>gi|26553525|ref|NP_757459.1| 1-deoxy-D-xylulose-5-phosphate synthase [Mycoplasma penetrans HF-2] >gi|30315825|sp|Q8EWX7|DXS_MYCPE 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|26453531|dbj|BAC43863.1| deoxyxylulose-5-phosphate synthase [Mycoplasma penetrans HF-2] (612 aa)
Score = 2936, Expect = 0.0e+00, Identities = 612/612 (100%), Positives = 612/612 (100%)
  Q:     1 MKKNKVKIDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           MKKNKVKIDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS
  S:     1 MKKNKVKIDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
>gi|16800470|ref|NP_470738.1| 1-deoxy-D-xylulose-5-phosphate synthase [Listeria innocua Clip11262] >gi|21263529|sp|Q92BZ0|DXS_LISIN 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|16413875|emb|CAC96633.1| tktB [Listeria innocua] (632 aa)
Score = 936, Expect = 8.7e-99, Identities = 227/582 (39%), Positives = 325/582 (55%)
  Q:    10 KIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKSKS--VIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLT----EKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTIN---VLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHS---LKLSDPNLNSNNQT---YGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKC---EDIEVKKEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKT-----KSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLS-CNIKKINIRNNKIGFGN 591
           KI +    K++ + EL  LA  +R  +I  +     H+  NLG+VEL++AL Y F+SP D   +D GHQ YVHK++T RA +  T+R+  GL GF +  ESIHD   TGHS   LS   G +   + K +   VIP+IGD A++ G+AFEALN+I      M++I+NDN MSI+ NVGALH ++ K + S +   T    +K++RKI    E   K+  +  K+   +        FFE LGF Y G IDG+NL+  I    + KR K     GP +LH+ T KG GY+ AELD +G +H     K+   +     +T   + SV +N L +L   D  I  I PAM + S     +K FP  + DVGIAE+HA T AAG+A    K F++IYSTFLQR+YD L+HDV R +L +   +DR  L  +DG+TH GI+DI FL SIPN IIT   ++ E  +L+  A+     PF IRY +      E  E  K    G W   +Q  ++   I+++G  +    K  +      + + +INA FI    +  + RI      I  VE+       G  ++    EN  +   I +I + +  IG G+
  S:    10 KIKDPSFMKQLDIQELEALAADIRAFLITSTSKSGGHIGPNLGVVELTIALHYTFNSPNDKFIWDVGHQSYVHKILTGRASQFDTLRQHGGLDGFPKRKESIHDVFETGHSSTSLSAAVGMVIARDIKKEDFYVIPIIGDGALTGGMAFEALNHIGDMGKDMIVILNDNDMSIAPNVGALHNVLGKLRTSNTFQQTKTNIDKLMRKIPTAGE---KLADTAEKAKDGIKHLLVEGTFFEELGFMYLGPIDGHNLEDVITNLEIAKRTK-----GPVLLHIITKKGKGYQPAELDSRGTWHGTGPYKVETGSFIKPAKTVASWSSVISNELMRLAANDERIVAITPAMPVGSKLEKFAKTFPERFFDVGIAEQHATTMAAGLATQAMKPFLAIYSTFLQRAYDQLVHDVCRQKLNVVIGIDRAGLVGADGETHQGIFDISFLNSIPNMIITMPKDEEEARQLMDTAFAYDDGPFAIRYPRGNGPGKELSESSKLIPIGEWETIIQPVDA--VILTFGPTLEQALKAAEQLEDLGQRVGVINARFIKPLDEALLHRIFKQKIPILTVEESLLKGGFGASVLEFMEENNYTDVTIHRIGLPDEFIGHGS 605
>gi|116872796|ref|YP_849577.1| 1-deoxy-D-xylulose-5-phosphate synthase [Listeria welshimeri serovar 6b str. SLCC5334] >gi|123458452|sp|A0AIG6|DXS_LISW6 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|116741674|emb|CAK20798.1| tktB [Listeria welshimeri serovar 6b str. SLCC5334] (634 aa)
Score = 936, Expect = 9.0e-99, Identities = 229/602 (38%), Positives = 335/602 (55%)
  Q:    10 KIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKSKS--VIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLT----EKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHS---LKLSDPNLNSNNQT---YGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKE---FSFGSWVYALQTKESKTCIISYGDIINDLKK-----EIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLI-ILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIK 611
           KI +    K++ + EL  LA  +R  +I  +     H+  NLG+VEL++AL Y F+SP+D   +D GHQ YVHK++T RA++  T+R+  GL GF +  ESIHD   TGHS   LS   G +   + K +   VIP+IGD A++ G+AFEALN+I      M++I+NDN MSI+ NVGALH ++ K + S     T    +K++RKI    E   K+  +  K+   L        FFE LGF Y G IDG+NL+  +  L+  K     GP ILHV T KG GY+ AELD +G +H     K+   +   + +T   + SV +N L +L   D  I  I PAM + S     +K FP  + DVGIAE+HA T AAG+A    K F++IYSTFLQR+YD L+HDV R +L +   +DR  L  +DG+TH GI+DI FL SIPN IIT   ++ E  +L++ A+   + PF IRY +     +E+ +       G W   +Q  ++   I+++G  I    K     E +   + +INA FI    +  + +++     I  VE+       G  ++  +   N     I +I + +  I  G+   I +   I    I  +IK
  S:     5 KIKDPSFMKQLDIKELEALAADIRAFLITSTSKSGGHIGPNLGVVELTIALHYTFNSPKDKFIWDVGHQSYVHKILTGRANQFDTLRKHGGLDGFPKRKESIHDVFETGHSSTSLSAACGMVIARDIKKEDFYVIPIIGDGALTGGMAFEALNHIGDMGKDMIVILNDNDMSIAPNVGALHNVLGKLRTSDKFQQTKTNIDKLIRKIPTAGE---KLADTAEKTKDSLKHLLVNGTFFEELGFMYLGPIDGHNLEDILTNLEIAKR--ARGPVILHVVTKKGKGYQPAELDSRGTWHGTGPYKVETGSFIKSVKTAPSWSSVISNELMRLATADERIVAITPAMPVGSKLEKFAKAFPERFFDVGIAEQHATTMAAGLATQGMKPFLAIYSTFLQRAYDQLVHDVCRQKLNVVIGIDRAGLVGADGETHQGIFDISFLNSIPNMIITMPKDEVEARQLMVTAFDYDAGPFAIRYPRGNGLGVELTESNTLIPIGEWETIIQPIDA--VIVTFGPTIQLALKAADQLETEGYRVGVINARFIKPLDETLLHQMIKQKIPILTVEESLLKGGFGASVLEFIETNNYTDVAIHRIGLPDEFISHGSVPVILESYGISEAGIELKIK 620
>gi|160915115|ref|ZP_02077328.1| hypothetical protein EUBDOL_01123 [Eubacterium dolichum DSM 3991] >gi|158432914|gb|EDP11203.1| hypothetical protein EUBDOL_01123 [Eubacterium dolichum DSM 3991] (625 aa)
Score = 927, Expect = 9.0e-98, Identities = 214/596 (35%), Positives = 326/596 (54%)
  Q:    16 DFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGF-IEKNNSKSK-SVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNSN-------NQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKC--EDIEVKKEFSFGSWVYALQTKESKTCIISYGDIINDL--KKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIK 611
           D K     EL +LA  +R+ +I        HLSSNLGIVEL++AL YVFDSP+D   +D GHQ YVHKM+T R    S +R+  G++GFQ+  ES+HD    GHS   LS   G  + ++   S   ++P+IGD A+S G+A EALN I   +  M+II NDN MSISKNVGA+ +  ++ + S+S    +  L+  L        +  ++ +  + +       + F      Y G +DG+N+K  + VLK  K     GP +LHV T KG GY  AE D++G +H +   DP    +       ++++  V +  +  L   + +I  I PAM   S      + +P    D GIAEEHA+T AAG+A A K+ F+S+YS+FLQR+YD + HDVAR++LP+   +DRC L   DG+THHG++DI  L+ IPN I+    +  E + LI  A+Q    P+ IRY +     + +        G+W Y   T E +  +ISYG  ++ +  K E    S+ ++NA F   +  E +  + +    I V E       L   ++  AN++ L     +I +R++ +  G+   + K   +D+ ++F  IK
  S:    11 DIKSCSFEELNELAGDIREFLIQSISKTGGHLSSNLGIVELTLALHYVFDSPKDKFIFDVGHQSYVHKMLTGRLKDFSNLRQYKGIAGFQKRGESVHDPWEAGHSSTSLSAALGMAVARDLDGSHFHILPIIGDGALSGGMAMEALNQIGSEQRNMIIIFNDNNMSISKNVGAMDEAFTRLRTSRSYTHLKDDLKHSLSTTRLGSNVLDTMKRVKNAVKDNIVDTSIFGEFNIDYLGPVDGHNIKNLVKVLKIAKQ--HEGPIVLHVITQKGKGYSFAEHDEEGAWHGVSQFDPKTGQSLAKNPPQHKSWSEVISATVLDLAHDNQDIVAITPAMKSGSKLQKFFEAYPQRSFDCGIAEEHAMTFAAGLAAAGKRPFISVYSSFLQRAYDQIHHDVARMKLPVVIGIDRCGLVGEDGETHHGVFDIAMLRPIPNMILAQPKDSEEAQNLIYSAFQQNQYPYAIRYPRGSVPYKKLSAYSYIEAGTWSYQ-DTGEPQLVVISYGSDVDKIVQKAEANQLSLRVVNARFFKPFDTEMLEELCAMQLPIIVYESDVQIGGLSSAIVEYANDHGLKNTFVRIGLRDHFVEHGSIPKLRKVEQVDLGTLFQVIK 616
>gi|47095948|ref|ZP_00233551.1| 1-deoxy-D-xylulose-5-phosphate synthase [Listeria monocytogenes str. 1/2a F6854] >gi|47015694|gb|EAL06624.1| 1-deoxy-D-xylulose-5-phosphate synthase [Listeria monocytogenes str. 1/2a F6854] (604 aa)
Score = 903, Expect = 5.5e-95, Identities = 221/602 (36%), Positives = 323/602 (53%)
  Q:    10 KIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKSKS--VIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNS------NNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKE---FSFGSWVYALQTKESKTCIISYGDIINDLKK-----EIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLI--ILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIK 611
           KI +    K++ + EL  LA  +R  +I  +     H+  NLG+VEL++AL Y F+SP+D   +D GHQ YVHK++T RA++  T+RE  GL GF +  ESIHD   TGHS   LS   G +   + K +   VIP+IGD A++ G+A EALN+I      M++I+NDN MSI+ NVGA+H I+ K + S +                             SK +K      FFE LGF Y G IDG+++++ I  L+  K     GP +LH+ T KG GY+ AELD +G +H          S         ++ SV +N L +L E D  I  I PAM + S     +K FP  + DVGIAE+HA T AAG+A    K F++IYSTFLQR+YD L+HDV R +L +   +DR  L  +DG+TH GI+DI FL SIPN  I+   ++ E  +L+  A+     PF IRY + +   ++V +       G W   +Q  ++   I+++G  I    K     EI+   + +INA +I    +  + +IL     I  VE+       G  ++  I AN N     + +I + +  I  G+   I +   I    +  +IK
  S:     5 KIKDPSFMKRLDIQELEALAADIRAFLITSTSKSGGHIGPNLGVVELTIALHYSFNSPKDKFIWDVGHQSYVHKILTGRANQFGTLREHGGLDGFPKRKESIHDVFETGHSSTSLSAAAGMVIARDIKKEDFYVIPIIGDGALTGGMALEALNHIGDMGKDMIVILNDNDMSIAPNVGAIHNILGKLRTSDT-----------------------------SKQTKTNVDGAFFEELGFMYLGPIDGHDIEEVITNLELAKRAK--GPVLLHIVTKKGKGYQPAELDSRGTWHGTGPYKVETGSFIKPAKRAASWSSVISNELIRLAEMDERIVAITPAMPVGSKLEKFAKAFPERFFDVGIAEQHATTMAAGLATQGMKPFLAIYSTFLQRAYDQLVHDVCRQKLNVVIGIDRAGLVGADGETHQGIFDISFLNSIPNMTISMPKDEVEARQLMDTAFSYNDGPFAIRYPRGEAPGVQVVESNTLIPIGQWETIIQPLDA--VILTFGPTIELALKAAEQLEIEGYRVGVINARYIKPLDEALLHKILKQKIPILTVEESLLKGGFGASVLEFIEAN-NYRDVIMHRIGLPDEFISHGSVSIILESFGISTTGLVLKIK 590
>gi|16803405|ref|NP_464890.1| 1-deoxy-D-xylulose-5-phosphate synthase [Listeria monocytogenes EGD-e] >gi|153179431|ref|ZP_01932650.1| 1-deoxy-D-xylulose-5-phosphate synthase [Listeria monocytogenes F6900] >gi|153183725|ref|ZP_01934542.1| 1-deoxy-D-xylulose-5-phosphate synthase [Listeria monocytogenes J0161] >gi|153190761|ref|ZP_01938124.1| 1-deoxy-D-xylulose-5-phosphate synthase [Listeria monocytogenes J2818] >gi|153196143|ref|ZP_01940551.1| 1-deoxy-D-xylulose-5-phosphate synthase [Listeria monocytogenes 10403S] >gi|21263515|sp|Q8Y7C1|DXS_LISMO 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|16410781|emb|CAC99443.1| tktB [Listeria monocytogenes] >gi|126943377|gb|EBA21098.1| 1-deoxy-D-xylulose-5-phosphate synthase [Listeria monocytogenes J0161] >gi|127634425|gb|EBA23811.1| 1-deoxy-D-xylulose-5-phosphate synthase [Listeria monocytogenes 10403S] >gi|127765745|gb|EBA26090.1| 1-deoxy-D-xylulose-5-phosphate synthase [Listeria monocytogenes J2818] >gi|133732916|gb|EBA34614.1| 1-deoxy-D-xylulose-5-phosphate synthase [Listeria monocytogenes F6900] (609 aa)
Score = 903, Expect = 5.8e-95, Identities = 221/602 (36%), Positives = 323/602 (53%)
  Q:    10 KIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKSKS--VIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNS------NNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKE---FSFGSWVYALQTKESKTCIISYGDIINDLKK-----EIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLI--ILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIK 611
           KI +    K++ + EL  LA  +R  +I  +     H+  NLG+VEL++AL Y F+SP+D   +D GHQ YVHK++T RA++  T+RE  GL GF +  ESIHD   TGHS   LS   G +   + K +   VIP+IGD A++ G+A EALN+I      M++I+NDN MSI+ NVGA+H I+ K + S +                             SK +K      FFE LGF Y G IDG+++++ I  L+  K     GP +LH+ T KG GY+ AELD +G +H          S         ++ SV +N L +L E D  I  I PAM + S     +K FP  + DVGIAE+HA T AAG+A    K F++IYSTFLQR+YD L+HDV R +L +   +DR  L  +DG+TH GI+DI FL SIPN  I+   ++ E  +L+  A+     PF IRY + +   ++V +       G W   +Q  ++   I+++G  I    K     EI+   + +INA +I    +  + +IL     I  VE+       G  ++  I AN N     + +I + +  I  G+   I +   I    +  +IK
  S:    10 KIKDPSFMKRLDIQELEALAADIRAFLITSTSKSGGHIGPNLGVVELTIALHYSFNSPKDKFIWDVGHQSYVHKILTGRANQFGTLREHGGLDGFPKRKESIHDVFETGHSSTSLSAAAGMVIARDIKKEDFYVIPIIGDGALTGGMALEALNHIGDMGKDMIVILNDNDMSIAPNVGAIHNILGKLRTSDT-----------------------------SKQTKTNVDGAFFEELGFMYLGPIDGHDIEEVITNLELAKRAK--GPVLLHIVTKKGKGYQPAELDSRGTWHGTGPYKVETGSFIKPAKRAASWSSVISNELIRLAEMDERIVAITPAMPVGSKLEKFAKAFPERFFDVGIAEQHATTMAAGLATQGMKPFLAIYSTFLQRAYDQLVHDVCRQKLNVVIGIDRAGLVGADGETHQGIFDISFLNSIPNMTISMPKDEVEARQLMDTAFSYNDGPFAIRYPRGEAPGVQVVESNTLIPIGQWETIIQPLDA--VILTFGPTIELALKAAEQLEIEGYRVGVINARYIKPLDEALLHKILKQKIPILTVEESLLKGGFGASVLEFIEAN-NYRDVIMHRIGLPDEFISHGSVSIILESFGISTTGLVLKIK 595
>gi|153174470|ref|ZP_01929971.1| 1-deoxy-D-xylulose-5-phosphate synthase [Listeria monocytogenes FSL N3-165] >gi|133730074|gb|EBA31772.1| 1-deoxy-D-xylulose-5-phosphate synthase [Listeria monocytogenes FSL N3-165] (609 aa)
Score = 902, Expect = 7.3e-95, Identities = 218/602 (36%), Positives = 321/602 (53%)
  Q:    10 KIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKSKS--VIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNS------NNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKE---FSFGSWVYALQTKESKTCIISYGDIINDLKK-----EIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLI-ILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIK 611
           KI +    K++ + EL  LA  +R  +I  +     H+  NLG+VEL++AL Y F+SP+D   +D GHQ YVHK++T RA++  T+RE  GL GF +  ESIHD   TGHS   LS   G +   + K +   VIP+IGD A++ G+A EALN+I      M++I+NDN MSI+ NVGA+H I+ K + S +                             SK +K      FFE LGF Y G IDG+++++ I  L+  K     GP +LH+ T KG GY+ AELD +G +H          S         ++ SV +N L +L E D  I  I PAM + S     +K FP  + DVGIAE+HA T AAG+A    K F++IYSTFLQR+YD L+HDV R +L +   +DR  L  +DG+TH GI+DI FL SIPN  I+   ++ E  +L+  A+     PF IRY + +   ++V +       G W   +Q  ++   I+++G  I    K     EI+   + +INA +I    +  + +IL     I  VE+       G  ++  +   N     + +I + +  I  G+   I +   I    +  +IK
  S:    10 KIKDPSFMKRLDIQELEALAADIRAFLITSTSKSGGHIGPNLGVVELTIALHYSFNSPKDKFIWDVGHQSYVHKILTGRANQFGTLREHGGLDGFPKRKESIHDVFETGHSSTSLSAAAGMVIARDIKKEDFYVIPIIGDGALTGGMALEALNHIGDMGKDMIVILNDNDMSIAPNVGAIHNILGKLRTSDT-----------------------------SKQTKTNVDGAFFEELGFMYLGPIDGHDIEEVITNLELAKRAK--GPVLLHIVTKKGKGYQPAELDSRGTWHGTGPYKVETGSFIKPAKRAASWSSVISNELIRLAEMDERIVAITPAMPVGSKLEKFAKAFPERFFDVGIAEQHATTMAAGLATQGMKPFLAIYSTFLQRAYDQLVHDVCRQKLNVVIGIDRAGLVGADGETHQGIFDISFLNSIPNMTISMPKDEVEARQLMDTAFSYNDGPFAIRYPRGEAPGVQVVESNTLIPIGQWETIIQPLDA--VILTFGPTIELALKAAEQLEIEGYHVGVINARYIKPLDEALLHQILKQKIPILTVEESLLKGGFGASVLEFIEANNYRDVIMHRIGLPDEFISHGSVSIILESFGISTTGLVLKIK 595
>gi|47093752|ref|ZP_00231502.1| 1-deoxy-D-xylulose-5-phosphate synthase [Listeria monocytogenes str. 4b H7858] >gi|47017873|gb|EAL08656.1| 1-deoxy-D-xylulose-5-phosphate synthase [Listeria monocytogenes str. 4b H7858] (593 aa)
Score = 889, Expect = 2.1e-93, Identities = 215/594 (36%), Positives = 317/594 (53%)
  Q:    18 KKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKSKS--VIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNS------NNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKE---FSFGSWVYALQTKESKTCIISYGDIINDLKK-----EIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLI-ILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIK 611
           K++ + EL  LA  +R  +I  +     H+  NLG+VEL++AL Y F+SP+D   +D GHQ YVHK++T RA +  T+RE  GL GF +  ESIHD   TGHS   LS   G +   + K +   VIP+IGD A++ G+A EALN+I      M++I+NDN MSI+ NVGA+H I+ K + S +            FK+  +K                     FFE LGF Y G I+G+++++ I  L+  K     GP +LH+ T KG GY+ AELD +G +H          S         ++ SV +N L +L E D  I  I PAM + S     +K FP  + DVGIAE+HA T AAG+A    K F++IYSTFLQR+YD L+HDV R +L +   +DR  L  +DG+TH GI+DI FL SIPN  I+   ++ E  +L+  A+     PF IRY + +    +V +       G W   +Q  ++   I+++G  I    K     E++   + +INA +I    +  + +IL     I  VE+       G  ++  +   N     + +I + +  I  G+   I +   I    I  +IK
  S:     2 KQLDIQELEALAADIRAFLITSTSKSGGHIGPNLGVVELTIALHYSFNSPKDKFIWDVGHQSYVHKILTGRASQFGTLREHGGLDGFPKRKESIHDVFETGHSSTSLSAAAGMVIARDIKKEEFYVIPIIGDGALTGGMALEALNHIGDMGKDMIVILNDNDMSIAPNVGAIHNILGKLRTSDT------------FKQTKAKV-----------------DGTFFEELGFMYLGPINGHDIEEVITNLELAKRTK--GPVLLHIVTKKGKGYQPAELDSRGTWHGTGPYKVETGSFIKPAKRAASWSSVISNELIRLAEKDERIVAITPAMPVGSKLEKFAKAFPERFFDVGIAEQHATTMAAGLATQGMKPFLTIYSTFLQRAYDQLVHDVCRQKLNVVIGIDRAGLVGADGETHQGIFDISFLNSIPNMTISMPKDEVEARQLMDTAFSYNDGPFAIRYPRGEAPGAQVAESNTLIPIGKWETIIQPIDA--VILTFGPTIRLALKAAEQLELEGYHVGVINARYIKPLDEALLHQILKQKIPILTVEESLLKGGFGASVLEFIEASNYSDVVMHRIGLPDEFISHGSVSIILESFGISTTGIVLKIK 579
>gi|46907591|ref|YP_013980.1| 1-deoxy-D-xylulose-5-phosphate synthase [Listeria monocytogenes str. 4b F2365] >gi|67460117|sp|Q71ZV7|DXS_LISMF 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|46880859|gb|AAT04157.1| 1-deoxy-D-xylulose-5-phosphate synthase [Listeria monocytogenes str. 4b F2365] (609 aa)
Score = 889, Expect = 2.2e-93, Identities = 217/602 (36%), Positives = 320/602 (53%)
  Q:    10 KIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKSKS--VIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNS------NNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKE---FSFGSWVYALQTKESKTCIISYGDIINDLKK-----EIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLI-ILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIK 611
           KI +    K++ + EL  LA  +R  +I  +     H+  NLG+VEL++AL Y F+SP+D   +D GHQ YVHK++T RA +  T+RE  GL GF +  ESIHD   TGHS   LS   G +   + K +   VIP+IGD A++ G+A EALN+I      M++I+NDN MSI+ NVGA+H I+ K + S +            FK+  +K                     FFE LGF Y G I+G+++++ I  L+  K     GP +LH+ T KG GY+ AELD +G +H          S         ++ SV +N L +L E D  I  I PAM + S     +K FP  + DVGIAE+HA T AAG+A    K F++IYSTFLQR+YD L+HDV R +L +   +DR  L  +DG+TH GI+DI FL SIPN  I+   ++ E  +L+  A+     PF IRY + +    +V +       G W   +Q  ++   I+++G  I    K     E++   + +INA +I    +  + +IL     I  VE+       G  ++  +   N     + +I + +  I  G+   I +   I    I  +IK
  S:    10 KIKDPSFMKQLDIQELEALAADIRAFLITSTSKSGGHIGPNLGVVELTIALHYSFNSPKDKFIWDVGHQSYVHKILTGRASQFGTLREHGGLDGFPKRKESIHDVFETGHSSTSLSAAAGMVIARDIKKEEFYVIPIIGDGALTGGMALEALNHIGDMGKDMIVILNDNDMSIAPNVGAIHNILGKLRTSDT------------FKQTKAKV-----------------DGTFFEELGFMYLGPINGHDIEEVITNLELAKRTK--GPVLLHIVTKKGKGYQPAELDSRGTWHGTGPYKVETGSFIKPAKRAASWSSVISNELIRLAEKDERIVAITPAMPVGSKLEKFAKAFPERFFDVGIAEQHATTMAAGLATQGMKPFLTIYSTFLQRAYDQLVHDVCRQKLNVVIGIDRAGLVGADGETHQGIFDISFLNSIPNMTISMPKDEVEARQLMDTAFSYNDGPFAIRYPRGEAPGAQVAESNTLIPIGKWETIIQPIDA--VILTFGPTIRLALKAAEQLELEGYHVGVINARYIKPLDEALLHQILKQKIPILTVEESLLKGGFGASVLEFIEASNYSDVVMHRIGLPDEFISHGSVSIILESFGISTTGIVLKIK 595
>gi|153166752|ref|ZP_01927256.1| 1-deoxy-D-xylulose-5-phosphate synthase [Listeria monocytogenes FSL N1-017] >gi|133727376|gb|EBA29074.1| 1-deoxy-D-xylulose-5-phosphate synthase [Listeria monocytogenes FSL N1-017] (609 aa)
Score = 888, Expect = 2.6e-93, Identities = 217/602 (36%), Positives = 320/602 (53%)
  Q:    10 KIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKSKS--VIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNS------NNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKE---FSFGSWVYALQTKESKTCIISYGDIINDLKK-----EIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLI-ILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIK 611
           KI +    K++ + EL  LA  +R  +I  +     H+  NLG+VEL++AL Y F+SP+D   +D GHQ YVHK++T RA +  T+RE  GL GF +  ESIHD   TGHS   LS   G +   + K +   VIP+IGD A++ G+A EALN+I      M++I+NDN MSI+ NVGA+H I+ K + S +            FK+  +K                     FFE LGF Y G I+G+++++ I  L+  K     GP +LH+ T KG GY+ AELD +G +H          S         ++ SV +N L +L E D  I  I PAM + S     +K FP  + DVGIAE+HA T AAG+A    K F++IYSTFLQR+YD L+HDV R +L +   +DR  L  +DG+TH GI+DI FL SIPN  I+   ++ E  +L+  A+     PF IRY + +    +V +       G W   +Q  ++   I+++G  I    K     E++   + +INA +I    +  + +IL     I  VE+       G  ++  +   N     + +I + +  I  G+   I +   I    I  +IK
  S:    10 KIKDPSFMKQLDIQELEALAADIRAFLITSTSKSGGHIGPNLGVVELTIALHYSFNSPKDKFIWDVGHQSYVHKILTGRASQFGTLREHGGLDGFPKRKESIHDVFETGHSSTSLSAAAGMVIARDIKKEEFYVIPIIGDGALTGGMALEALNHIGDMGKDMIVILNDNDMSIAPNVGAIHNILGKLRTSDT------------FKQTKAKV-----------------DGTFFEELGFMYLGPINGHDIEEVITNLELAKRTK--GPVMLHIVTKKGKGYQPAELDSRGTWHGTGPYKVETGSFIKPAKRAASWSSVISNELIRLAEKDERIVAITPAMPVGSKLEKFAKAFPERFFDVGIAEQHATTMAAGLATQGMKPFLTIYSTFLQRAYDQLVHDVCRQKLNVVIGIDRAGLVGADGETHQGIFDISFLNSIPNMTISMPKDEVEARQLMDTAFSYNDGPFAIRYPRGEAPGAQVAESNTLIPIGKWETIIQPIDA--VILTFGPTIRLALKAAEQLELEGYHVGVINARYIKPLDEALLHQILKQKIPILTVEESLLKGGFGASVLEFIEASNYSDVVMHRIGLPDEFISHGSVSIILESFGISTTGIVLKIK 595
>gi|153202204|ref|ZP_01943833.1| 1-deoxy-D-xylulose-5-phosphate synthase [Listeria monocytogenes HPB2262] >gi|133735487|gb|EBA37185.1| 1-deoxy-D-xylulose-5-phosphate synthase [Listeria monocytogenes HPB2262] (609 aa)
Score = 887, Expect = 3.4e-93, Identities = 217/602 (36%), Positives = 320/602 (53%)
  Q:    10 KIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKSKS--VIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNS------NNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKE---FSFGSWVYALQTKESKTCIISYGDIINDLKK-----EIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLI-ILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIK 611
           KI +    K++ + EL  LA  +R  +I  +     H+  NLG+VEL++AL Y F+SP+D   +D GHQ YVHK++T RA +  T+RE  GL GF +  ESIHD   TGHS   LS   G +   + K +   VIP+IGD A++ G+A EALN+I      M++I+NDN MSI+ NVGA+H I+ K + S +            FK+  +K                     FFE LGF Y G I+G+++++ I  L+  K     GP +LH+ T KG GY+ AELD +G +H          S         ++ SV +N L +L E D  I  I PAM + S     +K FP  + DVGIAE+HA T AAG+A    K F++IYSTFLQR+YD L+HDV R +L +   +DR  L  +DG+TH GI+DI FL SIPN  I+   ++ E  +L+  A+     PF IRY + +    +V +       G W   +Q  ++   I+++G  I    K     E++   + +INA +I    +  + +IL     I  VE+       G  ++  +   N     + +I + +  I  G+   I +   I    I  +IK
