSDDLSRLRELFGVFERKTELLKLLAQGREAQGVNIFI--GEESGVMTLDECSVVTAPYCINGQVVGTLGVVGPTRMAYERV 321
>gi|163797072|ref|ZP_02191027.1| Negative regulator of class I heat shock protein [alpha proteobacterium BAL199] >gi|159177588|gb|EDP62141.1| Negative regulator of class I heat shock protein [alpha proteobacterium BAL199] (356 aa)
Score = 229, Expect = 3.3e-17, Identities = 81/326 (24%), Positives = 172/326 (52%)
  Q:     3 EITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSK---PYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQ----IKSKMIK----TVHGQSSLLA-VPEFQDTEKLKEILQILESTSIWEQIAFKQNQTG-SNTLITFGDEVSHEDIVFAQTDLNI-----NEQNKT---KLVMVAPTRVDYSKIKGLLEF 328
           ++ +R +E+ ++IV+ YV T   VGS+ +  +    +S AT+RN MA LE+ GLL   HTS+GR+P+ AG + +     +       +E   +  +   A RT++   ++EE+   ++  ++   + +   +E  LK I+ V +  Q A+V+++T  G +   I+          ++      N RL    ++++  ++++       ++ + +  L EL  R+ Q    I+S+  +     + GQS LL  V   +D E+++ + +ILE     E      + TG ++ +  F   +  E+ +F  T  ++     ++Q +     + ++ PTR++Y++I  ++++
  S:    15 QLNERSREIFRHIVDAYVETGEAVGSRTLSRRLGLVLSPATIRNVMADLEEAGLLYAPHTSAGRLPTDAGLRIFVDGLLEIGGDLSVEERASIDGKCAAAGRTVA--EMLEEASSTLAGLSRCAGLVVSPKSEAPLKHIEFVPLGNQRALVVMVTEGGLVENRILELPAGLPASALTEASNYLNSRLKGQMLQDLRRQVET-------EITQRQAELDELTSRVVQAGLAIRSEGPQGPALILRGQSQLLTDVSAVEDLERVRSLFEILEEK---ESTLRLLDSTGVADGVQIF---IGAENSLFRHTGCSMIISPYHDQRRMIVGAIGVIGPTRMNYARIIPMVDY 346
>gi|49483830|ref|YP_041054.1| heat-inducible transcription repressor [Staphylococcus aureus subsp. aureus MRSA252] >gi|56749022|sp|Q6GGB8|HRCA_STAAR Heat-inducible transcription repressor hrcA >gi|49241959|emb|CAG40654.1| heat-inducible transcription repressor [Staphylococcus aureus subsp. aureus MRSA252] (325 aa)
Score = 229, Expect = 3.8e-17, Identities = 85/326 (26%), Positives = 161/326 (49%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKL-KLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIE-NNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIK------SKMIKTVH-------------GQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEV--SHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFI 329
           IT RQ  +L  IVEDYV    PVGSK +IE++  N+S AT+RN+M  LE L  +EK H+SSGR PS  G+++Y     +   + +  KL +L  +  +    +   +      +S  ++   + +  N+ + ++  + ++  N    +++++ S G++    +H   D         I   ND            K++++ + +  K+ E+   LQ+ I    Q +      +K++ T++             G+  L+      +   ++ ILQ +ES  I E +   Q+ +  N  +  G+E+  S  DI    +  + +E  K ++ ++ PT + Y  +  LL  I
  S:     2 ITDRQLSILNAIVEDYVDFGQPVGSKTLIERHNLNVSPATIRNEMKQLEDLNYIEKTHSSSGRSPSQLGFRYYVNRLLEQTSHQKTNKLRRLNQLLVENQYDVSSALTYFADELSNISQYTTLVVHPNHKQDIINNVHLIRANPNLVIMVIVFSSGHVEH--VHLASD---------IPFSND------------KLNTISNFVTNKLTEFNQNLQDDIVSFVQSEQEEIFINKLLNTMNNHISNQSNSIYMGGKVKLIDALNESNVSSIQPILQYIESNRIAELL---QDISSPNINVKIGNEIDDSLSDISIVTSQYHFDETLKGQIAVIGPTAMHYQNVIQLLNRI 324
>gi|86609809|ref|YP_478571.1| heat-inducible transcription repressor [Synechococcus sp. JA-2-3B'a(2-13)] >gi|123501244|sp|Q2JJ73|HRCA_SYNJB Heat-inducible transcription repressor hrcA >gi|86558351|gb|ABD03308.1| heat-inducible transcription repressor HrcA [Synechococcus sp. JA-2-3B'a(2-13)] (389 aa)
Score = 229, Expect = 3.9e-17, Identities = 73/258 (28%), Positives = 137/258 (53%)
  Q:     3 EITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNF---------------SKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISE-STKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKD---DSILKDISICIRIFNDRL-IDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQ--IKSKMIKTVH-GQSSLLAVPEFQDTEKLKEILQILE 260
           E+T RQ+++L   V  Y+ATA PVGSK + + Y   +S AT+RND+A LE++GLL + HTS+GRVPS  GY+ Y  +                  P+   + L  +L     D    +D +++   ++++  S  + +I       V +  + +V +     MV+V+T        ++   D   DS  +D+   +++ ++ L +    K  A   D     + E+ + Y   LQ+L+  + Q  ++  + +    G + L+  PEF    +++ ++Q++E
  S:     4 ELTPRQRKILWATVRSYIATAEPVGSKTLAQSYNFGVSTATIRNDLATLEQVGLLFQPHTSAGRVPSDFGYRVYVNDLLTSANSGGIPHDAPQPDPHPALQQLMDQLGRELGD---DLDSLLQRVAQLLAHLSGCIALITPPQGPVVAIHHVQLVSVAPGRVMVLVVTDSYQTHSALVSPPDWPSDS-REDLEDELQLLSNFLTLKLRGKTFAELQDLSWLKLDEEFRTYGHWLQQLLRSVVQRCLQPSLGQVFSAGMAELMRQPEFSQARQVQAVMQLIE 280
>gi|86160745|ref|YP_467530.1| heat-inducible transcription repressor HrcA [Anaeromyxobacter dehalogenans 2CP-C] >gi|123497393|sp|Q2IHN8|HRCA_ANADE Heat-inducible transcription repressor hrcA >gi|85777256|gb|ABC84093.1| heat-inducible transcription repressor HrcA [Anaeromyxobacter dehalogenans 2CP-C] (355 aa)
Score = 229, Expect = 3.9e-17, Identities = 76/334 (22%), Positives = 156/334 (46%)
  Q:     3 EITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSK---PYINDENLKLKLRNVFADRTMSIDVVIEESCKII-SESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIK-------TVHGQSSLLAVPEFQDTEKLKEILQ-ILESTSIWEQIAFKQNQTGSNTLITFGDE---VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEKG 336
           E+ +R++E+L+ +V+DY+ T  PV S+ ++ ++    S ATVR+ MA LE LG LEK H SSGR+P+  GY+ Y     K   P   D +   +L     D    +  +IE +  ++ S S    ++         +++++ V + +   +V+ +++ G +T  ++  +      ++       N++L                +I+ + ++  +  L +L+++   +  +           + G+SS L  PEF D +K + +L+   E   I       +  T     I  G E    +  D+          ++    L +V PTR++Y+++  L++    +  + 
  S:     6 ELDRREREILRALVQDYIHTGEPVASQPLLSRHELEWSPATVRSVMADLEALGFLEKPHASSGRIPTERGYRLYVDTMLKVRPPSPADRDRIERLAQAAPD----VSSLIEGTADLLHSLSHHAGVVTTPRPQADPVRQLEFVRLRENRVLVVFVSAAGIVTNKLVQLEFTMEPAELERAAAYLNEKLHARAEAAEPELAALRAAILGD-MRADQSALHDLLQKALVLAEQSFAAAGVEKVVMEGESSFLDAPEFSDVQKARALLRGFAEKDRILR--VLDRVLTAQEVQIFIGAESEFATVPDVSVVAAPYGRGDRVLGTLAVVGPTRMNYARVIPLVDLTARQISRA 347
>gi|148558856|ref|YP_001258204.1| heat-inducible transcription repressor [Brucella ovis ATCC 25840] >gi|148370113|gb|ABQ60092.1| heat-inducible transcription repressor HrcA [Brucella ovis ATCC 25840] (374 aa)
Score = 228, Expect = 4.1e-17, Identities = 79/328 (24%), Positives = 169/328 (51%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSK----PYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKS--------KMIKTVHGQSSLLA-VPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDE-----VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEF 328
           +  + QR +++ + IVE Y+   +PVGS+ +       +S AT+RN M+ LE LGL+   H S+GR+P+  G +F+   F +    P     +++ ++R   A  + S++ V+ E+ +++S  ++   + + N T+V LK I+ V +    A+ +++  +G++   +I          +       N  +    + E  ++   ++ + +E  +E + + QEL+ +   + S        ++I  V G+++LL  V   +D E+L+ +   LE+     Q+     + G    I  G E     +S   +V A    +  ++    L ++ PTR++Y++I  ++++
  S:    28 LSSLDQRSRDIFRLIVETYLNDGDPVGSRNLSRLLPHTLSPATIRNVMSDLEHLGLIYAPHISAGRLPTQIGLRFFVDAFLEVGDLPPEERSSIEAQVRA--AGTSNSVESVLTEASQVLSGLSRGAGLVLTNKTDVALKHIEFVRLEPMRALAVLVMQNGDVENRVIDLPAGISTSQLIEASNFLNAHIHGHTLSEAKSE---LRKLSEETRRELDQLSQELVAKGLAVWSGAGADQPARLI--VRGRANLLENVHAQEDIERLRHLFDDLETKDGMVQL-LDLAEAGLGVRIFIGSENKLFSLSGSSLVVAPYR-DSEQRVIGALGVIGPTRLNYARIVPMVDY 364
>gi|21283263|ref|NP_646351.1| heat-inducible transcriptional repressor [Staphylococcus aureus subsp. aureus MW2] >gi|49486417|ref|YP_043638.1| heat-inducible transcription repressor [Staphylococcus aureus subsp. aureus MSSA476] >gi|57651975|ref|YP_186479.1| heat-inducible transcription repressor HrcA [Staphylococcus aureus subsp. aureus COL] >gi|87161015|ref|YP_494237.1| heat-inducible transcription repressor HrcA [Staphylococcus aureus subsp. aureus USA300] >gi|88195391|ref|YP_500195.1| heat-inducible transcription repressor HrcA [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|151221697|ref|YP_001332519.1| heat-inducible transcription repressor [Staphylococcus aureus subsp. aureus str. Newman] >gi|161509810|ref|YP_001575469.1| heat shock transcriptional repressor HrcA [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|168728405|ref|ZP_02760682.1| heat shock transcriptional repressor HrcA [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|122539396|sp|Q2FXZ0|HRCA_STAA8 Heat-inducible transcription repressor hrcA >gi|123485605|sp|Q2FGE1|HRCA_STAA3 Heat-inducible transcription repressor hrcA >gi|172048913|sp|A6QHC5|HRCA_STAAE Heat-inducible transcription repressor hrcA >gi|189028273|sp|A8Z4C1|HRCA_STAAT Heat-inducible transcription repressor hrcA >gi|24211772|sp|Q8NWA8|HRCA_STAAW Heat-inducible transcription repressor hrcA >gi|56748968|sp|Q6G8Y5|HRCA_STAAS Heat-inducible transcription repressor hrcA >gi|71152133|sp|Q5HFH8|HRCA_STAAC Heat-inducible transcription repressor hrcA >gi|21204703|dbj|BAB95399.1| Heat-inducible transcriptional repressor [Staphylococcus aureus subsp. aureus MW2] >gi|49244860|emb|CAG43321.1| heat-inducible transcription repressor [Staphylococcus aureus subsp. aureus MSSA476] >gi|57286161|gb|AAW38255.1| heat-inducible transcription repressor HrcA [Staphylococcus aureus subsp. aureus COL] >gi|87126989|gb|ABD21503.1| heat-inducible transcription repressor HrcA [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|87202949|gb|ABD30759.1| heat-inducible transcription repressor HrcA [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|150374497|dbj|BAF67757.1| heat-inducible transcription repressor [Staphylococcus aureus subsp. aureus str. Newman] >gi|160368619|gb|ABX29590.1| heat shock transcriptional repressor HrcA [Staphylococcus aureus subsp. aureus USA300_TCH1516] (325 aa)
Score = 228, Expect = 4.3e-17, Identities = 85/326 (26%), Positives = 161/326 (49%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKL-KLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIE-NNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIK------SKMIKTVH-------------GQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEV--SHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFI 329
           IT RQ  +L  IVEDYV    PVGSK +IE++  N+S AT+RN+M  LE L  +EK H+SSGR PS  G+++Y     +   + +  KL +L  +  +    +   +      +S  ++   + +  N+ + ++  + ++  N    +++++ S G++    +H   D         I   ND            K++++ + +  K+ E+   LQ+ I    Q +      +K++ T++             G+  L+      +   ++ ILQ +ES  I E +   Q+ +  N  +  G+E+  S  DI    +  + +E  K ++ ++ PT + Y  +  LL  I
  S:     2 ITDRQLSILNAIVEDYVDFGQPVGSKTLIERHNLNVSPATIRNEMKQLEDLNYIEKTHSSSGRSPSQLGFRYYVNRLLEQTSHQKTNKLRRLNQLLVENQYDVSSALTYFADELSNISQYTTLVVHPNHKQDIINNVHLIRANPNLVIMVIVFSSGHVEH--VHLASD---------IPFNND------------KLNTISNFVTNKLTEFNQNLQDDIVSFVQSEQEEIFINKLLNTMNNHISNQSNSIYMGGKVKLIDALNESNVSSIQPILQYIESNRIAELL---QDISSPNINVKIGNEIDDSLSDISIVTSQYHFDETLKGQIAVIGPTAMHYQNVIQLLNRI 324
>gi|108800426|ref|YP_640623.1| heat-inducible transcription repressor [Mycobacterium sp. MCS] >gi|119869555|ref|YP_939507.1| heat-inducible transcription repressor [Mycobacterium sp. KMS] >gi|126436049|ref|YP_001071740.1| heat-inducible transcription repressor [Mycobacterium sp. JLS] >gi|123178459|sp|Q1B6B7|HRCA_MYCSS Heat-inducible transcription repressor hrcA >gi|166220395|sp|A3Q272|HRCA_MYCSJ Heat-inducible transcription repressor hrcA >gi|166220396|sp|A1UIQ9|HRCA_MYCSK Heat-inducible transcription repressor hrcA >gi|108770845|gb|ABG09567.1| heat-inducible transcription repressor HrcA [Mycobacterium sp. MCS] >gi|119695644|gb|ABL92717.1| heat-inducible transcription repressor HrcA [Mycobacterium sp. KMS] >gi|126235849|gb|ABN99249.1| heat-inducible transcription repressor HrcA [Mycobacterium sp. JLS] (347 aa)
Score = 228, Expect = 4.5e-17, Identities = 52/168 (30%), Positives = 99/168 (58%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFS--KPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTK-LPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKD 168
           M     R+ E+L+ IV D+VAT  P+GSK ++E++   +S+ATVRNDMA LE  G + + HTSSGRVP+  GY+ +       KP  + E   + L+  F +  + +D V+  + +++++ T+ + +++    +   ++ +++V +     +++VIT  G + + I+   D
  S:     1 MGSADDRRFEVLRAIVADFVATKEPIGSKTLVERHNLGVSSATVRNDMAVLEAEGYITQPHTSSGRVPTEKGYREFVDRLDDVKPLSSAERRAI-LK--FLETGVDLDDVLRRAVRLLAQLTRQVAIVQYPTLSTSSVRHLEVVALTPARLLLVVITDTGRVDQRIVELGD 168
>gi|187250523|ref|YP_001875005.1| heat-inducible transcription repressor HrcA [Elusimicrobium minutum Pei191] >gi|186970683|gb|ACC97668.1| heat-inducible transcription repressor HrcA [Elusimicrobium minutum Pei191] (363 aa)
Score = 228, Expect = 4.7e-17, Identities = 66/329 (20%), Positives = 164/329 (49%)
  Q:     6 QRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISE-STKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILES----TSIWEQIAFKQNQTGSNTLITFGDE---VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFE 334
           +R+++LL+++++ +V T  P+GS++V +  +P IS+AT+RN M  LE+ G L + HTS GR+P+   Y+FY    SK        K+++   + D +  +D  + ++ ++++  S     +   +  E ++KR+D + +  +  + +++T  G++    +          +     + N++L    + +    +    +    ++ +   + ++++E I + ++     + G   LL      D + L+++L+I+E      ++ E+       +G+   +T G E      +++    +   + ++    L ++ P  ++Y+++  L+ FI +  E
  S:    11 EREEKLLRWVIQKFVETRRPIGSELVAKHALPGISSATIRNIMKKLEEEGYLLQPHTSGGRIPTDKAYRFYVDYLSKVQKIAAQEKIRIEKEYEDASSELDRTMVQTSRMLAALSNSAGFVYTTSIAEQVVKRLDFIPLAPEHILAVLVTESGSVKHLPLRTNYTISPARLRFLSNVINEKLAGLTVVDAQRVLWESMNTGNNEINDVLILAKKVLEEISEAQNNSEIYLEGLGQLLEGITDTDYDDLRQMLRIVEERKSFAAMMEERIKDLQHSGNKISVTIGSEHGLKEFKNLSIISSAYKVGDKTIGMLGIIGPKHMEYTRMISLVNFIGDLLE 347
>gi|126660212|ref|ZP_01731329.1| heat-inducible transcription repressor [Cyanothece sp. CCY0110] >gi|126618514|gb|EAZ89266.1| heat-inducible transcription repressor [Cyanothece sp. CCY0110] (369 aa)
Score = 228, Expect = 4.9e-17, Identities = 69/250 (27%), Positives = 137/250 (54%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYIND-ENLKLKLRNVFADRTMSIDVVIEESCKIISE-STKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDIS-----------ICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKT---VHGQSSLLAVPEFQDTEKLK 253
           + QR +++L+  V  Y+ATA PVGSK ++ +Y  ++S+AT+RN +  LEK G L + +TS+GR+PS  GY+ Y  N   P     + +K  L      +T + +  ++ + +I++  S  + +I +   +   L+ + ++ I+ + AM++V+T D   T++I+     ++ +D             I     N +L    + E+ +++D  K  I +    Y   L+ L++++       + T   +HG S +L  PEF   ++++
  S:    13 LNQRHQDILRATVRHYIATAEPVGSKTLVTEYDFSVSSATIRNTLGKLEKAGFLYQPYTSAGRIPSDFGYRIYVDNLMTPNKKRAKQIKQNLSQQLKQKTYNFETALQRATQILANLSGYIALITLPQTSPNQLRHLQLIPISSKQAMLLVVT-DSYQTQSIVVDIPTTLGRDNEENQECLEEELHILSNFLNSQLKGKSLLEL-SQLDWEK--IDQDFINYADFLKSLLKQLKTYLKTSVSTQMMIHGVSEVLRQPEFSQLQQVQ 274
>gi|148251805|ref|YP_001236390.1| heat-inducible transcription repressor [Bradyrhizobium sp. BTAi1] >gi|166219853|sp|A5E8J0|HRCA_BRASB Heat-inducible transcription repressor hrcA >gi|146403978|gb|ABQ32484.1| heat-inducible transcription repressor HrcA [Bradyrhizobium sp. BTAi1] (362 aa)
Score = 227, Expect = 6.2e-17, Identities = 48/164 (29%), Positives = 92/164 (56%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFAD--RTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNII 164
           + ++ +R +E+ + IVE Y+AT  PVGS+ +       +S A+VRN MA LE+LGL+   HTS+GR+P+ AG +F+     +     E  +  +++  A   R  S++  ++E+   +S  T+   + +   +   LK I+ V +  + A+V+++  DG +   ++
  S:    16 LAQLNERSREIFRQIVESYLATGEPVGSRNISRLIAVPLSPASVRNVMADLEQLGLIYAPHTSAGRLPTEAGLRFFVDALMQVGDMTEAERQSIQSQLASVGRAQSVEAALDEALTRLSGLTRAAAVVLTAKSNTRLKHIEFVRLEPERALVVLVGEDGQVENRVL 181
>gi|82751185|ref|YP_416926.1| heat-inducible transcription repressor [Staphylococcus aureus RF122] >gi|123547848|sp|Q2YT45|HRCA_STAAB Heat-inducible transcription repressor hrcA >gi|82656716|emb|CAI81143.1| heat-inducible transcription repressor [Staphylococcus aureus RF122] (325 aa)
Score = 227, Expect = 6.3e-17, Identities = 85/326 (26%), Positives = 161/326 (49%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKL-KLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIE-NNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIK------SKMIKTVH-------------GQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEV--SHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFI 329
           IT RQ  +L  I+EDYV    PVGSK +IE++  N+S AT+RN+M  LE L  +EK H+SSGR PS  G+++Y     +   + +  KL +L  +  +    +   +      +S  ++   + +  N+ + ++  + ++  N    +++++ S G++    +H   D         I   ND            K++++ + +  K+ E+   LQ+ I    Q +      +K+I T++             G+  L+      +   ++ ILQ +ES  I E +   Q+ +  N  +  G+E+  S  DI    +  + +E  K ++ ++ PT + Y  +  LL  I
  S:     2 ITDRQLSILNAILEDYVDFGQPVGSKTLIERHNLNVSPATIRNEMKQLEDLNYIEKAHSSSGRSPSQLGFRYYVNRLLEQTSHQKTNKLRRLNQLLVENQYDVSSALTYFADELSNISQYTTLVVHPNHKQDIINNVHLIRANPNLVIMVIVFSSGHVEH--VHLASD---------IPFSND------------KLNTISNFVTNKLTEFNQNLQDDIVSFVQSEQEEIFINKLINTMNNHISNQSNSIYMGGKVKLIDALNESNVSSIQPILQYIESNRIAELL---QDISSPNINVKIGNEIDDSLSDISIVTSQYHFDETLKGQIAVIGPTAMHYQNVIQLLNRI 324
>gi|59799761|gb|AAX07322.1| heat shock regulatory protein [Anabaena sp. L-31] (357 aa)
Score = 227, Expect = 6.5e-17, Identities = 53/154 (34%), Positives = 92/154 (59%)
  Q:     3 EITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTM----SIDVVIEESCKII-SESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSD 156
           ++T RQ+ +L   V  Y+ATA PVGSK +IE+Y   +S+AT+RN M  LEK GLL + HTS+GRVPS +GY+ Y      P    E L  ++ +    R      S++++++ + +I+ S S  + +I +       ++ + +++I     M+I++T +
  S:     4 QLTNRQQHILWATVRHYIATAEPVGSKALIEEYDLGVSSATIRNVMGVLEKSGLLYQPHTSAGRVPSDSGYRIYVDKLITP---SEVLAKEVESALQQRLQWEDWSLEILLQGAAQILASLSGCISLITMPQTNTATVRHLQLMQIEAGRIMLILVTDN 159
>gi|166031123|ref|ZP_02233952.1| hypothetical protein DORFOR_00808 [Dorea formicigenerans ATCC 27755] >gi|166028970|gb|EDR47727.1| hypothetical protein DORFOR_00808 [Dorea formicigenerans ATCC 27755] (359 aa)
Score = 226, Expect = 6.9e-17, Identities = 82/334 (24%), Positives = 173/334 (51%)
  Q:     2 KEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMI---KIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKN-IIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIER---IFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILES----TSIWEQIAFKQNQTGSNTLITFGDEV---SHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEK 335
           +E+++R+ ++L+ I+++Y+ T  PVGS+ + +    N+S+AT+RN+MA LE+LG + + HTS+GR+PS  GY+ Y     +     E    ++++   ++   +D +++++ K+++ ST    +    + N   +   ++ MV+   +  M+ VI  +GN+ KN IIH  +    +++     + N  L    I+EI      + + +KE    +  V+  +++    + Q+   M     G +++   PE  D +  +EI+   E     T +  Q    +  TG    I  GDE    + +D         + +  K  + ++ P R+DY  +   ++ +++E ++
  S:    17 QELSERKLKILQAIIKNYLETGEPVGSRTISKYTDLNLSSATIRNEMADLEELGYILQPHTSAGRIPSDKGYRLYVDMLME---QKEQELSEMQDQMLEKADKMDQLLKQAAKVLANSTNYATLVSSPMNNRNRIKFIQLTMVD---EEQMIAVIVLEGNVIKNKIIHVDEPINNENLLKLNMLLNTTLNGMSIEEINL---GLIARLKEGAGIHSEVVGNVLDAVADVIQVDEDMQIYTSGATNIFKYPELSDKQSAQEIISAFEEKQQLTDLVTQTLSNEENTGIQVYI--GDEAPVKTMKDCSVVTATYELGDGVKGTIGIIGPKRMDYENVLKSMKRLQSELDQ 353
>gi|146337340|ref|YP_001202388.1| heat-inducible transcription repressor [Bradyrhizobium sp. ORS278] >gi|166219854|sp|A4YJR2|HRCA_BRASO Heat-inducible transcription repressor hrcA >gi|146190146|emb|CAL74138.1| Heat-inducible transcription repressor [Bradyrhizobium sp. ORS278] (362 aa)
Score = 226, Expect = 6.9e-17, Identities = 48/164 (29%), Positives = 92/164 (56%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFA--DRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNII 164
           + ++ +R +E+ + IVE Y+AT  PVGS+ +       +S A+VRN MA LE+LGL+   HTS+GR+P+ AG +F+     +     E  +  +++  A   R  S++  ++E+   +S  T+   + +   +   LK I+ V +  + A+V+++  DG +   ++
  S:    16 LAQLNERSREIFRQIVESYLATGEPVGSRNISRLIAVPLSPASVRNVMADLEQLGLIYAPHTSAGRLPTEAGLRFFVDALMQVGDMTEAERQSIQSQLAAVGRAQSVEAALDEALTRLSGLTRAAAVVLTAKSNTRLKHIEFVRLEPEQALVVLVGEDGQVENRVL 181
>gi|148998191|ref|ZP_01825660.1| heat-inducible transcription repressor HrcA [Streptococcus pneumoniae SP11-BS70] >gi|168576579|ref|ZP_02722453.1| heat-inducible transcription repressor HrcA [Streptococcus pneumoniae MLV-016] >gi|147755834|gb|EDK62878.1| heat-inducible transcription repressor HrcA [Streptococcus pneumoniae SP11-BS70] >gi|183577702|gb|EDT98230.1| heat-inducible transcription repressor HrcA [Streptococcus pneumoniae MLV-016] (344 aa)
Score = 226, Expect = 7.0e-17, Identities = 84/319 (26%), Positives = 159/319 (49%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIE-NNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDS-MKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSL-----LAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKI 322
           +T+RQ+++L  I++ +  T  PVGSKV+ E    N S+AT+RNDMA LEK GLLEK HTSSGR+PS AG+++Y K+    +   EN   ++   F      ++ +++E+  ++++ +   ++ ++   +   L   D+V + + +A+ +    +     +      + + +D+     I  +R +   + +I  KI + +  II+      + V+ +L E IF+        + G+ +L     LA  +F D  + K  L+I E          +++Q   N  I  G E    D+    +   I  +    L ++ P  +DY ++
  S:     2 VTERQQDILNLIIDIFTKTHEPVGSKVLQESI--NSSSATIRNDMAELEKQGLLEKAHTSSGRMPSVAGFQYYVKHSLDFHRLAENEVYEIVKAFDQEFFKLEDILQEAANLLTDLSGCTVVALDVEPSRQRLTAFDIVVLGQHTALAVFTLDESRTVTSQFLIPRNFLQEDLLKLKSIIQERFLGHTVLDIHYKIRTEIPQIIQRYFTTTDNVI-DLFEHIFKEMFNENIVMAGKVNLLNFANLAAYQFFDQPQ-KVALEIRE--------GLREDQM-QNVRIADGQESCLADLAVISSKFLIPYRGVGILAIIGPVNLDYQQL 314
>gi|146317954|ref|YP_001197666.1| heat-inducible transcription repressor [Streptococcus suis 05ZYH33] >gi|146320141|ref|YP_001199852.1| heat-inducible transcription repressor [Streptococcus suis 98HAH33] >gi|145688760|gb|ABP89266.1| Transcriptional regulator of heat shock gene [Streptococcus suis 05ZYH33] >gi|145690947|gb|ABP91452.1| Transcriptional regulator of heat shock gene [Streptococcus suis 98HAH33] (351 aa)
Score = 226, Expect = 7.0e-17, Identities = 74/261 (28%), Positives = 140/261 (53%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFY-EKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIE-NNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEY-----------EFVLQELIERIFQIKSKMIKTVHGQSS---LLAVPEFQDTEKLKEILQILESTSI 264
           ITQRQ ++L  IVE +     PVGSK + E  M   S+AT+RNDMA LE+LGLLEK HTSSGR+PS AG++++   + +  +IN+E++  ++   F      ++ ++E + +++++ T    + ++   T   L   D+V+++   A+ ++                + + +D+ +  R+ ++R +   +  I  K   +++ I + V+ Y           +++   L +    I  K+    +G  +   LL  P+    E L++ L   + TSI
  S:     9 ITQRQNDILNLIVELFTRHHEPVGSKALQE--MIASSSATIRNDMAKLEQLGLLEKAHTSSGRMPSRAGFQYFVNHSLNLKHINEEDV-YQVVKAFDFEAFKLEDILERASQVLADLTGYTSVILDVEPTSQQLTSFDIVQLSSHDALAVLTLDQSKPVTVQFAIPKNFLTRDLEVLKRLVDERFVGQTVLAIHYK---LRTEIPQVVQRYFATTDNVLDLMDYIFSNLFQESVFISGKVASLTYGNLATYQLLDSPQLLAPE-LRQGLAPNQQTSI 278
>gi|167343708|ref|ZP_02289579.1| heat-inducible transcription repressor [Listeria monocytogenes FSL J1-208] (256 aa)
Score = 226, Expect = 7.2e-17, Identities = 57/206 (27%), Positives = 112/206 (54%)
  Q:    55 GLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKI-ENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKID-SMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILE 260
           G +EK H+SSGRVPS  GY+FY     +P   D++ +  +++ F++    ++ +I+ S  ++S+ T    I +    T+  L     V IN   AM+I+IT  G++  +++   + + L DI   + I N+RL+   + ++  +I   +K ++ + V+ YE  +    +   Q   + +    G++++L  PEF D  K++E+L ++E
  S:     3 GFIEKTHSSSGRVPSEKGYRFYVDYLLQPKKLDKSDRQMIQSFFSENYYEMEGLIQNSALMLSDLTNYTSILLGPEATKNHLSGFRFVPINNFQAMLILITDQGHVDNHLVTIPEGTTLSDIERMVNILNERLVGLSLDDLKVQIPMEVKELLGKHVRNYESFMHVFSDSFAQASQQKV-YFGGKTNILNQPEFHDINKVREMLHLME 209
>gi|15827254|ref|NP_301517.1| heat-inducible transcription repressor [Mycobacterium leprae TN] >gi|21263736|sp|Q9CCN2|HRCA_MYCLE Heat-inducible transcription repressor hrcA >gi|13092803|emb|CAC30132.1| putative heat-inducible transcription repressor [Mycobacterium leprae] (343 aa)
Score = 226, Expect = 7.5e-17, Identities = 48/168 (28%), Positives = 98/168 (58%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFS--KPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISEST-KLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKD 168
           M    +R+ E+L+ IV D+VAT  P+GS+ ++E++   +S+AT+RNDMA LE  G + + HTSSGRVP+  GY+ +       KP    E   ++    F +  + +D V+  + +++++ T ++ +++    +   ++ ++++ ++    +++VIT  G + + I    D
  S:     1 MGNADERRFEVLRAIVADFVATKEPIGSRALVERHNLGVSSATIRNDMAVLEAEGYITQPHTSSGRVPTEKGYREFVDRLEDVKPLSAAERRAIQ---SFLESGVDLDDVLRRAVRLLAQLTCQVAVVQYPTLSTSTVRHLEVIALSPARLLMVVITESGRVDQRIAELGD 168
>gi|167768092|ref|ZP_02440145.1| hypothetical protein CLOSS21_02637 [Clostridium sp. SS2/1] >gi|167710421|gb|EDS21000.1| hypothetical protein CLOSS21_02637 [Clostridium sp. SS2/1] (352 aa)
Score = 226, Expect = 8.2e-17, Identities = 81/336 (24%), Positives = 167/336 (49%)
  Q:     3 EITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLP-MIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKN-IIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVH-------GQSSLLAVPEFQDTEKLKEILQILESTSIWEQI------AFKQNQTGSNTLITFGDEVSH-EDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEKGWK 338
           E+  R+K +LK I+ +Y+ T  PVGS+ + +    N+S+AT+RN+MA LE +G + + HTS+GR+PS  GY+FY        + + + + + +     R   ++V++++    ++ ST    M+   +   V LK + + +++ +  + +++T  GN+ KN +I  ++    +D+     + N  L    +++I          + + ++E   + Q+++ERI +  +K I           G +++L  PE  + +   E+L  L       ++      +   N TG    I     V + +D         + E     + ++ P R+DY K+   L+ +  E +  +K
  S:    10 ELNDRKKLILKAIIANYLETGEPVGSRTIAKHPELNLSSATIRNEMADLEDMGYILQPHTSAGRIPSDTGYRFYVDQL----MTERDSEHEEKQALIQRVDKMEVLLKQVANALANSTNYATMVSSPHYQNVTLKFVQLSQVDHEHLLAVIVTQ-GNIVKNKMIQVEEPLSNEDVLKLNVLLNTFLQGLTLQDINLA-------LIQTMREQAGIRQDVLERILEEIAKAIHDADHMEIYTGGATNILKYPELGNPDTATELLDTLVEKKALTKLVDSTLESDSDNHTGIQVYIGEESPVKNMKDCSIVTATYELAEGGTGTVGIIGPKRMDYKKVVKTLKNLTEELDDIFK 349
>gi|81097098|ref|ZP_00875409.1| Negative regulator of class I heat shock protein [Streptococcus suis 89/1591] >gi|80976843|gb|EAP40415.1| Negative regulator of class I heat shock protein [Streptococcus suis 89/1591] (344 aa)
Score = 226, Expect = 8.3e-17, Identities = 61/209 (29%), Positives = 116/209 (55%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFY-EKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIE-NNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEY 212
           ITQRQ ++L  IVE +     PVGSK + E  M   S+AT+RNDMA LE+LGLLEK HTSSGR+PS AG++++   + +  YI++E++  ++   F      ++ ++E + +++++ T    + ++   T   L   D+V+++   A+ ++                + + +D+ +  R+ ++R +   +  I  K   +++ I + V+ Y
  S:     2 ITQRQNDILNLIVELFTRHHEPVGSKALQE--MIASSSATIRNDMAKLEQLGLLEKAHTSSGRMPSRAGFQYFVNHSLNLEYIDEEDV-YQVVKAFDFEAFKLEDILERASQVLADLTGYTSVILDVEPTSQQLTSFDIVQLSSHDALAVLTLDQSKPVTVQFAIPKNFLTRDLEVLKRLVDERFVGQTVLAIHYK---LRTEIPQVVQRY 206
>gi|159896970|ref|YP_001543217.1| heat-inducible transcription repressor HrcA [Herpetosiphon aurantiacus ATCC 23779] >gi|159890009|gb|ABX03089.1| heat-inducible transcription repressor HrcA [Herpetosiphon aurantiacus ATCC 23779] (354 aa)
Score = 226, Expect = 8.5e-17, Identities = 69/290 (23%), Positives = 145/290 (50%)
  Q:     3 EITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKL-PMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIF-QIKSKMIKTVH--GQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDI 292
           E+ +R++ +LK +++ Y+ TA PV S+ +       +S+ATVRN+MA LE  GLL   HTS+GR+P+ AGY+F+ +N           +  +++ F      ++  I  +  +++ + +   ++      E   K I+++ IN    +++++  +G++ +  +    ++  + +S      N+   +   K IA  I   +S  +  +  +E ++ E + R   Q +  + + +H  G   +L  PEF    +++E+L ILE  ++ E +   Q        +  G E S +++
  S:     4 ELNERRRRVLKAVIQQYIDTATPVASQDLARSL--GVSSATVRNEMAALEDAGLLTHLHTSAGRLPTDAGYRFFVENLMDRAALSTQEQRMIQHQFYQIRSELNQWIHLAAAVLARTAQTAAVVTPPRAYESRFKHIELISINDALVLLVLVLHEGSVKQQTLPADPNTTQEQLSRIAGRINELCHEASAKAIAN-IAHNQSTNQPPLSSFEVLVIESVARAMQQFEEHVNELIHHDGLLEMLHQPEFGQVTRVREVLSILEGGTMLESL-IPQALASDGVQVIIGGEHSRDEL 293
>gi|77409360|ref|ZP_00786061.1| heat-inducible transcription repressor HrcA [Streptococcus agalactiae COH1] >gi|77172032|gb|EAO75200.1| heat-inducible transcription repressor HrcA [Streptococcus agalactiae COH1] (360 aa)
Score = 225, Expect = 9.8e-17, Identities = 67/221 (30%), Positives = 120/221 (54%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIE-NNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIF 224
           ITQRQ ++L  IVE +  T  PVGSK +  +   + S+AT+RNDMA LEKLGLLEK HTSSGR+PS AG+K++ ++  +    DE     +   F      ++ +++++  I+SE T    + ++       L   D+V+++   A+ ++   +            + + +D+     I  +RL+D  + +I  K   +++ I + V++Y FV  + + ++F
  S:    18 ITQRQNDILNLIVELFTQTHEPVGSKAL--QRTIDSSSATIRNDMAKLEKLGLLEKAHTSSGRMPSPAGFKYFVEHSLRLDSIDEQDIYHVIKAFDFEAFKLEDMLQKASHILSEMTGYTSVILDVEPARQRLTGFDVVQLSNHDALAVMTLDESKPVTVQFAIPRNFLTRDLIAFKAIVEERLLDGSVMDIHYK---LRTEIPQIVQKY-FVTTDNVLQLF 233
>gi|76798487|ref|ZP_00780723.1| heat-inducible transcription repressor HrcA [Streptococcus agalactiae 18RS21] >gi|76586152|gb|EAO62674.1| heat-inducible transcription repressor HrcA [Streptococcus agalactiae 18RS21] (360 aa)
Score = 225, Expect = 9.8e-17, Identities = 67/221 (30%), Positives = 120/221 (54%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIE-NNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIF 224
           ITQRQ ++L  IVE +  T  PVGSK +  +   + S+AT+RNDMA LEKLGLLEK HTSSGR+PS AG+K++ ++  +    DE     +   F      ++ +++++  I+SE T    + ++       L   D+V+++   A+ ++   +            + + +D+     I  +RL+D  + +I  K   +++ I + V++Y FV  + + ++F
  S:    18 ITQRQNDILNLIVELFTQTHEPVGSKAL--QRTIDSSSATIRNDMAKLEKLGLLEKAHTSSGRMPSPAGFKYFVEHSLRLDSIDEQDIYHVIKAFDFEAFKLEDMLQKASHILSEMTGYTSVILDVEPARQRLTGFDVVQLSNHDALAVMTLDESKPVTVQFAIPRNFLTRDLIAFKAIVEERLLDGSVMDIHYK---LRTEIPQIVQKY-FVTTDNVLQLF 233
>gi|125624378|ref|YP_001032861.1| heat-inducible transcription repressor [Lactococcus lactis subsp. cremoris MG1363] >gi|1176136|sp|P42370|HRCA_LACLM Heat-inducible transcription repressor hrcA >gi|435490|emb|CAA54087.1| orf1 [Lactococcus lactis] >gi|124493186|emb|CAL98151.1| Heat-inducible transcription repressor hrcA [Lactococcus lactis subsp. cremoris MG1363] (347 aa)
Score = 225, Expect = 1.0e-16, Identities = 82/326 (25%), Positives = 150/326 (46%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIEN-NTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDS-MKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQIL-ESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFI 329
           IT+RQ+++L  IV  Y     P+GSK +++      S+AT+RNDM  LE+LGL++K HTSSGR+PS +GYK++ +N  +     +N   K+   F      +  + + + K +SE T L    +     +  L   +MV ++  S + ++    G +  N           D+++   +  +RL+   + +I   + + +  I++   K    VLQ L E IF    K   TV G  ++        T+ L E+ ++  +   +  +I    N      +    DE   +++        I  +    L +V P  +DY +   +L+ +
  S:     2 ITERQRQILNLIVSLYAKDHTPIGSKSLLDSIQA--SSATIRNDMKALERLGLIQKEHTSSGRIPSVSGYKYFVENVIQLEEFSQNDLFKVMKAFDGDFYRLSDLFKTAAKSLSELTGLTSFVLNAPQRDQQLVSFEMVMLDNHSVLSVITLGTGEVRTNQFILPKSMTEADLAVFSNLVKERLVGKKVIDIHYTLRTEIPQIVQRYFKVTSEVLQ-LFESIFDDLFKEHLTVAGHKNIFDYA----TDNLAELYKLFSDDERMLHEIREITNNDEMRAVKFDNDEKFMKNLTIISQKFVIPYRGFGTLTVVGPVEMDYQRTLSVLDLV 323
>gi|22536280|ref|NP_687131.1| heat-inducible transcription repressor [Streptococcus agalactiae 2603V/R] >gi|46576573|sp|Q8E2A0|HRCA_STRA5 Heat-inducible transcription repressor hrcA >gi|22533101|gb|AAM99003.1|AE014195_22 heat-inducible transcription repressor HrcA [Streptococcus agalactiae 2603V/R] (344 aa)
Score = 224, Expect = 1.2e-16, Identities = 67/221 (30%), Positives = 120/221 (54%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIE-NNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIF 224
           ITQRQ ++L  IVE +  T  PVGSK +  +   + S+AT+RNDMA LEKLGLLEK HTSSGR+PS AG+K++ ++  +    DE     +   F      ++ +++++  I+SE T    + ++       L   D+V+++   A+ ++   +            + + +D+     I  +RL+D  + +I  K   +++ I + V++Y FV  + + ++F
  S:     2 ITQRQNDILNLIVELFTQTHEPVGSKAL--QRTIDSSSATIRNDMAKLEKLGLLEKAHTSSGRMPSPAGFKYFVEHSLRLDSIDEQDIYHVIKAFDFEAFKLEDMLQKASHILSEMTGYTSVILDVEPARQRLTGFDVVQLSNHDALAVMTLDESKPVTVQFAIPRNFLTRDLIAFKAIVEERLLDGSVMDIHYK---LRTEIPQIVQKY-FVTTDNVLQLF 217
>gi|117927991|ref|YP_872542.1| heat-inducible transcription repressor [Acidothermus cellulolyticus 11B] >gi|166219848|sp|A0LSZ6|HRCA_ACIC1 Heat-inducible transcription repressor hrcA >gi|117648454|gb|ABK52556.1| heat-inducible transcription repressor HrcA [Acidothermus cellulolyticus 11B] (339 aa)
Score = 224, Expect = 1.2e-16, Identities = 84/316 (26%), Positives = 158/316 (50%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFS--KPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTK-LPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHF------KDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKE-YEFVLQELIERIFQIKSKMIKTVHGQSSLLAVP-EFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDI---VFAQTDLNINEQNKTKLVMVAPTRVDY 319
           + +R+ E+L+ IVED+V+T  PVGSK ++E++   +S ATVRNDMA LE  G + + HTS+GRVP+  GY+ +    S  KP    E   ++    F    + +D VI  + +++++ T+ + +++        ++ ++++ ++    +++VIT  G + +  I         D + L++  +   I   R++D P   +AT  D      +         VL  L+     I+      V G ++L   P +F   E ++ +L+ LE   +  ++   +    S  L+  G+E  HE +       +      +    L +V P R+DY
  S:     2 LDERKLEVLRAIVEDFVSTNEPVGSKALVERHHLKVSPATVRNDMAALEDEGYIVQPHTSAGRVPTKKGYRLFVDRLSTIKPLSVAERRAIEH---FLAGAVDLDDVISRTVRLLAQLTRQVAVVQYPTLDRSAVRHLELIRLSGTRVLLVVITDTGRVEQRQIDLPGELEETDTAELRN-RLNAAIAGKRVVDVP-DLLATFADGEPPARRSAATAIVSAVLDALV-----IRRDERVVVGGAANLARFPTDF--PESVQPVLEALEEQVVLIRL-LGEATRPSEVLVRIGEEDVHEGLRSTAVVSSAYGSKGRALASLGVVGPMRMDY 318
>gi|77406318|ref|ZP_00783382.1| heat-inducible transcription repressor HrcA [Streptococcus agalactiae H36B] >gi|77175056|gb|EAO77861.1| heat-inducible transcription repressor HrcA [Streptococcus agalactiae H36B] (360 aa)
Score = 224, Expect = 1.3e-16, Identities = 67/221 (30%), Positives = 124/221 (56%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFY-EKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIE-NNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIF 224
           ITQRQ ++L  IVE +  T  PVGSK +  +   + S+AT+RNDMA LEKLGLLEK HTSSGR+PS AG+K++ E +     I+++++   ++  F      ++ +++++  I+SE T    + ++       L   D+V+++   A+ ++   +            + + +D+     I  +RL+D  + +I  K   +++ I + V++Y FV  + + ++F
  S:    18 ITQRQNDILNLIVELFTQTHEPVGSKAL--QRTIDSSSATIRNDMAKLEKLGLLEKAHTSSGRMPSPAGFKYFVEHSLRLDSIDEQDIYYVIK-AFDFEAFKLEDMLQKASHILSEMTGYTSVILDVEPARQRLTGFDVVQLSNHDALAVMTLDESKPVTVQFAIPRNFLTRDLIAFKAIVEERLLDGSVMDIHYK---LRTEIPQIVQKY-FVTTDNVLQLF 233
>gi|76787247|ref|YP_328819.1| heat-inducible transcription repressor [Streptococcus agalactiae A909] >gi|123602601|sp|Q3K3T4|HRCA_STRA1 Heat-inducible transcription repressor hrcA >gi|76562304|gb|ABA44888.1| heat-inducible transcription repressor HrcA [Streptococcus agalactiae A909] (344 aa)
Score = 224, Expect = 1.3e-16, Identities = 67/221 (30%), Positives = 124/221 (56%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFY-EKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIE-NNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIF 224
           ITQRQ ++L  IVE +  T  PVGSK +  +   + S+AT+RNDMA LEKLGLLEK HTSSGR+PS AG+K++ E +     I+++++   ++  F      ++ +++++  I+SE T    + ++       L   D+V+++   A+ ++   +            + + +D+     I  +RL+D  + +I  K   +++ I + V++Y FV  + + ++F
  S:     2 ITQRQNDILNLIVELFTQTHEPVGSKAL--QRTIDSSSATIRNDMAKLEKLGLLEKAHTSSGRMPSPAGFKYFVEHSLRLDSIDEQDIYYVIK-AFDFEAFKLEDMLQKASHILSEMTGYTSVILDVEPARQRLTGFDVVQLSNHDALAVMTLDESKPVTVQFAIPRNFLTRDLIAFKAIVEERLLDGSVMDIHYK---LRTEIPQIVQKY-FVTTDNVLQLF 217
>gi|21911069|ref|NP_665337.1| heat-inducible transcription repressor [Streptococcus pyogenes MGAS315] >gi|94991077|ref|YP_599177.1| heat-inducible transcription repressor [Streptococcus pyogenes MGAS10270] >gi|123382398|sp|Q1JFC6|HRCA_STRPD Heat-inducible transcription repressor hrcA >gi|25090563|sp|Q8K623|HRCA_STRP3 Heat-inducible transcription repressor hrcA >gi|21905278|gb|AAM80140.1| putative heat-inducible heat shock transcription repressor protein [Streptococcus pyogenes MGAS315] >gi|94544585|gb|ABF34633.1| Heat-inducible transcription repressor hrcA [Streptococcus pyogenes MGAS10270] (344 aa)
Score = 224, Expect = 1.3e-16, Identities = 67/221 (30%), Positives = 120/221 (54%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIE-NNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIF 224
           ITQRQ ++L  IVE +  T  PVGSK +  +   + S+AT+RNDMA LEKLGLLEK HTSSGR+PS AG+K++ ++  +    DE     +   F      ++ +++++  I+SE T    + ++       L   D+V+++   A+ ++   +            + + +D+     I  +RL+D  + +I  K   +++ I + V++Y FV  + + ++F
  S:     2 ITQRQNDILNLIVELFTQTHEPVGSKAL--QRTIDSSSATIRNDMAKLEKLGLLEKAHTSSGRMPSPAGFKYFVEHSLRLDSIDEQDIYHVIKAFDFEAFKLEDMLQKASHILSEMTGYTSVILDVEPARQRLTGFDVVQLSNHDALAVMTLDESKPVTVQFAIPRNFLTRDLIAFKAIVEERLLDSSVIDIHYK---LRTEIPQIVQKY-FVTTDNVLQLF 217
>gi|88855041|ref|ZP_01129706.1| heat-inducible transcription repressor [marine actinobacterium PHSC20C1] >gi|88815569|gb|EAR25426.1| heat-inducible transcription repressor [marine actinobacterium PHSC20C1] (340 aa)
Score = 224, Expect = 1.4e-16, Identities = 85/317 (26%), Positives = 165/317 (52%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFS--KPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTK-LPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSM---KSIIKEKVKEYEFVLQELIER---IFQIKSKMIKTV----HGQSSLLAVPEFQDTEK--LKEILQILESTSIWEQIA----FKQNQTGSNTLITFGDEVSHEDIVFAQTDLNI-------NEQNKTKLVMVAPTRVDYS 320
           ++ R  ++L+ IV+DYVAT  PVGSK ++E++   +SAAT+RNDM  LE   L+   HTSSGRVP+  GY+ +    +  +P  + +   ++    F  +   +D V+  + +++S+ T  + +++  +     ++ I++V ++    M + IT  G + + +I         D+S       + L D  + E+  K++S    +S+ +   +   F     +ER   + Q+ S +++ V    H +  L        TE+     I  +LE  +I EQ+     F + Q  S ++ T    +  E+  F   + ++       +     ++ ++ PTR+DYS
  S:     2 VSARGLDVLRVIVQDYVATREPVGSKSIVERHSFGVSAATIRNDMVLLEDEELITAPHTSSGRVPTDKGYRMFVDQLADLRPLTSAQRQAIE---SFLGQADDLDDVLARTVRLLSQLTNSVALVQYPSLATARVRHIELVPLSASRIMTVFITDSGRVEQRLI---------DVS-------EALDDVFLGEMRAKLNSALNGQSLPEAAERLANFADVFSVERRPVVSQVASSLVEQVLANRHDRLVLAGTANLARTEQDFSGSIFPVLE--AIEEQVTLLRLFGEMQVTSGSVST---RIGRENAEFGLEETSVVTGGYSSSGGGVARVGVLGPTRMDYS 320
>gi|77414670|ref|ZP_00790806.1| heat-inducible transcription repressor HrcA [Streptococcus agalactiae 515] >gi|77159289|gb|EAO70464.1| heat-inducible transcription repressor HrcA [Streptococcus agalactiae 515] (360 aa)
Score = 224, Expect = 1.4e-16, Identities = 67/221 (30%), Positives = 119/221 (53%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIE-NNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIF 224
           ITQRQ ++L  IVE +  T  PVGSK +  +     S+AT+RNDMA LEKLGLLEK HTSSGR+PS AG+K++ ++  +    DE     +   F      ++ +++++  I+SE T    + ++       L   D+V+++   A+ ++   +            + + +D+     I  +RL+D  + +I  K   +++ I + V++Y FV  + + ++F
  S:    18 ITQRQNDILNLIVELFTQTHEPVGSKAL--QRTIESSSATIRNDMAKLEKLGLLEKAHTSSGRMPSPAGFKYFVEHSLRLDSIDEQDIYHVIKAFDFEAFKLEDMLQKASHILSEMTGYTSVILDVEPARQRLTGFDVVQLSNHDALAVMTLDESKPVTVQFAIPRNFLTRDLIAFKAIVEERLLDGSVMDIHYK---LRTEIPQIVQKY-FVTTDNVLQLF 233
>gi|40643391|emb|CAD55134.1| heat inducible transcriptional repressor [Fusobacterium nucleatum subsp. polymorphum ATCC 10953] >gi|148323795|gb|EDK89045.1| heat shock transcriptional repressor HrcA [Fusobacterium nucleatum subsp. polymorphum ATCC 10953] (340 aa)
Score = 224, Expect = 1.4e-16, Identities = 94/332 (28%), Positives = 165/332 (49%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSK-PYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIE---NNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHF-----KDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEV---SHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEK 335
           I++R+K +L  IV+ Y+   + +GS+ +++KY   +S+AT+RN MA LE +G +EK HTSSGR+P+  GYK+Y     K   I  E ++  + NV+  R   ++ +++++  ++S+ T    I +E   +N +V   R+++V I++   M I++  D  +    IH      K++   K   +  +I N+ +    I +I         II E   E      EL +        M+K  +       +  F + + ++E+ +      + EQ A  Q  + SN  +  GDE+     ED  F  +  +I        VM  P R+ YSK  GL+  +  E  K
  S:     3 ISEREKLVLNAIVDYYLTVGDTIGSRTLVKKYGIELSSATIRNVMADLEDMGFIEKTHTSSGRIPTDMGYKYYLTELLKVEKITQEEIE-NISNVYNRRVDELENILKKTSTLLSKLTNYAGIAVEPKPDNKKV--SRVELVYIDEYLIMAIIVMDDRRVKTKSIHLPYPITKEEVEKKADELNAKIRNNEI---AINDIEKFFTESTDIIYEYDDE-----DELSKYFINNLPSMLKNENIAGVTDVIEFFNERKDIRELFE-----KLIEQKA--QENSKSNVNVILGDELGIKELEDFSFVYSIYDIGGAQGIIGVM-GPKRMAYSKTMGLINHVSREVNK 327
>gi|118593716|ref|ZP_01551091.1| heat-inducible transcription repressor [Stappia aggregata IAM 12614] >gi|118433726|gb|EAV40388.1| heat-inducible transcription repressor [Stappia aggregata IAM 12614] (357 aa)
Score = 223, Expect = 1.5e-16, Identities = 76/328 (23%), Positives = 167/328 (50%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSK--PYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKT------VHGQSSLLA-VPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKTKLV----MVAPTRVDYSKIKGLLEF 328
           + ++ +R +E+ + IVE Y+ T  PVGS+ V  K   ++S A+VRN M+ LE LGLL   HTS+GR+P+  G +F+     +      DE   +  +   + +  S + V+ E+ +++S  +    + + + +++ LK I+ V I    A+ I+++ DG++   ++    D     +       N ++    + EI ++++ ++   +    E + + Q++I+    +      T      V G+S+LL  +   +D E+++ +   LES     Q+     + G    I  G E +   +  +   ++    +  ++V    ++ PTR++Y+++  ++++
  S:    11 LSDLDKRSREIFRSIVETYLETGEPVGSRNVSRKLGISLSPASVRNVMSDLEHLGLLHSPHTSAGRLPTEIGLRFFVDALLEVGDLTQDERRAIDAQVRASQKANSAEQVLTEASQMLSGLSMGAGVVLTHKSDMRLKHIEFVRIEPLKALAILVSEDGSVENRVVDLPGDLPSSALVEASNYLNAQIKGRTLSEIRSELERVRDADQ---AELDLLSQKVIDAGLAVWGGESATDPGTLIVRGRSNLLTDLDAVEDLERIRLLFDDLESKKDLIQL-LGLAEKGDGVRIFIGSENNLFSLSGSSLVVSPYRDSNQRIVGVLGVIGPTRLNYARVIPMVDY 347
>gi|25010169|ref|NP_734564.1| heat-inducible transcription repressor [Streptococcus agalactiae NEM316] >gi|46576579|sp|Q8E7Q9|HRCA_STRA3 Heat-inducible transcription repressor hrcA >gi|23094520|emb|CAD45739.1| Unknown [Streptococcus agalactiae NEM316] (344 aa)
Score = 223, Expect = 1.5e-16, Identities = 67/221 (30%), Positives = 119/221 (53%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIE-NNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIF 224
           ITQRQ ++L  IVE +  T  PVGSK +  +     S+AT+RNDMA LEKLGLLEK HTSSGR+PS AG+K++ ++  +    DE     +   F      ++ +++++  I+SE T    + ++       L   D+V+++   A+ ++   +            + + +D+     I  +RL+D  + +I  K   +++ I + V++Y FV  + + ++F
  S:     2 ITQRQNDILNLIVELFTQTHEPVGSKAL--QRTIESSSATIRNDMAKLEKLGLLEKAHTSSGRMPSPAGFKYFVEHSLRLDSIDEQDIYHVIKAFDFEAFKLEDMLQKASHILSEMTGYTSVILDVEPARQRLTGFDVVQLSNHDALAVMTLDESKPVTVQFAIPRNFLTRDLIAFKAIVEERLLDGSVMDIHYK---LRTEIPQIVQKY-FVTTDNVLQLF 217
>gi|88809893|ref|ZP_01125399.1| Negative regulator of class I heat shock protein [Synechococcus sp. WH 7805] >gi|88786277|gb|EAR17438.1| Negative regulator of class I heat shock protein [Synechococcus sp. WH 7805] (357 aa)
