>gi|26553524|ref|NP_757458.1| hypothetical protein MYPE720 [Mycoplasma penetrans HF-2] >gi|26453530|dbj|BAC43862.1| hypothetical protein [Mycoplasma penetrans HF-2] (181 aa)
Score = 731, Expect = 5.8e-76, Identities = 181/181 (100%), Positives = 181/181 (100%)
  Q:     1 MSLKKGENKNIKISLSSYKFFLKRKMSHLFVPKKKRNNLELKISLIFSLIYISLITNQRFWKLNKKTIIEVYDIFFVKCTDDLKQNLISILETATKKINYGFKLDDLNVYDLYDHVESFYSNCEILEYFKKMKKLKRVYISEEEMGQFITINQNLKFILNFIKITSPTRFNSIYRKLMNLV 181
           MSLKKGENKNIKISLSSYKFFLKRKMSHLFVPKKKRNNLELKISLIFSLIYISLITNQRFWKLNKKTIIEVYDIFFVKCTDDLKQNLISILETATKKINYGFKLDDLNVYDLYDHVESFYSNCEILEYFKKMKKLKRVYISEEEMGQFITINQNLKFILNFIKITSPTRFNSIYRKLMNLV
  S:     1 MSLKKGENKNIKISLSSYKFFLKRKMSHLFVPKKKRNNLELKISLIFSLIYISLITNQRFWKLNKKTIIEVYDIFFVKCTDDLKQNLISILETATKKINYGFKLDDLNVYDLYDHVESFYSNCEILEYFKKMKKLKRVYISEEEMGQFITINQNLKFILNFIKITSPTRFNSIYRKLMNLV 181
>gi|156049559|ref|XP_001590746.1| hypothetical protein SS1G_08486 [Sclerotinia sclerotiorum 1980] >gi|154692885|gb|EDN92623.1| hypothetical protein SS1G_08486 [Sclerotinia sclerotiorum 1980] (4282 aa)
Score = 83, Expect = 8.3e-01, Identities = 21/73 (28%), Positives = 38/73 (52%)
  Q:    13 ISLSSYKFFLKRKMSHLFVPKKKRNNLELKISLIFSLIYISLITNQRFWKLNKKTIIEVYDIFFVKCTDDLKQ 85
           +S  S+  FL  +++  FVP+   +N+E +   + SL+ I L    RF    ++ +  V+    +  T+DLKQ
  S:  3889 VSSESWDRFLSEELAENFVPQVWDDNVEKRDQELISLLLIKLFRLDRFVPAAERFVTAVFGSGLLDVTEDLKQ 3961