  S:    10 KIKDPSFMKQLDIQELEALAADIRAFLITSTSKSGGHIGPNLGVVELTIALHYSFNSPKDKFIWDVGHQSYVHKILTGRASQFGTLREHGGLDGFPKRKESIHDVFETGHSSTSLSAAAGMVIARDIKKEEFYVIPIIGDGALTGGMALEALNHIGDMGKDMIVILNDNDMSIAPNVGAIHNILGKLRTSDT------------FKQTKAKV-----------------DGTFFEELGFMYLGPINGHDIEEVITNLELAKRTK--GPVLLHIVTKKGKGYQPAELDSRGTWHGTGPYKVETGSFIKPAKRAASWSSVISNELIRLAEKDERIVAITPAMPVGSKLEKFAKAFPERFFDVGIAEQHATTMAAGLATQGMKPFLTIYSTFLQRAYDQLVHDVCRQKLNVVIGIDRAGLVGADGETHQGIFDISFLNSIPNMTISMPKDEVEARQLMDTAFSYNDGPFAIRYPRGEAPGAQVAESNTLIPIGKWETIIQPIDA--VILTFGPTIRLALKAAEQLELEGYHVGVINARYIKPLDEALLHQILKQKIPILTVEESLLKGGFGVSVLEFIEASNYSDVVMHRIGLPDEFISHGSVSIILESFGISTTGIVLKIK 595
>gi|168265874|ref|ZP_02687839.1| 1-deoxy-D-xylulose-5-phosphate synthase [Listeria monocytogenes FSL J2-071] (623 aa)
Score = 887, Expect = 4.3e-93, Identities = 224/594 (37%), Positives = 324/594 (54%)
  Q:    18 KKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKSKS--VIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLT----EKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVL---KRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNS------NNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDI---EVKKEFSFGSWVYALQTKESKTCIISYGDII-----NDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLI--ILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIK 611
           K++ + EL  LA  +R  +I  +     H+  NLG+VEL++AL Y F+SP+D   +D GHQ YVHK++T RA++  T+R+  GL GF +  ES HD   TGHS   LS   G +   + K +   VIPVIGD A++ G+A EALN+I      M++I+NDN MSI+ NVGALH ++ K + S     T    +K++RKI    E   K+  +  K+   +        FFE LGF Y G IDG+NL+  I  L   KR K     GP +LH+ T KG GY+ AELD +G +H          S       + ++ S+ +N L +L   D  I  I PAM + S     +K FP  + DVGIAE+HA T A G+A    K F++IYSTFLQR+YD L+HD+ R +L +   +DR  L  +DG+TH GI+DI FL SIPN  IT   ++ E  RL+  A+     PF IRY +         E  +    G W   +Q  ++   I+++G  I        + E + + + +INA +I    +  +  IL     I  VE+       G  ++  I AN N     + +I + +  I  G+   I +   I    I  +IK
  S:     2 KQLDIQELEALAADIRAFLITSTSKSGGHIGPNLGVVELTIALHYTFNSPKDKFIWDVGHQSYVHKILTGRANQFDTLRQHGGLDGFPKRKESSHDVFETGHSSTSLSAAAGMVIARDIKKEDFYVIPVIGDGALTGGMALEALNHIGDMGKDMIVILNDNDMSIAPNVGALHNVLGKLRTSDKFQQTKTNIDKLMRKIPTAGE---KLADATEKAKDSIKHLLVEGTFFEELGFMYLGPIDGHNLEDIITNLEFAKRTK-----GPVLLHIVTKKGKGYQPAELDSRGTWHGTGPYKVETGSFIKPVKKSSSWSSIISNELMRLAAMDERIVAITPAMPVGSKLEKFAKAFPERFFDVGIAEQHATTMAGGLATQGMKPFLAIYSTFLQRAYDQLVHDICRQKLNVVIGIDRAGLVGADGETHQGIFDISFLNSIPNMTITMPKDETEARRLMDTAFAYDDGPFAIRYPRGDGPGTLLSESTELIPIGQWETLIQPVDA--VILTFGPTIPLALQASKQLESEGRRVGVINARYIKPLDESLLHHILKQKIPILTVEESLLKGGFGSSVLEFIEAN-NYTDVMVHRIGLPDEFISHGSVPLILESYGISNAGIVLKIK 609
>gi|172056945|ref|YP_001813405.1| deoxyxylulose-5-phosphate synthase [Exiguobacterium sibiricum 255-15] >gi|171989466|gb|ACB60388.1| deoxyxylulose-5-phosphate synthase [Exiguobacterium sibiricum 255-15] (628 aa)
Score = 886, Expect = 4.6e-93, Identities = 215/607 (35%), Positives = 337/607 (55%)
  Q:     6 VKIDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKSKS--VIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGK----NFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSL---KLSDPNL---NSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDI---EVKKEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIK----TKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           +K+ +I +    K+M + EL   A  +R+ +I+       HL+ NLG+VEL++AL   FDSP D   +D GHQ YVHK++T RA +  T+R+  GL GF + NES+HD   TGHS   LS   G    N  K      I +IGD A++ G+A EALN+I   +  +++I+NDN MSI+ NVGA+H+++ + + S+ V   +  L  ++ K      I   + K   KL +  KG      FFE LGF+Y+G +DG++L   I  L  +K     GP +LHV T KG GY+ AE D  G +H L   K+    +    S   +Y    A+ L K+   D+ + +I PAM++ S      K+FP    DVGIAE+HAVT AAG A    K  VSIYSTF QR+YD L+HDVAR  L +TF +DR  L  +DG+TH G++DI F++ +PN  I  A ++ EL+ L+  A + +  P  +R+ + +   +   E   E S  +W   ++ + +   I+++G  + D  K  +      S+ +INA  I    ++ +  + +    +  +E+       G  ++  ANE +    +K+  I +  I  G   ++ +++ +    I  E++S
  S:     1 MKLTEIQDPSFLKRMSVSELELFAGDIRRFLIEELATTGGHLAPNLGVVELTLALHREFDSPNDKFVWDVGHQAYVHKILTGRAGQFDTLRQHKGLCGFPKRNESVHDVWETGHSSTSLSAAMGIAVSNELKGNDDRAIAIIGDGALTGGMALEALNHIGAEQQNVIVILNDNEMSIAPNVGAMHQMLGRIRSSRKVRYAQDELETLIKKIPL---IGGKLEKGGEKLKEAVKGALVPGMFFEELGFNYYGPVDGHDLTDLIEQLNYVKK--EEGPVLLHVITKKGKGYRPAEYDGIGTWHGLGPYKIESGEVIKGKSKAPSYSFTVADTLTKMAREDDKLTLITPAMSVGSKLDCFEKEFPERMFDVGIAEQHAVTFAAGQATQGMKPVVSIYSTFFQRAYDQLVHDVARQNLDVTFTIDRSGLVGADGETHQGVFDIAFMRHVPNIRIVMAKDENELQHLLYSAVKYEG-PIAVRFPRGEGIGVPMDETLHEISLDTW--DVEREGTDVAIMAFGPQVQDALKIAELLEGDVSVRVINARTIKPLDEKMLNALYAEGIPLVTLEEAVLKGGFGSAVLEHANEQEAFPRVKRFGIPDWYIEHGGVNELLEEIGLLPGQIAEEVRS 618
>gi|15835225|ref|NP_296984.1| 1-deoxy-D-xylulose-5-phosphate synthase [Chlamydia muridarum Nigg] >gi|13124149|sp|Q9PK62|DXS_CHLMU 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|7190646|gb|AAF39439.1| 1-deoxyxylulose-5-phosphate synthase [Chlamydia muridarum Nigg] (632 aa)
Score = 886, Expect = 5.3e-93, Identities = 228/603 (37%), Positives = 340/603 (56%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDR-ADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIY-WSIYKS--FSKLSKFFKGKN--FFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPN-------LNSNNQTYGSV---AANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYALQTKESKTC------IISYGDIINDLKKEIKTKSID------LINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEI 610
           +  I + +  + + L +L  L   +R +II        HL+SNLGIVEL++AL YVF SP+D   +D GHQ YVHK++T R  +  S IR  NGLSGF  P ES HD   +GH+GN LS+  G  +  +  S  ++P++GDAA S GL  EALNN+  + +  +I++NDN MSIS+NVG + + +S++         +KI +KI     W +KI  +S  KS    K+    K  +   FE  G HY G  DG+N+KK I  L+ +K + P+ P + HV T KG G  EAE  D  LYH +K    N       L+S  +T  S      + L +L E    +Q++ PAM+L S   +  K+FP+ + DVGIAE HAVT +AG+A +   V  SIYSTFL R+ DN+ HDV   ELP+ F +DR  L++ DG +HHGIYD+GFL S+PN ++    N   LERL+  +   KS P  IRY      ++  +KE S  S+      +    C      +I+ G +  D    +K + +D      +++ +FI     E +  +LS +  + V+E+      L  + ++  N + L  ++  + I +  I  GN E I   + +  + I  +I
  S:     6 LQHISSPQKLRSLSLDQLPLLCDEIRNRIIATLSLTGGHLASNLGIVELTVALHYVFASPEDQFIFDVGHQAYVHKLLTGRNTEAFSNIRHDNGLSGFTSPQESNHDIFFSGHAGNALSLALGLAKGASHGSSHILPILGDAAFSCGLTLEALNNVPSDLSKFIIVLNDNQMSISENVGNIPQGISQWIQPPKF---DKIFQKI---HSWMRKIPGFSRQKSELLHKVDIALKSLSHPLFEQFGIHYVGPFDGHNIKKLIPALEAVKGL-PY-PVLFHVCTAKGNGLAEAE-KDPALYHGVKAYFKNHSPKKKPLSSEVKTPSSFPQHVGHILCQLGEKHPRLQVVTPAMSLGSCLEDFRKQFPDRFTDVGIAEGHAVTFSAGIARSGTPVVCSIYSTFLNRAMDNVFHDVCMQELPVIFAIDRAGLAFHDGRSHHGIYDLGFLCSMPNMVVCQPRNASVLERLLFSSLLWKS-PCAIRYP-----NLSTRKEVSNPSFSPIFPGEAEVLCQGDDLLLIALGHMC-DTALAVKEQLLDHGISTTVVDPIFIKPLDTELLQTLLSHHSKVVVLEEHSIHGGLSAEFLLFLNNHNLKTDVLSLGIPDIFIPHGNPETILNMIGLTSDQITLKI 620
>gi|167040178|ref|YP_001663163.1| 1-deoxy-D-xylulose-5-phosphate synthase [Thermoanaerobacter sp. X514] >gi|166854418|gb|ABY92827.1| deoxyxylulose-5-phosphate synthase [Thermoanaerobacter sp. X514] (620 aa)
Score = 883, Expect = 9.8e-93, Identities = 215/599 (35%), Positives = 338/599 (56%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKSK--SVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVF-LTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAE-LDDKGLYHSLKLSDPN----LNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYALQTKESKTCIISYGDIINDL---KKEIKTKSID--LINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSI 606
           +++I +  D KK+   +   +   +R+ +I+       HL+SNLGIVEL++AL YVF+SP D I +D GHQCYVHKM+T R D+  T+R+ NGLSG+ +  ES+HD    GHS   +S   G  +  + K +  SV+ VIGD A++ G+AFEALNN   +KT +++++N N MSIS+NVG+L   +SK +   +   L +++   +       K ++  I +    + +      FFE +GF Y G IDG+++   I VL+R K I   GP ++HV T KG GYK AE   DK  +HS    D      +N    TY  V    L ++   D+ I  I  AM   +  ++ +K  P  + DVGIAE+HA T AAGMA+   K + ++YSTFLQR+YD L+HDV   +LP+ F +DR  +   DG+TH G++D+ +L+ IPN  I    +  EL  ++ L+ +N   P  IRY + K  + ++ +E S       L T+  +  I + G ++  +   K+ +K   +   ++N  F+    +E +L I +  K I  VE    +  +G  ++ L N N +   + ++   +  I  G+ E++ KK N+D  SI
  S:     2 LEQIDSPYDLKKLDKKDFPLICEEIRQFLIEKVSKTGGHLASNLGIVELTIALHYVFNSPVDKIIWDVGHQCYVHKMLTGRKDQFDTLRKFNGLSGYTKRTESVHDIFGAGHSSTSISAALGIAKARDLKGEKYSVVAVIGDGALTGGMAFEALNNAGRSKTDLIVVLNHNEMSISENVGSLSLYLSKLRTDPTYNKLKQEVDNLLNIVPPIGKSLHKYIERIKDSVKQLVVSGMFFEEMGFTYLGPIDGHDVGSLIEVLERAKKIK--GPILVHVITKKGKGYKFAEKFPDK--FHSAAPFDIQTGKFVNEGQATYSDVFGKTLTEMALQDDKIVAITAAMPEGTGLIHFAKLIPERFFDVGIAEQHATTFAAGMAVQGYKPYFAVYSTFLQRAYDQLIHDVCIQKLPVVFAIDRAGIVGEDGETHQGVFDLSYLRPIPNITIMSPKDANELVEMVKLS-RNLEFPVAIRYPRGKAGEFDITRECSIEFGKAELVTEGKEIAIFALGRMVGKVLEAKEILKVSDLQPFIVNLRFVKPLDEELILDISNKVKFIVTVEDNVIAGGVGSAILELLNSNGIYKPVLRLGFPDKFIEHGDVENLFKKYNLDAESI 608
>gi|167037516|ref|YP_001665094.1| 1-deoxy-D-xylulose-5-phosphate synthase [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|166856350|gb|ABY94758.1| deoxyxylulose-5-phosphate synthase [Thermoanaerobacter pseudethanolicus ATCC 33223] (620 aa)
Score = 882, Expect = 1.6e-92, Identities = 215/599 (35%), Positives = 338/599 (56%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKSK--SVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVF-LTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAE-LDDKGLYHSLKLSDPN----LNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYALQTKESKTCIISYGDIINDL---KKEIKTKSID--LINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSI 606
           +++I +  D KK+   +   +   +R+ +I+       HL+SNLGIVEL++AL YVF+SP D I +D GHQCYVHKM+T R D+  T+R+ NGLSG+ +  ES+HD    GHS   +S   G  +  + K +  SV+ VIGD A++ G+AFEALNN   +KT +++++N N MSIS+NVG+L   +SK +   +   L +++   +       K ++  I +    + +      FFE +GF Y G IDG+++   I VL+R K I   GP ++HV T KG GYK AE   DK  +HS    D      +N    TY  V    L ++   D+ I  I  AM   +  ++ +K  P  + DVGIAE+HA T AAGMA+   K + ++YSTFLQR+YD L+HDV   +LP+ F +DR  +   DG+TH G++D+ +L+ IPN  I    +  EL  ++ L+ +N   P  IRY + K  + ++ +E S       L T+  +  I + G ++  +   K+ +K   +   ++N  F+    +E +L I +  K I  VE    +  +G  ++ L N N +   + ++   +  I  G+ E++ KK N+D  SI
  S:     2 LEQIDSPYDLKKLDKKDFPLICEEIRQFLIEKVSKTGGHLASNLGIVELTIALHYVFNSPVDKIIWDVGHQCYVHKMLTGRKDQFDTLRKFNGLSGYTKRTESVHDIFGAGHSSTSISAALGIAKARDLKGEKYSVVAVIGDGALTGGMAFEALNNAGRSKTDLIVVLNHNEMSISENVGSLSLYLSKLRTDPTYNKLKQEVDNLLNIVPPIGKSLHKYIERIKDSVKQLVVPGMFFEEMGFTYLGPIDGHDVGSLIEVLERAKKIK--GPILVHVITKKGKGYKFAEKFPDK--FHSAAPFDIQTGKFVNEGQATYSDVFGKTLTEMALQDDKIVAITAAMPEGTGLIHFAKLIPERFFDVGIAEQHATTFAAGMAVQGYKPYFAVYSTFLQRAYDQLIHDVCIQKLPVVFAIDRAGIVGEDGETHQGVFDLSYLRPIPNITIMSPKDANELVEMVKLS-RNLEFPVAIRYPRGKAGEFDITRECSIEFGKAELVTEGKEIAIFALGRMVGKVLEAKEILKVSDLQPFIVNLRFVKPLDEELILDISNKVKFIVTVEDNVIAGGVGSAILELLNSNGIYKPVLRLGFPDKFIEHGDVENLFKKYNLDAESI 608
>gi|169828969|ref|YP_001699127.1| 1-deoxy-D-xylulose-5-phosphate synthase [Lysinibacillus sphaericus C3-41] >gi|168993457|gb|ACA40997.1| 1-deoxy-D-xylulose-5-phosphate synthase [Lysinibacillus sphaericus C3-41] (633 aa)
Score = 881, Expect = 1.9e-92, Identities = 213/603 (35%), Positives = 337/603 (55%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKSKS--VIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFK-KEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNN---LKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHS---LKLSDPNL---NSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKE---FSFGSWVYALQTKESKTCIISYGDII------NDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENK-LSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEI 610
           ++KI +    K +   EL  +A  +R  +I+       H+  NLG+VEL+M L  +FDSP+D   +D GHQ YVHK++T RA +  T+R+  GL GF +  ES HD   TGHS   LS   G     + K +   VIP+IGD A++ G+A EALN+I + KT M++I+NDN MSI+ NVGALH ++ + + +K     ++ L  ++ K      K+  +  +    L        FFE LGF Y G IDG++   L+ T++  K++K     GP ++HV T KG GYK AE D  G +H     K+ +       +    + S+ A  + K+   D  I  I PAM + S    + + FPN + DVGIAE+HA T AAG+A  N K F++IYSTFLQR+YD +LHD+AR  L +   +DR  L  +DG+TH G++DI FL+ IPN  I    ++ E + ++  A +    P  +RY +     + +  E      GSW    + K++   I+++G  I       D+  + +   I+++NA FI    K+ + RILS +K I  +E+       G  ++  A+++  L+  + ++ I +  I  GN + + +++++      A +
  S:     3 LNKITSPSFLKNLNKKELEQVAQEIRTFLIEKCSVTGGHIGPNLGVVELTMMLHKMFDSPKDKFLWDVGHQAYVHKILTGRASQFDTLRQFKGLCGFPKRVESEHDEWETGHSSTSLSAAMGMAAARDIKKEHNYVIPIIGDGALTGGMALEALNHIGHAKTNMIVILNDNEMSIAPNVGALHSVLGRLRTAKEYSKAKEELESLINKIPVLGGKLASTAERLKDSLKYLVVSGVFFEELGFKYLGPIDGHDFEALEMTLSHAKKVK-----GPVLVHVITKKGKGYKPAEDDTIGNWHGTGPYKIENGAFVKSETKGPAWSSLIAETVRKIAHEDERIVTITPAMPVGSKLQGIQQDFPNRFFDVGIAEQHAATMAAGLATQNMKPFLAIYSTFLQRAYDQVLHDIARPNLNVFIGIDRAGLVGADGETHQGVFDIAFLRHIPNMTIMMPKDENEGQHMVKTAIEYDGGPIALRYPRGNGIGVPLDDELVALPIGSWEVLREGKDAS--ILTFGTTIPMAMQAADMLAQ-QGIDIEVVNARFIKPMDKDMLHRILSNHKPILTIEEAVLKGGFGSGVLEFAHDHGYLNAIVDRMGIPDQYIEHGNVDQLLEEIHMTAEDAVARM 619
>gi|75763307|ref|ZP_00743053.1| 1-deoxy-D-xylulose 5-phosphate synthase [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|74489207|gb|EAO52677.1| 1-deoxy-D-xylulose 5-phosphate synthase [Bacillus thuringiensis serovar israelensis ATCC 35646] (633 aa)
Score = 877, Expect = 5.1e-92, Identities = 211/608 (34%), Positives = 332/608 (54%)
  Q:     5 KVKIDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGF-IEKNNSKSKS-VIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFK-KEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHS---LKLSDPNLNSNNQT---YGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFS---FGSWVYALQTKESKTCIISYGDII-----NDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKL-SCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           +V + +I N    K M + EL  L+  +RK +I+       H++ NLG+VEL++AL  +FDSPQD   +D GHQ YVHK++T RA +  T+R+  GL GF +  ES HD   TGHS   LS   G  + ++  K+K  VIP+IGD A++ G+A EALN+I + KT M++I+NDN MSI+ NVGALH ++ + + +      +  L  IL K      K+  +  K    L        FFE LGF Y G +DG++ +K    L+  K     GP ++HV T KG GYK AE D  G +H     K+   +     +    + +V +  + KL   D  I  I PAM + S      K+FPN   DVGIAE+HA T AAGMA    K F++IYSTFLQR+YD ++HD+ R  L +   +DR  L  +DG+TH G++DI FL+ +PN ++    ++ E + L+  A Q +  P  +RY +     + + +E      G+W      + ++  I+++G  I        + E    S+ ++NA FI    +  +  +L     I  +E+       G  ++  A+EN   S  ++++ I +  I  G+   + +++ +  +++   I +
  S:     3 RVDLTQIQNPSFLKDMSISELEGLSEDIRKFLIEELSQTGGHIAPNLGVVELTIALHKLFDSPQDKFLWDVGHQSYVHKILTGRAKEFGTLRQYQGLCGFPKRCESEHDVWETGHSSTSLSAAMGMALARDLKKTKEYVIPIIGDGALTGGMALEALNHIGHEKTDMIVILNDNEMSIAPNVGALHNVLGRLRTAGKYHWVKDELEYILKKIPAVGGKVAATAEKIKDSLKYLLVSGVFFEELGFTYLGPVDGHDYEKLFETLQYAKKTK--GPVLVHVITKKGKGYKPAESDVIGTWHGTGPYKIESGDFVKPKEVAPAWSAVVSETVLKLARADERIVAITPAMPVGSKLEKFQKEFPNRMIDVGIAEQHATTMAAGMATQGMKPFLAIYSTFLQRAYDQVVHDICRQNLNVFIGIDRSGLVGADGETHQGVFDISFLRHLPNMVLMMPKDENEGQHLVYTAMQYEDGPIALRYARGNGLGVHMDEELKAIPIGTW--ETLKEGTQAAILTFGTTIPMAMEAAERLEKAGVSVKVVNARFIKPMDEAYLHDLLGKNIPILTIEEACLIGGFGTGVVEFASENGYHSALVERMGIPDRFIEHGSVTKLLEEIGLTTDAVVDRIHT 624
>gi|187606248|ref|ZP_02992414.1| deoxyxylulose-5-phosphate synthase [Exiguobacterium sp. AT1b] >gi|187481693|gb|EDU19731.1| deoxyxylulose-5-phosphate synthase [Exiguobacterium sp. AT1b] (633 aa)
Score = 876, Expect = 6.4e-92, Identities = 190/496 (38%), Positives = 289/496 (58%)
  Q:    17 FKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKSKS---VIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGK----NFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSL---KLSDPNL---NSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDI---EVKKEFSFGSWVYALQTKESKTCIISYGDIIND 512
            K+M + EL  L   +R+ +I+       HL+ NLG+VEL++AL  VFDSP+D + +D GHQ YVHK++T R ++  T+R+ NGL GF +  ES HD   TGHS   LS   G    N  K ++    I +IGD A++ G+A EALN+I   K  +++I+NDN MSI+ NVGA+H ++ + + S+ +    + +  ++   +    +  S+ +S  ++    K       FFE LGF YFG  DG++LK  +  L+  K I   GP ++HV T KG GY+ AELD  G +H L   K+    +        +Y  V A  + K+ E D  + +I PAM++ S     +KKFP    DVGIAE+HAVT A G A    K  VSIYSTF QR+YD L+HD+ R  L + F +DR  L  +DG+TH G++DI F++ +PN  I  A ++ EL++L+  A +    P  IR+ + +   +   E  +E S   W   ++ + +   I+++G  + D
  S:    15 LKRMSVSELESLGSDIRRFLIEKLAVTGGHLAPNLGVVELTLALHRVFDSPKDQLVWDVGHQAYVHKILTGRTNQFDTLRQYNGLCGFPKRCESEHDVWETGHSSTSLSAAMGIAIANELKGRANDRAIAIIGDGALTGGMALEALNHIGAEKQNVIVILNDNEMSIAPNVGAMHNMLGRIRASRKLKHAREEMESLI---KHIPLVGSSLERSGERVKDLLKSALIPGTFFEELGFTYFGPTDGHDLKDLLETLEYAKKID--GPVLVHVITKKGKGYRPAELDGVGTWHGLGPYKIESGEVIKGKPKGPSYSKVVAETITKVAESDERVTLITPAMSVGSKLDCFTKKFPERMFDVGIAEQHAVTLAGGQATQGLKPVVSIYSTFFQRAYDQLVHDICRQNLNVVFTIDRSGLVGADGETHQGVFDIAFMRHVPNIRILMAKDEEELQQLVYSALRYDGGPIAIRFPRGEGIGVPMSETLQEISLDDW--EVEAEGTDVAILTFGPQVQD 519
>gi|53728900|ref|ZP_00134615.2| COG1154: Deoxyxylulose-5-phosphate synthase [Actinobacillus pleuropneumoniae serovar 1 str. 4074] >gi|126207695|ref|YP_001052920.1| 1-deoxy-D-xylulose-5-phosphate synthase [Actinobacillus pleuropneumoniae L20] >gi|165975663|ref|YP_001651256.1| 1-deoxy-D-xylulose-5-phosphate synthase [Actinobacillus pleuropneumoniae serovar 3 str. JL03] >gi|190149479|ref|YP_001968004.1| 1-deoxy-D-xylulose-5-phosphate synthase (DXPS) [Actinobacillus pleuropneumoniae serovar 7 str. AP76] >gi|166198593|sp|A3MYS9|DXS_ACTP2 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|126096487|gb|ABN73315.1| 1-deoxy-D-xylulose-5-phosphate synthase (DXPS) [Actinobacillus pleuropneumoniae L20] >gi|165875764|gb|ABY68812.1| 1-deoxyxylulose-5-phosphate synthase [Actinobacillus pleuropneumoniae serovar 3 str. JL03] >gi|189914610|gb|ACE60862.1| 1-deoxy-D-xylulose-5-phosphate synthase (DXPS) [Actinobacillus pleuropneumoniae serovar 7 str. AP76] (617 aa)
Score = 876, Expect = 6.5e-92, Identities = 199/546 (36%), Positives = 317/546 (58%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI---EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLT-----EKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNL-----NSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEK 553
           + +I + ED + +   +L  +A  LR  +++     S HL+S LG+VEL++AL YV+ +P D + +D GHQ Y HK++T R D++ TIR+ NG+  F    ES++D +S GHS   +S   G     EK N+  K+V  VIGD AI+ G+AFEA+N+     T ML+I+NDN MSIS+NVGAL+  +++   S S++ T     +K+L K+   K + KK    +    S  S        FE LGF+Y G IDG+N+ + +  L  ++ +   GP  LH++T KG GY+ AE D  G YH +   DP       +    TY  +  N+L ++ E D+ +  I PAM   S  +  SK+FP  Y DV IAE+HAVT  AG+AIA  K  V+IYS+FLQR+YD L+HDVA   LP+ F +DR  +  +DG TH G +D+ F++ IPN  I C S++ E+ +++  AY+  + P  +RY +   + + +    +       L  +  K  I+++G ++N+ +   +  +  L +  F+    ++ V  +  +++ +  +E+
  S:     8 LSQINSPEDLRLLAKEQLQSVADELRAYLLESVSQTSGHLASGLGVVELTVALHYVYQTPFDQLIWDVGHQAYPHKILTGRRDQMHTIRQKNGIHPFPWREESLYDVLSVGHSSTSISAGVGIAVAAEKENAGRKTVC-VIGDGAITAGMAFEAMNHAGALHTDMLVILNDNEMSISENVGALNNHLARI-FSGSIYTTVRDGSKKVLDKVPTIKNFMKKSEEHMKGVISPES------TLFEELGFNYIGPIDGHNIDELVKTLSNMRELK--GPQFLHIRTKKGKGYEPAENDPIG-YHGVPKFDPTCGQLPKSKTIPTYSDIFGNWLCEMAEQDSKLIGITPAMREGSGMVEFSKRFPEQYFDVAIAEQHAVTFGAGLAIAGYKPVVAIYSSFLQRAYDQLIHDVAIQNLPVIFAIDRAGIVGADGQTHQGAFDVSFMRCIPNMTIMCPSDENEMRQMLYTAYR-MNTPTAVRYPRGNAQGVALAPMQALEVGKGKLIQQGQKVAILNFGPLLNEARIVAEKHNYTLADMRFVKPLDEQLVAELADSHELLVTLEE 554
>gi|126653066|ref|ZP_01725201.1| 1-deoxy-D-xylulose-5-phosphate synthase [Bacillus sp. B14905] >gi|126590167|gb|EAZ84291.1| 1-deoxy-D-xylulose-5-phosphate synthase [Bacillus sp. B14905] (649 aa)
Score = 876, Expect = 6.5e-92, Identities = 211/597 (35%), Positives = 336/597 (56%)
  Q:     5 KVKIDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKSKS--VIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFK-KEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNN---LKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHS---LKLSDPNL---NSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKE---FSFGSWVYALQTKESKTCIISYGDII------NDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENK-LSCNIKKINIRNNKIGFGNKEDIDKKLNI 601
           KV ++KI +    K +   EL  +A  +R  +I+       H+  NLG+VEL++ L  +FDSP+D   +D GHQ YVHK++T RA +  T+R+  GL GF +  ES HD   TGHS   LS   G     + K +   VIP+IGD A++ G+A EALN+I + KT M++I+NDN MSI+ NVGALH ++ + + +K     ++ L  ++ K      K+  +  +    L        FFE LGF Y G IDG++   L+ T++  K++K     GP ++HV T KG GYK AE D  G +H     K+ +       +    + S+ A  + K+   D  +  I PAM + S    + + FPN + DVGIAE+HA T AAG+A  N K F++IYSTFLQR+YD +LHD+AR  L +   +DR  L  +DG+TH G++DI FL+ IPN  I    ++ E + ++  A +    P  +RY +     + +  E      GSW    + K+    I+++G  I       D+  + +   I+++NA FI    ++ + RILS +K I  +E+       G  ++  A+++  L+  + ++ I +  I  GN + + +++++
  S:    16 KVDLNKITSPSFLKNLNKKELEQVAQEIRTFLIEKCSVTGGHIGPNLGVVELTIMLHKMFDSPKDKFLWDVGHQAYVHKILTGRASQFDTLRQFKGLCGFPKRVESEHDEWETGHSSTSLSAAMGMAAARDIKKEHNYVIPIIGDGALTGGMALEALNHIGHAKTNMIVILNDNEMSIAPNVGALHSVLGRLRTAKEYSKAKEELESLINKIPVLGGKLASTAERLKDSLKYLVVSGVFFEELGFKYLGPIDGHDFEALEMTLSHAKKVK-----GPVLVHVITKKGKGYKPAEDDTIGNWHGTGPYKIENGAFVKSETKGPAWSSLIAETVRKIAHEDERVVTITPAMPVGSKLQGIQQDFPNRFFDVGIAEQHAATMAAGLATQNMKPFLAIYSTFLQRAYDQVLHDIARPNLNVFIGIDRAGLVGADGETHQGVFDIAFLRHIPNMTIMMPKDENEGQHMVKTAIEYDGGPIALRYPRGNGIGVPLDDELVALPIGSWEVLREGKDGS--ILTFGTTIPMAMQAADMLAQ-QGIDIEVVNARFIKPMDEDMLHRILSNHKPILTIEEAVLKGGFGSGVLEFAHDHGYLNAIVDRMGIPDQYIEHGNVDQLLEEIHM 626
>gi|152979038|ref|YP_001344667.1| 1-deoxy-D-xylulose-5-phosphate synthase [Actinobacillus succinogenes 130Z] >gi|150840761|gb|ABR74732.1| deoxyxylulose-5-phosphate synthase [Actinobacillus succinogenes 130Z] (617 aa)
Score = 875, Expect = 1.1e-91, Identities = 214/601 (35%), Positives = 335/601 (55%)