Score = 223, Expect = 1.5e-16, Identities = 78/326 (23%), Positives = 161/326 (49%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFY-EKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKL-PMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLI---DCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSH---EDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFI 329
           + QRQ+++L+  V  YV T  PVGSK +++++    S+ATVR+ M  LE+ GLL + H S+GR+PS  GY+ Y +    KP     +L+ +L  + + R  ++D ++++  + +++ T L  +I +   TE  L  I +V   ++  +++++ +D + T ++           ++   R  +D+L        + +  ++ +    ++E ++  +          F   S+    VHG S L+A PEF D+ K++ +L +++        AF  +    +  +  G E  H    D    Q+          ++ +V P R+ Y+  +  ++ +
  S:    31 LPQRQQDVLQATVHHYVDTIEPVGSKTLVQRFGLQASSATVRSAMGALEQKGLLVQPHPSAGRIPSAKGYRHYVDCLLPKPGAAVHHLEQELTQL-SLRWAALDDLLQQLARRLTDFTGLMSLITVPQPTERRLHAIRLVRTEER--LLVMLVADSSQTHHLNLRLPHGSAHQVAALERWTDDQLRRSGQLGWESLPQQLQTCGQALREALEHKD---------PFIGPSEQGAHVHGVSRLVAQPEFSDSAKVRPLLDLMDCNP----AAFIPSDPSRDDCVWIGGEHPHTALSDCSVIQSSYRSGGGGVGQVALVGPMRMAYATARAAVQSV 348
>gi|153812685|ref|ZP_01965353.1| hypothetical protein RUMOBE_03092 [Ruminococcus obeum ATCC 29174] >gi|149831201|gb|EDM86290.1| hypothetical protein RUMOBE_03092 [Ruminococcus obeum ATCC 29174] (346 aa)
Score = 223, Expect = 1.5e-16, Identities = 80/337 (23%), Positives = 167/337 (49%)
  Q:     2 KEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLP-MIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKN-IIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKT--------VHGQSSLLAVPEFQDTEKLKEILQILES-TSIWEQIAFKQNQTGSNTLITFGDEV---SHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEKGWK 338
           +++T R+K +LK I++ Y+ T  PVGS+ + +    N+S+AT+RN+M+ L  +G + + HTS+GR+PS  GY+ Y     +     E+   ++RN+  ++T  ++ V++   ++++ +T    M+ +   +   LK I +  +N +  +V V+  +GN+ +N II   ++   + +     + N  L   PI++I   + +       ++KE   +   L+ R+    +  I            G ++    PE  D  K  E++   E    + + +  +     +   +  GDE+   + +D         + E     + +V P R+DY  +   L+ +K E ++ +K
  S:     3 EQLTDRKKRILKAIIKTYMETGEPVGSRTISKDADLNVSSATIRNEMSDLTDMGYIVQPHTSAGRIPSDKGYRLYVDELMR---EKEDEIAEIRNLMIEKTDKMEKVLKNVARVLASNTNYATMVSVPQYSGNKLKFIQLSRVN-ELQLVAVVVCEGNVIRNQIIDLDEEMDDETLLKLNLLLNTNLNGLPIQDINLGMIA-------RLKEQAGIHSGLVARVLDAVAATIHVDEDDLEIYTSGATNFFKYPELSDKTKATELISTFEEKQQLVDLVKERMADDNTGVQVYIGDELPISTMKDCSVVTATYELGEGMHGTIGIVGPKRMDYENVVNSLKTLKVELDEVFK 342
>gi|149026399|ref|ZP_01836537.1| heat-inducible transcription repressor HrcA [Streptococcus pneumoniae SP23-BS72] >gi|147929282|gb|EDK80282.1| heat-inducible transcription repressor HrcA [Streptococcus pneumoniae SP23-BS72] (344 aa)
Score = 223, Expect = 1.6e-16, Identities = 83/319 (26%), Positives = 158/319 (49%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIE-NNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDS-MKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSL-----LAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKI 322
           +T+RQ+++L  I++ +  T  PVGSK + E    N S+AT+RNDMA LEK GLLEK HTSSGR+PS AG+++Y K+    +   EN   ++   F      ++ +++E+  ++++ +   ++ ++   +   L   D+V + + +A+ +    +     +      + + +D+     I  +R +   + +I  KI + +  II+      + V+ +L E IF+        + G+ +L     LA  +F D  + K  L+I E          +++Q   N  I  G E    D+    +   I  +    L ++ P  +DY ++
  S:     2 VTERQQDILNLIIDIFTKTHEPVGSKALQESI--NSSSATIRNDMAELEKQGLLEKAHTSSGRMPSVAGFQYYVKHSLDFHRLAENEVYEIVKAFDQEFFKLEDILQEAANLLTDLSGCTVVALDVEPSRQRLTAFDIVVLGQHTALAVFTLDESRTVTSQFLIPRNFLQEDLLKLKSIIQERFLGHTVLDIHYKIRTEIPQIIQRYFTTTDNVI-DLFEHIFKEMFNENIVMAGKVNLLNFANLAAYQFFDQPQ-KVALEIRE--------GLREDQM-QNVRIADGQESCLADLAVISSKFLIPYRGVGILAIIGPVNLDYQQL 314
>gi|116511769|ref|YP_808985.1| heat-inducible transcription repressor [Lactococcus lactis subsp. cremoris SK11] >gi|122940223|sp|Q02ZQ9|HRCA_LACLS Heat-inducible transcription repressor hrcA >gi|116107423|gb|ABJ72563.1| heat-inducible transcription repressor HrcA [Lactococcus lactis subsp. cremoris SK11] (347 aa)
Score = 223, Expect = 1.6e-16, Identities = 82/326 (25%), Positives = 151/326 (46%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIEN-NTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDS-MKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQIL-ESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFI 329
           IT+RQ+++L  IV  Y     P+GSK +++      S+AT+RNDM  LE+LGL++K HTSSGR+PS +GYK++ +N  +     +N   K+   F      +  + + + K +SE T L    +     +  L   +MV ++  S + ++    G +  N           D+++   +  +RL+   + +I   + + +  I++   K    VLQ L E IF    K   TV G+ ++        T+ L E+ ++  +   +  +I    N      +    DE   +++        I  +    L +V P  +DY +   +L+ +
  S:     2 ITERQRQILNLIVSLYAKDHTPIGSKSLLDSIQA--SSATIRNDMKALERLGLIQKEHTSSGRIPSVSGYKYFVENVIQLEEFSQNDLFKVMKAFDGDFYRLSDLFKTAAKSLSELTGLTSFVLNAPQRDQQLVSFEMVILDNHSVLSVITLGTGEVRTNQFILPKSMTEADLAVFSNLVKERLVGKKVIDIHYTLRTEIPQIVQRYFKVTSEVLQ-LFESIFDDLFKEHLTVAGRKNIFDYA----TDNLAELYKLFSDDERMLHEIREITNNDEMRAVKFDNDEKFMKNLTIISQKFVIPYRGFGTLTVVGPVEMDYQRTLSVLDLV 323
>gi|77412046|ref|ZP_00788373.1| heat-inducible transcription repressor HrcA [Streptococcus agalactiae CJB111] >gi|77161903|gb|EAO72887.1| heat-inducible transcription repressor HrcA [Streptococcus agalactiae CJB111] (360 aa)
Score = 223, Expect = 1.6e-16, Identities = 67/221 (30%), Positives = 120/221 (54%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIE-NNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIF 224
           ITQRQ ++L  IVE +  T  PVGSK +  +   + S+AT+RNDMA LEKLGLLEK HTSSGR+PS AG+K++ ++  +    DE     +   F      ++ +++++  I+SE T    + ++       L   D+V+++   A+ ++   +            + + +D+     I  +RL+D  + +I  K   +++ I + V++Y FV  + + ++F
  S:    18 ITQRQNDILNLIVELFTQTHEPVGSKAL--QRTIDSSSATIRNDMAKLEKLGLLEKAHTSSGRMPSPAGFKYFVEHSLRLDSIDEQDIYHVIKAFDFEAFKLEDMLQKASHILSEMTGYTSVILDVEPARQRLTGFDVVQLSNHDALAVMTLDESKPVTVQFAIPRNFLTRDLIAFKAIVEERLLDGSVIDIHYK---LRTEIPQIVQKY-FVTTDNVLQLF 233
>gi|15672934|ref|NP_267108.1| heat-inducible transcription repressor [Lactococcus lactis subsp. lactis Il1403] >gi|13878527|sp|Q9CGZ0|HRCA_LACLA Heat-inducible transcription repressor hrcA >gi|12723889|gb|AAK05050.1|AE006329_9 heat-inducible transcription repressor HrcA [Lactococcus lactis subsp. lactis Il1403] (347 aa)
Score = 223, Expect = 1.7e-16, Identities = 83/326 (25%), Positives = 150/326 (46%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIEN-NTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDS-MKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQIL-ESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFI 329
           IT+RQ+++L  IV  Y     P+GSK +++      S+AT+RNDM  LEKLGL++K HTSSGRVPS +GYK++ +N  +     +N   K+   F      +  + + + K +S  T L    +     +  L   +MV ++  S + ++    G +  N           D+++   +  +RL+   + +I   + + +  I++   K    VLQ L E IF    K   TV G+ ++        T+ L E+ ++  +   +  +I    N      +    DE   +++        I  +    L +V P  +DY +   +L+ +
  S:     2 ITERQRQILNLIVSLYAKEHTPIGSKSLLDSIQA--SSATIRNDMKVLEKLGLIQKEHTSSGRVPSVSGYKYFVENVIQLDEFSQNDLFKVMKAFDGDFYRLSDLFKTAAKSLSGLTGLTSFVLNAPQRDQQLVSFEMVMLDSHSVLSVITLGTGEVRTNQFILPKSMTEADLAVFSNLVKERLVGKKVIDIHYTLRTEIPQIVQRYFKVTSEVLQ-LFESIFDDLFKERLTVAGRKNIFDYA----TDNLAELYKLFSDDERMLHEIREITNNDEMRAVKFDNDEKYMKNLTIISQKFVIPYRGFGTLTVVGPVEMDYQRTLSVLDLV 323
>gi|27468187|ref|NP_764824.1| heat-inducible transcriptional repressor [Staphylococcus epidermidis ATCC 12228] >gi|57867039|ref|YP_188726.1| heat-inducible transcription repressor HrcA [Staphylococcus epidermidis RP62A] >gi|38258088|sp|Q8CP15|HRCA_STAES Heat-inducible transcription repressor hrcA >gi|71152134|sp|Q5HNW4|HRCA_STAEQ Heat-inducible transcription repressor hrcA >gi|27315733|gb|AAO04868.1|AE016748_102 Heat-inducible transcriptional repressor [Staphylococcus epidermidis ATCC 12228] >gi|57637697|gb|AAW54485.1| heat-inducible transcription repressor HrcA [Staphylococcus epidermidis RP62A] (325 aa)
Score = 222, Expect = 2.2e-16, Identities = 87/326 (26%), Positives = 161/326 (49%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRN--VFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISIC-IRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEV--SHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFI 329
           IT+RQ  +L  IVEDYV    P+GSK +I ++  ++S AT+RN+M  LE++  +EK HTSSGRVPS +G ++Y     +   +    K++  N  +  +   S   +   + ++  +S    ++   N+ + ++  I ++  N    +++++ S G++    IHF   + L +I++  I  F         K +   I+S  S  +E +   E V  E+I      +S  I  + G+  L+      +   ++ ILQ +ES  I E +   ++ + S   +  G E+  S  DI    +  + +E  K ++ ++ PT + Y  +  LL  I
  S:     2 ITKRQLSILNAIVEDYVDFGQPIGSKTLIHRHHLDVSPATIRNEMKQLEEMHFIEKTHTSSGRVPSESGIRYYVNRLLEQTSHQSQNKIQRLNQLLIENHYDSSTALTNFAHELSMKSQYATLVVRPNHKQDVINDIHLIRANNHLIILVMVFSSGHVEN--IHFVSHAQLNNINLNKIANFLTEHFSFNRKVLTQNIESYFSQKEELLLANEVV--EMINLQIGNQSNSI-YMGGKVKLIDALNESNVSSIQPILQYIESNKITELL---EDISTSQINVRIGKEIDDSLSDISIVTSQYHFDESLKGQIAVIGPTAMHYQNVIQLLNRI 324
>gi|163765098|ref|ZP_02172131.1| heat-inducible transcription repressor HrcA [Anaeromyxobacter sp. K] >gi|167458509|ref|ZP_02324711.1| heat-inducible transcription repressor HrcA [Anaeromyxobacter dehalogenans 2CP-1] >gi|167415266|gb|EDR81998.1| heat-inducible transcription repressor HrcA [Anaeromyxobacter dehalogenans 2CP-1] >gi|196174695|gb|ACG75668.1| heat-inducible transcription repressor HrcA [Anaeromyxobacter sp. K] (353 aa)
Score = 222, Expect = 2.3e-16, Identities = 76/334 (22%), Positives = 161/334 (48%)
  Q:     3 EITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSK---PYINDENLKLKLRNVFADRTMSIDVVIEESCKII-SESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIK-------TVHGQSSLLAVPEFQDTEKLKEILQ-ILESTSIWEQIAFKQNQTGSNTLITFGDE---VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEKG 336
           E+ +R++E+L+ +V+DY+ T  PV S+ ++ ++    S ATVR+ MA LE LG LEK H SSGR+P+  GY+ +     K   P + D +   +L     D    +  +IE +  ++ S S    ++         +++++ V + +   +V+ ++  G +T  ++  +      ++       N++L     +  A ++ ++++ I   ++  +  L +L+++   +  +           + G+SS L  PEF D +K + +L+   E   I       +  T     I  G E    +  D+          ++    L +V PTR++Y+++  L++    +  + 
  S:     6 ELDRREREILRALVQDYIHTGEPVASQPLLSRHELEWSPATVRSVMADLEALGFLEKPHASSGRIPTERGYRLFVDTMLKVRPPSVADRDRIERLAQAAPD----VSSLIEGTADLLHSLSHHAGVVTTPRPQADPVRQLEFVRLRENRVLVVFVSEAGIVTNKLVQLEFAMEPAELERAAAYLNEKL---HARADAAELAALRAAILTDMRADQSALHDLLQKALVLAEQSFAGTGVEKVVMEGESSFLDAPEFSDVQKARALLRGFAEKDRILR--VLDRVLTAQEVQIFIGAESEFATVPDVSVVAAPYGRGDRVLGTLAVVGPTRMNYARVIPLVDLTARQISRA 345
>gi|148990037|ref|ZP_01821291.1| heat-inducible transcription repressor HrcA [Streptococcus pneumoniae SP6-BS73] >gi|168482757|ref|ZP_02707709.1| heat-inducible transcription repressor HrcA [Streptococcus pneumoniae CDC1873-00] >gi|147924563|gb|EDK75650.1| heat-inducible transcription repressor HrcA [Streptococcus pneumoniae SP6-BS73] >gi|172043634|gb|EDT51680.1| heat-inducible transcription repressor HrcA [Streptococcus pneumoniae CDC1873-00] (344 aa)
Score = 222, Expect = 2.3e-16, Identities = 78/319 (24%), Positives = 155/319 (48%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIE-NNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDS-MKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKI 322
           +T+RQ+++L  I++ +  T  PVGSK + E    N S+AT+RNDMA LEK GLLEK HTSSGR+PS AG+++Y K+    +   EN   ++   F      ++ +++E+  ++++ +   ++ ++   +   L   D+V + + +A+ +    +     +      + + +D+     I  +R +   + +I  KI + +  II+      + V+ +L E IF+        + G+ +LL     +  +   +  ++  +  I E +   Q Q   N  +  G E    D+    +   I  +    L ++ P  +DY ++
  S:     2 VTERQQDILNLIIDIFTKTHEPVGSKALQESI--NSSSATIRNDMAELEKQGLLEKAHTSSGRMPSVAGFQYYVKHSLDFHRLAENEVYEIVKAFDQEFFKLEDILQEAANLLTDLSGCTVVALDVEPSRQRLTAFDIVVLGQHTALAVFTLDESRTVTSQFLIPRNFLQEDLLKLKSIIQERFLGHTVLDIHYKIRTEIPQIIQRYFTTTDNVI-DLFEHIFKEMFNENIVMAGKVNLLNFANLEAYQFFDQPQKV--ALEIREGLREDQMQ---NVRVADGQESCLADLAVISSKFLIPYRGVGILAIIGPVNLDYQQL 314
>gi|85374030|ref|YP_458092.1| heat-inducible transcription repressor [Erythrobacter litoralis HTCC2594] >gi|122544510|sp|Q2NAJ6|HRCA_ERYLH Heat-inducible transcription repressor hrcA >gi|84787113|gb|ABC63295.1| transcriptional regulator [Erythrobacter litoralis HTCC2594] (346 aa)
Score = 222, Expect = 2.4e-16, Identities = 77/335 (22%), Positives = 171/335 (51%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNF---SKPYIND-ENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDS--ILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQI-----KSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILES-TSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNI------NEQNKTKLVM--VAPTRVDYSKIKGLLEFIKNEFEK 335
           + E+T R + + + +VE Y+ +  PVGSK + ++   ++S A++R+ +A LE +GLL   HTS+GR+P+  G + +       ++P   + E +  +L+     R+  I+  +E +  ++S+ +    + +  + E  L +I +V + +  A+ +++  DG +   +I   D    +L+ +S        RL     + +A    +M+  I +     +   Q L+ER   +       + +  V GQ++LL     +D ++++ +L  LE+  S+ E +   ++   +   I        E+ +FA +  ++      + + K   V+  + PTR++Y+++  +++F      K
  S:     6 VTELTDRARAIFQLVVEGYLESGQPVGSKTLSQEQSLDLSPASIRSVLADLESIGLLAAPHTSAGRMPTETGLRLFVDGMMQVAEPTRAEREAIAQRLK-----RSGPIEQALEATSSMLSDLSGAAGMVMVPSREPRLAQISLVPLGQGKALAVLVGEDGAIENRVIETGDTPAHVLEQVS---NFITARLAG---RTLAEATAAMRKEIADGKSALDTASQNLVERGLAVWTEDAAERPVLIVRGQANLLDESALEDLDRVRSLLDDLENKQSVAELLETARDAEATRIFI------GSENRLFALSGSSVIASPYRDREGKVVGVLGVIGPTRLNYARVVPMVDFTARSLGK 343
>gi|86747552|ref|YP_484048.1| heat-inducible transcription repressor [Rhodopseudomonas palustris HaA2] >gi|123409017|sp|Q2J323|HRCA_RHOP2 Heat-inducible transcription repressor hrcA >gi|86570580|gb|ABD05137.1| heat-inducible transcription repressor HrcA [Rhodopseudomonas palustris HaA2] (362 aa)
Score = 222, Expect = 2.5e-16, Identities = 78/328 (23%), Positives = 169/328 (51%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEK------NFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELI---------------ERIFQIKSKMIKTVHGQSSLLAVPE-FQDTEKLKEILQILESTSIWEQIAF---KQNQ----TGSNTLIT-FGDEVSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEF 328
           + ++ +R +++ + IVE Y+AT  PVGS+ +       +S A+VRN MA LE+LGL+   HTS+GR+P+  G +F+        + ++P    ++++ +L +V   R  +++  + E+   +S  T+   + +   + V LK ++ V +  + A+VI++  DG +   ++          ++      N R+    + E   ++++M S   +   E + + Q++I               + I +  + +++ +H    L  V   F D E  + ++ +L      E +      +N+    +GS+T+I  + D   H  IV               L ++ PTR++Y+++  ++++
  S:    16 LAQLNERSRDIFRQIVESYLATGEPVGSRNISRLISMPLSPASVRNVMADLEQLGLIYAPHTSAGRLPTELGLRFFVDALMQVGDLTEP--ERQSIQAQLSSV--GRAQTVEAALGEALTRLSGLTRAAAVVLTAKSNVRLKHLEFVRLEPERALVILVAEDGQVENRVLALPPGVPSSALTEASNFLNARIRGRTLAEARLELETMLS---QDRTELDQLTQKVISAGIASWSGGDGEDRQLIVRGHANLLEDLHAMEDLERVRRLFDDLETKRGVVDLLGRAESAEGVRIFIGSENKLFSLSGSSTIIAPYSDGAGH--IVGV-------------LGVIGPTRLNYARVIPMVDY 351
>gi|169824479|ref|YP_001692090.1| heat-inducible transcription repressor [Finegoldia magna ATCC 29328] >gi|167831284|dbj|BAG08200.1| heat-inducible transcription repressor [Finegoldia magna ATCC 29328] (348 aa)
Score = 221, Expect = 2.6e-16, Identities = 84/318 (26%), Positives = 166/318 (52%)
  Q:     2 KEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFA-------DRTMSIDVVIEESCKIISESTKLPMIK-IENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRL-IDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIV---FAQTDLNINEQNKTKLVMVAPTRVDY 319
           + +TQR+  +L   +++Y+ TA P+GS+V+ + Y    S AT+RN+M+ L  LG L ++H SSGR+PS   ++ Y       YI D+  K    +          +R +  + +I+ S + ISE T+ P+I  ++ + ++ L  I+++ I++ + +++ +   G+L   +I   +  I ++  I I     +L +   + E+   ++   S  K     ++  + E+IE      S M  +V G S++    E+ D  K++ I++ LE     ++I    N + +   I  GDE + + +V     ++    N+ N   + +VAP R++Y
  S:     3 EHLTQRKFNILLATIDNYIKTAQPIGSRVLSKNYNIGFSPATIRNEMSDLGDLGYLVQSHISSGRIPSQKAFRLYVD-----YILDKLYKSDESSSSLMSIRKPYERIVEPEKLIKSSSQFISEITQYPVISMLKKSDKMRLSHIELLPISEYNYVLLTLYDSGDLNHTVIS-SEQIIEQNELIKINFLLKKLFLGKNLNEVYDNLEEFSSKYKYN-DLFKGAITEIIENEKDKLSSMYVSVEGLSNIFKYSEYNDLSKVQSIIEYLEDK---DKIVSILNSSDNFLDIKVGDENNEQPLVENTIIKSSYFFNKNNIGVIAIVAPMRMNY 322
>gi|19746716|ref|NP_607852.1| heat-inducible transcription repressor [Streptococcus pyogenes MGAS8232] >gi|50914840|ref|YP_060812.1| heat-inducible transcription repressor [Streptococcus pyogenes MGAS10394] >gi|71904151|ref|YP_280954.1| heat-inducible transcription repressor [Streptococcus pyogenes MGAS6180] >gi|94994956|ref|YP_603054.1| heat-inducible transcription repressor [Streptococcus pyogenes MGAS10750] >gi|139473220|ref|YP_001127935.1| heat-inducible transcription repressor [Streptococcus pyogenes str. Manfredo] >gi|122986819|sp|Q1J576|HRCA_STRPF Heat-inducible transcription repressor hrcA >gi|123761397|sp|Q48RR1|HRCA_STRPM Heat-inducible transcription repressor hrcA >gi|166220405|sp|A2RCW4|HRCA_STRPG Heat-inducible transcription repressor hrcA >gi|24211773|sp|Q8NZM6|HRCA_STRP8 Heat-inducible transcription repressor hrcA >gi|61213306|sp|Q5XAD4|HRCA_STRP6 Heat-inducible transcription repressor hrcA >gi|19748941|gb|AAL98351.1| putative heat shock transcription repressor protein [Streptococcus pyogenes MGAS8232] >gi|50903914|gb|AAT87629.1| Heat-inducible transcription repressor [Streptococcus pyogenes MGAS10394] >gi|71803246|gb|AAX72599.1| heat-inducible transcription repressor [Streptococcus pyogenes MGAS6180] >gi|94548464|gb|ABF38510.1| Heat-inducible transcription repressor hrcA [Streptococcus pyogenes MGAS10750] >gi|134271466|emb|CAM29687.1| heat-inducible transcription repressor HrcA [Streptococcus pyogenes str. Manfredo] (344 aa)
Score = 221, Expect = 2.8e-16, Identities = 66/221 (29%), Positives = 120/221 (54%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIE-NNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIF 224
           ITQRQ ++L  IVE +  T  PVGSK +  +   + S+AT+RNDMA LEKLGLLEK HTSSGR+PS AG+K++ ++  +    DE     +   F      ++ +++++  I++E T    + ++       L   D+V+++   A+ ++   +            + + +D+     I  +RL+D  + +I  K   +++ I + V++Y FV  + + ++F
  S:     2 ITQRQNDILNLIVELFTQTHEPVGSKAL--QRTIDSSSATIRNDMAKLEKLGLLEKAHTSSGRMPSPAGFKYFVEHSLRLDSIDEQDIYHVIKTFDFEAFKLEDMLQKASHILAEMTGYTSVILDVEPARQRLTGFDVVQLSNHDALAVMTLDESKPVTVQFAIPRNFLTRDLIAFKAIVEERLLDSSVIDIHYK---LRTEIPQIVQKY-FVTTDNVLQLF 217
>gi|121603818|ref|YP_981147.1| heat-inducible transcription repressor [Polaromonas naphthalenivorans CJ2] >gi|120592787|gb|ABM36226.1| heat-inducible transcription repressor HrcA [Polaromonas naphthalenivorans CJ2] (337 aa)
Score = 221, Expect = 3.0e-16, Identities = 71/319 (22%), Positives = 152/319 (47%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEI----ATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEF-QDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDE---VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKI 322
           +  R + LLK +VE Y+A   PVGS+ + +     +S AT+RN M+ LE LGL+   HTS+GR+P+  GY+ +         +  ++  ++  +  D+ +    VI  +  ++S  ++   + +      + + I+ + ++++  +VI+++ DG++   +I  + D     +       N       I+E+      ++++++  I   ++E   V  E IE      S+    V G+ +LLAV +F  D   L+++  + E  +   ++    +       I  G E   + ++++        ++ Q    L ++ P R+ Y K+
  S:     2 LDSRARLLLKALVERYIADGQPVGSRTLSKASGLELSPATIRNVMSDLEDLGLIVSPHTSAGRIPTARGYRLFVDTMLTTQRDPFSVAGQMARIAPDQPLK---VISNAAHMLSSLSQFVGVVMAPRRTSVFRHIEFLRLSEKRFLVIIVSPDGDVQNRVIFTETDYTASQLIEASNFLNSHYAGMAIEEVRERLKNEVEALRGEIATLMQEAVLVSSEAIE------SRDEVVVSGERNLLAVSDFSSDMGNLRKLFDLFEQKAQLMRL-LDVSSRAEGVRIYIGGESQVIPYQELSVVTAPYEVDGQVVGTLGVIGPMRMPYEKM 318
>gi|167758845|ref|ZP_02430972.1| hypothetical protein CLOSCI_01188 [Clostridium scindens ATCC 35704] >gi|167663585|gb|EDS07715.1| hypothetical protein CLOSCI_01188 [Clostridium scindens ATCC 35704] (347 aa)
Score = 220, Expect = 3.4e-16, Identities = 79/332 (23%), Positives = 168/332 (50%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLP-MIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLID-CPIKEIATKIDSMKSIIKEKVKEYEFVLQELIER---IFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLIT--FGDEV---SHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEK 335
           ++ R+ ++L  I+++Y+ T  PVGS+ + +    N+S+AT+RN+MA LE++G + + HTS+GR+PS  GY+ Y     +     E    +++    D+   +D ++ ++ K+++ ST    M+    N E  LK I +  ++ +  ++ VI   GN+ KN I   D+ I  +  + + +  +  ++   I+EI      + + +KE+   +  V+  +++    + Q+   M     G +++   PE  D +  +EI+   E      ++  +      NT I    GDE    + +D         + +  K  + ++ P R+DY  +   ++ +++E ++
  S:     7 LSDRKLKILHAIIQNYLETGEPVGSRTISKYTDLNLSSATIRNEMADLEEMGYIMQPHTSAGRIPSDKGYRLYVDMLME---EKEQELSEMQEQMLDKADKMDQLLRQAAKVLANSTNYATMVSTPMNNENKLKFIQLSMVDDEQ-IIAVIVLGGNVIKNKIIDIDEPISNENLLKLNMLLNTTLNGMSIEEINL---GLIARLKEQAGIHSEVVGNVLDAVADVIQVDDDMQIYTSGATNIFKYPELSDNQSAQEIISAFEEKQQLSELVTQTLSQEDNTGIQVYIGDETPVKTMKDCSVVTATYELGDGMKGTIGIIGPKRMDYEHVLKSMKRLQSELDE 341
>gi|158425911|ref|YP_001527203.1| heat-inducible transcription repressor [Azorhizobium caulinodans ORS 571] >gi|158332800|dbj|BAF90285.1| negative regulator of class I heat shock protein [Azorhizobium caulinodans ORS 571] (366 aa)
Score = 220, Expect = 3.9e-16, Identities = 81/328 (24%), Positives = 165/328 (50%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFAD-----RTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKS-------KMIKTVHGQSSLLA-VPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKTKLV----MVAPTRVDYSKIKGLLEF 328
           + +I +R +E+ + IVE Y+AT  PVGS+ +       +S A+VRN MA LE  GL+   HTS+GR+P+  G +F+     +  I D N + + RN+ A      +  +++ V++E+  ++S  ++   +     T+ LLK ++ V ++   A+VI+++ DG +   ++          +       N  +    + E   +   M++++ E  +E + +   ++E      S       K+I  V GQ+ LL  +   +D E+++ +   LE+      +   + + G    I  G E     +  + T +      + ++V    ++ PTR++Y +I  +++F
  S:    14 LAQIDERSREIFRQIVESYLATGEPVGSRNIARLIPMTLSPASVRNVMADLEAAGLIYAPHTSAGRLPTERGLRFFVDALLE--IGDVNERDR-RNIEAQVAAAAKGHTVEGVLQEASALLSGLSRGAGVVTATKTDPLLKHVEFVPLDVGRALVILVSEDGQVENRVLPLPPGLPAAALMEAGNFLNAHIRGRTLGEARAE---METLLAEVRRELDTLTARVVEDGLASWSDEGPGERKLI--VRGQAKLLEDLHALEDLERIRLLFDDLEAKRDVVDL-LGRAEEGQALRIFIGSENKLFSMSGSSTIVAPYRDGQGRVVGVLGVIGPTRLNYGRIVPMVDF 349
>gi|163707763|ref|ZP_02124724.1| heat-inducible transcription repressor HrcA [Methylobacterium nodulans ORS 2060] >gi|162427864|gb|EDQ38538.1| heat-inducible transcription repressor HrcA [Methylobacterium nodulans ORS 2060] (367 aa)
Score = 220, Expect = 4.1e-16, Identities = 73/328 (22%), Positives = 165/328 (50%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSK--PYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIE----RIFQIKSKMIKTVHGQSSLLA-VPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNI----NEQNKTKLV----MVAPTRVDYSKIKGLLEF 328
           + E+ +R +E+ + IVE Y+AT  PVGS+ +       +S A+VRN MA LE+ GL+   HTS+GR+P+  G +F+     +      +E  +++ +   A    + +  + E+  ++S  ++   + +       L+ ++ V ++   A+V++++ DG++   ++          +       N R+    + E+  +I++ +  +K   +E + + + L++    R      +    V GQ++LL  +   +D E+++ +   LES    + I       G   +  F   +  E+ +F+ +  ++        + K+V    ++ PTR++Y++I  +++F
  S:    19 LAELNERSREIFRQIVESYLATGEPVGSRNLARILPMTLSPASVRNVMADLEQAGLIYAPHTSAGRLPTETGLRFFVDALLELGDVGQEEQGRIEAQMRAAASRHTFETALTEASVMLSGISRGAGVVVTTKQNANLRHVEFVRLDPGRALVVLVSEDGSVENRLVDLPPGLPAGALQEASNFLNARIRGRTLGEVRAEIEASREAMK---RELDALTERLVDAGLARSVGPSEERHLIVRGQANLLEDLRAAEDLERIRLLFSDLESQK--DVIDLLTRAEGGEGVRIF---IGSENKLFSLSGSSMIAAPFHDGRQKIVGVVGVIGPTRLNYARIVPMVDF 353
>gi|70726335|ref|YP_253249.1| heat-inducible transcriptional repressor [Staphylococcus haemolyticus JCSC1435] >gi|123660343|sp|Q4L6T2|HRCA_STAHJ Heat-inducible transcription repressor hrcA >gi|68447059|dbj|BAE04643.1| heat-inducible transcriptional repressor [Staphylococcus haemolyticus JCSC1435] (325 aa)
Score = 220, Expect = 4.3e-16, Identities = 85/326 (26%), Positives = 162/326 (49%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFY-EKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIE-NNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSIL-----KDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVH--GQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEV--SHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFI 329
           ITQRQ  +L  IVEDYV    P+GSK +I+++  ++S AT+RN+M  LE L  LEK H+SSGR PS  G++ Y ++   +    ++N   +L  +  +    I   +      +S  +    + +   ++E ++  + +++ N    ++++I + G++     HF  +S L     + I+I   I N+ +      EI+ K+           +E +F+  ++++ I    SK   ++   G+  L+      +   ++ ILQ LES  I E +   Q  + ++  +  G E+  S  DI    +  + +   K ++ ++ PT + Y  +  LL  I
  S:     2 ITQRQLSILNAIVEDYVDLGQPIGSKALIDRHHLDVSPATIRNEMKQLEDLNFLEKTHSSSGRSPSEEGFRLYVDQLLKQTSRQNKNKIQRLNQLLIENHYDISSALSYFANELSMKSHYATLVVRPKHSEEMINNVHLIKANDSIMILVIIYNSGHVE----HFHLNSALELSSDRLIAISNFISNNNI------EISAKLSDKIRSFANSNEENQFI-NDIVKMINSHISKQSNSIFLGGKVKLIDALNESNVSSIQPILQYLESERITELL---QTISTNDINVKIGKEIDESLSDISIVTSQYHFDNSLKGQIAVIGPTAMRYQNVIQLLNQI 324
>gi|15675608|ref|NP_269782.1| heat-inducible transcription repressor [Streptococcus pyogenes M1 GAS] >gi|71911313|ref|YP_282863.1| heat-inducible transcription repressor [Streptococcus pyogenes MGAS5005] >gi|94989132|ref|YP_597233.1| heat-inducible transcription repressor [Streptococcus pyogenes MGAS9429] >gi|94993025|ref|YP_601124.1| heat-inducible transcription repressor [Streptococcus pyogenes MGAS2096] >gi|122987085|sp|Q1JKD4|HRCA_STRPC Heat-inducible transcription repressor hrcA >gi|123080181|sp|Q1JA81|HRCA_STRPB Heat-inducible transcription repressor hrcA >gi|21263733|sp|Q99YC7|HRCA_STRP1 Heat-inducible transcription repressor hrcA >gi|13622815|gb|AAK34503.1| putative heat shock transcription repressor protein [Streptococcus pyogenes M1 GAS] >gi|71854095|gb|AAZ52118.1| heat-inducible transcription repressor [Streptococcus pyogenes MGAS5005] >gi|94542640|gb|ABF32689.1| heat-inducible transcription repressor [Streptococcus pyogenes MGAS9429] >gi|94546533|gb|ABF36580.1| Heat-inducible transcription repressor hrcA [Streptococcus pyogenes MGAS2096] (344 aa)
Score = 219, Expect = 4.6e-16, Identities = 66/221 (29%), Positives = 120/221 (54%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIE-NNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIF 224
           ITQRQ ++L  IVE +  T  PVGSK +  +   + S+AT+RNDMA LEKLGLLEK HTSSGR+PS AG+K++ ++  +    DE     +   F      ++ +++++  I++E T    + ++       L   D+V+++   A+ ++   +            + + +D+     I  +RL+D  + +I  K   +++ I + V++Y FV  + + ++F
  S:     2 ITQRQNDILNLIVELFTQTHEPVGSKAL--QRTIDSSSATIRNDMAKLEKLGLLEKAHTSSGRMPSPAGFKYFVEHSLRLDSIDEQDIYHVIKAFDFEAFKLEDMLQKASHILAEMTGYTSVILDVEPARQRLTGFDVVQLSNHDALAVMTLDESKPVTVQFAIPRNFLTRDLIAFKAIVEERLLDNSVIDIHYK---LRTEIPQIVQKY-FVTTDNVLQLF 217
>gi|39933407|ref|NP_945683.1| heat-inducible transcription repressor [Rhodopseudomonas palustris CGA009] >gi|192288764|ref|YP_001989369.1| heat-inducible transcription repressor HrcA [Rhodopseudomonas palustris TIE-1] >gi|61213469|sp|Q6NCY7|HRCA_RHOPA Heat-inducible transcription repressor hrcA >gi|39647253|emb|CAE25774.1| transcriptional repressor of class I heat shock genes [Rhodopseudomonas palustris CGA009] >gi|192282513|gb|ACE98893.1| heat-inducible transcription repressor HrcA [Rhodopseudomonas palustris TIE-1] (362 aa)
Score = 219, Expect = 4.8e-16, Identities = 49/164 (29%), Positives = 95/164 (57%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEK------NFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNII 164
           + ++ +R +E+ + IVE Y+AT  PVGS+ +       +S A+VRN MA LE+LGL+   HTS+GR+P+  G +F+        + ++P    ++++ +L +V   R  +++  + E+   +S  T+   + +     V LK I+ V +  + A+VI++  DG +   ++
  S:    16 LAQLNERSREIFRQIVESYLATGEPVGSRNISRLISVPLSPASVRNVMADLEQLGLIYAPHTSAGRLPTELGLRFFVDALMQIGDLTEP--ERQSIQAQLSSV--GRAHTVEAALGEALTRLSGLTRAAAVVLTAKANVRLKHIEFVRLEPERALVILVAEDGQVENRVL 181
>gi|19703461|ref|NP_603023.1| heat-inducible transcription repressor hrcA [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >gi|22256775|sp|Q8RH08|HRCA_FUSNN Heat-inducible transcription repressor hrcA >gi|19713541|gb|AAL94322.1| Heat-inducible transcription repressor hrcA [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] (351 aa)
Score = 219, Expect = 5.1e-16, Identities = 91/332 (27%), Positives = 167/332 (50%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSK-PYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIE---NNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIF-QIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEV---SHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEK 335
           I++R+K +L  IV+ Y+   + +GS+ +++KY   +S+AT+RN MA LE +G +EK HTSSGR+P+  GYK+Y     K   I  E ++  + NV+  R   ++ +++++  ++S+ T    I +E   +N +V   R+++V I++   M I++  D  +    IH       +++   +   N ++ +    EIA   D  K   +     YE+  ++ + + F      M+K  +       +  F + + ++E+ +      + EQ A  Q  + SN  +  GDE+     ED  F  +  +I        VM  P R+ YSK  GL+  +  E  K
  S:    14 ISEREKLVLNAIVDYYLTVGDTIGSRTLVKKYGIELSSATIRNVMADLEDMGFIEKTHTSSGRIPTDMGYKYYLTELLKVEKITQEEIE-NISNVYNRRVDELENILKKTSTLLSKLTNYAGIAVEPKPDNKKV--SRVELVYIDEYLVMAIIVMDDRRVKTKNIHLAYPISKEEVEKKVDELNAKIRN---NEIAIN-DIEKFFTESTDIVYEYDDEDELSKYFINNLPSMLKNENIAEVTDVIEFFNERKDIRELFE-----KLIEQKA--QENSKSNVNVILGDELGIKELEDFSFVYSIYDIGGAQGIIGVM-GPKRMAYSKTMGLINHVSREVNK 338
>gi|34763856|ref|ZP_00144763.1| Heat-inducible transcription repressor hrcA [Fusobacterium nucleatum subsp. vincentii ATCC 49256] >gi|27886375|gb|EAA23643.1| Heat-inducible transcription repressor hrcA [Fusobacterium nucleatum subsp. vincentii ATCC 49256] (346 aa)
Score = 218, Expect = 6.4e-16, Identities = 90/332 (27%), Positives = 169/332 (50%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSK-PYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIE---NNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPI--KEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLA-----VPEFQDTEKLKEILQILE-------STSIWEQIAFK--QNQTGSNTLITFGDEV---SHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEK 335
           I++R+K +L  IV+ Y+   + +GS+ +++KY   +S+AT+RN MA LE +G +EK HTSSGR+P+  GYK+Y     K   I  E ++  + NV+  R   ++ +++++  ++S+ T    I +E   +N +V   R+++V I++   M I++  D  +    IH                     +  PI  +E+  K+D + +    K+K  E  + + IE+ F   + ++     +  L       +P     E + E+  ++E          ++E++  +  +  + SN  +  GDE+     ED  F  +  +I        VM  P R+ Y+K  GL+  +  E  K
  S:     8 ISEREKLVLNAIVDYYLTVGDTIGSRTLVKKYGIELSSATIRNVMADLEDMGFIEKTHTSSGRIPTDMGYKYYLTELLKVEKITQEEIE-NISNVYDRRVDELENILKKTSTLLSKLTNYAGIAVEPKPDNKKV--SRVELVYIDEYLIMAIIVMDDRRVKTKNIH---------------------LPYPISKEEVEKKVDELNA----KIKNNEIAIND-IEKFFTESTDIVYEYDDEDELTKYFINNLPSMLKNENIAEVTDVIEFFNERKDIRELFEKLIEQKAKENSNSNVNVILGDELGIKELEDFSFVYSIYDIGGAQGIIGVM-GPKRMAYTKTMGLINHVSREVNK 332
>gi|154246475|ref|YP_001417433.1| heat-inducible transcription repressor [Xanthobacter autotrophicus Py2] >gi|154160560|gb|ABS67776.1| heat-inducible transcription repressor HrcA [Xanthobacter autotrophicus Py2] (366 aa)
Score = 217, Expect = 7.5e-16, Identities = 80/328 (24%), Positives = 162/328 (49%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLK----LKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQI-----------KSKMIKTVHGQSSLLA-VPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITF-GDEVSHEDIVFAQTDLNINEQNKTKLV----MVAPTRVDYSKIKGLLEF 328
           + +I QR +E+ + IVE Y+AT  PVGS+ +       +S A+VRN MA LE  GL+   HTS+GR+P+  G +F+     +  I D N +    ++ + + A +T +++ V++E+  ++S   +   +     T+  LK ++ V +    A+VI+++ DG +   ++          ++      N R+    + +   +++++       + E    L  L  R+ +              K+I  V GQ+ LL  +   +D E+++ +   LE+    E +        +  L  F G E     +  + T +      + ++V    ++ PTR++Y +I  +++F
  S:    14 LAQIDQRAREIFRQIVESYLATGEPVGSRNLSRLIPMTLSPASVRNVMADLETAGLIYAPHTSAGRLPTERGLRFFVDALME--IGDVNERDRTNIETQVMAAAKTTTVEGVLQEASAMLSGLARGAGVVTATKTDPRLKHVEFVPLEPGRALVILVSEDGQVENRVLPLPPGLPTSALTEATNFLNARIRGRTLGDARAEMENL-------LAELRLDLDALTARVVEDGLASWSGEEPGDRKLI--VRGQAKLLEDLRALEDLERIRLLFDDLETKR--EVVDLLGRAEEAQALRIFIGSENRLFSLSGSSTIVAPYRDGQGRVVGVLGVIGPTRLNYGRIVPMVDF 349
>gi|90421850|ref|YP_530220.1| heat-inducible transcription repressor [Rhodopseudomonas palustris BisB18] >gi|122477602|sp|Q21CI5|HRCA_RHOPB Heat-inducible transcription repressor hrcA >gi|90103864|gb|ABD85901.1| heat-inducible transcription repressor HrcA [Rhodopseudomonas palustris BisB18] (362 aa)
Score = 217, Expect = 7.5e-16, Identities = 47/164 (28%), Positives = 96/164 (58%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEK------NFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNII 164
           + ++ +R +E+ + IVE Y+AT  PVGS+ +       +S A+VRN M+ LE+LGL+   HTS+GR+P+  G +F+        + ++P    ++++ +L +V   R  S++  + E+   +S  T+   + +   +   LK I+ V +  + A+V++++ DG +   ++
  S:    16 LAQLNERSREIFRQIVESYLATGEPVGSRNISRLITVPLSPASVRNVMSDLEQLGLIYAPHTSAGRLPTELGLRFFVDALMQVGDLTEP--ERQSIQAQLASV--GRAQSVEAALGEALTRLSGLTRAAAVVLTAKSNARLKHIEFVRLEPERALVVLVSEDGQVENRVL 181
>gi|163849849|ref|YP_001637892.1| heat-inducible transcription repressor [Methylobacterium extorquens PA1] >gi|163661454|gb|ABY28821.1| heat-inducible transcription repressor HrcA [Methylobacterium extorquens PA1] (363 aa)
Score = 217, Expect = 7.7e-16, Identities = 82/328 (25%), Positives = 161/328 (49%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLR-----NVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKT----------VHGQSSLL-AVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKTKLV----MVAPTRVDYSKIKGLLEF 328
           +  + +R +E+ + IVE YV T  PVGS+ +      ++S A++RN MA LE  GL+   HTSSGR+P+  G +F+     +  I D +L  K R        A R  + D  + E+  ++S  ++   + +    +  LK ++ V ++ + A+V++++ DG +   ++          +       N RL           +D++++ I+   KE +  L  L ER+  + + +  T          V GQ++LL  +   +D E+++ +   LE+     ++  +  Q G    I  G E     +  +         +  K+V    ++ PTR++YS+I  ++++
  S:    16 LAALNERSREIFRQIVESYVTTGEPVGSRNLARILPMSLSPASIRNVMADLEHSGLIFAPHTSSGRLPTELGLRFFVDAMME--IGDVDLAEKARIEAQMQAAASR-HTFDSALAEASSLLSGISRGAGVVLTTKVDAGLKHVEFVRLDPERALVVLVSIDGTVENRLVDLPPGLPAGALQEASNFLNARL-------RGRTLDTLRADIENGRKEMKRELDALTERL--VDAGLATTVGPSEARQLIVRGQANLLDDLRAAEDLERIRLLFNDLETQKDVIELLARAEQ-GDGVRIFIGSENKLFSLSGSSMIAAPFRDSAQKIVGVVGVIGPTRLNYSRIVPMVDY 350
>gi|466967|gb|AAA17153.1| ygrp; B1937_F1_18 [Mycobacterium leprae] (197 aa)
Score = 217, Expect = 8.2e-16, Identities = 48/168 (28%), Positives = 98/168 (58%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFS--KPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISEST-KLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKD 168
           M    +R+ E+L+ IV D+VAT  P+GS+ ++E++   +S+AT+RNDMA LE  G + + HTSSGRVP+  GY+ +       KP    E   ++    F +  + +D V+  + +++++ T ++ +++    +   ++ ++++ ++    +++VIT  G + + I    D
  S:     1 MGNADERRFEVLRAIVADFVATKEPIGSRALVERHNLGVSSATIRNDMAVLEAEGYITQPHTSSGRVPTEKGYREFVDRLEDVKPLSAAERRAIQ---SFLESGVDLDDVLRRAVRLLAQLTCQVAVVQYPTLSTSTVRHLEVIALSPARLLMVVITESGRVDQRIAELGD 168
>gi|149926211|ref|ZP_01914473.1| heat-inducible transcription repressor [Limnobacter sp. MED105] >gi|149825029|gb|EDM84241.1| heat-inducible transcription repressor [Limnobacter sp. MED105] (339 aa)
Score = 217, Expect = 8.3e-16, Identities = 68/319 (21%), Positives = 148/319 (46%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDV--VIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTV--HGQSSLLAVPEFQ-DTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDE--VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKI 322
           I +R + +LK +VE Y+   NPVGS+ +      ++S AT+RN MA LE+L L+   HTS+GRVP+  GY+     F    +  + L + ++   +      D   V+ ++  ++S  +    +        L + ++ + ++ +  ++I++T DG++   I+  +      ++++    FN        ++   ++      I + + +   ++Q  +    + +      V   G+  LL V +   D E+LK++  + E  +   ++    N+     +   GD   V  E++       ++N +    L ++ PTR+ Y ++
  S:     2 IDERARSILKTLVERYITEGNPVGSRALSRYSTLDLSPATIRNVMADLEELRLVVSPHTSAGRVPTPQGYRM----FVDSLLTVKPLAIDVQTALSGGIQREDPNRVLNKAVNLLSSLSSFAGVITAPKKAALFRHVEFLSLSDRKVLLIIVTPDGDVQNRILIVEKPYTQSELTMAANFFNQHFAGLSFQQAKQRLSEELHQISQDISK---LMQAAVNAGTEAEESQADGVLLSGERKLLDVSDLSTDMERLKKMFGVFEQRTALLRLLESSNRAEGVQIFIGGDSSLVPMEEMSVISAPYHVNGEVVGTLGVIGPTRMAYERL 320
>gi|27375786|ref|NP_767315.1| heat-inducible transcription repressor [Bradyrhizobium japonicum USDA 110] >gi|10720042|sp|Q9REF2|HRCA_BRAJA Heat-inducible transcription repressor hrcA >gi|6433782|emb|CAB60664.1| HrcA protein [Bradyrhizobium japonicum] >gi|27348924|dbj|BAC45940.1| heat-inducible transcription repressor [Bradyrhizobium japonicum USDA 110] (362 aa)
Score = 217, Expect = 8.9e-16, Identities = 76/322 (23%), Positives = 160/322 (49%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSK-PYIND-ENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRL-----------IDCPIKEIATKIDSM-KSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVP-EFQDTEKLKEILQILESTSIWEQIAF---KQNQ----TGSNTLIT-FGDEVSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKI 322
           + ++ +R +++ + IVE Y+AT  PVGS+ +       +S A+VRN MA LE+LGL+   HTS+GR+P+  G +F+     +   +ND E   ++ +     +  S++  ++++   +S  T+   + +   +   LK I+ V +  + A+VI++  DG +   ++          I+      N R+           ++  + E   ++D + + +I   +  +     E  + I +  + +++ +H    L  V   F D E  + ++ +L      E +      +N+    +GS+T+I+ + D   H  IV               L ++ PTR++Y+++
  S:    16 LAQLNERSRDIFRQIVESYLATGEPVGSRNISRLIAMPLSPASVRNVMADLEQLGLIYAPHTSAGRLPTELGLRFFVDALMQVGDLNDAERQSIQSQLTSVGQAQSVEAALDQALTRLSGLTRAAAVVLTPKSNARLKHIEFVRLEPEKALVILVGEDGQVENRVLTLPPGVPSSAITEAGNFLNSRIRGRTLAEARLELETALGEARAELDQLTQKVISAGIASWSGGENEDRQLIVRGHANLLEDLHALEDLERVRLLFDDLETKRGVIDLLGRAETAEGVRIFIGSENKLFSLSGSSTIISPYRDAAGH--IVGV-------------LGVIGPTRLNYARV 345
>gi|75674393|ref|YP_316814.1| heat-inducible transcription repressor [Nitrobacter winogradskyi Nb-255] >gi|123614307|sp|Q3SW79|HRCA_NITWN Heat-inducible transcription repressor hrcA >gi|74419263|gb|ABA03462.1| heat-inducible transcription repressor HrcA [Nitrobacter winogradskyi Nb-255] (362 aa)
Score = 217, Expect = 9.0e-16, Identities = 74/328 (22%), Positives = 168/328 (51%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEK------NFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRL-----------IDCPIKEIATKIDSM-KSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVP-EFQDTEKLKEILQILESTSIWEQIAF---KQNQ----TGSNTLIT-FGDEVSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEF 328
           + ++ +R +++ + IVE Y+AT  PVGS+ +       +S A+VRN M+ LE+LGL+   HTS+GR+P+  G +F+        + ++P    ++++ +L +V   +  S++  +EE+   +S  T+   + +   + V LK I+ V +    A+V+++  DG +   ++          ++      N R+           ++  + +   ++D + + I+   +  +     +  + I +  + +++ +H    L  V   F D E  +E++ +L      + +      +N+    +GS+T+I  + D   H  IV               L ++ PTR++Y+++  ++++
  S:    16 LAQLNERSRDIFRQIVESYLATGEPVGSRNISRLIAVPLSPASVRNVMSDLEQLGLIYAPHTSAGRLPTELGLRFFVDALMQVGDLTEP--ERQSIQSQLASV--GKAQSVEAALEEALTRLSGLTRTAAVVLTAKSNVRLKHIEFVRLEPDKALVVLVAEDGQVENRVLTLPSGVPASALTEASNFLNARIRGRTLAEARLELETALAQSKAELDQLTQKIVAAGIASWSGGDSDDRQLIVRGHANLLEDLHAMEDLERVRLLFDDLETKREVIDLLGRAERADGVRIFIGSENKLFSLSGSSTIIAPYSDGAGH--IVGV-------------LGVIGPTRLNYARVIPMVDY 351
>gi|160937127|ref|ZP_02084490.1| hypothetical protein CLOBOL_02018 [Clostridium bolteae ATCC BAA-613] >gi|158440028|gb|EDP17776.1| hypothetical protein CLOBOL_02018 [Clostridium bolteae ATCC BAA-613] (362 aa)
Score = 216, Expect = 1.0e-15, Identities = 80/335 (23%), Positives = 171/335 (51%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLP-MIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKN-IIHFKDDSILKDISICIRIFNDRLIDCPIKEIATK-IDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQN---QTGSNTLITFGDEV---SHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEKGWK 338
           +  R+  +LK I++ Y+ T  PVGS+ + +     +S+AT+RN+M+ LE++G + + HTS+GR+PS  GY+FY     +  ++ E+   + + +   +   +++V+++  ++++ +T    MI   +  +  LK I + ++ K   +V V+  +GN+ KN +I  +D+   +++     + N  L    I++I    I  +K       +  + VL E+ E I   +  +     G +++   PE  D +K   ++  LE   + ++   + N   +  +   +  GDE    S +D      + ++    +  + ++ P R+DY K+ G L  + N+ +  +K
  S:    19 LDDRKVTILKAIIKTYLETGEPVGSRTISKYSDLKLSSATIRNEMSDLEEMGYIVQPHTSAGRIPSDKGYRFY---VDQIMLDKESEVTEFKEMMVQKVDKLELVLKKMAQVLAANTNYATMISGPSYHKTKLKFIQLSKMEKHKLLV-VVVVEGNIIKNTMIDIEDNLSDEELLNLNILLNSSLNGLTIEDINLDVISKLKGDAGIHSQVVDLVLNEVAEAIKAGEEDLQIYTSGATNIFKYPELSDGDKASRLIDTLEHKEVLQEFVAEVNSGTEEEAGIQVYIGDESPVQSMKDCSVVTANYDLGGGLRGTIGIIGPKRMDYEKVLGTLRNLMNQLDTAFK 358
>gi|116516738|ref|YP_815966.1| heat-inducible transcription repressor [Streptococcus pneumoniae D39] >gi|168488203|ref|ZP_02712402.1| heat-inducible transcription repressor HrcA [Streptococcus pneumoniae SP195] >gi|168490591|ref|ZP_02714734.1| heat-inducible transcription repressor HrcA [Streptococcus pneumoniae CDC0288-04] >gi|122279148|sp|Q04LY2|HRCA_STRP2 Heat-inducible transcription repressor hrcA >gi|46576563|sp|Q8DQW9|HRCA_STRR6 Heat-inducible transcription repressor hrcA >gi|116077314|gb|ABJ55034.1| heat-inducible transcription repressor HrcA [Streptococcus pneumoniae D39] >gi|183573073|gb|EDT93601.1| heat-inducible transcription repressor HrcA [Streptococcus pneumoniae SP195] >gi|183574957|gb|EDT95485.1| heat-inducible transcription repressor HrcA [Streptococcus pneumoniae CDC0288-04] (344 aa)
Score = 216, Expect = 1.1e-15, Identities = 82/319 (25%), Positives = 157/319 (49%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIE-NNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDS-MKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSL-----LAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKI 322
           +T+RQ+++L  I++ +  T  PVGSK + E    N S+AT+RNDMA LEK GLLEK HTSSGR+PS AG+++Y K+        EN   ++   F      ++ +++E+  ++++ +   ++ ++   +   L   D+V + + +A+ +    +     +      + + +D+     I  +R +   + +I  KI + +  II+      + V+ +L E IF+        + G+ +L     LA  +F D  + K  L+I E          +++Q   N  +  G E    D+    +   I  +    L ++ P  +DY ++
  S:     2 VTERQQDILNLIIDIFTKTHEPVGSKALQESI--NSSSATIRNDMAELEKQGLLEKAHTSSGRMPSVAGFQYYVKHSLDFDRLAENEVYEIVKAFDQEFFKLEDILQEAANLLTDLSGCTVVALDVEPSRQRLTAFDIVVLGQHTALAVFTLDESRTVTSQFLIPRNFLQEDLLKLKSIIQERFLGHTVLDIHYKIRTEIPQIIQRYFTTTDNVI-DLFEHIFKEMFNENIVMAGKVNLLNFANLAAYQFFDQPQ-KVALEIRE--------GLREDQM-QNVRVADGQESCLADLAVISSKFLIPYRGVGILAIIGPVNLDYQQL 314
>gi|156449560|ref|ZP_02055942.1| heat-inducible transcription repressor HrcA [Methylobacterium chloromethanicum CM4] >gi|156191294|gb|EDO23481.1| heat-inducible transcription repressor HrcA [Methylobacterium chloromethanicum CM4] (363 aa)
Score = 216, Expect = 1.1e-15, Identities = 82/328 (25%), Positives = 161/328 (49%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLR-----NVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKT----------VHGQSSLL-AVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKTKLV----MVAPTRVDYSKIKGLLEF 328