  Q:    11 IPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI---EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFL-----TEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNSNNQ-----TYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVK--KEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIK 611
           I + +D + +    L  +   LR  +++     S HL+S LG VEL++AL YV+ +P D + +D GHQ Y HK++T R DK+STIR+ +GL  F    ES  D ++ GHS   +S   G     EK N+  K+V  VIGD AI+ G+AFEALN+     T ML+I+NDN MSISKNVGAL+  +++   S S++      ++KIL K+   K + KK      +   K   F      FE LGF+Y G IDG+N+++ +  L  ++ +   GP  LH++T KG GY  AE  D   +H +   DP      Q     TY  +  ++L ++ E D+ I  I PAM   S  +  SK+FP  Y DV IAE+HAVT AAG+AI   K  V+IYSTFLQR+YD L+HDVA   LP+ F +DR  +  +DG TH G +D+ F++ +PN II   SN+ E  +++   Y+    P  +RY +     +E++  +E + G     L     K  I+++G +++   K  +     +++  F+    +  +L I  TY+ I  +E+       G  +  + N ++ +  + ++ + +  I  G++++I   L +D   I  +I+
  S:     9 IDSPDDLRALDKERLPQVCDELRTYLLECVSQSSGHLASGLGCVELTVALHYVYQTPFDQLIWDVGHQAYPHKILTGRRDKMSTIRQKDGLHPFPWREESEFDVLTVGHSSTSISAGLGIAVAAEKENAGRKTVC-VIGDGAITAGMAFEALNHAGALHTDMLVILNDNEMSISKNVGALNTHLARI-FSGSLYSAVRDGSKKILEKVPTVKNFMKKT-----EEHMKGVMFSPESTLFEELGFNYIGPIDGHNIEELVVTLSNMRELK--GPQFLHIRTKKGKGYAPAE-KDPVRFHGVPKFDPTCGELPQSNAKPTYSKIFGDWLCEMAEKDSRIAGITPAMCEGSGMVAFSKRFPEQYFDVAIAEQHAVTFAAGLAIGGYKPVVAIYSTFLQRAYDQLIHDVAIQNLPVLFAIDRAGIVGADGQTHQGAFDVSFMRCVPNLIIMTPSNENECRQMLYTGYRC-GKPAAVRYPRGNAVGVELEPLRELTIGK--SKLIRNGKKIAILNFGTLLSSAIKAAENLDATVVDMRFVKPIDEVRILEIAQTYELIVTLEENAIQGGAGSAVAEVLNSHQKTTALLQLGLPDFFIPQGSQQEILADLGLDEKGIEEKIR 611
>gi|33151663|ref|NP_873016.1| 1-deoxy-D-xylulose-5-phosphate synthase [Haemophilus ducreyi 35000HP] >gi|41016951|sp|Q7VNP7|DXS_HAEDU 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|33147884|gb|AAP95405.1| 1-deoxyxylulose-5-phosphate synthase [Haemophilus ducreyi 35000HP] (617 aa)
Score = 873, Expect = 1.5e-91, Identities = 205/546 (37%), Positives = 320/546 (58%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI---EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLT-----EKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNSNNQ-----TYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVK--KEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEK 553
           + +I + ED + +   +L  LA  LR  ++D     S HL+S LG+VEL++AL YV+ +P D + +D GHQ Y HK++T R D++ TIR+ NG+  F    ES +D +S GHS   +S   G     +K N+  K+V  VIGD AI+ G+AFEA+N+     T ML+I+NDN MSIS+NVGAL+  +++   S S++ +     +K+L K+   K + KK      +   K   F      FE LGF+Y G IDG+N+++ +  L  ++ +   GP  LHV+T KG GY+ AE +D   YH +   DP      Q     TY  +  N+L ++ E D  I  I PAM   S  +  SK+FP  Y DV IAE+HAVT AAG+AIA  K  V+IYSTFLQR+YD L+HD+A   LP+ F +DR  +  +DG TH G +D+ F++ IPN  I C +++ E+ +++  AY+ ++ P  IRY +     I ++   E + G      Q K  K  I+++G ++++ ++   + +  L++  F+    K  +  +  ++  +  +E+
  S:     8 LSQIDSPEDLRLLGKEDLSALANELRTYLLDSVSQTSGHLASGLGVVELTVALHYVYQTPFDQLIWDVGHQAYPHKILTGRRDQMHTIRQKNGIHPFPWREESPYDVLSVGHSSTSISAGLGIAVAAQKENAGRKTVC-VIGDGAITAGMAFEAMNHAGALHTDMLVILNDNEMSISENVGALNNHLARI-FSGSLYTSMRDGSKKVLDKVPTIKNFMKK-----SEEHMKGVIFSPDSTLFEELGFNYIGPIDGHNIEELVKTLTNMRELK--GPQFLHVRTKKGKGYEPAE-NDPISYHGVPRFDPASGKLPQSKIVPTYSDIFGNWLCEMAENDEKIIGITPAMREGSGMVEFSKRFPTQYFDVAIAEQHAVTFAAGLAIAGYKPVVAIYSTFLQRAYDQLIHDIAIQNLPVIFAIDRAGVVGADGQTHQGAFDLSFMRCIPNMTIMCPADENEMHQMLYTAYKMQT-PTAIRYPRGNARGIALQPMAELAVGKARIIHQGK--KVAILNFGALLSEAQEVAISHNYTLVDMRFVKPLDKTLISELADSHSLLVTLEE 555
>gi|20807747|ref|NP_622918.1| 1-deoxy-D-xylulose-5-phosphate synthase [Thermoanaerobacter tengcongensis MB4] >gi|22095585|sp|Q8RAC5|DXS_THETN 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|20516301|gb|AAM24522.1| Deoxyxylulose-5-phosphate synthase [Thermoanaerobacter tengcongensis MB4] (622 aa)
Score = 872, Expect = 2.3e-91, Identities = 216/599 (36%), Positives = 338/599 (56%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKSKS--VIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKIL-FKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAE-LDDKGLYHSLKLSDPN----LNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYALQTKESKTCIISYGDIIN---DLKKEIKTKSID--LINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSI 606
           +++I +  D KK+ + +L  L+  +R+ I++       HL+SNLGIVEL++AL YVF+SP D I +D GHQCYVHKMIT R DK  T+R+ NGLSG+ +  ESIHD    GHS   LS   G     + K +   VI VIGD A++ G+A EALNNI  ++  +++I+N N MSIS+NVG+L   +SK +   +    ++ +  +L       K ++  I K    + +      FFE LGF Y G IDG+N+++ I VL+R K +   GP ++HV T KG GY  AE   DK  +HS    D      +     +Y  V    L ++   D  I  I  AM   +  ++ +K  P+ + DVGIAE+HA T AAG+A+   K + ++YSTFLQR+YD ++HDV   +LP+ F VDR  +   DG+TH G++DI FL++IPN  I    +  EL  ++ L+ +N   P  IRY + K  + ++ ++ SF      +  +  K  + + G +++   D  + +K   I+  ++N  F+    +E +L I +    +  VE    +  +G  ++ L N+ K+   + ++   +  I  G+ E + KK  +D  SI
  S:     2 LEQINSPYDLKKLDIKDLPRLSEEIRQFIVEKVSKTGGHLASNLGIVELTLALHYVFNSPVDKIIWDVGHQCYVHKMITGRRDKFDTLRQFNGLSGYTKRTESIHDIFGAGHSSTSLSAALGIATARDLKGEKYHVIAVIGDGALTGGMALEALNNIGRSRKDVIVILNHNEMSISENVGSLSLYLSKLRTDPTYNKVKQEIDNLLNIIPPIGKSLHKYIEKIKDSIKQLVVPGMFFEELGFTYLGPIDGHNVEELIEVLERSKKMK--GPLLIHVVTKKGKGYMFAEKRPDK--FHSAAPFDIETGKFVGEGKDSYSDVFGKTLAEMALKDEKIVAITAAMPEGTGLIHFAKLIPDRFFDVGIAEQHATTFAAGLAVEGYKPYFAVYSTFLQRAYDQVIHDVCIQKLPVVFAVDRAGIVGEDGETHQGVFDISFLRAIPNIAIMSPKDANELVEMVKLS-RNLDFPVAIRYPRGKAGEYDISRKPSFPLGKGEVLLEGEKIAVFALGRMVSKSIDAAEILKGHGINPFVVNLRFVKPLDEELILEISNKVDLVVTVEDNVIAGGVGSAILELLNDKKVYRPVLRLGFPDKFIEHGDVESLFKKYGLDSQSI 608
>gi|168140160|ref|ZP_02583389.1| 1-deoxy-D-xylulose-5-phosphate synthase [Bacillus cereus G9842] (630 aa)
Score = 872, Expect = 2.3e-91, Identities = 210/605 (34%), Positives = 330/605 (54%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGF-IEKNNSKSKS-VIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFK-KEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHS---LKLSDPNLNSNNQT---YGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFS---FGSWVYALQTKESKTCIISYGDII-----NDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKL-SCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           + +I N    K M + EL  L+  +RK +I+       H++ NLG+VEL++AL  +FDSPQD   +D GHQ YVHK++T RA +  T+R+  GL GF +  ES HD   TGHS   LS   G  + ++  K+K  VIP+IGD A++ G+A EALN+I + KT M++I+NDN MSI+ NVGALH ++ + + +      +  L  IL K      K+  +  K    L        FFE LGF Y G +DG++ +K    L+  K     GP ++HV T KG GYK AE D  G +H     K+   +     +    + +V +  + KL   D  I  I PAM + S      K+FPN   DVGIAE+HA T AAGMA    K F++IYSTFLQR+YD ++HD+ R  L +   +DR  L  +DG+TH G++DI FL+ +PN ++    ++ E + L+  A Q +  P  +RY +     + + +E      G+W      + ++  I+++G  I        + E    S+ ++NA FI    +  +  +L     I  +E+       G  ++  A+EN   S  ++++ I +  I  G+   + +++ +  +++   I +
  S:     3 LTQIQNPSFLKDMSISELEGLSEDIRKFLIEELSQTGGHIAPNLGVVELTIALHKLFDSPQDKFLWDVGHQSYVHKILTGRAKEFGTLRQYQGLCGFPKRCESEHDVWETGHSSTSLSAAMGMALARDLKKTKEYVIPIIGDGALTGGMALEALNHIGHEKTDMIVILNDNEMSIAPNVGALHNVLGRLRTAGKYHWVKDELEYILKKIPAVGGKVAATAEKIKDSLKYLLVSGVFFEELGFTYLGPVDGHDYEKLFETLQYAKKTK--GPVLVHVITKKGKGYKPAESDVIGTWHGTGPYKIESGDFVKPKEVAPAWSAVVSETVLKLARADERIVAITPAMPVGSKLEKFQKEFPNRMIDVGIAEQHATTMAAGMATQGMKPFLAIYSTFLQRAYDQVVHDICRQNLNVFIGIDRSGLVGADGETHQGVFDISFLRHLPNMVLMMPKDENEGQHLVYTAMQYEDGPIALRYARGNGLGVHMDEELKAIPIGTW--ETLKEGTQAAILTFGTTIPMAMEAAERLEKAGVSVKVVNARFIKPMDEAYLHDLLGKNIPILTIEEACLIGGFGTGVVEFASENGYHSALVERMGIPDRFIEHGSVTKLLEEIGLTTDAVVDRIHT 621
>gi|118479368|ref|YP_896519.1| 1-deoxy-D-xylulose-5-phosphate synthase [Bacillus thuringiensis str. Al Hakam] >gi|118418593|gb|ABK87012.1| 1-Deoxy-D-xylulose-5-phosphate synthase [Bacillus thuringiensis str. Al Hakam] (633 aa)
Score = 871, Expect = 2.4e-91, Identities = 211/607 (34%), Positives = 331/607 (54%)
  Q:     6 VKIDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGF-IEKNNSKSKS-VIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFK-KEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHS---LKLSDPNLNSNNQT---YGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFS---FGSWVYALQTKESKTCIISYGDII-----NDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKL-SCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           V + +I N    K M + EL  L+  +RK +I+       H++ NLG+VEL++AL  +FDSP+D   +D GHQ YVHK++T RA +  T+R+  GL GF +  ES HD   TGHS   LS   G  + ++  K+K  VIP+IGD A++ G+A EALN+I + KT M++I+NDN MSI+ NVGALH ++ + + +      +  L  IL K      K+  +  K    L        FFE LGF Y G +DG++ +K    L+  K     GP ++HV T KG GYK AE D  G +H     K+   +     +    + +V +  + KL   D  I  I PAM + S      K+FP+   DVGIAE+HA T AAGMA    K F++IYSTFLQR+YD ++HD+ R  L +   +DR  L  +DG+TH G++DI FL+ +PN +I    ++ E + L+  A Q +  P  +RY +     + + +E      GSW      + ++  I+++G  I        + E    S+ ++NA FI    +  +  +L     I  +E+       G  ++  A+EN   S  ++++ I +  I  G+   + +++ +  +++   I +
  S:     4 VDLTQIQNPSFLKDMSISELEGLSEDIRKFLIEELSQTGGHIAPNLGVVELTIALHKLFDSPKDKFLWDVGHQSYVHKILTGRAKEFGTLRQYQGLCGFPKRCESEHDVWETGHSSTSLSAAMGMALARDLKKTKEYVIPIIGDGALTGGMALEALNHIGHEKTDMIVILNDNEMSIAPNVGALHNVLGRLRTAGKYHWVKDELEYILKKIPAVGGKVAATAEKIKDSLKYLLVSGVFFEELGFTYLGPVDGHDYEKLFETLQYAKKTK--GPVLVHVITKKGKGYKPAESDVIGTWHGTGPYKIESGDFVKPKEVAPAWSAVVSETVLKLARTDERIVAITPAMPVGSKLEKFQKEFPDRMIDVGIAEQHATTMAAGMATQGMKPFLAIYSTFLQRAYDQVVHDICRQNLNVFIGIDRSGLVGADGETHQGVFDISFLRHLPNMVIMMPKDENEGQHLVYTAMQYEDGPIALRYARGNGLGVHMDEELKAIPIGSW--ETLKEGTQAAILTFGTTIPMAMEAAERLEKAGVSVKVVNARFIKPMDEAYLHDLLGKNIPILTIEEACLIGGFGTGVVEFASENGYHSALVERMGIPDRFIEHGSVTKLLEEIGLTTDAVVDRIHT 624
>gi|167935780|ref|ZP_02522855.1| 1-deoxy-D-xylulose-5-phosphate synthase [Bacillus cereus AH1134] (630 aa)
Score = 871, Expect = 2.8e-91, Identities = 210/605 (34%), Positives = 330/605 (54%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGF-IEKNNSKSKS-VIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFK-KEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHS---LKLSDPNLNSNNQT---YGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFS---FGSWVYALQTKESKTCIISYGDII-----NDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKL-SCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           + +I N    K M + EL  L+  +RK +I+       H++ NLG+VEL++AL  +FDSPQD   +D GHQ YVHK++T RA +  T+R+  GL GF +  ES HD   TGHS   LS   G  + ++  K+K  VIP+IGD A++ G+A EALN+I + KT M++I+NDN MSI+ NVGALH ++ + + +      +  L  IL K      K+  +  K    L        FFE LGF Y G +DG++ +K    L+  K     GP ++HV T KG GYK AE D  G +H     K+   +     +    + +V +  + KL   D  I  I PAM + S      K+FP+   DVGIAE+HA T AAGMA    K F++IYSTFLQR+YD ++HD+ R  L +   +DR  L  +DG+TH G++DI FL+ +PN ++    ++ E + L+  A Q +  P  +RY +     + + KE      G+W      + ++  I+++G  I        + E    S+ ++NA FI    +  +  +L     I  +E+       G  ++  A+EN   S  ++++ I +  I  G+   + +++ +  +++   I +
  S:     3 LTQIQNPSFLKDMSISELEGLSEDIRKFLIEELSQTGGHIAPNLGVVELTIALHKLFDSPQDKFLWDVGHQSYVHKILTGRAKEFGTLRQYQGLCGFPKRCESEHDVWETGHSSTSLSAAMGMALARDLKKTKEYVIPIIGDGALTGGMALEALNHIGHEKTDMIVILNDNEMSIAPNVGALHNVLGRLRTAGKYHWVKDELEYILKKIPAVGGKVAATAEKIKDSLKYLLVSGVFFEELGFTYLGPVDGHDYEKLFETLQYAKKTK--GPVLVHVITKKGKGYKPAESDVIGTWHGTGPYKIESGDFVKPKEVAPAWSAVVSETVLKLARADERIVAITPAMPVGSKLEKFQKEFPDRMIDVGIAEQHATTMAAGMATQGMKPFLAIYSTFLQRAYDQVVHDICRQNLNVFIGIDRSGLVGADGETHQGVFDISFLRHLPNMVLMMPKDENEGQHLVYTAMQYEDGPIALRYARGNGLGVHMDKELKAIPIGTW--ETLKEGTQAAILTFGTTIPMAMEAAERLEKAGVSVKVVNARFIKPMDEAYLHDLLGKNIPILTIEEACLIGGFGTGVVEFASENGYHSALVERMGIPDRFIEHGSVTKLLEEIGLTTDAVVDRIHT 621
>gi|95928788|ref|ZP_01311534.1| deoxyxylulose-5-phosphate synthase [Desulfuromonas acetoxidans DSM 684] >gi|95135133|gb|EAT16786.1| deoxyxylulose-5-phosphate synthase [Desulfuromonas acetoxidans DSM 684] (625 aa)
Score = 871, Expect = 3.0e-91, Identities = 204/595 (34%), Positives = 334/595 (56%)
  Q:    16 DFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSK--SKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKK--EWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNSNNQT------YGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYALQTKESKTCII----SYGDIINDLKKEIKTKSIDL--INAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEI 610
           D K   L+EL  LA  LR +II+   +   HL+S+LGIVEL++AL YV +SP+D I +D GHQ Y HK++T R +  +T+R+ +G+SGF +  ES HD    GHS   +S   G     + K  +  V+ VIGD +++ GLAFEALN+  +    M+II+NDN MSIS NVGAL   +S+ +M+  +F+  K   +I  K    + K +     ++      F      FE+ G  Y G IDG+++ + I  L+ +  +   GP+++HV T KG GY+ AE D+  L+H +   D        T      Y SV   +L +L E D+ +  I  AM   +  +  +++FP  + DVGIAE+HAVT AAGMA    +  V+IYSTFLQR+YDN+LHDV    LP+TF +DR  L  +DG THHG++D+ +L+ IPN  +    ++ EL+R ++ A      PF  RY +     ++   +F   +     + +E +   +    ++ +   D+  ++  K I++  ++A F+    +E ++       NI  +E+   +   G  ++ L  +N+L   + ++ + +  I  G+ +++ K   +D++ +  +I
  S:    13 DLKDFSLNELTVLAQELRDEIINTVSHTGGHLASSLGIVELTIALHYVMNSPRDKIIWDVGHQAYAHKLLTGRLNLFNTLRQLDGISGFPKRKESPHDCFDVGHSSTSISAALGMAVGRDCKELNNKVVAVIGDGSLTAGLAFEALNHAGHLDRNMIIILNDNEMSISPNVGALSSFLSR-KMTSRLFVRFKRETEIFLKSVPRFGKDLVQLAKRTEDSFKAFVTPGMLFEAFGIEYVGPIDGHSMDELIETLQNVSRLD--GPSLIHVVTRKGKGYQPAE-DNPALFHGVGPFDKTSGKVKTTTGAPPSYTSVFGEYLCQLAEKDSRLVAITAAMCTGTGLVPFAERFPKRFFDVGIAEQHAVTLAAGMACEELRPVVAIYSTFLQRAYDNVLHDVCLQNLPVTFALDRGGLVGADGPTHHGVFDLSYLRHIPNVTVAVPRDELELKRAMLTA-TTSDGPFVYRYPRGNGLGLQQTDDFKPLTIGQGEKLREGQAATLVSIGTFAETAMDVAVKLSEKGIEIAVVDARFLKPLDQELLIAEARRTGNIITLEENVLAGGFGSAVMELMEKNRLYPRVMRLGLPDEFIQQGSHDELLKLHGLDVDGLTEKI 618
>gi|166154542|ref|YP_001654660.1| 1-deoxy-D-xylulose-5-phosphate synthase [Chlamydia trachomatis 434/Bu] >gi|166155417|ref|YP_001653672.1| 1-deoxy-D-xylulose-5-phosphate synthase [Chlamydia trachomatis L2b/UCH-1/proctitis] >gi|165930530|emb|CAP04025.1| 1-deoxy-D-xylulose 5-phosphate synthase [Chlamydia trachomatis 434/Bu] >gi|165931405|emb|CAP06979.1| 1-deoxy-D-xylulose 5-phosphate synthase [Chlamydia trachomatis L2b/UCH-1/proctitis] (640 aa)
Score = 870, Expect = 3.3e-91, Identities = 224/598 (37%), Positives = 338/598 (56%)
  Q:    15 EDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDR-ADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVF-LTEKI------LRKILFKKE-WSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNSNNQTYGSV-----------AANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWV---YALQTKESKTCIISYGDIIN---DLKKEIKTKSID--LINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           +D   + L +L  L   +R KII+       HL+SNLG VEL++AL YVF SP D   +D GHQ YVHK++T R  +  S IR  NGLSGF  P ES HD   +GH+GN LS+  G  + +++ S  ++P++GDAA S GL  EALNNI  + +  +I++NDN MSIS+NVG + + +S++   + +  L++KI      L   L KK+  S K+  ++ KS S           FE  G HY G IDG+N+KK +  L+ IK+     P + HV T+KG G  EAE D    YH +K    N  S  +T G+V           A N L +L +    +Q++ PAM+L S   +  K+FP+ + DVGIAE HAVT +AG+A +   V  SIYSTFL R+ DN+ HDV   ELP+ F +DR  L++ DG +HHGIYD+GFL S+PN +I    N   LERL   +   KS P  IRY      +      F F   +     +  +     +I+ G + N    +K+ +    I   +++ +FI    ++ +  +L+ +  + ++E+      LG + ++  N++ +  ++  + + +  I  GN E I   + +  + I   I S
  S:    13 QDLHALSLDKLPVLCDEIRNKIIESLSLTGGHLASNLGGVELTVALHYVFSSPDDQFIFDVGHQSYVHKLLTGRNTEAFSNIRHDNGLSGFTTPQESNHDIFFSGHAGNALSLALGLAKGSSNSSSHILPILGDAAFSCGLTLEALNNIPADLSKFIIVLNDNQMSISENVGNIPQGISQWIYPQKISKLSQKIHSWIQNLPSFLHKKKTLSHKVDIAL-KSLSH--------PLFEQFGLHYVGPIDGHNVKKLVQALQMIKDQPQ--PILFHVCTVKGNGLTEAERDPI-RYHGVKAHFQN-TSLKKTSGNVELQTPISFPQHAGNILCRLGKKYPQLQVVTPAMSLGSCLEDFRKQFPDRFTDVGIAEGHAVTFSAGIARSGTPVCCSIYSTFLHRAMDNVFHDVCMQELPVIFAIDRAGLAFHDGRSHHGIYDLGFLCSMPNMVICQPRNALVLERLFFSSLLWKS-PCAIRYPNIPANEKASNSSFPFSPILPGEAEILCQGDDLLLIALGHMCNTALTVKEHLLDYGISTTVVDPIFIKPLDRKLLQSLLTHHSKVIILEEHSIHGGLGSEFLLFLNQHNIKADVLSLGVPDMFIPHGNPETILNLIGLTSDHITQRILS 624
>gi|163941935|ref|YP_001646819.1| 1-deoxy-D-xylulose-5-phosphate synthase [Bacillus weihenstephanensis KBAB4] >gi|163864132|gb|ABY45191.1| deoxyxylulose-5-phosphate synthase [Bacillus weihenstephanensis KBAB4] (630 aa)
Score = 869, Expect = 4.7e-91, Identities = 209/605 (34%), Positives = 328/605 (54%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKSKS--VIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFK-KEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYH---SLKLSDPNLNSNNQT---YGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFS---FGSWVYALQTKESKTCIISYGDII-----NDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKL-SCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           + +I N    K M + EL  L+  +RK +I+       H++ NLG+VEL++AL  +FDSP+D   +D GHQ YVHK++T RA +  T+R+  GL GF +  ES HD   TGHS   LS   G     + K     VIP+IGD A++ G+A EALN+I + KT M++I+NDN MSI+ NVGALH ++ + + +      +  L  IL K      K+  +  K    L        FFE LGF Y G +DG++ +K    L+  K     GP ++HV T KG GYK AE D  G +H   S K+   +     +    + +V +  + KL   D  I  I PAM + S      K+FP+   DVGIAE+HA T AAGMA    K F++IYSTFLQR+YD ++HD+ R  L +   +DR  L  +DG+TH G++DI FL+ +PN ++    ++ E + L+  A Q +  P  +RY +     +++ +E      G+W      + ++  I+++G  I        + E    S+ ++NA FI    +  +  +L     I  +E+       G  ++  A+EN   S  I+++ I +  I  G+   + +++ +  +++   I +
  S:     3 LTQIQNPSFLKDMSISELEGLSEDIRKFLIEELSQTGGHIAPNLGVVELTIALHKLFDSPKDKFLWDVGHQSYVHKILTGRAKEFGTLRQYQGLCGFPKRCESEHDVWETGHSSTSLSAAMGMALARDLKKTEEYVIPIIGDGALTGGMALEALNHIGHEKTDMIVILNDNEMSIAPNVGALHNVLGRLRTAGKYHWVKDELEYILKKIPAVGGKVAATAEKIKDSLKYLLVSGVFFEELGFTYLGPVDGHDYEKLFETLQYAKKTK--GPVLVHVITKKGKGYKPAESDVIGTWHGTGSYKIESGDFVKPKEVAPAWSAVVSETVLKLARTDERIVAITPAMPVGSKLEKFQKEFPDRMIDVGIAEQHATTMAAGMATQGMKPFLAIYSTFLQRAYDQVVHDICRQNLNVFIGIDRSGLVGADGETHQGVFDIAFLRHLPNMVLMMPKDENEGQHLVYTAMQYEDGPIALRYARGNGLGVQMDEELKAIPIGTW--ETLKEGTQAAILTFGTTIPMAMEAAERLEQAGVSVKVVNARFIKPMDEAYLHELLGKNIPILTIEEACLIGGFGTGVVEFASENGYHSALIERMGIPDRFIEHGSVTKLLEEIGLTTDAVVDRIHT 621
>gi|47569436|ref|ZP_00240117.1| deoxyxylulose-5-phosphate synthase [Bacillus cereus G9241] >gi|47553851|gb|EAL12221.1| deoxyxylulose-5-phosphate synthase [Bacillus cereus G9241] (633 aa)
Score = 869, Expect = 5.0e-91, Identities = 210/607 (34%), Positives = 331/607 (54%)
  Q:     6 VKIDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGF-IEKNNSKSKS-VIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFK-KEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHS---LKLSDPNLNSNNQT---YGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFS---FGSWVYALQTKESKTCIISYGDII-----NDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKL-SCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           V + +I N    K M + EL  L+  +RK +I+       H++ NLG+VEL++AL  +FDSP+D   +D GHQ YVHK++T RA +  T+R+  GL GF +  ES HD   TGHS   LS   G  + ++  K+K  VIP+IGD A++ G+A EALN+I + KT M++I+NDN MSI+ NVGALH ++ + + +      +  L  IL K      K+  +  K    L        FFE LGF Y G +DG++ +K    L+  K     GP ++HV T KG GYK AE D  G +H     K+   +     +    + +V +  + KL   D  I  I PAM + S      K+FP+   DVGIAE+HA T AAGMA    K F++IYSTFLQR+YD ++HD+ R  L +   +DR  L  +DG+TH G++DI FL+ +PN ++    ++ E + L+  A Q +  P  +RY +     + + +E      GSW      + ++  I+++G  I        + E    S+ ++NA FI    +  +  +L     I  +E+       G  ++  A+EN   S  ++++ I +  I  G+   + +++ +  +++   I +
  S:     4 VDLTQIQNPSFLKDMSISELEGLSEDIRKFLIEELSQTGGHIAPNLGVVELTIALHKLFDSPKDKFLWDVGHQSYVHKILTGRAKEFGTLRQYQGLCGFPKRCESEHDVWETGHSSTSLSAAMGMALARDLKKTKEYVIPIIGDGALTGGMALEALNHIGHEKTDMIVILNDNEMSIAPNVGALHNVLGRLRTAGKYHWVKDELEYILKKIPAVGGKVAATAEKIKDSLKYLLVSGVFFEELGFTYLGPVDGHDYEKLFETLQYAKKTK--GPVLVHVITKKGKGYKPAESDVIGTWHGTGPYKIESGDFVKPKEVAPAWSAVVSETVLKLARTDERIVAITPAMPVGSKLEKFQKEFPDRMIDVGIAEQHATTMAAGMATQGMKPFLAIYSTFLQRAYDQVVHDICRQNLNVFIGIDRSGLVGADGETHQGVFDISFLRHLPNMVLMMPKDENEGQHLVYTAMQYEDGPIALRYARGNGLGVHMDEELKAIPIGSW--ETLKEGTQAAILTFGTTIPMAMEAAERLEKAGVSVKVVNARFIKPMDEAYLHDLLGKNIPILTIEEACLIGGFGTGVVEFASENGYHSALVERMGIPDRFIEHGSVTKLLEEIGLTTDAVVDRIHT 624
>gi|76789056|ref|YP_328142.1| 1-deoxy-D-xylulose-5-phosphate synthase [Chlamydia trachomatis A/HAR-13] >gi|119368199|sp|Q3KM28|DXS_CHLTA 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|76167586|gb|AAX50594.1| 1-deoxy-D-xylulose 5-phosphate synthase [Chlamydia trachomatis A/HAR-13] (640 aa)
Score = 868, Expect = 5.9e-91, Identities = 227/598 (37%), Positives = 339/598 (56%)
  Q:    15 EDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDR-ADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVF-LTEKI------LRKILFKKE-WSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNSNNQTYGSV-----------AANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYALQTKESKTC------IISYGDIIN---DLKKEIKTKSID--LINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           +D   + L +L  L   +R KII+       HL+SNLG VEL++AL YVF SP D   +D GHQ YVHK++T R  +  S IR  NGLSGF  P ES HD   +GH+GN LS+  G  + +++ S  ++P++GDAA S GL  EALNNI  + +  +I++NDN MSIS+NVG + + +S +   + +  L++KI      L   L KK+  S K+  ++ KS S           FE  G HY G IDG+N+KK +  L+ IK+     P + HV T+KG G  EAE D    YH +K    N  S  +T G+V           A N L +L +    +Q++ PAM+L S   +  K+FP+ + DVGIAE HAVT +AG+A +   V  SIYSTFL R+ DN+ HDV   ELP+ F +DR  L++ DG +HHGIYD+GFL S+PN +I    N   LERL   +   KS P  IRY      +   K   SF  +   L  +    C      +I+ G + N    +K+ +    I   +++ +FI    ++ +  +L+ +  + ++E+      LG + ++  N++ +  ++  + + +  I  GN E I   + +  + I   I S
  S:    13 QDLHALSLDKLPVLCDEIRNKIIESLSLTGGHLASNLGGVELTVALHYVFSSPDDQFIFDVGHQSYVHKLLTGRNTEAFSNIRHDNGLSGFTTPQESNHDIFFSGHAGNALSLALGLAKGSSNSSSHILPILGDAAFSCGLTLEALNNIPADLSKFIIVLNDNQMSISENVGNIPQGISHWMYPQKISKLSQKIHSWIQNLPSFLHKKKTLSHKVDIAL-KSLSH--------PLFEQFGLHYVGPIDGHNVKKLVQALQMIKDQPQ--PILFHVCTVKGNGLAEAERDPI-RYHGVKAHFQN-TSLKKTSGNVELQTPISFPQHAGNILCRLGKKYPQLQVVTPAMSLGSCLEDFRKQFPDRFTDVGIAEGHAVTFSAGIARSGTPVCCSIYSTFLHRAMDNVFHDVCMQELPVIFAIDRAGLAFHDGRSHHGIYDLGFLCSMPNMVICQPRNALVLERLFFSSLLWKS-PCAIRYPNIPANE---KASNSFFPFSPILPGEAEILCQGDDLLLIALGHMCNTALTVKEHLLDYGISTTVVDPIFIKPLDRKLLQSLLTHHSKVIILEEHSIHGGLGSEFLLFLNQHNIKADVLSLGVPDMFIPHGNPETILNLIGLTSDHITQRILS 624
>gi|15605054|ref|NP_219838.1| 1-deoxy-D-xylulose-5-phosphate synthase [Chlamydia trachomatis D/UW-3/CX] >gi|13124122|sp|O84335|DXS_CHLTR 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|3328750|gb|AAC67926.1| Transketolase [Chlamydia trachomatis D/UW-3/CX] (640 aa)
Score = 868, Expect = 5.9e-91, Identities = 227/598 (37%), Positives = 339/598 (56%)
  Q:    15 EDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDR-ADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVF-LTEKI------LRKILFKKE-WSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNSNNQTYGSV-----------AANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYALQTKESKTC------IISYGDIIN---DLKKEIKTKSID--LINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           +D   + L +L  L   +R KII+       HL+SNLG VEL++AL YVF SP D   +D GHQ YVHK++T R  +  S IR  NGLSGF  P ES HD   +GH+GN LS+  G  + +++ S  ++P++GDAA S GL  EALNNI  + +  +I++NDN MSIS+NVG + + +S +   + +  L++KI      L   L KK+  S K+  ++ KS S           FE  G HY G IDG+N+KK +  L+ IK+     P + HV T+KG G  EAE D    YH +K    N  S  +T G+V           A N L +L +    +Q++ PAM+L S   +  K+FP+ + DVGIAE HAVT +AG+A +   V  SIYSTFL R+ DN+ HDV   ELP+ F +DR  L++ DG +HHGIYD+GFL S+PN +I    N   LERL   +   KS P  IRY      +   K   SF  +   L  +    C      +I+ G + N    +K+ +    I   +++ +FI    ++ +  +L+ +  + ++E+      LG + ++  N++ +  ++  + + +  I  GN E I   + +  + I   I S
  S:    13 QDLHALSLDKLPVLCDEIRNKIIESLSLTGGHLASNLGGVELTVALHYVFSSPDDQFIFDVGHQSYVHKLLTGRNTEAFSNIRHDNGLSGFTTPQESNHDIFFSGHAGNALSLALGLAKGSSNSSSHILPILGDAAFSCGLTLEALNNIPADLSKFIIVLNDNQMSISENVGNIPQGISHWMYPQKISKLSQKIHSWIQNLPSFLHKKKTLSHKVDIAL-KSLSH--------PLFEQFGLHYVGPIDGHNVKKLVQALQMIKDQPQ--PILFHVCTVKGNGLAEAERDPI-RYHGVKAHFQN-TSLKKTSGNVELQTPISFPQHAGNILCRLGKKYPQLQVVTPAMSLGSCLEDFRKQFPDRFTDVGIAEGHAVTFSAGIARSGTPVCCSIYSTFLHRAMDNVFHDVCMQELPVIFAIDRAGLAFHDGRSHHGIYDLGFLCSMPNMVICQPRNALVLERLFFSSLLWKS-PCAIRYPNIPANE---KASNSFFPFSPILPGEAEILCQGDDLLLIALGHMCNTALTVKEHLLDYGISTTVVDPIFIKPLDRKLLQSLLTHHSKVIILEEHSIHGGLGSEFLLFLNQHNIKADVLSLGVPDMFIPHGNPETILNLIGLTSDHITQRILS 624
>gi|30264252|ref|NP_846629.1| 1-deoxy-D-xylulose-5-phosphate synthase [Bacillus anthracis str. Ames] >gi|47529695|ref|YP_021044.1| 1-deoxy-D-xylulose-5-phosphate synthase [Bacillus anthracis str. 'Ames Ancestor'] >gi|49187079|ref|YP_030331.1| 1-deoxy-D-xylulose-5-phosphate synthase [Bacillus anthracis str. Sterne] >gi|49480923|ref|YP_038238.1| 1-deoxy-D-xylulose-5-phosphate synthase [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|52141319|ref|YP_085510.1| 1-deoxy-D-xylulose-5-phosphate synthase [Bacillus cereus E33L] >gi|166995756|ref|ZP_02262216.1| 1-deoxy-D-xylulose-5-phosphate synthase [Bacillus cereus AH820] >gi|167634596|ref|ZP_02392916.1| 1-deoxyxylulose-5-phosphate synthase [Bacillus anthracis str. A0442] >gi|167638504|ref|ZP_02396780.1| 1-deoxyxylulose-5-phosphate synthase [Bacillus anthracis str. A0193] >gi|170687519|ref|ZP_02878736.1| 1-deoxyxylulose-5-phosphate synthase [Bacillus anthracis str. A0465] >gi|177654790|ref|ZP_02936547.1| 1-deoxyxylulose-5-phosphate synthase [Bacillus anthracis str. A0174] >gi|190565738|ref|ZP_03018657.1| 1-deoxyxylulose-5-phosphate synthase [Bacillus anthracis Tsiankovskii-I] >gi|196035027|ref|ZP_03102434.1| 1-deoxyxylulose-5-phosphate synthase [Bacillus cereus W] >gi|196041551|ref|ZP_03108843.1| 1-deoxyxylulose-5-phosphate synthase [Bacillus cereus NVH0597-99] >gi|41016958|sp|Q81M54|DXS_BACAN 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|81613593|sp|Q6HDY8|DXS_BACHK 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|81686286|sp|Q635A7|DXS_BACCZ 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|30258897|gb|AAP28115.1| 1-deoxyxylulose-5-phosphate synthase [Bacillus anthracis str. Ames] >gi|47504843|gb|AAT33519.1| 1-deoxyxylulose-5-phosphate synthase [Bacillus anthracis str. 'Ames Ancestor'] >gi|49181006|gb|AAT56382.1| 1-deoxyxylulose-5-phosphate synthase [Bacillus anthracis str. Sterne] >gi|49332479|gb|AAT63125.1| 1-deoxy-D-xylulose 5-phosphate synthase [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|51974788|gb|AAU16338.1| 1-deoxy-D-xylulose 5-phosphate synthase [Bacillus cereus E33L] >gi|167513352|gb|EDR88722.1| 1-deoxyxylulose-5-phosphate synthase [Bacillus anthracis str. A0193] >gi|167530048|gb|EDR92783.1| 1-deoxyxylulose-5-phosphate synthase [Bacillus anthracis str. A0442] >gi|170668714|gb|EDT19460.1| 1-deoxyxylulose-5-phosphate synthase [Bacillus anthracis str. A0465] >gi|172080451|gb|EDT65537.1| 1-deoxyxylulose-5-phosphate synthase [Bacillus anthracis str. A0174] >gi|190562657|gb|EDV16623.1| 1-deoxyxylulose-5-phosphate synthase [Bacillus anthracis Tsiankovskii-I] >gi|195992566|gb|EDX56527.1| 1-deoxyxylulose-5-phosphate synthase [Bacillus cereus W] >gi|196027539|gb|EDX66154.1| 1-deoxyxylulose-5-phosphate synthase [Bacillus cereus NVH0597-99] (630 aa)
Score = 868, Expect = 6.0e-91, Identities = 210/605 (34%), Positives = 330/605 (54%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGF-IEKNNSKSKS-VIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFK-KEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHS---LKLSDPNLNSNNQT---YGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFS---FGSWVYALQTKESKTCIISYGDII-----NDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKL-SCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           + +I N    K M + EL  L+  +RK +I+       H++ NLG+VEL++AL  +FDSP+D   +D GHQ YVHK++T RA +  T+R+  GL GF +  ES HD   TGHS   LS   G  + ++  K+K  VIP+IGD A++ G+A EALN+I + KT M++I+NDN MSI+ NVGALH ++ + + +      +  L  IL K      K+  +  K    L        FFE LGF Y G +DG++ +K    L+  K     GP ++HV T KG GYK AE D  G +H     K+   +     +    + +V +  + KL   D  I  I PAM + S      K+FP+   DVGIAE+HA T AAGMA    K F++IYSTFLQR+YD ++HD+ R  L +   +DR  L  +DG+TH G++DI FL+ +PN +I    ++ E + L+  A Q +  P  +RY +     + + +E      GSW      + ++  I+++G  I        + E    S+ ++NA FI    +  +  +L     I  +E+       G  ++  A+EN   S  ++++ I +  I  G+   + +++ +  +++   I +
  S:     3 LTQIQNPSFLKDMSISELEGLSEDIRKFLIEELSQTGGHIAPNLGVVELTIALHKLFDSPKDKFLWDVGHQSYVHKILTGRAKEFGTLRQYQGLCGFPKRCESEHDVWETGHSSTSLSAAMGMALARDLKKTKEYVIPIIGDGALTGGMALEALNHIGHEKTDMIVILNDNEMSIAPNVGALHNVLGRLRTAGKYHWVKDELEYILKKIPAVGGKVAATAEKIKDSLKYLLVSGVFFEELGFTYLGPVDGHDYEKLFETLQYAKKTK--GPVLVHVITKKGKGYKPAESDVIGTWHGTGPYKIESGDFVKPKEVAPAWSAVVSETVLKLARTDERIVAITPAMPVGSKLEKFQKEFPDRMIDVGIAEQHATTMAAGMATQGMKPFLAIYSTFLQRAYDQVVHDICRQNLNVFIGIDRSGLVGADGETHQGVFDISFLRHLPNMVIMMPKDENEGQHLVYTAMQYEDGPIALRYARGNGLGVHMDEELKAIPIGSW--ETLKEGTQAAILTFGTTIPMAMEAAERLEKAGVSVKVVNARFIKPMDEAYLHDLLGKNIPILTIEEACLIGGFGTGVVEFASENGYHSALVERMGIPDRFIEHGSVTKLLEEIGLTTDAVVDRIHT 621
>gi|166981803|ref|ZP_02253254.1| 1-deoxy-D-xylulose-5-phosphate synthase [Bacillus cereus AH187] >gi|168161511|ref|ZP_02596744.1| 1-deoxy-D-xylulose-5-phosphate synthase [Bacillus cereus H3081.97] (630 aa)
Score = 867, Expect = 8.0e-91, Identities = 209/605 (34%), Positives = 331/605 (54%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGF-IEKNNSKSKS-VIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFK-KEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHS---LKLSDPNLNSNNQT---YGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFS---FGSWVYALQTKESKTCIISYGDII-----NDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKL-SCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           + +I N    K+M + EL  L+  +RK +I+       H++ NLG+VEL++AL  +FDSP+D   +D GHQ YVHK++T RA +  T+R+  GL GF +  ES HD   TGHS   LS   G  + ++  K+K  VIP+IGD A++ G+A EALN+I + KT M++I+NDN MSI+ NVGALH ++ + + +      +  L  IL K      K+  +  K    L        FFE LGF Y G +DG++ +K    L+  K     GP ++HV T KG GYK AE D  G +H     K+   +     +    + +V +  + KL   D  I  I PAM + S      K+FP+   DVGIAE+HA T AAGMA    K F++IYSTFLQR+YD ++HD+ R  L +   +DR  L  +DG+TH G++DI FL+ +PN ++    ++ E + L+  A Q +  P  +RY +     + + +E      GSW      + ++  I+++G  I        + E    S+ ++NA FI    +  +  +L     I  +E+       G  ++  A+EN   S  ++++ I +  I  G+   + +++ +  +++   I +
  S:     3 LTQIQNPSFLKEMSISELEGLSEDIRKFLIEELSQTGGHIAPNLGVVELTIALHKLFDSPKDKFLWDVGHQSYVHKILTGRAKEFGTLRQYQGLCGFPKRCESEHDVWETGHSSTSLSAAMGMALARDLKKTKEYVIPIIGDGALTGGMALEALNHIGHEKTDMIVILNDNEMSIAPNVGALHNVLGRLRTAGKYHWVKDELEYILKKIPAVGGKVAATAEKIKDSLKYLLVSGVFFEELGFTYLGPVDGHDYEKLFETLQYAKKTK--GPVLVHVITKKGKGYKPAESDVIGTWHGTGPYKIESGDFVKPKEVAPAWSAVVSETVLKLARTDERIVAITPAMPVGSKLEKFQKEFPDRMIDVGIAEQHATTMAAGMATQGMKPFLAIYSTFLQRAYDQVVHDICRQNLNVFIGIDRSGLVGADGETHQGVFDISFLRHLPNMVLMMPKDENEGQHLVYTAMQYEDGPIALRYARGNGLGVHMDEELKAIPIGSW--ETLKEGTQAAILTFGTTIPMAMEAAERLEKAGVSVKVVNARFIKPMDEAYLHDLLGKNIPILTIEEACLIGGFGTGVVEFASENGYHSALVERMGIPDRFIEHGSVTKLLEEIGLTTDAVVDRIHT 621
>gi|30022259|ref|NP_833890.1| 1-deoxy-D-xylulose-5-phosphate synthase [Bacillus cereus ATCC 14579] >gi|168136575|ref|ZP_02579804.1| 1-deoxy-D-xylulose-5-phosphate synthase [Bacillus cereus B4264] >gi|41016957|sp|Q818R9|DXS_BACCR 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|29897816|gb|AAP11091.1| 1-deoxy-D-xylulose 5-phosphate synthase [Bacillus cereus ATCC 14579] (630 aa)
Score = 867, Expect = 8.3e-91, Identities = 209/605 (34%), Positives = 330/605 (54%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGF-IEKNNSKSKS-VIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFK-KEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHS---LKLSDPNLNSNNQT---YGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFS---FGSWVYALQTKESKTCIISYGDII-----NDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKL-SCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           + +I N    K M + EL  L+  +RK +I+       H++ NLG+VEL++AL  +FDSPQD   +D GHQ YVHK++T RA +  T+R+  GL GF +  ES HD   TGHS   LS   G  + ++  K+K  VIP+IGD A++ G+A EALN+I + KT M++I+NDN MSI+ NVGALH ++ + + +      +  L  IL K      K+  +  K    L        FFE LGF Y G +DG++ +K    L+  K     GP ++HV T KG GYK AE D  G +H     K+   +     +    + +V +  + KL   D  I  I PAM + S      K+FP+   DVGIAE+HA T AAGMA    K F++IYSTFLQR+YD ++HD+ R  L +   +DR  L  +DG+TH G++DI FL+ +PN ++    ++ E + L+  A Q +  P  +RY +     + + +E      G+W      + ++  I+++G  I        + E    S+ ++NA FI    +  +  +L     I  +E+       G  ++  A+EN   S  ++++ I +  I  G+   + +++ +  +++   I +
  S:     3 LTQIQNPSFLKDMSISELEGLSEDIRKFLIEELSQTGGHIAPNLGVVELTIALHKLFDSPQDKFLWDVGHQSYVHKILTGRAKEFGTLRQYQGLCGFPKRCESEHDVWETGHSSTSLSAAMGMALARDLKKTKEYVIPIIGDGALTGGMALEALNHIGHEKTDMIVILNDNEMSIAPNVGALHNVLGRLRTAGKYHWVKDELEYILKKIPAVGGKVAATAEKIKDSLKYLLVSGVFFEELGFTYLGPVDGHDYEKLFETLQYAKKTK--GPVLVHVITKKGKGYKPAESDVIGTWHGTGPYKIESGDFVKPKEVAPAWSAVVSETVLKLARADERIVAITPAMPVGSKLEKFQKEFPDRMIDVGIAEQHATTMAAGMATQGMKPFLAIYSTFLQRAYDQVVHDICRQNLNVFIGIDRSGLVGADGETHQGVFDISFLRHLPNMVLMMPKDENEGQHLVYTAMQYEDGPIALRYARGNGLGVHMDEELKAIPIGTW--ETLKEGTQAAILTFGTTIPMAMEAAERLEKAGVSVKVVNARFIKPMDEAYLHDLLGKNIPILTIEEACLIGGFGTGVVEFASENGYHSALVERMGIPDRFIEHGSVTKLLEEIGLTTDAVVDRIHT 621
>gi|167854994|ref|ZP_02477768.1| 1-deoxy-D-xylulose-5-phosphate synthase [Haemophilus parasuis 29755] >gi|167853842|gb|EDS25082.1| 1-deoxy-D-xylulose-5-phosphate synthase [Haemophilus parasuis 29755] (615 aa)
Score = 866, Expect = 1.2e-90, Identities = 200/529 (37%), Positives = 312/529 (58%)
  Q:     1 MKKNKVKIDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI---EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLT-----EKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNSNNQT-----YGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVF 529
           M+K    + +I + +D + +   +L  L   LR  +++     S HL+S LG+VEL++AL YV+ +P D + +D GHQ Y HK++T R D++ TIR+ +GL  F    ES  D +S GHS   +S   G     EK N+  K+V  VIGD AI+ G+AFEA+N+     T ML+I+NDN MSIS+NVGAL+  +++   + S++ T     +K+L  I   KE+ +K    +    S +         FE+LGF+Y G IDG+++++ I+ LK ++N+   GP  LH+KT KG GY  AE D  G +H +   D       QT     Y ++  ++L ++ E D  I  I PAM   S  +  SK+FP  Y DV IAE+HAVT  AG+AIA  K  V+IYS+FLQR+YD L+HDVA   LP+ F +DR  +  +DG TH G +D+ F++ +PN  I C S++ E+ +++  AY   S P  +RY +   + +E++   +       +  +  K  I+++G ++N+ K+  +T +  L++  F
  S:     1 MQKTYPLLSQINSPDDLRLLPKDKLQPLCDELRAYLLESVSQTSGHLASGLGVVELTVALHYVYQTPFDQLIWDVGHQAYPHKILTGRRDQMHTIRQKDGLHPFPWREESPFDVLSVGHSSTSISAGLGIAVAAEKENAGRKTVC-VIGDGAITAGMAFEAINHAGSIHTNMLVILNDNEMSISENVGALNNHLARL-FTGSLYGTLREGGKKLLSGIPSIKEFVRKTEEHVKGFVSPVG------TMFETLGFNYIGPIDGHDIEELISTLKNMRNMS--GPQFLHIKTKKGKGYTPAEQDPIG-FHGVPKFDHTSGKLPQTKSVPTYSNIFGDWLCEMAERDPKIIGITPAMREGSGMVEFSKRFPQQYFDVAIAEQHAVTFGAGLAIAGYKPVVAIYSSFLQRAYDQLIHDVAIQNLPVIFAIDRAGIVGADGQTHQGAFDLSFMRCVPNMTIMCPSDENEMRQMLYTAYTMNS-PVAVRYPRGNAQGVELQPMQALEIGKGKVLKQGEKVAILNFGALLNEAKQVAETHNYTLVDMRF 530
>gi|42783295|ref|NP_980542.1| 1-deoxy-D-xylulose-5-phosphate synthase [Bacillus cereus ATCC 10987] >gi|81568852|sp|Q731B7|DXS_BACC1 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|42739223|gb|AAS43150.1| 1-deoxyxylulose-5-phosphate synthase [Bacillus cereus ATCC 10987] (630 aa)
Score = 865, Expect = 1.2e-90, Identities = 209/605 (34%), Positives = 330/605 (54%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGF-IEKNNSKSKS-VIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFK-KEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHS---LKLSDPNLNSNNQT---YGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFS---FGSWVYALQTKESKTCIISYGDII-----NDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKL-SCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           + +I N    K M + EL  L+  +RK +I+       H++ NLG+VEL++AL  +FDSP+D   +D GHQ YVHK++T RA +  T+R+  GL GF +  ES HD   TGHS   LS   G  + ++  K+K  VIP+IGD A++ G+A EALN+I + KT M++I+NDN MSI+ NVGALH ++ + + +      +  L  IL K      K+  +  K    L        FFE LGF Y G +DG++ +K    L+  K     GP ++HV T KG GYK AE D  G +H     K+   +     +    + +V +  + KL   D  I  I PAM + S      K+FP+   DVGIAE+HA T AAGMA    K F++IYSTFLQR+YD ++HD+ R  L +   +DR  L  +DG+TH G++DI FL+ +PN ++    ++ E + L+  A Q +  P  +RY +     + + +E      GSW      + ++  I+++G  I        + E    S+ ++NA FI    +  +  +L     I  +E+       G  ++  A+EN   S  ++++ I +  I  G+   + +++ +  +++   I +
  S:     3 LTQIQNPSFLKDMSISELEGLSEDIRKFLIEELSQTGGHIAPNLGVVELTIALHKLFDSPKDKFLWDVGHQSYVHKILTGRAKEFGTLRQYQGLCGFPKRCESEHDVWETGHSSTSLSAAMGMALARDLKKTKEYVIPIIGDGALTGGMALEALNHIGHEKTDMIVILNDNEMSIAPNVGALHNVLGRLRTAGKYHWVKDELEYILKKIPAVGGKVAATAEKIKDSLKYLLVSGVFFEELGFTYLGPVDGHDYEKLFETLQYAKKTK--GPVLVHVITKKGKGYKPAESDVIGTWHGTGPYKIESGDFVKPKEVAPAWSAVVSETVLKLARTDERIVAITPAMPVGSKLEKFQKEFPDRMIDVGIAEQHATTMAAGMATQGMKPFLAIYSTFLQRAYDQVVHDICRQNLNVFIGIDRSGLVGADGETHQGVFDISFLRHLPNMVLMMPKDENEGQHLVYTAMQYEDGPIALRYARGNGLGVHMDEELKAIPIGSW--ETLKEGTQAAILTFGTTIPMAMEAAERLEKAGVSVKVVNARFIKPMDEAYLHDLLGKNIPILTIEEACLIGGFGTGVVEFASENGYHSALVERMGIPDRFIEHGSVTKLLEEIGLTTDAVVDRIHT 621
>gi|65321562|ref|ZP_00394521.1| COG1154: Deoxyxylulose-5-phosphate synthase [Bacillus anthracis str. A2012] (630 aa)
Score = 865, Expect = 1.3e-90, Identities = 210/605 (34%), Positives = 329/605 (54%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGF-IEKNNSKSKS-VIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFK-KEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHS---LKLSDPNLNSNNQT---YGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFS---FGSWVYALQTKESKTCIISYGDII-----NDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKL-SCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           + +I N    K M + EL  L+  +RK +I+       H++ NLG+VEL++AL  +FDSP+D   +D GHQ YVHK++T RA +  T+R+  GL GF +  ES HD   TGHS   LS   G  + ++  K+K  VIP+IGD A++ G+A EALN+I + KT M++I+NDN MSI+ NVGALH ++ + + +      +  L  IL K      K+  +  K    L        FFE LGF Y G +DG++ +K    L+  K     GP ++HV T KG GYK AE D  G +H     K+   +     +    + +V +  + KL   D  I  I PAM + S      K+FP+   DVGIAE+HA T AAGMA    K F++IYSTFLQR+YD ++HD+ R  L +   +DR  L  +DG+TH G++DI FL+ +PN +I    ++ E + L+  A Q +  P   RY +     + + +E      GSW      + ++  I+++G  I        + E    S+ ++NA FI    +  +  +L     I  +E+       G  ++  A+EN   S  ++++ I +  I  G+   + +++ +  +++   I +
  S:     3 LTQIQNPSFLKDMSISELEGLSEDIRKFLIEELSQTGGHIAPNLGVVELTIALHKLFDSPKDKFLWDVGHQSYVHKILTGRAKEFGTLRQYQGLCGFPKRCESEHDVWETGHSSTSLSAAMGMALARDLKKTKEYVIPIIGDGALTGGMALEALNHIGHEKTDMIVILNDNEMSIAPNVGALHNVLGRLRTAGKYHWVKDELEYILKKIPAVGGKVAATAEKIKDSLKYLLVSGVFFEELGFTYLGPVDGHDYEKLFETLQYAKKTK--GPVLVHVITKKGKGYKPAESDVIGTWHGTGPYKIESGDFVKPKEVAPAWSAVVSETVLKLARTDERIVAITPAMPVGSKLEKFQKEFPDRMIDVGIAEQHATTMAAGMATQGMKPFLAIYSTFLQRAYDQVVHDICRQNLNVFIGIDRSGLVGADGETHQGVFDISFLRHLPNMVIMMPKDENEGQHLVYTAMQYEDGPIAXRYARGNGLGVHMDEELKAIPIGSW--ETLKEGTQAAILTFGTTIPMAMEAAERLEKAGVSVKVVNARFIKPMDEAYLHDLLGKNIPILTIEEACLIGGFGTGVVEFASENGYHSALVERMGIPDRFIEHGSVTKLLEEIGLTTDAVVDRIHT 621
>gi|110005163|emb|CAK99490.1| putative deoxyxylulose-5-phosphate synthase protein [Spiroplasma citri] (592 aa)
Score = 863, Expect = 2.1e-90, Identities = 222/566 (39%), Positives = 326/566 (57%)
  Q:     6 VKIDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFD-SPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQ---MSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNSNNQTYGSVAANFLEKLIEY-DNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPN-TIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYALQTKESKTCIISYGDIINDLK---KEIKTKSIDLINAVFITNYQKENVLRI-LSTYKNIYVVEKVFDSNCLGDDLI-ILANEN 571
           +K+    N+ D KK+K   L++LA  +R  II+       HL+SNLG VEL+++LL  FD    DLI +DTGHQ Y +K++TDR    STIR ++GL+ FQ  NES +D +S GH+G  LS    +    N K  ++I VIGDAA +NGL  EAL  +      +++I+NDNGMSISKNV  LH  +SK +   + +S     K+LR I         + W  +    K+ + F     F      Y G +DG+N +K    L++ K        +LH+KT KG GY  ++ + +  YHS  L+D   N +N+ +    A  +EK+ +        I+ AM  S +      + P  + DVG+AEEHAVT AAG A+ ++KV V++Y++FLQR+YD +LHDV R  LP+ FL+DR  L+ +DGD+HHGIYDIGFL S+ +  II+  +   E ++L+ LA  NK NPFFIRY K       +   FS G W Y ++  +++  +I+YG+ +   K    ++ TK I++INA FI    KE + +I    Y+ I + E+V     L   +I  L N N
  S:     1 MKLQDYQNHTDLKKLKTKALIELAADVRCLIIETVTKNGGHLASNLGTVELTISLLKTFDIDNNDLIIFDTGHQTYAYKILTDRKTHFSTIRLADGLTAFQHINESKYDHLSNGHAGTGLSTAIAY--SYNQKYNNIICVIGDAAFTNGLTLEALTYLGTISNKIIVILNDNGMSISKNVNVLHTTVSKVRTGWLYRSASKVAKVLRYIP-----PLTLLWLGHLLIEKIIRSFAIPGLFAGFNLDYIGAVDGHNFRKLAKSLRQAKK--RNASVVLHLKTKKGYGYGLSQAEQEK-YHSYSLTD---NKHNE-WSYYVAKTIEKIFQTATEKFYFISAAMQASVHLEEFMLQNPQYFFDVGLAEEHAVTLAAGFALDHQKVIVNMYASFLQRTYDQILHDVVRNHLPVVFLIDRASLALADGDSHHGIYDIGFLNSMGDLPIISQPATSSEFDQLLKLALINKKNPFFIRYPKGGITQQVLSVPFSVGQWEYVIKNPKARILLITYGNNVIKTKTVITKLDTKKINVINARFINPVDKEMLKQINTEKYQQIIIFEEVIKETGLYAKIIDFLINHN 563
>gi|86147430|ref|ZP_01065742.1| 1-deoxy-D-xylulose-5-phosphate synthase [Vibrio sp. MED222] >gi|85834723|gb|EAQ52869.1| 1-deoxy-D-xylulose-5-phosphate synthase [Vibrio sp. MED222] (627 aa)
Score = 862, Expect = 3.4e-90, Identities = 208/592 (35%), Positives = 334/592 (56%)
  Q:    15 EDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLT-----EKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDP------NLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFS---FGSWVYALQTKE----SKTCIISYGDIINDLKKEIKTKSIDLINAV-----FITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSI 606
           ED + +    L  L   LR  +++     S HL+S LG VEL++AL YV+++P D + +D GHQ Y HK++T R D++STIR+ +GL  F    ES +D +S GHS   +S   G     K   K++ V+ VIGD AI+ G+AFEA+N+       ML+I+NDN MSIS+NVGAL+  +++  +S S++ +     +K+L  +   KE        + ++   L         FE LGF+Y G +DG+++ + I  LK ++++   GP  LH+ T KG GY+ AE D  G YH +   DP         S+  T+  +  +FL  +   D  +  I PAM   S  +  SK++P  Y DV IAE+HAVT A GMAIA  K  V+IYSTFLQR YD L+HDVA ++LP+ F +DR  L  +DG TH G +D+ F++ IPN +I   S++ E  +++   +Q+ + P  +RY +      E++ EF+    G      ++K+    SK  I+S+G  +     E   ++ D I+A      F+    +  + ++ + Y  +  +E+   +   G  +I    + KL   +  + + +  I  G ++++ ++L +D   I
  S:    18 EDLRLLPKETLTQLCDELRTYLLNSVSQSSGHLASGLGTVELTVALHYVYNTPFDQLVWDVGHQAYPHKILTGRRDRLSTIRQKDGLHPFPWRQESEYDTLSVGHSSTSISAGLGMAISAKKEGKNRKVVSVIGDGAITAGMAFEAMNHAGDIHNDMLVILNDNEMSISENVGALNNHLAQV-LSGSLYTSIREGGKKVLSGVPPIKEL-------VRRTEEHLKGMVVPGTMFEELGFNYIGPVDGHDVNELIKTLKNMRDLK--GPQFLHIMTKKGKGYEPAEKDPIG-YHGVPKFDPAHSSLPKSTSSKPTFSKIFGDFLCDMAAQDPKLMAITPAMREGSGMVRFSKEYPEQYFDVAIAEQHAVTLATGMAIAGDKPIVAIYSTFLQRGYDQLIHDVAIMDLPVMFAIDRAGLVGADGQTHQGAFDLSFMRCIPNMVIMAPSDENECRQMLYTGHQH-TGPSAVRYPRGNGMGTEIQSEFTALEIGKGRIVRESKKAKDGSKVAILSFGTFL-----ESALQTADAIDATVADMRFVKPLDEALIKQLAADYDVLVTIEENAIAGGAGAGVIEFLMQEKLLMPVLNLGLPDKFIAQGTQDELHEELGLDAKGI 617
>gi|170717622|ref|YP_001784703.1| deoxyxylulose-5-phosphate synthase [Haemophilus somnus 2336] >gi|189027776|sp|B0UUA4|DXS_HAES2 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|168825751|gb|ACA31122.1| deoxyxylulose-5-phosphate synthase [Haemophilus somnus 2336] (617 aa)