           +  + +R +E+ + IVE YV T  PVGS+ +      ++S A++RN MA LE  GL+   HTSSGR+P+  G +F+     +  I D +L  K R        A R  + D  + E+  ++S  ++   + +    +  LK ++ V ++ + A+V++++ DG +   ++          +       N RL           +D++++ I+   KE +  L  L ER+  + + +  T          V GQ++LL  +   +D E+++ +   LE+     ++  +  Q G    I  G E     +  +         +  K+V    ++ PTR++YS+I  ++++
  S:    16 LAALNERSREIFRQIVESYVTTGEPVGSRNLARILPMSLSPASIRNVMADLEHSGLIFAPHTSSGRLPTELGLRFFVDAMME--IGDVDLAEKARIEAQMQAAASR-HTFDSALAEASSLLSGISRGAGVVLTTKVDAGLKHVEFVRLDPERALVVLVSIDGTVENRLVDLPPGLPAGALQEASNFLNARL-------RGRTLDTLRADIENGRKEMKRELDVLTERL--VDAGLATTVGPSEARQLIVRGQANLLDDLRAAEDLERIRLLFNDLETQKDVIELLARAEQ-GDGVRIFIGSENKLFSLSGSSMIAAPFRDSAQKIVGVVGVIGPTRLNYSRIVPMVDY 350
>gi|89052698|ref|YP_508149.1| heat-inducible transcription repressor [Jannaschia sp. CCS1] >gi|88862247|gb|ABD53124.1| heat-inducible transcription repressor HrcA [Jannaschia sp. CCS1] (354 aa)
Score = 216, Expect = 1.2e-15, Identities = 71/328 (21%), Positives = 156/328 (47%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQI-------KSKMIKTVHGQSSLLA-VPEFQDTEKLKEILQILE-STSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKT--KLVMVAPTRVDYSKIKGLLEF 328
           + ++  R +E+ + +VE Y+ T  PVGS+ +      N+SAATVRN M  LE +GLL+  H+S+GR+P+  G + +   F +      + K  L +   D    +  +++     +S +T    + +    E  ++ I+ V ++    +V+++ SDG++   +           +       N R+    +  I  +++     I+ + +E + +   LI+    +        +++I  V G+S+LL+   E +D ++++++   LE    I E +   ++  G    I   +++             +N   K    + ++ PTR++Y +I  ++++
  S:     8 LDDLNDRSREVFRRVVEGYLETGAPVGSRTLTRTLSENVSAATVRNTMQDLEHMGLLDSPHSSAGRMPTQQGLRMFVDGFLEVGDLSRDDKRALDDTMGDNATDVSGLLDRVGSALSSATHGASLVLTPKHEAPIQHIEFVTLSATQCLVVLVFSDGHVENRLFTPPAGMTQSAMREAANFLNARIEGQTVSTIRAQLEVD---IETRRREIDDLASGLIDSGLAVWDGTGDNTARLI--VRGRSNLLSDSQESEDLDRIRQLFDDLERKRDITEFLELTEDGDGVRIFIGSENKLFSLSGSSLVVSPYMNSDRKIVGAVGVIGPTRLNYGRIVPIVDY 341
>gi|15900429|ref|NP_345033.1| heat-inducible transcription repressor [Streptococcus pneumoniae TIGR4] >gi|149002186|ref|ZP_01827128.1| heat-inducible transcription repressor [Streptococcus pneumoniae SP14-BS69] >gi|194397298|ref|YP_002037181.1| heat-inducible transcription repressor HrcA [Streptococcus pneumoniae G54] >gi|18285210|sp|Q9X4R2|HRCA_STRPN Heat-inducible transcription repressor hrcA >gi|14971989|gb|AAK74673.1| heat-inducible transcription repressor HrcA [Streptococcus pneumoniae TIGR4] >gi|147759501|gb|EDK66492.1| heat-inducible transcription repressor [Streptococcus pneumoniae SP14-BS69] >gi|194356965|gb|ACF55413.1| heat-inducible transcription repressor HrcA [Streptococcus pneumoniae G54] (344 aa)
Score = 216, Expect = 1.2e-15, Identities = 82/319 (25%), Positives = 156/319 (48%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIE-NNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDS-MKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSL-----LAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKI 322
           +T+RQ+++L  I++ +  T  PVGSK + E    N S+AT+RNDMA LEK GLLEK HTSSGR+PS AG+++Y K+        EN   ++   F      ++ +++E+  ++++ +   ++ ++   +   L   D+V + + +A+ +    +     +      + + +D+     I  +R +   + +I  KI + +  II+      + V+ +L E IF+        + G+  L     LA  +F D  + K  L+I E          +++Q   N  +  G E    D+    +   I  +    L ++ P  +DY ++
  S:     2 VTERQQDILNLIIDIFTKTHEPVGSKALQESI--NSSSATIRNDMAELEKQGLLEKAHTSSGRMPSVAGFQYYVKHSLDFDRLAENEVYEIVKAFDQEFFKLEDILQEAANLLTDLSGCTVVALDVEPSRQRLTAFDIVVLGQHTALAVFTLDESRTVTSQFLIPRNFLQEDLLKLKSIIQERFLGHTVLDIHYKIRTEIPQIIQRYFTTTDNVI-DLFEHIFKEMFNENIVMAGKVHLLNFANLAAYQFFDQPQ-KVALEIRE--------GLREDQM-QNVRVADGQESCLADLAVISSKFLIPYRGVGILAIIGPVNLDYQQL 314
>gi|162448279|ref|YP_001610646.1| heat-inducible transcriptional repressor [Sorangium cellulosum 'So ce 56'] >gi|189028270|sp|A9GHW2|HRCA_SORC5 Heat-inducible transcription repressor hrcA >gi|161158861|emb|CAN90166.1| heat-inducible transcriptional repressor [Sorangium cellulosum 'So ce 56'] (347 aa)
Score = 215, Expect = 1.3e-15, Identities = 72/327 (22%), Positives = 157/327 (48%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEV-LLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTV--------HGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITF-GDEVSHEDIVFAQTDLNI-----NEQNKTKLVMVAPTRVDYSKIKGLLE 327
           M +++ R +++L   V +++AT +PVGS+ +  KY  ++SAA++RN +A LE+ G L + HTS+GR+P+    + +     +        + +L   F +     +  + E+ + +SE +    +      E+  L ++  +       + +++ +DG++    I   +     +++    +  D +    + EI       + +   ++ +    +  L  R F++ SK    V         GQ+ L+ +PE+ D ++LK++++ LE       +  +    G+  +  F G E    D+   Q  L       N +    + ++ PTR+DY+K+  L++
  S:     1 MGDLSNRARKILFAAVTEFIATGDPVGSRTLARKYGLDLSAASIRNVLADLEEAGYLHQPHTSAGRIPTDRALRLFIDALVELRSLSPEQQAELSARFTEIYAGANDPLRETGRYLSELSGAAAVVAAPRAELRALAQLRFIPTKPGQLLAVLVFADGSVANRFISVDEAINEGELTRIHNLLTDVIEGRTLGEI-------RDLFARRLADERLQIDALRRRAFELGSKATADVTPRSEVVIEGQNRLIDLPEYADVDRLKKLMKALEEREELVDLLDRTLAAGAGEVTVFVGSEAG--DLGGGQLSLVAAPYMENGRVAGTVGVLGPTRMDYAKVMPLVD 333
>gi|119357670|ref|YP_912314.1| heat-inducible transcription repressor HrcA [Chlorobium phaeobacteroides DSM 266] >gi|166220388|sp|A1BHL3|HRCA_CHLPD Heat-inducible transcription repressor hrcA >gi|119355019|gb|ABL65890.1| heat-inducible transcription repressor HrcA [Chlorobium phaeobacteroides DSM 266] (357 aa)
Score = 215, Expect = 1.3e-15, Identities = 85/330 (25%), Positives = 169/330 (51%)
  Q:     2 KEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSK-PYINDENLK---LKLRNVFADRTMSIDVVIEESCKII-SESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILK-DISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQE---------LIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTL--------ITFGDEVSH---EDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKN 331
           +++  R++++L  I++ YV +A PVGS+ +       +S AT+RN MA LE  G + + HTS+GR P+  GY++Y     K   +NDE  K        +  +R  S   V+  + K++ S S +L ++     +  + +++DMV ++  + M+++++    + K I+   D ++ + ++S  + + N RL    + EI   I    S          FV++          +IER++         + G   ++  PEF+  EK+++ + ++E      ++  ++N+  S T+        I+ G E      ED+    T   +      KL ++ PTR+DY     +L ++ +
  S:     4 RDLNLRERQVLGIIIQAYVVSAAPVGSRYIARNCNLGLSDATIRNVMADLEDEGYISQPHTSAGRTPTDKGYRYYVDLIMKVRRVNDEEKKRIDADFGQLTTERRGSSSEVLLSAAKVLGSISRQLSVVLSPALSNAVFEKLDMVLLS-STRMMVILSIQSLIVKTIVMELDLAVSRQEVSGVVDLLNQRLSGLTLSEIRKTISMRLSDCLADASLINFVVRSAGQLFDETPIIERLY---------ISGAGYIVDQPEFKQPEKVRDFITMIEDKFSVAKLV-ERNRIYSETVHPSRMEVSISIGKENRERKAEDLTIVSTPYYVGGM-MGKLGILGPTRMDYGHAVSVLNYMAD 347
>gi|15902497|ref|NP_358047.1| heat-inducible transcription repressor [Streptococcus pneumoniae R6] >gi|15458021|gb|AAK99257.1| Heat inducible transcription repressor [Streptococcus pneumoniae R6] (355 aa)
Score = 215, Expect = 1.3e-15, Identities = 82/319 (25%), Positives = 157/319 (49%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIE-NNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDS-MKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSL-----LAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKI 322
           +T+RQ+++L  I++ +  T  PVGSK + E    N S+AT+RNDMA LEK GLLEK HTSSGR+PS AG+++Y K+        EN   ++   F      ++ +++E+  ++++ +   ++ ++   +   L   D+V + + +A+ +    +     +      + + +D+     I  +R +   + +I  KI + +  II+      + V+ +L E IF+        + G+ +L     LA  +F D  + K  L+I E          +++Q   N  +  G E    D+    +   I  +    L ++ P  +DY ++
  S:    13 VTERQQDILNLIIDIFTKTHEPVGSKALQESI--NSSSATIRNDMAELEKQGLLEKAHTSSGRMPSVAGFQYYVKHSLDFDRLAENEVYEIVKAFDQEFFKLEDILQEAANLLTDLSGCTVVALDVEPSRQRLTAFDIVVLGQHTALAVFTLDESRTVTSQFLIPRNFLQEDLLKLKSIIQERFLGHTVLDIHYKIRTEIPQIIQRYFTTTDNVI-DLFEHIFKEMFNENIVMAGKVNLLNFANLAAYQFFDQPQ-KVALEIRE--------GLREDQM-QNVRVADGQESCLADLAVISSKFLIPYRGVGILAIIGPVNLDYQQL 325
>gi|95931199|ref|ZP_01313921.1| heat-inducible transcription repressor HrcA [Desulfuromonas acetoxidans DSM 684] >gi|95132761|gb|EAT14438.1| heat-inducible transcription repressor HrcA [Desulfuromonas acetoxidans DSM 684] (345 aa)
Score = 215, Expect = 1.4e-15, Identities = 68/326 (20%), Positives = 156/326 (47%)
  Q:     3 EITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISE-STKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDD-SILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKT-------VHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDI---VFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEF 328
           E+ +R   +L+ IVE ++A+  P+GS+ +  +    +S ATVRN M+ LE +G +   HTS+GR+P+  GY+FY     +     E  +  +        +    +++++ +I+S  S+   ++        + + I+ + +++   +VI+++  G +   +I    D     ++   +   N  L    I+++       +S I E+++E +    EL+     + +K+  +       + G S++L  PEF D E+++ + +  E       +   ++Q      I  G +  +++              +Q    L ++ P+R+ YS++  ++++
  S:     2 ELNERSLSILEAIVEGHIASGEPMGSRTIARQQKMPLSPATVRNVMSDLEDMGYIISPHTSAGRIPTDKGYRFYVDTMLRVRNLSEAERRNIDAFCQSDNLRTQELLKKAGRILSSMSSYTGLVLAPRFDATIFRHIEFLPLSQGRLLVILVSRSGLVQNKVIELDGDMPSAHELEQIMNYLNSSLSGMTIQQV-------RSCIVEQMREEKARYDELMRHALALSTKVFDSDVEDEVIIEGVSNVLNQPEFSDIERMRRLFEAFEQKHHLIDL-LDKSQQAEGVQIYIGSQSEYQEFDGCSLITAKYTRGDQILGSLGVIGPSRMAYSQVVPVVDY 331
>gi|148983895|ref|ZP_01817214.1| heat-inducible transcription repressor [Streptococcus pneumoniae SP3-BS71] >gi|149012607|ref|ZP_01833604.1| heat-inducible transcription repressor [Streptococcus pneumoniae SP19-BS75] >gi|169834466|ref|YP_001694013.1| heat-inducible transcription repressor HrcA [Streptococcus pneumoniae Hungary19A-6] >gi|147763412|gb|EDK70349.1| heat-inducible transcription repressor [Streptococcus pneumoniae SP19-BS75] >gi|147924042|gb|EDK75154.1| heat-inducible transcription repressor [Streptococcus pneumoniae SP3-BS71] >gi|168996968|gb|ACA37580.1| heat-inducible transcription repressor HrcA [Streptococcus pneumoniae Hungary19A-6] (344 aa)
Score = 215, Expect = 1.4e-15, Identities = 78/319 (24%), Positives = 153/319 (47%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIE-NNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDS-MKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKI 322
           +T+RQ+++L  I++ +  T  PVGSK + E    N S+AT+RNDMA LEK GLLEK HTSSGR+PS AG+++Y K+        EN   ++   F      ++ +++E+  ++++ +   ++ ++   +   L   D+V + + +A+ +    +     +      + + +D+     I  +R +   + +I  KI + +  II+      + V+ +L E IF+        + G+  LL        +   +  ++  +  I E +  +Q Q   N  +  G E    D+    +   I  +    L ++ P  +DY ++
  S:     2 VTERQQDILNLIIDIFTKTHEPVGSKALQESI--NSSSATIRNDMAELEKQGLLEKAHTSSGRMPSVAGFQYYVKHSLDFDRLAENEVYEIVKAFDQEFFKLEDILQEAANLLTDLSGCTVVALDVEPSRQRLTAFDIVVLGQHTALAVFTLDESRTVTSQFLIPRNFLQEDLLKLKSIIQERFLGHTVLDIHYKIRTEIPQIIQRYFTTTDNVI-DLFEHIFKEMFNENIVMAGKVHLLNFANLAAYQFFDQPQKV--ALEIREGLREEQMQ---NVRVADGQESCLADLAVISSKFLIPYRGVGILAIIGPVNLDYQQL 314
>gi|38234292|ref|NP_940059.1| heat-inducible transcription repressor [Corynebacterium diphtheriae NCTC 13129] >gi|61213470|sp|Q6NG13|HRCA_CORDI Heat-inducible transcription repressor hrcA >gi|38200555|emb|CAE50250.1| Putative heat-inducible transcription repressor [Corynebacterium diphtheriae] (345 aa)
Score = 215, Expect = 1.4e-15, Identities = 51/156 (32%), Positives = 99/156 (63%)
  Q:     6 QRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYIND-ENLKLKLRNV---FADRTMSIDVVIEESCKIISESTK-LPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTK 161
           QR++E+L+ IV DY+A+  PVGSK ++E++   +S+AT+RNDMA LE  G + + H SSGR+P+   Y+ +  +     IND + L +  R     F +R + ++ V++ S +++S+ T+   +I++ N     +K  ++V ++    ++++IT +G + +
  S:     7 QRRQEVLRAIVADYIASQEPVGSKALLERHNLKVSSATIRNDMAVLESEGYIVQQHASSGRIPTEKAYRTFVDS-----INDIKPLSVAERRAILGFLERGVDLEDVLKRSVQLLSQLTRQAAVIQLPNLNVSRVKHCEVVLLSPVRLLLVLITDNGRVEQ 162
>gi|91775126|ref|YP_544882.1| heat-inducible transcription repressor [Methylobacillus flagellatus KT] >gi|122400112|sp|Q1H396|HRCA_METFK Heat-inducible transcription repressor hrcA >gi|91709113|gb|ABE49041.1| heat-inducible transcription repressor HrcA [Methylobacillus flagellatus KT] (339 aa)
Score = 215, Expect = 1.4e-15, Identities = 74/319 (23%), Positives = 153/319 (47%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNF--SKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLP-MIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIK-----TVHGQSSLLAVPEFQ-DTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSH---EDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKI 322
           + +R + LLK ++E Y++   PVGS+ +      ++S A++RN M+ LE  G +   HTS+GR+P+  GY+ +       +P  N E  KL+  NV +  +     +I ++ +++S  T    ++ I        + ++ + ++++  +VI++T+DG +   II  +      D++     FN              +D +K  + E++K+ +  +  L+    +  SK         + G+ +LL V +   +   L+++ ++ E  +   Q+   Q+Q  S   I  G E  +   ++          N Q    L ++ PTR+ Y ++
  S:     2 LDKRAQILLKTLIEHYISDGQPVGSRKLSVASGLDLSPASIRNIMSELEDHGFIASPHTSAGRIPTQRGYRLFVDTLLTVQPLQNQEIRKLE--NVLS--SPDPQELINKAAELLSSLTHFAGLVMIPKRQGAAFRHLEFLPLSEKRILVIIVTTDGAVQNRIILAEKPYSASDLTQASNFFNQHY-------AGNTLDEVKQKLHEELKQMQSDMTRLMAAALEASSKTADNKDGVVIAGKRNLLDVQDLSTNVSSLRKLFEMFEHRTSLMQL-LDQSQKASGVQIFIGGESGYLPLDECSMVTAPYETNGQTIGTLGVIGPTRMAYERV 320
>gi|24216402|ref|NP_713883.1| heat-inducible transcription repressor hrcA [Leptospira interrogans serovar Lai str. 56601] >gi|45656424|ref|YP_000510.1| heat-inducible transcriptional repressor [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] >gi|47606420|sp|P61447|HRCA_LEPIN Heat-inducible transcription repressor hrcA >gi|47606737|sp|P61446|HRCA_LEPIC Heat-inducible transcription repressor hrcA >gi|24197690|gb|AAN50901.1|AE011525_8 Heat-inducible transcription repressor hrcA [Leptospira interrogans serovar Lai str. 56601] >gi|45599659|gb|AAS69147.1| heat-inducible transcriptional repressor [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] (342 aa)
Score = 215, Expect = 1.4e-15, Identities = 74/326 (22%), Positives = 154/326 (47%)
  Q:     3 EITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEV-LLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTE-KLKEILQILESTSIWEQIAFKQ--NQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEF 328
           ++T+R K +LK +V++++    PVGSK + +K+   +S A++R  +  LE  G L   HTS GR+P+  GY+FY  +    Y      K +++  +      +D +++ +  ++S  +    I I     +  LK I+++ +     ++I++   G +    I    +   + +    +  ND L    I EI   I     I K+  +++  +   +   +    S++   + G  +L A   F+D E +L ++L +L+     +   F +  +Q G  T+I    + S   +    ++  + E+    L ++ P R+DY++   L++F
  S:     2 DLTERHKRILKALVDEFIQENRPVGSKTLFDKHDIGLSPASIRTVLKDLEDFGYLASKHTSGGRIPTERGYRFYVDSLVILYELTLKEKQRIQQEYLKMQFKLDQILKATASVLSSLSNAAGIVIGPAKNLDTLKHIELIHVRGDEILMILVMRSGTVLHRNIFVDQNYSQEALYQVSKYLNDNLKGYDIYEIQNVIIPKLMIRKDGPEDFIRIADLISSAMTPDNSEVTLYIDGFKNLYA--NFRDEEQQLSQVLSLLDDQGFLKAF-FSEYIDQDGVFTIIGKDGDRSMSGVSIITSNYKMGEKKIGALGIIGPQRMDYNRALPLVDF 328
>gi|91787199|ref|YP_548151.1| heat-inducible transcription repressor [Polaromonas sp. JS666] >gi|91696424|gb|ABE43253.1| heat-inducible transcription repressor HrcA [Polaromonas sp. JS666] (338 aa)
Score = 215, Expect = 1.5e-15, Identities = 72/319 (22%), Positives = 152/319 (47%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTM--SIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKT-----VHGQSSLLAVPEF-QDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDE---VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKI 322
           +  R + LLK +VE Y+A   PVGS+ +       +S AT+RN M+ LE+LGL+   HTS+GR+P+  GY+     F    +  +  +L   ++ A R        VI  +  ++S  ++   + +      + + I+ + ++++  +VI+++ DG++   +I  + D     +       N       I+E+  +       ++ +V+     +  L++   Q+ S+ I++     V G+ +LLAV +F  D   L+++  + E  +   ++    +       I  G E   + ++++        ++ Q    L ++ P R+ Y K+
  S:     2 LDDRARLLLKALVERYIADGQPVGSRTLSRASGLELSPATIRNVMSDLEELGLIVSPHTSAGRIPTARGYRL----FVDTMLTTQRDQLSAGHITAPRLAPDQPQKVISNAAHMLSSLSQFVGVVMAPRRTSVFRHIEFLRLSEKRFLVIIVSPDGDVQNRVIFTEADYTQSQLIEASNFLNSHYAGMAIEEVRER-------LQNEVEALRGEIATLMQAAVQVSSEAIESRDEVVVSGERNLLAVSDFSSDMGNLRKLFDLFEQKAQLMRL-LDVSSRAEGVRIYIGGESQVIPYQELSVVTAPYEVDGQVVGTLGVIGPMRMPYEKM 319
>gi|4566769|gb|AAD23452.1| heat shock transcription repressor HrcA [Streptococcus pneumoniae] (344 aa)
Score = 214, Expect = 1.6e-15, Identities = 82/319 (25%), Positives = 156/319 (48%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIE-NNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDS-MKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSL-----LAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKI 322
           +T+RQ+++L  I++ +  T  PVGSK + E    N S+AT+RNDMA LEK GLLEK HTSSGR+PS AG+++Y K+        EN   ++   F      ++ +++E+  ++++ +   ++ ++   +   L   D+V + + +A+ +    +     +      + + +D+     I  +R +   + +I  KI + +  II+      + V+ +L E IF+        + G+ +L     LA  +F D  + K  L+I E          +++Q   N  +  G E    D     +   I  +    L ++ P  +DY ++
  S:     2 VTERQQDILNLIIDIFTKTHEPVGSKALQESI--NSSSATIRNDMAELEKQGLLEKAHTSSGRMPSVAGFQYYVKHSLDFDRLAENEVYEIVKAFDQEFFKLEDILQEAANLLTDLSGCTVVALDVEPSRQRLTAFDIVVLGQHTALAVFTLDESRTVTSQFLIPRNFLQEDLLKLKSIIQERFLGHTVLDIHYKIRTEIPQIIQRYFTTTDNVI-DLFEHIFKEMFNENIVMAGKVNLLNFANLAAYQFFDQPQ-KVALEIRE--------GLREDQM-QNVAVADGQESCLADXAVISSKFLIPYRGVGILAIIGPVNLDYQQL 314
>gi|13473879|ref|NP_105447.1| heat-inducible transcription repressor [Mesorhizobium loti MAFF303099] >gi|22256795|sp|Q98DN7|HRCA_RHILO Heat-inducible transcription repressor hrcA >gi|14024630|dbj|BAB51233.1| repressor protein of class I heat shock genes [Mesorhizobium loti MAFF303099] (360 aa)
Score = 214, Expect = 1.6e-15, Identities = 75/328 (22%), Positives = 169/328 (51%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSK-PYINDENLKLKLRNVFADRT-MSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQI--------KSKMIKTVHGQSSLLA-VPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDE-----VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEF 328
           ++ +  R +++ + IV+ Y+    PVGS+ +      ++S AT+RN M+ LE LGL+   H S+GR+P+ AG +F+   F +   ++DE  +     V A  +  +++ ++ E+ +++S  ++   + +    EV LK I+ +++    A+ ++++ +G++   ++       +  +       N  +    + E  T+I  +K   +E     + + Q+L+E+   +         +++I  V G+++LL  V    D E L+ + + +E+     Q+     + GS   I  G E     +S   +V A    + + +    L ++ PTR++Y++I  ++++
  S:    14 LQSLDMRSRDIFRRIVDSYLRDGEPVGSRSLSRILPSSLSPATIRNVMSDLEHLGLIYAPHISAGRLPTQAGLRFFVDAFMELGDLSDEERRTIEAQVRASGSGATLEHMLTEASQMLSGMSRGAGLVLAAKNEVALKHIEFIQLEPTKALAVLVSQNGDVENRVVELPAGITVSQLHEASNFLNAHIRGRTLAEARTEIARIK---EETRAALDTLSQDLVEKGLAVWAGAESGLPARLI--VRGRANLLENVTAQADIELLRHLFEDMETQDGLIQL-LDLAEQGSGVRIFIGSENKLFSLSGSSLVVAPYR-DKDARVVGALGVIGPTRLNYARIVPMVDY 350
>gi|89900440|ref|YP_522911.1| heat-inducible transcription repressor [Rhodoferax ferrireducens T118] >gi|89345177|gb|ABD69380.1| heat-inducible transcription repressor HrcA [Rhodoferax ferrireducens T118] (334 aa)
Score = 214, Expect = 1.7e-15, Identities = 73/319 (22%), Positives = 150/319 (47%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDV---VIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIK------TVHGQSSLLAVPEF-QDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDE--VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKI 322
           +  R K LLK +VE Y+A   PVGS+ + +     +S AT+RN M+ LE LGL+   HTS+GR+P+  GY+ +          D  L ++ +  FA   ++ D    VI  +  ++S  ++   + I      + + I+ + ++++  +VI+++ +G++   +I  + D     +       N   +   I+++  +       +K +V+     +  L++    + S+ +        + G+ +LLAV +F  D   L+    + E  +   ++     Q     +   G+   V  ED+        ++ Q    L ++ PTR+ Y ++
  S:     2 LDDRAKLLLKALVERYIADGQPVGSRTLSKASGLELSPATIRNVMSDLEDLGLIVSPHTSAGRIPTARGYRLFV---------DTMLTVR-QEQFAAHVLAPDQPQKVISNAANLLSSLSQFVGVVIAPRRSSVFRHIEFLRLSERRLLVIIVSPEGDVQNRVIFTETDYSQAQLIEAANYLNSHYVGLAIEQVRER-------LKNEVESLRSEIASLMQAAVAVSSEAMSETQDEVVISGERNLLAVTDFSNDMGHLRRAFDLFEQKAQLMRLLDIAGQAEGVRIFIGGESQVVPFEDLSIVSAPYEVDGQVVGTLGVIGPTRMAYDRM 315
>gi|163757818|ref|ZP_02164907.1| putative heat-inducible transcriptional regulator [Hoeflea phototrophica DFL-43] >gi|162285320|gb|EDQ35602.1| putative heat-inducible transcriptional regulator [Hoeflea phototrophica DFL-43] (361 aa)
Score = 214, Expect = 1.8e-15, Identities = 72/326 (22%), Positives = 170/326 (52%)
  Q:     3 EITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFS-----KPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQI---------KSKMIKTVHGQSSLL-AVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDE-----VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEF 328
           E+  R +E+ + +VE Y+ + +P+GS+ +      ++S A++RN M+ LE LGL+   H S+GR+P+  G +F+   F      +P +  E+++ ++R    D+   ++ ++ E+ +++S  T+   + I +  +  ++ I+ + +++  A+V+++  +  +   I+   D      +       N  L    + E+  +   ++ I  E   E + + ++L+ER              +++I  V G+++LL  V E ++ ++L+ +   LE      ++     + GS   I  G E     +S   ++ A    +  E+    + ++ PTR++Y++I  ++++
  S:    15 ELDDRSREIFRALVESYMESGDPLGSRSLSRMLPMSLSPASIRNVMSDLEDLGLIYAPHVSAGRLPTQKGLRFFVDAFMQVGDLQPEMR-ESIERQVRP--NDQNSPVETLLTEASQMLSGMTRGAGLVIASKQDSTIRHIEFIRLDQSRALVVLVGGNDQVENRIMELPDGVTAGQLVEAANFLNAHLAGRTLSEVRAE---LQRITDEVRNELDALSRDLVERGLAAWAGSQGGSGAARLI--VRGRANLLEGVSEGEELDRLRMLFDELERNENLTEL-MTAAEEGSGVRIFIGSENKLFSLSGSSVIVAPWR-DSEERVVGAVGIIGPTRLNYARIVPMVDY 350
>gi|111657649|ref|ZP_01408381.1| hypothetical protein SpneT_02001159 [Streptococcus pneumoniae TIGR4] (355 aa)
Score = 214, Expect = 1.8e-15, Identities = 82/319 (25%), Positives = 156/319 (48%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIE-NNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDS-MKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSL-----LAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKI 322
           +T+RQ+++L  I++ +  T  PVGSK + E    N S+AT+RNDMA LEK GLLEK HTSSGR+PS AG+++Y K+        EN   ++   F      ++ +++E+  ++++ +   ++ ++   +   L   D+V + + +A+ +    +     +      + + +D+     I  +R +   + +I  KI + +  II+      + V+ +L E IF+        + G+  L     LA  +F D  + K  L+I E          +++Q   N  +  G E    D+    +   I  +    L ++ P  +DY ++
  S:    13 VTERQQDILNLIIDIFTKTHEPVGSKALQESI--NSSSATIRNDMAELEKQGLLEKAHTSSGRMPSVAGFQYYVKHSLDFDRLAENEVYEIVKAFDQEFFKLEDILQEAANLLTDLSGCTVVALDVEPSRQRLTAFDIVVLGQHTALAVFTLDESRTVTSQFLIPRNFLQEDLLKLKSIIQERFLGHTVLDIHYKIRTEIPQIIQRYFTTTDNVI-DLFEHIFKEMFNENIVMAGKVHLLNFANLAAYQFFDQPQ-KVALEIRE--------GLREDQM-QNVRVADGQESCLADLAVISSKFLIPYRGVGILAIIGPVNLDYQQL 325
>gi|150395239|ref|YP_001325706.1| heat-inducible transcription repressor [Sinorhizobium medicae WSM419] >gi|166220403|sp|A6U5E1|HRCA_SINMW Heat-inducible transcription repressor hrcA >gi|150026754|gb|ABR58871.1| heat-inducible transcription repressor HrcA [Sinorhizobium medicae WSM419] (359 aa)
Score = 214, Expect = 1.9e-15, Identities = 76/325 (23%), Positives = 166/325 (51%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSK--PYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKS---------KMIKTVHGQSSLLAVPE-FQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDE-----VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEF 328
           + +R  E+ + IVE Y+ +  P+GS+ +      ++S A+VRN M+ LE LGL+   H S+GR+P+  G +F+   F +      +E   ++ +    +R  S++ ++ E+ +++S  ++   + I   ++ +LK ++ + +    A+ +++     +   II          ++      N  L    I E+ T+++ +K  ++    E + + Q+L+ER   I S         ++I  V G+++LL   E  +D E+L+ +   LE      +I     ++G    I  G E     +S   ++ A    + +++    + ++ PTR++YS+I  ++++
  S:    15 LDERSGEIFRRIVESYLESGEPLGSRNLSRLLPISLSPASVRNVMSDLEDLGLIYSPHVSAGRLPTQTGLRFFVDAFMQVGNLSPEERASIERQVGPGNRDHSVENLLTEASQMLSGMSRGAGLVITTKSDPVLKHVEFIRLAPTKALAVLVGEHDQVENRIIELPAGITSAQLTEAANFVNAHLAGQTIPELRTQLEKVKETVR---GELDALSQDLVERGLAIWSGSEGDGQPARLI--VRGRANLLEGLEGTEDIERLRMLFDDLEKKDSLIEI-LNLAESGPGVRIFIGSENKLFSLSGSSLIVAPYR-DSDDRIVGAVGVIGPTRLNYSRIVPMVDY 349
>gi|149005628|ref|ZP_01829367.1| heat-inducible transcription repressor HrcA [Streptococcus pneumoniae SP18-BS74] >gi|147762568|gb|EDK69528.1| heat-inducible transcription repressor HrcA [Streptococcus pneumoniae SP18-BS74] (344 aa)
Score = 214, Expect = 1.9e-15, Identities = 82/319 (25%), Positives = 156/319 (48%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIE-NNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDS-MKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSL-----LAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKI 322
           +T+RQ+++L  I++ +  T  PVGSK + E    N S+AT+RNDMA LEK GLLEK HTSSGR+PS AG+++Y K+        EN   ++   F      ++ +++E+  ++++ +   ++ ++   +   L   D+V + + +A+ +    +     +      + + +D+     I  +R +   + +I  KI + +  II+      + V+ +L E IF+        + G+ +L     LA  +F D  + K  L+I E          +++Q   N  +  G E    D+    +   I  +    L +  P  +DY ++
  S:     2 VTERQQDILNLIIDIFTKTHEPVGSKALQESI--NSSSATIRNDMAELEKQGLLEKAHTSSGRMPSVAGFQYYVKHSLDFDRLAENEVYEIVKAFDQEFFKLEDILQEAANLLTDLSGCTVVALDVEPSRQRLTAFDIVVLGQHTALAVFTLDESRTVTSQFLIPRNFLQEDLLKLKSIIQERFLGHTVLDIHYKIRTEIPQIIQRYFTTTDNVI-DLFEHIFKEMFNENIVMAGKVNLLNFANLAAYQFFDQPQ-KVALEIRE--------GLREDQM-QNVRVADGQESCLADLAVISSKFLIPYRGVGILAITGPVNLDYQQL 314
>gi|15887679|ref|NP_353360.1| heat-inducible transcription repressor [Agrobacterium tumefaciens str. C58] >gi|61226077|sp|P0A3I8|HRCA_AGRT5 Heat-inducible transcription repressor hrcA >gi|61226078|sp|P0A3I9|HRCA_AGRTU Heat-inducible transcription repressor hrcA >gi|3170206|gb|AAC18052.1| groE operon repressor HrcA [Agrobacterium tumefaciens] >gi|15155234|gb|AAK86145.1| heat-inducible transcription repressor [Agrobacterium tumefaciens str. C58] (363 aa)
Score = 214, Expect = 1.9e-15, Identities = 76/325 (23%), Positives = 167/325 (51%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSK----PYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQI------KSKMIK-TVHGQSSLL-AVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDE-----VSHEDIVFAQTDLNINEQNKT--KLVMVAPTRVDYSKIKGLLEF 328
           + +R +E+ + IVE Y+ T  P+GS+ +      ++S A+VRN M+ LE+LGL+   H S+GR+P+  G +F+   F +    P     N+  ++  V A    S++ ++ E+ +++S  ++   + +    +V+LK ++ + +    A+ +++     +   II          ++      N  L    ++E+  +  + ++   E   E   + Q+L+ER   I      + K+ +  V G+S+LL  +   +D ++++ +   LE      +I     ++GS   I  G E     +S   ++ A      +E+N+    + ++ PTR++Y++I  ++++
  S:    15 LDERSREIFRRIVEGYLDTGEPLGSRSLSRLLPMSLSPASVRNVMSDLEELGLIYSPHISAGRLPTQTGLRFFVDAFMQVGDLPADERANIDRQIGPV-AGHEQSLEGLLTEASRMLSGMSRGAGLVLTAKNDVILKHVEFIRLEPTKALAVLVGDHNQVENRIIELPAGISSSQLTEAANFINAHLSGQTLQELRGQFQTQRT---ELQSELGMLAQDLVERGLAIWAGDNEEGKLGRLIVRGRSNLLEGLAGEEDIDRVRMLFDDLERKENLIEI-LNLAESGSGVRIFIGSENKLFSLSGSSLIVAPYR---DEENRVVGAVGVIGPTRLNYARIVPMVDY 350
>gi|85714060|ref|ZP_01045049.1| heat-inducible transcription repressor [Nitrobacter sp. Nb-311A] >gi|85699186|gb|EAQ37054.1| heat-inducible transcription repressor [Nitrobacter sp. Nb-311A] (365 aa)
Score = 214, Expect = 1.9e-15, Identities = 46/164 (28%), Positives = 91/164 (55%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFAD--RTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNII 164
           + ++ +R +E+ + IVE Y+AT  PVGS+ V       +S A+VRN M+ LE+LGL+   HTS+GR+P+  G +F+     +     E  +  ++N  A   +  S++  ++++   +S  T+   + +   + + LK I+ V +    A+V+++  DG +   ++
  S:    19 LAQLNERSREIFRQIVESYLATGEPVGSRNVSRLIALPLSPASVRNVMSDLEQLGLIYAPHTSAGRLPTELGLRFFVDALMQVGDLTEPERQSIQNQLASVGKAQSVEAALDKALTRLSGLTRAAAVVLTAKSNMRLKHIEFVRLEPDKALVVLVAEDGQVENRVL 184
>gi|163732971|ref|ZP_02140415.1| heat-inducible transcription repressor [Roseobacter litoralis Och 149] >gi|161393506|gb|EDQ17831.1| heat-inducible transcription repressor [Roseobacter litoralis Och 149] (354 aa)
Score = 214, Expect = 2.0e-15, Identities = 73/328 (22%), Positives = 154/328 (46%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQI-------KSKMIKTVHGQSSLLAVP-EFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDE----VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEF 328
           + E+ +R +E+ + +VE Y+A   PVGS+ +   +   +SAAT+RN M  LE LGLL+  H S+GR+P+  G + +     +    DE  + K+    +     +  +++     +S  T+   + +    E  +K I+ V ++ + A+V+++ +DG++   +           +       N  +    + E+   I   K  I+ + +E + + Q L+E    +         ++I  V G+S+LL    E +D E+++ +   LE      +   ++ + G    I  G E          +     +N + +    + ++ PTR++Y +I  ++ +
  S:     8 LGEMNERSREVFRRVVEGYLADGAPVGSRTLTRDFSEKVSAATIRNTMQDLEYLGLLDSPHISAGRIPTQMGLRMFVDGLLEIGDPDETDREKIDATMSSNAEDVSGLLDRVGSALSGVTQGASLVMTPKHEAPIKHIEFVSLSPERALVVLVFADGHVENRLFSPPAGQTPSSMREAANFLNALIEGKTLSEVHGAI---KKEIRNRRQEIDSLAQALVESGMAVWEGEGDQNERLI--VRGRSNLLTEDGEGEDFERIRLLFDDLERKRDIAEF-LERTEEGDGVRIFIGSENKLFSLSGSSLVVSPYMNADRKIIGAVGVIGPTRLNYGRIVPIVNY 341
>gi|189347185|ref|YP_001943714.1| heat-inducible transcription repressor HrcA [Chlorobium limicola DSM 245] >gi|189341332|gb|ACD90735.1| heat-inducible transcription repressor HrcA [Chlorobium limicola DSM 245] (357 aa)
Score = 213, Expect = 2.5e-15, Identities = 83/329 (25%), Positives = 166/329 (50%)
  Q:     3 EITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFY-EKNFSKPYINDENLKLKLRNVFADRT-----MSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKI---------DSMKSIIKEKVKEYEFVLQE--LIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQT-------GSNTLITFGDEVSHE---DIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKN 331
           E+T R++++L  +++ YV +A PVGS+ +   Y   +S AT+RN MA LE+ G + + HTS+GRVP+  GY++Y +       INDE  K ++   F   T      S +V+   +  + + S +L ++     +  + +++DMV ++    MVI+      L   ++    +   + +   + + N+RL    + EI   +         DS  +++   V+    +  E  +IER++         + G   ++  PEF+  EK+++++ ++E  +   ++              G +  IT G E       ++    T   + +    KL ++ PTR+DY     +L ++ +
  S:     5 ELTLRERQVLGIVIQSYVVSAAPVGSRYIARNYNLGLSDATIRNVMADLEREGFISQPHTSAGRVPTDKGYRYYVDLIMHVQRINDEE-KRRIDADFGQLTCERKGTSTEVLFSAAKVLGTISRQLSVVLSPAFSNAVFEKLDMVLLSSSRMMVILSIRSLFLRTIVMELDIEVSRQMVDDVVAVLNERLSGLTLVEIRRTLVVRLSDCTCDS--ALLDRIVRSSGELFDETPMIERLY---------ISGAEYIIDQPEFKQPEKVRDLISMIEDKTSVAKLVDDATAAVEAVKPQGMDVSITIGKENIERKAGELTILSTPYYVGDM-VGKLGILGPTRMDYEHAVRVLNYMAD 347
>gi|2735759|gb|AAC35414.1| heat shock operon regulator HrcA [Leptospira interrogans] (342 aa)
Score = 213, Expect = 2.5e-15, Identities = 74/326 (22%), Positives = 153/326 (46%)
  Q:     3 EITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEV-LLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTE-KLKEILQILESTSIWEQIAFKQ--NQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEF 328
           ++T+R K +LK +V+ ++    PVGSK + +K+   +S A++R  +  LE  G L   HTS GR+P+  GY+FY  +    Y      K +++  +      +D +++ +  ++S  +    I I     +  LK I+++ +     ++I++   G +    I    +   + +    +  ND L    I EI   I     I K+  +++  +   +   +    S++   + G  +L A   F+D E +L ++L +L+     +   F +  +Q G  T+I    + S   +    ++  + E+    L ++ P R+DY++   L++F
  S:     2 DLTERHKRILKALVDKFIQENRPVGSKTLFDKHDIGLSPASIRTVLKDLEDFGYLASKHTSGGRIPTERGYRFYVDSLVILYELTLKEKQRIQQEYLKMQFKLDQILKATASVLSSLSNAAGIVIGPAKNLDTLKHIELIHVRGDEILMILVMRSGTVLHRNIFVDQNYSQEALYQVSKYLNDNLKGYDIYEIQNVIIPKLMIRKDGPEDFIRIADLISSAMTPDNSEVTLYIDGFKNLYA--NFRDEEQQLSQVLSLLDDQGFLKAF-FSEYIDQDGVFTIIGKDGDRSMSGVSIITSNYKMGEKKIGALGIIGPQRMDYNRALPLVDF 328
>gi|194336188|ref|YP_002017982.1| heat-inducible transcription repressor HrcA [Pelodictyon phaeoclathratiforme BU-1] >gi|194308665|gb|ACF43365.1| heat-inducible transcription repressor HrcA [Pelodictyon phaeoclathratiforme BU-1] (350 aa)
Score = 212, Expect = 2.9e-15, Identities = 77/332 (23%), Positives = 155/332 (46%)
  Q:     2 KEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLR----NVFADRTMSIDVVIEESCKIISE-STKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKI----------DSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSH---EDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEF 333
           +++  R++++L  I++ YV TA PVGS+ +   Y    S AT+RN MA LE  G + + HTS+GR+P+  GY++Y          D+N K ++      +  DR  +   V+  + K++   S +L ++     +  + +++DMV ++    MVI+      +   ++    +   + I   + + N RL    + EI   I            +K++I        F    + ER++         + G   ++  PEF+  +K++E++ ++E      ++      +  +  I+ G E      ED+        +      KL ++ P R+DY     +L ++ +  
  S:     4 RDLNLRERQVLGIIIQAYVVTAAPVGSRYIARNYNLGFSDATIRNVMAELEDEGYISQPHTSAGRIPTDKGYRYYVDLIMTFQSLDDNEKKRIEENIGQISIDRKGTSSDVLLSAVKVLGTISRQLSVVLSPTLSNAIFEKLDMVLLSSTRMMVILSIQSLFVKTIVMELDLEVSRQTIDGVVDMLNQRLSGLTLAEIRRSITRRLSGCSCDSGLKNLIVRSAGTL-FDESPIFERLY---------ISGTEYIVDQPEFKQPDKVRELITMIEDKFSMAKLVENSGPSRMDITISIGKENCERQAEDLTIVSAPYYVGNM-VGKLGILGPKRMDYEHAVRVLNYMADSL 342
>gi|116329213|ref|YP_798933.1| heat-inducible transcriptional repressor, HrcA [Leptospira borgpetersenii serovar Hardjo-bovis L550] >gi|116330180|ref|YP_799898.1| heat-inducible transcriptional repressor, HrcA [Leptospira borgpetersenii serovar Hardjo-bovis JB197] >gi|122282055|sp|Q04VD0|HRCA_LEPBJ Heat-inducible transcription repressor hrcA >gi|122283006|sp|Q04Y45|HRCA_LEPBL Heat-inducible transcription repressor hrcA >gi|116121957|gb|ABJ80000.1| Heat-inducible transcriptional repressor, HrcA [Leptospira borgpetersenii serovar Hardjo-bovis L550] >gi|116123869|gb|ABJ75140.1| Heat-inducible transcriptional repressor, HrcA [Leptospira borgpetersenii serovar Hardjo-bovis JB197] (342 aa)
Score = 212, Expect = 3.0e-15, Identities = 71/326 (21%), Positives = 155/326 (47%)
  Q:     3 EITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEV-LLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTE-KLKEILQILESTSIWEQIAFKQ--NQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEF 328
           ++T+R K +LK +V++++    PVGSK + +K+   +S A++R  +  LE  G L   HTS GR+P+  GY+FY  +    Y      K +++  +      +D +++ +  ++S  +    I I     +  LK ++++ +     ++I++   G +    I    +   + +    +  ND L    I EI   +     + ++  +++  + + L   +    S++   + G  +L A   F+D E +L ++L +L+     ++  F +  +Q G  T+I      S   +    ++  + E+    L ++ P R+DY++   L++F
  S:     2 DLTERHKRILKALVDEFIQENRPVGSKTLFDKHDIGLSPASIRTVLKDLEDYGYLASKHTSGGRIPTERGYRFYVDSLVILYELTLKEKQRIQQEYLKMQFKLDQILKATASVLSSLSNAAGIVIGPAKNLDTLKHLELIHVRGDEILMILVMRSGTVLHRNIFVDRNYSQEALYQVSKYLNDNLKGYDIYEIQNVVVPNLMVRRDGPEDFTRIAELLSSAMNPDNSEVTLYIDGFKNLYA--NFRDEEQQLSQVLSLLDDQGFLKEF-FSEYIDQDGVYTIIGKDGNRSMSGVSIITSNYKMGEKKIGALGIIGPQRMDYNRALPLVDF 328
>gi|114706054|ref|ZP_01438957.1| heat-inducible transcription repressor [Fulvimarina pelagi HTCC2506] >gi|114538900|gb|EAU42021.1| heat-inducible transcription repressor [Fulvimarina pelagi HTCC2506] (365 aa)
Score = 212, Expect = 3.1e-15, Identities = 79/322 (24%), Positives = 164/322 (50%)
  Q:     7 RQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYIND------ENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQI--------KSKMIKTVHGQSSLL-AVPEFQDTEKLKEILQILESTS-IWEQIAFKQNQTGSNTLITFGDE-----VSHEDIVFAQTDLNINEQNKTKLV----MVAPTRVDYSKIKGLLEF 328
           R +E+ + IVE Y+    PVGS+++ +    ++S A+VRN M+ LE LGL+   H S+GR+P+  G +F+   F +  + D      E ++ K+R   A    S D ++ E+ +++S  ++   I +   +++ LK I+ + +    A+ +++  +G +   +           ++      N  +    + E   +ID +K+   E     + + Q+L++    +         S++I  V G+++LL  V   +D E+L+ +   LES S + E +   +   G    I  G E     +S   +V A  +         +++    ++ PTR++Y +I  ++++
  S:    18 RSREIFRLIVESYLDQGVPVGSRMLSKLLTTSLSPASVRNVMSDLEALGLIYSPHVSAGRMPTELGLRFFVDAFLE--VGDLAASEREEIEEKVR--LAGDGRSFDGLLTEASQLLSGLSRGAGIVLTATSDLRLKHIEFIRLEPTKALAVLVGVNGEVENRLFDLPAGVTPSQLTEAGNFLNAHVAGRTLPEARARIDHLKN---ETNAALDVLSQQLVDEGLAVWSEVGGDQPSRLI--VRGRANLLDNVSATEDLERLRLLFDDLESKSGMIELLGLAEK--GDGVRIFIGKENNLFSLSGSSLVVAPYEKQAAGSGPERVIGAVGVIGPTRLNYRRIVPMVDY 353
>gi|115522380|ref|YP_779291.1| heat-inducible transcription repressor [Rhodopseudomonas palustris BisA53] >gi|115516327|gb|ABJ04311.1| heat-inducible transcription repressor HrcA [Rhodopseudomonas palustris BisA53] (374 aa)
Score = 212, Expect = 3.1e-15, Identities = 48/164 (29%), Positives = 96/164 (58%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEK------NFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNII 164
           + ++ +R +E+ + IVE Y+AT  PVGS+ +       +S A+VRN M+ LE+LGL+   HTS+GR+P+  G +F+        + ++P    ++++ +L +V   +  S++  + E+   +S  T+   + +   + V LK I+ V +  + A+VI++  DG +   ++
  S:    28 LAQLNERSREIFRQIVESYLATGEPVGSRNLSRLINVPLSPASVRNVMSDLEQLGLIYAPHTSAGRLPTELGLRFFVDALMQLGDLTEP--ERQSIQAQLASV--GQAQSVESALGEALTRLSGLTRAAAVVLTTKSNVRLKHIEFVRLEPERALVILVAEDGQVENRVL 193
>gi|33866809|ref|NP_898368.1| putative heat-inducible transcriptional repressor HrcA [Synechococcus sp. WH 8102] >gi|46576437|sp|Q7U3Z7|HRCA_SYNPX Heat-inducible transcription repressor hrcA >gi|33639410|emb|CAE08794.1| putative heat-inducible transcriptional repressor HrcA [Synechococcus sp. WH 8102] (324 aa)
Score = 212, Expect = 3.2e-15, Identities = 74/320 (23%), Positives = 160/320 (50%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKN-FSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKL-PMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDI---VFAQTDLNINEQNKTKLVMVAPTRVDYS 320
           MK ++ RQ+++L+  V  YV T  PVGS+ +++++    S+ATVR+ M  LEK GLL + HTS+GR+PS  GY+ Y  +   +P +  ++L+ +L  + + R  ++D ++++  + +++ T L  +I         L+ I +V+   +  +++++  D     ++          +++   R  + +L D  I        + +S+  +  +  + +   L       ++ ++  VHG S L+A PEF  T +L+ +L++++       +    +Q G    +  G+E   + +      Q      ++   ++ +V P R+ Y+
  S:     1 MKPLSARQQQVLQATVHHYVDTMEPVGSRTLVQRFGIPASSATVRSAMGALEKRGLLTQPHTSAGRIPSALGYRCYVDDLLPEPGVAVQHLERELTGL-SLRWAALDDLLQQLARRLTDFTGLMSLITRPQQPRAQLEAIRLVQSGDR--LLVMLVEDSGRASHLNLRLPPGASDELTAIERWTDQQLEDGSI--------NWRSLPPQLQRSGDVLRSALDHPSMSPETPLV--VHGLSRLVAEPEFHSTAELRPLLELIDDQPC--AVVSATDQPG----VWIGEEHPQKALQACSVVQAPYRCGQEGVGQVALVGPMRMAYA 306
>gi|15964130|ref|NP_384483.1| heat-inducible transcription repressor [Sinorhizobium meliloti 1021] >gi|22256785|sp|Q92SK1|HRCA_RHIME Heat-inducible transcription repressor hrcA >gi|15073306|emb|CAC41814.1| Probable heat-inducible transcription repressor protein [Sinorhizobium meliloti 1021] (359 aa)
Score = 212, Expect = 3.2e-15, Identities = 76/325 (23%), Positives = 165/325 (50%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSK--PYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKS---------KMIKTVHGQSSLLAVPE-FQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDE-----VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEF 328
           + +R  E+ + IVE Y+ +  P+GS+ +      ++S A+VRN M+ LE LGL+   H S+GR+P+  G +F+   F +      +E   ++ +    +R  S++ ++ E+ +++S  ++   + I   ++ +LK ++ + +    A+ +++     +   II          ++      N  L    I E+ T+++ +K  ++    E + + Q+L+ER   I S         ++I  V G+++LL   E   D E+L+ +   LE      +I     ++G    I  G E     +S   ++ A    + +++    + ++ PTR++YS+I  ++++
  S:    15 LDERSGEIFRRIVESYLESGEPLGSRNLSRLLPVSLSPASVRNVMSDLEDLGLIYSPHVSAGRLPTQLGLRFFVDAFMQVGNLSPEERASIERQVHPGNRDRSVENLLTEASQMLSGMSRGAGLVITTKSDPVLKHVEFIRLAPTKALAVLVGEHDQVENRIIELPAGITSAQLTEAANFVNAHLAGQTIPELRTQLEKVKETVR---GELDALSQDLVERGLAIWSGSEGDGQPARLI--VRGRANLLEGLEGTDDIERLRMLFDDLEKKDSLIEI-LNLAESGPGVRIFIGSENKLFSLSGSSLIVAPYR-DSDDRIVGAVGVIGPTRLNYSRIVPMVDY 349
>gi|82703538|ref|YP_413104.1| heat-inducible transcription repressor [Nitrosospira multiformis ATCC 25196] >gi|123543947|sp|Q2Y6A9|HRCA_NITMU Heat-inducible transcription repressor hrcA >gi|82411603|gb|ABB75712.1| heat-inducible transcription repressor HrcA [Nitrosospira multiformis ATCC 25196] (339 aa)
Score = 212, Expect = 3.3e-15, Identities = 71/319 (22%), Positives = 157/319 (49%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNF--SKPY--INDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIE-NNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEF-QDTEKLKEILQILE-STSIWEQIAFKQNQTGSNTLITFGDE---VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKI 322
           + +R + LLK +VE Y++   PVGS+ + +    ++SAAT+RN MA LE +GL+   H S+GR+P+  GY+F+       KP   I    L+ +L      R      +I  + ++++E T+   + +       + + I+ + ++++  ++I++T +G++   ++    +    +++      N     C I EI T++ S    +++ +        +  +   +  S+ +  V G+  LL V +   +   LK++  + E  T++ + + F +   G    I  G+E   V+ ++         ++ +    + ++ PTR+ Y ++
  S:     2 LNKRAQILLKTLVERYISEGQPVGSRSLSKFSGLDLSAATIRNVMADLEDMGLVASPHASAGRIPTHQGYRFFVDTLLVVKPLDVIEIHQLQDQLHPDNPSR------LINSASQLLAELTRFAGVVVSPKRNSAIFRYIEFMSLSEKRVLLIIVTPEGDVQNRVLFTDRNYSQSELTEAANFINHNYAGCAIDEIRTRLQSELKQLRQDMTSLMTAAIDAGDAAIRENSEAV-IVAGERKLLDVQDLSSNMASLKKLFDLFERKTALLQLLEFSRKAEGVQIFI--GEECGVVTMDEFSVVTAPYRVDGKMVGTVAVIGPTRMAYERV 321
>gi|21242271|ref|NP_641853.1| heat-inducible transcription repressor [Xanthomonas axonopodis pv. citri str. 306] >gi|21107698|gb|AAM36389.1| heat-inducible transcriptional repressor [Xanthomonas axonopodis pv. citri str. 306] (343 aa)
Score = 212, Expect = 3.5e-15, Identities = 74/321 (23%), Positives = 143/321 (44%)
  Q:     7 RQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDR-----LID---CPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDE---VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLE 327
           R ++LL+ ++  Y+    PVGSK + +    ++S AT+RN +A LE +GLL   HTS+GRVP+  GY+ +  +  +     E    +LR   A    +  ++   S  + + S  + ++      +   + ID V ++ +  + I++ +D  +   +I  +      ++       N +     L D   C ++E+      M+ ++   V        EL              + GQ+ L+ V +  D ++L+E+ +   S     Q+  +  Q      I  G+E   VS ED+         N Q    L ++ P R+ Y ++  L++
  S:     5 RARQLLRTLIARYIRDGEPVGSKTLAQHAGLDVSPATIRNILADLEDVGLLSSPHTSAGRVPTAHGYRVFVDSLVQMQPPGEEEVRRLRAELASGNGTQSLLGSASQMLSAMSHFVGVVSAPRREQFAFRHIDFVALDARRVLAILVFADNEVQNRVIEPRRAYEPAELERVANYLNAQFAGRALADIRACLLRELRMAKSEMEQLLAHSV--------ELASEALVPADADDMVMAGQTRLMGVQDLSDLDRLRELFEAFASKREILQLLERTIQ-APGVRIFIGEETGMVSLEDVSLVTAPYAANGQVLGVLGVIGPKRMAYDRLIPLVQ 327
>gi|32130436|sp|Q8PMB2|HRCA_XANAC Heat-inducible transcription repressor hrcA (350 aa)
Score = 212, Expect = 3.5e-15, Identities = 74/321 (23%), Positives = 143/321 (44%)
  Q:     7 RQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDR-----LID---CPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDE---VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLE 327
           R ++LL+ ++  Y+    PVGSK + +    ++S AT+RN +A LE +GLL   HTS+GRVP+  GY+ +  +  +     E    +LR   A    +  ++   S  + + S  + ++      +   + ID V ++ +  + I++ +D  +   +I  +      ++       N +     L D   C ++E+      M+ ++   V        EL              + GQ+ L+ V +  D ++L+E+ +   S     Q+  +  Q      I  G+E   VS ED+         N Q    L ++ P R+ Y ++  L++
  S:    12 RARQLLRTLIARYIRDGEPVGSKTLAQHAGLDVSPATIRNILADLEDVGLLSSPHTSAGRVPTAHGYRVFVDSLVQMQPPGEEEVRRLRAELASGNGTQSLLGSASQMLSAMSHFVGVVSAPRREQFAFRHIDFVALDARRVLAILVFADNEVQNRVIEPRRAYEPAELERVANYLNAQFAGRALADIRACLLRELRMAKSEMEQLLAHSV--------ELASEALVPADADDMVMAGQTRLMGVQDLSDLDRLRELFEAFASKREILQLLERTIQ-APGVRIFIGEETGMVSLEDVSLVTAPYAANGQVLGVLGVIGPKRMAYDRLIPLVQ 334