Score = 862, Expect = 3.4e-90, Identities = 212/597 (35%), Positives = 334/597 (55%)
  Q:    15 EDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI---EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLT-----EKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSL-----KLSDPNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVK--KEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIK 611
           +D + +   +L  L   LR  +++     S HL+S LG VEL++AL YVF +P D + +D GHQ Y HK++T R DK+STIR+  GL  F    ES  D +S GHS   +S   G     +K N   K++  VIGD AI+ G+AFEALN+     T ML+I+NDN MSIS+NVGAL+  +++  +S S++ T     +KIL  +   KE+ KK    +    S +         FE LGF+Y G IDG+N+ + I+ LK ++++   GP  LH+KT KG GY  AE D  G +H +     KL +   +S   TY  +  ++L ++   D  +  I PAM   S  +  S++FP  Y DV IAE+HAVT AAG+AIA  K  V+IYSTFLQR+YD L+HDVA   LP+ F +DR  +  +DG TH G +D+ F++ IPN +I   SN+ E  +++   Y+    P  +RY +     ++++   E   G      Q K     I+++G ++++  K  +     +++  F+     + +  I  T+  I  +E+       G  +     + +   ++ ++ + +N I  G ++++  +L ++   IF +IK
  S:    14 DDLRLLSKDKLPQLCQELRSYLLESVSQSSGHLASGLGTVELTVALHYVFKTPFDQLLWDVGHQAYPHKILTGRRDKMSTIRQKGGLHPFPWREESEFDVLSVGHSSTSISAGLGIAIAAQKENLGRKTIC-VIGDGAITAGMAFEALNHAGSVHTDMLVILNDNEMSISENVGALNNHLARL-LSGSIYSTLRESGKKILSGLPPIKEFVKKTEEHVKGFVSPVG------TLFEQLGFNYIGPIDGHNIHELISTLKNMQSLS--GPQFLHIKTKKGKGYAPAEKDPIG-FHGVPKFDHKLGELPKSSTTPTYSQIFGSWLCEIAAQDEKLIGITPAMREGSGMVEFSQQFPQQYFDVAIAEQHAVTFAAGLAIAGYKPVVAIYSTFLQRAYDQLIHDVAIQNLPVLFAIDRAGIVGADGQTHQGAFDLSFMRCIPNLVIMTPSNENECRQMLYTGYKC-GKPAAVRYPRGNAIGVKLEPLAELPLGKSKLIRQGK--NIAILNFGTLLSEATKVAEDLDATVVDMRFVKPLDTQRIQEIAQTHSLIVTLEENAIQGGAGSAVAETLYQQQQKVSLLQLGLPDNFIPQGTQKEMLAELKLNAEGIFEQIK 611
>gi|113461048|ref|YP_719115.1| 1-deoxy-D-xylulose-5-phosphate synthase [Haemophilus somnus 129PT] >gi|123132106|sp|Q0I3G1|DXS_HAES1 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|112823091|gb|ABI25180.1| 1-Deoxy-D-xylulose-5-phosphate synthase [Haemophilus somnus 129PT] (617 aa)
Score = 860, Expect = 5.4e-90, Identities = 212/597 (35%), Positives = 334/597 (55%)
  Q:    15 EDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI---EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLT-----EKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSL-----KLSDPNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVK--KEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIK 611
           +D + +   +L  L   LR  +++     S HL+S LG VEL++AL YVF +P D + +D GHQ Y HK++T R DK+STIR+  GL  F    ES  D +S GHS   +S   G     +K N   K++  VIGD AI+ G+AFEALN+     T ML+I+NDN MSIS+NVGAL+  +++  +S S++ T     +KIL  +   KE+ KK    +    S +         FE LGF+Y G IDG+N+ + I+ LK ++++   GP  LH+KT KG GY  AE D  G +H +     KL +   +S   TY  +  ++L ++   D  +  I PAM   S  +  S++FP  Y DV IAE+HAVT AAG+AIA  K  V+IYSTFLQR+YD L+HDVA   LP+ F +DR  +  +DG TH G +D+ F++ IPN +I   SN+ E  +++   Y+    P  +RY +     ++++   E   G      Q K     I+++G ++++  K  +     +++  F+     + +  I  T+  I  +E+       G  +     + +   ++ ++ + +N I  G ++++  +L ++   IF +IK
  S:    14 DDLRLLSKDKLPQLCQELRSYLLESVSQSSGHLASGLGTVELTVALHYVFKTPFDQLLWDVGHQAYPHKILTGRRDKMSTIRQKGGLHPFPWREESEFDVLSVGHSSTSISAGLGIAIAAQKENLGRKTIC-VIGDGAITAGMAFEALNHAGSVHTDMLVILNDNEMSISENVGALNNHLARL-LSGSIYSTLRESGKKILSGLPPIKEFVKKTEEHVKGFVSPVG------TLFEQLGFNYIGPIDGHNIHELISTLKNMQSLS--GPQFLHIKTKKGKGYAPAEKDPIG-FHGVPKFDHKLGELPKSSTTPTYSQIFGSWLCEIAVQDEKLIGITPAMREGSGMVEFSQQFPQQYFDVAIAEQHAVTFAAGLAIAGYKPVVAIYSTFLQRAYDQLIHDVAIQNLPVLFAIDRAGIVGADGQTHQGAFDLSFMRCIPNLVIMTPSNENECRQMLYTGYKC-GKPAAVRYPRGNAIGVKLEPLAELPLGKSKLIRQGK--NIAILNFGTLLSEATKVAEDLDATVVDMRFVKPLDTQRIQEIAQTHSLIVTLEENAIQGGAGSAVAETLYQQQQKVSLLQLGLPDNFIPQGTQKEMLAELKLNAEGIFEQIK 611
>gi|165872978|ref|ZP_02217600.1| 1-deoxyxylulose-5-phosphate synthase [Bacillus anthracis str. A0488] >gi|196046324|ref|ZP_03113550.1| 1-deoxyxylulose-5-phosphate synthase [Bacillus cereus 03BB108] >gi|164711261|gb|EDR16816.1| 1-deoxyxylulose-5-phosphate synthase [Bacillus anthracis str. A0488] >gi|196022794|gb|EDX61475.1| 1-deoxyxylulose-5-phosphate synthase [Bacillus cereus 03BB108] (616 aa)
Score = 860, Expect = 5.6e-90, Identities = 207/593 (34%), Positives = 325/593 (54%)
  Q:    20 MKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGF-IEKNNSKSKS-VIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFK-KEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHS---LKLSDPNLNSNNQT---YGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFS---FGSWVYALQTKESKTCIISYGDII-----NDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKL-SCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           M + EL  L+  +RK +I+       H++ NLG+VEL++AL  +FDSP+D   +D GHQ YVHK++T RA +  T+R+  GL GF +  ES HD   TGHS   LS   G  + ++  K+K  VIP+IGD A++ G+A EALN+I + KT M++I+NDN MSI+ NVGALH ++ + + +      +  L  IL K      K+  +  K    L        FFE LGF Y G +DG++ +K    L+  K     GP ++HV T KG GYK AE D  G +H     K+   +     +    + +V +  + KL   D  I  I PAM + S      K+FP+   DVGIAE+HA T AAGMA    K F++IYSTFLQR+YD ++HD+ R  L +   +DR  L  +DG+TH G++DI FL+ +PN +I    ++ E + L+  A Q +  P  +RY +     + + +E      GSW      + ++  I+++G  I        + E    S+ ++NA FI    +  +  +L     I  +E+       G  ++  A+EN   S  ++++ I +  I  G+   + +++ +  +++   I +
  S:     1 MSISELEGLSEDIRKFLIEELSQTGGHIAPNLGVVELTIALHKLFDSPKDKFLWDVGHQSYVHKILTGRAKEFGTLRQYQGLCGFPKRCESEHDVWETGHSSTSLSAAMGMALARDLKKTKEYVIPIIGDGALTGGMALEALNHIGHEKTDMIVILNDNEMSIAPNVGALHNVLGRLRTAGKYHWVKDELEYILKKIPAVGGKVAATAEKIKDSLKYLLVSGVFFEELGFTYLGPVDGHDYEKLFETLQYAKKTK--GPVLVHVITKKGKGYKPAESDVIGTWHGTGPYKIESGDFVKPKEVAPAWSAVVSETVLKLARTDERIVAITPAMPVGSKLEKFQKEFPDRMIDVGIAEQHATTMAAGMATQGMKPFLAIYSTFLQRAYDQVVHDICRQNLNVFIGIDRSGLVGADGETHQGVFDISFLRHLPNMVIMMPKDENEGQHLVYTAMQYEDGPIALRYARGNGLGVHMDEELKAIPIGSW--ETLKEGTQAAILTFGTTIPMAMEAAERLEKAGVSVKVVNARFIKPMDEAYLHDLLGKNIPILTIEEACLIGGFGTGVVEFASENGYHSALVERMGIPDRFIEHGSVTKLLEEIGLTTDAVVDRIHT 607
>gi|42527415|ref|NP_972513.1| 1-deoxy-D-xylulose-5-phosphate synthase [Treponema denticola ATCC 35405] >gi|81411947|sp|Q73LF4|DXS_TREDE 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|41818000|gb|AAS12424.1| 1-deoxy-D-xylulose-5-phosphate synthase [Treponema denticola ATCC 35405] (653 aa)
Score = 859, Expect = 6.8e-90, Identities = 217/595 (36%), Positives = 320/595 (53%)
  Q:     1 MKKNKVKIDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIE--KNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSV----FLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLY--HSLKLSDPNLNSNNQ-TYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKC--EDIEVKKEFSFGSWVYALQTKESKTCIISYGDIINDLKKEI-----KTKSIDLINAVFITNYQKENVLRILSTYKNIYVVE---KVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDI 595
           M KN + + KI   ED K +  +EL DLAV +RK+I+ +  +   HL+SNLG++EL++A+  VF SP D + +D GHQ Y HKMIT R  + ST+R   GLSGF +  ES+HD  +TGH+   +S   G +E  + N  S  VI VIGD A++ G+AFEAL+N    K  +++IINDN MSISKN GA  + +S+  + +      +L +K +  I         I W + +    +   F   N F   GF Y G I+G+N+++   VLK +K +    P ++ V+TIKG GY  AE++    +      ++D  +  N+  T+       L K  E ++ I  I  AM   +       KFP  + D GIAE HAVT AAG+A A  K   +IYSTFLQRS D ++HD +   LP+ F +DR     +DG+TH G++DI  L+ +PN  I C +++ ELE ++  A   + NP  IRY K  C  E  E  +    G  V    + +S+  I   G + N++K+       +  S D+ N  F     +   L I   Y  I  VE   K+   +   + LI+    NK      K  ++N K      ED+
  S:     1 MTKNSL-LSKIKGPEDIKLLSYNELKDLAVEIRKEILTVVGHNGGHLASNLGVIELTLAIHRVFSSPHDAVVWDVGHQSYTHKMITGRQSRFSTLRLWEGLSGFPKREESVHDAFNTGHASTSISAALGILEGKRLNKDSGKVIAVIGDGAMTGGMAFEALSNAGELKKDLIVIINDNKMSISKNTGAFSEYLSRLTVHEGYQRFKYLFDKAVGSIPLVGNKLNSIIWRLKRG---MKGIFYKNNIFVDFGFEYVGPINGHNMRELEKVLKNVKKLN--SPVVMLVETIKGKGYPLAEINPAAFHGIGPFNIADGKVEKNDAITFTQAFGKALVKAAEKNSKIAAITAAMESGTGLSLFHSKFPERFFDAGIAEGHAVTFAAGLASAGMKPVTAIYSTFLQRSIDQIIHDTSIQNLPVIFAIDRAGPVPADGETHQGLFDIALLRPVPNMTILCPASEKELELMLSWALM-QDNPIAIRYPKADCPKEIPEFSQSIEKGRGVLIKNSDKSRILITCTGGMYNEVKEASAILAHRGLSTDIYNVRFAKPIDENYFLNITKDYSYILFVEDGMKIGSLSSYLESLILRYESNKTGSQSNKTGLQNKKTAVLAFEDM 607
>gi|152976581|ref|YP_001376098.1| 1-deoxy-D-xylulose-5-phosphate synthase [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|189027766|sp|A7GSJ5|DXS_BACCN 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|152025333|gb|ABS23103.1| deoxyxylulose-5-phosphate synthase [Bacillus cereus subsp. cytotoxis NVH 391-98] (630 aa)
Score = 857, Expect = 1.2e-89, Identities = 208/605 (34%), Positives = 327/605 (54%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKSKS--VIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFK-KEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHS---LKLSDPNLNSNNQT---YGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFS---FGSWVYALQTKESKTCIISYGDIINDLKKEIKTK------SIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKL-SCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           + +I N    K M + EL +L+  +RK +I+       H++ NLG+VEL++AL  +FDSP+D   +D GHQ YVHK++T RA +  T+R+  GL GF +  ES HD   TGHS   LS   G     + K     VIP+IGD A++ G+A EALN+I + KT M++I+NDN MSI+ NVGALH ++ + + +      +  L  IL K      K+  +  K    L        FFE LGF Y G +DG++ +K    L+  K     GP ++HV T KG GYK AE D  G +H     K+   +     +    + +V +  + KL   D  I  I PAM + S      ++FPN   DVGIAE+HA T AAGMA    K F++IYSTFLQR+YD ++HD+ R  L +   +DR  L  +DG+TH G++DI FL+ +PN ++    ++ E + L+  A Q +  P  +RY +     + +  EF     G+W      + ++  I+++G  I  +  E   +      S+ ++NA FI    +  +  +L     I  +E+       G  ++  A E+   S  I+++ I +  I  G+   + +++ +  +++   I +
  S:     3 LTQIQNPSFLKDMSISELEELSEDIRKFLIEELSQTGGHIAPNLGVVELTIALHTLFDSPKDKFLWDVGHQSYVHKILTGRAKEFRTLRQYKGLCGFPKRCESEHDVWETGHSSTSLSAAMGMALARDLKKTDEYVIPIIGDGALTGGMALEALNHIGHEKTDMIVILNDNEMSIAPNVGALHNVLGRLRTAGKYQWVKDELEYILKKIPAVGGKVAATAEKIKDSLKYLLVSGVFFEELGFTYLGPVDGHDYEKLFETLQYAKKTK--GPVLVHVITKKGKGYKPAESDVIGTWHGTGPYKIESGDFVKPKEVAPAWSAVVSETVRKLARVDERIVAITPAMPVGSKLEKFHQEFPNRMIDVGIAEQHATTMAAGMATQGMKPFLAIYSTFLQRAYDQVVHDICRQNLNVFIGIDRSGLVGADGETHQGVFDIAFLRHLPNIVLMMPKDENEGQHLVYTAMQYEDGPIALRYPRGNGLGVPMDDEFKVIPIGTW--ETLREGTQAAIVTFGTTI-PMAMEAAERLGKAGVSVKVVNARFIKPMDEAYLHDLLGKNIPILTIEEACLIGGFGSGVMEFAAEHGYHSALIERMGIPDYFIEHGSVTKLLEEIGLTTDAVVDRIHT 621
>gi|188996591|ref|YP_001930842.1| deoxyxylulose-5-phosphate synthase [Sulfurihydrogenibium sp. YO3AOP1] >gi|188931658|gb|ACD66288.1| deoxyxylulose-5-phosphate synthase [Sulfurihydrogenibium sp. YO3AOP1] (631 aa)
Score = 852, Expect = 4.1e-89, Identities = 222/609 (36%), Positives = 345/609 (56%)
  Q:     3 KNKVKIDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKSKSV--IPVIGDAAISNGLAFEALNNIAY-NKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSI-YKSFSKLSKFFKG----KNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDP-----NLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVK--KEFSFGSWVYALQTKESKTCIISYGDIIN---DLKKEIKTKSID--LINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIK 611
           K+   ++KI NY+D K +   E+  L   +R  IID++     H+  +LG VEL++ALL  FD  +D I +D GHQ Y +K++TDR ++  T+R+  G+SGF +  ES +D   TGHS   +S   GF    + K   V  I VIGD A++ G AFE LNN  + + +  ++I+NDN MSIS NVGA++   +K  ++K VF  +K  +K+   KE   KI+     K F K+ ++ KG       FE LGF Y G IDG++L      L+ IK +   GP +LHV T KG GYK AE ++   +H +   D      N +SN  TY  V  + L +L E D+ I  I PAM   S  +  ++KFP+ + DVGIAE+HA T A  +A+   K   + YSTFLQR+YD ++HD+A  ELP+ F +DR  L   DG THHG++DI FL+ IPN II    ++ EL  L+ +   N   PF +RY +     ++++       GSW    + ++    I++ G  +    ++KK+++ K  +  ++NA FI    +  + ++L T++ +   E    +   G  +     +N  S  + +  I +  I  G  E +++ L +D+NS+  +I+
  S:     2 KDYPMLEKINNYKDLKNLNKEEIEKLCEDIRSYIIDVTSLNGGHIGPSLGTVELTVALLMAFDPEKDKIVWDVGHQTYAYKILTDRKEQFRTLRQYKGISGFSKIKESKYDHFGTGHSSTSISAALGFRVGKDLKKDDVYTIAVIGDGAMTAGQAFEGLNNAGWLDPSRFIVILNDNQMSISPNVGAIYTYFNKI-ITKQVF--QKPRQKL---KEAINKIFGEQGVKIFRKIEEYTKGLFAPGLIFEELGFTYVGPIDGHSLFDLEQTLENIKQMR--GPILLHVITQKGKGYKYAE-ENPTTFHGVSPFDKISGVFNKSSNLPTYSKVFGDALVELAEKDDKIVAITPAMKEGSGLVKFAEKFPDRFFDVGIAEQHAATFAGALALEGFKPVAAYYSTFLQRAYDQVIHDIALQELPVFFAIDRGGLVGDDGPTHHGVFDIAFLRPIPNMIIASPKDEQELRDLLYIGL-NSKRPFALRYPRGTGYGVKIEGFNTIEIGSWEILDEGRD--IAILAVGKYVYRALEVKKQLRLKGFNPTVVNARFIKPMDENLLNKLLKTHEFVITAEDGVLNGGFGSAVAEFVIDNGYSNKVLRFGIPDKFIEHGKVELLERDLGLDVNSMVNKIE 618
>gi|84394355|ref|ZP_00993076.1| 1-deoxy-D-xylulose-5-phosphate synthase [Vibrio splendidus 12B01] >gi|84375014|gb|EAP91940.1| 1-deoxy-D-xylulose-5-phosphate synthase [Vibrio splendidus 12B01] (627 aa)
Score = 851, Expect = 6.5e-89, Identities = 206/592 (34%), Positives = 333/592 (56%)
  Q:    15 EDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLT-----EKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDP------NLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFS---FGSWVYALQTKE----SKTCIISYGDIINDLKKEIKTKSIDLINAV-----FITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSI 606
           ED + +    L  L   LR  +++     S HL+S LG VEL++AL YV+++P D + +D GHQ Y HK++T R D++STIR+ +GL  F    ES +D +S GHS   +S   G     K   K++ V+ VIGD AI+ G+AFEA+N+       ML+I+NDN MSIS+NVGAL+  +++  +S S++ +     +K+L  +   KE        + ++   L         FE LGF+Y G +DG+++ + I  LK ++++   GP  LH+ T KG GY+ AE D  G YH +   DP         S+  T+  +  +FL  +   D  +  I PAM   S  +  SK++P  Y DV IAE+HAVT A GMAIA  K  V+IYSTFLQR YD L+HDVA ++LP+ F +DR  L  +DG TH G +D+ F++ IPN +I   S++ E  +++   +Q+ + P  +RY +      E++ EF+    G      ++++    SK  I+S+G  +     E   ++ D I+A      F+    +  + ++ + +  +  +E+   +   G  +I    + KL   +  + + +  I  G + ++ ++L +D   I
  S:    18 EDLRLLPKETLTQLCDELRTYLLNSVSQSSGHLASGLGTVELTVALHYVYNTPFDQLVWDVGHQAYPHKILTGRRDRLSTIRQKDGLHPFPWRQESEYDTLSVGHSSTSISAGLGMAISAKKEGKNRKVVSVIGDGAITAGMAFEAMNHAGDIHNDMLVILNDNEMSISENVGALNNHLAQV-LSGSLYTSIREGGKKVLSGVPPIKEL-------VRRTEEHLKGMVVPGTMFEELGFNYIGPVDGHDVNELIKTLKNMRDLK--GPQFLHIMTKKGKGYEPAEKDPIG-YHGVPKFDPAHSSLPKSTSSKPTFSKIFGDFLCDMAAQDPKLMAITPAMREGSGMVRFSKEYPEQYFDVAIAEQHAVTLATGMAIAGDKPIVAIYSTFLQRGYDQLIHDVAIMDLPVMFAIDRAGLVGADGQTHQGAFDLSFMRCIPNMVIMAPSDENECRQMLYTGHQH-TGPSAVRYPRGNGMGTEIQSEFTALEIGKGRIVRESEKAKDGSKVAILSFGTFL-----ESALQTADAIDATVADMRFVKPLDEALIKQLAADHDVLVTIEENAIAGGAGAGVIEFLMQEKLLMPVLNLGLPDKFIAQGTQGELHEELGLDAKGI 617
>gi|59711318|ref|YP_204094.1| 1-deoxy-D-xylulose-5-phosphate synthase [Vibrio fischeri ES114] >gi|75431768|sp|Q5E6Z0|DXS_VIBF1 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|59479419|gb|AAW85206.1| 1-deoxyxylulose-5-phosphate synthase, thiamine-requiring, FAD-requiring [Vibrio fischeri ES114] >gi|121308573|dbj|BAF43672.1| 1-deoxyxylulose-5-phosphate synthase [Vibrio fischeri] (627 aa)
Score = 849, Expect = 8.8e-89, Identities = 199/597 (33%), Positives = 337/597 (56%)
  Q:    15 EDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGF--IEKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYW---SIYKSFSKLSKFFKGK----NFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNS------NNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKE---FSFGSWVYALQTKES----KTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIK 611
           ++ + +    L  L   LR  +++     S HL+S LG+VEL++AL YV+++P D + +D GHQ Y HK++T R +++STIR+ +GL  F    ES +D +S GHS   +S   G     +   +++ ++ VIGD AI+ G+AFEALN+       ML+++NDN MSIS+NVGAL+  +++  +S S++ +          +E  KK+     +I +   +  +  KG       FE LGF+Y G +DG+++ + +  LK ++N+   GP  LH+ T KG GY+ AE D    YH +   DP+  S         T+ +V  +FL  + + D+ +  I PAM   S  +  SK++PN Y D  IAE+HAVT A+GMAIA     V+IYSTFLQR YD L+HDVA ++LP+ F +DR  L  +DG TH G +DI F++ IPN +I   S++ E  +++   +++ + P  +RY +     I+V  E      G      +TK +    +  I+++G  + +  +  +     + +  F     +  +  +++ +  +  +E+   S   G  +I    +N+L   + ++ + +  I  G +E++  +L +D N I  +I+
  S:    18 DELRSLPKESLPALCDELRTYLLNSVSKTSGHLASGLGVVELTVALHYVYNTPFDQLIWDVGHQAYPHKILTGRREQLSTIRQKDGLHPFPWRGESEYDVLSVGHSSTSISAALGLAICAEKEQENRKIVSVIGDGAITAGMAFEALNHAGDIHPDMLVVLNDNEMSISENVGALNNQLARV-LSGSLYTS---------IREGGKKVLSGTPTIKELLKRTEEHLKGMVVPGTMFEELGFNYIGPVDGHDVNELVRTLKNMRNLK--GPQFLHIMTKKGKGYEPAEKDPIS-YHGVPKFDPSNTSLPKSSGGKPTFSAVFGDFLCDMAKEDSKLMAITPAMREGSGMVRFSKEYPNQYFDAAIAEQHAVTLASGMAIAGYNPIVAIYSTFLQRGYDQLIHDVAIMDLPVMFAIDRAGLVGADGQTHQGAFDISFMRCIPNMVIMTPSDENECRQMLYTGHKH-TGPSAVRYPRGSATGIQVNNEMQALEIGKGRLLRETKVTEKGERVAILNFGTFLANSLEAAEKLDATVADMRFAKPLDEALICELVTNHDVLVTIEENAISGGAGSGVIEFLMKNRLVKPVLQLGLPDEFIAQGTQEEMHTELKLDANGIEQQIR 622
>gi|15618968|ref|NP_225254.1| 1-deoxy-D-xylulose-5-phosphate synthase [Chlamydophila pneumoniae CWL029] >gi|15836591|ref|NP_301115.1| 1-deoxy-D-xylulose-5-phosphate synthase [Chlamydophila pneumoniae J138] >gi|16753056|ref|NP_445329.1| 1-deoxy-D-xylulose-5-phosphate synthase [Chlamydophila pneumoniae AR39] >gi|33242432|ref|NP_877373.1| 1-deoxy-D-xylulose-5-phosphate synthase [Chlamydophila pneumoniae TW-183] >gi|13124163|sp|Q9Z6J9|DXS_CHLPN 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|4377395|gb|AAD19197.1| Transketolase [Chlamydophila pneumoniae CWL029] >gi|7189705|gb|AAF38589.1| 1-deoxyxylulose-5-phosphate synthase [Chlamydophila pneumoniae AR39] >gi|8979433|dbj|BAA99267.1| transketolase [Chlamydophila pneumoniae J138] >gi|33236943|gb|AAP99030.1| transketolase [Chlamydophila pneumoniae TW-183] (644 aa)
Score = 849, Expect = 9.3e-89, Identities = 192/464 (41%), Positives = 285/464 (61%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADK-ISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKSKS-VIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYW---SIYKSFSKLSK----FFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNSNNQ-----------TYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRY 471
           +D I +  D KK+ + +L  LA  +R +II +      HLSSNLGIVEL++AL YVF SP+D   +D GHQ Y HK++T R ++    IR  NGLSGF  P ES HD   +GH+G  LS+  G  +    +S++ VIP++GDAA S GL  EALNNI+ + +  ++I+NDN MSISKNVGA+ +I S++    +   T K+ +++   ++W  KI     S+ K   +LS+     F     FE  G  Y G IDG+N+KK I +L+ ++N+ PF P ++HV T KG G  +A+ ++   YH ++    N N               ++  +    L +L E  + + ++ PAM++ S      +KFP  + DVGIAE HAVT +AG+A A   V  SIYSTFL R+ DN+ HDV   +LP+ F +DR  L+Y DG +HHGIYD+ FL+++P  II    ++   ++L+  +  + S+P  IRY
  S:     9 LDLILSPADLKKLSISQLPGLAEEIRYRIISVLSQTGGHLSSNLGIVELTIALHYVFSSPKDKFIFDVGHQTYPHKLLTGRNNEGFDHIRNDNGLSGFTNPTESDHDLFFSGHAGTALSLALGMAQTTPLESRTHVIPILGDAAFSCGLTLEALNNISTDLSKFVVILNDNNMSISKNVGAMSRIFSRWLHHPA---TNKLTKQV---EKWLAKIPRYGDSLAKHSRRLSQCVKNLFCPTPLFEQFGLAYVGPIDGHNVKKLIPILQSVRNL-PF-PILVHVCTTKGKGLDQAQ-NNPAKYHGVR---ANFNKRESAKHLPAIKPKPSFPDIFGQTLCELGEVSSRLHVVTPAMSIGSRLEGFKQKFPERFFDVGIAEGHAVTFSAGIAKAGNPVICSIYSTFLHRALDNVFHDVCMQDLPVIFAIDRAGLAYGDGRSHHGIYDMSFLRAMPQMIICQPRSQVVFQQLLYSSL-HWSSPSAIRY 479
>gi|149181864|ref|ZP_01860353.1| 1-deoxy-D-xylulose-5-phosphate synthase [Bacillus sp. SG-1] >gi|148850403|gb|EDL64564.1| 1-deoxy-D-xylulose-5-phosphate synthase [Bacillus sp. SG-1] (630 aa)
Score = 847, Expect = 1.6e-88, Identities = 206/603 (34%), Positives = 334/603 (55%)
  Q:    10 KIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGF-IEKNNSKSKS-VIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFK-KEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDG---NNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHS---LKLSDPNL---NSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFS---FGSWVYALQTKESKTCIISYGDII-------NDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLS-CNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           K P++   K +   EL  L+  +RK +I+       H+  NLG+VEL++AL   FDSP+D I +D GHQ YVHK++T RA +  T+R+  GL GF +  ES HD   TGHS   LS   G  I ++  K  S ++PVIGD A++ G+A EALN+I + +  M++++NDN MSI+ NVGALH ++ + + +      +  L  IL K      K+  +  +    L   F    FFE +GF Y G IDG   N+L + I   K+ +     GP ILHV T KG G+  AE D KG +H     K+   +L    +   ++  + +  + KL   D  I  I PAM + S     + +FP+   DVGIAE+HA T +AG+A    K F++IYSTFLQR+YD +LHD+ R  L +   +DR  L  +DG+TH G++DI F++ +PN ++    ++ E + L+  A +    P  +R+ +     +++ KE      G W    + ++  T I+++G  I         L+K+    S+ ++NA FI    ++ +  I+     I  +E+       G  ++  A+E+  +   I++I I +  I  G+ +++ K++ +   ++   I++
  S:     7 KDPSF--LKSLSQQELESLSEDIRKFLIETLSKTGGHIGPNLGVVELTIALHKCFDSPKDKIIWDVGHQSYVHKILTGRAGQFGTLRQYKGLCGFPKMVESEHDVWETGHSSTSLSAAMGMAIARDVKKEDSFIVPVIGDGALTGGMALEALNHIGHEQKDMIVVLNDNEMSIAPNVGALHNVLGRLRTAGKYHWVKDELEYILKKIPAVGGKLAVTAERVKDSLKYLFVSGMFFEEMGFTYLGPIDGHDYNDLLENIQYAKKTE-----GPVILHVITKKGKGFHPAESDKKGTWHGTGPYKMDSGDLIKPVNAPPSWSGLVSETVRKLAREDERIVAITPAMPVGSKLEGFASEFPDRMFDVGIAEQHAATVSAGLATQGMKPFLAIYSTFLQRAYDQVLHDICRQNLNVFIGIDRAGLVGADGETHQGVFDIAFMRHLPNVVLMMPKDENEGQHLVNTAIKYDDGPIALRFPRGNGLGVKMDKELKTIPIGEWEVLKEGRD--TAILTFGTTIPMALEAAEQLEKQ--GVSVKVVNARFIKPLDEKMLSGIMRDNMPILTIEEAVLQGGFGSAVLEFAHEHGFNEVTIERIGIPDKFIEHGSVKELLKEIGMTTENVVDRIQT 621
>gi|15895347|ref|NP_348696.1| 1-deoxy-D-xylulose-5-phosphate synthase [Clostridium acetobutylicum ATCC 824] >gi|21263536|sp|Q97HD5|DXS_CLOAB 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|15025065|gb|AAK80036.1|AE007710_6 Deoxyxylulose-5-phosphate synthase [Clostridium acetobutylicum ATCC 824] (619 aa)
Score = 847, Expect = 1.7e-88, Identities = 217/605 (35%), Positives = 334/605 (55%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNN--SKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSL----KLSDPNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEV---KKEFSFGSWVYALQTKESKTCIISYGDIIND---LKKEIKTKSID--LINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           +D   + +D K M   EL + A  +RK +ID       HL+SNLG+VEL+++L  VF+  +D I +D GHQ YVHK++T R DK  ++++ NGLSGF + NESI+D   TGHS   +S   G     +    +  VI VIGD A++ G+A EALN+I Y KT ++II+NDN MSI+KNVG++ K ++K ++       +K ++  L +     ++  SI +    + +      FFE +G  Y G IDG+N+++  +V+ + K I   GP ILHVKT KG GY  AE ++   +HS+      +   L+    TY       + ++ E ++ I  I  AMT  +     SKKFP  + DVGI+E+HAVT AAG+A    K   ++YSTFLQR+YD +LHDV   +LP+ F +DR  +   DG+TH G++DI +L SIPN  I       EL  ++  A + ++ P  +RY K   +  +V    KEF  G W      K+    I++ G ++     ++ E+    ID  +INA FI    K+ + R         V+E       +G  ++   N+ K   ++  +  ++  I  GN E + K  ++D+  I   I S
  S:     5 LDNYEDVDDIKNMSSDELKEFASEIRKFLIDKISKTGGHLASNLGVVELTLSLHKVFNLKKDKIIWDVGHQAYVHKILTGRKDKFDSLKQFNGLSGFPKRNESIYDAFETGHSSTSISAASGIARARDLSKDNYDVIAVIGDGALTGGMALEALNDIGYKKTNVIIILNDNQMSIAKNVGSISKYLNKIRLDPKYNKLKKDVKTKLQRTNIGSEVANSIERIKGGIKQMVVSGMFFEDIGIKYLGPIDGHNIEELTSVISKAKEIK--GPVILHVKTQKGKGYSYAE-ENPNKFHSIGKFNSKTGEALSKPKDTYSKAFGKAMVQMAENNDKIVAITAAMTDGTGLCEFSKKFPQRFFDVGISEQHAVTMAAGLAATGYKPVFAVYSTFLQRAYDQVLHDVCIQKLPVVFAIDRAGIVGEDGETHQGVFDISYLSSIPNMTIMAPKCVEELNYIMNWAVK-QNYPIAVRYPKGGNDISDVLAPLKEFRHGKWEILKDGKD--VAIVAVGKMVQRAMVVRDELLKYGIDCAIINATFIKPIDKDTLNRFARDNYKFVVIEDNVLHGGIGSLILEHLNDMKFKNDVLNLGFKDEFITHGNIEILYKLYDLDIEGICKRIIS 617
>gi|163729504|ref|ZP_02136984.1| 1-deoxy-D-xylulose-5-phosphate synthase [Vibrio fischeri MJ11] >gi|161397320|gb|EDQ21609.1| 1-deoxy-D-xylulose-5-phosphate synthase [Vibrio fischeri MJ11] (627 aa)
Score = 846, Expect = 2.0e-88, Identities = 199/597 (33%), Positives = 337/597 (56%)
  Q:    15 EDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGF--IEKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYW---SIYKSFSKLSKFFKGK----NFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNS------NNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKE---FSFGSWVYALQTKES----KTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIK 611
           ++ + +    L  L   LR  +++     S HL+S LG+VEL++AL YV+++P D + +D GHQ Y HK++T R +++STIR+ +GL  F    ES +D +S GHS   +S   G     +   +++ ++ VIGD AI+ G+AFEALN+       ML+++NDN MSIS+NVGAL+  +++  +S S++ +          +E  KK+     +I +   +  +  KG       FE LGF+Y G +DG+++ + +  LK ++N+   GP  LH+ T KG GY+ AE D    YH +   DP+  S         T+ +V  +FL  + + D+ +  I PAM   S  +  SK++PN Y D  IAE+HAVT A+GMAIA     V+IYSTFLQR YD L+HDVA ++LP+ F +DR  L  +DG TH G +DI F++ IPN +I   S++ E  +++   +++ + P  +RY +     I+V  E      G      +TK +    +  I+++G  + +  +  +     + +  F     +  +  +++ +  +  +E+   S   G  +I    +N+L   + ++ + +  I  G +E++  +L +D N I  +I+
  S:    18 DELRSLPKESLPALCDELRTYLLNSVSKTSGHLASGLGVVELTVALHYVYNTPFDQLIWDVGHQAYPHKILTGRREQLSTIRQKDGLHPFPWRGESEYDVLSVGHSSTSISAALGLAICAEKEQENRKIVSVIGDGAITAGMAFEALNHAGDIHPDMLVVLNDNEMSISENVGALNNQLARV-LSGSLYTS---------IREGGKKVLSGTPTIKELLKRTEEHLKGMVVPGTMFEELGFNYIGPVDGHDVNELVRTLKNMRNLK--GPQFLHIMTKKGKGYEPAEKDPIS-YHGVPKFDPSNTSLPKSSGGKPTFSAVFGDFLCDMAKEDSKLMAITPAMREGSGMVRFSKEYPNQYFDAAIAEQHAVTLASGMAIAGYNPIVAIYSTFLQRGYDQLIHDVAIMDLPVMFAIDRAGLVGADGQTHQGAFDISFMRCIPNMVIMTPSDENECRQMLYTGHKH-TGPSAVRYPRGSATGIQVNNEMQALEIGKGRLLRETKVTDKGERVAILNFGTFLANSLEAAEKLDATVADMRFAKPLDEALICELVTNHDVLVTIEENAISGGAGSGVIEFLMKNRLVKPVLQLGLPDEFIAQGTQEEMHIELKLDSNGIEQQIR 622
>gi|167756950|ref|ZP_02429077.1| hypothetical protein CLORAM_02499 [Clostridium ramosum DSM 1402] >gi|167703125|gb|EDS17704.1| hypothetical protein CLORAM_02499 [Clostridium ramosum DSM 1402] (623 aa)
Score = 846, Expect = 2.1e-88, Identities = 214/604 (35%), Positives = 335/604 (55%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKN--NSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKF-FKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSL---KLSDPNL----NSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKE-FSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSID--LINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIK 611
           ++KI +    K++ + +L  LA  +RK +I+       HLSSNLG+VELS+AL YVF+SP+D I +D GHQ YVHK++T RA + ST+R+  GLSGFQ+  ES HD    GHS   LS   G       N ++  ++PVIGDAA+  G + EALN++      ++II+NDN M+I K+VG     +S  ++S +    ++  R I    +  K I+ ++ K      K        FE  G  Y G ++G++    I VL   K+       ++HV T KG GYK AE D  G +H +    + D  +     S+  ++  + A+ +E+ ++ D +I  I PAM   S   N+   +P    DVGIAEEHA+T  AG+AI+ KK F+SIYS+FLQR+YD + HD+AR++L     VDRC    +DG THHG++D+G L  +PN II   SN ++ +R I    +N  +P+ +R  +   ED+ V  E  + G W   +  K+    II YG  +N +++  K K I   +I+A+FI     E++L  +   K + V E    +  L  ++    ++N +   I    + ++    G    I +   +DM++ + ++K
  S:     3 LEKITDPSFLKELDIRQLNQLADDIRKFLINNISKTGGHLSSNLGVVELSIALHYVFNSPKDKIFFDVGHQSYVHKILTGRAGQFSTLRQYKGLSGFQKRCESEHDPWEAGHSSTALSGALGMAVARDLNHENYHILPVIGDAAMVGGESLEALNHLGSINNKVIIILNDNQMAIGKSVGGFGDFLSSIRISGTYNNLKEDYRNITSHNKIGKMIF-NVSKRVKDFVKHGLIDDTIFEDFGVDYLGPVNGHDFDDLIRVLNLAKSAKT--SVVVHVVTKKGRGYKYAENDIAGKWHGIAPFNIEDGTMKGAGTSSKISWSKMVADHIERQMKSDQDIVAITPAMIHGSAMDNIFMHYPERSFDVGIAEEHALTFTAGLAISQKKPFISIYSSFLQRAYDQINHDIARMDLGCLICVDRCGFVGADGPTHHGVFDLGILTPLPNVIICTPSNSYDAKRFINTYLKNNDHPYILRIPRGDIEDMNVGDELLTIGKW-QVVNRKDYDVTIICYGQNVNLIREFFKDKEIKVRIIDALFIKP-MDEDMLNEIIDEKPLIVYETELKTGSLASNIAYYYSQNNILKRIHSFGVDDHYSVQGTVAQILQDEGLDMDTFYQKVK 614
>gi|91762254|ref|ZP_01264219.1| 1-deoxy-D-xylulose-5-phosphate synthase [Candidatus Pelagibacter ubique HTCC1002] >gi|91718056|gb|EAS84706.1| 1-deoxy-D-xylulose-5-phosphate synthase [Candidatus Pelagibacter ubique HTCC1002] (637 aa)
Score = 845, Expect = 2.7e-88, Identities = 205/538 (38%), Positives = 311/538 (57%)
  Q:    16 DFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKN--NSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNSNNQT--------YGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIE---VKKEFSFGSWVYALQTKESKTCIISYGDIINDLK---KEIKTKSID--LINAVFITNYQKENVLRILSTYKNIYVVEK 553
           D +K+  ++L +++  +RK++ID       HL + LG+VEL++AL YVFD+P D + +D GHQ Y HK++T R  KI T+R+ NGLSGF + +ES +D     HS   +S   G  E N  ++KS ++I VIGD AIS G+A+EA+NN   +KT M++I+NDN MSI+K VGA+   ++K    K  F   +  + I+    +SK+      K+   L     G   F SLGF+Y G IDG++L   I +LK  ++    GP ++H+KT KG GY  AE   K   H   +S  N+ +  Q         Y  V AN L K  E D+ +  +  AM   +     +K FP    DVGIAE+HAVT AAG+A    K +V+IYSTFLQR+YD ++HDVA   LP+ F++DR  L  +DG TH G +DI +L ++PN I+   S++ EL ++I  +    + P  IRY +     +E   + +    G      + K+   CI+S G  + + K    E+K K I+  +++A F     +E +L+    ++ +  VE+
  S:    15 DLRKLSENDLQEVSNEVRKEMIDAVSETGGHLGAGLGVVELTVALHYVFDTPNDRLIWDVGHQTYPHKILTGRKSKIKTLRQGNGLSGFTKRSESEYDPFGAAHSSTSISSALGMAEANKLSNKSSNIIAVIGDGAISAGMAYEAMNNAGASKTKMIVILNDNDMSIAKPVGAMRTYLAKLLTGKIYFSLRETFKLIV--SAFSKRFSAKAGKAEDFLRSAVTGGTLFNSLGFYYVGPIDGHDLSTLIPILKNARDSKHQGPIMIHIKTQKGKGYSYAE---KASDHYHGVSKFNVVTGEQVKSGTNLPAYTKVFANTLVKHAERDSKVVGVTAAMPGGTGMDIFAKDFPKRMFDVGIAEQHAVTFAAGLATEGYKPYVAIYSTFLQRAYDQVVHDVAIQSLPVRFIIDRAGLVGADGSTHAGSFDITYLSTLPNFIVMAPSDEAELVKMINTSMSINNKPCAIRYPRGNGIGVELPSIDENIEIGKGRVIQEGKQ--VCILSIGTRLEECKIAAAELKNKGIESTIVDARFAKPLDQELILKCAREHEVMITVEE 563
>gi|146296858|ref|YP_001180629.1| deoxyxylulose-5-phosphate synthase [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145410434|gb|ABP67438.1| 1-Deoxy-D-xylulose-5-phosphate synthase [Caldicellulosiruptor saccharolyticus DSM 8903] (617 aa)
Score = 845, Expect = 3.0e-88, Identities = 217/599 (36%), Positives = 341/599 (56%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGF-IEKN-NSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVF----LTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAE-LDDKGLYHSLKLSDPNLNSN-----NQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSID--LINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLI-ILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSI 606
           ++K+   ED KK+ + EL  L+  +R+ ++    N   HL++NLG+VEL++ALLY F+ P+D I +D GHQCYV+K++T R ++ +T+R+  GLSGF +  ESI+D   TGHS   +S+  GF I ++ N K  +VI VIGD A++ GLA+E LNN       +L+I+NDN MSISKNVGA+ K +SK +     F     T++++  I F  E   K+   + K    L         FE+LGF Y+G IDG+++K+   V + +KN++   P ++H+ T KG GY+ AE   +K  YH +   D    ++     ++++  V  + L +L + +  I  I  AM   +     +K +P  + DVGIAEEHAVT AA +A    K FV+IYSTFLQR++D ++HDV    L + F VDR  +   DG+THHG +DI +L  IPN  +    +  E E ++  A      P  IRY +   + + V +  SFG     +  + S   I + G  ++ L   IK  +++  LIN  F+     E + ++  T+K I +VE       LG+ +  I+A  N L+  +K I + +  I  G+  ++   L +D  ++
  S:     4 LEKVNYPEDIKKLSISELYTLSEEIREFLLYNIANTGGHLAANLGVVELTLALLYTFNPPEDKIVWDVGHQCYVYKILTGRKERFATLRKLGGLSGFPKSKESIYDSFDTGHSSTSISVALGFAIARDLNHKDYNVIAVIGDGALTGGLAYEGLNNAGRYNGKLLVILNDNQMSISKNVGAIAKYLSKVRTQPRYFKLKKATDELVANIPFVGE---KLNQLVRKLKGGLKYILFPGMLFEALGFEYYGPIDGHDIKRMCEVFENVKNLIK--PVLVHIVTQKGKGYEHAERFPEK--YHGVPPFDIETGNHLTDTMSKSFSEVLGDKLCELAKENQKIVGITAAMPDGTGLTKFAKMYPERFFDVGIAEEHAVTFAAALAKEGFKPFVAIYSTFLQRAFDQIIHDVCLQNLNVVFCVDRAGIVGEDGETHHGSFDISYLTLIPNLTVMAPKDTKEFEMMLDFAAAYHGGPIAIRYPRGTTKIVGVYEPISFGK--SEILVEGSDLAIFTVGRHVSMLYDIIKENNLNVTLINIRFLKPLDVELIEKMTKTHKKILIVEDNTVIGGLGEKIKGIIAEINSLNL-VKHIGLPDKFIQHGSISELYSLLGLDKENL 607
>gi|119472099|ref|ZP_01614330.1| 1-deoxy-D-xylulose 5-phosphate synthase (DXP synthase) [Alteromonadales bacterium TW-7] >gi|119445119|gb|EAW26412.1| 1-deoxy-D-xylulose 5-phosphate synthase (DXP synthase) [Alteromonadales bacterium TW-7] (620 aa)
Score = 844, Expect = 3.5e-88, Identities = 208/605 (34%), Positives = 331/605 (54%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGF--IEKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSI---YKSFSKLSKFFKGK----NFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNS------NNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSN-PFFIRYTKEKCEDIEVKKEFSFGSWVYALQTKE-SKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           +DK     D  + KL E  +    LR+ +++     S HL+S LG VEL++AL YV+++P+D + +D GHQ Y HK++T R D++ TIR+ +GL  F   +ES +D  S GHS   +S   G     +     +  + VIGD AI+ G+AFEA+N++   K+ MLII+NDN MSIS+NVGAL    ++  +S S +            +E SKK+   +    +  S++ +  KG      FFE LG +Y G IDG+++   ++ L+ ++N+   GP +LH+KT KG GYK AE D  G YH +   DPN +S         T+  V  ++L  + + D+ +  I PAM   S  +  SK+  + Y DV IAE+HAVT AAG A    K  V+IYS+FLQR+YD L+HDVA   LP+ F +DR  +  +DG+TH G YD+ F++ IPN +I   S+  E  +++   Y  K+N P  +RY +      +++ +        A   KE SK  I+S+G ++ + +      +  L+N  FI       +  I+  +  I  +E    +   G  +       + +  I  + I +  I  G ++++  ++ +    I + I+S
  S:    14 VDKPAQLRDLAQDKLPEFSNE---LREYLLNSVSQSSGHLASGLGTVELTVALHYVYNTPEDRVVWDVGHQAYPHKILTGRRDQMHTIRQKDGLHPFPFRDESDYDTFSVGHSSTSISAALGMSIAAQKEGTGRKTVAVIGDGAITAGMAFEAMNHLGDVKSDMLIILNDNEMSISENVGALTNHFARI-LSGSFYTN---------IREGSKKLLSGVPPVKELASRMEEHLKGMVIPGTFFEELGLNYIGPIDGHDVNMLVDTLRNMRNLK--GPQLLHIKTQKGKGYKPAEADPIG-YHGVPKFDPNTSSLPKSKPGAPTFSKVFGDWLCDMAQQDDKLMAITPAMREGSGMVRFSKEHADKYFDVAIAEQHAVTLAAGFACEGLKPVVAIYSSFLQRAYDQLIHDVALQNLPVLFAIDRAGIVGADGETHQGAYDLSFMRCIPNMVIMAPSDTNECRQMLYTGY--KANCPVAVRYPRGSAGTADIQSDMQLFEIGKANTIKEGSKIAILSFGTLLENAQLAANELNATLVNMRFIKPLDTSLLNDIIKNHDVIVTLEDNAIAGGAGSAVNEYLASQQANVKILNLGIPDEFIKHGTQDEMHDEMGLGEQGILSSIRS 617
>gi|148976609|ref|ZP_01813296.1| 1-deoxy-D-xylulose-5-phosphate synthase [Vibrionales bacterium SWAT-3] >gi|145963960|gb|EDK29218.1| 1-deoxy-D-xylulose-5-phosphate synthase [Vibrionales bacterium SWAT-3] (627 aa)
Score = 844, Expect = 3.7e-88, Identities = 202/592 (34%), Positives = 330/592 (55%)
  Q:    15 EDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLT-----EKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNSNNQ------TYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYALQTKES-------KTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSI 606
           ED + +    L  L   LR  +++     S HL+S LG VEL++AL YV+++P D + +D GHQ Y HK++T R D++STIR+ +GL  F    ES +D +S GHS   +S   G     K   K++ V+ VIGD AI+ G+AFEA+N+       ML+I+NDN MSIS+NVGAL+  +++  +S S++ +     +K+L  +   KE        + ++   L         FE LGF+Y G +DG+++ + I  LK ++++   GP  LH+ T KG GY+ AE D  G YH++   +P   S ++      T+  V  +FL  +   D  +  I PAM   S  +  SK++P+ Y DV IAE+HAVT A GMAIA  K  V+IYSTFLQR YD L+HDVA ++LP+ F +DR  L  +DG TH G +D+ F++ IPN +I   S++ E  +++   +Q+ + P  +RY +      E++ EF+          +ES       K  I+S+G  + +  +        + +  F+    +  + ++ + +  +  +E+   +   G  +I    + KL   +  + + +  I  G + ++ ++L +D   I
  S:    18 EDLRLLPKETLTQLCDELRTYLLNSVSQSSGHLASGLGTVELTVALHYVYNTPFDQLVWDVGHQAYPHKILTGRRDRLSTIRQKDGLHPFPWREESEYDTLSVGHSSTSISAALGMAISAKKEGKNRKVVSVIGDGAITAGMAFEAMNHAGDVHNDMLVILNDNEMSISENVGALNNHLAQV-LSGSLYTSIREGGKKVLSGVPPIKEL-------VRRTEEHLKGMVVPGTMFEELGFNYIGPVDGHDVNELIKTLKNMRDLK--GPQFLHIMTKKGKGYEPAEKDPIG-YHAVPKFNPAKLSLSKSTSSKPTFSKVFGDFLCDMAAQDPKLMAITPAMREGSGMVRFSKEYPDQYFDVAIAEQHAVTLATGMAIAGDKPIVAIYSTFLQRGYDQLIHDVAIMDLPVMFAIDRAGLVGADGQTHQGAFDLSFMRCIPNMVIMAPSDENECRQMLYTGHQH-NGPSAVRYPRGNGMGTEIQSEFTALEIGKGRIVRESSKAKDGAKVAILSFGTFLENALQAADAMDATVADMRFVKPLDEALIKQLAADHDVLVTIEENAIAGGAGAGVIEFLMQEKLLMPVLNLGLPDKFIAQGTQGELHEELGLDAKGI 617
>gi|71282210|ref|YP_267832.1| 1-deoxy-D-xylulose-5-phosphate synthase [Colwellia psychrerythraea 34H] >gi|118595507|sp|Q487D3|DXS_COLP3 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|71147950|gb|AAZ28423.1| 1-deoxy-D-xylulose-5-phosphate synthase [Colwellia psychrerythraea 34H] (630 aa)
Score = 844, Expect = 3.8e-88, Identities = 211/597 (35%), Positives = 335/597 (56%)
  Q:    15 EDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFL-----TEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKG----KNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNSNNQ------TYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRY-----TKEKCEDIEVKKEFSFGSWVYALQTKESK------TCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDL--IILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIK 611
           ED + M   +L  ++  LR  +++     S H +S LG +EL++AL YV+++P D + +D GHQ Y HK++T R D++ TIR+  GL  F    ES +D +S GHS   +S   G     +  +K++  + VIGD A++ G+AFEALN+    K  MLII+NDN MSISKNVGAL+  ++K  +S S+F      ++K+L  I   KE +           S+  +  KG      FFE LGF+Y G IDG++++  +  +K ++N+   GP  LHV T KG GY+ AE  D   YH++   +P   +  Q      TY  +  ++L K  E D  +  + PAM   S  +  S++FP+ Y DV IAE+H+VT AAG+AI   K  V+IYS+FLQR YD  +HDVA   LP+ F +DR  +  +DG TH G++D+ FL+ IPNT+I   SN+ E + ++   Y+    P  +RY     T E    ++   E   G  +      ES+        I+S+G ++ + KK     +  L++  F+    +  +  + + +  +  VE    +   G  +   +LA    ++  I  I + ++ +  G +E++  +L +D   I  +IK
  S:    18 EDLRNMPQEQLTRISNELRSFLLNSVSKSSGHFASGLGTIELTVALHYVYNTPFDHLIWDVGHQAYPHKILTGRRDQLHTIRQKGGLHPFPWREESEYDTLSVGHSSTSISAALGLAVAAEKEAKNRKTVAVIGDGAMTAGMAFEALNHAGDIKKDMLIILNDNDMSISKNVGALNNHLAKL-LSGSIFTGFRESSKKLLGNIPPIKELA-----------SRAEEHLKGMVVPSTFFEELGFNYIGPIDGHDVESLVTTIKNMRNLK--GPQFLHVVTTKGKGYQAAE-QDPIKYHAVPKFNPEETNLPQSKPSLPTYSKIFGDWLCKTAEIDKKLVAVTPAMAEGSGMVEFSQRFPDQYYDVAIAEQHSVTYAAGLAIGGLKPVVAIYSSFLQRGYDQFIHDVAIQNLPVMFAIDRAGIVGADGATHQGVFDLSFLRCIPNTVIMAPSNERECQLMLNTGYK-LDGPSVVRYPRGNGTGEILPSVDETIELGKGVTILTATVIESQEQTNKSIAILSFGSMLGEAKKAALELNATLVDMRFVKPLDETLIDTLNAKHDCLVTVEDNAIAGGAGSGVNEYLLAQGKPVT--ILNIGVTDHFVKHGTQEEMHHELELDAEGIVIKIK 626
>gi|163812801|ref|ZP_02204461.1| deoxyxylulose-5-phosphate synthase [Dehalococcoides sp. VS] >gi|157403573|gb|EDO69633.1| deoxyxylulose-5-phosphate synthase [Dehalococcoides sp. VS] (647 aa)
Score = 844, Expect = 3.9e-88, Identities = 214/605 (35%), Positives = 337/605 (55%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGF-IEKNNSKSK-SVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFS-KLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNSNN-QTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVK-----------KEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIR--NNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           +D I +  D KK+ L EL +LA  +R+++++       HL+S+LG+VEL++AL  VF+SP+D I +D GHQ Y HK++T R ++ +T+R+  G+SGF   +ES HD    GH+   +S   G  + ++ +K+  SVI VIGD AIS G++FEA+NN  +  T  ++I+NDNGM+IS + GAL K ++  +        ++  ++ +    + K + W+  KS   K  K     + +E LGF Y G +DG+N+++    LKR K+     P ++H+ T KG GY +AE D    YH +      L S + Q+Y  V    L K++  +  +  I  AMT       ++  FP+   DVGI E+HAVT AAGMA       V IYSTFLQRS+D ++HDV   +LP+ F +DR  +   DG TH GI+D+ F+  IP+ I+   S++ +L+ L+  A  N   PF IRY +   E +E++           +  S GS +  L T +S    +++     ++  E   K   L+N  +I+   KE V++I   +K +  VE+   S  LG  +  +  E  L  +IK  NI   +  +  GN+  +  K  +D   I  +I S
  S:    19 LDTINSPSDLKKLTLDELNELAAQIREELVNRVTLNGGHLASSLGVVELTIALHRVFESPKDKIIWDVGHQSYAHKLLTGRREQFATLRQHGGISGFTCRDESPHDPFGAGHASTSISAGLGMAVARDLAKADYSVISVIGDGAISGGMSFEAINNAGHLHTKFIVILNDNGMAISPSTGALSKFLNNVRFDPRFEFAKRGAKQTITNMPFGKAV-WAFTKSIKHKFEKSMLPGSLWEELGFIYLGPVDGHNIRELEAALKRAKDFES-QPVLIHMITQKGKGYDDAEADAVK-YHGISPKSGGLKSGHGQSYSQVFGQTLHKIMSDNPQVVAITAAMTDGCGLGEVAADFPDRVFDVGICEQHAVTFAAGMATQGYIPVVVIYSTFLQRSFDQIIHDVCLQKLPVVFAIDRGGIVGDDGKTHQGIFDLSFMSLIPDMIVAAPSDENDLQHLLYTAV-NSGKPFAIRYPRGFGEGVEMENGLHNIPIGQNEVLSTGSEIAILATGKS----VAFSREALEILAESSIKPT-LVNNRYISPLDKELVIKIARNHKYLITVEENVISGGLGSRINTILAEAGLVNSIKVANIAIPDKFVEHGNQSLLRAKYGLDGKGIAQKILS 631
>gi|47076771|dbj|BAD18314.1| 1-deoxyxylulose-5-phosphate synthase [Geobacillus stearothermophilus] (630 aa)
Score = 843, Expect = 4.6e-88, Identities = 202/605 (33%), Positives = 335/605 (55%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSK--SKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMS-KSVFLTEKILRKILFKK--EWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHS---LKLSDPNLNSNNQ---TYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDI---EVKKEFSFGSWVYALQTKESKTCIISYGDII-------NDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKL-SCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           + KI +    K M + EL  L+  +R+ +I+       H+  NLG+VEL++AL   FDSP+D + +D GHQ YVHK++T RA +  T+R+  GLSGF + +ES HD   TGHS   LS   G     + K   + ++P+IGD A++ G+A EALN+I + KT M++I+NDN MSI+ NVGALH I+ + + + K  ++ +++  ++L K+      K+  +  +    L        FFE LGF Y G +DG++ +     L+  K +   GP ++HV T KG GY  AE D  G +H     K+         +   ++ ++ +  + +L   D  I  I PAM + S     + +FP+   DVGIAE+HA T AAG+A    K F++IYSTFLQR+YD ++HDV R  L + F +DR  L  +DG+TH G++DI FL+ +PN ++    ++ E + ++  A +    P  +R+ +     +   E  KE   G+W      +++   I+++G  I       + L KE    S+ ++NA FI    +  +L +L +   I  +E+       G  ++  A++       I+++ I +  I  G+  ++ +++ +    I   IK+
  S:     3 LTKIEHPRVLKTMSIPELKQLSAEIRRFLIEKLSKTGGHIGPNLGVVELTIALHREFDSPKDKLIWDVGHQAYVHKILTGRAAEFDTLRQYKGLSGFPKRSESEHDVWETGHSSTSLSAAMGMAIARDLKGTDEYIVPIIGDGALTGGMALEALNHIGHEKTDMIVILNDNEMSIAPNVGALHNILGRLRTAGKYQWVKDEL--ELLLKRIPAVGGKLAATAERLKDSLKYLLVSGVFFEELGFTYLGPVDGHDFEDLFENLRYAKKMK--GPVLVHVITKKGKGYSPAENDKVGTWHGTGPYKIETGAFVKTKEAGPSWSALVSETVRRLARTDPRIVAITPAMPVGSKLEGFASEFPDRMFDVGIAEQHATTLAAGLATQGMKPFLAIYSTFLQRAYDQVVHDVCRQNLNVFFAIDRAGLVGADGETHQGVFDIAFLRHVPNLVLMMPKDENEGQHMVYTAIRYDDGPIAMRFPRGNGLGVPLDEELKEIPIGTWEVLRDGRDA--AILTFGTTISMALEAADQLAKE--GVSVKVVNARFIKPMDEAVLLELLESRLPILTIEEAVLQGGFGSAVLEFAHDRGYHQAVIERMGIPDRFIEHGSVSELLREIGLTAAHIVDRIKT 621
>gi|77361282|ref|YP_340857.1| 1-deoxy-D-xylulose 5-phosphate synthase (DXP synthase) [Pseudoalteromonas haloplanktis TAC125] >gi|119368201|sp|Q3II09|DXS_PSEHT 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|76876193|emb|CAI87415.1| 1-deoxy-D-xylulose 5-phosphate synthase (DXP synthase) [Pseudoalteromonas haloplanktis TAC125] (620 aa)
Score = 843, Expect = 5.0e-88, Identities = 204/581 (35%), Positives = 317/581 (54%)
  Q:    32 LRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGF--IEKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSI---YKSFSKLSKFFKGK----NFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNS------NNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYALQTKE-SKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           LR  +++     S HL+S LG VEL++AL YV+++P D + +D GHQ Y HK++T R D + TIR+ +GL  F    ES +D  S GHS   +S   G     +   K +  + VIGD AI+ G+AFEA+N++   K+ MLII+NDN MSIS+NVGAL    ++  +S S +            +E SKK+   +    +  SK+ +  KG      FFE LG +Y G IDG+++   ++ L+ ++N+   GP +LH+KT KG GYK AE D  G YH +   DPN +S         T+ +V  ++L  + + D+ +  I PAM   S  +  SK+ P+ Y DV IAE+HAVT AAG A    K  V+IYS+FLQR+YD L+HDVA   LP+ F +DR  +  +DG+TH G YD+ F++ IPN +I   S+  E   ++   YQ    P  +RY +      E+           A   K+ +K  I+S+G ++ + +      +  L+N  FI       +  +++++  I  +E    S   G  +       K   +I  + I +  I  G ++++  ++ +    I   IK+
  S:    35 LRDYLLNSVSQSSGHLASGLGTVELTVALHYVYNTPDDRLVWDVGHQAYPHKILTGRRDLMHTIRKKDGLHPFPFREESQYDTFSVGHSSTSISAALGMSIAAQKEGKGRKTVAVIGDGAITAGMAFEAMNHLGDVKSDMLIILNDNEMSISENVGALTNHFARI-LSGSFYTN---------IREGSKKLLSGVPPVKQLASKMEEHIKGMMIPGTFFEELGLNYIGPIDGHDVNMLVDTLRNMRNLK--GPQLLHIKTQKGKGYKPAEADPIG-YHGVPKFDPNTSSLPKSKPGAATFSNVFGDWLCDIAKQDSKLMAITPAMREGSGMVRFSKEHPDQYFDVAIAEQHAVTLAAGFACEGLKPVVAIYSSFLQRAYDQLIHDVALQNLPVLFAIDRAGIVGADGETHQGAYDLSFMRCIPNMVIMAPSDTNECRHMLYTGYQANC-PVAVRYPRGSAGTAEIATNMQLLEIGKADVVKQGAKVAILSFGTLLENAQLAADELNATLVNMRFIKPLDTALLDELINSHDVIVTLEDNAISGGAGSAVNEYLATQKAQVSILNLGIPDEFIKHGTQDEMHDEMGLGEQGILTAIKA 617