>gi|153007526|ref|YP_001368741.1| heat-inducible transcription repressor [Ochrobactrum anthropi ATCC 49188] >gi|151559414|gb|ABS12912.1| heat-inducible transcription repressor HrcA [Ochrobactrum anthropi ATCC 49188] (372 aa)
Score = 211, Expect = 4.1e-15, Identities = 79/328 (24%), Positives = 171/328 (52%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSK----PYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFK---DDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKS--------KMIKTVHGQSSLLA-VPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDE-----VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEF 328
           +  + QR +++ + IVE Y+   +P+GS+ +       +S AT+RN M+ LE LGL+   H S+GR+P+  G +F+   F +    P     +++ ++R+  A    S++ V+ E+ +++S  ++   + +    E  LK I+ V +    A+ +++  +G++   +++      +S L + S      N  +    + E   +   +K + +E  +E + + QEL+ +   + S        ++I  V G+++LL  +   +D E+L+ +   LE+     Q+     + GS   I  G E     +S   +V A    +  ++    L ++ PTR++Y++I  ++++
  S:    26 LSSLDQRSRDIFRLIVETYLNDGDPLGSRNLSRLLPHTLSPATIRNVMSDLEHLGLIYAPHVSAGRLPTQIGLRFFVDAFLEVGDLPPEERSSIEAQVRS--AGMNNSVESVLTEASQVLSGLSRGAGLVLATKAEGALKHIEFVRLEPTRALAVLVMQNGDVENRVVNLPVGISNSQLVEAS---NFLNAHIHGHTLSEAKAE---LKKLTEETRQELDQLSQELVAQGLAVWSGAGTDQPARLI--VRGRANLLENIHAQEDIERLRHLFDDLETKDGMVQL-LDLAEAGSGVRIFIGSENKLFSLSGSSLVVAPYR-DSEQRVIGALGVIGPTRLNYARIVPMVDY 362
>gi|154254010|ref|YP_001414834.1| heat-inducible transcription repressor [Parvibaculum lavamentivorans DS-1] >gi|154157960|gb|ABS65177.1| heat-inducible transcription repressor HrcA [Parvibaculum lavamentivorans DS-1] (354 aa)
Score = 211, Expect = 4.2e-15, Identities = 45/162 (27%), Positives = 93/162 (57%)
  Q:     3 EITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNII 164
           ++ +R +E+L+ +VE Y+ T  PVGS+ +  +   ++SAA++RN M+ LE LGL+   HTS+GR+P+ AG + +     +     ++ ++ +    +    SI+ V++E+ K++S  +      +    +  LK ++ V I+ + A+V+++T  G +   +I
  S:     6 DLNERSREILRRVVETYLETGEPVGSRFLSRQLPLSLSAASIRNVMSDLEGLGLIFAPHTSAGRMPTEAGLRMFVDGLLEIGDLTDDERIAIERQVSGSHKSIEDVLDEASKLLSGLSHGAGFVVAPTYDAALKHVEFVPIDAERALVVIVTEGGAVENRVI 167
>gi|23465297|ref|NP_695900.1| heat-inducible transcription repressor [Bifidobacterium longum NCC2705] >gi|46576600|sp|Q8G6C7|HRCA_BIFLO Heat-inducible transcription repressor hrcA >gi|23325934|gb|AAN24536.1| heat-inducible transcription repressor [Bifidobacterium longum NCC2705] (372 aa)
Score = 211, Expect = 4.5e-15, Identities = 48/159 (30%), Positives = 93/159 (58%)
  Q:     4 ITQRQKEL-LKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISEST-KLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKN 162
           +TQ ++ L L+ +VEDY+ +  PVGS  +   +   +S+AT+RNDMA LE  G L + HTS+GRVP+  GY+++    +      E  +  + N F   ++S+   ++ S +++SE T ++ ++   +  +  L+ ++MV +   + + +VIT  G + ++
  S:     1 MTQSRRMLVLRAVVEDYIRSQEPVGSTSLTRDHDLGVSSATIRNDMAALEDEGYLIQPHTSAGRVPTEKGYRYFVDRLATVVPLSEAQRRGI-NSFLSGSVSLKDALQRSARLLSEITGQVAVVASPSLAKATLRHVEMVPVAMTTLLAVVITDTGRVAQH 160
>gi|154487312|ref|ZP_02028719.1| hypothetical protein BIFADO_01157 [Bifidobacterium adolescentis L2-32] >gi|154083830|gb|EDN82875.1| hypothetical protein BIFADO_01157 [Bifidobacterium adolescentis L2-32] (381 aa)
Score = 211, Expect = 4.6e-15, Identities = 53/218 (24%), Positives = 115/218 (52%)
  Q:     7 RQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISEST-KLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIF 224
           R+  +L+ +VEDY+ +  PVGS  +   +   +S+ATVRNDMA LE  G L + HTS+GRVP+  GY+++    +      E  +  + N F   ++++   ++ + +++++ T ++ ++   + ++  L+ I++V ++  + + +VIT  G + ++I++    + L D++    + N+    C    +    D ++ +   K       L E + + F
  S:    11 RRMLVLRAVVEDYIRSQEPVGSTTLTRDHDLGVSSATVRNDMAALEDEGYLIQPHTSAGRVPTEKGYRYFVDRLATVVPLSEAQRRGI-NSFLSGSVNLQDTLQRAARLLAQITGQVAVVAAPSLSKSTLRHIEIVPVSINTLLAVVITDTGRVAQHILNV---TKLPDVTTLTHLTNEINTQCSGVSLTRTADCVRQMGARKEYHAISTLAETLAQAF 225
>gi|119025846|ref|YP_909691.1| heat-inducible transcription repressor [Bifidobacterium adolescentis ATCC 15703] >gi|166219852|sp|A1A1M6|HRCA_BIFAA Heat-inducible transcription repressor hrcA >gi|118765430|dbj|BAF39609.1| heat-inducible transcription repressor hrcA [Bifidobacterium adolescentis ATCC 15703] (375 aa)
Score = 211, Expect = 4.6e-15, Identities = 53/218 (24%), Positives = 115/218 (52%)
  Q:     7 RQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISEST-KLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIF 224
           R+  +L+ +VEDY+ +  PVGS  +   +   +S+ATVRNDMA LE  G L + HTS+GRVP+  GY+++    +      E  +  + N F   ++++   ++ + +++++ T ++ ++   + ++  L+ I++V ++  + + +VIT  G + ++I++    + L D++    + N+    C    +    D ++ +   K       L E + + F
  S:     5 RRMLVLRAVVEDYIRSQEPVGSTTLTRDHDLGVSSATVRNDMAALEDEGYLIQPHTSAGRVPTEKGYRYFVDRLATVVPLSEAQRRGI-NSFLSGSVNLQDTLQRAARLLAQITGQVAVVAAPSLSKSTLRHIEIVPVSINTLLAVVITDTGRVAQHILNV---TKLPDVTTLTHLTNEINTQCSGVSLTRTADCVRQMGARKEYHAISTLAETLAQAF 219
>gi|92115784|ref|YP_575513.1| heat-inducible transcription repressor [Nitrobacter hamburgensis X14] >gi|122418903|sp|Q1QRU4|HRCA_NITHX Heat-inducible transcription repressor hrcA >gi|91798678|gb|ABE61053.1| heat-inducible transcription repressor HrcA [Nitrobacter hamburgensis X14] (362 aa)
Score = 211, Expect = 4.6e-15, Identities = 44/164 (26%), Positives = 91/164 (55%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFAD--RTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNII 164
           + ++ +R +++ + IVE Y+AT  PVGS+ +       +S A+VRN M+ LE+LGL+   HTS+GR+P+  G +F+     +     E  +  ++   A   +  S++  ++++   +S  T+   + +   + V LK I+ V +  + A+V+++  DG +   ++
  S:    16 LAQLNERSRDIFRQIVESYLATGEPVGSRNISRLITMPLSPASVRNVMSDLEQLGLIYAPHTSAGRLPTEFGLRFFVDALMQVGDLTETERQSIQTQLASVGKAQSVEAALDQALTRLSGLTRAAAVVLTAKSNVRLKHIEFVRLEPEKALVVLVAEDGQVENRVL 181
>gi|124024384|ref|YP_001018691.1| negative regulator of class I heat shock protein [Prochlorococcus marinus str. MIT 9303] >gi|123964670|gb|ABM79426.1| Negative regulator of class I heat shock protein [Prochlorococcus marinus str. MIT 9303] (352 aa)
Score = 210, Expect = 4.8e-15, Identities = 81/335 (24%), Positives = 163/335 (48%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFY-EKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKL-PMIKIENNTEVLLKRIDMVEINKQSAMVIVITSD--GNLTKNIIHFKDDSILKDISICIRIFNDRLI-----DCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEK 335
           ++ +  RQ+++L+  V  YV T  PVGSK +++++    SAATVR+ M  LE+ GLL + HTS+GRVPS  GY+ Y +     P    ++L+ +L N+ + R  ++D ++ +  + +++ T L  +I      +  L+ + +V    +  +++V +S+   +L   + H   +  L+ I    R   D+L            +  +++   S+++E +  +            Q  ++     HG S LLA PEF  +  L+ +L++++ T     +     Q G   +     + + E     Q   + + +   ++ +V P R+ Y+  K  +  + N  E+
  S:    21 LESLPARQQQVLQATVHHYVDTIEPVGSKTLVQRFGLKASAATVRSAMGALEQRGLLTQPHTSAGRVPSPQGYRHYVDCLLPPPGSAAQHLERELTNL-SLRWAALDDLMWQLARRLTDFTGLMSLITRPARPKPTLQAVRLVRSGDRLLVMLVESSNQASHLNLRLPHEASNE-LEAIEEWTR---DQLATTGNGSLDWSSLPPQLNLSGSLLREAIHSHSQA---------QTPAESDAVFHGMSRLLAQPEFSSSASLQPLLELMD-TQPAAVVPVGSEQLGGVWIGAEHPKSALEACSVVQATYHSSGEGIGQVALVGPMRMAYATAKAAVSSVANHLER 349
>gi|187479194|ref|YP_787219.1| heat-inducible transcription repressor [Bordetella avium 197N] >gi|115423781|emb|CAJ50332.1| heat-inducible transcription repressor [Bordetella avium 197N] (334 aa)
Score = 210, Expect = 5.0e-15, Identities = 71/316 (22%), Positives = 151/316 (47%)
  Q:     7 RQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNF--SKPY-INDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIK---------TVHGQSSLLAVPEF-QDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDE--VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKI 322
           R   LLK ++E Y+A   PVGS+ + + +  ++S AT+RN MA LE+LGL++  HTS+GRVP+  GY+ +  +     PY     N+   L  +   R       +  +  ++S  T+   + +      + ++I+ V ++ +  ++I++T DG++   I+  + D    ++      FN               D+++  +  ++ +    L+E I R+ Q   ++            + G+  LL V +   D ++L+++  + E  +   Q+    ++     +   GD   +  +++        ++ Q    L ++ PTR+ Y ++
  S:     4 RAHALLKALIERYIADGQPVGSRTLSKVF--DLSPATIRNVMADLEELGLIQSPHTSAGRVPTPRGYRMFVDSLLAVHPYQFEPANMAELLPMIEPSRA------VNAAAALLSNLTQFAGMVLTPKRAQVFRQIEFVRLSDKRVLLIIVTPDGDVQNRIMQVQRDYAESELVEAANFFNQHF-------SGKSFDAVRRTLSTELIQ----LREDISRLMQAAVEVGAEAAEETDSVVISGERKLLNVTDIASDMDRLRKMFSLFEKKTDLLQLLDVSSRAQGVQIYIGGDSQLLPMDEVTVVTAPYGVDGQIVGTLGVIGPTRMSYERV 315
>gi|153854629|ref|ZP_01995879.1| hypothetical protein DORLON_01874 [Dorea longicatena DSM 13814] >gi|149752733|gb|EDM62664.1| hypothetical protein DORLON_01874 [Dorea longicatena DSM 13814] (345 aa)
Score = 210, Expect = 5.1e-15, Identities = 73/332 (21%), Positives = 169/332 (50%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLP-MIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLID-CPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERI---FQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLIT--FGDEV---SHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEK 335
           +++R+ ++L  I+++Y+ T  PVGS+ + +    N+S+AT+RN+MA LE++G + + HTS+GR+PS  GY+ Y     +    + N   ++++   D+   +D +++++ K+++ +T    M+    N    +K I +  ++++  + +++   GN+ KN I   D+ I  +  + + +  +  ++   I+EI      + + +KE+   +  V+  +++ +     +   M     G +++   PE  D +  +EI+   E      ++  +      NT I    GDE    +  D         + +  K  + ++ P R+DY  +   ++ ++ E ++
  S:     1 MSERKLKILHAIIQNYLETGEPVGSRTISKYTDLNLSSATIRNEMADLEEMGYIIQPHTSAGRIPSDKGYRLYVDMLMEEKEQELN---EMQDQMLDKADKMDQLLKQAAKVLATNTNYATMVSTPMNNSNKIKFIQLSMVDEEQVIAVIVLG-GNVIKNKIINIDEPISNENLLKLNMLLNTTLNGMSIEEINL---GLIARLKEQAGIHSQVVGYVLDAVADAIHVDDDMQIYTSGATNIFKYPELSDNQSAQEIISAFEEKQQLSELVTQTLAQDENTGIQVYIGDETPVQTMRDCSVVTATYELGDGMKGTIGIIGPKRMDYEHVLKSMKRLQTELDQ 335
>gi|23494032|dbj|BAC19000.1| putative heat shock gene transcriptional repressor HrcA [Corynebacterium efficiens YS-314] (444 aa)
Score = 210, Expect = 5.1e-15, Identities = 51/170 (30%), Positives = 103/170 (60%)
  Q:     6 QRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYIND-ENLKLKLRNV---FADRTMSIDVVIEESCKIISEST-KLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDD------SILKDI 175
           +R+ E+L+ IV DY+ +  PVGSK ++E++  N+S+AT+RNDM+ LE  G + + H SSGRVP+  GY+ +  +     I+D + L L  R     F +  + ++ V+  S +++S+ T +  ++++       +K  ++V ++    ++++IT  G + +  +   +       ++LKD+
  S:   109 KRRYEVLRAIVADYIESQEPVGSKALLERHKLNVSSATIRNDMSVLESDGYIVQEHASSGRVPTEKGYRLFVDS-----IHDIKPLSLAERRAILGFLEGGVDLEDVLRRSVQLLSQLTHQAAVVQLPTLKTARVKHCEVVSLSPVRLLLVLITDTGRVDQRNVELDEPLEADQVTVLKDL 284
>gi|58581652|ref|YP_200668.1| heat-inducible transcription repressor [Xanthomonas oryzae pv. oryzae KACC10331] >gi|75435614|sp|Q5H188|HRCA_XANOR Heat-inducible transcription repressor hrcA >gi|58426246|gb|AAW75283.1| Heat-inducible transcription repressor hrcA [Xanthomonas oryzae pv. oryzae KACC10331] (350 aa)
Score = 210, Expect = 5.5e-15, Identities = 72/321 (22%), Positives = 145/321 (45%)
  Q:     7 RQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDR-----LID---CPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDE---VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLE 327
           R ++LL+ ++  Y+    PVGSK + +    ++S AT+RN +A LE +GLL   HTS+GRVP+  GY+ +  +  +     E    +LR   A    +  ++   S  + + S  + ++      +   + ID V ++ +  + I++ +D  +   +I  +      ++       N +     L D   C ++E+    + M+ ++   V        +L              + GQ+ L+ V +  D ++L+E+ ++  S     Q+  +  Q      I  G+E   VS ED+         + Q    L ++ P R+ Y ++  L++
  S:    12 RTRQLLRTLIARYIRDGEPVGSKTLAQHAGLDVSPATIRNILADLEDVGLLSSPHTSAGRVPTAHGYRVFVDSLVQMQPPGEEEVRRLRAELASGNGTQSLLGSASQMLSAMSHFVGVVSAPRREQFAFRHIDFVALDARRVLAILVFADNEVQNRVIEPRRAYEPAELERVANYLNAQFAGRALADIRACLLRELRMAKNEMEQLLAHSV--------DLASEALVPADADDMVMAGQTRLMGVQDLSDLDRLRELFEVFASKREILQLLERTIQ-APGVRIFIGEETGMVSLEDVSLVTAPYTAHGQVLGVLGVIGPKRMAYDRLIPLVQ 334
>gi|33864291|ref|NP_895851.1| negative regulator of class I heat shock protein [Prochlorococcus marinus str. MIT 9313] >gi|46576453|sp|Q7V4D3|HRCA_PROMM Heat-inducible transcription repressor hrcA >gi|33641071|emb|CAE22200.1| Negative regulator of class I heat shock protein [Prochlorococcus marinus str. MIT 9313] (352 aa)
Score = 210, Expect = 5.5e-15, Identities = 81/335 (24%), Positives = 163/335 (48%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFY-EKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKL-PMIKIENNTEVLLKRIDMVEINKQSAMVIVITSD--GNLTKNIIHFKDDSILKDISICIRIFNDRLI-----DCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEK 335
           ++ +  RQ+++L+  V  YV T  PVGSK +++++    SAATVR+ M  LE+ GLL + HTS+GRVPS  GY+ Y +     P    ++L+ +L N+ + R  ++D ++ +  + +++ T L  +I      +  L+ + +V    +  +++V +S+   +L   + H   +  L+ I    R   D+L            +  +++   S+++E +  +            Q  ++     HG S LLA PEF  +  L+ +L++++ T     +     Q G   +     + + E     Q   + + +   ++ +V P R+ Y+  K  +  + N  E+
  S:    21 LESLPARQQQVLQATVHHYVDTIEPVGSKTLVQRFGLKASAATVRSAMGALEQRGLLTQPHTSAGRVPSPQGYRHYVDCLLPPPGSAAQHLERELTNL-SLRWAALDDLMWQLARRLTDFTGLMSLITRPARPKPTLQAVRLVRSGDRLLVMLVESSNQASHLNLRLPHEASNE-LEAIEEWTR---DQLATTGNGSLDWSSLPPQLNLSGSLLREAIHSHSQA---------QTPAESDAVFHGMSRLLAQPEFSSSASLQPLLELMD-TQPAAVVPVGSEQLGGVWIGAEHPKSALEACSVVQAPYHSSGEGIGQVALVGPMRMAYATAKAAVSSVANHLER 349
>gi|189912757|ref|YP_001964312.1| Heat-inducible transcriptional repressor, HrcA [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] >gi|167777433|gb|ABZ95734.1| Heat-inducible transcriptional repressor, HrcA [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] (343 aa)
Score = 210, Expect = 5.6e-15, Identities = 74/326 (22%), Positives = 149/326 (45%)
  Q:     3 EITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEV-LLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQD-TEKLKEILQIL-ESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEF 328
           +++ R + +LK +VE++V+   PVGSK + EKY   +S AT+R+ +A LE +G +   HTS GRVP+  GY+ Y  +    +      K +++  +      +D V+  + K+++  ++   + +     +  LK I+++ +N    ++I++   G +    I F      + +    R  ND +    + EI + +     + KE  + +  +    I R     S  +  ++          F+D  E+L+ IL +  E   + E  +      G  T+I          +    T+  + E+    + ++ P R++Y+K   L+EF
  S:     2 DLSPRHRSILKALVEEFVSDNKPVGSKTLSEKYDIGLSPATIRSCLAELEDMGFIVARHTSGGRVPTERGYRLYVDSLVTLFELTMREKQRIQEEYLRMQFRLDQVLIATSKVLASLSQSASVVLGPEGSLDTLKHIELIHVNGGEVLMILVMRSGTVLNRNIFFDFHISQETLYQISRYLNDNVKGFDVHEIQSNLIPQMMLKKEGPEGFT-LFAPSIARAMGTDSHSVDNLYIDGLKNLYENFKDEEEQLENILHLFDEKQFLKEFFSDYVPMDGVYTIIGKDGNEKLGGVTIITTNYRMGEKRIGSMGIIGPQRMNYNKALPLIEF 329
>gi|153869429|ref|ZP_01999028.1| Negative regulator of class I heat shock protein [Beggiatoa sp. PS] >gi|152074079|gb|EDN70976.1| Negative regulator of class I heat shock protein [Beggiatoa sp. PS] (348 aa)
Score = 210, Expect = 5.8e-15, Identities = 58/253 (22%), Positives = 133/253 (52%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNF--SKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTK-LPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQ-----IKSKMIKTVHGQSSLLAVPEFQDTEKLKEIL 256
           +++R + LLK +V  Y+    P+GS+ +  +   ++S AT+RN MA LE++GL+   HTS+GR+P+  GY+ +  +   +KP  + E  +  LR        +   ++E++  ++SE T  + ++ +  +   +L+ ++ + ++++  + I++ ++  +   II+        ++       N+  +   IK +  ++       +E + +     +E+  ++F+       +  I T  GQ++L+ V E  D EKL+++ 
  S:     6 LSKRAQHLLKILVNRYIREGQPIGSRTLSREVTLDLSPATIRNVMADLEEMGLVCSPHTSAGRIPTVRGYRLFVDSLLQTKPLSHKE--EQLLRRQLTQEEYNNQRLLEQTSNLLSEITHFVGLVTLPKHKSKVLRHVEFLSLSEKRVLAILVFNEHEVENRIIYTSRHYEAAELQSAANYLNEAFVGKDIKTVRQQLLHEMQKNREDMDKMRQTAREMANKVFEDGGGDKNNDFIMT--GQTNLMEVAELSDVEKLRDLF 262
>gi|84623568|ref|YP_450940.1| heat-inducible transcription repressor [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|84367508|dbj|BAE68666.1| heat-inducible transcriptional repressor [Xanthomonas oryzae pv. oryzae MAFF 311018] (343 aa)
Score = 210, Expect = 6.1e-15, Identities = 72/321 (22%), Positives = 145/321 (45%)
  Q:     7 RQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDR-----LID---CPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDE---VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLE 327
           R ++LL+ ++  Y+    PVGSK + +    ++S AT+RN +A LE +GLL   HTS+GRVP+  GY+ +  +  +     E    +LR   A    +  ++   S  + + S  + ++      +   + ID V ++ +  + I++ +D  +   +I  +      ++       N +     L D   C ++E+    + M+ ++   V        +L              + GQ+ L+ V +  D ++L+E+ ++  S     Q+  +  Q      I  G+E   VS ED+         + Q    L ++ P R+ Y ++  L++
  S:     5 RTRQLLRTLIARYIRDGEPVGSKTLAQHAGLDVSPATIRNILADLEDVGLLSSPHTSAGRVPTAHGYRVFVDSLVQMQPPGEEEVRRLRAELASGNGTQSLLGSASQMLSAMSHFVGVVSAPRREQFAFRHIDFVALDARRVLAILVFADNEVQNRVIEPRRAYEPAELERVANYLNAQFAGRALADIRACLLRELRMAKNEMEQLMAHSV--------DLASEALVPADADDMVMAGQTRLMGVQDLSDLDRLRELFEVFASKREILQLLERTIQ-APGVRIFIGEETGMVSLEDVSLVTAPYTAHGQVLGVLGVIGPKRMAYDRLIPLVQ 327
>gi|183222725|ref|YP_001840721.1| heat-inducible transcription repressor HrcA [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] >gi|167781147|gb|ABZ99445.1| Heat-inducible transcription repressor HrcA [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] (346 aa)
Score = 209, Expect = 6.2e-15, Identities = 74/326 (22%), Positives = 149/326 (45%)
  Q:     3 EITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEV-LLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQD-TEKLKEILQIL-ESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEF 328
           +++ R + +LK +VE++V+   PVGSK + EKY   +S AT+R+ +A LE +G +   HTS GRVP+  GY+ Y  +    +      K +++  +      +D V+  + K+++  ++   + +     +  LK I+++ +N    ++I++   G +    I F      + +    R  ND +    + EI + +     + KE  + +  +    I R     S  +  ++          F+D  E+L+ IL +  E   + E  +      G  T+I          +    T+  + E+    + ++ P R++Y+K   L+EF
  S:     5 DLSPRHRSILKALVEEFVSDNKPVGSKTLSEKYDIGLSPATIRSCLAELEDMGFIVARHTSGGRVPTERGYRLYVDSLVTLFELTMREKQRIQEEYLRMQFRLDQVLIATSKVLASLSQSASVVLGPEGSLDTLKHIELIHVNGGEVLMILVMRSGTVLNRNIFFDFHISQETLYQISRYLNDNVKGFDVHEIQSNLIPQMMLKKEGPEGFT-LFAPSIARAMGTDSHSVDNLYIDGLKNLYENFKDEEEQLENILHLFDEKQFLKEFFSDYVPMDGVYTIIGKDGNEKLGGVTIITTNYRMGEKRIGSMGIIGPQRMNYNKALPLIEF 332
>gi|23308923|ref|NP_601491.2| heat-inducible transcription repressor [Corynebacterium glutamicum ATCC 13032] >gi|24211770|sp|Q8NNB3|HRCA_CORGL Heat-inducible transcription repressor hrcA >gi|21325062|dbj|BAB99684.1| Transcriptional regulator of heat shock gene [Corynebacterium glutamicum ATCC 13032] (341 aa)
Score = 209, Expect = 6.2e-15, Identities = 50/161 (31%), Positives = 97/161 (60%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYIND-ENLKLKLRNV---FADRTMSIDVVIEESCKIISEST-KLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTK 161
           M    +R+ E+L+ IV DY+A+  PVGSK ++E++  N+S+AT+RNDM+ LE  G + + H SSGRVP+  GY+ +  +     I+D + L L  R     F +  + ++ V+  S +++S+ T +  ++++       +K  ++V ++    ++++IT  G + +
  S:     1 MSATEKRRYEVLRAIVADYIASQEPVGSKSLLERHKLNVSSATIRNDMSVLESDGFIVQEHASSGRVPTERGYRLFVDS-----IHDIKPLSLAERRAILGFLEGGVDLEDVLRRSVQLLSQLTHQAAVVQLPTLKTARVKHCEVVPLSPMRLLLVLITDTGRVDQ 161
>gi|110636341|ref|YP_676549.1| heat-inducible transcription repressor [Mesorhizobium sp. BNC1] >gi|123352921|sp|Q11B41|HRCA_MESSB Heat-inducible transcription repressor hrcA >gi|110287325|gb|ABG65384.1| heat-inducible transcription repressor HrcA [Mesorhizobium sp. BNC1] (356 aa)
Score = 209, Expect = 6.3e-15, Identities = 74/328 (22%), Positives = 162/328 (49%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSK--PYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQI--------KSKMIKTVHGQSSLLA-VPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDE-----VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEF 328
           ++ +  R +++ + IVE Y+    PVGS+ +       +S AT+RN M+ LE LGL+   H S+GR+P+  G +F+   F +      +E   ++ +   + R  S+D ++ E+ +++S  ++   + +   TE  LK I+ +++  + A+ I+++ +G++   +I          +       N  +    + E  +++  +K   +E +       Q L+E+   I         +++I  + G+++LL  V    D E L+ +   LE+     Q+     + G    I  G E     +S   ++ A    + + +    L ++ PTR++Y++I  ++++
  S:    10 LQSLDARSRDIFRLIVESYLQRGEPVGSRNLSRLLPTQLSPATIRNVMSDLEHLGLIYAPHVSAGRLPTQQGLRFFVDAFMEVGDLSEEERRVIEAQIKASGRGQSLDHMLTEASQMLSGLSRGAGLVLAAKTEAPLKHIEFIQLEPRKALAILVSQNGDVENRVIELPAGVTASQLVEASNFLNAHIRGRTLAEAKSEMARLKEETREALDSLS---QSLVEQGLAIWAGAESDTPARII--IRGRANLLENVTAQADLELLRHLFDDLETKEALIQL-LGLAEEGPGVRIFIGSENKLFSLSGSSLIVAPYR-DQDSRVIGALGIIGPTRLNYARIVPMVDY 346
>gi|78047118|ref|YP_363293.1| heat-inducible transcription repressor [Xanthomonas campestris pv. vesicatoria str. 85-10] >gi|123585456|sp|Q3BVC0|HRCA_XANC5 Heat-inducible transcription repressor hrcA >gi|78035548|emb|CAJ23194.1| heat-inducible transcriptional repressor [Xanthomonas campestris pv. vesicatoria str. 85-10] (350 aa)
Score = 209, Expect = 6.8e-15, Identities = 69/321 (21%), Positives = 148/321 (46%)
  Q:     7 RQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMI-------KTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDE---VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLE 327
           R ++LL+ ++  Y+    PVGSK + +    ++S AT+RN +A LE +GLL   HTS+GRVP+  GY+ +  +  +     E    +LR   A    +  ++   S  + + S  + ++      +   + ID V ++ +  + I++ +D  +   +I  +      ++       N +     + +I       ++ +  +++  +  +++L+     + S+ +         + GQ+ L+ V +  D ++L+E+ +   S     Q+  +  Q      I  G+E   VS ED+         N Q    L ++ P R+ Y ++  L++
  S:    12 RARQLLRTLIARYIRDGEPVGSKTLAQHAGLDVSPATIRNILADLEDVGLLSSPHTSAGRVPTAHGYRVFVDSLVQMQPPGEEEVRRLRAELASGNGTQSLLGSASQMLSAMSHFVGVVSAPRREQFAFRHIDFVALDARRVLAILVFADNEVQNRVIEPRRAYEPAELERVANYLNAQFAGRALADI-------RACLLRELRMAKSEMEQLLAHSVDLASEALVPADAEDMVMAGQTRLMGVQDLSDLDRLRELFEAFASKREILQLLERTIQ-APGVRIFIGEETGMVSLEDVSLVTAPYAANGQVLGVLGVIGPKRMAYDRLIPLVQ 334
>gi|157150976|ref|YP_001449716.1| heat-inducible transcription repressor [Streptococcus gordonii str. Challis substr. CH1] >gi|189028274|sp|A8AVA6|HRCA_STRGC Heat-inducible transcription repressor hrcA >gi|157075770|gb|ABV10453.1| heat-inducible transcription repressor HrcA [Streptococcus gordonii str. Challis substr. CH1] (344 aa)
Score = 209, Expect = 7.1e-15, Identities = 76/319 (23%), Positives = 154/319 (48%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIE-NNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDS-MKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKI 322
           +T+RQ E+L  I++ +  T  PVGSK + +    N S+AT+RNDMA LEK GLLEK HTSSGR PS AG++++ K+        EN   ++   F     +++ +++++  ++++ +   ++ ++   +   L   D+V +++ +A+ +    + N   +      + + +D+     +  +R +   + +I  KI + +  II+      + V+  L E IF    K    V G+  LL   + +  +   +  ++  +  I + +A  Q Q+     +    E    D+    +   I  +    L ++ P  +DY ++
  S:     2 VTERQNEILNLIIDIFTKTHEPVGSKALQDSI--NSSSATIRNDMAALEKQGLLEKAHTSSGRKPSVAGFQYFVKHSLSFDRLAENELYEVIKAFDHEFFNLEDILQQAADLLAKLSGCTVVALDVEPSRQRLTAFDIVVLSQHTALAVFTLDESNTITSQFMIPRNFLREDLDRLKALVQERFLGQTVLDIHYKIRTEIPQIIQRYFTTTDNVIH-LFEHIFGDIFKENVIVSGKVGLLNFSDLKAYQFFDDSQKV--AFEIRDSLAEDQMQS---VRVADSRESCLSDLTIISSKFLIPYRGFGILAVIGPVNLDYQRV 314
>gi|110601633|ref|ZP_01389810.1| heat-inducible transcription repressor HrcA [Geobacter sp. FRC-32] >gi|110547639|gb|EAT60888.1| heat-inducible transcription repressor HrcA [Geobacter sp. FRC-32] (166 aa)
Score = 209, Expect = 7.3e-15, Identities = 47/163 (28%), Positives = 97/163 (59%)
  Q:     2 KEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNF--SKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEV-LLKRIDMVEINKQSAMVIVITSDGNLTKNII 164
           ++++ R +++L+ I+EDY+ TA PVGS+ +  ++   +S ATVRN MA LE++G L   HTS+GR+P+   Y+FY  +    +    DE  ++  R     + M+   V++E+ +++S ++    I +    +  + ++I+ V++  +  + I+++ +G +   II
  S:     3 EQLSPRGRQILEAIIEDYIVTAEPVGSRTITRRHPMALSPATVRNVMADLEEMGFLASPHTSAGRIPTDKAYRFYVNSLLSVRNIGRDEQEEILRRCSVTGKDMA--EVLKETSRMLSSTSHYMGIVVAPRFDANVFRQIEFVKLGSRRLLAILVSQNGTVQNRII 166
>gi|78185664|ref|YP_378098.1| negative regulator of class I heat shock protein [Synechococcus sp. CC9902] >gi|123581020|sp|Q3AW12|HRCA_SYNS9 Heat-inducible transcription repressor hrcA >gi|78169958|gb|ABB27055.1| heat-inducible transcription repressor HrcA [Synechococcus sp. CC9902] (324 aa)
Score = 209, Expect = 8.1e-15, Identities = 81/334 (24%), Positives = 162/334 (48%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFY-EKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDG---NLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDE---VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFE 334
           MK +++RQ+++L+  V  YV T  PVGS+ +++++    S+AT+R+ M  LE+ GLL + HTSSGR+PS  GY+ Y +    +P     +L+ +L  +        D++++ + ++   +  + +I     T+  L  I +V+ + +  +V+++ + G   +L   + H   D  L  I        +R  +  ++  A   + + +    +++    VL+  +E    I ++    VHG S L+A PEFQ  + L  +LQ+++     E +A      G+   +  G E    + E     Q      ++    + ++ P R+ Y+     +E +    E
  S:     1 MKPLSRRQEQVLQATVHHYVDTMEPVGSRTLVQRFSMPASSATIRSAMGALEQRGLLTQPHTSSGRIPSALGYRHYVDCLLPEPAATVLHLERELTGLSLGWAALDDLLLQLARRLTDFTGLMSLITRPTRTQPQLAAIRLVQ-SGERLLVMLVENSGHASHLNLRLPHATSDE-LDAI--------ERWAEQQLRGGALNWEKLPT----QLQRSGDVLRHALEHP-SISAEPTTLVHGLSRLVAEPEFQSAQDLGPLLQLIDD----EPMALI--SPGAEARVLIGQEHPQSALEACSVVQAPYRCGQEGTGHIALIGPMRMAYATACSAVERVARHLE 320
>gi|154249921|ref|YP_001410746.1| heat-inducible transcription repressor HrcA [Fervidobacterium nodosum Rt17-B1] >gi|154153857|gb|ABS61089.1| heat-inducible transcription repressor HrcA [Fervidobacterium nodosum Rt17-B1] (340 aa)
Score = 208, Expect = 8.4e-15, Identities = 67/212 (31%), Positives = 118/212 (55%)
  Q:     3 EITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDV-----VIEESCKIISESTK-LPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEF 214
           +IT+RQK++L  IV+DY+ T  PV SK V+E  +   S AT+RNDM  L + G + + HTS+GRVP+  G +FY     K  I DE   +K ++   D   +  +     V+  + K++S STK + +I+  N   + +KR+ +  ++K  ++V ++TS G  +   +   +   +++++    I N  +    + E  T+I  + S I    KE++F
  S:     2 DITERQKKILYCIVQDYINTKTPVSSKRVLESAIIGRSGATIRNDMNRLMRAGYIYQPHTSAGRVPTDKGLRFYVSELKK--IRDE---IKSKSTHVDTAANFPIGDMEKVLTGAAKLLSSSTKGMVIIEKPNPLNLRVKRVVITPVSKNFSIVNIVTSLGLSSSIPLQHGE---IENVAHVEEILNKVISGLTLNEFKTRIKEIISKIN-NFKEFDF 210
>gi|125718796|ref|YP_001035929.1| heat-inducible transcription repressor [Streptococcus sanguinis SK36] >gi|166220406|sp|A3CQC4|HRCA_STRSV Heat-inducible transcription repressor hrcA >gi|125498713|gb|ABN45379.1| Heat shock transcription repressor HrcA, putative [Streptococcus sanguinis SK36] (344 aa)
Score = 208, Expect = 8.4e-15, Identities = 77/319 (24%), Positives = 154/319 (48%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIE-NNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDS-MKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKI 322
           +T+RQ E+L  I++ +  T  PVGSK + +    N S+AT+RNDMA LEK GLLEK HTSSGR PS AG++++ K+        EN   ++   F     +++ +++++  ++++ +   ++ ++   +   L   D+V +++ +A+ +    + N   +      + + +D+     +  +R +   + +I  KI + +  II+      + V+Q L E IF    K    + G+  LL   +    +   +  ++  +  I + +A  Q Q+     +    E    D+    +   I  +    L +V P  +DY ++
  S:     2 VTERQNEILNLIIDIFTKTHEPVGSKALQDSI--NSSSATIRNDMAALEKQGLLEKAHTSSGRKPSVAGFQYFVKHSLSFDRLAENELYEVIKAFDHEFFNLEDILQQAADLLTKLSGCTVVALDVEPSRQRLTAFDIVVLSQHTALAVFTLDESNTITSQFMIPRNFLKEDLDRLKGLVRERFLGQTVLDIHYKIRTEIPQIIQRYFTTTDNVIQ-LFEHIFGDIFKENVILSGKVQLLEFSDLTAYQFFDDPQKV--AFEIRDSLAEDQMQS---VRVADSRESCLADLTLISSKFLIPYRGFGVLAVVGPVNLDYQRL 314
>gi|91974874|ref|YP_567533.1| heat-inducible transcription repressor [Rhodopseudomonas palustris BisB5] >gi|91681330|gb|ABE37632.1| heat-inducible transcription repressor HrcA [Rhodopseudomonas palustris BisB5] (362 aa)
Score = 208, Expect = 1.0e-14, Identities = 46/164 (28%), Positives = 95/164 (57%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEK------NFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNII 164
           + ++ +R +++ + IVE Y+AT  PVGS+ +       +S A+VRN MA LE LGL+   HTS+GR+P+  G +F+        + ++P    ++++ +L +V   +  +++  + E+   +S  T+   + +   + V LK ++ V +  + A+VI++  DG +   ++
  S:    16 LAQLNERSRDIFRQIVESYLATGEPVGSRNISRLISMPLSPASVRNVMADLEHLGLIYAPHTSAGRLPTELGLRFFVDALMQVGDLTEP--ERQSIQAQLSSV--GQAQTVEAALGEALTRLSGLTRAAAVVLTAKSNVRLKHLEFVRLEPERALVILVAEDGQVENRVL 181
>gi|114321053|ref|YP_742736.1| heat-inducible transcription repressor HrcA [Alkalilimnicola ehrlichei MLHE-1] >gi|114227447|gb|ABI57246.1| heat-inducible transcription repressor HrcA [Alkalilimnicola ehrlichei MLHE-1] (350 aa)
Score = 207, Expect = 1.1e-14, Identities = 59/255 (23%), Positives = 133/255 (52%)
  Q:     3 EITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNF--SKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLP-MIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIK--------TVHGQSSLLAVPEFQDTEKLKEILQ 257
           E++ R + LL+ +V+ Y++   PVGS+ +++    ++S+ATVRN MA LE+LG +   HTS+GR P+  GY+F+      ++ +  D+   L+LR     RT   D ++  +  ++S  T+   ++ +       L+ ++ + ++    + IV+ ++ ++   +I         ++       N +     ++ +       +  + E ++E    + +L++  F++  K+           V G+++L+A+ E  D +KL+E+ +
  S:     9 ELSPRAQHLLRTLVQCYISDGRPVGSRSLVKASGLSVSSATVRNVMAELEELGYVCSPHTSAGRQPTDKGYRFFVDTLLSARSWDTDQFDALELRLEAGGRT---DELLGSASHLLSGLTRYAGVVTLPRQDLRALRHVEFLPLSGNRVLAIVVLNESDVENRVIETDRPYQESELRTLSNYLNAQFSGWDVQRV-------RQSLVEAMREDRERMDQLMQTAFEMGEKVFNDEETGEDCVVAGETNLMALSELSDLDKLRELFR 264
>gi|116618444|ref|YP_818815.1| heat-inducible transcription repressor HrcA [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|116097291|gb|ABJ62442.1| heat-inducible transcription repressor HrcA [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (341 aa)
Score = 207, Expect = 1.1e-14, Identities = 62/266 (23%), Positives = 131/266 (49%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIE-NNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEI--ATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIA 269
           +T+RQK +L  I+ +Y    + VGSK + E     IS+AT+RN+MA LE   L++K HTS+GRVPS  GY++Y  +      + +     +   F      ID +++E+ + +S  T    + ++    ++ +    +V +     + +++T+DG +T       ++  ++ +   +   ND+++  P+ ++    + D + + +   +K     LQ   + + +     +  + G+ ++L   +  D   +K +L+ L +     QIA
  S:     3 LTERQKLILTAIIYEYTQREHAVGSKSLQEHLDIKISSATIRNEMAALESDDLIKKLHTSAGRVPSYEGYRYYLDHLMMTRRSTDRDVQAVIQSFRGNFHEIDDLLDETARTLSNLTGYTALILKPRRIDIKVSGFRLVPLEGHQLIAVLVTNDGKVTSQTFKLPNEMAIESLESMVAYINDQMVGRPVNDVLRMMQSDELPTQMSRMIKTPAAFLQLFGDVLARSNGDNVH-IGGRLNVLDFSKETDIADVKPLLEFLNNAEDVRQIA 270
>gi|78213925|ref|YP_382704.1| heat-inducible transcription repressor HrcA [Synechococcus sp. CC9605] >gi|78198384|gb|ABB36149.1| heat-inducible transcription repressor HrcA [Synechococcus sp. CC9605] (324 aa)
Score = 207, Expect = 1.1e-14, Identities = 81/333 (24%), Positives = 161/333 (48%)
  Q:     2 KEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFY-EKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKL-PMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDG---NLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSH---EDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFE 334
           K ++ RQ+++L+  V  YV T  PVGS+ +++++    S+ATVR+ M  LE+ GLL + HTS+GRVPS  GY+ Y +    +P +  ++L  +L   F+ R   +D ++    + +++ T L  +I         L+ I +V  +    +V+++ ++G   +L   + H  +  +               ++C       + D     +  +++    VL+  +++     S  +  VHG S L++ PEF+ T  L+ +L++++     +Q A   ++ G +  +  GDE      E     Q     NE     + +V P R+ Y+  +  ++ +    E
  S:     3 KPLSLRQEQVLQATVHHYVDTMEPVGSRTLVQRFGIPASSATVRSAMGALERRGLLHQPHTSAGRVPSPMGYRHYVDALLPEPGVAVQHLDRELTG-FSLRWAGLDDLLMHLARRLTDFTGLMSLITQPQQENQQLETIRLVP-SGDRLLVMLVEANGRASHLNLRLPHGAEAELTA-------------MECWASAQLEQGDLNWDALPRQLQRSGAVLRNALDQPAPANSTQV-VVHGLSRLVSEPEFESTSSLRPLLELID-----DQPATLISR-GESARVWIGDEHPQPALEACAVVQAPYRCNE-GLGHVALVGPMRMAYATARAAVQRVARHLE 320
>gi|114326688|ref|YP_743845.1| heat-inducible transcription repressor [Granulibacter bethesdensis CGDNIH1] >gi|114314862|gb|ABI60922.1| heat-inducible transcription repressor hrcA [Granulibacter bethesdensis CGDNIH1] (379 aa)
Score = 207, Expect = 1.2e-14, Identities = 76/322 (23%), Positives = 149/322 (46%)
  Q:     7 RQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIK--------TVHGQSSLLA-VPEFQDTEKLKEILQILEST-SIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNI------NEQNKT--KLVMVAPTRVDYSKIKGLLEF 328
           R   +L+ IVE YV T  PVGS+ +  +   N+S AT+RN MA L   GLL   HTS+GR+P+  G + +     +     E+ +  +      R  S++  + E+  ++S  +    + +   +E  L+ I+ V ++   A+VI++TS+G +   ++          +       N RL + P+ +       ++ ++ E++      L  L  ++ +                V GQ  LLA   +      ++ +   LE+  +I   +   +N  G    I        E  +F  + L++      NE N+    + ++ PTR++Y +I  ++++
  S:    38 RSAAILREIVEQYVETGEPVGSRTLSRRLPVNLSPATIRNVMADLTDAGLLFAPHTSAGRLPTDRGLRLFVDGLLQFGALSEDEQNSIAASLEARGRSLEDTLTEASTLLSGLSSAAGLVLAPKSEGALRHIEFVPLSTGRALVIMVTSEGQVENRVMEIPPGLPPSALQQAANYLNARLSNKPLAD-------LRRLVTEEITANRTQLDTLAAQVVEAGLATWSGEERGGNLIVRGQGKLLADAVQAGQLAAIQMLFDQLEAQETILRLLDLAENSDGVRIFI------GAESGLFGASGLSMVVAPARNEANRIVGAIGVIGPTRINYGRIIPVVDY 364
>gi|46191235|ref|ZP_00120371.2| COG1420: Transcriptional regulator of heat shock gene [Bifidobacterium longum DJO10A] (366 aa)
Score = 207, Expect = 1.2e-14, Identities = 45/152 (29%), Positives = 88/152 (57%)
  Q:    11 LLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISEST-KLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKN 162
           +L+ +VEDY+ +  PVGS  +   +   +S+AT+RNDMA LE  G L + HTS+GRVP+  GY+++    +      E  +  + N F   ++S+   ++ S +++SE T ++ ++   +  +  L+ ++MV +   + + +VIT  G + ++
  S:     3 VLRAVVEDYIRSQEPVGSTSLTRDHDLGVSSATIRNDMAALEDEGYLIQPHTSAGRVPTEKGYRYFVDRLATVVPLSEAQRRGI-NSFLSGSVSLKDALQRSARLLSEITGQVAVVASPSLAKATLRHVEMVPVAMTTLLAVVITDTGRVAQH 154
>gi|75993697|gb|ABA33884.1| HrcA [Bifidobacterium breve] (365 aa)
Score = 207, Expect = 1.2e-14, Identities = 47/159 (29%), Positives = 95/159 (59%)
  Q:     4 ITQRQKEL-LKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISEST-KLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKN 162
           +TQ ++ L L+ +VEDY+ +  PVGS  + ++    +S+AT+RNDMA LE  G L + HTS+GRVP+  GY+++    +      E  +  + N F   ++S+   ++ S +++SE T ++ ++   + ++  L+ +++V +   + + +VIT  G + ++
  S:     1 MTQSRRMLVLRAVVEDYIRSQEPVGSAALSKERDLGVSSATIRNDMAALEDEGYLIQPHTSAGRVPTEKGYRYFVDRLATVVPLSEAQRRGI-NSFLSGSVSLKDALQRSARLLSEITGQVAIVASPSLSKATLRHVELVPVAMSTLLAVVITDTGRVAQH 160
>gi|148553490|ref|YP_001261072.1| heat-inducible transcription repressor [Sphingomonas wittichii RW1] >gi|148498680|gb|ABQ66934.1| heat-inducible transcription repressor HrcA [Sphingomonas wittichii RW1] (342 aa)
Score = 207, Expect = 1.3e-14, Identities = 71/328 (21%), Positives = 155/328 (47%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSM--KSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIA--FKQNQTGSNTLITFGDEVSHEDI----VFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEF 328
           M E++ R +E+ + +VE Y+ +  P+GS+ + +    N+S A++RN M  LE+LGLLE  HTS+GR+P+ +G + +     +        +       A R   ++  + ++  ++S  +    I +    E++L++   V +++Q A+ +++  DG++   ++          +       ++RL    + E   +I++   +            V Q L        ++ +  V GQ++L+      D E+++++L  +E     E+IA      ++G    I  G E     +    V A      + +    + ++ PTR++Y++I  +++F
  S:     1 MSEMSTRAREVFRVVVESYLGSGQPIGSRTISKLAGLNLSPASIRNVMQDLEELGLLEAPHTSAGRMPTQSGLRLFVDGMMQT-AEPSIEERAAIEARAARGSPVEEALAQTSAVLSGLSACAGIVLVPPHEMVLRQFSFVPLSRQQAVAVLVGHDGSVENRVVDLPPGLPPSALVEAGNFISERLGGLTLAEARARIEAELGRERAALDAAAASLVQQGLAVWSEDGSARPVLIVRGQANLIDPSAAADLERVRQLLDEIEGK---EEIARLLDSARSGQGMKIFIGSENKLFSLSGSSVIAAPYRGGDGRVVGVVGVIGPTRLNYARIVPMVDF 332
>gi|118052206|ref|ZP_01520753.1| heat-inducible transcription repressor HrcA [Comamonas testosteroni KF-1] >gi|118000334|gb|EAV14491.1| heat-inducible transcription repressor HrcA [Comamonas testosteroni KF-1] (335 aa)
Score = 207, Expect = 1.3e-14, Identities = 73/319 (22%), Positives = 143/319 (44%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEF-QDTEKLKEILQILES-TSIWEQIAFKQNQTGSNTLITFGDE---VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKI 322
           + +R K LLK ++E Y+A   PVGS+ +       +S AT+RN MA LE++GL+   HTS+GRVP+  GY+     F    +  +   L    +  ++      VI  +  ++S  ++   + +      + K I+ V ++++  +VI+++ +G++   +I    D     +       N       ++E+ T++ +    ++ +V         +   +     +    + G+ +LL+V +F  D   L+    + E  T I   + F     G    I  G E   V  ED+        ++ +    L ++ PTR+ Y K+
  S:     2 LDERAKLLLKALIERYIADGQPVGSRTLSRASGLELSPATIRNVMADLEEMGLIISPHTSAGRVPTARGYRL----FVDTMLTVDRSDLVTPGLMPEQPQK---VIANAANLLSNLSQFVGVVMVPRRSSVFKHIEFVRLSERRFLVIIVSPEGDVQNRVIFTDVDYESSQLIEASNFLNHHYAGLTMEEVRTRLQTEVEQLRGQVASLMQAAVNVGAEVMSHHDREDVVIAGERNLLSVSDFSSDMGNLRRAFDLFEQKTQILRLLDFSNQADGVR--IYIGGESQTVPFEDLSVVSAPYELDGKVVGTLGVIGPTRMHYDKM 316
>gi|77464798|ref|YP_354302.1| heat-inducible transcription repressor [Rhodobacter sphaeroides 2.4.1] >gi|77389216|gb|ABA80401.1| heat-inducible transcription repressor HrcA [Rhodobacter sphaeroides 2.4.1] (356 aa)
Score = 206, Expect = 1.4e-14, Identities = 72/328 (21%), Positives = 150/328 (45%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSI---IKEKVKEYEFVLQELIERIFQI-------KSKMIKTVHGQSSLL-AVPEFQDTEKLKEILQILE-STSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKT--KLVMVAPTRVDYSKIKGLLEF 328
           + E+  R +E+ + +VE Y+A+ +PVGS+ +       +SAAT+RN M  LE LGLL+  H S+GR+P+  G + +     +     E  + ++ + F      +  +++     +S  T+   + +    E  ++ I+ V +    A+V+++ +DG++   +           +       N       + E  T  D  ++I   I  + +E + +  +L++    +         ++I  V GQS LL    E  D E+++ +   LE    I E +   +   G    I   +++             +N   K    + ++ PTR++Y +I  ++++
  S:     8 LSEMNDRSREVFRRVVEGYLASGDPVGSRTLTRHMSEKVSAATIRNVMQDLEYLGLLDSPHVSAGRIPTQLGLRMFVDGLLEVGQVSEKDRERIDSTFGGNEHDVVSLLDRVGATLSAVTQGASLVLAPKHEAAIRHIEFVSLGADRALVVLVFADGHVENRVFRPPSGQTASSMREAANFLN------ALVEGRTLGDLRQTIGQEITRRRQEIDALAHDLVQSGLAVWENPGEQSERLI--VRGQSHLLEGGAEAADFERIRTLFDDLERKRDIAEYLELTEAGEGVRIFIGSENKLFSLSGSSLVVSPYMNADRKIIGAIGVIGPTRLNYGRIVPIVDY 341
>gi|62391132|ref|YP_226534.1| heat-inducible transcription repressor [Corynebacterium glutamicum ATCC 13032] >gi|145296246|ref|YP_001139067.1| heat-inducible transcription repressor [Corynebacterium glutamicum R] >gi|41326471|emb|CAF20633.1| Transcriptional regulator of heat shock genes [Corynebacterium glutamicum ATCC 13032] >gi|140846166|dbj|BAF55165.1| hypothetical protein [Corynebacterium glutamicum R] (342 aa)
Score = 206, Expect = 1.4e-14, Identities = 49/156 (31%), Positives = 96/156 (61%)
  Q:     6 QRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYIND-ENLKLKLRNV---FADRTMSIDVVIEESCKIISEST-KLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTK 161
           +R+ E+L+ IV DY+A+  PVGSK ++E++  N+S+AT+RNDM+ LE  G + + H SSGRVP+  GY+ +  +     I+D + L L  R     F +  + ++ V+  S +++S+ T +  ++++       +K  ++V ++    ++++IT  G + +
  S:     7 KRRYEVLRAIVADYIASQEPVGSKSLLERHKLNVSSATIRNDMSVLESDGFIVQEHASSGRVPTERGYRLFVDS-----IHDIKPLSLAERRAILGFLEGGVDLEDVLRRSVQLLSQLTHQAAVVQLPTLKTARVKHCEVVPLSPMRLLLVLITDTGRVDQ 162
>gi|114769783|ref|ZP_01447393.1| heat-inducible transcription repressor [alpha proteobacterium HTCC2255] >gi|114549488|gb|EAU52370.1| heat-inducible transcription repressor [alpha proteobacterium HTCC2255] (352 aa)
Score = 206, Expect = 1.5e-14, Identities = 82/328 (25%), Positives = 160/328 (48%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLR-NVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCP--IKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQ----IKSKMIK----------------TVHGQSSLLAVPEF-QDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDE----VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEF 328
           + ++ +R KE+ + +VE Y+ T +PVGS+ +      N+SAAT+RN M  LE LGLL   H S+GR+P+ +G + +     +  + D N + +   +   D    +  V+ ++  ++S  T+   + +   +E  +K I+ V +    A+V+++T DGN+                    R+FN  L   P  ++E A  ++S+ S     + +   V++  +ER  Q    +  +MIK                 V G+S+LL   +  +D E++K +   LE      Q      + G    I  G E          +     +N + +    + ++ P R++Y ++  ++++
  S:     9 IDDLNERSKEVFRLLVESYLNTGDPVGSRTLTRSLSENVSAATIRNVMNDLEFLGLLNAPHVSAGRIPTESGLRLFVDGLLE--VGDINTQERKEIDASLDYPNDMSSVLNKAGTMLSGLTQGASVVMAPKSEAPIKHIEFVSLAPDRALVVLVTEDGNVEN------------------RMFNPPLGQTPSSMREAANFLNSIVS--GHTISDLRSVVERHVERHQQDLDLLSQQMIKDGVAVWAKDQGAEARLIVRGRSNLLDDGQSDEDMERIKTLFDDLEQKKDISQF-LDLAEQGEGVKIFIGSENKLFSLSGSSLVVSPYMNADRKVIGAVGVIGPKRLNYGRVVPIVDY 341
>gi|161170279|gb|ABX59249.1| transcriptional regulator of heat shock protein [uncultured marine bacterium EB000_55B11] (352 aa)
Score = 206, Expect = 1.5e-14, Identities = 82/328 (25%), Positives = 159/328 (48%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLR-NVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCP--IKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQ----IKSKMIK----------------TVHGQSSLLAVPEF-QDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDE----VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEF 328
           + ++ +R KE+ + +VE Y+ T +PVGS+ +      N+SAAT+RN M  LE LGLL   H S+GR+P+ +G + +        + D N + +   +   D    +  V+ ++  ++S  T+   + +   +E  +K I+ V +    A+V+++T DGN+                    R+FN  L   P  ++E A  ++S+ S     + +   V++  +ER  Q    +  +MIK                 V G+S+LL   +  +D E++K +   LE      Q      + G    I  G E          +     +N + +    + ++ P R++Y ++  ++++
  S:     9 IDDLNERSKEVFRLLVESYLNTGDPVGSRTLTRSLSENVSAATIRNVMNDLEFLGLLNAPHVSAGRIPTESGLRLFVDGLLX--VGDINTQERKEIDASLDYPXDMSSVLNKAGTMLSGLTQGASVVMAPKSEAPIKHIEFVSLAPDRALVVLVTEDGNVEN------------------RMFNPPLGQTPSSMREAANFLNSIVS--GHTISDLRSVVERHVERHQQDLDLLSQQMIKDGVAVWAKDQGAEARLIVRGRSNLLDDGQSDEDMERIKTLFDDLEQKKDISQF-LDLAEQGEGVKIFIGSENKLFSLSGSSLVVSPYMNADRKVIGAVGVIGPKRLNYGRVVPIVDY 341
>gi|24378604|ref|NP_720559.1| heat-inducible transcription repressor [Streptococcus mutans UA159] >gi|26006975|sp|O06940|HRCA_STRMU Heat-inducible transcription repressor hrcA >gi|24376459|gb|AAN57865.1|AE014860_2 transcriptional regulator; repressor (HrcA) of class I heat shock genes [Streptococcus mutans UA159] (344 aa)
Score = 206, Expect = 1.5e-14, Identities = 61/221 (27%), Positives = 116/221 (52%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIE-NNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDS-MKSIIKEKVKEYEFVLQELIERIF 224
           ITQRQK++L  IVE +  T  P+GSK +        S+AT+RNDMA LEKLGLLEK HTSSGR+PS  G++++ ++   P   DE    ++   F      +  +++ +  +++  T    + ++    +  L   D+V+++   A+ ++   + +          + +  D+    +I  +R ++  + +I  ++ + +  II++     + VL +L + IF
  S:     2 ITQRQKDILNLIVELFTKTHEPIGSKTLQNSIAS--SSATIRNDMAALEKLGLLEKAHTSSGRLPSQEGFRYFVEHSLNPDSLDEQDVYQVIKAFDFEAFRLGDLLQRASDVLANLTGYTALILDVEPKKQRLTTFDIVKLSNHDALAVLTLDEASPVTVQFAIPKNFLDSDLMTVAKIARERFLNQTVLDIHYRLRTELPQIIQKYFPRTDNVL-DLFDHIF 221