>gi|90408170|ref|ZP_01216338.1| 1-deoxy-D-xylulose-5-phosphate synthase [Psychromonas sp. CNPT3] >gi|90310700|gb|EAS38817.1| 1-deoxy-D-xylulose-5-phosphate synthase [Psychromonas sp. CNPT3] (619 aa)
Score = 843, Expect = 5.3e-88, Identities = 206/610 (33%), Positives = 335/610 (54%)
  Q:     3 KNKVKIDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFL-----TEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPN-----LNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYALQTKESKTC-------IISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANE----NKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           KN   + KI   ED + +K  +L +L   LR+ +++     S H +S LG+VEL++AL YV+ +P D + +D GHQ Y HK++T R DK+S+IR   GL  F    ES +D +S GHS   +    G     +   K + V+ VIGD AI+ G+AFEA+N+       ML+I+NDN MSIS+NVGAL+  ++K  +S  ++      ++K+L  I   KE++K+       +   L         FE  GF+Y G +DG+N+   ++ L+ ++     GP  LH+ T KG GYK+AELD  G YH++    P+      +S+  T+ ++  ++L  + + D  +  I PAM   S  +  S++  + Y DV IAE+HAVT A GM+IA     V+IYS+FLQR++D ++HDVA  +  + F +DR  +  +DG TH G YD+ FL+ IP+ +I   S++ E   ++   +  K  P  +RY +     I V+KE        AL   E+K C       I+ +G  +       +  +  LI+  F+    +  +LR+   + +   +E+    NC+        NE     K+  N+  + + +N +  G +++I + L +D   I  +IK+
  S:     6 KNYPLLAKINYPEDLRLLKKQQLPELCDELRQFLLNSVSQSSGHFASGLGVVELTVALHYVYKTPFDHLIFDVGHQAYPHKILTGRRDKMSSIRNFKGLHPFPWRQESEYDVLSVGHSSTSIGAALGMAIAAEKEQKGRKVVAVIGDGAITAGMAFEAMNHAGALHNDMLVILNDNEMSISENVGALNNHLAKI-LSGDLYTHFRERSKKVLENIPPIKEFAKR-------TEEHLKGLVSPSTIFEEFGFNYIGPVDGHNVLDLVDTLRNMR--ARPGPQFLHIMTKKGKGYKQAELDPIG-YHAVPKFTPDQGLPATSSSAPTFSTIFGDWLNDMADIDPKLTAITPAMREGSGMVKFSQRHSDKYYDVAIAEQHAVTLAGGMSIAGLHPVVAIYSSFLQRAFDQVIHDVAIQQQGVLFAIDRAGIVGADGPTHQGAYDLTFLRCIPSMVIMTPSDEQECRNMLYTGHILKGQPAAVRYPRGIGTGIVVEKEMQ------ALNIGEAKVCREGKKLAILCFGTFLQQAISVAQKMNATLIDMRFVKPLDEALLLRLSKDHTDFVSIEE----NCIAGGAGSAVNEFFMAQKIKVNVLNLGLPDNFVEQGTQQEIYQLLELDSAGIERQIKA 617
>gi|160897685|ref|YP_001563267.1| 1-deoxy-D-xylulose-5-phosphate synthase [Delftia acidovorans SPH-1] >gi|160363269|gb|ABX34882.1| deoxyxylulose-5-phosphate synthase [Delftia acidovorans SPH-1] (638 aa)
Score = 842, Expect = 6.5e-88, Identities = 199/546 (36%), Positives = 305/546 (55%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQG--FIEKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKG----KNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNL------NSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEK---CEDIEVKKEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEK 553
           +  I +  D +++   EL  LA  LR  ++D       HLSSNLG VEL++AL  VFD+P D + +D GHQ Y HK++T R ++++++R+  GLSGF +  ES +D   T HS   +S   G     K   + +  I VIGD A++ G+AFEALNN       +L+I+NDN MSIS  VGAL++ +++  MS   +   + + K + K+         + +   +L +  KG       FE+ GF+Y G IDG++L   I  L+ IK++   GP  LHV T KG GYK AE D    YH     DP++          QT+  V  ++L  + + D  +  I PAM   S  +   K+FP  Y DVGIAE+HAVT AAGMA    K  V+IYSTFLQR YD L+HDVA  +LP+ F +DR  L  +DG TH G YDI F++ IP+  + C +++ E  +L+  AY+ + +P  +RY +        +E  +   FG      ++ + +  I+++G ++       +     ++N  +     +E + ++ ST++ I  VE+
  S:    21 LQTIDDPSDLRRLSRAELKTLAQQLRAYVLDSVSKTGGHLSSNLGTVELTVALHAVFDTPYDRVVWDVGHQTYPHKILTGRRERMASLRQFGGLSGFPQRAESPYDTFGTAHSSTSISAALGMALAAKQKGEDRRAIAVIGDGAMTAGMAFEALNNAGVTDANLLVILNDNDMSISPPVGALNRYLAQL-MSGQFYAKARDMGKSVLKQ------VPPLLELAKRLEQQAKGMVVPATLFENFGFNYIGPIDGHDLDSLIPTLENIKSLK--GPQFLHVVTKKGQGYKLAEADPVA-YHGPGKFDPSVGLVKPATPPKQTFTQVFGHWLCDMADKDQRLVGITPAMREGSGMVEFHKRFPGRYYDVGIAEQHAVTFAAGMACEGLKPVVAIYSTFLQRGYDQLIHDVALQKLPVVFALDRAGLVGADGATHAGAYDIAFVRCIPHMSMACPADERECRQLLTTAYE-QDHPVAVRYPRGAGVGVAPLESLEGLPFGKGEVRRESAKKQVAILAFGTLLYPALAAAEALDATVVNMRWAKPLDEELLRQVASTHELIVTVEE 570
>gi|147669319|ref|YP_001214137.1| 1-deoxy-D-xylulose-5-phosphate synthase [Dehalococcoides sp. BAV1] >gi|146270267|gb|ABQ17259.1| 1-Deoxy-D-xylulose-5-phosphate synthase [Dehalococcoides sp. BAV1] (633 aa)
Score = 842, Expect = 6.9e-88, Identities = 211/605 (34%), Positives = 334/605 (55%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGF-IEKNNSKSK-SVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFS-KLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNSNNQ-TYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEF-SFGSWVYALQTKESKTCIISYGDIINDLKK--EIKTKS---IDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIK--KINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           +D I +  D KK+ L EL +LAV +R+++++       HL+S+LG+VEL++AL  VF+SP+D I +D GHQ Y HK++T R ++ +T+R+  GLSGF   +ES HD    GH+   +S   G  + ++ +K   SVI VIGD AIS G++FEA+NN  +  T  ++I+NDNGM+IS + GAL K ++  +        ++  ++ +    + K + W+  KS   K  K     + +E LGF Y G +DG+N+++    LKR K+     P ++H+ T KG GY +AE D    YH +      L S++  +Y  V    L K++  +  +  I  AMT       ++  FP+   DVGI E+HAVT AAGMA       V IYSTFLQR +D ++HDV   +LP+ F +DR  +   DG TH GI+D+ F+  IP+ +++  S++ +L+ L+  A  N   PF +RY +   E +E++    +       +    S   I++ G  +   ++  EI T+S     L+N  +I+    E VL+I  ++K +  VE+   S  LG  +  L  E  L   IK   I I +  +  GN+  +  K  +D   I   + S
  S:     5 LDTINSPSDLKKLSLDELRELAVQIREELVNRVTLNGGHLASSLGVVELTIALHRVFESPKDKIIWDVGHQSYAHKLLTGRREQFATLRQHGGLSGFTCRDESPHDPFGAGHASTSISAGLGMAVARDLAKEDYSVISVIGDGAISGGMSFEAINNAGHLHTKFIVILNDNGMAISPSTGALSKFLNNVRFDPRFEFAKRNAKQTITNMPFGKAV-WAFTKSIKRKFEKSMLPGSLWEELGFIYLGPVDGHNIRELEAALKRAKDFES-KPVLIHMITKKGKGYDDAEADAVK-YHGISPKSGGLKSSHGLSYSQVFGQTLHKIMSQNPQVVAITAAMTDGCGLGEIAAAFPDRVFDVGICEQHAVTFAAGMATQGYIPVVVIYSTFLQRGFDQIIHDVCLQKLPVVFAIDRGGIVGDDGKTHQGIFDLSFMSLIPDMVVSAPSDENDLQHLLYTAV-NSGKPFALRYPRGFGEGVEIESSLHNIPIGQNEILVNGSDVAILATGKSVAFAREALEILTESGIKPTLVNNRYISPLDSELVLKIAQSHKYLVTVEENVISGGLGSRINTLLAEAGLVNKIKIANIGIPDKFVEHGNQSLLRAKYGLDGKGIAQRVLS 617
>gi|192813473|ref|ZP_03042135.1| deoxyxylulose-5-phosphate synthase [Geobacillus sp. Y412MC10] >gi|192797738|gb|EDV74256.1| deoxyxylulose-5-phosphate synthase [Geobacillus sp. Y412MC10] (635 aa)
Score = 841, Expect = 8.8e-88, Identities = 203/602 (33%), Positives = 325/602 (53%)
  Q:    11 IPNY---EDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKSKS--VIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKK--EWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSL---KLSDPNL--NSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEF---SFGSWVYALQTKESKTCIISYGDIIN---DLKKEIKTKSI--DLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLI-ILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           +PN    E  K + + EL DLA  +R  +I+       HL+ NLG+VEL++AL Y FDSP+D + +D GHQ YVHK++T R DK  T+R+  GL GF + +ES HD    GHS   LS   G     + K +   VI +IGD A++ G+AFEALN+I + +  +++I+NDN MSI+ NVGA+H  +SK + S   +L  K   +++ KK      K+  +  K    L         FE LGF Y G +DG++L K I+ LK+  N+   GP ++H  T KG GY+ AE D    +H +   K+    +     N  Y  V    L +L E D  I  + PAM   S  +  SKKFP+   DVGIAE+HA T  A +A+   K   ++YSTF+QR+YD ++HD+ R    + F +DR     +DG+TH G+YD+ F++ IPN +I    ++ EL  ++  A      P   RY +     + +  E      G+W   +        I++ G ++    +  +++K + I  +++NA F+     + +  +  T  ++ V+E+   +  LG  ++   A +      +  + I +  I  G+     +++ + +  +  EI+S
  S:     3 LPNIKQPEQLKNLSVDELEDLAGQIRHFLIEKLSVTGGHLAPNLGVVELTLALHYCFDSPRDKMIFDVGHQAYVHKILTGRMDKFDTLRKYKGLCGFVKRSESEHDVWEAGHSSTSLSAAMGMAMARDLKGEDNRVIAMIGDGALTGGMAFEALNHIGHEQKKLMVILNDNEMSIAPNVGAMHNYLSKIR-SDRFYLRAKDEVEMVLKKIPAIGGKLAKTAEKMKDSLKYMMVPGVLFEELGFTYLGPVDGHDLNKLIDTLKQADNVD--GPVLIHAVTTKGKGYRPAESDSHK-WHGITPYKIESGQVLKAVGNPMYTEVFGQTLVELGEQDKRIVAVTPAMPGGSGLIPFSKKFPDRMIDVGIAEQHAATLCAALAMEGMKPVFAVYSTFMQRAYDQIVHDICRHNANVMFAIDRAGFVGADGETHQGVYDVAFMRHIPNIVIMMPKDENELRHMMKTALDYNEGPIAYRYPRNNVRGVPMDTELVPIPIGTW--EVVRPGEGYAILASGPMVQLAEEAAEQLKREGIAVEVVNARFLKPLDGDMLANLAKTGTSMLVLEETSQAGSLGSAVLEYFAEQGIHDAVVSLMGIEDRFIEHGSIPQQREEVGLTLEGVCQEIRS 619
>gi|145589884|ref|YP_001156481.1| deoxyxylulose-5-phosphate synthase [Polynucleobacter sp. QLW-P1DMWA-1] >gi|145048290|gb|ABP34917.1| 1-Deoxy-D-xylulose-5-phosphate synthase [Polynucleobacter sp. QLW-P1DMWA-1] (633 aa)
Score = 840, Expect = 1.1e-87, Identities = 198/495 (40%), Positives = 283/495 (57%)
  Q:    15 EDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKSKS--VIPVIGDAAISNGLAFEALNNIA-YNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKG----KNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIV--PFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLN-----SNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYALQTKESKTCIISYGDI 509
           +D KK+   EL  LA  LR+ I+D       HLSSNLG VELS+AL YVFD+P+D I +D GHQ Y HK++T R D++ T+R+  GLSGF   +ES  D   TGHS   +S   G      +K +    + VIGD+A++ G+AFEA+NN   Y+  P+++I+NDN MSIS  VGAL++ +++         T+K +  +L        I   + +   +L    KG       F+  GF+YFG IDG++L   I +L+ ++ +     GP  LHV T KG GY+ AE D   LYH     DP        ++ +T+  V   +L  +   D  +  I PAM   S  ++  K FP  Y DVGIAE+HAVT AAGMA    K  V+IYSTFLQR+YD L+HDVA  +LP+ F +DR  L  +DG TH G YDI FL+ IPN ++   +++ E   L+  A+ ++ +P  +RY +              GS V  + + E +T  +  G+I
  S:    10 DDLKKLTREELPALADELRQFILDSVSKTGGHLSSNLGTVELSIALHYVFDTPRDRIVWDVGHQSYPHKILTGRRDQMHTLRQFKGLSGFPHRSESEFDAFGTGHSSTSISAAMGMARAFQTKGERQVAVAVIGDSAMTGGMAFEAMNNAGVYDDLPLVVILNDNDMSISPAVGALNRHLARLLSGNIYSATKKGIDSVL-------SIAPPLREFAKRLEDHAKGMVSPSTIFQEFGFNYFGPIDGHDLDALIPMLQNVRRLALEGRGPQFLHVVTKKGQGYELAEADPV-LYHGPSKFDPEQGVKKSLTSKKTFTQVFGEWLCDMAHADPLLVGITPAMREGSGLVDFEKNFPKRYYDVGIAEQHAVTFAAGMACEGMKPVVAIYSTFLQRAYDQLIHDVALQDLPVLFALDRAGLVGADGATHAGAYDIPFLRCIPNMLVMTPADEAECRDLLTTAF-HQPHPSAVRYPR--------------GSGVGTIPSTELRTVPLGKGEI 495
>gi|171323377|ref|ZP_02911897.1| deoxyxylulose-5-phosphate synthase [Geobacillus sp. WCH70] >gi|171090571|gb|EDT36864.1| deoxyxylulose-5-phosphate synthase [Geobacillus sp. WCH70] (630 aa)
Score = 840, Expect = 1.2e-87, Identities = 201/605 (33%), Positives = 328/605 (54%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSK--SKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFK-KEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHS---LKLSDPNLNSNNQT---YGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFS---FGSWVYALQTKESKTCIISYGDIINDLKKEIKTK------SIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKL-SCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           + KI N    K M   +L++L+  +RK +I+       H+  NLG+VEL++AL  VFDSP+D + +D GHQ YVHK++T RA +  T+R+  GLSGF + +ES HD   TGHS   LS   G     + K   + ++P+IGD A++ G+A EALN+I + K  +++++NDN MSI+ NVGALH ++ + + +      +  L  +L +      K+  +  +    L        FFE LGF Y G +DG+N       L   K I   GP +LHV T KG GY  AE D  G +H     K+   +      T   +  + +  + KL   D  I  I PAM + S     + +FP+   DVGIAE+HA T AAG+A    K F++IYSTFLQR+YD ++HDV R  L + F +DR  L  +DG+TH G++DI FL+ +PN +I    ++ E + ++  A Q    P  +R+ +     +++ +E      G+W    + ++    I+++G  I+ +  E   K      S+ ++NA FI    ++ +  +L +   I  +E+       G  ++  A+++      I ++ I +  I  G+ +++  ++ +    I   +K+
  S:     3 VTKIKNPRFLKNMSTKQLIELSADIRKFLIEKLSKTGGHIGPNLGVVELTIALHKVFDSPKDKLIWDVGHQSYVHKILTGRASEFDTLRQYKGLSGFPKRSESEHDVWETGHSSTSLSAAMGMAIARDLKGTDEYIVPIIGDGALTGGMALEALNHIGHEKKDIIVVLNDNEMSIAPNVGALHNVLGRLRTAGKYQWVKDELEFLLKRIPAVGGKLAATAERIKDSLKYLLVSGVFFEELGFTYLGPVDGHNFDDLFENLHYAKKIK--GPVLLHVITKKGKGYSPAENDKVGTWHGTGPYKIETGDFLKPVDTAPSWSELVSETVRKLARTDKRIVAITPAMPVGSKLEGFASEFPDRMFDVGIAEQHATTLAAGLATQGMKPFLAIYSTFLQRAYDQVVHDVCRQNLNVFFAIDRAGLVGADGETHQGVFDIAFLRHVPNLVIMMPKDENEGQHMVYTAIQYDDGPIALRFPRGNGLGVKLDEELKKIPIGTWEVLREGRD--LAILTFGTTIS-MALEAAEKLAKDNISVKVVNARFIKPMDEKILHDLLESNIPILTIEEAVLQGGFGSAVLEFAHDHGYHQAVINRMGIPDRFIEHGSVKELLNEIGLTTAHIIDRVKT 621
>gi|15615342|ref|NP_243645.1| 1-deoxy-D-xylulose-5-phosphate synthase [Bacillus halodurans C-125] >gi|13124134|sp|Q9K971|DXS_BACHD 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|10175400|dbj|BAB06498.1| 1-deoxyxylulose-5-phosphate synthase [Bacillus halodurans C-125] (629 aa)
Score = 839, Expect = 1.3e-87, Identities = 195/520 (37%), Positives = 296/520 (56%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSK--SKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMS------KFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSL---KLSDPNL--NSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDI---EVKKEFSFGSWVYALQTKESKTCIISYGDII---NDLKKEIKTK--SIDLINA 527
           ++K+ +    K M   EL  LA  +R+ +I+       HL  NLG+VEL++AL  +FDSP+D + +D GHQ YVHK++T RA +   +R+  GL GF + +ES HD   TGHS   LS   G     + K   ++VI +IGD A++ G+A EALN+I + +  +++++NDN MSI+ NVGALH ++       K+Q +K     E +++KI     +  K+  +  +    L        FFE +GF Y G +DG++L   +  LK  K     GP ++HV T KG GY  AE D+KG +H +   K+    L       +Y  V A  L+K+   D  I  +  AM   +     +K+FP+   DVGIAE+HA T A G+A    K   ++YSTFLQR YD ++HD+ R  L + F +DR  L  +DG+TH G++DI +L+ +PN  I    ++ EL+ ++  A Q +  P  +RY +     I   EV KE   GSW   +  + +  CI+++G +I       KE+  +  SI LINA
  S:     3 LEKLHDPSLIKSMTKQELEQLAEEIRQFLIEKLSITGGHLGPNLGVVELTLALHSLFDSPKDKLIWDVGHQAYVHKILTGRAGQFDQLRQYKGLCGFPKRDESEHDVWETGHSSTSLSAAMGMATARDLKGTDENVIAIIGDGALTGGMALEALNHIGHEQKDLIVVLNDNEMSIAPNVGALHNVLGRLRTAGKYQKAKEDL--EMLIKKI---PAFGGKLAQAAERVKDSLKYLLVSGIFFEEMGFTYLGPVDGHDLDDLMENLKYAKKTK--GPVLIHVLTKKGKGYAPAENDEKGTWHGVGHYKIESGELVKKPAPPSYSGVFAETLKKIARNDPRIVALTAAMPGGTKLDQFAKEFPDRMFDVGIAEQHATTMAGGLATQGLKPVFAVYSTFLQRGYDQVVHDICRQNLNVFFAIDRAGLVGADGETHQGVFDIAYLRHLPNMKILMPKDENELQHMVYTAIQYEGGPIAVRYPRGNGYGIKMDEVLKEIPIGSW--EVLQEGTDACILTFGTMIPVAEQASKELSQQGYSIRLINA 534
>gi|88859184|ref|ZP_01133825.1| 1-deoxy-D-xylulose 5-phosphate synthase (DXP synthase) [Pseudoalteromonas tunicata D2] >gi|88819410|gb|EAR29224.1| 1-deoxy-D-xylulose 5-phosphate synthase (DXP synthase) [Pseudoalteromonas tunicata D2] (620 aa)
Score = 839, Expect = 1.3e-87, Identities = 201/594 (33%), Positives = 328/594 (55%)
  Q:    17 FKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLT-----EKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGK----NFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNSNNQ------TYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYALQTKE-SKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEI 610
            +++    L  L+  LR+ ++      S HL+S LG VEL++AL YV+++P+D + +D GHQ Y HK++T R D++ TIR+ NGL  F    ES +D  S GHS   +S   G     K  +K++ V+ VIGD A++ G+AFEA+N+       ML+I+NDN MSIS+NVGAL+  +++  +S S +       +K+L  +   KE +           SK+ +  KG      FFE LGF+Y G IDG+++    + L+ ++N+   GP +LHV+T KG GY+ AE D  G YH +   DP+ +S  +      T+  V  ++L  +   D+ +  I PAM   S  +  SK++P  Y DV IAE+HAVT AAG+A       V+IYS+FLQR+YD L+HDVA   LP+ F +DR  +  +DG+TH G YD+ F++ IPN +I   S+  E  +++   ++  + P  +RY +    +          +   A   ++  K  I+S+G ++   K   +  +  L++  FI     + +  + + +K    +E        G  +      NKLS ++  + I +  I  G ++++  ++ +D   I  +I
  S:    20 LRELPQERLATLSTELREYLLTSVSQSSGHLASGLGTVELTVALHYVYNTPEDRLIWDVGHQAYPHKILTGRRDQMHTIRQKNGLHPFPYREESQYDTFSVGHSSTSISAALGMAIAAKKEAKNRKVVAVIGDGAVTAGMAFEAMNHAGDLDADMLVILNDNEMSISENVGALNNHLARI-LSGSFYTNIREGGKKLLSGMPPVKELA-----------SKMEEHLKGMVVPGTFFEELGFNYIGPIDGHDVNMLCDTLRNMRNLK--GPQLLHVRTQKGKGYQPAEADPIG-YHGVPKFDPSESSLPKSKPAAPTFSKVFGDWLCDMAAQDSKLMAITPAMREGSGMVRFSKEYPAQYFDVAIAEQHAVTLAAGLACEGLNPVVAIYSSFLQRAYDQLIHDVALQNLPVLFAIDRAGIVGADGETHQGAYDLSFMRCIPNMVIMAPSDTNECRQMLYTGHK-LNQPAAVRYPRGSAGEYLANSPMQAIAIGKANTIRQGEKVAILSFGTLLEHAKPVAEKLNATLVDMRFIKPIDCDLLTELAAKHKYFITLEDNAIQGGAGSAVNEFVMTNKLSVHVLNLGIPDEFIKHGTQDEMHSEMGLDSAGILTKI 615
>gi|32490893|ref|NP_871147.1| 1-deoxy-D-xylulose-5-phosphate synthase [Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis] >gi|30315820|sp|Q8D357|DXS_WIGBR 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|25166099|dbj|BAC24290.1| dxs [Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis] (626 aa)
Score = 839, Expect = 1.4e-87, Identities = 220/610 (36%), Positives = 348/610 (57%)
  Q:     3 KNKVK---IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVF-LTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLY----HSLKLSDPNLNSNN-QTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSID--LINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           KN++K   + KI N  + +K+   +L+ L   LR+ +ID   + S H +S LG++EL++AL Y++++P D + +D GHQ Y HK+IT R D+I +IR+ NGL  F    ES +D +S GHS   +S   G     +     + V+ VIGD AI++G+AFEA+N+    K+ +LI++NDN MSIS+NVGAL+K  + F +SK +F   +K   K+L K    KKI   I    +K++ +F  K  FE LGF+Y G  +G+++    N+LK+++  +  GP ILHV T KG+GY  AE D  G +     +L++  P    N+  TY S+   +L    + D  +  I PAM   S  +N SK +PN Y DV IAE+HAVT AAG+AI   K  V+IYSTFLQR+YD ++HD+A  +LP+ F +DR  +   DG TH G  D+ +L+ IPN II   S++ E   ++   YQ +  P  +RY +     ++    +        +  K  K  I+++G ++  ++  I  K +D  L++  F+       ++R+  T+K +  +E+       G  +      NKL   +  I I +N +  G++ ++   L +D   I  +IK+
  S:     7 KNEIKFSILKKINNPIELRKLPKKKLIFLCEELREFLIDSVSSSSGHFASGLGVIELTVALHYIYNTPFDYLVWDVGHQAYPHKIITGRRDQIRSIRKKNGLHPFPFREESEYDILSVGHSSTSISASLGMSISARKEGMGRKVVSVIGDGAITSGMAFEAMNHAGDIKSDLLIVLNDNEMSISENVGALNKYSNNF-ISKKIFPFLKKNGEKLLNKIPRFKKI---IEILENKINNYFSPKYLFEELGFNYSGPYNGHDVLLLSNILKKLR--LKKGPNILHVITKKGMGYAPAEKDPIGWHAVPKFNLQIGIPPKKQNSLNTYSSIFGKWLCDTAKKDKKLIAITPAMREGSGLVNFSKMYPNQYFDVAIAEQHAVTFAAGLAIGGYKPIVAIYSTFLQRAYDQIIHDIAIQKLPVLFAIDRAGIVGPDGPTHQGFLDLSYLRCIPNMIIMTPSDENECRLMLHTGYQ-QLGPSAVRYPRGYGIGVKFSNLYKIPLGKGIVLRKGKKIAILNFGVLL--IQANIVAKELDATLVDMRFVKPLDNLLLIRMAKTHKALITIEENVIMGGAGSAVNEFIMYNKLLVPVLNIGIPDNFVSHGSQTEVRSSLGLDSIGIKEKIKN 620
>gi|196235403|ref|ZP_03134206.1| deoxyxylulose-5-phosphate synthase [Thermus aquaticus Y51MC23] >gi|196220665|gb|EDY15281.1| deoxyxylulose-5-phosphate synthase [Thermus aquaticus Y51MC23] (615 aa)
Score = 838, Expect = 1.7e-87, Identities = 212/599 (35%), Positives = 333/599 (55%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKSKS--VIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHS---LKLSDPNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIE--VKKEFSFGSWVYALQTKESKTCIISYGDIIN-DLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSI 606
           ++K+   ED K + L ELL LA  +R +II ++     HL+S+LG+VEL +AL  VF SP+D I +D GHQ Y HK++T R D+  T+R+  G+SGF + +ES HD I+ GH+   L+   G     + + +   V+ VIGD A++ G+A  ALN I   +  MLII+NDN MSIS+NVGAL+K   + Q+ K V   EK+ R IL  +  S +++  + ++          +N F + G  Y G +DG++LK  I++L+ +K +   GPT+LHV T KG GYK AE D    +H         P   S   ++     + + +L   +  + +I PAM   S  +  S + P  Y DVGI E+ AVT AAG+A+   K  V+IYSTFLQR+YD  +HDVA   LP+ F +DR  +  +DG THHG++DI +L++IPN  I    +  EL  ++  A +    P  IRY ++  E +E  +  E ++G+W   +  + ++  I+++G  +   L+       + ++NA F+    +E +LR LS YK +  VE        G  ++   NE  L   ++ + + +  +  G    + ++  ID   I
  S:     3 LEKVNGPEDLKNLSLEELLLLAEEIRSEIIRVTAQNGGHLASSLGVVELILALHRVFQSPKDKILFDVGHQAYAHKLVTGRKDRFHTLRQEGGISGFTKVSESPHDAITVGHASTSLANALGMALARDLRGEDHHVVAVIGDGALTGGMALAALNKIGELQKRMLIILNDNEMSISENVGALNKYFKELQIRKWVQDAEKLGRNIL--ERISPQLFGLVDRAKEAAKLLLHQENPFYAWGIRYVGPVDGHDLKGLIHILEHLKELE--GPTLLHVVTKKGKGYKVAEADPI-YWHGPPGFNPEKPEKVSKGYSWSQAFGDAVTELAHLEPKLFVITPAMREGSGLVRYSIEHPERYLDVGICEDVAVTTAAGLALKGMKPIVAIYSTFLQRAYDQAIHDVAIENLPVVFAIDRAGVVGADGPTHHGVFDIAYLRTIPNFQIAAPKDALELRAMLKKALE-VGGPVAIRYPRDNVERVEEGLWPEIAWGTW--EVLKEGTEVYILAFGKTLRYALEAAGDDPRVGVVNARFLKPLDRE-MLRKLSHYK-LLTVEDHQKMGGFGSAVLEALNEMGLRPEVRVLGLPDRFLEHGPIPSLHRQAGIDPEGI 599
>gi|145298028|ref|YP_001140869.1| 1-deoxyxylulose-5-phosphate synthase [Aeromonas salmonicida subsp. salmonicida A449] >gi|166198595|sp|A4SJP9|DXS_AERS4 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|142850800|gb|ABO89121.1| 1-deoxyxylulose-5-phosphate synthase [Aeromonas salmonicida subsp. salmonicida A449] (621 aa)
Score = 838, Expect = 1.8e-87, Identities = 204/607 (33%), Positives = 331/607 (54%)
  Q:     6 VKIDKIPNYE------DFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKS--KSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLT-----EKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPN------LNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYALQTKESK-TCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           V I   PN        + + +    L  L   LR+ ++      S HL+S LG VEL++AL YV+++P D + +D GHQ Y HK++T R D++ +IR+ +GL  F    ES +D +S GHS   +    G      S+   + V+ VIGD AI+ G+AFEALN+       ML+++NDN MSIS+NVGAL+  +++  MS  ++ T     +K+L  +   KE +K+       +   L         FE LGF+Y G IDG++++  +  L+ ++N+    P +LHVKT KG GY+ AE D  G YH +   DP+       +    ++ ++   +L  +   D  +  I PAM   S  +  S+++P+ Y DV IAE+HAVT AAG+AIA+KK  V+IYS+FLQR+YD ++HDVA   LP+ F +DR  L  +DG TH G +DI FL+++PN ++   S++ E  +++   YQ  + P  +RY +     IEV+ E            +  K T I+++G ++   +   +     L++  F+    +  VL + +++     +E        G  +  L   NK    +  + + +  +  G +E+I   L +D   I A I++
  S:     3 VDISNFPNLALADTPVELRSLPFERLPLLCNELREYLLRSVSRSSGHLASGLGTVELTVALHYVYNTPFDRLVWDVGHQAYPHKILTGRRDRMQSIRQKDGLHPFPWRGESEYDVLSVGHSSTSIGAALGMAVAAESEGLGRKVVAVIGDGAITAGMAFEALNHAGDVHKDMLVVLNDNEMSISENVGALNNHLARI-MSGKLYTTIREGGKKVLAGLPPVKELAKR-------AEEHLKGMVVPGTLFEELGFNYIGPIDGHDIEALVETLRNMRNLK--DPQLLHVKTKKGKGYEPAEKDPIG-YHGVPKFDPDECTLPKASGGKPSFSAIFGQWLCDMAAKDEKLVGITPAMREGSGLVKFSQQYPDRYFDVAIAEQHAVTFAAGLAIADKKPVVAIYSSFLQRAYDQVIHDVALQSLPVLFAIDRAGLVGADGPTHQGAFDISFLRTVPNMVVMTPSDENECRQMLYTGYQC-NQPAAVRYPRGSGTGIEVQTEMQVLELGKGRIVRNGKGTAILAFGTLLQQARAAAEALDATLVDMRFVKPMDEALVLSLAASHDQFVTIEDNAIMGGAGSAVNELLMRNKQCKPVLNLGLPDRFVEQGTQEEIYALLGLDSTGIQASIEA 617