>gi|120612240|ref|YP_971918.1| heat-inducible transcription repressor [Acidovorax avenae subsp. citrulli AAC00-1] >gi|120590704|gb|ABM34144.1| heat-inducible transcription repressor HrcA [Acidovorax avenae subsp. citrulli AAC00-1] (334 aa)
Score = 206, Expect = 1.5e-14, Identities = 72/319 (22%), Positives = 149/319 (46%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIK------TVHGQSSLLAVPEF-QDTEKLKEILQILES-TSIWEQIAFKQNQTGSNTLITFGDE---VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKI 322
           +  R K LLK ++E Y+A   PVGS+ +      ++S AT+RN MA LE +GL+   HTS+GR+P+  GY+     F    +  +  +L    +  D+      VI  + +++S  ++   + +      + + I+ + ++++  +VI+++ DG++   +I  + D     ++      N       ++E+  +       +K +V +    +  L++    + S+ +        + G+ +LLA+ +F  D   L++   + E  T I   +       G    I  G E   V  E++        ++ Q    L ++ PTR+ Y ++
  S:     2 LDDRAKLLLKALIERYIADGQPVGSRTLSRSSGLDLSPATIRNVMADLEDIGLIASPHTSAGRIPTAKGYRL----FVDTMLTVQRGELCSPELAPDQPQK---VIANAAQLLSSLSQFVGVVMAPRRPSVFRHIEFLRLSERRLLVIIVSPDGDVQNRVIFTEVDHSQSQLAEAANFLNSHYSGLGMEEVRER-------LKTEVDQLRGEIASLMQAAVNVGSEAMAASQEEVVISGERNLLALSDFSNDMGNLRKAFDLFEQKTQILRLLDVSNRAEGVRIFI--GGESQVVPFEELSVVSAPYEVDGQVVGTLGVIGPTRMPYDRM 315
>gi|119503070|ref|ZP_01625155.1| Negative regulator of class I heat shock protein [marine gamma proteobacterium HTCC2080] >gi|119461416|gb|EAW42506.1| Negative regulator of class I heat shock protein [marine gamma proteobacterium HTCC2080] (350 aa)
Score = 206, Expect = 1.7e-14, Identities = 67/320 (20%), Positives = 139/320 (43%)
  Q:     3 EITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQI-KSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILE-STSIWEQIAFKQNQTGSNTLITFGDEVSHE---DIVFAQTDLNINEQNKTKLVMVAPTRVDYSKI 322
           +++ R   LL+ +VE ++    PVGSK +      ++S ATVRN M+ LE  G L   HTS+GR+P+  GY+F+     +    + N  L LR        + D+V   S  +   +++  ++ +       L++++ + +++   +VI++ ++  +   +I          +     + N R     + E+  ++    +  + ++ EY     +L  R     +      V G++ LL     +D +KL+E+    +    + E +       G    I  G+E  ++   D            +    L ++ PTR+ Y ++
  S:    10 DLSGRATNLLRTLVEMHIRDGQPVGSKSLQAHSALSVSPATVRNIMSDLEDRGFLTSPHTSAGRIPTARGYRFFVDTLLQVQPIEANAVLALREELDPNRTAKDLVQTASSLLAHVTSQAGIVTVPKTAVNQLRQVEFLPLSENRVLVILVVNEREVQNRVIELSQPLTEAQLKAAADLINHRYAGADLVEVKARLVEEMAEARSRIDEYMAAALDLANRALDDGEPSEDYVVAGENYLLGQAHPEDMDKLRELFDAFQHKRDVLELLERSYRAQGVQIFI--GEEAGYDVFGDYSVVTAPYAQGSRTLGVLGVIGPTRMAYERV 332
>gi|103485748|ref|YP_615309.1| heat-inducible transcription repressor [Sphingopyxis alaskensis RB2256] >gi|123078635|sp|Q1GWJ6|HRCA_SPHAL Heat-inducible transcription repressor hrcA >gi|98975825|gb|ABF51976.1| heat-inducible transcription repressor HrcA [Sphingopyxis alaskensis RB2256] (347 aa)
Score = 205, Expect = 2.3e-14, Identities = 80/335 (23%), Positives = 167/335 (49%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNF---SKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKE---YEFVLQELIERIFQIKS-----KMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDE-----VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEK 335
           + E+T R +++ + +V+ Y+ T  PVGS+ + +    N+S A++RN M  LE+ GLL   HTS+GR+P+  G + +       ++P   D   + ++    ++    I+  + ++   +S  +    + +    E +LK++  V ++++ A+V+++  DG +   II   D     D S  +   N   I   +  + T  ++M  + +E   E    +   Q+L+ R   I S     + +  V GQ++LL      D ++++++L  LE+     Q+     + GS T I  G E     +S   ++ A      + +    + ++ PTR++Y++I  +++F      +
  S:     6 ITELTTRARDVFRLVVDAYLETGQPVGSRTLSKLATLNLSPASIRNVMQDLEEYGLLASPHTSAGRMPTEQGLRLFVDGMMQVAEPSAED---RAQIEASLSEGG-PIESALAQATAALSGLSACAGLVLVPKHERVLKQVAFVPMSERQALVVLVAGDGTVENRII---DVPAGLDPSALVEAGN--FISATLSGL-TLTEAMARVRREIEAERIAIDRAAQDLVSRGLAIWSSDGADRPVLIVRGQANLLDDSAVGDLDRVRQLLDELETKQDIAQL-LDSAREGSATRIFIGSENKLFSLSGSSVIAAPYRG-ADGRVVGVVGVIGPTRLNYARIVPMVDFTAQSLSR 344
>gi|163745103|ref|ZP_02152463.1| heat-inducible transcription repressor [Oceanibulbus indolifex HEL-45] >gi|161381921|gb|EDQ06330.1| heat-inducible transcription repressor [Oceanibulbus indolifex HEL-45] (354 aa)
Score = 204, Expect = 2.5e-14, Identities = 72/328 (21%), Positives = 155/328 (47%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQI-------KSKMIKTVHGQSSLLAVP-EFQDTEKLKEILQILE-STSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKT--KLVMVAPTRVDYSKIKGLLEF 328
           +K++  R +E+ + +VE Y+   +PVGS+ +   +   +SAAT+RN M  LE +GLL+  H S+GR+P+  G + +  +  +     E  + K+     + +  +  +++     +S  T    + +    E  +K I+ V ++   A+V+++ SDG++   +           +       N  +    I E+     S+K  I ++ +E + + Q+L+E    +         ++I  V G+S+LL    E +D ++++ +   LE    I E +   ++  G    I   +++             +N   K    + ++ PTR++Y +I  ++ +
  S:     8 LKDMNDRSREVFRRVVEGYLENGDPVGSRTLTRDFSEKVSAATIRNVMQDLEYMGLLDSPHVSAGRIPTQMGLRMFVDSMIEIGDPTELDREKIDATLGNNSSDVGGLLDRIGSALSGVTHGASLVLTPKHEAPIKHIEFVSLSPDRALVVLVFSDGHVENRLFTPPPGQTPSSMREAANFLNAFVEGKTISELQR---SIKREIAKRRQEIDVLAQQLVESGAVLWDGDGEHSERLI--VRGRSNLLGGEGEAEDLDRIRSLFDDLERKRDIAEFLELAEDGEGVRIFIGSENKLFSLSGSSLVVSPYMNADRKVIGAVGVIGPTRLNYGRIVPIVNY 341
>gi|108804352|ref|YP_644289.1| heat-inducible transcription repressor HrcA [Rubrobacter xylanophilus DSM 9941] >gi|108765595|gb|ABG04477.1| heat-inducible transcription repressor HrcA [Rubrobacter xylanophilus DSM 9941] (342 aa)
Score = 204, Expect = 2.7e-14, Identities = 52/155 (33%), Positives = 92/155 (59%)
  Q:     3 EITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVL---LKRIDMVEINKQSAMVIVITSDG 157
           +IT+RQ+E+L   +E Y++T +PVGS  + E+   + S++T+R ++A LE LGLL   HTS+GRVP+ AGY++Y           E +  + R   ++   S+D ++ +  + +SE T+L  + +      L   + RID + + ++S ++IV T  G
  S:     5 QITERQREILLKTLELYISTGSPVGSHALAERV--DASSSTIRAELATLESLGLLTHPHTSAGRVPTDAGYRYYVDALLA-----EGVAERRRLETSEEHRSLDELLRDVSESMSEVTRL--LAVVAGPGALGDPVARIDYLPLPERSLLLIVSTESG 153
>gi|88704207|ref|ZP_01101921.1| Heat-inducible transcription repressor hrcA [gamma proteobacterium KT 71] >gi|88701258|gb|EAQ98363.1| Heat-inducible transcription repressor hrcA [Congregibacter litoralis KT71] (344 aa)
Score = 203, Expect = 3.3e-14, Identities = 69/321 (21%), Positives = 152/321 (47%)
  Q:     2 KEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDE---NLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIK-TVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHE---DIVFAQTDLNINEQNKTKLVMVAPTRVDYSKI 322
           +E+T+R + LLK +V  ++   +PVGS+ + E+   ++S ATVRN M+ LE+ G L   HTS+GRVP+  GY+F+  +  +  + DE   +    +R        + D+V   S  + S +++  ++ +   T+  L++++ + ++    +VI++ +   +   IIH +     +++       N R     + ++  +++      +  +  Y     +L ++    +++     + G+S LL     ++  +L+E+   LES      +  ++        I  G+E   +   D            ++   L ++ PTR+ Y ++
  S:     3 RELTERSETLLKTLVAMHIRDGSPVGSQTLREEAGLSVSPATVRNVMSDLEERGFLHSPHTSAGRVPTAQGYRFFVDSLLQ--VTDEPDPSAFDSIRKELNPDRNTADLVQSASTMLSSITSQAGVVTVPKPTQQPLRQVEFLPLSGDRVLVILVINQREVQNRIIHTQRVFSDEELRAAAAQINQRYAGQALADVQERVEQELLSARNSLDNYLSATLDLAQQALAEEARPSDYLIVGESRLLEGASPEELARLRELFSTLESKRDLSHL-LERCSEADGVKIFIGEEAGSQIFGDYSLITAPYGDGARSLGVLGVIGPTRMAYDRV 327
>gi|110677819|ref|YP_680826.1| heat-inducible transcription repressor [Roseobacter denitrificans OCh 114] >gi|109453935|gb|ABG30140.1| heat-inducible transcription repressor HrcA, putative [Roseobacter denitrificans OCh 114] (344 aa)
Score = 203, Expect = 3.5e-14, Identities = 71/325 (21%), Positives = 152/325 (46%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQI-------KSKMIKTVHGQSSLLAVP-EFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDE----VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEF 328
           + +R +E+ + +VE Y+A   PVGS+ +   +   +SAAT+RN M  LE LGLL+  H S+GR+P+  G + +     +    DE  + K+    +  +  +  +++     +S  T+   + +    E  +K I+ V ++   A+V+++ +DG++   +           +       N  +    + E+   I   +  I+ + +E + + Q L+E    +         ++I  V G+S+LL    E +D E+++ +   LE      +   ++ + G    I  G E          +     +N + +    + ++ PTR++Y +I  ++ +
  S:     1 MNERSREVFRRVVEGYLADGAPVGSRTLTRDFSEKVSAATIRNTMQDLEYLGLLDSPHISAGRIPTQMGLRMFVDGLLEIGDPDEMDREKIDATLSSNSEDVSGLLDRVGSALSGVTQGASLVMTPKHEAPIKHIEFVSLSPDRALVVLVFADGHVENRLFSPPAGQTPSSMREAANFLNALIEGKTLSEVHGAI---QKEIRNRRQEIDSLAQALVESGMAVWEREGDQNERLI--VRGRSNLLTGDGEGEDFERIRLLFDDLERKRDIAEF-LERTEEGEGVRIFIGSENKLFSLSGSSLVVSPYMNADRKIIGAVGVIGPTRLNYGRIVPIVNY 331
>gi|119898872|ref|YP_934085.1| heat-inducible transcription repressor [Azoarcus sp. BH72] >gi|119671285|emb|CAL95198.1| heat-inducible transcriptional repressor [Azoarcus sp. BH72] (342 aa)
Score = 203, Expect = 3.6e-14, Identities = 67/322 (20%), Positives = 155/322 (48%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLR-NVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTE-VLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKI-DSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEF-QDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDE--VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKI 322
           M  +  R + LLK ++E Y+A   PVGS+ +       +S ATVRN M+ LE++G +   HTS+GRVP+  GY+F+       +  D     +L+  +  D+   +   I  +  ++S+ T+   + +    E V +++I+ + +++   ++I++T+ G++   I+  K      ++S   +  N+        EI T++ D ++ +  +  +     ++   E   +  +  +  + G+++LL V +   +  +L+E+ ++ E  +   Q+    N+     +   G+      +      +   ++ +    + ++ PTR+ Y ++
  S:     1 MNPLDARSQILLKTLIERYIADGQPVGSRALSRYSGLELSPATVRNVMSDLEEMGFIASPHTSAGRVPTALGYRFFVDALLTVHPMDRVRVEELQGQLLPDQPQRL---ISSASHLLSQLTQFAGVVVAPRKEAVRIRQIEFIRLSESRILLIIVTAAGDVQNRILLTKRAYSAVELSNAAQHLNEHFAGLSFDEIRTRVQDELRQLHSDMSELMTATVEAGTEAAAETGNNYV--ISGETNLLEVEDLSSNMSRLRELFKLFEQKTGLMQLLDLSNRAQGVQIFIGGESGLAPLDGCSVITSSYEVDGEVVGSVGVIGPTRMAYDRV 323
>gi|68535672|ref|YP_250377.1| heat-inducible transcription repressor [Corynebacterium jeikeium K411] >gi|123775733|sp|Q4JWP8|HRCA_CORJK Heat-inducible transcription repressor hrcA >gi|68263271|emb|CAI36759.1| putative transcriptional regulator HrcA [Corynebacterium jeikeium K411] (341 aa)
Score = 203, Expect = 4.0e-14, Identities = 44/156 (28%), Positives = 94/156 (60%)
  Q:     6 QRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEK--NFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTK-LPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTK 161
            R+ ++L+ IV D++A+  PVGSK++++++   +S+AT+RNDMA LE  G + + H SSGR+P+  GY+ +    N  KP    E   +     F +  + ++ V+  S +++S+ T+ + ++++ +     +K  ++V++     ++++IT  G + +
  S:     7 HRRNQVLRAIVSDFIASHEPVGSKMLVDRHQLGVSSATIRNDMAVLEAEGYITQQHASSGRIPTVKGYRRFVDGINEVKPLSTPERRAIL---DFLEHGVDLEDVLRRSVQLLSQLTRQVAVVQMPDLRRGRVKHCELVKLGSHRILLVLITDTGRVDQ 162
>gi|41015982|dbj|BAD07395.1| hrcA [Listeria monocytogenes] (275 aa)
Score = 202, Expect = 4.3e-14, Identities = 62/261 (23%), Positives = 132/261 (50%)
  Q:    73 YKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKI-ENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKID-SMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTS--------IWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEF 333
           Y+FY     +P   D++ +  +R+ F++    ++ +I+ S  ++S+ T    I +    T+  L     V IN   AM+I+IT  G++  +++   + + L DI   + I N+RL+   + ++  +I   +K ++ + V+ YE  +    +   Q   + +    G++++L  PEF D  K++E+L ++E           I + +  K  +  +N+L+        ED        NI  +    +V++ PTR++YS++ GL++ +  + 
  S:     1 YRFYVDYLLQPKKLDKSDRQMIRSFFSENYYEMEGLIQNSALMLSDLTNYTSILLGPEATKNHLSGFRFVPINNFQAMLILITDQGHVDNHLVTIPEGTTLSDIERMVNILNERLVGLSLDDLKVQIPMEVKELLGKHVRNYESFMHVFSDSFAQASQQKV-YFGGKTNILNQPEFHDINKVREMLHLMEEEQDVYELFRDIPDGLQVKIGRENNNSLM--------EDCSIITATYNIAGERVGGIVLLGPTRMEYSRMMGLVDVMSRDL 262
>gi|87123587|ref|ZP_01079438.1| Negative regulator of class I heat shock protein [Synechococcus sp. RS9917] >gi|86169307|gb|EAQ70563.1| Negative regulator of class I heat shock protein [Synechococcus sp. RS9917] (332 aa)
Score = 202, Expect = 4.4e-14, Identities = 68/260 (26%), Positives = 142/260 (54%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFY-EKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKL-PMIKIENNTEVLLKRIDMVEINKQSAMVIVITSD--GNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMK-SIIKEKVKEYEFVLQELIERIFQIKS--KMIKTVHGQSSLLAVPEFQDTEKLKEILQILE 260
           M  +  RQ+E+L+  V  YV T  PVGS+ +++++    S+ATVR+ M  LE+ GLL + HTS+GRVPS  GY+ Y +    KP    ++L+ +L  + + R  ++D ++++  + +++ T L  +I     +   L+ + +V    +  +++V +S+   +L   + H     +       +  +  R +D      +++  ++  + +  +++ +  VL++ I    Q+K   +    VHG S L+A PEF D+  ++ +L++++
  S:     1 MDTLPNRQQEVLRATVHHYVDTIEPVGSRTLVQRFGLKASSATVRSAMGALEQRGLLTQPHTSAGRVPSARGYRHYVDCLLPKPGAAVQHLEQELTQI-SLRWAALDDLLQQMARRLTDFTGLMSLITRPQRSTPSLQAVRLVCSGDRLLVMLVESSNQASHLNLRLPHGSGHQLE-----AMETWTRRQLD------SSRDGNLDWNSLPLQLQPFGRVLEDAISSHQQLKQAEETAALVHGVSRLIAQPEFIDSSLVRPLLELVD 255
>gi|126730096|ref|ZP_01745908.1| heat-inducible transcription repressor [Sagittula stellata E-37] >gi|126709476|gb|EBA08530.1| heat-inducible transcription repressor [Sagittula stellata E-37] (354 aa)
Score = 202, Expect = 4.5e-14, Identities = 48/163 (29%), Positives = 87/163 (53%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNI 163
           + E+  R +E+ + +VE Y+ +  PVGS+ +       ISAAT+RN M  LE LGLL+  H S+GRVP+  G + +     +    D + + KL +    R+  +  +++E    +S  T+   + +    E  LK ID V + +  A+V+++ +DG++   +
  S:     8 LSELNDRSREVFRRVVEGYLESGEPVGSRSLTRMLSERISAATIRNVMQDLEFLGLLDSPHVSAGRVPTQLGLRMFVDGLLEVRDLDNSDREKL-DATVGRSGDVGGLLDEIGSALSGVTRGASLVLTPKHEAPLKHIDFVSLAQDRALVVIVFADGHVENRV 169
>gi|167729726|emb|CAO80638.1| hypothetical protein [Candidatus Cloacamonas acidaminovorans] (354 aa)
Score = 202, Expect = 4.6e-14, Identities = 83/331 (25%), Positives = 167/331 (50%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFY----EKNFSKPYINDENL--KLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILK-DISICIRIFNDRLIDCPIKEIATKI-DSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHED-----IVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKN 331
           MK+   R  E LK +V++Y+ +  PV S+++ EKY+ N+S+AT+R D+  LEK+ L+ + HTS+GR+P+  GY+ Y    E    K      +L  ++ +RN + D   ++  ++E   K   E+ +L  +     +   L ++D+  I  ++ ++ V++ D  L K +I   D+ + +  +   +R  ND L    I +IA ++   M+      +    + L EL +   +I    I    G  + L   EF D E + + + +L+          +++Q+     +  G++++        +++A+ ++         L ++AP R +Y K+  L+  + N
  S:     5 MKKNVLRLNETLKALVDEYIMSCEPVSSRILNEKYLRNVSSATLRLDLLKLEKMNLISQPHTSAGRIPTIKGYREYLRLIEPEIEKIRYEGMDLLREILVRN-YKDTPRALYYIMENLAK---ETDQLSFVAEPEVSSGYLAKLDVFSIG-ENKLIFVMSLDSGLDKTVILKCDNELTEAQLKKLVRYLNDELAGLQIYDIANRVLVEMQENADNGM--ISWFLAELHKAFMEISDFFIH-YDGSINFLEQKEFDDKENILKFMSLLQRQDFLLN-TMRKHQSDKEVNVVLGEDLAKGSWLDFALIYAKYEVF---GIPGYLGVLAPVRTEYRKLIPLIRDVAN 336
>gi|171464080|ref|YP_001798193.1| heat-inducible transcription repressor HrcA [Polynucleobacter necessarius STIR1] >gi|171193618|gb|ACB44579.1| heat-inducible transcription repressor HrcA [Polynucleobacter necessarius STIR1] (336 aa)
Score = 202, Expect = 5.2e-14, Identities = 71/319 (22%), Positives = 151/319 (47%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTM-------SIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDI----SICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEF-QDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFG--DEVSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKI 322
           + +R + LLK ++E Y+    P+GS+ +      ++SAAT RN MA LE +GL+   HTS+GR+P+  GY+ +          D  + ++     A R +       S   V+  + +I+S  T    + +      + K I+ + + +   ++I++T +G++   I+    D  L  +    +     F  +  D     + + +D++++ I   +      LQ  +      +  ++  + G+  LL V +   + +KL+++  +LE  S+  Q+    +      +   G  D + +ED+       +++ Q    L ++ PTR+ Y ++
  S:     1 MDERSRALLKILIERYIEEGQPIGSRTLSRYSGLDLSAATTRNVMADLEDMGLVTSPHTSAGRIPTPRGYRLFV---------DTMVTVRPLEAIAAREVEKGLLPDSPQRVLTSAAQILSNLTHFAGVVMTPKRAQVFKHIEFLRLGEGKILLIMVTPEGDVQNRILPTTQDYTLSQLIEAGNFINTHFAGKSFDQVRMHLKSDLDNLRADISGLMA---LALQNGVADYDMSRGDVV--LSGERRLLNVGDLSSNLDKLRKMFDMLERKSVLMQLLDVSSHADGIQIFIGGESDLLPYEDLAVISAPYSVDGQIVGTLGVIGPTRMAYDRV 319
>gi|188992196|ref|YP_001904206.1| heat-inducible transcriptional repressor [Xanthomonas campestris pv. campestris] >gi|167733956|emb|CAP52162.1| heat-inducible transcriptional repressor [Xanthomonas campestris pv. campestris] (369 aa)
Score = 201, Expect = 5.3e-14, Identities = 70/321 (21%), Positives = 148/321 (46%)
  Q:     7 RQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKE-KVKEYEFVLQELIERIFQIKSKMI-------KTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDE---VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLE 327
           R + LL+ ++  Y+    PVGSK + +    ++S AT+RN +A LE +GLL   HTS+GRVP+  GY+ +  +  +     E    +LR   A    +  ++   S  + + S  + ++      +   + ID V ++ +  + I++ +D  +   +I  +      ++       N +     + +I        S+++E ++ + E  +++L+     + S+ +         + GQ+ L+ V +  D ++L+E+ +   S     Q+  +  Q      I  G+E   VS +D+           Q    L ++ P R+ Y ++  L++
  S:    31 RARHLLRTLIARYIRDGEPVGSKTLAQHAGLDVSPATIRNILADLEDIGLLSSPHTSAGRVPTAHGYRVFVDSLVQMQPPGEEEVRRLRAELASSNGTQSLLGSASQMLSAMSHFVGVVSAPRREQFAFRHIDFVPLDARRVLAILVFADNEVQNRVIEPRRAYEPAELERVANYLNAQFAGRALSDIRA------SLLRELRLAKNE--MEQLLAHSVDLASEALVPADADDMVMAGQTRLMGVQDLSDLDRLRELFEAFASKREILQLLERTIQ-APGVRIFIGEETGMVSLDDVSLVTAPYTAGGQVLGVLGVIGPKRMAYDRVIPLVQ 353
>gi|13879040|gb|AAG53934.2|AF302775_1 HrcA [Xanthomonas campestris pv. campestris] (350 aa)
Score = 201, Expect = 5.3e-14, Identities = 70/321 (21%), Positives = 148/321 (46%)
  Q:     7 RQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKE-KVKEYEFVLQELIERIFQIKSKMI-------KTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDE---VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLE 327
           R + LL+ ++  Y+    PVGSK + +    ++S AT+RN +A LE +GLL   HTS+GRVP+  GY+ +  +  +     E    +LR   A    +  ++   S  + + S  + ++      +   + ID V ++ +  + I++ +D  +   +I  +      ++       N +     + +I        S+++E ++ + E  +++L+     + S+ +         + GQ+ L+ V +  D ++L+E+ +   S     Q+  +  Q      I  G+E   VS +D+           Q    L ++ P R+ Y ++  L++
  S:    12 RARHLLRTLIARYIRDGEPVGSKTLAQHAGLDVSPATIRNILADLEDIGLLSSPHTSAGRVPTAHGYRVFVDSLVQMQPPGEEEVRRLRAELASSNGTQSLLGSASQMLSAMSHFVGVVSAPRREQFAFRHIDFVPLDARRVLAILVFADNEVQNRVIEPRRAYEPAELERVANYLNAQFAGRALSDIRA------SLLRELRLAKNE--MEQLLAHSVDLASEALVPADADDMVMAGQTRLMGVQDLSDLDRLRELFEAFASKREILQLLERTIQ-APGVRIFIGEETGMVSLDDVSLVTAPYTAGGQVLGVLGVIGPKRMAYDRVIPLVQ 334
>gi|66769072|ref|YP_243834.1| heat-inducible transcription repressor [Xanthomonas campestris pv. campestris str. 8004] >gi|66574404|gb|AAY49814.1| heat-inducible transcriptional repressor [Xanthomonas campestris pv. campestris str. 8004] (369 aa)
Score = 201, Expect = 5.3e-14, Identities = 70/321 (21%), Positives = 148/321 (46%)
  Q:     7 RQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKE-KVKEYEFVLQELIERIFQIKSKMI-------KTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDE---VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLE 327
           R + LL+ ++  Y+    PVGSK + +    ++S AT+RN +A LE +GLL   HTS+GRVP+  GY+ +  +  +     E    +LR   A    +  ++   S  + + S  + ++      +   + ID V ++ +  + I++ +D  +   +I  +      ++       N +     + +I        S+++E ++ + E  +++L+     + S+ +         + GQ+ L+ V +  D ++L+E+ +   S     Q+  +  Q      I  G+E   VS +D+           Q    L ++ P R+ Y ++  L++
  S:    31 RARHLLRTLIARYIRDGEPVGSKTLAQHAGLDVSPATIRNILADLEDIGLLSSPHTSAGRVPTAHGYRVFVDSLVQMQPPGEEEVRRLRAELASSNGTQSLLGSASQMLSAMSHFVGVVSAPRREQFAFRHIDFVPLDARRVLAILVFADNEVQNRVIEPRRAYEPAELERVANYLNAQFAGRALSDIRA------SLLRELRLAKNE--MEQLLAHSVDLASEALVPADADDMVMAGQTRLMGVQDLSDLDRLRELFEAFASKREILQLLERTIQ-APGVRIFIGEETGMVSLDDVSLVTAPYTAGGQVLGVLGVIGPKRMAYDRVIPLVQ 353
>gi|21230927|ref|NP_636844.1| heat-inducible transcription repressor [Xanthomonas campestris pv. campestris str. ATCC 33913] >gi|21112541|gb|AAM40768.1| heat-inducible transcriptional repressor [Xanthomonas campestris pv. campestris str. ATCC 33913] (369 aa)
Score = 201, Expect = 5.3e-14, Identities = 70/321 (21%), Positives = 148/321 (46%)
  Q:     7 RQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKE-KVKEYEFVLQELIERIFQIKSKMI-------KTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDE---VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLE 327
           R + LL+ ++  Y+    PVGSK + +    ++S AT+RN +A LE +GLL   HTS+GRVP+  GY+ +  +  +     E    +LR   A    +  ++   S  + + S  + ++      +   + ID V ++ +  + I++ +D  +   +I  +      ++       N +     + +I        S+++E ++ + E  +++L+     + S+ +         + GQ+ L+ V +  D ++L+E+ +   S     Q+  +  Q      I  G+E   VS +D+           Q    L ++ P R+ Y ++  L++
  S:    31 RARHLLRTLIARYIRDGEPVGSKTLAQHAGLDVSPATIRNILADLEDIGLLSSPHTSAGRVPTAHGYRVFVDSLVQMQPPGEEEVRRLRAELASSNGTQSLLGSASQMLSAMSHFVGVVSAPRREQFAFRHIDFVPLDARRVLAILVFADNEVQNRVIEPRRAYEPAELERVANYLNAQFAGRALSDIRA------SLLRELRLAKNE--MEQLLAHSVDLASEALVPADDDGMVMAGQTRLMGVQDLSDLDRLRELFEAFASKREILQLLERTIQ-APGVRIFIGEETGMVSLDDVSLVTAPYTAGGQVLGVLGVIGPKRMAYDRVIPLVQ 353
>gi|32130435|sp|Q8PAL1|HRCA_XANCP Heat-inducible transcription repressor hrcA (350 aa)
Score = 201, Expect = 5.3e-14, Identities = 70/321 (21%), Positives = 148/321 (46%)
  Q:     7 RQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKE-KVKEYEFVLQELIERIFQIKSKMI-------KTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDE---VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLE 327
           R + LL+ ++  Y+    PVGSK + +    ++S AT+RN +A LE +GLL   HTS+GRVP+  GY+ +  +  +     E    +LR   A    +  ++   S  + + S  + ++      +   + ID V ++ +  + I++ +D  +   +I  +      ++       N +     + +I        S+++E ++ + E  +++L+     + S+ +         + GQ+ L+ V +  D ++L+E+ +   S     Q+  +  Q      I  G+E   VS +D+           Q    L ++ P R+ Y ++  L++
  S:    12 RARHLLRTLIARYIRDGEPVGSKTLAQHAGLDVSPATIRNILADLEDIGLLSSPHTSAGRVPTAHGYRVFVDSLVQMQPPGEEEVRRLRAELASSNGTQSLLGSASQMLSAMSHFVGVVSAPRREQFAFRHIDFVPLDARRVLAILVFADNEVQNRVIEPRRAYEPAELERVANYLNAQFAGRALSDIRA------SLLRELRLAKNE--MEQLLAHSVDLASEALVPADDDGMVMAGQTRLMGVQDLSDLDRLRELFEAFASKREILQLLERTIQ-APGVRIFIGEETGMVSLDDVSLVTAPYTAGGQVLGVLGVIGPKRMAYDRVIPLVQ 334
>gi|145589952|ref|YP_001156549.1| heat-inducible transcription repressor [Polynucleobacter sp. QLW-P1DMWA-1] >gi|145048358|gb|ABP34985.1| heat-inducible transcription repressor HrcA [Polynucleobacter sp. QLW-P1DMWA-1] (336 aa)
Score = 201, Expect = 5.3e-14, Identities = 69/319 (21%), Positives = 151/319 (47%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKL-RNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEI----ATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEF-QDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFG--DEVSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKI 322
           + +R + LLK ++E Y+    P+GS+ +      ++SAAT+RN MA LE +GL+   HTS+GR+P+  GY+ +          +E    ++ + +  D   S   V+  + +I+S  T    + +      + K I+ + + +   ++I++T +G++   I+    D     +       N +      +++     + +D++++ I   +      LQ  +      +  M+  + G+  LL V +   + +KL+++  +LE  S+  Q+    +      +   G  D + +ED+       +++ Q    L ++ PTR+ Y ++
  S:     1 MDERSRALLKTLIERYIEEGQPIGSRTLSRFSGLDLSAATIRNVMADLEDMGLVTSPHTSAGRIPTPRGYRLFVDTMVTVRPLEEMAAREVEKGLLPD---SPQRVLNSAAQILSNLTHFAGVVMTPKRAQVFKHIEFLRLGEGKILLIMVTPEGDVQNRILPTTQDYTPSQLIEAGNFINTQFAGKSFEQVRLHLKSDLDNLRADISGLMA---LALQSGVADYDMGRGDMV--LSGERRLLNVGDLSSNLDKLRKMFDMLEQKSVLMQLLDVSSHADGIQIFIGGESDLLPYEDLAVISAPYSVDGQIVGTLGVIGPTRMAYDRV 319
>gi|124514673|gb|EAY56185.1| Transcriptional regulator of heat shock gene [Leptospirillum sp. Group II UBA] (352 aa)
Score = 201, Expect = 5.5e-14, Identities = 69/257 (26%), Positives = 126/257 (49%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKN--FSKPYINDENLKL-KLRNVFADRTMSIDV--VIEESCKIISESTKLPMIKIENNT--EVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQEL--IERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILE 260
           + +R   +L   V  Y+  A PVGS+VV   +  + S AT+RN MA LE+ G L   HTS+GR+P+  G++++  N  FS      E+  L    +V  D +  +D+  V+     +++  T    I +E  T  E  L   +++ + ++  + I++T  G + K  +   + S  K+I       N    +  + EI  K+     ++ E  +E    LQ+L  + R+ ++K      +   S    +PEF D+  L  ++++ E
  S:     5 LDERSWTVLSATVNGYIRMAAPVGSRVVNRLFGLSYSPATIRNVMADLEEEGYLTHPHTSAGRIPTAKGFRYFVDNSSFSMQETLPESASLSSFLDVILDESSPLDLVDVLSSVMNLVARLTNYTAIVLEPGTRNEEKLLSFELIPVGERHILAILVTDSGAVYKRTVLLPEGSRTKEIVFLGDSLNASSCNVQLSEIREKLFDEMELLGEAYRE---TLQQLFFLNRMPEMK------LFRASRFAEMPEFSDSSILHSLMEVFE 261
>gi|116072048|ref|ZP_01469316.1| Negative regulator of class I heat shock protein [Synechococcus sp. BL107] >gi|116065671|gb|EAU71429.1| Negative regulator of class I heat shock protein [Synechococcus sp. BL107] (324 aa)
Score = 201, Expect = 6.3e-14, Identities = 76/334 (22%), Positives = 158/334 (47%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFY-EKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDG---NLTKNIIHFKDDSILKDISICIRIFNDRLIDCPI---KEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDE---VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFE 334
           MK +++RQ+++L+  V  YV T  PVGS+ +++++    S+AT+R+ M  LE+ GLL + HTSSGR+PS  GY+ Y +    +P     +L+ +L  +        D++++ + ++   +  + +I     T+  L+ I +V+ + +  +V+++ + G   +L   + H   D +       I  + +  +   +   +++ T++     +++  ++     L                 VHG S L+A PEFQ  + L  +LQ+++     E  A      G+   +  G E    + E     Q      ++    + ++ P R+ Y+     +E +    E
  S:     1 MKPLSRRQEQVLQATVHHYVDTMEPVGSRTLVQRFSMPASSATIRSAMGALEQRGLLTQPHTSSGRIPSALGYRHYVDCLLPEPAATVLHLERELTGLSLGWAALDDLLLQLARRLTDFTGLMSLITRPKRTQPQLEAIRLVQ-SGERLLVMLVENSGHASHLNLRLPHATSDEL-----DAIERWTEEQLRAGVLNWEKLPTQLQRSGDVLRHALEHPSISLAP------------TTLVHGLSRLVAEPEFQSAQDLGPLLQLIDD----EPTALI--SPGAEARVFIGQEHPQSALEACSVVQAPYRCGQEGTGHVALIGPMRMAYATACSAVERVARHLE 320
>gi|110597725|ref|ZP_01386009.1| heat-inducible transcription repressor HrcA [Chlorobium ferrooxidans DSM 13031] >gi|110340632|gb|EAT59112.1| heat-inducible transcription repressor HrcA [Chlorobium ferrooxidans DSM 13031] (357 aa)
Score = 201, Expect = 6.7e-14, Identities = 76/332 (22%), Positives = 157/332 (47%)
  Q:     2 KEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFAD-----RTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKI-------DSMKSIIKEKVKEYEFVLQE--LIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQ-------NQTGSNTLITFGDEVSH---EDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEF 333
           + +  R++++L  I++ YV TA PVGS+ + + Y   +S AT+RN MA LE  G + + HTS+GR+P+  GY++Y          DE  K ++           +  S DV++  +  + S S  L ++     +  + +++DMV ++    MVI+      +   ++    +   + +   + + N+RL    + EI   I       D   ++    V+    +  E  + ER++         + G   ++  PEF+  +K+++++ ++E      ++             +G +  I+ G E S    E++    T   I      K+ +  P R+DY     ++ ++ +  
  S:     4 RNLNARERQVLGIIIQSYVVTAAPVGSRYIAQNYKLGLSDATIRNVMAELEDAGYISQPHTSAGRIPTDQGYRYYVDLIMTVQSLDEQEKQRIDANIGQFGIERKGASADVLLSAAKVLGSISRNLSVVLSPTLSNAIFEKLDMVLLSSTRMMVILSIQSLFVKTIVMELDLEVSRQTVDDVVDVINERLAGLTLAEIRRSIAKRLYDCDCDAALKNLVVRSAGTLFDESPIFERLY---------ISGTEYIVDQPEFKQPDKVRDLITMIEDKFSMAKLVENNGPLVEVIRPSGIDISISIGKENSERQAEELTIVSTPYYIGNM-VGKIGIFGPKRMDYEHAVRVINYMADSL 349
>gi|113953279|ref|YP_731818.1| heat-inducible transcription repressor HrcA [Synechococcus sp. CC9311] >gi|113880630|gb|ABI45588.1| heat-inducible transcription repressor HrcA [Synechococcus sp. CC9311] (332 aa)
Score = 200, Expect = 6.9e-14, Identities = 65/262 (24%), Positives = 140/262 (53%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFY-EKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKL-PMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSI----IKEKVKEYEFVLQELIE--RIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILEST 262
           ++ + +RQ+E+L+  V  YV T  PVGS+ +++++    SAATVR+ M  LE+ GLL + HTS+GRVPS  GY+ Y +    +P    ++L  +L N  + R  ++D +++   + +++ T L  +I     ++  L+ I +V   ++  +++V              K+ S    +++ +   ++  I+   +    ++D   S+    +  +++     L++ I+  +  +   +     HG S L+A PEF  + K++ +L++++ +
  S:     3 VQPLPRRQQEVLRATVHHYVDTIEPVGSRTLVQRFDLQASAATVRSAMGALEQRGLLTQPHTSAGRVPSPNGYRHYVDCLLPRPGAIAQHLDQEL-NQLSLRWAALDDLLQNMARRLTDFTGLMSLITHPTQSQPALEAIRLVRSEERLLVMLV--------------KNSSQASHLNLRLPHGSEHQIEAMDQWARRQLDGNGSLNWNALPRELQACGRALRDAIDSHQTLETAQETKALFHGVSRLVAEPEFSQSAKVRPLLELMDQS 257
>gi|161485966|ref|NP_738800.2| heat-inducible transcription repressor [Corynebacterium efficiens YS-314] >gi|46576595|sp|Q8FNF4|HRCA_COREF Heat-inducible transcription repressor hrcA (342 aa)
Score = 200, Expect = 7.2e-14, Identities = 51/170 (30%), Positives = 103/170 (60%)
  Q:     6 QRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYIND-ENLKLKLRNV---FADRTMSIDVVIEESCKIISEST-KLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDD------SILKDI 175
           +R+ E+L+ IV DY+ +  PVGSK ++E++  N+S+AT+RNDM+ LE  G + + H SSGRVP+  GY+ +  +     I+D + L L  R     F +  + ++ V+  S +++S+ T +  ++++       +K  ++V ++    ++++IT  G + +  +   +       ++LKD+
  S:     7 KRRYEVLRAIVADYIESQEPVGSKALLERHKLNVSSATIRNDMSVLESDGYIVQEHASSGRVPTEKGYRLFVDS-----IHDIKPLSLAERRAILGFLEGGVDLEDVLRRSVQLLSQLTHQAAVVQLPTLKTARVKHCEVVSLSPVRLLLVLITDTGRVDQRNVELDEPLEADQVTVLKDL 182
>gi|88812328|ref|ZP_01127578.1| Negative regulator of class I heat shock protein [Nitrococcus mobilis Nb-231] >gi|88790335|gb|EAR21452.1| Negative regulator of class I heat shock protein [Nitrococcus mobilis Nb-231] (331 aa)
Score = 200, Expect = 7.4e-14, Identities = 75/308 (24%), Positives = 146/308 (47%)
  Q:    15 IVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNF--SKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLP-MIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEI-ATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIK--TVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKTKLVM-----VAPTRVDYSKI 322
           +V+ Y+    P GS+ +  +   N+S ATVRN MA LE+ G +   HTS+GRVP+  GY+F+  +     P    E  +L++R    DR  + DV+I+ +  ++S  T+L  ++ I       ++++  + ++++  + I++ ++  +   I+    D    ++       N   +   I++I A  +D+M    KE  +     + E+ +R+F           + G+++L+   E  + EKLK++ +          +   +  T     I  G E  +E  VF    L  +       V+     + PTR+ Y +I
  S:     1 MVQRYIREGQPTGSRTLTRESGLNLSPATVRNIMADLEEAGYVRAPHTSAGRVPTDLGYRFFVDSLLTVNPLREWEIEQLRIR---LDRGSNADVLIDSASNLLSGLTQLTGVVTIPRRHTGSVRQLGFLPLSERRVLAILVVNEQEVQNRILQTGRDYSGAELEHIANYLNAEFVGKDIEQIRAALLDAMHQDRKEMTELMSLAI-EVAQRLFTRSEDEDDDYVMAGETNLMTFAELSNIEKLKQLFEAFNHKRDIIHL-LDRCLTADGVQIFIGQESGYE--VFDGVSLVTSRYQSDDGVLGVLGVIGPTRMPYGRI 312
>gi|152980076|ref|YP_001354579.1| heat-inducible transcription repressor [Janthinobacterium sp. Marseille] >gi|151280153|gb|ABR88563.1| heat-inducible transcriptional repressor [Janthinobacterium sp. Marseille] (342 aa)
Score = 200, Expect = 7.6e-14, Identities = 72/320 (22%), Positives = 156/320 (48%)
  Q:     3 EITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYK-FYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIK------TVHGQSSLLAVPEF-QDTEKLKEILQILES-TSIWEQIAFKQNQTGSNTLITFGDE---VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKI 322
           ++  R + LLK +VE Y+A   PVGS+ + +    ++S AT+RN MA LE++G +   HTS+GRVP+  GY+ F +   +   I++  L+ KL+     +T S   +I  + +I+S  ++   I +    E + ++ID + ++++  ++++++  G++   ++    D     +       N         E+  ++         ++K+    +  L++   +  S  +        + G+ +LL+V +   +   L+++  + E  TS+ + +      TG    I  G E   V  + +    +   +N +    L ++ PTR+ Y ++
  S:     2 QLDNRAQTLLKALVERYIADGQPVGSRELSKISGLDLSPATIRNIMADLEEMGFVASPHTSAGRVPTPRGYRVFVDTLLTVQSIDESALESKLQTSL--QTGSSQKIISNAAQILSSLSEFAGIVMTPRHESVFQQIDFLRLSEKRILLVIVSPSGDVQNRLLLTDVDYSPSQLIQAANYINQNYGGLSFDEVRIRLQG-------ELKQLRDDMTRLMQAAVEAGSDAMNDNSDDVVISGERNLLSVSDLSSNMVSLRQLFDLFEQKTSLMQLLDVSNKATGVQIFI--GGESNLVPMDQMSVVTSPYTVNGKVVGTLGVIGPTRMAYERV 322
>gi|126463641|ref|YP_001044755.1| heat-inducible transcription repressor [Rhodobacter sphaeroides ATCC 17029] >gi|126105305|gb|ABN77983.1| heat-inducible transcription repressor HrcA [Rhodobacter sphaeroides ATCC 17029] (346 aa)
Score = 200, Expect = 8.1e-14, Identities = 71/325 (21%), Positives = 148/325 (45%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSI---IKEKVKEYEFVLQELIERIFQI-------KSKMIKTVHGQSSLL-AVPEFQDTEKLKEILQILE-STSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKT--KLVMVAPTRVDYSKIKGLLEF 328
           +  R +E+ + +VE Y+A+ +PVGS+ +       +SAAT+RN M  LE LGLL+  H S+GR+P+  G + +     +     E  + ++ + F      +  +++     +S  T+   + +    E  ++ I+ V +    A+V+++ +DG++   +           +       N       + E  T  D  ++I   I  + +E + +  +L++    +         ++I  V GQS LL    E  D E+++ +   LE    I E +   +   G    I   +++             +N   K    + ++ PTR++Y +I  ++++
  S:     1 MNDRSREVFRRVVEGYLASGDPVGSRTLTRHMSEKVSAATIRNVMQDLEYLGLLDSPHVSAGRIPTQLGLRMFVDGLLEVGQVSEKDRERIDSTFGGNEHDVVSLLDRVGATLSAVTQGASLVLAPKHEAAIRHIEFVSLGADRALVVLVFADGHVENRVFRPPSGQTASSMREAANFLN------ALVEGRTLGDLRQTIGQEITRRRQEIDALAHDLVQSGLAVWENPGEQSERLI--VRGQSHLLEGGAEAADFERIRTLFDDLERKRDIAEYLELTEAGEGVRIFIGSENKLFSLSGSSLVVSPYMNADRKIIGAIGVIGPTRLNYGRIVPIVDY 331
>gi|160900851|ref|YP_001566433.1| heat-inducible transcription repressor [Delftia acidovorans SPH-1] >gi|160366435|gb|ABX38048.1| heat-inducible transcription repressor HrcA [Delftia acidovorans SPH-1] (334 aa)
Score = 200, Expect = 8.7e-14, Identities = 78/319 (24%), Positives = 151/319 (47%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRT--MSIDVVIEESCKIISESTKL--------PMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKT------VHGQSSLLAVPEF-QDTEKLKEILQILES-TSIWEQIAFKQNQTGSNTLITFGDE---VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKI 322
           + +R K LLK ++E Y+A   PVGS+ +       +S AT+RN MA LE LGL+   HTS+GR+P+  GY+ +                    + ADR   ++ ++V E+  K+I+ +  L         ++ +   T V  K I+ V ++++  +VI+++ DG++   +I    D     +       N       ++E+  ++     +++ +V         L++    I ++ + +      + G+ +LL+V +F  D   L+    + E  T I   + F     G    I  G E   V  E++        ++ +    L ++ PTR+ Y ++
  S:     2 LDERAKLLLKALIERYIADGQPVGSRTLSRASGLELSPATIRNVMADLEDLGLIISPHTSAGRIPTARGYRLFVDTM----------------LTADRADIVTPELVPEQPQKVIANAANLLSSLSQFVGVVLVPRRTSV-FKHIEFVRLSERRFLVIIVSPDGDVQNRVIFTDVDYSSSQLIEASNFLNSHYAGLAMEEVRERLKGEVELLRGEVA-------TLMQAAVNIGTEAMTSAQEDVVIAGERNLLSVSDFSSDMGNLRRAFDLFEQKTQILRLLDFSSQAEGVR--IYIGGESQVVPFEELSVVSAPYELDGKVVGTLGVIGPTRMHYDRM 315
>gi|134095822|ref|YP_001100897.1| heat-inducible transcription repressor [Herminiimonas arsenicoxydans] >gi|133739725|emb|CAL62776.1| Heat-inducible transcription repressor HrcA [Herminiimonas arsenicoxydans] (342 aa)
Score = 199, Expect = 9.9e-14, Identities = 72/320 (22%), Positives = 149/320 (46%)
  Q:     3 EITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYK-FYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEF-QDTEKLKEILQILES-TSIWEQIAFKQNQTGSNTLITFGDE---VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKI 322
           ++  R + LLK +VE Y+A   PVGS+ + +    ++S AT+RN MA LE++G +   HTS+GRVP+  GY+ F +   +   I++  L+ KL+     +T S   +I  +  I+S  ++   I I    E + ++ID + ++++  +++++   G++   ++    D     +       N         ++  ++      +++ +        E         S  +  + G+ +LL+V +   +   L+++  + E  TS+ + +      TG    I  G E   V  + +        +N Q    L ++ PTR+ Y ++
  S:     2 QLDNRAQTLLKALVERYIADGQPVGSRELSKISGLDLSPATIRNIMADLEEMGFVASPHTSAGRVPTPRGYRVFVDTLLTVQTIDESALESKLQATL--QTGSQHKIIANAAGILSSLSEFAGIVITPRRESVFQQIDFLRLSEKRILLVIVGPGGDVQNRLLLTDVDYSPTQLVQAANYINQNYGGLSFDDVRIRLQGELKALRDDMTRLMQAAVEAGSDAMNDNSDDV-VISGERNLLSVSDLSSNMVSLRKLFDLFEQKTSLMQLLEVSSKATGVQIFI--GGESNLVPMDQMSVVTAPYTVNGQVVGTLGVIGPTRMAYERV 322
>gi|94496903|ref|ZP_01303477.1| transcriptional regulator [Sphingomonas sp. SKA58] >gi|94423579|gb|EAT08606.1| transcriptional regulator [Sphingomonas sp. SKA58] (347 aa)
Score = 199, Expect = 1.1e-13, Identities = 74/335 (22%), Positives = 160/335 (47%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNF---SKPYINDENLKLKLRNVFADRTMS--IDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKS-----KMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDE-----VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEK 335
           + E+  R +++ + +VE Y+ T  PVGS+ + +    ++S A++RN M  LE+LGLL   HTS+GR+P+  G + +       ++P I +       R + A  T +  I+  +  +   +S  +    I +    E +L++   V +N + A+ +++  DG++   ++   D      ++      + R +   ++E     +++   ++      +   ++L+ER     S     + +  V GQS LL      D E+ +++L+ LE       +  +    GS T I  G E     +S   ++ A      + +    + ++ PTR++Y+++  +++F      +
  S:     6 ISELNDRARDVFRLVVESYLGTGLPVGSRTISKMASLSLSPASIRNVMQDLEELGLLAAPHTSAGRMPTETGLRLFVDGMMQAAEPSIEER------RAIEAGITENGPIEEALSAATATLSGLSACAGIVMVPKREPVLRQFGFVPLNARQALAVLVGQDGSVENRVLDLPDGVSPVMLNEAANFMSARFVGLTLREAG---EALGREMEADRGALDRAARDLVERGIATWSHDADDRPVLIVRGQSRLLDESIAADLERARQLLEQLEGKQEIMDL-LRGALAGSATKIFIGSENKLFSLSGSSVIAAPYRG-ADGRVVGVVGVIGPTRLNYARVIPMVDFTAQTLSR 344
>gi|83950766|ref|ZP_00959499.1| heat-inducible transcription repressor [Roseovarius nubinhibens ISM] >gi|83838665|gb|EAP77961.1| heat-inducible transcription repressor [Roseovarius nubinhibens ISM] (354 aa)
Score = 198, Expect = 1.3e-13, Identities = 82/328 (25%), Positives = 155/328 (47%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVF-ADRTM--------SIDV--VIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQI-------KSKMIKTVHGQSSLLAVPEFQ-DTEKLKEILQILE-STSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKT--KLVMVAPTRVDYSKIKGLLEF 328
           ++E+  R +E+ + +V+ Y+    PVGS+ +  +    ISAATVRN M  LE LGLL   H S+GR+P+  G + +               L++ N+  ADR M        S DV  V++     +S  T+   + +    E  +K I+ V + +  A+V+++ +DGN+   I           +       N  +    + ++ T+       I  + +E + + +EL++    +         ++I  V G+S+LLA    Q D EK++E+   LE    I + +       G    I   +++             +N   K    + ++ PTR++Y +I  ++++
  S:     8 LEELNDRSREVFRRVVDSYLLNGEPVGSRSLTREMSEKISAATVRNVMQDLEYLGLLSSPHVSAGRLPTQEGLRMFVDGL-----------LEVSNLGDADREMIDATVTGNSQDVADVLDRVGAALSGVTRGASLVLAPKHEAPIKHIEFVSLAQDRALVVLVFADGNVENRIFTPPPGQTPSSMREAANFLNALIEGKTLSDLRTRFSKE---INARRQEIDVLARELVDSGLAVWDREGDAPERLI--VRGRSNLLAADGDQADLEKIRELFDDLERKRDIADFLELADEGEGVRIFIGSENKLFSLSGSSLVVSPYMNADRKIVGAVGVIGPTRLNYGRIVPIVDY 341
>gi|55820216|ref|YP_138658.1| heat-inducible transcription repressor [Streptococcus thermophilus LMG 18311] >gi|55822107|ref|YP_140548.1| heat-inducible transcription repressor [Streptococcus thermophilus CNRZ1066] >gi|116627081|ref|YP_819700.1| heat-inducible transcription repressor [Streptococcus thermophilus LMD-9] >gi|81559923|sp|Q5M1U0|HRCA_STRT1 Heat-inducible transcription repressor hrcA >gi|81561100|sp|Q5M6D3|HRCA_STRT2 Heat-inducible transcription repressor hrcA >gi|122268316|sp|Q03MR8|HRCA_STRTD Heat-inducible transcription repressor hrcA >gi|55736201|gb|AAV59843.1| heat shock protein, transcription repressor [Streptococcus thermophilus LMG 18311] >gi|55738092|gb|AAV61733.1| heat shock protein, transcription repressor [Streptococcus thermophilus CNRZ1066] >gi|116100358|gb|ABJ65504.1| heat-inducible transcription repressor HrcA [Streptococcus thermophilus LMD-9] (360 aa)
Score = 198, Expect = 1.3e-13, Identities = 74/326 (22%), Positives = 151/326 (46%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTK-LPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFI 329
           ITQRQ  +L  IVE +  T  PV SK + +    + S+AT+RNDMA LEK+G LEK H SSGR+PS AG++++  N       DE    ++   F      ++ +++ + K+++E T    +I+    T+  L   ++V+++   A+ ++   +            + +  D+ I  ++   R +   + +I  ++ +    I +K  +    + +L + IF    K +  + G+ + LA  +     K  + L   +  ++  + A   ++  +   +    E + E++        I  +    + ++ P  +DY ++  L+  I
  S:     2 ITQRQNAILNLIVEMFTRTHEPVCSKALQDSI--DSSSATIRNDMAKLEKMGYLEKAHISSGRMPSRAGFQYFVANSLNLDTIDEQDVYQVVKAFDFEAFKLEDILDAAAKLLAEMTGCTAVIQDVEPTKQRLTGFEIVQLSNHDALAVLTLDESKPVTVQFAIPKNFLSSDLEIFHKLVQGRFLGNTVLDIHYRLRTETPQIVQKYFKITDNVLDLFDYIFSHLFKELIFIEGKVASLAYADL----KTYQFLDNPQHVALALRSAISDDEV-TKISVAESTEEALENVTVMSHKFLIPYRGTALMHVIGPIEMDYRRMVSLVNVI 321
>gi|113867153|ref|YP_725642.1| heat-inducible transcription repressor [Ralstonia eutropha H16] >gi|113525929|emb|CAJ92274.1| transcriptional regulator, HrcA-family [Ralstonia eutropha H16] (344 aa)
Score = 197, Expect = 2.0e-13, Identities = 66/319 (20%), Positives = 154/319 (48%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNF--SKPYINDENLKL---KLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKT------VHGQSSLLAVPEFQDT-EKLKEILQILE-STSIWEQIAFKQNQTGSNTLITFGDE---VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKI 322
           + +R K LLK ++E Y+A   PVGS+ + +    ++S AT+RN M+ LE++G +   HTS+GR+P+  GY+ +  +   +KP   + +L     ++++    + +    +I  + + +S  +    + +        ++I+ + ++ +  ++I+++ +G++   II  +       +      FN               D+++  ++ ++++    + +L++   +  S           + G+  LL V +   + +KL+ +  + E  TS+ + +    +  G    I  G E   V  ED+        ++ Q    L ++ PTR+ Y ++
  S:     1 MDERSKTLLKTLIERYIAEGQPVGSRTLSKYSGLDLSPATIRNVMSDLEEMGFIASPHTSAGRIPTPRGYRLFVDSMLTAKPLERNADLAELTGQIQDQLGGQQLGPQRMITAAARTLSNLSHFAGVVMTPRRAQAFRQIEFMRLSDKRILLIIVSPEGDVQNRIIQTELSYTPAQLIEAANFFNSHY-------AGMSFDAVRGHLRVELQDLRRDMSQLMQAAVEAGSVAEDEDDDHVFISGERKLLEVEDLASSMDKLRRLFDVFEHKTSLLQLLDVSSHAQGVQIFI--GGESRLVPIEDMAVITAPYEVDGQIVGTLGVIGPTRMAYERV 326
>gi|150019997|ref|YP_001305351.1| heat-inducible transcription repressor HrcA [Thermosipho melanesiensis BI429] >gi|149792518|gb|ABR29966.1| heat-inducible transcription repressor HrcA [Thermosipho melanesiensis BI429] (337 aa)
Score = 197, Expect = 2.0e-13, Identities = 82/268 (30%), Positives = 141/268 (52%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDV-----------VIEESCKIISESTK-LPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFV---LQELIERIFQIKSKMIK--TVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQI 268
           MK +T RQK++L  +V +YV +  PV S  ++E    + S ATVRNDM  L  LG + + HTS+GR+P+  G +FY            N  LK+R+       SIDV           +I+ + K++S + K   +++  N   + ++RI +  + K  ++V +IT  G  +   I   + S  +D+    +  N  L    + E   K       +KE V+++ +V   L+E IE   +I S+  +   V G  +L+    F + EKL+EI++I  ++  + +I
  S:     1 MKNLTGRQKKILYCLVREYVKSGIPVSSSKILESTNLDWSGATVRNDMRKLGYLGYVFQPHTSAGRIPTDKGLRFY-----------VNEILKMRSETKKVGSSIDVKTDFPIGDLDKIIQGAAKLLSNTLKAFVIVEKPNPMYLRIRRIVLTPVTKTFSIVNIITELGLTSVLPIQHSEVSNFEDVE---QFLNKSLDGILLSEFKLK-------LKEVVEKFSWVGGRLKEFIELSEKIASEKYEEYVVEGVFNLVNAKRFNE-EKLREIVKISTNSDFYPRI 263
>gi|78356073|ref|YP_387522.1| heat-inducible transcription repressor HrcA [Desulfovibrio desulfuricans subsp. desulfuricans str. G20] >gi|78218478|gb|ABB37827.1| heat-inducible transcription repressor HrcA [Desulfovibrio desulfuricans G20] (354 aa)
Score = 196, Expect = 2.1e-13, Identities = 73/287 (25%), Positives = 142/287 (49%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNF--SKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIIS-ESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKT--------VHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHE 290
           +  R+ E+L  I+E Y+ATA PVGS  V  +    +SAA++RN MA L   G L + H S+GR+P+  G++ Y      ++P   DE  +  + N      + I  ++ E+ +++S  S ++ ++   +  EV    ID V+I+  + ++ V+  +G L +N +   +  + +D    +R  N     C        +   +  +  +++  E  L+ L  R   +     +         V+G  ++L   EF D  +++++L +LE  +   ++  K   + S T ++FG E  +E
  S:     3 LAHREAEILATIIERYIATAAPVGSVSVARRSGLRLSAASMRNTMAELTDKGYLSQPHASAGRIPTARGFRLYLDALLKTRPLSRDE--RSAILNELTTHGLEISDMLREASRMLSAHSRQVAVVLAPSRDEVRWHTIDFVKIS-DTLVLTVLVLEGGLVRNHVLSVETPVTQDE--LVRYGNYLNEYCK----GLTLSQARVRVARELQAAEAHLEALYFRALGLARLAFEHMDDDREVFVNGTLNMLDQAEFTDHTRIRDMLALLEERNSILELLDKAILSDSVT-VSFGQEDENE 290
>gi|149912897|ref|ZP_01901431.1| heat-inducible transcription repressor HrcA, putative [Roseobacter sp. AzwK-3b] >gi|149813303|gb|EDM73129.1| heat-inducible transcription repressor HrcA, putative [Roseobacter sp. AzwK-3b] (365 aa)
Score = 196, Expect = 2.6e-13, Identities = 72/328 (21%), Positives = 147/328 (44%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKT-----VHGQSSLL-AVPEFQDTEKLKEILQILE-STSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKT--KLVMVAPTRVDYSKIKGLLEF 328
           ++E+ +R +E+ + +VE Y+ +  PVGS+ +   +   +SAAT+RN M  LE LGLLE  H S+GRVP+  G + +     +        +  +       +  +  +++     +S  T    + +    E  +K I+ V + +  A+V+++ +DG++   I           +       N       + E+   I      I E+ +E + + ++L+E    +      T     V G+++LL A  E QD ++++ +   LE    I E +       G    I   +++             +N   K    + ++ PTR++Y +I  ++++
  S:    19 LEEMNERSREVFRRVVESYLLSGAPVGSRTLTRDFSEKVSAATIRNVMQDLEYLGLLESPHISAGRVPTQTGLRMFVDGLLEVGDLQSTDREMIDATLGSNSKDVSGILDRIGSALSGVTHGASLVLAPKREAPIKHIEFVSLAQDRALVVLVFADGHVENRIFTPPPGQTPSSMREAANFLNALAEGRTLSELQRVISKQ---IVERRQEIDKLARDLVESGLAVWDGEGDTYERLIVRGRANLLDAETEEQDLDRIRTLFDDLERKRDIAEFLELADEGEGVRIFIGSENKLFSLSGSSLVVSPYMNADRKIIGAVGVIGPTRLNYGRIVPIVDY 352
>gi|148994828|ref|ZP_01823883.1| heat-inducible transcription repressor [Streptococcus pneumoniae SP9-BS68] >gi|147927023|gb|EDK78066.1| heat-inducible transcription repressor [Streptococcus pneumoniae SP9-BS68] (336 aa)
Score = 195, Expect = 2.8e-13, Identities = 79/312 (25%), Positives = 150/312 (48%)
  Q:    11 LLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIE-NNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDS-MKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSL-----LAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKI 322
           +L  I++ +  T  PVGSK + E    N S+AT+RNDMA LEK GLLEK HTSSGR+PS AG+++Y K+        EN   ++   F      ++ +++E+  ++++ +   ++ ++   +   L   D+V + + +A+ +    +     +      + + +D+     I  +R +   + +I  KI + +  II+      + V+ +L E IF+        + G+ +L     LA  +F D  + K  L+I E          +++Q   N  +  G E    D+    +   I  +    L ++ P  +DY ++
  S:     1 MLNLIIDIFTKTHEPVGSKALQESI--NSSSATIRNDMAELEKQGLLEKAHTSSGRMPSVAGFQYYVKHSLDFDRLAENEVYEIVKAFDQEFFKLEDILQEAANLLTDLSGCTVVALDVEPSRQRLTAFDIVVLGQHTALAVFTLDESRTVTSQFLIPRNFLQEDLLKLKSIIQERFLGHTVLDIHYKIRTEIPQIIQRYFTTTDNVI-DLFEHIFKEMFNENIVMAGKVNLLNFANLAAYQFFDQPQ-KVALEIRE--------GLREDQM-QNVRVADGQESCLADLAVISSKFLIPYRGVGILAIIGPVNLDYQQL 306
>gi|90420649|ref|ZP_01228555.1| heat-inducible transcription repressor HrcA [Aurantimonas sp. SI85-9A1] >gi|90334940|gb|EAS48701.1| heat-inducible transcription repressor HrcA [Aurantimonas sp. SI85-9A1] (369 aa)
Score = 195, Expect = 3.0e-13, Identities = 76/325 (23%), Positives = 163/325 (50%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYIND------ENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKS--------KMIKTVHGQSSLLA-VPEFQDTEKLKEILQILESTS-IWEQIAFKQNQTGSNTLITFGDE-----VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEF 328
           + +R +E+ + IVE Y+    PVGS+++       +S A++RN M+ LE LGL+   H S+GR+P+  G +F+   F +  + D      E ++ K+R     R    + ++ E+ +++S  ++   I + +  ++ LK I+ + +    A+ +++ ++G +   I+          +       N  ++   + E + +I  +K      +   + + ++L+E+   + S        ++I  V G+++LL  V   +D E+L+ +   LE+ S I E +   +   G    I  G E     +S   +V A       E     + ++ PTR++Y +I  ++++
  S:    18 LDERSREIFRLIVESYLDIGEPVGSRMLSRLLTNALSPASIRNVMSDLEALGLIYAPHVSAGRMPTELGLRFFVDAFLE--VGDLGSSEREEIEEKVRVSGDGR--PFESLLTEASQLLSGLSRGAGIVLTSKADLRLKHIEFIRLEPTRALAVLVGANGEVENRILDLPAGVTASQLVEAGNFLNAHIVGRTLGEASEEIARLKDNTSSAL---DLLSRQLVEKGLAVWSGASADQPARLI--VRGRANLLENVTASEDIERLRLLFDDLETKSGIIELLGLAEKGNGVRIFI--GSENKLFSLSGSSLVVAPYQGG-GESVIGAVGVIGPTRLNYKRIVPMVDY 351
>gi|89067432|ref|ZP_01154945.1| heat-inducible transcription repressor [Oceanicola granulosus HTCC2516] >gi|89047001|gb|EAR53055.1| heat-inducible transcription repressor [Oceanicola granulosus HTCC2516] (364 aa)
Score = 195, Expect = 3.1e-13, Identities = 74/326 (22%), Positives = 147/326 (45%)
  Q:     3 EITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIER---IFQIKSKMIK--TVHGQSSLL-AVPEFQDTEKLKEILQILE-STSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKT--KLVMVAPTRVDYSKIKGLLEF 328
           E+T R +E+ + +VE Y+ T  PVGS+ +       +SAATVRN M  LE LGLL   H S+GRVP+  G + +     +        + ++       +  +  +++     +S  T    + +    E  +K I+ V +    A+V+++ +DG++   +           +       N       + E+ T   +M+  I  + +E + +  +L+E    I++ K +  +   V G+ +LL    E  D E+++E+   LE    I E +   +   G    I   +++             +N   K    + ++ PTR++Y +I  ++++
  S:    20 EMTDRSREVFRRVVEGYLETGAPVGSRSLTRTMSEKVSAATVRNVMQDLEYLGLLGSPHVSAGRVPTQLGLRMFVDGLLEVGDLSGEDRARIDETLTSNSDDVPALLDRVGSALSGMTLGASLVLAPKHEAPVKHIEFVSLAPDRALVVLVFADGHVENRVFTPPPGQTPSSMREAANFVNALAQGRTLAELGT---AMQREIANRRREIDTLAADLVESGLAIWENKGESTERLIVRGRGNLLDESGEPGDLERIRELFDDLERKRDIAEFLELAEEGEGVRIFIGSENKLFSLSGSSLVVSPYMNADRKIIGAVGVIGPTRLNYGRIVPIVDY 351
>gi|121608037|ref|YP_995844.1| heat-inducible transcription repressor [Verminephrobacter eiseniae EF01-2] >gi|121552677|gb|ABM56826.1| heat-inducible transcription repressor HrcA [Verminephrobacter eiseniae EF01-2] (334 aa)
Score = 195, Expect = 3.3e-13, Identities = 70/319 (21%), Positives = 150/319 (47%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELI----ERIFQIKSKMIKTVHGQSSLLAVPEF-QDTEKLKEILQILES-TSIWEQIAFKQNQTGSNTLITFGDE---VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKI 322
           +  R K LLK +VE Y+A   PVGS+ + +    ++S AT+R+ MA LE LGL+   HTS+GR P+  GY+     F    +  +   L    +  ++      VI  + +++S  ++   + I      + + I+ + ++++  +VI+++ +G++   +I    D     +       N       ++++  ++ S   +++ ++     ++Q  +    E +  ++ +++  + G+ +LLAV +F  D + L+    + E  T I   +       G    I  G E   V  E++        ++      L ++ PTR+ Y ++
  S:     2 LDDRAKLLLKALVERYIADGQPVGSRTLSQASGIDLSPATIRHVMADLEDLGLIASPHTSAGRRPTARGYRL----FVDTMLTVQRDPLTAPELAPEQPQK---VIANAAQLLSSLSQFVGVVIAPRRSSVFRHIEFLRLSERRFLVIIVSPEGDVQNRVIFTDIDYSQAQLIEASHFLNSHYTGLAMEQVRERLKSEVDMLRNEIAA---LMQAAVNVGSEALSDVQDEVV--ISGERNLLAVSDFSSDMDHLRRAFDLFEQKTQILRLLDISSQAQGVR--IYIGGESQVVPFEELSVVSASYEVDGTMVGTLGVIGPTRMPYDRM 315
>gi|28895245|ref|NP_801595.1| heat-inducible transcription repressor [Streptococcus pyogenes SSI-1] >gi|28810491|dbj|BAC63428.1| putative heat shock transcription repressor protein [Streptococcus pyogenes SSI-1] (335 aa)
Score = 195, Expect = 3.3e-13, Identities = 61/213 (28%), Positives = 113/213 (53%)
  Q:    12 LKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIE-NNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIF 224
           +  IVE +  T  PVGSK +  +   + S+AT+RNDMA LEKLGLLEK HTSSGR+PS AG+K++ ++  +    DE     +   F      ++ +++++  I+SE T    + ++       L   D+V+++   A+ ++   +            + + +D+     I  +RL+D  + +I  K   +++ I + V++Y FV  + + ++F
  S:     1 MNLIVELFTQTHEPVGSKAL--QRTIDSSSATIRNDMAKLEKLGLLEKAHTSSGRMPSPAGFKYFVEHSLRLDSIDEQDIYHVIKAFDFEAFKLEDMLQKASHILSEMTGYTSVILDVEPARQRLTGFDVVQLSNHDALAVMTLDESKPVTVQFAIPRNFLTRDLIAFKAIVEERLLDSSVIDIHYK---LRTEIPQIVQKY-FVTTDNVLQLF 208
>gi|149204369|ref|ZP_01881336.1| heat-inducible transcription repressor [Roseovarius sp. TM1035] >gi|149142254|gb|EDM30301.1| heat-inducible transcription repressor [Roseovarius sp. TM1035] (354 aa)
Score = 195, Expect = 3.4e-13, Identities = 70/328 (21%), Positives = 150/328 (45%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQI-------KSKMIKTVHGQSSLL-AVPEFQDTEKLKEILQILE-STSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKT--KLVMVAPTRVDYSKIKGLLEF 328
           ++++  R +E+ + +VE Y+A  +PVGS+ +   +   +SAAT+RN M  LE +GLL   H S+GR+P+  G + +     +    +   +  +       +  +  V++     +S  T+   + +    E  +K I+ V +    A+V+++ SDG++   I           +       N  +    + ++ T I      I  + +E + + ++LI+    +         ++I  V G+++LL A  E +D E+++ +   LE    I E +       G    I   +++             +N   K    + ++ PTR++Y +I  ++++
  S:     8 LEQLNDRSREVFRRVVESYLANGDPVGSRTLTRDFSEKVSAATIRNVMQDLEYMGLLGSPHISAGRIPTQEGLRMFVDGLLEVSNLEATDRQAIDATVGSNSQDVGGVLDRIGAALSGVTRGASLVLAPKHEAPIKHIEFVSLGHDRALVVLVFSDGHVENRIFTPPPGQTPSSMREAANFLNALIEGKTLSDLQTVISRQ---IAARRQEIDQLARDLIDSGLAVWEGEGDKYERLI--VRGRANLLNATSEEKDLERIRILFDDLERKRDIAEFLELADEGAGVRIFIGSENKLFSLSGSSLVVSPYMNADRKIIGAVGVIGPTRLNYGRIVPIVDY 341
>gi|163812727|ref|ZP_02204391.1| heat-inducible transcription repressor HrcA [Dehalococcoides sp. VS] >gi|157403651|gb|EDO69707.1| heat-inducible transcription repressor HrcA [Dehalococcoides sp. VS] (345 aa)
Score = 194, Expect = 3.4e-13, Identities = 65/266 (24%), Positives = 132/266 (49%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTK-LPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKI-----DSMK---SIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIA 269
           +T R + +L+ IV  Y+  A PV S  ++E    +I +AT+RN++  LE  G + + H S+G +P+  GY++Y ++     +   N K  +R++F      ++  +  +  ++S+  + + ++ +   T+  +  I++V +     +V++I     + + +I+F+D     ++++     ND        +I  K+     D  K   S++K    E E   QE  E  F           G   +L  PEF   ++++EI+Q+LE   + + IA
  S:     2 LTSRAEIILRSIVRQYITKAVPVSSSSILEDCGLDICSATIRNEVVRLETEGYILRPHHSAGSIPADKGYRYYVESLKDVEL-PTNDKFLIRHLFHQVEKEMEEWLNLTVAVLSQRVQSMAVVTMPRQTQGKVHHIELVSLQDNLVLVVLILRGAKVKQQLINFEDAVSQPELTLISNRLNDAYAGLTRFQIEQKLFNLNPDEFKVRDSLVKMMRGEDE---QESREPFFD----------GLHYMLEQPEFHQNQRVQEIMQLLEQKKLSKMIA 262
>gi|166711484|ref|ZP_02242691.1| heat-inducible transcription repressor [Xanthomonas oryzae pv. oryzicola BLS256] (335 aa)
Score = 194, Expect = 3.7e-13, Identities = 70/317 (22%), Positives = 141/317 (44%)
  Q:    11 LLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDR-----LID---CPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDE---VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLE 327
           +L+ ++  Y+    PVGSK + +    ++S AT+RN +A LE +GLL   HTS+GRVP+  GY+ +  +  +     E    +LR   A    +  ++   S  + + S  + ++      +   + ID V ++ +  + I++ +D  +   +I  +      ++       N +     L D   C ++E+    + M+ ++   V        +L              + GQ+ L+ V +  D ++L+E+ +   S     Q+  +  Q      I  G+E   VS ED+         + Q    L ++ P R+ Y ++  L++
  S:     1 MLRTLIARYIRDGEPVGSKTLAQHAGLDVSPATIRNILADLEDVGLLSSPHTSAGRVPTAHGYRVFVDSLVQMQPPGEEEVRRLRAELASGNGTQSLLGSASQMLSAMSHFVGVVSAPRREQFAFRHIDFVALDARRVLAILVFADNEVQNRVIEPRRAYEPAELERVANYLNAQFAGRALADIRACLLRELRMAKNEMEQLLAHSV--------DLASEALVPADADDMVMAGQTRLMGVQDLSDLDRLRELFEAFASKREILQLLERTIQ-APGVRIFIGEETGMVSLEDVSLVTAPYTAHGQVLGVLGVIGPKRMAYDRLIPLVQ 319
>gi|146278690|ref|YP_001168849.1| heat-inducible transcription repressor [Rhodobacter sphaeroides ATCC 17025] >gi|145556931|gb|ABP71544.1| heat-inducible transcription repressor HrcA [Rhodobacter sphaeroides ATCC 17025] (350 aa)
Score = 194, Expect = 3.7e-13, Identities = 71/328 (21%), Positives = 152/328 (46%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYK-FYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSI---IKEKVKEYEFVLQELIERIFQI-------KSKMIKTVHGQSSLL-AVPEFQDTEKLKEILQILE-STSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKT--KLVMVAPTRVDYSKIKGLLEF 328
           + E+  R +E+ + +VE Y+A+ +PVGS+ +       +SAAT+RN M  LE LGLL+  H S+GR+P+  G + F +       ++DE+ + ++          +  +++     +S  T    + +    E  ++ I+ V +    A+V+++ +DG++   +           +       N       + E  T  D  ++I   I  + +E + +  +L++    +         ++I  V G+++LL    E  D E+++ +   LE    I E +   +   G    I   +++             +N   K    + ++ PTR++Y +I  ++++
  S:     2 LSEMNDRSREVFRRVVEGYLASGDPVGSRTLTRHMTEKVSAATIRNVMQDLEYLGLLDSPHVSAGRIPTQLGLRMFVDGLLEVGTVSDED-RERIDATMGGNEHDVVSLLDRVGATLSSITHGASLVLSPKHEAPIRHIEFVSLGADRALVVLVFADGHVENRVFRPPPGQTASSMREAANFLN------ALVEGRTLADMRQTIGQEISRRRREIDALAHDLVQSGLAVWENPGEQSERLI--VRGRANLLEGSTEAADFERIRTLFDDLERKRDIAEFLELAEEGEGVRIFIGSENKLFSLSGSSLVVSPYMNADRKIIGAIGVIGPTRLNYGRIVPIVDY 335
>gi|86356021|ref|YP_467913.1| heat-inducible transcription repressor [Rhizobium etli CFN 42] >gi|86280123|gb|ABC89186.1| heat-inducible transcriptional regulator (repressor) protein [Rhizobium etli CFN 42] (368 aa)
Score = 194, Expect = 3.9e-13, Identities = 70/325 (21%), Positives = 167/325 (51%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKL---RNVFADRTMS-IDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQI---------KSKMIKTVHGQSSLL-AVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKTKLV----MVAPTRVDYSKIKGLLEF 328
           + +R +E+ + IVE Y+ +  P+GS+ +      ++S A+VRN M+ LE+LGL+   H S+GR+P+  G +F+   F +  I D + + +    R V A+   + ++ ++ E+ +++S  ++   + I + ++ +LK ++ + +    A+ +++     +   II          ++      N  +    + E+  ++  +K  ++    E + + ++L+ER   +          +++I  + G+++LL  +   +D ++L+ +   LE      +I     +TGS   I  G E     +  +   +     +  ++V    ++ PTR++YS+I  ++++
  S:    21 LDERSREIFRRIVEGYLESGEPLGSRNLSRLLPMSLSPASVRNVMSDLEELGLIYSPHVSAGRLPTQIGLRFFVDAFMQ--IGDLSAEDRANIDRQVRAESGGNPVESMMNEASRMLSGISRGAGLVITSKSDPVLKHVEFIRLEPTKALAVLVGDHDQVENRIIELPAGVTSSQLTEAANFLNAHMSGQTLPELRKQLSRLKDDVRH---ELDALSRDLVERGIAVWAGSPDEGKPAQLI--IRGRANLLEGLAGAEDLDRLRMLFDDLEKKDSLIEI-LNLAETGSGVRIFIGSENKLFSLSGSSLIVAPYRDDDDRIVGAVGVIGPTRLNYSRIVPMVDY 355
>gi|99082713|ref|YP_614867.1| heat-inducible transcription repressor [Silicibacter sp. TM1040] >gi|99038993|gb|ABF65605.1| heat-inducible transcription repressor HrcA [Silicibacter sp. TM1040] (354 aa)
Score = 194, Expect = 3.9e-13, Identities = 73/328 (22%), Positives = 154/328 (46%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEK---NFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQI-------KSKMIKTVHGQSSLLA---VPE--------FQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDE----VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEF 328
           ++++  R +E+ + +VE+Y+ T  PVGS+ +       +SAATVRN M  LE LGLL+  H S+GR+P+  G + +         P   D  +   +     D +  +  +++     +S  T    + +    E  L+ I+ V + +  A+V+++ SDG++   +           +       N  +    + ++   +   +  I+ + +E + +  E+IE            ++++I  V G+++LL+    P+        F D E+ ++I + LE T           + G    I  G E          +     +N + +    + ++ PTR++Y +I  ++++
  S:     8 LQDMNDRSREVFRILVENYLDTGGPVGSRTLTRSLSEKVSAATVRNVMQDLEYLGLLDSPHVSAGRIPTQMGLRLFVDGLLQMGDPSRQDREM---IDRTLGDNSSDVGGMLDRVGAALSGVTHGASLVLTPKHEAELRHIEFVSLAQDRALVVLVFSDGHVENRLFTPPPGQTPSSMREAANFLNALIEGRTLSDVRKDV---QGEIERRRQEIDSLAHEMIESGLAAWEDEGSDQARLI--VRGRANLLSEDGAPDELEKIRSLFDDLERKRDIAEFLELT-----------EEGDGVRIFIGSENKLFSLSGSSLVVSPYMNADRKIIGAVGVIGPTRLNYGRIVPIVDY 341
>gi|159046004|ref|YP_001534798.1| heat-inducible transcription repressor [Dinoroseobacter shibae DFL 12] >gi|157913764|gb|ABV95197.1| heat-inducible transcription repressor HrcA [Dinoroseobacter shibae DFL 12] (354 aa)
Score = 192, Expect = 6.3e-13, Identities = 78/328 (23%), Positives = 152/328 (46%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVF---ADRTMSIDVVIEESCKIISESTK-LPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFN--------DRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLA-VPEFQDTEKLKEILQILESTSIWEQIAFKQ-NQTGSNTLITFGDE----VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEF 328
           + E++ R +E+ + +VE Y+ T +PVGS+ +       +SAAT+RN M  LE LGLL+  H SSGR+P+  G +     F    +   NL  + R V    A    S+  +++     +S  T+   ++    N    +K ++ V +    A+ +++ +DG +   +           +       N          L D   +EIA++   +  +  + V+    V Q+  E       ++I  V G+++LL   P  +D E+++++   LE     +  AF    + G    I  G E          +     +N + +    + ++ PTR++Y ++  ++E+
  S:     8 ISEMSDRSREVFRRVVEGYLQTGDPVGSRTLTRSMSEKVSAATIRNVMQDLEFLGLLDSPHVSSGRIPTQMGLRM----FVDGLLEIGNLSSEDREVIESSAGENDSVGGLLDRVGSALSGITQGASLVLAPKNESAPIKHVEFVSLAPGRALAVLVFADGQVENRVFTPPAGQTPSSMREAANFLNAVAEGRSLSELADVIRREIASRRSELDRLAADMVEAGTAVWQDPGES----NERLI--VRGRANLLGDGPPSEDLERVRKLFDDLERKR--DIAAFLDLAEAGEGVRIFIGSENKLFSLSGSSLVVSPYMNADRKIIGAVGVIGPTRLNYGRVVPVVEY 341
>gi|121593327|ref|YP_985223.1| heat-inducible transcription repressor [Acidovorax sp. JS42] >gi|120605407|gb|ABM41147.1| heat-inducible transcription repressor HrcA [Acidovorax sp. JS42] (334 aa)
Score = 192, Expect = 6.6e-13, Identities = 72/319 (22%), Positives = 144/319 (45%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIK------TVHGQSSLLAVPEF-QDTEKLKEILQILES-TSIWEQIAFKQNQTGSNTLITFGDE---VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKI 322
           +  R K LLK +VE Y+A   PVGS+ +       +S AT+RN MA LE LGL+   HTS+GRVP+  GY+     F    +  +  +L    +  ++      VI  +  ++S  ++   + +      + + I+ + ++++  +VI+++ DG++   +I  + D     +       N       ++++  +       +K +V +    +  L++    + S+ +          G+ +LL+V +F  +   L+    + E  T I   +       G    I  G E   V  E++        ++ Q    L ++ PTR+ Y ++
  S:     2 LDDRSKLLLKALVERYIAEGQPVGSRTLSRASGLELSPATIRNVMADLEDLGLIASPHTSAGRVPTAKGYRL----FVDTMLTVQQEQLPTVQLMPEQPQK---VIANAAHLLSSLSQFVGVVMAPRRASVFRHIEFLRLSEKRFLVIIVSPDGDVQNRVIFTEVDYSQSQLVEAANFLNANYAGLTMEQVRER-------LKLEVDKLRGEIAALMQAAVSVGSEAMSGSQDEVVFSGERNLLSVSDFSSNMSHLRRAFDLFEQKTQILRLLDISSRAEGVRIFI--GGESQVVPFEELSVVSAPYEVDGQVVGTLGVIGPTRMSYDRM 315
>gi|114330782|ref|YP_747004.1| heat-inducible transcription repressor [Nitrosomonas eutropha C91] >gi|122314278|sp|Q0AHZ3|HRCA_NITEC Heat-inducible transcription repressor hrcA >gi|114307796|gb|ABI59039.1| heat-inducible transcription repressor HrcA [Nitrosomonas eutropha C91] (338 aa)
Score = 192, Expect = 6.9e-13, Identities = 72/319 (22%), Positives = 152/319 (47%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFY-EKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKI--ENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEF-QDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFG--DEVSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKI 322
           + +R K LLK +VE Y+    PVGS+ + +    ++S AT+RN M  LE++G +   HTS+GR+P+T GY+F+ +       +++E + L L N       S   +I  + +++S+ T+   + +  +     + + I+ V ++++  ++I++T +G++   II  +      D+       N     C ++EI + +    + ++  + +      E+     Q  S+ +  + G+  L  V +  ++   LK++ ++ E  S   Q+     Q     +   G  DE   E+I        +  +    + ++ P R+ Y +I
  S:     2 LNERAKILLKTLVERYIHEGQPVGSRSLAKFSGLDLSPATIRNVMTDLEEMGFVSSPHTSAGRMPTTLGYRFFVDTLLVVQSLDNEQITL-LENRMHPNNPS--HLINVTSRLLSDLTQFVGVVVTPKRMGGAVFRHIEFVPLSEKRILLILVTPEGDVQNRIIFTETVYNQSDLIEAGNFLNQHYAGCALEEIRSGLQHELTQLRRNMTDLMNAAIEIGNAALQESSEAV-VIAGEHKLFDVRDLSENLSSLKQLFELFERKSKLLQLMELSRQACGVKIFIGGESDETMLEEISVVTAPYEMEGKIVGTVGVIGPRRMAYERI 322
>gi|194522838|ref|YP_002058371.1| heat-inducible transcription repressor HrcA [Burkholderia mallei FMH] >gi|194527823|ref|YP_002063346.1| heat-inducible transcription repressor HrcA [Burkholderia mallei JHU] >gi|147746848|gb|EDK53925.1| heat-inducible transcription repressor HrcA [Burkholderia mallei FMH] >gi|147751833|gb|EDK58900.1| heat-inducible transcription repressor HrcA [Burkholderia mallei JHU] (405 aa)
Score = 192, Expect = 7.4e-13, Identities = 67/316 (21%), Positives = 147/316 (46%)
  Q:     7 RQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNF---SKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKS-----KMIKTVHGQSSLLAVPEF-QDTEKLKEILQIL-ESTSIWEQIAFKQNQTGSNTLITFGDE---VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKI 322
           R + LLK ++E Y+A   PVGS+ +       +S AT+RN M+ LE+LGL+   HTS+GRVP+  GY+ +         P  +D   +L    + A        V+  +  ++S  ++   + +      + K+I+ + ++ +  ++I++T +G++   +I  + D     ++      N               D ++  ++E++ +    +  L+       +     +    + G+ +LL V +   D  +L+++  +  + TS+ + +    +  G    I  G E   V  +++        +N +    L ++ PTR+ Y+++
  S:    70 RARTLLKTLIERYIADGQPVGSRTLSRYSGLELSPATIRNVMSDLEELGLVSSPHTSAGRVPTPRGYRLFVDTMLTVESPIDSDAVTRLVQTTLQAGEPQQ--RVVAAAASVLSNLSQFAGVVLTPRRSHVFKQIEFLRLSDKRILLIIVTPEGDVQNRMIATQRDYAPAQLTEASNYINAHF-------AGLSFDEVRRRLREEIDQLRGDMTALMHAAVTASTEEPDDEETVLISGERNLLEVADLSSDMARLRKLFDVFDQKTSLLQLLDVSSHAQGVQIFI--GGESTLVPIDEMSVVTAPYEVNGKIVGTLGVIGPTRMAYNRV 387
>gi|194557245|ref|YP_002092270.1| Negative regulator of class I heat shock protein [Burkholderia cenocepacia PC184] >gi|124871036|gb|EAY62752.1| Negative regulator of class I heat shock protein [Burkholderia cenocepacia PC184] (370 aa)
Score = 192, Expect = 7.4e-13, Identities = 66/316 (20%), Positives = 149/316 (47%)
  Q:     7 RQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNF--SKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKT-----VHGQSSLLAVPEF-QDTEKLKEILQIL-ESTSIWEQIAFKQNQTGSNTLITFGDE---VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKI 322
           R + LLK ++E Y+A   PVGS+ +       +S AT+RN M+ LE+LGL+   HTS+GRVP+  GY+ +       +  I+ E +  +++N           V+  +  ++S  ++   + +      + K+I+ + ++ +  ++I++T +G++   ++    D     ++      N               D ++  +++++ +    +  L+       +++  T     + G+ +LL V +   D  +L+++  +  + T + + +    +  G    I  G E   V  E++        +N Q    L ++ PTR+ Y+++
  S:    35 RARTLLKTLIERYIADGQPVGSRTLSRYSGLELSPATIRNVMSDLEELGLVSSPHTSAGRVPTPRGYRLFVDTMLTVEAPIDAEAVARQVQNTLQAGEPQ-QRVVAAAASVLSNLSQFAGVVLTPRRSHVFKQIEFMRLSDKRILLIIVTPEGDVQNRMLATPRDYSPSQLTEASNYINAHF-------AGLSFDEVRRRLRDEIDQLRGDMTTLMHAAVTASTEVPDTEDTVLISGERNLLEVADLSSDMARLRKLFDVFDQKTGLLQLLDVSSHAQGVQIFI--GGESTLVPIEEMSVVTAPYEVNGQIVGTLGVIGPTRMAYNRV 352
>gi|30249448|ref|NP_841518.1| heat-inducible transcription repressor [Nitrosomonas europaea ATCC 19718] >gi|46576513|sp|Q82UK7|HRCA_NITEU Heat-inducible transcription repressor hrcA >gi|30138811|emb|CAD85388.1| Negative regulator of class I heat shock protein [Nitrosomonas europaea ATCC 19718] (338 aa)
Score = 191, Expect = 7.8e-13, Identities = 69/319 (21%), Positives = 148/319 (46%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFY-EKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKI--ENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDT-EKLKEILQILESTSIWEQIAFKQNQTGSNTLITFG--DEVSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKI 322
           + +R+K LLK +VE Y+    PVGS+ + +    ++S AT+RN M  LE++G +   HTS+GR+P+T GY+F+ +       +++E + L    +  +    +   +  + +++SE T+   + +  +     + + I+ V + ++  ++I++T +G++   II  +      D+       N     C ++EI + +    + ++  +        E+     Q  S+ +  + G+  L  V +  D    LK + ++ E  S   Q+     Q     +   G  DE   E++        +  +    + ++ P R+ Y +I
  S:     2 LNEREKILLKTLVERYIHEGQPVGSRSLAKFSGLDLSPATIRNVMTDLEEMGYVSSPHTSAGRMPTTLGYRFFVDTLLVVKSLDNEQITLLENQLHPNNPTHL---MNVTSRLLSELTRFVGVVVTPKRMGGAVFRHIEFVALTEKRILLILVTPEGDVQNRIILTETAYSQSDLIEAGNFLNQHYAGCTLEEIRSGLQRELTQLRRDMTGLMNAAIEIGNDALQESSEAV-VIAGEHRLFDVRDLSDNLSSLKSLFEMFERKSKLLQLMELSRQAHGVKIFIGGESDETMLEEVSVVTAPYEMEGKIVGTVGVIGPRRMAYERI 322
>gi|83942035|ref|ZP_00954497.1| heat-inducible transcription repressor [Sulfitobacter sp. EE-36] >gi|83847855|gb|EAP85730.1| heat-inducible transcription repressor [Sulfitobacter sp. EE-36] (344 aa)
Score = 191, Expect = 7.8e-13, Identities = 69/325 (21%), Positives = 145/325 (44%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQI-----KSKMIKTVHGQSSLLAVP-EFQDTEKLKEILQILE-STSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKT--KLVMVAPTRVDYSKIKGLLEF 328
           +  R +E+ + +VE Y+A  +PVGS+ +   +   +SAAT+RN M  LE +GLL   H S+GR+P+  G + +     +     E  + K+          +  +++     +S  T+   + +    E  +K I+ V ++   A+V+++ SDG++   +           +       N  +    I E+   I      I ++ ++ + + Q+L+E    +     +S     V G+S+L+    E ++ E ++++   LE    I E +       G    I   +++             +N   K    + ++ PTR++Y +I  ++ +
  S:     1 MNDRSREVFRRVVEGYLANGDPVGSRTLTRDFSEKVSAATIRNVMQDLEYMGLLGSPHVSAGRIPTQMGLRMFVDGMIEIGDPTETDREKIDATVGSNNADVSGILDRVGSALSGVTQGASLVLTPKHEAPIKHIEFVSLSHDRALVVLVFSDGHVENRLFTPPPGQTPSSMREAANFLNALVEGKTISELQRTIAHE---ISQRRQQIDVLAQQLVESGLALWQGEGESPERLIVRGRSNLINTEGEAENVELIRQLFDDLERKRDIAEFLELADAGDGVRIFIGSENKLFSLSGSSLVVSPYMNADRKVIGAVGVIGPTRLNYGRIVPIVNY 331
>gi|116073969|ref|ZP_01471231.1| Negative regulator of class I heat shock protein [Synechococcus sp. RS9916] >gi|116069274|gb|EAU75026.1| Negative regulator of class I heat shock protein [Synechococcus sp. RS9916] (332 aa)
Score = 191, Expect = 7.9e-13, Identities = 40/95 (42%), Positives = 60/95 (63%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFY------EKNFSKPYINDENLKLKLR 95
           M  +  RQ+E+L+  V  YV T  PVGS+ +++++    S+ATVR+ M  LE+ GLL + HTS+GRVPS  GY+ Y      +   +  Y+  E  +L LR
  S:     1 MDSLPSRQQEVLRATVHHYVDTIEPVGSRTLVKRFGLQASSATVRSAMGALEQRGLLTQPHTSAGRVPSAKGYRHYVDCLLPQPGAAAQYLEQELTQLSLR 101
>gi|107021821|ref|YP_620148.1| heat-inducible transcription repressor [Burkholderia cenocepacia AU 1054] >gi|116688768|ref|YP_834391.1| heat-inducible transcription repressor [Burkholderia cenocepacia HI2424] >gi|170732068|ref|YP_001764015.1| heat-inducible transcription repressor HrcA [Burkholderia cenocepacia MC0-3] >gi|122979156|sp|Q1BYY0|HRCA_BURCA Heat-inducible transcription repressor hrcA >gi|166219855|sp|A0K4S1|HRCA_BURCH Heat-inducible transcription repressor hrcA >gi|105892010|gb|ABF75175.1| heat-inducible transcription repressor HrcA [Burkholderia cenocepacia AU 1054] >gi|116646857|gb|ABK07498.1| heat-inducible transcription repressor HrcA [Burkholderia cenocepacia HI2424] >gi|169815310|gb|ACA89893.1| heat-inducible transcription repressor HrcA [Burkholderia cenocepacia MC0-3] (340 aa)
Score = 191, Expect = 8.4e-13, Identities = 66/316 (20%), Positives = 149/316 (47%)
  Q:     7 RQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNF--SKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKT-----VHGQSSLLAVPEF-QDTEKLKEILQIL-ESTSIWEQIAFKQNQTGSNTLITFGDE---VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKI 322
           R + LLK ++E Y+A   PVGS+ +       +S AT+RN M+ LE+LGL+   HTS+GRVP+  GY+ +       +  I+ E +  +++N           V+  +  ++S  ++   + +      + K+I+ + ++ +  ++I++T +G++   ++    D     ++      N               D ++  +++++ +    +  L+       +++  T     + G+ +LL V +   D  +L+++  +  + T + + +    +  G    I  G E   V  E++        +N Q    L ++ PTR+ Y+++
  S:     5 RARTLLKTLIERYIADGQPVGSRTLSRYSGLELSPATIRNVMSDLEELGLVSSPHTSAGRVPTPRGYRLFVDTMLTVEAPIDAEAVARQVQNTLQAGEPQ-QRVVAAAASVLSNLSQFAGVVLTPRRSHVFKQIEFMRLSDKRILLIIVTPEGDVQNRMLATPRDYSPSQLTEASNYINAHF-------AGLSFDEVRRRLRDEIDQLRGDMTTLMHAAVTASTEVPDTEDTVLISGERNLLEVADLSSDMARLRKLFDVFDQKTGLLQLLDVSSHAQGVQIFI--GGESTLVPIEEMSVVTAPYEVNGQIVGTLGVIGPTRMAYNRV 322
>gi|84684655|ref|ZP_01012556.1| heat-inducible transcription repressor [Rhodobacterales bacterium HTCC2654] >gi|84667634|gb|EAQ14103.1| heat-inducible transcription repressor [Rhodobacterales bacterium HTCC2654] (354 aa)
Score = 191, Expect = 8.6e-13, Identities = 41/163 (25%), Positives = 82/163 (50%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNI 163
           + E+  R +E+ + +VE Y+ + +PVGS+ +       +SAAT+RN M  LE LGLL   H S+GR+P+  G + +   F +     +  + K++      +  +  ++    K +S  T    + +   +E  +K I+ V +    A+ +++ +DG +   +
  S:     8 LDELNDRSREVFRRLVEAYLESGDPVGSRTLTRTLSEKVSAATIRNVMQDLEYLGLLNSPHVSAGRIPTELGLRMFVDGFLEVGDLTDGDRDKIQETLGSNSADVPALMSSVGKALSGITSGASLVLTPKSEAPIKHIEFVSLGVDRALTVLVFADGQVENRL 170
>gi|167946095|ref|ZP_02533169.1| Negative regulator of class I heat shock protein [Endoriftia persephone 'Hot96_1+Hot96_2'] (231 aa)
Score = 191, Expect = 9.2e-13, Identities = 44/166 (26%), Positives = 96/166 (57%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYK-FYEKNFSKPYIND---ENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLP-MIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDD 169
           +++R +  LK ++E Y+    PVGS+ + ++   ++S AT+RN MA LE LGL+   HTS+GRVP+T G++ F +   +   +     ENL+ +L+     +   +  ++  + +++S  T +  ++ +        ++I+ + ++++  + I++T+DG +   I++   D
  S:    12 VSERAQHFLKVLIEHYIREGQPVGSRTLAKEVGMDLSPATIRNVMADLEDLGLITSPHTSAGRVPTTTGFRMFLDSLLTVKRLKTREVENLREQLQ---LTQATDMSGLLASASQMLSGVTHMAGVVTVPRRKHTEFRQIEFLPLSERRVLAILVTADGEVNNRILNTHRD 179
>gi|57233844|ref|YP_182110.1| heat-inducible transcription repressor HrcA [Dehalococcoides ethenogenes 195] >gi|123618308|sp|Q3Z6N9|HRCA_DEHE1 Heat-inducible transcription repressor hrcA >gi|57224292|gb|AAW39349.1| heat-inducible transcription repressor HrcA [Dehalococcoides ethenogenes 195] (345 aa)
Score = 191, Expect = 9.2e-13, Identities = 65/266 (24%), Positives = 132/266 (49%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTK-LPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKI-----DSMK---SIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIA 269
           +T R + +L+ IV  Y+  A PV S  ++E    +I +AT+RN++  LE  G + + H S+G +P+  GY++Y ++     +   N K  +R++F      ++  +  +  ++S+  + + ++ +   T+  +  I++V +     +V++I     + + +I+F++     ++++     ND        +I  K      D +K   S+IK    E E   QE  E  F           G   +L  PEF   ++++EI+Q+LE   + + IA
  S:     2 LTPRAEIILRSIVRQYITKAVPVSSSSILEDCGLDICSATIRNEVVRLETEGYILRPHHSAGSIPADKGYRYYVESLKDVEL-PTNDKFLIRHLFHQVEKEMEEWLNLTVAVLSQRVQSMAVVTMPRQTQGKVHHIELVSLQDNLVLVVLILRGAKVKQQLINFENTVSQPELTLISNRLNDAYAGLTRFQIEQKTLNLNPDELKVKDSLIKMMRGEDE---QESREPFFD----------GLHYMLEQPEFHQNQRVQEIMQLLEQKKLSKMIA 262
>gi|86136765|ref|ZP_01055343.1| heat-inducible transcription repressor [Roseobacter sp. MED193] >gi|85826089|gb|EAQ46286.1| heat-inducible transcription repressor [Roseobacter sp. MED193] (355 aa)
Score = 190, Expect = 1.0e-12, Identities = 76/328 (23%), Positives = 154/328 (46%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQI-------KSKMIKTVHGQSSLL----AVPE--------FQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDE----VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEF 328
           + ++  R +E+ + +VE Y+A+  PVGS+ +       +SAATVRN M  LE LGLL+  H S+GR+P+  G + +     +        + K+          +  +++     +S  T+   + +    E  ++ I+ V + +  A+V+++ SDG++   +           +       N  LI+   + ++     M+  I  + +E + + Q++IE            K+++I  V G+++LL     VPE        F D E+ ++I + LE T           + G    I  G E          +     +N + +    + ++ PTR++Y +I  ++++
  S:     8 LSDMNDRSREVFRTVVESYLASGEPVGSRTLTRSLNEKVSAATVRNVMQDLEYLGLLDSPHVSAGRIPTQQGLRMFVDGLLEVEDLQARDREKIDATLGKTAGDVGGMLDRVGSALSGVTQGASLVLTPKQESEIRHIEFVSLAQDRALVVLVFSDGHVENRLFTPPPGQTPSSMREAANFLN-ALIEG--RTLSGVRRDMQKEIDARRQEIDVLAQDMIESGLAAWEEDDSEKARLI--VRGRANLLGEGGGVPEELDLIRSLFDDLERKQDIAEFLELT-----------EDGEGVRIFIGSENKLFSLSGSSLVVSPYMNSDRKIIGAVGVIGPTRLNYGRIVPIVDY 342
>gi|119478692|ref|ZP_01618571.1| Negative regulator of class I heat shock protein [marine gamma proteobacterium HTCC2143] >gi|119448373|gb|EAW29626.1| Negative regulator of class I heat shock protein [marine gamma proteobacterium HTCC2143] (284 aa)
Score = 190, Expect = 1.0e-12, Identities = 60/257 (23%), Positives = 127/257 (49%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYK-FYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQI---KSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILE 260
           +T+R + LLK +++ Y+    PVGS+ ++E+   +IS ATVR+ M+ LE LGL+   HTS+GR+P+T GY+ F +   +   I  + ++     +  D++ + ++V   S  + + +++  ++ +    ++ L++I+ + ++    +VI++ ++  +   I+H        ++       N R     +  I   I       KE +  Y     +L  + F     +      V G++ L++    +D E+LK +    E
  S:     6 VTERAQLLLKSLIQRYIREGQPVGSRSLLEESRLSISPATVRSVMSDLEDLGLVSSPHTSAGRIPTTQGYRLFVDSLITMQPITAQAIQSLETELDPDKSPT-ELVHTASQLLSTITSQAGLVTMPRPEKLSLRQIEFLPLSGNRVLVILVINEREVQNRIVHTSRQYSDIELQQATTAINQRFAGRSLSSIRQGIVMAMQQDKESIDHYMQATLDLASKAFDTEDARQDADYVVAGENQLVSATAAEDMERLKSLFSAFE 265
>gi|69935601|ref|ZP_00630537.1| Negative regulator of class I heat shock protein [Paracoccus denitrificans PD1222] >gi|119382766|ref|YP_913822.1| heat-inducible transcription repressor [Paracoccus denitrificans PD1222] >gi|119372533|gb|ABL68126.1| heat-inducible transcription repressor HrcA [Paracoccus denitrificans PD1222] (351 aa)
Score = 190, Expect = 1.1e-12, Identities = 40/163 (24%), Positives = 82/163 (50%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNI 163
           + ++  R +E+ + +VE Y+AT  PVGS+ +  +    +SAAT+RN M  LE LGLL+  H S+GR+P+  G + +     +      + +  +     D      V+++     +S  T+   + +    E  ++ I+ V +    ++V+++ +DG +   +
  S:     7 LSDLNDRSREVFRRVVEAYLATGEPVGSRTLTREMSEKLSAATIRNVMQDLELLGLLDHPHISAGRMPTQLGLRLFVDGLMEAGPVSSSDREMIEETLGDDNRDTGVMLDRVSTALSALTRGASLVLMPKQEAPVRHIEFVSLAPDRSLVVLVFADGRVENRV 169
>gi|85708633|ref|ZP_01039699.1| heat-inducible transcription repressor [Erythrobacter sp. NAP1] >gi|85690167|gb|EAQ30170.1| heat-inducible transcription repressor [Erythrobacter sp. NAP1] (346 aa)
Score = 190, Expect = 1.1e-12, Identities = 75/335 (22%), Positives = 162/335 (48%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKS-----KMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDE-----VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEK 335
           + E+TQR +E+ + +VE+Y+ +  PVGSK +      N+S A++R+ +A LE LGLL   HTS+GR+P+ AG + +     +        + ++    A+    ++  ++++  ++SE +    + +    E  L +  +V + +  A+ +++  DG +   ++   D +    +         RL    + E A    +M++ IK    + +   ++L+ER   + S     + +  V G ++LL      D E+++ +L  LE+     Q+  +  +    T I  G E     +S   ++ A    ++  +    L ++ PTR++Y+++  +++       K
  S:     6 ITELTQRAREIFRRVVEEYIDSGQPVGSKTLASDGALNLSPASIRSVLAELEGLGLLAAPHTSAGRMPTDAGLRIFVDGMMRVAEPSAEERAQIEARLAEGG-PVEQALQKTSALLSELSGAAGMVMVPTREQRLAQFSLVSLGQGRALAVLVGEDGGVENRVLDL-DPAATGSLEAASNYITSRLAGRTLAEAA---QAMRAEIKSGKSQLDDASRDLVERGLAVWSADADERPVLIVRGAANLLDEAAMGDIERVRSLLDDLENKQSVAQL-LESAREADATRIFIGAENRLFGLSGSSVI-ASPYRDMEGRVVGVLGVIGPTRLNYARVVPMVDLTARSLGK 343
>gi|74099844|gb|AAZ99130.1| HrcA [Rhizobium leguminosarum] (362 aa)
Score = 190, Expect = 1.2e-12, Identities = 69/325 (21%), Positives = 167/325 (51%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKL---RNVFADRTMS-IDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKS---------KMIKTVHGQSSLL-AVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKTKLV----MVAPTRVDYSKIKGLLEF 328
           + +R +E+ + IVE Y+ +  P+GS+ +      ++S A+VRN M+ LE+LGL+   H S+GR+P+  G +F+   F +  + D + + +    R V A+   + ++ ++ E+ +++S  ++   + I + ++ +LK ++ + +    A+ +++     +   II          ++      N  +    + E+  ++  +K  ++    E + + ++L+ER   + S         ++I  + G+++LL  +   +D ++L+ +   LE      +I     ++GS   I  G E     +  +   +     +  ++V    ++ PTR++YS+I  ++++
  S:    15 LDERSREIFRRIVEGYLESGEPLGSRNLSRLLPMSLSPASVRNVMSDLEELGLIYSPHVSAGRLPTQIGLRFFVDAFMQ--VGDLSAEERANIDRQVRAESGGNPVESMMNEASRMLSGISRGAGLVITSKSDPVLKHVEFIRLEPTKALAVLVGDHDQVENRIIELPAGVTSSQLTEAANFLNAHMSGQTLPELRKQLSRLKDDVRH---ELDALSRDLVERGIAVWSGSPDEGKPAQLI--IRGRANLLEGLAGAEDLDRLRLLFDDLEKKDSLIEI-LNLAESGSGVRIFIGSENKLFSLSGSSLIVAPYRDDDDRIVGAVGVIGPTRLNYSRIVPMVDY 349
>gi|85706901|ref|ZP_01037991.1| heat-inducible transcription repressor [Roseovarius sp. 217] >gi|85668512|gb|EAQ23383.1| heat-inducible transcription repressor [Roseovarius sp. 217] (354 aa)
Score = 190, Expect = 1.2e-12, Identities = 71/328 (21%), Positives = 152/328 (46%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVF----ADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQI-------KSKMIKTVHGQSSLLA-VPEFQDTEKLKEILQILE-STSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKT--KLVMVAPTRVDYSKIKGLLEF 328
           + ++  R +E+ + +VE Y+A  +PVGS+ +   +   +SAAT+RN M  LE +GLL   H S+GR+P+  G +     F    +   NL++  R          +  +   ++     +S  T+   + +    E  +K I+ V +    A+V+++ SDG++   I           +       N  +    + ++ T I    S+ ++++ +   + ++LI+    +         ++I  V G+++LL+   E +D E+++ +   LE    I E +       G    I   +++             +N   K    + ++ PTR++Y +I  ++++
  S:     8 LDQLNDRSREVFRRVVESYLAKGDPVGSRTLTRDFSEKVSAATIRNVMQDLEYMGLLGSPHISAGRIPTQEGLRM----FVDGLLEVSNLEVTDRQAIDATVGSNSQDVAGALDRIGAALSGVTRGASLVLAPKHEAPIKHIEFVSLGHDRALVVLVFSDGHVENRIFTPPPGQTPSSMREAANFLNALIEGKTLSDLQTVISRQISVRRQEIDQ---LARDLIDSGLAVWEGEGDHYERLI--VRGRANLLSTTAEEKDLERIRILFDDLERKRDIAEFLELADEGAGVRIFIGSENKLFSLSGSSLVVSPYMNADRKIIGAVGVIGPTRLNYGRIVPIVDY 341
>gi|167837758|ref|ZP_02464641.1| heat-inducible transcription repressor [Burkholderia thailandensis MSMB43] (340 aa)
Score = 190, Expect = 1.2e-12, Identities = 68/316 (21%), Positives = 147/316 (46%)
  Q:     7 RQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNF---SKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKS-----KMIKTVHGQSSLLAVPEF-QDTEKLKEILQIL-ESTSIWEQIAFKQNQTGSNTLITFGDE---VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKI 322
           R + LLK ++E Y+A   PVGS+ +       +S AT+RN M+ LE+LGL+   HTS+GRVP+  GY+ +         P  +D   +L    + A        V+  +  ++S  ++   + +      + K+I+ + ++ +  ++I++T +G++   +I  + D     ++      N               D ++  ++E++ +    +  L+       +     +    + G+ +LL V +   D  +L+++  +  + TS+ + +    +  G    I  G E   V  +++        +N Q    L ++ PTR+ Y+++
  S:     5 RARTLLKTLIERYIADGQPVGSRTLSRYSGLELSPATIRNVMSDLEELGLVSSPHTSAGRVPTPRGYRLFVDTMLTVESPIDSDAVTRLVQTTLQAGEPQQ--KVVAAAASVLSNLSQFAGVVLTPRRSHVFKQIEFLRLSDKRILLIIVTPEGDVQNRMIATQRDYSPAQLTEASNYINAHF-------AGLSFDEVRRRLREEIDQLRGDMTALMHAAVTASTEEPDDEETVLISGERNLLEVADLSSDMARLRKLFDVFDQKTSLLQLLDVSSHAQGVQIFI--GGESTLVPIDEMSVVTAPYEVNGQIVGTLGVIGPTRMAYNRV 322
>gi|194564159|ref|YP_002099181.1| Negative regulator of class I heat shock protein [Burkholderia dolosa AUO158] >gi|124895783|gb|EAY69663.1| Negative regulator of class I heat shock protein [Burkholderia dolosa AUO158] (384 aa)
Score = 190, Expect = 1.2e-12, Identities = 64/316 (20%), Positives = 151/316 (47%)
  Q:     7 RQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNF--SKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKT-----VHGQSSLLAVPEF-QDTEKLKEILQIL-ESTSIWEQIAFKQNQTGSNTLITFGDE---VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKI 322
           R + LLK ++E Y+A   PVGS+ +       +S AT+RN M+ LE+LGL+   HTS+GRVP+  GY+ +       +  I+ + ++ +++N           V+  +  ++S  ++   + +      + K+I+ + ++++  ++I++T +G++   ++    D     ++      N               D ++  +++++ +    +  L+       +++  T     + G+ +LL V +   D  +L+++  +  + T + + +    +  G    I  G E   V  E++        +N +    L ++ PTR+ Y+++
  S:    49 RARTLLKTLIERYIADGQPVGSRTLSRYSGLELSPATIRNVMSDLEELGLVSSPHTSAGRVPTPRGYRLFVDTMLTVETPIDAKAVERQVQNTLQPGEPP-QRVVAAAASVLSNLSQFAGVVLTPRRSHVFKQIEFMRLSEKRILLIIVTPEGDVQNRMLATPRDYSPSQLTEASNYINAHF-------AGLSFDEVRRRLRDEIDQLRGDMTALMHAAVTASTEVPDTEDTVLISGERNLLEVADLSSDMARLRKLFDVFDQKTGLLQLLDVSSHAQGVQIFI--GGESTLVPIEEMSVVTAPYEVNGKIVGTLGVIGPTRMAYNRV 366
>gi|83953084|ref|ZP_00961806.1| heat-inducible transcription repressor [Sulfitobacter sp. NAS-14.1] >gi|83842052|gb|EAP81220.1| heat-inducible transcription repressor [Sulfitobacter sp. NAS-14.1] (344 aa)
Score = 189, Expect = 1.3e-12, Identities = 69/325 (21%), Positives = 145/325 (44%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQI-----KSKMIKTVHGQSSLLAVP-EFQDTEKLKEILQILE-STSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKT--KLVMVAPTRVDYSKIKGLLEF 328
           +  R +E+ + +VE Y+A  +PVGS+ +   +   +SAAT+RN M  LE +GLL   H S+GR+P+  G + +     +     E  + K+          +  +++     +S  T+   + +    E  +K I+ V ++   A+V+++ SDG++   +           +       N  +    I E+   I      I ++ ++ + + Q+L+E    +     +S     V G+S+L+    E ++ E ++++   LE    I E +       G    I   +++             +N   K    + ++ PTR++Y +I  ++ +
  S:     1 MNDRSREVFRRVVEGYLANGDPVGSRTLTRDFSEKVSAATIRNVMQDLEYMGLLGSPHVSAGRIPTQMGLRMFVDGMIEIGDPTEMDREKIDATVGSNNADVSGILDRVGSALSGVTQGASLVLTPKHEAPIKHIEFVSLSHDRALVVLVFSDGHVENRLFTPPPGQTPSSMREAANFLNALVEGKTISELQRTIAHE---ISQRRQQIDVLAQQLVESGLALWQGEGESPERLIVRGRSNLINTEGEAENVELIRQLFDDLERKRDIAEFLELADAGDGVRIFIGSENKLFSLSGSSLVVSPYMNADRKVIGAVGVIGPTRLNYGRIVPIVNY 331
>gi|186477252|ref|YP_001858722.1| heat-inducible transcription repressor HrcA [Burkholderia phymatum STM815] >gi|184193711|gb|ACC71676.1| heat-inducible transcription repressor HrcA [Burkholderia phymatum STM815] (339 aa)
Score = 189, Expect = 1.5e-12, Identities = 66/316 (20%), Positives = 148/316 (46%)
  Q:     7 RQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNF--SKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKT-----VHGQSSLLAVPEF-QDTEKLKEILQIL-ESTSIWEQIAFKQNQTGSNTLITFGDE---VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKI 322
           R + LLK ++E Y+A   PVGS+ +       +S AT+RN M+ LE+LGL+   HTS+GR+P+  GY+ +       +P  +++ +   ++     +      V+  +  ++S  ++   + +      + K+I+ + ++ +  ++I++T +G++   I+  + D     +       N               D ++  ++E++ E    +  L+       + +  T     + G+  LL V +   D  +L+++  +  + TS+ + +    +  G    I  G E   V  E++        +N +    L ++ PTR+ Y+++
  S:     5 RAQTLLKTLIERYIAEGQPVGSRTLSRYSGLELSPATIRNVMSDLEELGLVISPHTSAGRIPTPRGYRLFVDTMLTVEPSADEDAVMRAVKTTL--QPGEPQKVVAAAASVLSNLSQFAGVILTPRRSHVFKQIEFLRLSDKRILLIIVTPEGDVQNRIMATQRDFTPSQLVEASNYINAHF-------AGLSFDEVRRRLREEIDELRGDMTTLMHAAVTASTDVTDTGETVLISGERKLLEVADLSSDMARLRKLFDVFDQKTSLLQLLDVSSHAQGVQIFI--GGESNLVPIEEMSVVTAPYEVNGKIVGTLGVIGPTRMAYNRV 321
>gi|167563988|ref|ZP_02356904.1| heat-inducible transcription repressor [Burkholderia oklahomensis EO147] >gi|167571132|ref|ZP_02364006.1| heat-inducible transcription repressor [Burkholderia oklahomensis C6786] (340 aa)
Score = 189, Expect = 1.5e-12, Identities = 68/316 (21%), Positives = 146/316 (46%)
  Q:     7 RQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNF---SKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKT-----VHGQSSLLAVPEF-QDTEKLKEILQIL-ESTSIWEQIAFKQNQTGSNTLITFGDE---VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKI 322
           R + LLK ++E Y+A   PVGS+ +       +S AT+RN M+ LE+LGL+   HTS+GRVP+  GY+ +         P   D   +L    + A        V+  +  ++S  ++   + +      + K+I+ + ++ +  ++I++T +G++   +I  + D     ++      N               D ++  ++E++ E    +  L+       ++         + G+ +LL V +   D  +L+++  +  + TS+ + +    +  G    I  G E   V  +++        +N +    L ++ PTR+ Y+++
  S:     5 RARTLLKTLIERYIADGQPVGSRTLSRYSGLELSPATIRNVMSDLEELGLVSSPHTSAGRVPTPRGYRLFVDTMLTVESPIDADAVTRLVQTTLQAGDPQQ--KVVAAAASVLSNLSQFAGVVLTPRRSHVFKQIEFLRLSDKRILLIIVTPEGDVQNRMIATQRDYTPSQLTEASNYINAHF-------AGLSFDEVRRRLREEIDELRGDMTALMHAAVTASTEEADDEDTVLISGERNLLEVADLSSDMARLRKLFDVFDQKTSLLQLLDVSSHAQGVQIFI--GGESTLVPIDEMSVVTAPYEVNGKIVGTLGVIGPTRMAYNRV 322
>gi|167358424|ref|ZP_02293080.1| heat-inducible transcription repressor HrcA [Rhizobium leguminosarum bv. trifolii WSM1325] >gi|167074788|gb|EDR78608.1| heat-inducible transcription repressor HrcA [Rhizobium leguminosarum bv. trifolii WSM1325] (362 aa)
Score = 189, Expect = 1.5e-12, Identities = 68/325 (20%), Positives = 167/325 (51%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKL---RNVFADRTMS-IDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQI---------KSKMIKTVHGQSSLL-AVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKTKLV----MVAPTRVDYSKIKGLLEF 328
           + +R +E+ + IVE Y+ +  P+GS+ +      ++S A+VRN M+ LE+LGL+   H S+GR+P+  G +F+   F +  + D + + +    R V A+   + ++ ++ E+ +++S  ++   + I + ++ +LK ++ + +    A+ +++     +   II          ++      N  +    + E+  ++  +K  ++    E + + ++L+ER   +          +++I  + G+++LL  +   +D ++L+ +   LE      +I     ++GS   I  G E     +  +   +     +  ++V    ++ PTR++YS+I  ++++
  S:    15 LDERSREIFRRIVEGYLESGEPLGSRNLSRILPMSLSPASVRNVMSDLEELGLIYSPHVSAGRLPTQIGLRFFVDAFMQ--VGDLSAEERASIDRQVRAESGGNPVESMMNEASRMLSGISRGAGLVITSKSDPVLKHVEFIRLEPTKALAVLVGDHDQVENRIIELPAGVTSSQLTEAANFLNAHMSGQTLPELRKQLSRLKDDVRH---ELDALSRDLVERGIAVWAGSPDEGKPTQLI--IRGRANLLEGLAGAEDLDRLRLLFDDLEKKDSLIEI-LNLAESGSGVRIFIGSENKLFSLSGSSLIVAPYRDDDDRIVGAVGVIGPTRLNYSRIVPMVDY 349
>gi|134294818|ref|YP_001118553.1| heat-inducible transcription repressor [Burkholderia vietnamiensis G4] >gi|166219859|sp|A4JBR5|HRCA_BURVG Heat-inducible transcription repressor hrcA >gi|134137975|gb|ABO53718.1| heat-inducible transcription repressor HrcA [Burkholderia vietnamiensis G4] (340 aa)
Score = 189, Expect = 1.6e-12, Identities = 65/316 (20%), Positives = 149/316 (47%)
  Q:     7 RQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNF--SKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKT-----VHGQSSLLAVPEF-QDTEKLKEILQIL-ESTSIWEQIAFKQNQTGSNTLITFGDE---VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKI 322
           R + LLK ++E Y+A   PVGS+ +       +S AT+RN M+ LE+LGL+   HTS+GRVP+  GY+ +       +  I+ E +  +++N           V+  +  ++S  ++   + +      + K+I+ + ++ +  ++I++T +G++   ++    D     ++      N               D ++  +++++ +    +  L+       +++  T     + G+ +LL V +   D  +L+++  +  + T + + +    +  G    I  G E   V  E++        +N +    L ++ PTR+ Y+++
  S:     5 RARTLLKTLIERYIADGQPVGSRTLSRYSGLELSPATIRNVMSDLEELGLVSSPHTSAGRVPTPRGYRLFVDTMLTVEAPIDAEAVARQVQNTLQAGEPQ-QRVVAAAASVLSNLSQFAGVVLTPRRSHVFKQIEFMRLSDKRILLIIVTPEGDVQNRMLATPRDYTPSQLTEASNYINAHF-------AGLSFDEVRRRLRDEIDQLRGDMTTLMHAAVTASTEVPDTEDTVLISGERNLLEVADLSSDMARLRKLFDVFDQKTGLLQLLDVSSHAQGVQIFI--GGESTLVPIEEMSVVTAPYEVNGKIVGTLGVIGPTRMAYNRV 322
>gi|114800305|ref|YP_761990.1| heat-inducible transcription repressor [Hyphomonas neptunium ATCC 15444] >gi|114740479|gb|ABI78604.1| heat-inducible transcription repressor HrcA [Hyphomonas neptunium ATCC 15444] (362 aa)
Score = 189, Expect = 1.6e-12, Identities = 46/168 (27%), Positives = 85/168 (50%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKD 168
           M+ + QR + + + IVE Y+AT  PVGS+  + K    +S A++RN MA L +LGLL+  H S+GR P+  G + +   F +        K ++ +  A     I+ V+ E+  I+S       +      +  ++ ++ V +    A+ +++T DG++   I+   D
  S:    11 MQRLDQRSRNIFREIVEGYLATGEPVGSRT-LSKAGIALSPASIRNVMADLTELGLLDAPHISAGRAPTHKGLRLFVDGFLEYGDPSREDKRQIDDRLAAAGTEIEAVLGEASDILSGLAGGAGLVASPARDAAVRHVEFVPLAGGDALCVLVTEDGDVENRILKVPD 177
>gi|121598498|ref|YP_991843.1| heat-inducible transcription repressor [Burkholderia mallei SAVP1] >gi|124385260|ref|YP_001027090.1| heat-inducible transcription repressor [Burkholderia mallei NCTC 10229] >gi|121227308|gb|ABM49826.1| heat-inducible transcription repressor HrcA [Burkholderia mallei SAVP1] >gi|124293280|gb|ABN02549.1| heat-inducible transcription repressor HrcA [Burkholderia mallei NCTC 10229] (385 aa)
Score = 189, Expect = 1.7e-12, Identities = 67/316 (21%), Positives = 147/316 (46%)
  Q:     7 RQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNF---SKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKS-----KMIKTVHGQSSLLAVPEF-QDTEKLKEILQIL-ESTSIWEQIAFKQNQTGSNTLITFGDE---VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKI 322
           R + LLK ++E Y+A   PVGS+ +       +S AT+RN M+ LE+LGL+   HTS+GRVP+  GY+ +         P  +D   +L    + A        V+  +  ++S  ++   + +      + K+I+ + ++ +  ++I++T +G++   +I  + D     ++      N               D ++  ++E++ +    +  L+       +     +    + G+ +LL V +   D  +L+++  +  + TS+ + +    +  G    I  G E   V  +++        +N +    L ++ PTR+ Y+++
  S:    50 RARTLLKTLIERYIADGQPVGSRTLSRYSGLELSPATIRNVMSDLEELGLVSSPHTSAGRVPTPRGYRLFVDTMLTVESPIDSDAVTRLVQTTLQAGEPQQ--RVVAAAASVLSNLSQFAGVVLTPRRSHVFKQIEFLRLSDKRILLIIVTPEGDVQNRMIATQRDYAPAQLTEASNYINAHF-------AGLSFDEVRRRLREEIDQLRGDMTALMHAAVTASTEEPDDEETVLISGERNLLEVADLSSDMARLRKLFDVFDQKTSLLQLLDVSSHAQGVQIFI--GGESTLVPIDEMSVVTAPYEVNGKIVGTLGVIGPTRMAYNRV 367
>gi|121998260|ref|YP_001003047.1| heat-inducible transcription repressor HrcA [Halorhodospira halophila SL1] >gi|121589665|gb|ABM62245.1| heat-inducible transcription repressor HrcA [Halorhodospira halophila SL1] (351 aa)
Score = 189, Expect = 1.7e-12, Identities = 67/320 (20%), Positives = 145/320 (45%)
  Q:     3 EITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNF--SKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLP-MIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIK--------TVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHE---DIVFAQTDLNINEQNKTKLVMVAPTRVDYSKI 322
           E+  R + LL+ +V  Y+ +  PVGS+ +      ++S AT+RN MA LE+LG L   HTS+GRVP+  G +FY       +P   D   +L+ R +  DR    + + + +  ++S+ T+L  ++ +      +L+ ++ + ++    + I++ ++ ++   +I  + D    ++       N       +  +   + +     +++       L EL+    ++  K +          V GQ++L+   E  D ++L+++ +          +   +        I  G E  +E    +        +  +    L ++ PTR+ Y +I
  S:     8 ELGDRARILLRTLVRRYIDSGRPVGSRSLARDAGLSVSPATIRNVMADLEELGYLVAPHTSAGRVPTDRGLRFYVDCLLQVQPIGGDTVERLRQR-LARDRDEGAEELADSASDLLSQLTRLAGVVTLPRCDWAVLRHVEFLPLSDCRVLAILVINERDVQNRVIRTERDFSEAELQRIANYLNAEFAGLELPRVRQSLLAAMQADQQR-------LDELMRSAVEVGEKALAEEQDDEGYVVAGQTNLMEFEELSDVDRLRQLFEAFTQKRDILHL-LDRCARADGVQIYIGQEAGYEVFDGLSLVTARYGVAGEAAGVLGVIGPTRMAYDRI 332
>gi|84514910|ref|ZP_01002273.1| heat-inducible transcription repressor [Loktanella vestfoldensis SKA53] >gi|84511069|gb|EAQ07523.1| heat-inducible transcription repressor [Loktanella vestfoldensis SKA53] (366 aa)
Score = 188, Expect = 1.8e-12, Identities = 83/328 (25%), Positives = 153/328 (46%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMS---IDVV--IEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQI-----KSKMIKTVHGQSSLLAVPEFQ-DTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDE-----VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEF 328
           + ++  R +E+ + +VE Y+ +  PVGS+ +       +SAAT+RN M  LE LGLL   H S+GRVP+  G +     F    +   +L  K R    D+TM     DVV  +++  + +S  T    + +    E  +K I+ V +NK  A+V+++ +DG++   I           +       N       + E+   I      IK + +E + +  EL++    +     +S     V G+ +LL   E + D E+++ +   LE      Q      Q G    I  G E     ++   +V +   +N + +    + ++ PTR++Y +I  ++ +
  S:    20 ITQMNDRSREVFRRVVEGYLESGAPVGSRSLTRTLSEKVSAATIRNVMQDLEYLGLLGSPHVSAGRVPTQLGLRM----FVDGLLEIGDLDGKDRQAI-DQTMQSADSDVVTMLDQVGQALSGVTHGASLVLTPKHEAAIKHIEFVSLNKDRALVVLVFADGHVENRIFTPPPGQTPSSMREAANFLNAIAEGHTLSELGQVILRE---IKARRREIDTLAAELVQSGLALWENEGESTERLIVRGRGNLLTDNENEGDLERIRSLFDDLERKRDIAQF-LDLAQDGDGVRIFIGSENKLFSLTGSSLVVSPY-MNADRKIIGAVGVIGPTRLNYGRIVPIVNY 353
>gi|83747233|ref|ZP_00944275.1| HrcA [Ralstonia solanacearum UW551] >gi|83726057|gb|EAP73193.1| HrcA [Ralstonia solanacearum UW551] (466 aa)
Score = 188, Expect = 1.9e-12, Identities = 69/319 (21%), Positives = 148/319 (46%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSK--------PYINDENLKLKLRNVFADR---------TMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIK-----TVHGQSSLLAVPEFQDT-EKLKEILQILES-TSIWEQIAFKQNQTGSNTLITFGDE---VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKI 322
           + +R   LLK ++E Y+A   PVGS+ + +    ++S AT+RN M+ LE++G +   HTS+GRVP+  GY+ +              PY   + +  ++    A++         + S   VI  + + +S  ++   I +        ++I+ + +++   ++IV+T +G++   IIH         +       N               D+++  ++ ++   +  +  L++   +  S  +       + G+  LL V +   + +KL+ +  + E  T + + +       G    I  G E   V HED+        ++ +    L ++ P R+ Y ++
  S:   115 MDKRATILLKTLIERYIAEGQPVGSRTLSKYSGLDLSPATIRNVMSDLEEMGFIASPHTSAGRVPTPRGYRLFVDTMLTASPLDTLGPY---DRMAQQIAGTIAEQVRAQLASHGSESSQRVIAAAAQTLSNLSQFAGIVMTPRRTHAFRQIEFLRLSETRILLIVVTPEGDVQNRIIHTDTPYTPSQLVEAANYINAHY-------GGMTFDAVRERLRGELNALQADMTSLMQAAVEAGSSAVSDEEPVVISGERKLLEVEDLSSSMDKLRRLFAVFEQKTGLLQLLDVSSRAEGVQIFI--GGESSLVPHEDMAVITAPYEVDGKIVGTLGVIGPMRMAYERV 448
>gi|124268517|ref|YP_001022521.1| heat-inducible transcription repressor [Methylibium petroleiphilum PM1] >gi|124261292|gb|ABM96286.1| heat-inducible transcription repressor HrcA [Methylibium petroleiphilum PM1] (342 aa)
Score = 188, Expect = 2.1e-12, Identities = 74/319 (23%), Positives = 149/319 (46%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNF--SKPY---INDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRL----IDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIK------TVHGQSSLLAVPEF-QDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDE---VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKI 322
           + +R K LLK +VE Y+A   PVGS+ +       +S AT+RN MA LE+LGL+   HTS+GR+P+  GY+ +      ++P     ++  L      +  D+      VI  + +++S  ++   +        +   I+ + + ++  +VI+++ DG++   +I    D    ++       N       I+   + + T+ID+++          E  L  L++   Q  S+          V G+ +LL + +F  D   L+++  + E  +   ++    +       I  G E   V  E++        ++ +    L ++ PTR+ Y ++
  S:     2 LDERAKTLLKTLVERYIADGQPVGSRTLSRASGLELSPATIRNVMADLEELGLIASPHTSAGRIPTARGYRLFVDTMLTARPLDMARSEPGLAAAQEQLQPDQPQR---VITHAAQVLSNLSQFVGVVTAPRKAGVFHHIEFMRLGERRVLVILVSPDGDVQNRVIFTARDHSPAELVEASNFINAHYSGLSIEAVRERLKTEIDALRG---------EIAL--LMQAAVQFGSEAADGENEQVVVSGERNLLTMQDFSSDMGSLRKLFDLFEQKTQLMRL-LDVSSRAEGVRIYIGGESQIVPFEELSVVSAPYEVDGKIVGTLGVIGPTRMAYDRM 324
>gi|53720440|ref|YP_109426.1| heat-inducible transcription repressor [Burkholderia pseudomallei K96243] >gi|53726221|ref|YP_103890.1| heat-inducible transcription repressor [Burkholderia mallei ATCC 23344] >gi|76810660|ref|YP_334698.1| heat-inducible transcription repressor [Burkholderia pseudomallei 1710b] >gi|126441063|ref|YP_001060295.1| heat-inducible transcription repressor [Burkholderia pseudomallei 668] >gi|126451351|ref|YP_001081741.1| heat-inducible transcription repressor [Burkholderia mallei NCTC 10247] >gi|126455393|ref|YP_001067554.1| heat-inducible transcription repressor [Burkholderia pseudomallei 1106a] >gi|161357014|ref|ZP_02102891.1| heat-inducible transcription repressor [Burkholderia pseudomallei 1106b] >gi|166998818|ref|ZP_02264670.1| heat-inducible transcription repressor [Burkholderia mallei PRL-20] >gi|167721079|ref|ZP_02404315.1| heat-inducible transcription repressor [Burkholderia pseudomallei DM98] >gi|167740052|ref|ZP_02412826.1| heat-inducible transcription repressor [Burkholderia pseudomallei 14] >gi|167817268|ref|ZP_02448948.1| heat-inducible transcription repressor [Burkholderia pseudomallei 91] >gi|167825678|ref|ZP_02457149.1| heat-inducible transcription repressor [Burkholderia pseudomallei 9] >gi|167847166|ref|ZP_02472674.1| heat-inducible transcription repressor [Burkholderia pseudomallei B7210] >gi|167895749|ref|ZP_02483151.1| heat-inducible transcription repressor [Burkholderia pseudomallei 7894] >gi|167904140|ref|ZP_02491345.1| heat-inducible transcription repressor [Burkholderia pseudomallei NCTC 13177] >gi|167912399|ref|ZP_02499490.1| heat-inducible transcription repressor [Burkholderia pseudomallei 112] >gi|167920353|ref|ZP_02507444.1| heat-inducible transcription repressor [Burkholderia pseudomallei BCC215] >gi|194318195|ref|YP_002014159.1| heat-inducible transcription repressor HrcA [Burkholderia mallei ATCC 10399] >gi|194505406|ref|YP_002034977.1| heat-inducible transcription repressor HrcA [Burkholderia pseudomallei 1655] >gi|194507308|ref|YP_002019846.1| heat-inducible transcription repressor HrcA [Burkholderia pseudomallei Pasteur 52237] >gi|194569451|ref|YP_002104454.1| heat-inducible transcription repressor HrcA [Burkholderia pseudomallei 406e] >gi|194577598|ref|YP_002112477.1| heat-inducible transcription repressor HrcA [Burkholderia mallei 2002721280] >gi|123598094|sp|Q3JP05|HRCA_BURP1 Heat-inducible transcription repressor hrcA >gi|166219856|sp|A3MNA5|HRCA_BURM7 Heat-inducible transcription repressor hrcA >gi|166219857|sp|A3NYY3|HRCA_BURP0 Heat-inducible transcription repressor hrcA >gi|166219858|sp|A3ND74|HRCA_BURP6 Heat-inducible transcription repressor hrcA >gi|61213343|sp|Q62HD0|HRCA_BURMA Heat-inducible transcription repressor hrcA >gi|61213353|sp|Q63R42|HRCA_BURPS Heat-inducible transcription repressor hrcA >gi|52210854|emb|CAH36842.1| putative heat-inducible transcription repressor [Burkholderia pseudomallei K96243] >gi|52429644|gb|AAU50237.1| heat-inducible transcription repressor HrcA [Burkholderia mallei ATCC 23344] >gi|76580113|gb|ABA49588.1| heat-inducible transcription repressor HrcA [Burkholderia pseudomallei 1710b] >gi|126220556|gb|ABN84062.1| heat-inducible transcription repressor HrcA [Burkholderia pseudomallei 668] >gi|126229035|gb|ABN92575.1| heat-inducible transcription repressor HrcA [Burkholderia pseudomallei 1106a] >gi|126244221|gb|ABO07314.1| heat-inducible transcription repressor HrcA [Burkholderia mallei NCTC 10247] >gi|148024896|gb|EDK83074.1| heat-inducible transcription repressor HrcA [Burkholderia mallei 2002721280] >gi|157808957|gb|EDO86127.1| heat-inducible transcription repressor HrcA [Burkholderia pseudomallei 406e] >gi|157939260|gb|EDO94930.1| heat-inducible transcription repressor HrcA [Burkholderia pseudomallei Pasteur 52237] >gi|160694808|gb|EDP84816.1| heat-inducible transcription repressor HrcA [Burkholderia mallei ATCC 10399] >gi|184211293|gb|EDU08336.1| heat-inducible transcription repressor HrcA [Burkholderia pseudomallei 1655] (340 aa)
Score = 187, Expect = 2.4e-12, Identities = 67/316 (21%), Positives = 147/316 (46%)
  Q:     7 RQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNF---SKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKS-----KMIKTVHGQSSLLAVPEF-QDTEKLKEILQIL-ESTSIWEQIAFKQNQTGSNTLITFGDE---VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKI 322
           R + LLK ++E Y+A   PVGS+ +       +S AT+RN M+ LE+LGL+   HTS+GRVP+  GY+ +         P  +D   +L    + A        V+  +  ++S  ++   + +      + K+I+ + ++ +  ++I++T +G++   +I  + D     ++      N               D ++  ++E++ +    +  L+       +     +    + G+ +LL V +   D  +L+++  +  + TS+ + +    +  G    I  G E   V  +++        +N +    L ++ PTR+ Y+++
  S:     5 RARTLLKTLIERYIADGQPVGSRTLSRYSGLELSPATIRNVMSDLEELGLVSSPHTSAGRVPTPRGYRLFVDTMLTVESPIDSDAVTRLVQTTLQAGEPQQ--RVVAAAASVLSNLSQFAGVVLTPRRSHVFKQIEFLRLSDKRILLIIVTPEGDVQNRMIATQRDYAPAQLTEASNYINAHF-------AGLSFDEVRRRLREEIDQLRGDMTALMHAAVTASTEEPDDEETVLISGERNLLEVADLSSDMARLRKLFDVFDQKTSLLQLLDVSSHAQGVQIFI--GGESTLVPIDEMSVVTAPYEVNGKIVGTLGVIGPTRMAYNRV 322
>gi|163742619|ref|ZP_02150005.1| heat-inducible transcription repressor [Phaeobacter gallaeciensis 2.10] >gi|161384204|gb|EDQ08587.1| heat-inducible transcription repressor [Phaeobacter gallaeciensis 2.10] (358 aa)
Score = 187, Expect = 2.5e-12, Identities = 48/163 (29%), Positives = 88/163 (53%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTM---------SIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNI 163
           +K++  R +++ + +VE Y+ T +PVGS+ +       +SAATVRN M  LE LGLL   HTS+GRVP+  G + +     +  + D N + + R    D TM          +  +++     +S  T+   + +    E  ++ I+ V +    A+V+++ SDG++   +
  S:     8 LKDMNDRSRDVFRAVVESYLETGDPVGSRTLTRSLNEKVSAATVRNVMQDLEHLGLLNSPHTSAGRVPTQVGLRMFVDGLLE--VGDLNTQDRQR---IDETMGGTAGGGSAGLAGMLDRVGSALSGVTQGASLVLTPKHEAEIRHIEFVTLAHDRALVVLVFSDGHVENRL 174
>gi|126738496|ref|ZP_01754201.1| heat-inducible transcription repressor [Roseobacter sp. SK209-2-6] >gi|126720295|gb|EBA17001.1| heat-inducible transcription repressor [Roseobacter sp. SK209-2-6] (354 aa)
Score = 187, Expect = 2.8e-12, Identities = 78/328 (23%), Positives = 158/328 (48%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIH---FKDDSILKDISICIRIF-NDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQI-------KSKMIKTVHGQSSLLA---VPE--------FQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDE----VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEF 328
           + ++  R +E+ + +VE Y+ +  PVGS+ +       +SAATVRN M  LE LGLL   H S+GRVP+  G + +     +    +   + K+          +  +++     +S  T+   + +    E  ++ I+ V +    A+V+++ SDG +   +      +  S +++ +  +  F   R +    K+I  +I+       ++ +E + + Q++IE            ++++I  V G+S+LLA   VPE        F D E+ ++I + LE T           + G    I  G E          +     +N + +    + ++ PTR++Y +I  ++++
  S:     8 LSDLNDRSREVFRTVVESYLESGEPVGSRTLTRSLSEKVSAATVRNVMQDLEFLGLLNSPHVSAGRVPTQRGLRMFVDGLLEVEDLNRQDQQKIDATLGQNAGDVGGMLDRIGAALSGVTQGASLVLTPKQESEIRHIEFVSLAADRALVVLVFSDGRVENRLFTPPPGQTPSSMREAANFLNAFIEGRTLGGLRKDILKEIE-------DRRQEIDVLAQDMIESGLAAWEDNGNDQARLI--VRGRSNLLAESGVPEELDLIRNLFDDLERKQDIAEFLELT-----------EEGDGVRIFIGSENKLFSLSGSSLVVSPYMNSDRKIIGAVGVIGPTRLNYGRIVPIVDY 341
>gi|120603207|ref|YP_967607.1| heat-inducible transcription repressor HrcA [Desulfovibrio vulgaris subsp. vulgaris DP4] >gi|166220391|sp|A1VFG4|HRCA_DESVV Heat-inducible transcription repressor hrcA >gi|120563436|gb|ABM29180.1| heat-inducible transcription repressor HrcA [Desulfovibrio vulgaris subsp. vulgaris DP4] (355 aa)
Score = 186, Expect = 3.0e-12, Identities = 41/173 (23%), Positives = 85/173 (49%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISE-STKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDG----NLTKNIIHFKDDSILK 173
           M  +  R+  +L  I+E Y+ +A PVGS+ V  +    +S A++RN M+ L  +G LE+ HTS+GR+P+   ++ Y     +     +   L +          +  ++  +  ++SE + ++ M+      E  L+ +D V   +   + +++   G     L ++  HF  D +++
  S:     1 MSALGSRETHVLTTIIESYITSAAPVGSRTVSRRSGLALSPASMRNTMSDLTDMGFLEQPHTSAGRIPTPKAFRLYVDALLRQSARRDEAPLHMVEALHGHEPEVGALLRRASNLVSEHARQVSMVLAPGPAEARLRSLDFVPAGEGLVLAVLVLEGGMVRTRLVRDDTHFGSDELVR 178
>gi|114762204|ref|ZP_01441672.1| heat-inducible transcription repressor [Roseovarius sp. HTCC2601] >gi|114545228|gb|EAU48231.1| heat-inducible transcription repressor [Roseovarius sp. HTCC2601] (354 aa)
Score = 186, Expect = 3.0e-12, Identities = 73/326 (22%), Positives = 145/326 (44%)
  Q:     3 EITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQI-------KSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIA--FKQNQTGSNTLITFGDE----VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEF 328
           E+  R +E+ + +VE Y+    PVGS+ +       +SAAT+RN M  LE LGLL+  H S+GR+P+  G + +     +    D + + KL          +  +++     +S  T    + +    E  +K I+ V +    A+V+++ +DG++   +           +       N  +    + E+      M   IK + +E + +  +LIE             +++I  V G+++LL      +TE+L  I  + +       IA   +  +TG    I  G E          +     +N + +    + ++ PTR++Y +I  ++++
  S:    10 EMNDRSREVFRKVVESYLEFGEPVGSRTLTRSLSEKVSAATIRNVMQDLEYLGLLDSPHVSAGRIPTQLGLRMFVDGLLEVRDLDLSDREKLDATLGPGGDDMGGILDRVGSALSGVTHGASLVLTPKHEAPIKHIEFVSLGHDRALVVLVFADGHVENRLFRPPPGQTPSSMREAANFLNALIEGKTLSELR---GVMAEQIKHRRQEIDTLAADLIEAGIATWESDADNSARLI--VRGRANLLGTE--AETEELDRIRSLFDDLERKRDIAEFLELAETGDGVRIFIGSENKLFSLSGSSLVVSPYMNADRKIIGAVGVIGPTRLNYGRIVPIVDY 341
>gi|46579226|ref|YP_010034.1| heat-inducible transcription repressor HrcA [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] >gi|61213495|sp|Q72DW6|HRCA_DESVH Heat-inducible transcription repressor hrcA >gi|46448639|gb|AAS95293.1| heat-inducible transcription repressor HrcA [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] (355 aa)
Score = 186, Expect = 3.0e-12, Identities = 41/173 (23%), Positives = 85/173 (49%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISE-STKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDG----NLTKNIIHFKDDSILK 173
           M  +  R+  +L  I+E Y+ +A PVGS+ V  +    +S A++RN M+ L  +G LE+ HTS+GR+P+   ++ Y     +     +   L +          +  ++  +  ++SE + ++ M+      E  L+ +D V   +   + +++   G     L ++  HF  D +++
  S:     1 MSALGSRETHVLTTIIESYITSAAPVGSRTVSRRSGLALSPASMRNTMSDLTDMGFLEQPHTSAGRIPTPKAFRLYVDALLRQSARRDEAPLHMVEALHGHEPEVGALLRRASNLVSEHARQVSMVLAPGPAEARLRSLDFVPAGEGLVLAVLVLEGGMVRTRLVRDDTHFGSDELVR 178
>gi|77166265|ref|YP_344790.1| negative regulator of class I heat shock protein [Nitrosococcus oceani ATCC 19707] >gi|76884579|gb|ABA59260.1| heat-inducible transcription repressor HrcA [Nitrosococcus oceani ATCC 19707] (349 aa)
Score = 186, Expect = 3.2e-12, Identities = 48/162 (29%), Positives = 89/162 (54%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIE--------ESCKIISESTKLPMIKIENNTEV-LLKRIDMVEINKQSAMVIVITSDGNLTKNIIH 165
           + +R + LLK +VE Y+    PVGS+ +  +   ++S AT+RN MA LE+LGL+   HTS+GRVP+  GY+F+     +P         K   V A R + I   +E         +  ++SE ++   + +    E   L++++ + +++   + I++ ++  +   IIH
  S:    10 LNERSQHLLKAMVECYIRDGEPVGSRTLSRESQLDLSPATIRNVMADLEELGLVFSPHTSAGRVPTVQGYRFFIDALLRP---------KQLGVTAIRELEIQFDVEAEPRALLTTASHLLSEISRFAGVVMLPRRECRALRQVEFLPLSENRVLAILVLNEQEVQNRIIH 171
>gi|56694937|ref|YP_165282.1| heat-inducible transcription repressor [Silicibacter pomeroyi DSS-3] >gi|56676674|gb|AAV93340.1| heat-inducible transcription repressor HrcA [Silicibacter pomeroyi DSS-3] (354 aa)
Score = 186, Expect = 3.3e-12, Identities = 69/328 (21%), Positives = 152/328 (46%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIE-------RIFQIKSKMIKTVHGQSSLL-AVPEFQDTEKLKEILQILE-STSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKT--KLVMVAPTRVDYSKIKGLLEF 328
           + ++  R +E+ + IVE Y+ +  PVGS+ +       +SAATVRN M  LE LGLL+  H S+GR+P+  G + +     +      + + KL          +   ++     +S  T+   + +    E  ++ I+ V + +  A+V+++ SDG++   +           +       N  +    + E+      M++ I  + +E + + ++++E       R  +  +++I  V G+++LL    + Q+ E+++ +   LE    I E +   ++  G    I   +++             +N   K    + ++ PTR++Y +I  ++++
  S:     8 LDDLNDRSREVFRLIVESYLDSGEPVGSRTLTRTLSEKVSAATVRNVMQDLEFLGLLDSPHISAGRIPTQMGLRMFVDGLLEVADLSLDDRAKLDATLGTNAGDVGGTLDRISATLSRVTQGASLVLTPKHEAEIRHIEFVSLAQDRALVVLVFSDGHVENRLFAPPPGQTPSSMREAANFLNALIEGKTLSEVRR---LMQTEIGARQQEIDQLARQMVESGLAVWDREGEEAARLI--VRGRANLLEGTGQEQELERIRVLFDDLERKRDIAEFLQLTEDGEGVRIFIGSENKLFSLSGSSLVVSPYMNADRKVIGAVGVIGPTRLNYGRIVPIVDY 341
>gi|116619860|ref|YP_822016.1| heat-inducible transcription repressor HrcA [Solibacter usitatus Ellin6076] >gi|116223022|gb|ABJ81731.1| heat-inducible transcription repressor HrcA [Solibacter usitatus Ellin6076] (345 aa)
Score = 186, Expect = 3.3e-12, Identities = 70/316 (22%), Positives = 150/316 (47%)
  Q:     7 RQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFS--------KPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKD-ISIC---IRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTS-IWEQIAFKQNQTGSNTLITFGDEVSH---EDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKI 322
           R +E+L  IV  Y+ T  PVGS+ + +     +S A++RN MA L   G L + HTS+GR+P+   ++FY ++ +           IN+E   L   +    R      ++ E  K +  +  +P +  E      L +I +V ++ +  +++++T D  +   ++   + +  ++ ISIC    R F+   +    +E+  +I   + +    + + + + Q   + + +I +     + G S+LL +      E+++E+   LE    + E +     Q      +  G E +H   +D+      + +      K+ ++ P R++Y ++
  S:    10 RYQEILTSIVRAYIDTGEPVGSRTISKLRQNTLSPASIRNVMADLADEGYLSQPHTSAGRIPTEKAFRFYVRSLTAGRFGTGESERINNEFRGL---DTVGQRVERSSYILVELTKNVGIAAAIPELAQE------LDQIQLVPLSDRRVLMVLVTRDHMVRNRVVMLDEPTSPEELISICNFVNRNFSGWQLGKARRELLNRIAQEREMYHAVLHKLQMLYQ---KGLLEIDTSPEVHMEGASNLLGLDLHLTRERMRELFHALEEKQRVIELLDRFLEQPPGELAVHVGLEKAHPAMKDLALIGMTIRMASGLPAKVAVLGPMRMNYERV 329
>gi|116250150|ref|YP_765988.1| heat-inducible transcription repressor [Rhizobium leguminosarum bv. viciae 3841] >gi|166220401|sp|Q1MMD0|HRCA_RHIL3 Heat-inducible transcription repressor hrcA >gi|115254798|emb|CAK05872.1| putative heat-inducible transcriptional regulator [Rhizobium leguminosarum bv. viciae 3841] (362 aa)
Score = 186, Expect = 3.4e-12, Identities = 68/325 (20%), Positives = 164/325 (50%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSID-------------VVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQI---------KSKMIKTVHGQSSLL-AVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKTKLV----MVAPTRVDYSKIKGLLEF 328
           + +R +E+ + IVE Y+ +  P+GS+ +      ++S A+VRN M+ LE+LGL+   H S+GR+P+  G +F+   F           +++ ++ A+   SID              ++ E+ +++S  ++   + I + ++ +LK ++ + +    A+ +++     +   II          ++      N  +    + E+  ++  +K  ++    E + + ++L+ER   +          +++I  + G+++LL  +   +D ++L+ +   LE      +I     ++GS   I  G E     +  +   +     +  ++V    ++ PTR++YS+I  ++++
  S:    15 LDERSREIFRRIVEGYLESGEPLGSRNLSRILPMSLSPASVRNVMSDLEELGLIYSPHVSAGRLPTQIGLRFFVDAF-----------MQVGDLSAEERASIDRQVRVESGGNPVESMMNEASRMLSGISRGAGLVITSKSDPVLKHVEFIRLEPTKALAVLVGDHDQVENRIIELPAGVTSSQLTEAANFLNAHMSGQTLPELRKQLSRLKDDVRH---ELDALSRDLVERGIAVWAGSPDEGKPTQLI--IRGRANLLEGLAGAEDLDRLRLLFDDLEKKDSLIEI-LNLAESGSGVRIFIGSENKLFSLSGSSLIVAPYRDDDDRIVGAVGVIGPTRLNYSRIVPMVDY 349
>gi|115350693|ref|YP_772532.1| heat-inducible transcription repressor [Burkholderia ambifaria AMMD] >gi|172059723|ref|YP_001807375.1| heat-inducible transcription repressor HrcA [Burkholderia ambifaria MC40-6] >gi|122323954|sp|Q0BI25|HRCA_BURCM Heat-inducible transcription repressor hrcA >gi|115280681|gb|ABI86198.1| heat-inducible transcription repressor HrcA [Burkholderia ambifaria AMMD] >gi|171992240|gb|ACB63159.1| heat-inducible transcription repressor HrcA [Burkholderia ambifaria MC40-6] (340 aa)
Score = 186, Expect = 3.7e-12, Identities = 65/316 (20%), Positives = 149/316 (47%)
  Q:     7 RQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNF--SKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKT-----VHGQSSLLAVPEF-QDTEKLKEILQIL-ESTSIWEQIAFKQNQTGSNTLITFGDE---VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKI 322
           R + LLK ++E Y+A   PVGS+ +       +S AT+RN M+ LE+LGL+   HTS+GRVP+  GY+ +       +  I+ E +  ++++           V+  +  ++S  ++   + +      + K+I+ + ++ +  ++I++T +G++   ++    D     ++      N               D ++  +++++ +    +  L+       +++  T     + G+ +LL V +   D  +L+++  +  + T + + +    +  G    I  G E   V  E++        +N Q    L ++ PTR+ Y+++
  S:     5 RARTLLKTLIERYIADGQPVGSRTLSRYSGLELSPATIRNVMSDLEELGLVSSPHTSAGRVPTPRGYRLFVDTMLTVETPIDAEAVARQVQHTLQAGEPQ-QRVVAAAASVLSNLSQFAGVVLTPRRSHVFKQIEFMRLSDKRILLIIVTPEGDVQNRMLATPRDYSPSQLTEASNYINAHF-------AGLSFDEVRRRLRDEIDQLRGDMTTLMHAAVTASTEVPDTEDTVLISGERNLLEVADLSSDMARLRKLFDVFDQKTGLLQLLDVSSHAQGVQIFI--GGESTLVPIEEMSVVTAPYEVNGQIVGTLGVIGPTRMAYNRV 322
>gi|33593487|ref|NP_881131.1| heat-inducible transcription repressor [Bordetella pertussis Tohama I] >gi|33598007|ref|NP_885650.1| heat-inducible transcription repressor [Bordetella parapertussis 12822] >gi|33602913|ref|NP_890473.1| heat-inducible transcription repressor [Bordetella bronchiseptica RB50] >gi|46576476|sp|Q7VVX7|HRCA_BORPE Heat-inducible transcription repressor hrcA >gi|46576485|sp|Q7W514|HRCA_BORPA Heat-inducible transcription repressor hrcA >gi|46576493|sp|Q7WGH9|HRCA_BORBR Heat-inducible transcription repressor hrcA >gi|33568544|emb|CAE34302.1| heat-inducible transcription repressor [Bordetella bronchiseptica RB50] >gi|33572843|emb|CAE42776.1| heat-inducible transcription repressor [Bordetella pertussis Tohama I] >gi|33574436|emb|CAE38774.1| heat-inducible transcription repressor [Bordetella parapertussis] (334 aa)
Score = 185, Expect = 3.8e-12, Identities = 69/316 (21%), Positives = 149/316 (47%)
  Q:     7 RQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEES------CKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIK---------TVHGQSSLLAVPEF-QDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDE--VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKI 322
           R + LLK ++E Y+A   PVGS+ + + +  ++S AT+RN MA LE+LGL+   HTS+GRVP+  GY+ +          D  L ++           +  V E S        ++S  T+   + +      + ++I+ + ++ +  ++I++T +G++   I+  + D    ++      FN       +       D+++  +  ++ +    L++ I R+ Q   +             + G+  LL V +   D ++L+++  + E  +   Q+    ++     +   GD   V  E++        ++ +    L ++ PTR+ Y ++
  S:     4 RARALLKALIERYIADGQPVGSRTLSKVF--DLSPATIRNVMADLEELGLIHSPHTSAGRVPTPRGYRMFV---------DSLLAVRAYQFEPAHIGELLPVSEPSRAVNAAAALLSNLTQFAGVVLTPKRTQIFRQIEFIRLSDKRVLLIIVTPEGDVQNRILSAQRDYTEAELLEAGNFFN-------VHFSGKSFDAVRRTLSTELAQ----LRDDISRLMQAAVEAGAEAADDGEAVVISGERKLLDVTDIASDMDRLRKMFSLFEKKTDLLQLLDVSSRAQGVQIYIGGDSQLVPMEEVSVITAPYGVDGKVIGTLGVIGPTRMAYERV 315
>gi|126734416|ref|ZP_01750163.1| heat-inducible transcription repressor HrcA, putative [Roseobacter sp. CCS2] >gi|126717282|gb|EBA14146.1| heat-inducible transcription repressor HrcA, putative [Roseobacter sp. CCS2] (354 aa)
Score = 185, Expect = 4.6e-12, Identities = 48/163 (29%), Positives = 87/163 (53%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMS-----IDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNI 163
           + E+  R +E+ + +VE Y+ +  PVGS+ +   +   ISAAT+RN M  LE LGL+   H S+GR+P+  G +     F    +   +L  K R    DRT++     +  V+++    +S  T    + +    E  +K I+ V +++  A+V+++  DG++   I
  S:     8 IDEMNTRSREVFRRVVEGYLESGAPVGSRTLTRDFSEKISAATIRNVMQDLEFLGLVGSPHVSAGRIPTQLGLRM----FVDGLLEVGDLDGKDRETI-DRTLTTNDQDVTSVLDQVGTALSGVTHGASLVLTPKHEAPIKHIEFVSLSQDRALVVLVFGDGHVENRI 170
>gi|149184526|ref|ZP_01862844.1| heat-inducible transcription repressor [Erythrobacter sp. SD-21] >gi|148831846|gb|EDL50279.1| heat-inducible transcription repressor [Erythrobacter sp. SD-21] (347 aa)
Score = 185, Expect = 4.9e-12, Identities = 68/335 (20%), Positives = 164/335 (48%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEK---NFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIAT----KIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIA-FKQNQTGSNTLITFGDEVSHEDIVFAQTDLNI------NEQNKTKLVM--VAPTRVDYSKIKGLLEFIKNEFEK 335
           + +++ R +E+ + +VE Y+ + +PVGSK +  +   N+S A++R+ +A LE+ GLL   HTS+GR+P+ +G + +       ++P    E   ++ R         I+  +E++  ++S+ +    + +    E  L ++ +  ++    + +++  DG +   I+    +++   +         +     + E A     +I S +S + E  +  + V + +         + +  V GQ++LL      D ++++ +L  LE+    + +A   +N   +  +  F   +  E+ +F+ +  ++      + Q K   V+  + PTR++Y+++  +++F      K
  S:     6 LTDMSDRAREIFRLVVEGYLESGSPVGSKALAGEGTVNLSPASIRSVLAELEQRGLLAAPHTSAGRMPTDSGLRLFVDAMMQVAEP-TAQERAAIEQR---IGHPGPIERALEQTSALLSDLSGAAGMVMVPRREPRLAQVSLTALDANRVLAVLVGEDGQVENRILALPAEALGTSLEQASNFLTAKAAGRTLAEAAVLVEREIASERSALDEASR--DIVARGIAMWSEDASHRPVLIVRGQANLLDESALADIDRVRSLLDDLENK---QSVATLLENAREAEAMRIF---IGSENRLFSLSGSSVIAAPYRDAQGKVVGVLGVIGPTRLNYARVVPMVDFTARSLGK 344
>gi|148260660|ref|YP_001234787.1| heat-inducible transcription repressor [Acidiphilium cryptum JF-5] >gi|146402341|gb|ABQ30868.1| heat-inducible transcription repressor HrcA [Acidiphilium cryptum JF-5] (367 aa)
Score = 184, Expect = 5.0e-12, Identities = 47/161 (29%), Positives = 85/161 (52%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYK-FYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNII 164
           + +R   +L+ IVE YV T  PVGS+ +       +S AT+RN MA L   GLL   H S+GR+P+  G + F +       ++DE  + ++    A    SI   + E+  ++S  ++   I +   +E  +K I+ V ++   A+V+++++DG +   +I
  S:    28 LDERSAAVLREIVEQYVETGEPVGSRTLSRLLPMGLSPATIRNVMADLTDAGLLFSPHISAGRLPTERGLRLFVDGLLHFGELSDEE-RERIEAALAQSGRSIQDTLTEASALLSGLSQAAGIVLAPKSEGAVKHIEFVPLSSGRALVVLVSADGQVENRVI 188
>gi|87301849|ref|ZP_01084683.1| Negative regulator of class I heat shock protein [Synechococcus sp. WH 5701] >gi|87283417|gb|EAQ75372.1| Negative regulator of class I heat shock protein [Synechococcus sp. WH 5701] (333 aa)
Score = 184, Expect = 6.3e-12, Identities = 35/76 (46%), Positives = 50/76 (65%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFY 76
           M  +  RQ+++L+  V  YV T  PVGS+ +I ++    SAATVR+ M  LE+ GLL + HTS+GR+PS  GY+ Y
  S:     1 MNALPHRQQQVLQATVHHYVDTMEPVGSRTLIRRFGLPASAATVRSTMGALEQRGLLLQPHTSAGRIPSQQGYRLY 76
>gi|160944954|ref|ZP_02092180.1| hypothetical protein FAEPRAM212_02469 [Faecalibacterium prausnitzii M21/2] >gi|158442685|gb|EDP19690.1| hypothetical protein FAEPRAM212_02469 [Faecalibacterium prausnitzii M21/2] (371 aa)
Score = 183, Expect = 7.3e-12, Identities = 36/74 (48%), Positives = 50/74 (67%)
  Q:     7 RQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNF 80
           R++ +L+ IV  Y     PVGS V+   +   +S+AT+RN+MA L KLGLLE+ HTS+GRVPS  GY++Y  N 
  S:    20 RKQRVLQAIVALYGLEGEPVGSSVLANYFDMAVSSATLRNEMAALTKLGLLEQPHTSAGRVPSAKGYRYYLDNL 93
>gi|91781879|ref|YP_557085.1| heat-inducible transcription repressor [Burkholderia xenovorans LB400] >gi|122970700|sp|Q145F6|HRCA_BURXL Heat-inducible transcription repressor hrcA >gi|91685833|gb|ABE29033.1| heat-inducible transcription repressor HrcA [Burkholderia xenovorans LB400] (339 aa)
Score = 183, Expect = 7.4e-12, Identities = 68/316 (21%), Positives = 150/316 (47%)
  Q:     7 RQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYK-FYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKT-----VHGQSSLLAVPEF-QDTEKLKEILQIL-ESTSIWEQIAFKQNQTGSNTLITFGDE---VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKI 322
           R + LLK ++E Y+A   PVGS+ +       +S AT+RN M+ LE LGL+   HTS+GR+P+  GY+ F +   +     DE   ++       +      ++  +  ++S  ++   + +      + K+I+ + ++ +  ++I++T +G++   I+     +  +D S    +     I+     ++   D ++  ++E++ E    +  L+       +    T     + G+ +LL V +   D  +L+++  +  + TS+ + +    +  G    I  G E   V  E++        +N +    L ++ PTR+ Y+++
  S:     5 RAQTLLKTLIERYIAEGQPVGSRTLSRYSGLELSPATIRNVMSDLEDLGLVISPHTSAGRIPTPRGYRLFVDTMLTVESAADEEAVMRTVKTTL-QAGEPQKIVAAAASVLSNLSQFAGVVLTPRRSHVFKQIEFMRLSDKRILLIIVTPEGDVQNRIM-----ATQRDFSPSQLVEASNYINAHFAGLS--FDDVRRRLREEIDELRGDMTTLMHAAVTASTDEADTGETVLISGERNLLEVADLSSDMARLRKLFDVFDQKTSLLQLLDVSSHAAGVQIFI--GGESNLVPIEEMSVVTAPYEVNGKIVGTLGVIGPTRMAYNRV 321
>gi|84501186|ref|ZP_00999391.1| heat-inducible transcription repressor [Oceanicola batsensis HTCC2597] >gi|84390477|gb|EAQ02965.1| heat-inducible transcription repressor [Oceanicola batsensis HTCC2597] (354 aa)
Score = 183, Expect = 7.6e-12, Identities = 43/163 (26%), Positives = 83/163 (50%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNI 163
           ++E+  R +E+ + +VE Y+    PVGS+ +       +SAAT+RN M  LE LGLL+  H S+GRVP+  G + +     +    D   + K+     +    +  +++     +S +T+   + +    E  +K I+ V +    A+V+++ +DG++   I
  S:     8 IEELNDRSREVFRRVVEGYLTNGEPVGSRTLTRLMNEKVSAATIRNVMQDLEYLGLLDSPHISAGRVPTQQGLRMFVDGLLEVSDLDVADREKIDATVGNGGGDVGGMLDRIGSALSGATQGASLVLAPKHEAPIKHIEFVSLGHDRALVVLVFADGHVENRI 170
>gi|83721380|ref|YP_441849.1| heat-inducible transcription repressor [Burkholderia thailandensis E264] >gi|167580681|ref|ZP_02373555.1| heat-inducible transcription repressor [Burkholderia thailandensis TXDOH] >gi|167618786|ref|ZP_02387417.1| heat-inducible transcription repressor [Burkholderia thailandensis Bt4] >gi|123537474|sp|Q2SZ00|HRCA_BURTA Heat-inducible transcription repressor hrcA >gi|83655205|gb|ABC39268.1| heat-inducible transcription repressor HrcA [Burkholderia thailandensis E264] (340 aa)
Score = 182, Expect = 8.5e-12, Identities = 67/316 (21%), Positives = 146/316 (46%)
  Q:     7 RQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNF---SKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELI-ERIFQIKSKMIKTVHGQSSLLAVPEF-QDTEKLKEILQIL-ESTSIWEQIAFKQNQTGSNTLITFGDE---VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKI 322
           R + LLK ++E Y+A   PVGS+ +       +S AT+RN M+ LE+LGL+   HTS+GRVP+  GY+ +         P  +D   +L    + A        V+  +  ++S  ++   + +      + K+I+ + ++ +  ++I++T +G++   +I  + D     ++      N         E+  +   ++  I E   +   ++   +     +   +    + G+ +LL V +   D  +L+++  +  + TS+ + +    +  G    I  G E   V  +++        +N +    L ++ PTR+ Y+++
  S:     5 RARTLLKTLIERYIADGQPVGSRTLSRYSGLELSPATIRNVMSDLEELGLVSSPHTSAGRVPTPRGYRLFVDTMLTVESPIDSDAVTRLVQTTLQAGEPQQ--KVVAAAASVLSNLSQFAGVVLTPRRSHVFKQIEFLRLSDKRILLIIVTPEGDVQNRMIATQRDYSPAQLTEASNYINAHFAGLSFDEVRRR---LRGEIDELRGDMTALMHAAVTASTEEPADEETVLISGERNLLEVADLSSDMARLRKLFDVFDQKTSLLQLLDVSSHAQGVQIFI--GGESTLVPIDEMSVVTAPYEVNGKIVGTLGVIGPTRMAYNRV 322
>gi|118594557|ref|ZP_01551904.1| heat-inducible transcription repressor [Methylophilales bacterium HTCC2181] >gi|118440335|gb|EAV46962.1| heat-inducible transcription repressor [Methylophilales bacterium HTCC2181] (337 aa)
Score = 182, Expect = 1.0e-11, Identities = 71/320 (22%), Positives = 148/320 (46%)
  Q:     3 EITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRN--VFADRTMSIDVVIEESCKIISESTKLP-MIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTV-HGQSSLLAVPEF-QDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKTKLVM---VAPTRVDYSKI 322
           ++  R + LLK ++  ++    PVGSK +      ++S A++RN M  LE  G +   HTS+GR+P+  GY+ +  +       D+     L+N  + +D       +I  +   +SE TK   ++ I    ++  K I+ + I+++  +VI++T DGN+  ++++   D     ++     FN       ++E   ++      +K  + +   ++   I        +    V  GQ+ LL   E  Q+   +++IL++ E  S   ++  + +Q  +   I  G+E  ++ +          E +   L +   + PTR+ Y ++
  S:     2 DLDSRAQSLLKTLITHHIGDGQPVGSKTLSASSDLDLSPASIRNIMKDLEDAGFVSSPHTSAGRIPTNKGYRLFVDSLVTVQSLDDVEISSLKNQLIASDNKH----LISSAANTLSELTKFAGIVMIPKAKKIKYKHIEFIGISERRVLVIIVTDDGNVQNSVLYTNHDYDKTSLTEAANYFNKEFSGYSVEEAKKRLMDDLKHMKTNISD---LMSSAINSAADNNDEADNIVMSGQTKLLETVELSQNVASIRKILEVFEKKSALLKL-LESSQHANGIQIFIGEESGYQALDECSVITAPYEADGEVLGILGVIGPTRMAYERV 321
>gi|167586226|ref|ZP_02378614.1| heat-inducible transcription repressor [Burkholderia ubonensis Bu] (340 aa)
Score = 182, Expect = 1.0e-11, Identities = 65/316 (20%), Positives = 148/316 (46%)
  Q:     7 RQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNF--SKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKT-----VHGQSSLLAVPEF-QDTEKLKEILQIL-ESTSIWEQIAFKQNQTGSNTLITFGDE---VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKI 322
           R + LLK +++ Y+A   PVGS+ +       +S AT+RN M+ LE+LGL+   HTS+GRVP+  GY+ +       +  I+ E +  +++           VV   +  ++S  ++   + +      + K+I+ + ++ +  ++I++T +G++   ++    D     ++      N               D ++  +++++ +    +  L+       +++  T     + G+ +LL V +   D  +L+++  +  + T + + +    +  G    I  G E   V  E++        +N Q    L ++ PTR+ Y+++
  S:     5 RARTLLKTLIDRYIADGQPVGSRTLSRYSGLELSPATIRNVMSDLEELGLVSSPHTSAGRVPTPRGYRLFVDTMLTVETPIDAEAVARQVQTTLQAGEPQQKVV-AAAASVLSNLSQFAGVVLTPRRSHVFKQIEFMRLSDKRILLIIVTPEGDVQNRMLATPRDYSPSQLTEASNYINAHF-------AGLSFDEVRRRLRDEIDQLRGDMTALMHAAVTASTEVPDTEDTVLISGERNLLEVADLSSDMARLRKLFDVFDQKTGLLQLLDVSSHAQGVQIFI--GGESTLVPIEEMSVVTAPYEVNGQIVGTLGVIGPTRMAYNRV 322
>gi|162147174|ref|YP_001601635.1| heat-inducible transcription repressor [Gluconacetobacter diazotrophicus PAl 5] >gi|187597181|ref|ZP_02983441.1| heat-inducible transcription repressor HrcA [Gluconacetobacter diazotrophicus PAl 5] >gi|161785751|emb|CAP55322.1| putative heat-inducible transcription repressor hrcA [Gluconacetobacter diazotrophicus PAl 5] >gi|187491006|gb|EDU28947.1| heat-inducible transcription repressor HrcA [Gluconacetobacter diazotrophicus PAl 5] (355 aa)
Score = 181, Expect = 1.2e-11, Identities = 43/158 (27%), Positives = 82/158 (51%)
  Q:     7 RQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNII 164
           R   +L+ IVE YV T  PVGS+ +  +   ++S AT+RN MA L + GLL   H S+GR+P+  G + +     +     E+ +  +      R  S+  ++ E+  ++S  +    + +   ++  +K I+ V +  + A+VI++ +DG +   +I
  S:    19 RSAAILREIVEQYVETGEPVGSRTLSRRLPLSLSPATIRNVMADLTEAGLLFSPHASAGRLPTEKGVRLFVDGLLQFGSLTEDERETITRSLEMRGRSLQDMLSEASSMLSGLSSAAGLVLAPKSDGAVKHIEFVALGPRRALVILVGADGQVENRVI 176
>gi|161371336|ref|ZP_02110901.1| heat-inducible transcription repressor [Burkholderia pseudomallei 1710a] (340 aa)
Score = 180, Expect = 1.6e-11, Identities = 66/316 (20%), Positives = 147/316 (46%)
  Q:     7 RQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLK-LKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKS-----KMIKTVHGQSSLLAVPEF-QDTEKLKEILQIL-ESTSIWEQIAFKQNQTGSNTLITFGDE---VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKI 322
           R + LLK ++E Y+A   PVGS+ +       +S AT+RN M+ LE+LGL+   HTS+GRVP+  GY+   ++ +   + D   +    R   A        V+  +  ++S  ++   + +      + K+I+ + ++ +  ++I++T +G++   +I  + D     ++      N               D ++  ++E++ +    +  L+       +     +    + G+ +LL V +   D  +L+++  +  + TS+ + +    +  G    I  G E   V  +++        +N +    L ++ PTR+ Y+++
  S:     5 RARTLLKTLIERYIADGQPVGSRTLSRYSGLELSPATIRNVMSDLEELGLVSSPHTSAGRVPTPRGYRAVRRHDADRRVADRFRRGHAARADHAAAGEPQQRVVAAAASVLSNLSQFAGVVLTPRRSHVFKQIEFLRLSDKRILLIIVTPEGDVQNRMIATQRDYAPAQLTEASNYINAHF-------AGLSFDEVRRRLREEIDQLRGDMTALMHAAVTASTEEPDDEETVLISGERNLLEVADLSSDMARLRKLFDVFDQKTSLLQLLDVSSHAQGVQIFI--GGESTLVPIDEMSVVTAPYEVNGKIVGTLGVIGPTRMAYNRV 322
>gi|87200076|ref|YP_497333.1| heat-inducible transcription repressor [Novosphingobium aromaticivorans DSM 12444] >gi|123489183|sp|Q2G6M4|HRCA_NOVAD Heat-inducible transcription repressor hrcA >gi|87135757|gb|ABD26499.1| heat-inducible transcription repressor HrcA [Novosphingobium aromaticivorans DSM 12444] (354 aa)
Score = 180, Expect = 1.7e-11, Identities = 73/335 (21%), Positives = 157/335 (46%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKL-RNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIA----TKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDE-----VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKNEFEK 335
           + ++T R +E+ + +VE Y+A+ +PVGSK +      N+S A++R+ +  L+  GLL   HTS+GR+P+  G + +     +        + ++ R + A  T  I+  +  +   +SE +    + +    E  L +I  V ++   A+ ++++ DG +   +I   +      +         RL    + E A     +I   +S + E     + V + L+       ++ +  V GQ++LL     QD E+++++L+ LE      ++     +    T I  G E     +S   ++ A    + + +    + ++ PTR++Y+++  +++F      K
  S:     6 LTDLTDRAREIFRLVVEGYIASGHPVGSKALAGHGSVNLSPASIRSVLQELQDAGLLAAPHTSAGRMPTEFGLRLFVDGIMQVAEPSAAERAQIERGLVAGGT--IESALAAASTALSELSAGAAVVMVPKREPRLVQISFVPLSPLRALAVLVSEDGGIENRVIDLPEPVGPSALEQAGNYLTSRLHGRTLGEAAGVVRAEIAGGRSALDE--ASADLVQRGLVVWTQDATARPVMVVRGQANLLDETALQDIERVRQLLEELEGAEAIARV-LDAAREAQATRIFIGSENRLFSLSGSSVI-ASPWRDGDGRVVGVVGVIGPTRLNYARVVPMVDFTAQTLGK 344
>gi|148243371|ref|YP_001228528.1| heat-inducible transcription repressor hrcA [Synechococcus sp. RCC307] >gi|166220409|sp|A5GWB6|HRCA_SYNR3 Heat-inducible transcription repressor hrcA >gi|147851681|emb|CAK29175.1| Heat-inducible transcription repressor hrcA [Synechococcus sp. RCC307] (330 aa)
Score = 180, Expect = 1.7e-11, Identities = 70/260 (26%), Positives = 131/260 (50%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYK-FYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKL-PMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIK--EIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILE 260
           M  + +RQ+++L+  V+ YV T  PVGS+ ++ ++  + S ATVR+ M  LE+ GLL + HTS+GRVPS  GY+ F +    +P      L+ +L  + + +  ++D ++    + +++ T L  +I      E  LK + +V    +  + +V +S  + + N+    D S    +       ND+L    I    + + + S+ + +K+ +  +         R  Q +  +     G + LL  PEFQ T  L+ +LQ++E
  S:     1 MLPLPRRQQQVLQATVQHYVDTVEPVGSRTLVRRFGLDASPATVRSAMGALEQKGLLTQPHTSAGRVPSPKGYRQFVDALLPEPGAAVVQLQRELAEL-SLQWAALDDLLHHLARRLADLTGLMSIITRPQRQEPRLKALRLVRSGDRLLVFLVESSAASSSLNLRLPPDSS--AQLQALEHWLNDQLSKSAINWSGLPSHLQSVGAPLKQALASHNR------GRNRQAEGALTT---GLAGLLCQPEFQLTTSLRPLLQLVE 252
>gi|56478156|ref|YP_159745.1| heat-inducible transcription repressor [Azoarcus sp. EbN1] >gi|56314199|emb|CAI08844.1| Negative regulator of class I heat shock protein [Azoarcus sp. EbN1] (341 aa)
Score = 179, Expect = 2.0e-11, Identities = 71/322 (22%), Positives = 156/322 (48%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNF--SKPY--INDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTE-VLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIK-----TVHGQSSLLAVPEF-QDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDE--VSHED-IVFAQTDLNINEQNKTKLVMVAPTRVDYSKI 322
           MK +  R + LLK ++E Y+    PVGS+ +       +S ATVRN M+ LE+ G +   HTS+GR+P+  GY+F+  +    +P        LK +L+     R M+       +  ++SE T+   + +    + V +++I+ + + +   ++I++T+ G++   I+  +      +++       +         +    D +++ I++++K+    + EL+    +  +   +      + G+++LL V +   +  +L+E+ ++ E  +   Q+    N+      I  GDE  +S  D          +N +    + ++ PTR+ Y ++
  S:     1 MKLLDPRSQILLKTLIERYIVEGQPVGSRALSRYSGLELSPATVRNVMSDLEEKGFITSPHTSAGRIPTALGYRFFVDSLLTVQPLEQARVRELKGQLQPDQPQRLMN------SASHLLSELTQFAGVVVSPRRDTVKIRQIEFISLAENRILLIIVTTAGDVQNRILITRRAYSSAELAEAASYLTEHF-------VGLGFDDIRARIRDELKQLRSDMSELMTAAVEAGNAAAEDSASYVLSGETNLLDVEDLSSNMARLRELFKLFEQKTGLMQLLDLSNR-AHGVQIFIGDESGLSQLDGCSVVTAGYEVNGKVVGSVGVIGPTRMAYDRV 322
>gi|17547368|ref|NP_520770.1| heat-inducible transcription repressor [Ralstonia solanacearum GMI1000] >gi|22256779|sp|Q8XW26|HRCA_RALSO Heat-inducible transcription repressor hrcA >gi|17429671|emb|CAD16356.1| probable heat-inducible transcription repressor hrca. transcription regulator protein [Ralstonia solanacearum] (352 aa)
Score = 179, Expect = 2.1e-11, Identities = 68/319 (21%), Positives = 147/319 (46%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYIND-----ENLKLKLRNVFADR---------TMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIK-----TVHGQSSLLAVPEFQDT-EKLKEILQILES-TSIWEQIAFKQNQTGSNTLITFGDE---VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKI 322
           + +R   LLK ++E Y+A   PVGS+ + +    ++S AT+RN M+ LE++G +   HTS+GRVP+  GY+ +          D     + +  ++    A++         + S   VI  + + +S  ++   I +        ++I+ + +++   ++IV+T +G++   IIH         +       N               D+++  ++ ++   +  +  L++   +  S  +       + G+  LL V +   + +KL+ +  + E  T + + +       G    I  G E   V HED+        ++ +    L ++ P R+ Y ++
  S:     1 MDKRATILLKTLIERYIAEGQPVGSRTLSKYSGLDLSPATIRNVMSDLEEMGFIASPHTSAGRVPTPRGYRLFVDTMLTAGPLDILGMHDRMAQQIAGTIAEQVRAQLASHGSESSQRVIAAAAQTLSNLSQFAGIVMTPRRTHAFRQIEFLRLSETRILLIVVTPEGDVQNRIIHTDTPYTPSQLVEAANYINAHY-------GGMTFDAVRERLRGELNALQADMTSLMQAAVEAGSSAVSDEDPVVISGERKLLEVEDLSSSMDKLRRLFAVFEQKTGLLQLLDVSSRAEGVQIFI--GGESSLVPHEDMAVITAPYEVDGKIVGTLGVIGPMRMAYERV 334
>gi|153885733|ref|ZP_02006889.1| heat-inducible transcription repressor HrcA [Ralstonia pickettii 12D] >gi|151577655|gb|EDN42055.1| heat-inducible transcription repressor HrcA [Ralstonia pickettii 12D] (352 aa)
Score = 178, Expect = 2.7e-11, Identities = 68/319 (21%), Positives = 148/319 (46%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNF--SKPY---INDENLKLKLRNVFADR---------TMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIK-----TVHGQSSLLAVPEFQDT-EKLKEILQILES-TSIWEQIAFKQNQTGSNTLITFGDE---VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKI 322
           + +R   LLK ++E Y+A   PVGS+ + +    ++S AT+RN M+ LE++G +   HTS+GRVP+  GY+ +      + P       + +  ++    A++         + S   VI  + + +S  ++   I +        ++I+ + +++   ++IV+T +G++   IIH         +       N               D+++  ++ ++   +  +  L++   +  S  +       + G+  LL V +   + +KL+ +  + E  T + + +       G    I  G E   V HED+        ++ +    L ++ P R+ Y ++
  S:     1 MDKRATILLKTLIERYIAEGQPVGSRTLSKYSGLDLSPATIRNVMSDLEEMGFIASPHTSAGRVPTPRGYRLFVDTMLTASPLDVLSTQDRMAQQMVGAIAEQVRTQLASHGSESSQRVIAAAAQTLSNLSQFAGIVMTPRRTHAFRQIEFLRLSESRILLIVVTPEGDVQNRIIHTDTPYTPSQLVEAANYINAHY-------GGQTFDAVRESLRGELSALQADMTALMQAAVEAGSSAVSEEDPVVISGERKLLEVEDLSSSMDKLRRLFAVFEQKTGLLQLLDVSSRAEGVQIFI--GGESSLVPHEDMAVITAPYEVDGKIVGTLGVIGPMRMAYERV 334
>gi|73540739|ref|YP_295259.1| heat-inducible transcription repressor [Ralstonia eutropha JMP134] >gi|72118152|gb|AAZ60415.1| heat-inducible transcription repressor HrcA [Ralstonia eutropha JMP134] (345 aa)
Score = 177, Expect = 3.5e-11, Identities = 63/319 (19%), Positives = 152/319 (47%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFY------EKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKT------VHGQSSLLAVPEFQDT-EKLKEILQILE-STSIWEQIAFKQNQTGSNTLITFGDE---VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKI 322
           + +R K LLK ++E Y+A   PVGS+ + +    ++S AT+RN M+ LE++G +   HTS+GR+P+  GY+ +       K   +  +    L  +++     + +    +I  + + +S  +    + +        ++++ + ++ +  ++I+++ +G++   II  +       +      FN               D+++  ++ ++++    + +L++   +  S  ++       + G+  LL V +   + +KL+ +  + E  TS+ + +    +  G    I  G E   V  E++        ++ Q    L ++ PTR+ Y ++
  S:     1 MDERSKTLLKTLIERYIAEGQPVGSRTLSKYSGLDLSPATIRNVMSDLEEMGFISSPHTSAGRIPTPRGYRLFVDTMLTVKPIERGGLEMTELAGQIQGQLGGQQLGPQRMITAAARTLSNLSHFAGVVMTPRRAQSFRQVEFMRLSDKRILLIIVSPEGDVQNRIIQTELSYTPAQLIEAANFFNAHY-------AGMSFDAVRDHLRVELQDLRRDMSQLMQAAVEAGSSAMEEEDDHLYISGERKLLEVEDLASSMDKLRRLFDVFEHKTSLLQLLDVSSHAQGVQIFI--GGESQLVPIEEMAVITAPYEVDGQIVGTLGVIGPTRMAYERV 327
>gi|161525808|ref|YP_001580820.1| heat-inducible transcription repressor [Burkholderia multivorans ATCC 17616] >gi|189349471|ref|YP_001945099.1| heat-inducible transcriptional repressor [Burkholderia multivorans ATCC 17616] >gi|160343237|gb|ABX16323.1| heat-inducible transcription repressor HrcA [Burkholderia multivorans ATCC 17616] >gi|189333493|dbj|BAG42563.1| heat-inducible transcriptional repressor [Burkholderia multivorans ATCC 17616] (340 aa)
Score = 177, Expect = 3.9e-11, Identities = 64/316 (20%), Positives = 149/316 (47%)
  Q:     7 RQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNF--SKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKT-----VHGQSSLLAVPEF-QDTEKLKEILQIL-ESTSIWEQIAFKQNQTGSNTLITFGDE---VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKI 322
           R + LLK ++E Y+A   PVGS+ +       +S AT+RN M+ LE+LGL+   HTS+GRVP+  GY+ +       +  I+   +  ++++          VV   +  ++S  ++   + +      + K+I+ + ++++  ++I++T +G++   ++    D     ++      N               D ++  +++++ +    +  L+       +++  T     + G+ +LL V +   D  +L+++  +  + T + + +    +  G    I  G E   V  E++        +N +    L ++ PTR+ Y+++
  S:     5 RARTLLKTLIERYIADGQPVGSRTLSRYSGLELSPATIRNVMSDLEELGLVSSPHTSAGRVPTPRGYRLFVDTMLTVETPIDAAAVARQVQSTLQAGEPQQKVV-AAAASVLSNLSQFAGVVLTPRRSHVFKQIEFMRLSEKRILLIIVTPEGDVQNRMLATPRDYSPSQLTEASNYINAHF-------AGLSFDEVRRRLRDEIDQLRGDMTALMHAAVTASTEVPDTEDTVLISGERNLLEVADLSSDMARLRKLFDVFDQKTGLLQLLDVSSHAQGVQIFI--GGESTLVPIEEMSVVTAPYEVNGKIVGTLGVIGPTRMAYNRV 322
>gi|58039736|ref|YP_191700.1| heat-inducible transcription repressor [Gluconobacter oxydans 621H] >gi|81557060|sp|Q5FRF2|HRCA_GLUOX Heat-inducible transcription repressor hrcA >gi|58002150|gb|AAW61044.1| Heat inducible transcription repressor HrcA [Gluconobacter oxydans 621H] (356 aa)
Score = 176, Expect = 4.5e-11, Identities = 74/322 (22%), Positives = 147/322 (45%)
  Q:     7 RQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKT--VHGQSSLLAVPEFQDTEKLKEILQILESTSIWE-QIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNI------NEQNKT--KLVMVAPTRVDYSKIKGLLEF 328
           R+  +L+ IVE+YV T  P+GS+ + ++  P++S AT+RN MA L + GLL   H S+GR+P+  G + +     +     E  +  + +       S   ++ E+  ++S  +    + +   ++  LK I+ V +     +VI++ SDG +   II          +       N RL D  +  +  ++   ++ +     E + +   +IE           T  V GQ  LLA  +  + E+L  I  + +     E  +   Q    S  +  +   +  E  +F  + +++      NE  K    + ++ PTR++Y +I  ++++
  S:    22 REAAILREIVEEYVETGEPIGSQTLAQRLQPSLSPATIRNVMAELARAGLLFSPHVSAGRLPTEKGVRLFVDGLLQFSSLTEEDRASIDSRLDIHGRSYQDILSEASSLLSGLSSAAGLVLAPKSDATLKHIEFVALGPGRVLVILVGSDGQVENRIIETPPGVPPSALVEAGNYLNSRLGDLTLGNLRERV---RAEMDASRHELDALTASVIESGLATWDADGGTLFVKGQGKLLA--DITEIERLTTIRMLFDHLETQETMLQLLQLADASEGVRIY---IGRESGMFGMSGVSMIVAPARNEAQKIVGAIGVIGPTRLNYGRIVPVVDY 346
>gi|73749086|ref|YP_308325.1| heat-inducible transcription repressor HrcA [Dehalococcoides sp. CBDB1] >gi|147669849|ref|YP_001214667.1| heat-inducible transcription repressor HrcA [Dehalococcoides sp. BAV1] >gi|123620013|sp|Q3ZYU9|HRCA_DEHSC Heat-inducible transcription repressor hrcA >gi|189028264|sp|A5FPT3|HRCA_DEHSB Heat-inducible transcription repressor hrcA >gi|73660802|emb|CAI83409.1| heat-inducible transcription repressor HrcA [Dehalococcoides sp. CBDB1] >gi|146270797|gb|ABQ17789.1| heat-inducible transcription repressor HrcA [Dehalococcoides sp. BAV1] (345 aa)
Score = 175, Expect = 5.7e-11, Identities = 61/265 (23%), Positives = 129/265 (48%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTK-LPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRL-----IDCPIKEIATKIDSMK---SIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQI 268
           +T R + +L+ IV  Y+  A PV S  ++E    +I +AT+RN++  LE  G + + H S+G +P+  GY++Y ++     +   N K  +R++F      ++  +  +  ++S+  + + ++ +   T+  +  I++V +     +V++I     + + +++F++     ++++     ND            K +    D +K   S++K    E E   QE  E  F           G   +L  PEF   ++ +EI+Q+LE   + + I
  S:     2 LTSRAEIILRSIVRQYITKAVPVSSSSILEDCGLDICSATIRNEVVRLEIEGYILRPHHSAGSIPADKGYRYYVESLKDVEL-PTNDKFLIRHLFHQVEKEMEEWLNLTVAVLSQRVQSMAVVTMPRQTQGKVHHIELVSLQDNLVLVVLILRGAKVKQQLVNFENVVSQPELTLISNRLNDAYDGLTRFQIEQKPLGLNHDELKVKDSLVKMMRGEDE---QESREPFFD----------GLHYMLEQPEFHQNQRAQEIMQLLEQKKLSKMI 261
>gi|187929954|ref|YP_001900441.1| heat-inducible transcription repressor HrcA [Ralstonia pickettii 12J] >gi|187726844|gb|ACD28009.1| heat-inducible transcription repressor HrcA [Ralstonia pickettii 12J] (352 aa)
Score = 175, Expect = 6.3e-11, Identities = 68/319 (21%), Positives = 147/319 (46%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNF--SKPY---INDENLKLKLRNVFADRTMS---------IDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIK-----TVHGQSSLLAVPEFQDT-EKLKEILQILES-TSIWEQIAFKQNQTGSNTLITFGDE---VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKI 322
           + +R   LLK ++E Y+A   PVGS+ + +    ++S AT+RN M+ LE++G +   HTS+GRVP+  GY+ +      + P       + +  ++    A++  S            VI  + + +S  ++   I +        ++I+ + +++   ++IV+T +G++   IIH         +       N               D+++  ++ ++   +  +  L++   +  S  +       + G+  LL V +   + +KL+ +  + E  T + + +       G    I  G E   V HED+        ++ +    L ++ P R+ Y ++
  S:     1 MDKRATILLKTLIERYIAEGQPVGSRTLSKYSGLDLSPATIRNVMSDLEEMGFIASPHTSAGRVPTPRGYRLFVDTMLTASPLDVLSTQDRMAQQMVGAIAEQVRSQLASHGAESSQRVIAAAAQTLSNLSQFAGIVMTPRRTHAFRQIEFLRLSESRILLIVVTPEGDVQNRIIHTDTPYSPSQLVEAANYINAHY-------GGQTFDAVRESLRGELSALQADMTALMQAAVEAGSSAVSDEEPVVISGERKLLDVEDLSSSMDKLRRLFAVFEQKTGLLQLLDVSSRAEGVQIFI--GGESSLVPHEDMAVITAPYEVDGKIVGTLGVIGPMRMAYERV 334
>gi|94309945|ref|YP_583155.1| heat-inducible transcription repressor [Ralstonia metallidurans CH34] >gi|93353797|gb|ABF07886.1| heat-inducible transcription repressor HrcA [Ralstonia metallidurans CH34] (348 aa)
Score = 174, Expect = 7.1e-11, Identities = 68/319 (21%), Positives = 147/319 (46%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNF--SKPYINDENLKLKLRNVFADRTMSIDV-------VIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFN--------DRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDT-EKLKEILQILE-STSIWEQIAFKQNQTGSNTLITFGDE---VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKI 322
           + +R K+LLK ++E Y+    PVGS+ + +    ++S AT+RN M+ LE++G +   HTS+GR+P+  GY+ +      ++P         +L  +       +         +I  +   +S  +    + +        ++++ + ++ +  ++I+++ +G++   II          +      FN        D + D    E+      M ++++  V+     + E  E++F         + G+  LL V +   + +KL+ +  + E  TS+ + +    +  G    I  G E   V  ED+        ++ Q    L ++ PTR+ Y ++
  S:     1 MDERSKKLLKTLIERYIVEGQPVGSRTLSKFSGLDLSPATIRNVMSDLEEMGFIASPHTSAGRIPTPRGYRLFVDTMLTARPLERAPEFSAELAELTGQIQGQLGGQQFGPQRMITAAAHTLSNLSHFAGVVMTPRRAQSFRQVEFMRLSDKRILLIIVSPEGDVQNRIIQTDLAYTPGQLIEAANFFNSHYAGMSFDAVRDHLRVELQDLRRDMSALMQAAVEAGSSAMAEDNEQVF---------ISGERKLLEVEDLSSSMDKLRRLFDVFEHKTSLLQLLDVSSHAQGVQIFI--GGESQLVPIEDMAVITAPYGVDGQIVGTLGVIGPTRMAYERV 330
>gi|163737985|ref|ZP_02145401.1| heat-inducible transcription repressor HrcA [Phaeobacter gallaeciensis BS107] >gi|161388601|gb|EDQ12954.1| heat-inducible transcription repressor HrcA [Phaeobacter gallaeciensis BS107] (358 aa)
Score = 174, Expect = 7.3e-11, Identities = 32/76 (42%), Positives = 49/76 (64%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFY 76
           +K++  R +++ + +VE Y+ T +PVGS+ +       +SAATVRN M  LE LGLL   HTS+GRVP+  G + +
  S:     8 LKDMNDRSRDVFRAVVESYLETGDPVGSRTLTRSLNEKVSAATVRNVMQDLEHLGLLNSPHTSAGRVPTQVGLRMF 83
>gi|71906569|ref|YP_284156.1| heat-inducible transcription repressor [Dechloromonas aromatica RCB] >gi|123627989|sp|Q47HJ5|HRCA_DECAR Heat-inducible transcription repressor hrcA >gi|71846190|gb|AAZ45686.1| heat-inducible transcription repressor HrcA [Dechloromonas aromatica RCB] (342 aa)
Score = 174, Expect = 8.6e-11, Identities = 42/161 (26%), Positives = 86/161 (53%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIE-NNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNII 164
           + +R + LLK +VE YVA   PVGS+ + +    ++S AT+RN MA LE+ G +   HTS+GR+P+  GY+ +  +       +     ++      R      +I  + +++S  T    + I        +++I+ + ++++  ++I++T+DG++   I+
  S:     2 LDERARTLLKTLVEHYVADGQPVGSRALSKFSGLDLSPATIRNVMADLEEAGFVASPHTSAGRIPTARGYRLFVDSLLTVQPLEARQMGEMEEALHGRPAG--QIIASASQLLSSLTHFAGVVIAPRRQSSRIRQIEFLSLSEKRILLIIVTADGDVQNRIV 161
>gi|16124408|ref|NP_418972.1| heat-inducible transcription repressor [Caulobacter crescentus CB15] >gi|13421266|gb|AAK22140.1| heat-inducible transcription repressor HrcA [Caulobacter crescentus CB15] (358 aa)
Score = 173, Expect = 9.8e-11, Identities = 44/164 (26%), Positives = 82/164 (50%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNII 164
           + E+  R +++ + +VE Y+ T  PVGS+  I K    +S A++RN M  L +LGLL+  HTS+GR+P+ AG + +   F +     E  K  +    A +  S +  + E+  I+S       I +    E  +K ++ V +     + +++  DG +   ++
  S:    15 LAELDARARDIFRRVVESYLETGEPVGSRT-ISKGGVALSPASIRNTMQDLAQLGLLDAPHTSAGRMPTHAGLRMFVDGFLEVGDVAEQEKRAIEARLAVKGRSFEEALAEASSILSGLAGGAGIVVTPVREGGVKHVEFVPLGGGQVLAVMVFEDGQVENRLM 177
>gi|1708298|sp|P54305|HRCA_CAUCR Heat-inducible transcription repressor hrcA >gi|992694|gb|AAB01515.1| HrcA [Caulobacter crescentus] (358 aa)
Score = 173, Expect = 9.8e-11, Identities = 44/164 (26%), Positives = 82/164 (50%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNII 164
           + E+  R +++ + +VE Y+ T  PVGS+  I K    +S A++RN M  L +LGLL+  HTS+GR+P+ AG + +   F +     E  K  +    A +  S +  + E+  I+S       I +    E  +K ++ V +     + +++  DG +   ++
  S:    15 LAELDARARDIFRRVVESYLETGEPVGSRT-ISKGGVALSPASIRNTMQDLAQLGLLDAPHTSAGRMPTHAGLRMFVDGFLEVGDVAEQEKRAIEARLAVKGRSFEEALAEASSILSGLAGGAGIVVTPVREGGVKHVEFVPLGGGQVLAVMVFEDGQVENRLM 177
>gi|62184881|ref|YP_219666.1| heat-inducible transcription repressor [Chlamydophila abortus S26/3] >gi|32129635|sp|Q8GH81|HRCA_CHLAB Heat-inducible transcription repressor hrcA >gi|26006345|gb|AAN77257.1|AF384685_1 HrcA [Chlamydophila abortus] >gi|62147948|emb|CAH63695.1| heat-inducible transcription repressor [Chlamydophila abortus S26/3] (386 aa)
Score = 172, Expect = 1.4e-10, Identities = 48/167 (28%), Positives = 95/167 (56%)
  Q:     4 ITQRQKELLKYIV---EDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDE--NLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMI----KIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDS 170
           I++R+ +LL  ++   E Y+ T  PVGSK + E    N+S AT+RN  A LE  G L+KNH S GR+P+   +++Y  + +  ++ D+     + L N     + +I   ++++ +++ E+ +LP      + EN++   +  I +  +++Q  +VI+ T  G +  + +   + S
  S:     6 ISKRESKLLYILLTTTELYLKTGQPVGSKTLKEYECSNLSTATIRNYFAELEAEGFLKKNHVSGGRIPTDLAFRYYVDHRAD-FLQDDLPETTIHLLNQLPKESQNIVKDLQKASELLGEALQLPTCFSSPRFENDS---VTNIQLSLVDEQRVVVILSTEFGQIFTDTLWLAETS 177
>gi|89898570|ref|YP_515680.1| heat-inducible transcription repressor [Chlamydophila felis Fe/C-56] >gi|123482943|sp|Q253K3|HRCA_CHLFF Heat-inducible transcription repressor hrcA >gi|89331942|dbj|BAE81535.1| heat-inducible transcription repressor [Chlamydophila felis Fe/C-56] (386 aa)
Score = 168, Expect = 4.1e-10, Identities = 47/156 (30%), Positives = 92/156 (58%)
  Q:     4 ITQRQKELLKYIV---EDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEK---NFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMI----KIENNTEVLLKRIDMVEINKQSAMVIVITSDGNL 159
           I++R+ ++L  ++   E Y+ T  PVGSK + E    N+S AT+RN  + LE  G L+KNH S GR+P+   +++Y     +FS+  + +     +L N   + + +I   ++++ +I+ E+ +LP      + EN++   +  I +  +++Q  +VI+ T  G +
  S:     6 ISKRESKILYILLTTTELYLKTGQPVGSKTLKEYECSNLSTATIRNYFSELESEGFLKKNHISGGRIPTDLAFRYYVDHCADFSQSELPEST--TRLLNQLPEESQNIVKDLQKALEILGEALQLPTCFSSPRFENDS---ITNIQISLVDEQRVVVILSTEFGQV 166
>gi|16752542|ref|NP_444804.1| heat-inducible transcription repressor [Chlamydophila pneumoniae AR39] >gi|33241852|ref|NP_876793.1| heat-inducible transcription repressor [Chlamydophila pneumoniae TW-183] >gi|7189179|gb|AAF38116.1| heat shock gene repressor HrcA [Chlamydophila pneumoniae AR39] >gi|33236361|gb|AAP98450.1| heat-inducible transcription repressor [Chlamydophila pneumoniae TW-183] (407 aa)
Score = 167, Expect = 5.1e-10, Identities = 67/259 (25%), Positives = 121/259 (46%)
  Q:     3 EITQRQKELLKYI---VEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFY--------EKNFSKPYIND-ENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMI----KIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILES 261
           ++++R  ++L  +    E Y+ T  PVGSK + E +  ++S AT+RN  A LE  G L+KNHTS GR+P+    + Y        E   S P  +    L  + RN+  D        ++++ +++ E   LP      + EN++   +  I + +++KQ A+ I+ T  G +  + +   +      I    +   + +   P  E  +K +   S+       Y  V+   + R      + +    G S LL    F+D E L   L + E+
  S:    26 KVSKRDSKILDILFATTELYLKTGQPVGSKTLKESFCSDLSTATIRNYFAELEAEGFLKKNHTSGGRIPTDLALRHYVDHQEECPEAEISAPIFDKISQLPSESRNIIKD--------LQKATELLGEILDLPTFFSSPRFENDS---VTNIQITQVDKQRAVTILSTEFGQIFTDTLWLPEACDTLSIKRIEKFLQNYIRKLPTNEELSKKEEHLSM-----SLYNEVVVRYLTRYCNFSEEDLYQT-GMSKLLKYEAFKDPEVLALGLSLFEN 283
>gi|15618412|ref|NP_224697.1| heat-inducible transcription repressor [Chlamydophila pneumoniae CWL029] >gi|15836032|ref|NP_300556.1| heat-inducible transcription repressor [Chlamydophila pneumoniae J138] >gi|6707688|sp|Q9Z850|HRCA_CHLPN Heat-inducible transcription repressor hrcA >gi|4376788|gb|AAD18641.1| HTH Transcriptional Repressor [Chlamydophila pneumoniae CWL029] >gi|8978871|dbj|BAA98707.1| HTH transcriptional repressor [Chlamydophila pneumoniae J138] (398 aa)
Score = 166, Expect = 6.1e-10, Identities = 67/259 (25%), Positives = 121/259 (46%)
  Q:     3 EITQRQKELLKYI---VEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFY--------EKNFSKPYIND-ENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMI----KIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILES 261
           ++++R  ++L  +    E Y+ T  PVGSK + E +  ++S AT+RN  A LE  G L+KNHTS GR+P+    + Y        E   S P  +    L  + RN+  D        ++++ +++ E   LP      + EN++   +  I + +++KQ A+ I+ T  G +  + +   +      I    +   + +   P  E  +K +   S+       Y  V+   + R      + +    G S LL    F+D E L   L + E+
  S:    17 KVSKRDSKILDILFATTELYLKTGQPVGSKTLKESFCSDLSTATIRNYFAELEAEGFLKKNHTSGGRIPTDLALRHYVDHQEECPEAEISAPIFDKISQLPSESRNIIKD--------LQKATELLGEILDLPTFFSSPRFENDS---VTNIQITQVDKQRAVTILSTEFGQIFTDTLWLPEACDTLSIKRIEKFLQNYIRKLPTNEELSKKEEHLSM-----SLYNEVVVRYLTRYCNFSEEDLYQT-GMSKLLKYEAFKDPEVLALGLSLFEN 274
>gi|76665029|emb|CAJ17955.1| heat-inducible transcription repressor [Candidatus Phytoplasma solani] (96 aa)
Score = 166, Expect = 6.2e-10, Identities = 34/73 (46%), Positives = 47/73 (64%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFY 76
           ++ R+K +LK ++ +Y     PVGSK ++        +ATVR DM  LE+ G L+KNHTSSGRVPS  GY +Y
  S:     2 LSDRKKLILKAVIANYSQKGQPVGSKSLLYLTEMKFCSATVRYDMMQLEQEGFLKKNHTSSGRVPSFKGYTYY 74
>gi|114571544|ref|YP_758224.1| heat-inducible transcription repressor [Maricaulis maris MCS10] >gi|114342006|gb|ABI67286.1| heat-inducible transcription repressor HrcA [Maricaulis maris MCS10] (359 aa)
Score = 166, Expect = 6.7e-10, Identities = 72/328 (21%), Positives = 165/328 (50%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCK----IISESTKLPMIK-------IENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDD---SILKDISICI------RIFND--RLIDCPIKEIATKIDS-MKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLLAVP-EFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEF 328
           +  +  R + + + IVE Y+ + +PVGS+ + +     +S A++RN MA L  LGLL   H S+GR+P+ AG + +               L++  + AD   +I+  +  S +    +++E+T L           +    E  L+ ++ V ++K   + +++  DG++   ++   D    + L D    +      R  +D  + I+  I E  + +DS  + ++K+ + ++     +    I + +S++++++     L  +   F+D E+ +E++ +L+     E +         N L +    +S   ++ A   +N  ++    L ++ PTR++Y+++  L+++
  S:    10 LAALDDRMRTIFREIVEAYLRSGDPVGSRTLSQSGNLTLSPASIRNTMADLADLGLLSAPHASAGRMPTHAGLRLFVDGL-----------LQVGELSADERKAIEGQVSMSGRSTKDLLTEATSLLGGLSGGAGLVVTQKREAPLRHVEFVPLSKVEMLGVLVFEDGSVENRLMRTPDGIPPAALIDAGNYLSTRLKGRTLSDARKAIEQEIAERRSALDSAAEGLVKQGLADWSGGKGQERSLIVRGQSRLLESLDAVGDLERIRLLFEDIERKEELVTLLDKARDAEGVRLFIG--AENPLFS----LSGSSVIVAPY-MNAEQEIIGALGVIGPTRLNYARVIPLVDY 343
>gi|84702129|ref|ZP_01016704.1| heat-inducible transcription repressor [Parvularcula bermudensis HTCC2503] >gi|84691375|gb|EAQ17215.1| heat-inducible transcription repressor [Parvularcula bermudensis HTCC2503] (348 aa)
Score = 166, Expect = 6.8e-10, Identities = 73/328 (22%), Positives = 148/328 (45%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSK---PYINDEN-LKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIER-IFQIKSKM----IKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIA--FKQNQTGSNTLITFGDE-----VSHEDIVFA---QTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEF 328
           + +I  R +++ K +V+ Y+ T  PVGS+ +  +    +S AT+RN M+ L   GLLE  H S+GR+P+  G + +     +   P   D   L+ +       R++     ++ +   +S  TK   + +    +  L+++  V +    A+++++   G++   ++H         +       N  +    + E  +++      I+E   E + + +EL++R +  + + M       V GQ++LL        E L  + Q+ E     + I       + G    I  G E     +S   +V A     D NI            PTR++Y+++  L+++
  S:     4 LADIDSRSRQIFKSLVDTYLQTGQPVGSRTLSREPDLGLSPATIRNVMSDLTSAGLLEAPHASAGRLPTEKGLRLFVDGLMEIGAPSPEDRRALEAEAGGEGEARSL-----LDRAAVQLSGLTKTASLVLTGTNDQPLRQVSFVPLEADRALMVLVNKAGDVENRLMHLPAGLPANALVQAANFLNASMSGRTLAEARSEV---AKAIEEARGELDDLTRELVQRGVADLSTGMGGGPQLIVKGQANLLT----DAAEDLDRVQQLFEELERQQGIVDLLTAAKEGDGVRIFIGSENPLFSLSGSAVVTAPYRDADRNIVGVVGVV----GPTRLNYARVIPLVDY 334
>gi|74318050|ref|YP_315790.1| heat-inducible transcription repressor [Thiobacillus denitrificans ATCC 25259] >gi|123611490|sp|Q3SHA4|HRCA_THIDA Heat-inducible transcription repressor hrcA >gi|74057545|gb|AAZ97985.1| Negative regulator of class I heat shock protein [Thiobacillus denitrificans ATCC 25259] (339 aa)
Score = 166, Expect = 7.5e-10, Identities = 39/161 (24%), Positives = 84/161 (52%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNII 164
           +  R + LLK +VE Y++   PVGS+ + +    ++S A++RN M+ LE++G +   HTS+GRVP+  GY+F+          D+     L N  A        ++  +  ++S+ ++   + +        ++I+ + ++ +  ++I++T +G +   +I
  S:     2 LNDRARILLKTLVERYISEGEPVGSRTLSKHAGLDLSPASIRNIMSDLEEMGFVASPHTSAGRVPTPRGYRFFVDTLLTVRPLDQVSVNHLENSLA--ASDPQRLMTAASTLLSDLSQFAGLVMTPRRNPAFRQIEFLTLSDKRVLLIIVTMEGEVENRVI 160
>gi|163855862|ref|YP_001630160.1| heat-inducible transcription repressor [Bordetella petrii DSM 12804] >gi|163259590|emb|CAP41891.1| heat-inducible transcriptional repressor [Bordetella petrii] (335 aa)
Score = 165, Expect = 1.0e-09, Identities = 66/316 (20%), Positives = 148/316 (46%)
  Q:     7 RQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNF--SKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKT---------VHGQSSLLAVPEF-QDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDE--VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKI 322
           R + LLK ++E ++A   PVGS+ + + +  ++S AT+RN MA LE LGL+   HTS+GRVP+  GY+ +  +    +P+      + +     A         +  +  ++S  T+   + +      + ++I+ + ++ +  ++I++T DG++   I+  + D    ++      FN       +       D+++  +  ++ +    L+E I R+ Q   +             + G+  LL V +   D ++L+++  + E  +   Q+    ++     +   GD   +  E++         + +    L ++ PTR+ Y ++
  S:     4 RARALLKALIERHIADGQPVGSRTLSKVF--DLSPATIRNVMADLEDLGLIHSPHTSAGRVPTPRGYRMFVDSLLAVQPF----EFQPQQFGEAALTATEPSRAVSAAAALLSNLTQFAGVVLTPKRAQVFRQIEFIRLSGKRVLLIIVTPDGDVQNRILSVQRDYSEAELIEAGNFFN-------VHFAGKSFDAVRRTLTTELAQ----LREDISRLMQAAVEAGAEAAEDGDDMIISGERKLLDVTDIASDMDRLRKMFSLFEQKTDLLQLLDISSRAQGVQIYIGGDSQLLPMEEVSVITAPYGADGRVIGTLGVIGPTRMAYERV 316
>gi|15835288|ref|NP_297047.1| heat-inducible transcription repressor [Chlamydia muridarum Nigg] >gi|7404388|sp|P54306|HRCA_CHLMU Heat-inducible transcription repressor hrcA >gi|7190708|gb|AAF39494.1| heat shock gene repressor HcrA [Chlamydia muridarum Nigg] (392 aa)
Score = 164, Expect = 1.2e-09, Identities = 43/146 (29%), Positives = 85/146 (58%)
  Q:    19 YVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVV--IEESCKIISESTKLPMI----KIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNII 164
           Y+ +  PVGSK++ E Y  ++S+AT+RN  A LE  G L KNH S GR+P+   +++Y  + S P +  E + +  + +      S ++V  ++++ +I+SE  +LP+     + E+++   +  I +V I+    + ++ T  G L  +++
  S:    30 YLESGQPVGSKLLKETYCSDLSSATIRNYFAQLETDGFLRKNHISGGRIPTDLAFRYYADHCS-PVLEQEEISIIQQKLKELPEYSKNIVKDLQKASEILSEILQLPVCFSSPRFESDS---VTNIQLVSIDDLRVVFVLSTEFGQLFTDVL 177
>gi|126724517|ref|ZP_01740360.1| heat-inducible transcription repressor [Rhodobacterales bacterium HTCC2150] >gi|126705681|gb|EBA04771.1| heat-inducible transcription repressor [Rhodobacterales bacterium HTCC2150] (355 aa)
Score = 164, Expect = 1.2e-09, Identities = 38/159 (23%), Positives = 78/159 (49%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNL 159
           +  +  R +E+ + +VE Y+    PVGS+ +       +SAAT+RN M  LE +GLL   H S+GR+P+  G + +  +  +        K ++ +        +  +++     +S  T    + +    E  +K I+ V ++ + A+V+++ +DG +
  S:     8 LSNMNARSREVFRRVVEGYLDNGEPVGSRTLTRSMNEKVSAATIRNTMQDLEFMGLLNSPHVSAGRIPTQFGLRMFVDSLMEVDNIKAEDKRQIESELDTNEGDVGSLLDNVGSALSGLTHSASLVLAPKQETPIKHIEFVSLSTERALVVLVFADGQV 166
>gi|157364633|ref|YP_001471400.1| heat-inducible transcription repressor HrcA [Thermotoga lettingae TMO] >gi|157315237|gb|ABV34336.1| heat-inducible transcription repressor HrcA [Thermotoga lettingae TMO] (340 aa)
Score = 163, Expect = 1.4e-09, Identities = 34/73 (46%), Positives = 50/73 (68%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFY 76
           I +RQK++L   V +Y+ +  PV S+ V+E    + S+ATVRND+  LE LG L + HTS+GR+P+  GY+FY
  S:     7 INERQKKILYCAVREYIMSKRPVSSERVLEASDLSCSSATVRNDLRKLEYLGYLHQPHTSAGRIPTDKGYRFY 79
>gi|1272433|gb|AAA97480.1| Possible negative regulator of CIRCE element; Homologs in B. subtilis and Clostridia spp. referred to as hrcA or orfA [Chlamydia trachomatis] (392 aa)
Score = 163, Expect = 1.4e-09, Identities = 43/146 (29%), Positives = 85/146 (58%)
  Q:    19 YVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVV--IEESCKIISESTKLPMI----KIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNII 164
           Y+ +  PVGSK++ E Y  ++S+AT+RN  A LE  G L KNH S GR+P+   +++Y  + S P +  E + +  + +      S ++V  ++++ +I+SE  +LP+     + E+++   +  I +V I+    + ++ T  G L  +++
  S:    30 YLESGQPVGSKLLKETYCSDLSSATIRNYFAQLETDGFLRKNHISGGRIPTDLAFRYYADHCS-PVLEQEEISIIQQKLKELPEYSKNIVKDLQKASEILSEILQLPVCFSSPRFESDS---VTNIQLVSIDDLRVVFVLSTEFGQLFTDVL 177
>gi|167644138|ref|YP_001681801.1| heat-inducible transcription repressor [Caulobacter sp. K31] >gi|189028260|sp|B0T368|HRCA_CAUSK Heat-inducible transcription repressor hrcA >gi|167346568|gb|ABZ69303.1| heat-inducible transcription repressor HrcA [Caulobacter sp. K31] (358 aa)
Score = 163, Expect = 1.5e-09, Identities = 73/328 (22%), Positives = 150/328 (45%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYK-FYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKS-----KMIKTVHGQSSLLA-VPEFQDTEKLKEILQILESTSIWEQIAFKQN-QTGSNTLITFGDEVSHEDI----VFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEF 328
           + ++  R +++ + +VE Y+ T  PVGS+  I +    +S A++RN M  L +LGLL+  H+S+GR+P+ AG + F +       I +E  +     +FA    S +  + E+  I+S       I +    E  +K ++ V +    A+ I++  DG +   ++          +       N RL    + E  T+   M + +    +E +     L+E      S          V G+++LLA     +D E+++ +   LE     + I    + ++     I  G E     +    + A   ++  ++    + ++ PTR++Y+++  L+++
  S:    15 LTDLDGRARDIFRRVVESYLETGEPVGSRT-ISRGGVQLSPASIRNTMQDLAQLGLLDAPHSSAGRIPTHAGLRMFVDGLLEVGDIGEEERRTIESRLFA-HGRSFEEAMGEASAILSGLAGGAGIVVTPVREGGVKHVEFVALGADQALAIMVFDDGTVENRLMKRSAGVTPASLQEASNFLNARLRGRTLNEAKTE---MAAELDTARRELDATAARLVEDGLAAWSGGDDPDRALIVRGRANLLADASAREDLERVRRLFDDLEQKG--QLIGLLDDVRSAEGVRIFIGAETRLFSLSGSSLIAAPYMSGRQKVLGAIGVIGPTRLNYARVIPLVDY 347
>gi|160903254|ref|YP_001568835.1| heat-inducible transcription repressor HrcA [Petrotoga mobilis SJ95] >gi|160360898|gb|ABX32512.1| heat-inducible transcription repressor HrcA [Petrotoga mobilis SJ95] (335 aa)
Score = 162, Expect = 1.9e-09, Identities = 45/156 (28%), Positives = 86/156 (55%)
  Q:     2 KEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCKIISESTK-LPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDG 157
           K +  RQKE+LK IVE Y+    PV S  V+E      S+AT+RNDM  L+KLG + + H+S GR+P+ +  K Y +     Y N E+  + +   +  +   ++++ +   ++IS + + L + +  N   V + R+ +  + + + ++ ++T+ G
  S:     3 KVLHDRQKEILKTIVELYLKNDKPVSSDEVLENSNIKASSATIRNDMQKLQKLGYIYQQHSSGGRIPTDSALKIYFQMIKDAY-NQEDTHIDIPKKY--KFYDLNLMFQSLSELISNTLEGLVIFEYPNPKYVYITRVTVTPLMETNNVITILTNLG 156
>gi|29840010|ref|NP_829116.1| heat-inducible transcription repressor [Chlamydophila caviae GPIC] >gi|33301150|sp|Q824B0|HRCA_CHLCV Heat-inducible transcription repressor hrcA >gi|29834357|gb|AAP04994.1| heat-inducible transcription repressor HrcA [Chlamydophila caviae GPIC] (386 aa)
Score = 162, Expect = 2.2e-09, Identities = 45/167 (26%), Positives = 96/167 (57%)
  Q:     4 ITQRQKELLKYIV---EDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYIND-ENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLPMI----KIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDS 170
           I++R+ ++L  ++   E Y+ T +PVGSK + E    N+S AT+RN  + LE  G L+KNH S GR+P+   +++Y  + +    ++     + L N   + + +I   ++++ +++ E+ +LP      + +N++   +  I +  +++Q A+VI+ T  G +  + +   + S
  S:     6 ISKRESKILYILLTTTELYLKTGHPVGSKTLKEYEGSNLSTATIRNYFSELEAEGFLKKNHISGGRIPTDLAFRYYVDHCADCSQDELPESTINLLNQLPEESQNIVKDLQKASELLGEALQLPTCFSSPRFDNDS---VTNIQLSLVDEQRAVVILSTEFGQIFTDTLWLSEAS 177
>gi|407686|gb|AAA23162.1| ORFA [Chlamydia trachomatis] >gi|745529|prf||2016314C ORF A (392 aa)
Score = 161, Expect = 2.5e-09, Identities = 40/146 (27%), Positives = 86/146 (58%)
  Q:    19 YVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVV--IEESCKIISESTKLPMI----KIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNII 164
           Y+ +  PVGSK++ E Y  ++S+AT+RN  A LE  G L KNH S GR+P+   +++Y  + + P++  E +    + +      S ++V  ++++ +++S+  +LP+     + E+++ +    I +V I+ Q  + ++ T  G +  +++
  S:    30 YLESGQPVGSKLLKETYCSDLSSATIRNYFAQLETDGFLRKNHISGGRIPTDLAFRYY-ADHNAPFLEQEEILAIQQKLTELPEYSKNIVKDLQKASEVLSDILQLPVCFSSPRFESDSVI---NIQLVAIDDQRVVFVLSTEFGQVFTDVL 177
>gi|166154605|ref|YP_001654723.1| heat-inducible transcription repressor [Chlamydia trachomatis 434/Bu] >gi|166155480|ref|YP_001653735.1| heat-inducible transcription repressor [Chlamydia trachomatis L2b/UCH-1/proctitis] >gi|165930593|emb|CAP04090.1| Putative transcriptional regulatory protein [Chlamydia trachomatis 434/Bu] >gi|165931468|emb|CAP07044.1| Putative transcriptional regulatory protein [Chlamydia trachomatis L2b/UCH-1/proctitis] (392 aa)
Score = 161, Expect = 2.5e-09, Identities = 40/146 (27%), Positives = 86/146 (58%)
  Q:    19 YVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVV--IEESCKIISESTKLPMI----KIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNII 164
           Y+ +  PVGSK++ E Y  ++S+AT+RN  A LE  G L KNH S GR+P+   +++Y  + + P++  E +    + +      S ++V  ++++ +++S+  +LP+     + E+++ +    I +V I+ Q  + ++ T  G +  +++
  S:    30 YLESGQPVGSKLLEETYCSDLSSATIRNYFAQLETNGFLRKNHISGGRIPTDLAFRYY-ADHNAPFLEQEEILAIQQKLTELPEYSKNIVKDLQKASEVLSDILQLPVCFSSPRFESDSVI---NIQLVAIDDQRVVFVLSTEFGQVFTDVL 177
>gi|83945050|ref|ZP_00957416.1| heat-inducible transcription repressor [Oceanicaulis alexandrii HTCC2633] >gi|83851832|gb|EAP89687.1| heat-inducible transcription repressor [Oceanicaulis alexandrii HTCC2633] (344 aa)
Score = 161, Expect = 2.6e-09, Identities = 71/325 (21%), Positives = 145/325 (44%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDV-----------VIEESCKIISESTKLPMIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKTVHGQSSLL-AVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDE-----VSHEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKIKGLLEF 328
           + +R + + + +VE Y+ T  PVGS+ + +    N+S A++RN +A L   GLL   H S+GR+P+ AG + +               L+L ++ AD   +ID            V+ E+  ++S       +      +  L+ ++ V ++    + +++T DGN+   ++          +       + RL    + E  + I    S  + ++      L E     +    +    V GQS LL +V   +D E+++ +   +E       +  +  Q     L   G E     +S   ++ A    N + Q    + ++ PTR++Y++I  ++++
  S:     3 LDERSRSIFRDLVETYLDTGEPVGSRTLSKTSGLNLSPASIRNTLADLTAAGLLASPHVSAGRMPTHAGLRLFVDGL-----------LQLGDLEADDRHAIDSRVSAVGKRPEDVLTEASNLLSGLAGGAGLVASPAHDAPLRHVEFVNLSPTEVLAVLVTEDGNVENRLMRPPPGLPPAALIEAGNYLSARLRGRTLSEALSAIREEISAKQAQLDSAASALVEAGLADWAGPEQRTLIVRGQSRLLESVEAAEDLERIRMLFDDIERQEGLLSLLDEARQAQGVRLF-IGSENPLFSLSGSSVIVAPYR-NRDNQIIGAIGVIGPTRLNYARIIPIVDY 331
>gi|56550911|ref|YP_161750.1| heat-inducible transcription repressor [Zymomonas mobilis subsp. mobilis ZM4] >gi|61213252|sp|Q5NRL5|HRCA_ZYMMO Heat-inducible transcription repressor hrcA >gi|56542485|gb|AAV88639.1| transcriptional regulator [Zymomonas mobilis subsp. mobilis ZM4] (345 aa)
Score = 160, Expect = 3.0e-09, Identities = 76/326 (23%), Positives = 161/326 (49%)
  Q:     3 EITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVVIEESCK--IISESTKLPMIK------IENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDD---SILKDISICIRI-FNDRLIDCPIKEIATKIDSMKSIIKEKVKEYEFVLQELIERIFQI-----KSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTDLNI--------NEQNKTKLVMVAPTRVDYSKIKGLLEF 328
           E++ R +E+ + +VE Y+ +  PVGSK +  + + N+S A++R  +  LE  GLL   H S+GR+P+  G + +             ++L   +      +  DV+   S K  +++ +T L  +       +    E++LK++  V ++   A+ I++ SDG++   +I        S L + S  I   F+        K + ++ID  +S       E +    +LI+R   +     + + +  V GQS LL     +D ++ K++L+ LE       +  K +++ +  +      +  E+ +F+ +  ++        +      + ++ PTR++Y +I  +++F
  S:     8 ELSSRAREIFQLVVESYLGSGLPVGSKTLARQGV-NLSPASIRYVLQELETKGLLLSPHISAGRMPTELGLRLFVNGM---------MQLSEPSEEERSAIEADVIRGHSPKERLVNATTTLSGLSACAGLVLVPKQELVLKQLGFVVLDDNRALAIIVGSDGSVENRVIELSSGFPASALTEASNYINAHFSGYSFSEAKKRLFSQIDLERS-------ELDSAASDLIKRGLAVWSEDSRKRPVLIVRGQSHLLQDAS-EDLDRAKQLLEELEDKKEIAGLLEKVSESDAAQIF-----IGSENKLFSLSGSSVIASPYHGEDGHMVGVVAVIGPTRLNYGRIVPMVDF 335
>gi|76789125|ref|YP_328211.1| heat-inducible transcription repressor [Chlamydia trachomatis A/HAR-13] >gi|123606907|sp|Q3KLV9|HRCA_CHLTA Heat-inducible transcription repressor hrcA >gi|76167655|gb|AAX50663.1| HrcA [Chlamydia trachomatis A/HAR-13] (392 aa)
Score = 160, Expect = 3.9e-09, Identities = 40/146 (27%), Positives = 87/146 (59%)
  Q:    19 YVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVV--IEESCKIISESTKLPMI----KIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNII 164
           Y+ ++ PVGSK++ E Y  ++S+AT+RN  A LE  G L KNH S GR+P+   +++Y  + + P++  E +    + +      S ++V  ++++ +++S+  +LP+     + E+++ +    I +V I+ Q  + ++ T  G +  +++
  S:    30 YLESSQPVGSKLLKETYCSDLSSATIRNYFAQLETDGFLRKNHISGGRIPTDLAFRYY-VDHNVPFLEQEEILAIQQKLTELPEYSKNIVKDLQKASEVLSDILQLPVCFSSPRFESDSVI---NIQLVAIDDQRVVFVLSTEFGQVFTDVL 177
>gi|170287883|ref|YP_001738121.1| heat-inducible transcription repressor HrcA [Thermotoga sp. RQ2] >gi|170175386|gb|ACB08438.1| heat-inducible transcription repressor HrcA [Thermotoga sp. RQ2] (338 aa)
Score = 159, Expect = 4.1e-09, Identities = 33/82 (40%), Positives = 52/82 (63%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSK 82
           +K++  RQ+++L  IV +Y+    PV S+ V+E      S+AT+RNDM  LE LG + + HTS+GR+P+  G +FY +   K
  S:    12 LKKLNDRQRKVLYCIVREYIENKKPVSSQRVLEVSNIEFSSATIRNDMKKLEYLGYIYQPHTSAGRIPTDKGLRFYYEEMLK 93
>gi|15605119|ref|NP_219904.1| heat-inducible transcription repressor [Chlamydia trachomatis D/UW-3/CX] >gi|6686260|sp|P36426|HRCA_CHLTR Heat-inducible transcription repressor hrcA >gi|3328820|gb|AAC67991.1| HTH Transcriptional Repressor [Chlamydia trachomatis D/UW-3/CX] (392 aa)
Score = 159, Expect = 4.9e-09, Identities = 40/146 (27%), Positives = 85/146 (58%)
  Q:    19 YVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYINDENLKLKLRNVFADRTMSIDVV--IEESCKIISESTKLPMI----KIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNII 164
           Y+    PVGSK++ E Y  ++S+AT+RN  A LE  G L KNH S GR+P+   +++Y  + + P++  E +    + +      S ++V  ++++ +++S+  +LP+     + E+++ +    I +V I+ Q  + ++ T  G +  +++
  S:    30 YLEGGQPVGSKLLKETYCSDLSSATIRNYFAQLETDGFLRKNHISGGRIPTDLAFRYY-ADHNAPFLEQEEILAIQQKLTELPEYSKNIVKDLQKASEVLSDILQLPVCFSSPRFESDSVI---NIQLVAIDDQRVVFVLSTEFGQVFTDVL 177
>gi|15643614|ref|NP_228660.1| heat shock operon repressor HrcA [Thermotoga maritima MSB8] >gi|7387783|sp|Q9WZV5|HRCA_THEMA Heat-inducible transcription repressor hrcA >gi|52695564|pdb|1STZ|A Chain A, Crystal Structure Of A Hypothetical Protein At 2.2 A Resolution >gi|52695565|pdb|1STZ|B Chain B, Crystal Structure Of A Hypothetical Protein At 2.2 A Resolution >gi|52695566|pdb|1STZ|C Chain C, Crystal Structure Of A Hypothetical Protein At 2.2 A Resolution >gi|4981384|gb|AAD35933.1|AE001751_13 heat shock operon repressor HrcA [Thermotoga maritima MSB8] (338 aa)
Score = 159, Expect = 5.0e-09, Identities = 33/82 (40%), Positives = 52/82 (63%)
  Q:     1 MKEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSK 82
           +K++  RQ+++L  IV +Y+    PV S+ V+E      S+AT+RNDM  LE LG + + HTS+GR+P+  G +FY +   K
  S:    12 LKKLNDRQRKVLYCIVREYIENKKPVSSQRVLEVSNIEFSSATIRNDMKKLEYLGYIYQPHTSAGRIPTDKGLRFYYEEMLK 93
>gi|148269221|ref|YP_001243681.1| heat-inducible transcription repressor HrcA [Thermotoga petrophila RKU-1] >gi|166220410|sp|A5IIT2|HRCA_THEP1 Heat-inducible transcription repressor hrcA >gi|147734765|gb|ABQ46105.1| heat-inducible transcription repressor HrcA [Thermotoga petrophila RKU-1] (338 aa)
Score = 158, Expect = 6.6e-09, Identities = 33/81 (40%), Positives = 51/81 (62%)
  Q:     2 KEITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSK 82
           K++  RQ+++L  IV +Y+    PV S+ V+E      S+AT+RNDM  LE LG + + HTS+GR+P+  G +FY +   K
  S:    13 KKLNDRQRKVLYCIVREYIENKKPVSSQRVLEVSNIEFSSATIRNDMKKLEYLGYIYQPHTSAGRIPTDKGLRFYYEEMLK 93
>gi|167957523|ref|ZP_02544597.1| Transcriptional regulator of heat shock gene [candidate division TM7 single-cell isolate TM7c] (237 aa)
Score = 154, Expect = 1.7e-08, Identities = 29/73 (39%), Positives = 49/73 (67%)
  Q:     4 ITQRQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFY 76
           +T RQ  +L  I+E Y   A PVGS ++ + +   +S+AT+R++M  LE +G + + HTS+GR+P+  GY++Y
  S:     1 MTDRQSHILIAIIEQYAEIAAPVGSVMLAKLF--GVSSATIRSEMVKLEHMGYIMQPHTSAGRIPTDKGYRYY 71
>gi|46447131|ref|YP_008496.1| heat-inducible transcription repressor [Candidatus Protochlamydia amoebophila UWE25] >gi|61213458|sp|Q6MB28|HRCA_PARUW Heat-inducible transcription repressor hrcA >gi|46400772|emb|CAF24221.1| putative Heat-inducible transcription repressor hrcA [Candidatus Protochlamydia amoebophila UWE25] (385 aa)
Score = 154, Expect = 1.9e-08, Identities = 74/325 (22%), Positives = 147/325 (45%)
  Q:     7 RQKELLKYIVEDYVATANPVGSKVVIEKYMPNISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEK---NFSKPYINDENLKLKLRNVFAD-RTMSIDVVIEESCKIISESTKLPM-IKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATKIDSMKSIIKEKVKEY-EFVLQELIERIFQIKSKMIKTVHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVSHEDIVFAQTD---------LNINEQNKTKLVMVAPTRVDYSKIKGLLEFIKN 331
           R++ +L  +V+ Y+ T  PVGS  + E    ++S+AT+RN  A LE+ G L ++H+S GR+P+   Y+ Y     N ++PY      +      F    +  I + ++E+ + +S  T   + +         +  + +V ++    + I++T  G +   ++H      +K  S  I+   +    C +  +    +            Y E +L+ ++     I   + +T  G S LL   +FQDT  L   L + E+     ++  K+ +  ++     GD++S     FA +            IN +    + ++ PTR+ Y  +  LL+   +
  S:    17 RERRVLLGLVDYYIQTGKPVGSNTLKEAGFEDLSSATIRNYFAQLEEEGYLLQSHSSGGRIPTDLAYRIYAHAYLNTNEPYPKQNPFE-----AFKSFESKEIAIFLQEAAEKLSWETNCAVFLSAPRFDHDFIANLKLVPLDAYRCLCIIMTDFGVIKTEVMHLP----VKLSSFGIKRI-ENYFHCRLTNLGEPENLEPEEETVAQTFYNELMLRYIVGYSNFIDVDLYRT--GFSRLLFYSDFQDTNLLASSLSLFENAHSM-RLLLKECKALNHLRFWIGDDLSS----FANSSPRCSVLTIPYYINYKPVGAVGLLGPTRLPYRALFSLLKLFSD 339
>gi|110833173|ref|YP_692032.1| heat-inducible transcription repressor hrcA [Alcanivorax borkumensis SK2] >gi|110646284|emb|CAL15760.1| Heat-inducible transcription repressor hrcA [Alcanivorax borkumensis SK2] (309 aa)
Score = 148, Expect = 9.6e-08, Identities = 64/284 (22%), Positives = 133/284 (46%)
  Q:    39 ISAATVRNDMAFLEKLGLLEKNHTSSGRVPSTAGYKFYEKNFSKPYI----NDENLKLKLRNVFADRTMSIDVVIEESCKIISESTKLP-MIKIENNTEVLLKRIDMVEINKQSAMVIVITSDGNLTKNIIHFKDDSILKDISICIRIFNDRLIDCPIKEIATK-IDSMKSIIKEKVKEYEFVLQELIERIFQIKSKMIKT--------VHGQSSLLAVPEFQDTEKLKEILQILESTSIWEQIAFKQNQTGSNTLITFGDEVS---HEDIVFAQTDLNINEQNKTKLVMVAPTRVDYSKI 322
           +S ATVRN M+ LE+LG+L   HTS+GRVP+  GY+ Y  +     +    +  +LK +LR + A    S +++ + S K ++E T++  ++ +       L++++ + ++ +  +V+++ +   +   IIH   D    ++       N       +  I    +D+M +  ++        +  L++    +  K ++T        V G+S+L+   E ++  +L+ +            +  +++       I  G E      ED          ++     L +V PTR+DY K+
  S:     1 MSPATVRNIMSELEELGVLSSPHTSAGRVPTELGYRLYVDSLLATSVMERPDHRHLKKELRQLLAPEQSSQELIAQAS-KTLAELTRMAGLVAVPRREVSTLRQVEFLPLSGKRVLVVLVVNRSEVQNRIIHTDRDYDGVELRQAANYINHTYAGWDLNSICDGLLDTMNTDRQQ--------MDALMQTAVAVADKALRTERPDSDYVVSGESNLIQTAEAENLGQLRNLFDAFNHKRDILHL-LERSMKADGVQIFIGRESGFQPFEDYSLISAPYTTDDGPMGVLAVVGPTRMDYGKV 291