>gi|52786336|ref|YP_092165.1| 1-deoxy-D-xylulose-5-phosphate synthase [Bacillus licheniformis ATCC 14580] >gi|161760687|ref|YP_079751.2| 1-deoxy-D-xylulose-5-phosphate synthase [Bacillus licheniformis ATCC 14580] >gi|81385108|sp|Q65HJ2|DXS_BACLD 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|52348838|gb|AAU41472.1| Dxs [Bacillus licheniformis DSM 13] >gi|145903046|gb|AAU24113.2| 1-deoxyxylulose-5-phosphate synthase [Bacillus licheniformis ATCC 14580] (633 aa)
Score = 838, Expect = 1.9e-87, Identities = 199/595 (33%), Positives = 328/595 (55%)
  Q:    17 FKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSK--SKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMS-KSVFLTEKILRKILFKK--EWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHS---LKLSDPNL---NSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFS---FGSWVYALQTKESKTCIISYGDII-------NDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENK-LSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIK 611
            K +   EL  L+  +R+ +I+       H+  NLG+VEL++AL   FDSP+D   +D GHQ YVHK++T R    +T+R+  GL GF + NES HD   TGHS   LS   G     + K  ++ +IP+IGD A++ G+A EALN+I + +  M++I+NDN MSI+ NVGA+H ++ + + + K  ++ +++  + LFK+      K+  +  +    L        FFE LGF Y G +DG++  +    L+  K     GP +LHV T KG GYK AE D  G +H     K+   +     +   ++ S+ +  + KL   D  I  I PAM + S     + +FP    DVGIAE+HA T AAG+A  N K F++IYSTFLQR+YD ++HD+ R  L +   +DR  L  +DG+TH G++DI FL+ IPN ++    ++ E + ++  A +    P  +R+ +     +++ KE      G+W   +    +   I+++G  I        +L+KE   +S+ ++NA FI    +  +  IL+    I  +E+       G  ++  A+E++  S  I ++ I +  I  G+   + +++ +    +   I+
  S:    12 LKNLSNEELESLSAEIRRFLIETLSESGGHIGPNLGVVELTIALHKEFDSPKDKFLWDVGHQSYVHKLLTGRGKDFATLRQHKGLCGFPKRNESEHDVWETGHSSTSLSGAMGMAAARDLKGTNEYIIPIIGDGALTGGMALEALNHIGHEQKDMIVILNDNEMSIAPNVGAIHSMLGRLRTAGKYQWVKDEL--EYLFKRIPAVGGKLAATAERIKDSLKYLLVSGMFFEELGFTYLGPVDGHSYDELFENLQYAKKTK--GPVLLHVITKKGKGYKPAETDKTGTWHGTGPYKIDTGDFVKPKAAAPSWSSLVSETVRKLAREDERIVAITPAMPVGSKLEGFASEFPERMFDVGIAEQHAATMAAGLATQNMKPFLAIYSTFLQRAYDQVVHDICRQNLNVFIGIDRAGLVGADGETHQGVFDIAFLRHIPNLVLMMPKDENEGQHMVNTAVKYDDGPIAMRFPRGNGLGVKMDKELKTIPIGTW--EVLRPGTDAVILTFGTTIPMALAAAEELQKE--GRSVRVVNARFIKPLDENMLKEILNEGLPILTIEEAVLQGGFGSSILEFAHEHQSYSPIIDRMGIPDQFIEHGSVAKLLEEIGMTKEDVIRRIR 620
>gi|153094269|gb|EDN75133.1| 1-deoxy-D-xylulose-5-phosphate synthase [Mannheimia haemolytica PHL213] (617 aa)
Score = 837, Expect = 2.2e-87, Identities = 199/553 (35%), Positives = 317/553 (57%)
  Q:     1 MKKNKVKIDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI---EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLT-----EKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNL-----NSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEK 553
           M+K    + +I + ED + +   +L  +   LR  +++     S HL+S LG+VEL++AL YV+ +P D + +D GHQ Y HK++T R D++ TIR+ +G+  F    ES +D +S GHS   +S   G     EK N+  K+V  VIGD AI+ G+AFEALN+     T ML+I+NDN MSIS+NVGAL+  +++   S S++ +     +KIL K+   K + KK      +   K   F      FE LGF+Y G IDG+N+ + +  L  ++ +   GP  LH++T KG GY  AE D  G YH +   DP       +    TY ++  ++L ++ E D  I  I PAM   S  +  SK+FP  Y DV IAE+HAVT  AG+AIA  K  V+IYS+FLQR+YD L+HDVA   LP+ F +DR  +  +DG TH G +D+ F++ IPN  I   S++ E+ +++  AY   + P  IRY +   + ++++           +  +  K  I+++G ++++ K   +  +  L++  FI    +  + ++  +++ +  +E+
  S:     1 MEKKYPLLSEINSPEDLRLLSKDQLQTVVDELRAYLLESVSQTSGHLASGLGVVELTVALHYVYQTPFDQLIWDVGHQAYPHKILTGRRDQMHTIRQKDGIHPFPWREESPYDVLSVGHSSTSISAGLGIAVAAEKENAGRKTVC-VIGDGAITAGMAFEALNHAGALHTDMLVILNDNEMSISENVGALNNHLARI-FSGSLYTSVRDGSKKILDKVPTIKNFMKK-----SEEHMKGVIFSPESTLFEELGFNYIGPIDGHNIDELVKTLSNMRELK--GPQFLHIRTKKGKGYTPAENDPIG-YHGVPKFDPTAAELPKSKAAPTYSNIFGDWLCEMAERDPKIIGITPAMREGSGMVEFSKRFPEQYFDVAIAEQHAVTFGAGLAIAGYKPVVAIYSSFLQRAYDQLIHDVAIQNLPVIFAIDRAGIVGADGQTHQGAFDLSFMRCIPNMTIMAPSDENEMRKMLYTAY-TMNTPSAIRYPRGNAKGVKLEPMQRLEVGKGNIIREGKKVAILNFGALLDEAKIVAEKHNYTLVDMRFIKPLDEALLQKVADSHELLVTLEE 555
>gi|73748558|ref|YP_307797.1| 1-deoxy-D-xylulose-5-phosphate synthase [Dehalococcoides sp. CBDB1] >gi|118595512|sp|Q3ZXC2|DXS_DEHSC 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|73660274|emb|CAI82881.1| deoxyxylulose-5-phosphate synthase [Dehalococcoides sp. CBDB1] (647 aa)
Score = 837, Expect = 2.5e-87, Identities = 213/605 (35%), Positives = 332/605 (54%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGF-IEKNNSKSK-SVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFS-KLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNSNNQ-TYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEF-SFGSWVYALQTKESKTCIISYGDIINDLKK--EIKTKS---IDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIK--KINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           +D I +  D KK+ L EL +LAV +R+++++       HL+S+LG+VEL++AL  VF+SP+D I +D GHQ Y HK++T R ++ +T+R+  GLSGF   +ES HD    GH+   +S   G  + ++ +K   SVI VIGD AIS G++FEA+NN  +  T  ++I+NDNGM+IS + GAL K ++  +        ++  ++ +    + K + W+  KS   K  K     + +E LGF Y G +DG+N+++    LKR K+     P ++H+ T KG GY +AE D    YH +      L S++  +Y  V    L K++  +  +  I  AMT       ++  FP+   DVGI E+HAVT AAGMA       V IYSTFLQR +D ++HDV   +LP+ F +DR  +   DG TH GI+D+ F+  IP+ +++  S++ +L+ LI  A  N   PF +RY +   E  E++    +       +    S   I++ G  +   K   EI T+S     L+N  +I+    E VL+I  ++K +  VE+   S  LG  +  L  E  L   IK   I I +  +  GN+  +  K  +D   I   + S
  S:    19 LDTINSPSDLKKLSLDELRELAVQIREELVNRVTLNGGHLASSLGVVELTIALHRVFESPKDKIIWDVGHQSYAHKLLTGRREQFATLRQHGGLSGFTCRDESPHDPFGAGHASTSISAGLGMAVARDLAKEDYSVISVIGDGAISGGMSFEAINNAGHLHTKFIVILNDNGMAISPSTGALSKFLNNVRFDPRFEFAKRNAKQTITNMPFGKAV-WAFTKSIKRKFEKSMLPGSLWEELGFIYLGPVDGHNIRELEAALKRAKDFES-KPVLIHMITKKGKGYDDAEADAVK-YHGISPKSGGLKSSHGLSYSQVFGQTLHKIMSQNPQVVAITAAMTDGCGLGEIAAAFPDRVFDVGICEQHAVTFAAGMATQGYIPVVVIYSTFLQRGFDQIIHDVCLQKLPVVFAIDRGGIVGDDGKTHQGIFDLSFMSLIPDMVVSAPSDENDLQHLIYTAV-NSGKPFALRYPRGFGEGAEIESSLHNIPIGQNEILVNGSDVAILATGKSVAFAKDALEILTESGIKPTLVNNRYISPLDSELVLKIAQSHKYLVTVEENVISGGLGSRINTLLAEAGLVNKIKIANIGIPDKFVEHGNQSLLRAKYGLDGKGIAQRVLS 631
>gi|171464022|ref|YP_001798135.1| deoxyxylulose-5-phosphate synthase [Polynucleobacter necessarius STIR1] >gi|171193560|gb|ACB44521.1| deoxyxylulose-5-phosphate synthase [Polynucleobacter necessarius STIR1] (633 aa)
Score = 837, Expect = 2.6e-87, Identities = 195/495 (39%), Positives = 284/495 (57%)
  Q:    15 EDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKSKS--VIPVIGDAAISNGLAFEALNNIA-YNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKG----KNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIV--PFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLN-----SNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYALQTKESKTCIISYGDI 509
           +D KK+   EL  LA  LR+ ++D       HLSSNLG VELS+AL YVFD+PQD I +D GHQ Y HK++T R ++++T+R+  GLSGF   +ES  D   TGHS   +S   G      +K +    + VIGD+A++ G+AFEA+NN   Y+  P+++I+NDN MSIS  VGAL++ +++         T+K +  +L        I   + +   +L    KG       F+  GF+YFG IDG++L   I +L+ ++ +     GP  LHV T KG GY+ AE D   LYH     +P        ++ +T+  V   +L  +   D  +  I PAM   S  +   K FP  Y DVGIAE+HAVT AAGMA    K  V+IYSTFLQR+YD L+HDVA  +LP+ F +DR  L  +DG TH G YDI FL+ IPN ++   +++ E   L+  A+ ++ +P  +RY +              G+ V  + +KE +T  +  G++
  S:    10 DDLKKLSREELPALADELREFVLDSVSKTGGHLSSNLGTVELSIALHYVFDTPQDRIVWDVGHQSYPHKILTGRRERMNTLRQYKGLSGFPHRSESEFDAFGTGHSSTSISAAMGMARAFQTKGERHVAVAVIGDSAMTGGMAFEAMNNAGVYDDLPLVVILNDNDMSISPAVGALNRHLARLLSGNIYSATKKSIDSVL-------SIAPPLREFAKRLEDHAKGMVSPSTIFQEFGFNYFGPIDGHDLDALIPMLQNVRRLALEGRGPQFLHVVTKKGQGYELAEADPV-LYHGPSKFNPEEGVKKSVASKKTFTRVFGEWLCDMAHADPLLVGITPAMREGSGLVEFEKNFPKRYYDVGIAEQHAVTFAAGMACEGMKPVVAIYSTFLQRAYDQLIHDVALQDLPVLFALDRAGLVGADGATHAGAYDISFLRCIPNMLVLTPADEAECRDLLTTAF-HQPHPSAVRYPR--------------GAGVGTIPSKELRTLPLGKGEV 495
>gi|196125110|ref|ZP_03116859.1| 1-deoxy-D-xylulose 5-phosphate synthase [Clostridium difficile ATCC 43255] (621 aa)
Score = 836, Expect = 2.8e-87, Identities = 212/604 (35%), Positives = 339/604 (56%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKSK--SVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKN--FFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNSNNQTYGSVAANFLEKLIEYDN---NIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYALQTKESKTCIISYGDIIN---DLKKEIKTKSID--LINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIK 611
           +DK+ + +D K M + E+  LA  +RK ++        HL+SNLG+VEL++AL  VFDSP+D I +D GHQ YVHK++T R D   ++R+ NGLSGF + NES HD   TGHS   +SI  G     + K +  SVI VIGD +I+ G+A EALN + Y  T M++I+NDN MSI KNVG + K +S    + +V      + KIL   +  + +  + ++   KL   F  ++  FF+SLG  Y+G IDG+N K+ I++L++ K+    GP +LHV T KG GY+ AE +    YH +   D      +    S++ +  EKL++  N   NI  I  AM   +        +P  Y DVGIAE+HA   AAG+A    K + ++YS+FLQR+YD ++HDV   + P+TFL+DR  L  +DG+THHG++D+ +L SIPN ++    +  E+E ++ L+ +    P  IRY +     ++  +        Y +  +   T I+  G ++    + K+ +  + I+  ++NA F+    +  +  +L  +KN+  +E    +   G  +     +N+ + NI  I I    +  GN +++   + +   SI  +I+
  S:     5 LDKVNSPKDIKNMSIEEMDLLAKDIRKFLVKSVSKTGGHLASNLGVVELTLALHKVFDSPKDKIVWDVGHQSYVHKIVTGRKDCFVSLRQFNGLSGFPKENESPHDIFDTGHSSTSISIATGIACARDIKKENYSVISVIGDGSITGGMALEALNQLGYIDTNMIVILNDNEMSIDKNVGGMSKYLSSIIRNSTVEKMTDEVDKILNVTQTGEILSKTAHRFKDKLMYSFSPQDCSFFDSLGIRYYGPIDGHNTKELIDILRKAKH--KKGPVLLHVITKKGKGYRFAE-EQPDKYHGVSKFDIKTGVTSAKVKSMSISVGEKLVDMANSNENIVAITAAMPSGTGLNLFESAYPKRYYDVGIAEQHATGFAAGLAKNGMKPYFAVYSSFLQRAYDQVIHDVCITKKPVTFLIDRAGLVGNDGETHHGMFDLSYLNSIPNIVVMAPKDTREMELMMDLSLKLDC-PLAIRYPRGSSYYLDKGEYGEIVLGKYEVLDEGQDTVILCIGSMVKHALEAKEILSREGINPTIVNARFLKPIDEGMLKALLKNHKNVVTIEDNIVTGGFGSRINKFIIDNEYNVNILNIAIPEEFVKHGNIDELYDFVGLSPKSIADKIR 616
>gi|91225062|ref|ZP_01260284.1| 1-deoxy-D-xylulose-5-phosphate synthase [Vibrio alginolyticus 12G01] >gi|91190005|gb|EAS76276.1| 1-deoxy-D-xylulose-5-phosphate synthase [Vibrio alginolyticus 12G01] (621 aa)
Score = 835, Expect = 4.1e-87, Identities = 194/592 (32%), Positives = 327/592 (55%)
  Q:    15 EDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLT-----EKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLN------SNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYALQTKE-SKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSI 606
           E+ + +    L +L   LR  +++     S HL+S LG VEL++AL YV+++P D + +D GHQ Y HK++T R DK+ TIR+ +GL  F    ES +D +S GHS   +S   G     +   K + ++ VIGD AI+ G+AFEA+N+       ML+I+NDN MSIS+NVGAL+  ++K  +S S++ +     +K+L  +   KE        + ++   L         FE  GF+Y G IDG+++ + +  LK ++ +   GP  LH+ T KG GY+ AE D  G YH +   DP  N          TY  +  +FL  +   D  +  I PAM   S  +  SK++P+ Y DV IAE+HAVT A GMAIA     V+IYSTFLQR YD L+HD+A ++LP+ F +DR  L  +DG TH G +D+ F++ IPN +I   S++ E  +++   +++ S P  +RY +     +E++ EF+          ++  K  I+S+G  + +  +  +  +  + +  F+    +  + ++ + +  +  +E+   +   G  ++    ++K+   +  + + +  I  G ++++ ++L +D   I
  S:    18 EELRLLPKETLPNLCDELRTYLLNSVSQSSGHLASGLGTVELTVALHYVYNTPIDKLIWDVGHQAYPHKILTGRRDKMPTIRQKDGLHPFPWREESEYDTLSVGHSSTSISAGLGMAISAQKEGKGRKIVSVIGDGAITAGMAFEAMNHAGDVHPDMLVILNDNEMSISENVGALNNHLAKV-LSGSLYTSIREGGKKVLSGVPPIKEL-------VRRTEEHLKGMVVPGTLFEEFGFNYIGPIDGHDVNELVKTLKNMRELK--GPQFLHIMTKKGKGYEPAEKDPIG-YHGVPKFDPTHNCLPKSSGGKPTYSKIFGDFLCDMAAQDPKLMAITPAMREGSGMVRFSKEYPDQYFDVAIAEQHAVTLATGMAIAGDHPIVAIYSTFLQRGYDQLIHDIAIMDLPVMFAIDRAGLVGADGQTHQGAFDLSFMRCIPNMVIMAPSDENECRQMLYTGHKH-SGPSAVRYPRGSGMGVEIETEFTALEIGKGRMVRQGEKVAILSFGTFLGNALEAAEYLNATVADMRFVKPLDEALIRQLAADHDVLVTLEENVIAGGAGAGVVEFMMKDKIIKPVLNLGLPDEFIHQGTQDELHEELGLDAKGI 611
>gi|168712862|ref|ZP_02745139.1| 1-deoxy-D-xylulose 5-phosphate synthase [Clostridium difficile QCD-63q42] (621 aa)
Score = 835, Expect = 4.2e-87, Identities = 212/604 (35%), Positives = 338/604 (55%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKSK--SVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKN--FFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNSNNQTYGSVAANFLEKLIEYDN---NIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYALQTKESKTCIISYGDIIN---DLKKEIKTKSID--LINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIK 611
           +DK+ + +D K M + E+  LA  +RK ++        HL+SNLG+VEL++AL  VFDSP+D I +D GHQ YVHK++T R D   ++R+ NGLSGF + NES HD   TGHS   +SI  G     + K +  SVI VIGD +I+ G+A EALN + Y  T M++I+NDN MSI KNVG + K +S    + +V      + KIL   +  + +  + ++   KL   F  ++  FF+SLG  Y+G IDG+N K+ I++L++ K+    GP +LHV T KG GY+ AE +    YH +   D      +    S++ +  EKL++  N   NI  I  AM   +        +P  Y DVGIAE+HA   AAG+A    K + ++YS+FLQR+YD ++HDV   + P+TFL+DR  L  +DG+THHG++D+ +L SIPN ++    +  E+E ++ L+ +    P  IRY +     ++  +        Y +      T I+  G ++    + K+ +  + I+  ++NA F+    +  +  +L  +KN+  +E    +   G  +     +N+ + NI  I I    +  GN +++   + +   SI  +I+
  S:     5 LDKVNSPKDIKNMSIEEMDLLAKDIRKFLVKSVSKTGGHLASNLGVVELTLALHKVFDSPKDKIVWDVGHQSYVHKIVTGRKDCFVSLRQFNGLSGFPKENESPHDIFDTGHSSTSISIATGIACARDIKKENYSVISVIGDGSITGGMALEALNQLGYIDTNMIVILNDNEMSIDKNVGGMSKYLSSIIRNSTVEKMTDEVDKILNVTQTGEILSKTAHRFKDKLMYSFSPQDCSFFDSLGIRYYGPIDGHNTKELIDILRKAKH--KKGPVLLHVITKKGKGYRFAE-EQPDKYHGVSKFDIKTGVTSAKVKSMSISVGEKLVDMANSNENIVAITAAMPSGTGLNLFESAYPKRYYDVGIAEQHATGFAAGLAKNGMKPYFAVYSSFLQRAYDQVIHDVCITKKPVTFLIDRAGLVGNDGETHHGMFDLSYLNSIPNIVVMAPKDTREMELMMDLSLKLDC-PLAIRYPRGSSYYLDKGEYGEIVLGKYEVLDDGQDTVILCIGSMVKHALEAKEILSREGINPTIVNARFLKPIDEGMLKALLKNHKNVVTIEDNIVTGGFGSRINKFIIDNEYNVNILNIAIPEEFVKHGNIDELYDFVGLSPKSIADKIR 616
>gi|168696608|ref|ZP_02728885.1| 1-deoxy-D-xylulose 5-phosphate synthase [Clostridium difficile QCD-37x79] >gi|168726220|ref|ZP_02758497.1| 1-deoxy-D-xylulose 5-phosphate synthase [Clostridium difficile QCD-76w55] >gi|168731415|ref|ZP_02763692.1| 1-deoxy-D-xylulose 5-phosphate synthase [Clostridium difficile QCD-97b34] >gi|196161838|ref|ZP_03122399.1| 1-deoxy-D-xylulose 5-phosphate synthase [Clostridium difficile CIP 107932] (621 aa)
Score = 835, Expect = 4.2e-87, Identities = 212/604 (35%), Positives = 338/604 (55%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKSK--SVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKN--FFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNSNNQTYGSVAANFLEKLIEYDNN---IQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYALQTKESKTCIISYGDIIN---DLKKEIKTKSID--LINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIK 611
           +DK+ + +D K M + E+  LA  +RK ++        HL+SNLG+VEL++AL  VFDSP+D I +D GHQ YVHK++T R D   ++R+ NGLSGF + NES HD   TGHS   +SI  G     + K +  SVI VIGD +I+ G+A EALN + Y  T M++I+NDN MSI KNVG + K +S    + +V      + KIL   +  + +  + ++   KL   F  ++  FF+SLG  Y+G IDG+N K+ I++L++ K+    GP +LHV T KG GY+ AE +    YH +   D      +    S++ +  EKL++  NN   I  I  AM   +        +P  Y DVGIAE+HA   AAG+A    K + ++YS+FLQR+YD ++HDV   + P+TFL+DR  L  +DG+THHG++D+ +L SIPN ++    +  E+E ++ L+ +    P  IRY +     ++  +        Y +      T I+  G ++    + K+ +  + I+  ++NA F+    +  +  +L  +KN+  +E    +   G  +     +N+ + NI  I I    +  GN +++   + +   SI  +I+
  S:     5 LDKVNSPKDIKNMSIEEMDLLAKDIRKFLVKSVSKTGGHLASNLGVVELTLALHKVFDSPKDKIVWDVGHQSYVHKIVTGRKDCFVSLRQFNGLSGFPKENESPHDIFDTGHSSTSISIATGIACARDIKKENYSVISVIGDGSITGGMALEALNQLGYIDTNMIVILNDNEMSIDKNVGGMSKYLSSIIRNSTVEKMTDEVDKILNVTQTGEILSKTAHRFKDKLMYSFSPQDCSFFDSLGIRYYGPIDGHNTKELIDILRKAKH--KKGPVLLHVITKKGKGYRFAE-EQPDKYHGVSKFDIKTGVTSAKVKSMSISVGEKLVDMANNNEDIVAITAAMPSGTGLNLFESAYPKRYYDVGIAEQHATGFAAGLAKNGMKPYFAVYSSFLQRAYDQVIHDVCITKKPVTFLIDRAGLVGNDGETHHGMFDLSYLNSIPNIVVMAPKDTREMELMMDLSLKLDC-PLAIRYPRGSSYYLDKGEYGEIVLGKYEVLDDGQDTVILCIGSMVKHALEAKEILSREGINPTIVNARFLKPIDEGMLKALLKNHKNVVTIEDNIVTGGFGSRINKFIIDNEYNVNILNIAIPEEFVKHGNIDELYDFVGLSPKSIADKIR 616
>gi|46199916|ref|YP_005583.1| 1-deoxy-D-xylulose-5-phosphate synthase [Thermus thermophilus HB27] >gi|81405405|sp|Q72H81|DXS_THET2 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|46197543|gb|AAS81956.1| 1-deoxy-D-xylulose 5-phosphate synthase [Thermus thermophilus HB27] (615 aa)
Score = 835, Expect = 4.2e-87, Identities = 212/599 (35%), Positives = 332/599 (55%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNN--SKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLN---SNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIE--VKKEFSFGSWVYALQTKESKTCIISYGDIIN-DLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSI 606
           +DK+ + ED K++ L ELL LA  +R +II ++     HL+S+LG VEL +AL  VFDSP+D I +D GHQ Y HK++T R D+  T+R+  G+SGF + +ES HD I+ GH+   L+   G +   +   +   V+ VIGD A++ G+A  ALN I   +  MLI++NDN MSIS+NVGAL+K   + Q+ K V   EK+ + IL  +  S +++  + ++          +N F + G  Y G +DG++LK  +++L+ +K +   GPT+LHV T KG GYK AE D    +H     DP      S   T+     + + +L   +  + ++ PAM   S  +  S + P  Y DVGI E+ AVT AAG+A+   K  V+IYSTFLQR+YD ++HDVA   LP+ F +DR  +  +DG THHG++DI +L+++PN  I    +  EL  ++  A +    P  IRY ++  E     V  E ++G W    +  E+   I+++G  +   L+       + ++NA F+    +E +LR LS YK +  VE        G  ++   NE  L   ++ + + +     G    + ++  ID   I
  S:     3 LDKVNSPEDLKRLSLEELLLLAEEIRSEIIRVTAQNGGHLASSLGAVELVLALHRVFDSPRDRILFDVGHQAYAHKLVTGRKDRFHTLRKEGGISGFTKVSESPHDAITAGHASTSLANALGMVLARDLMGEDYHVVAVIGDGALTGGMALAALNKIGELQKRMLIVLNDNEMSISENVGALNKYFKELQIRKWVQDAEKLGKNIL--ERISPQLFGLVDRAKEAAKLLLHQENPFYAWGIRYVGPVDGHDLKGLVHILEHLKALD--GPTLLHVVTKKGKGYKVAEADPI-YWHGPPGFDPKKPEKVSKGYTWSQAFGDAVTELAHMEPRLFVLTPAMREGSGLVRYSLEHPERYLDVGICEDVAVTTAAGLALRGMKPIVAIYSTFLQRAYDQVIHDVAIENLPVVFAIDRAGIVGADGATHHGVFDIAYLRTVPNLQIAAPKDALELRAMLKKALE-VGGPVAIRYPRDNVERAPEGVWPEIAWGKWEVLKEGTEAY--ILAFGKTLKYALEAAGDDPRVGVVNARFLKPLDRE-MLRALSRYK-LLTVEDHQRMGGFGSAVLEALNEMGLKPEVQVLGLPDRFFEHGAIPSLHRQAGIDAEGI 599
>gi|196165655|ref|ZP_03126186.1| 1-deoxy-D-xylulose 5-phosphate synthase [Clostridium difficile QCD-23m63] (621 aa)
Score = 835, Expect = 4.5e-87, Identities = 212/604 (35%), Positives = 338/604 (55%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKSK--SVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKN--FFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNSNNQTYGSVAANFLEKLIEYDN---NIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYALQTKESKTCIISYGDIIN---DLKKEIKTKSID--LINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIK 611
           +DK+ + +D K M + E+  LA  +RK ++        HL+SNLG+VEL++AL  VFDSP+D I +D GHQ YVHK++T R D   ++R+ NGLSGF + +ES HD   TGHS   +SI  G     + K +  SVI VIGD +I+ G+A EALN + Y  T M++I+NDN MSI KNVG + K +S    + +V      + KIL   +  + +  + ++   KL   F  ++  FF+SLG  Y+G IDG+N K  I++L++ K+    GP +LHV T KG GY+ AE +    YH +   D      +    S++ +  EKL++  N   NI  I  AM   +        +P  Y DVGIAE+HA   AAG+A    K + ++YS+FLQR+YD ++HDV   + P+TFL+DR  L  +DG+THHG++D+ +L SIPN ++    +  ELE ++ L+ +    P  IRY +     ++  +        Y +      T I+  G ++    + K+ +  + I+  ++NA F+    ++ +  +L  +KN+  +E    +   G  +     +N+ + NI  I I    +  GN +++   + +   SI  +I+
  S:     5 LDKVNSPKDIKNMSIEEMDLLAKDIRKFLVKSVSKTGGHLASNLGVVELTLALHKVFDSPKDKIVWDVGHQSYVHKIVTGRKDCFVSLRQFNGLSGFPKESESPHDIFDTGHSSTSISIATGIACARDIKKENYSVISVIGDGSITGGMALEALNQLGYINTNMIVILNDNEMSIDKNVGGMSKYLSSIIRNSTVEKMTDEVDKILNVTQTGEILSKTAHRFKDKLMYSFSPQDCSFFDSLGIRYYGPIDGHNTKDLIDILRKAKH--KKGPVLLHVITKKGKGYRFAE-EQPDKYHGVSKFDIKTGVTSGKVKSMSTSVGEKLVDMANNNENIVAITAAMPSGTGLNLFESAYPKRYYDVGIAEQHATGFAAGLAKNGMKPYFAVYSSFLQRAYDQVIHDVCITKKPVTFLIDRAGLVGNDGETHHGMFDLSYLNSIPNIVVMAPKDTRELELMMDLSLKLDC-PLAIRYPRGSSYYLDKGEYGEIVLGKYEVLDNGQDTVILCIGSMVKHALEAKEILSREGINPTIVNARFLKPIDEDMLKVLLKNHKNVVTIEDNIVTGGFGSRINKFIIDNEYNVNILNIAIPEEFVKHGNADELYDFVGLSPKSIADKIR 616
>gi|71083316|ref|YP_266035.1| 1-deoxy-D-xylulose-5-phosphate synthase [Candidatus Pelagibacter ubique HTCC1062] >gi|118595598|sp|Q4FN07|DXS_PELUB 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|71062429|gb|AAZ21432.1| 1-D-deoxyxylulose 5-phosphate synthase [Candidatus Pelagibacter ubique HTCC1062] (637 aa)
Score = 834, Expect = 4.8e-87, Identities = 203/538 (37%), Positives = 309/538 (57%)
  Q:    16 DFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKN--NSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNSNNQT--------YGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIE---VKKEFSFGSWVYALQTKESKTCIISYGDIINDLK---KEIKTKSID--LINAVFITNYQKENVLRILSTYKNIYVVEK 553
           D +K+  ++L +++  +RK++ID       HL + LG+VEL++AL YVFD+P D + +D GHQ Y HK++T R  KI T+R+ NGLSGF + +ES +D     HS   +S   G  E N  ++K  ++I VIGD AIS G+A+EA+NN   +KT M++I+NDN MSI+K VGA+   ++K    K  F   +  + I+    +SK+      K+   L     G   F SLGF+Y G IDG++L   I +LK  ++    GP ++H+KT KG GY  AE   K   H   +S  N+ +  Q         Y  V AN L K  E D+ +  +  AM   +     +K FP    DVGIAE+HAVT AAG+A    K +V+IYSTFLQR+YD ++HDVA   LP+ F++DR  L  +DG TH G +DI +L ++PN I+   S++ EL ++   +    + P  IRY +     +E   + +    G      + K+   CI+S G  + + K    E+K K I+  +++A F     +E +L+    ++ +  VE+
  S:    15 DLRKLSENDLQEVSNEVRKEMIDAVSETGGHLGAGLGVVELTVALHYVFDTPNDRLIWDVGHQTYPHKILTGRKSKIKTLRQGNGLSGFTKRSESEYDPFGAAHSSTSISSALGMAEANKLSNKLNNIIAVIGDGAISAGMAYEAMNNAGASKTKMIVILNDNDMSIAKPVGAMRTYLAKLLTGKIYFSLRETFKLIV--SAFSKRFSVKAGKAEDFLRSAVTGGTLFNSLGFYYVGPIDGHDLSTLIPILKNARDSKHQGPIMIHIKTQKGKGYSYAE---KASDHYHGVSKFNVVTGEQVKSGTNLPAYTKVFANTLVKHAERDSKVVGVTAAMPGGTGMDIFAKDFPKRMFDVGIAEQHAVTFAAGLATEGYKPYVAIYSTFLQRAYDQVVHDVAIQSLPVRFIIDRAGLVGADGSTHAGSFDITYLSTLPNFIVMAPSDEAELVKMTNTSMTINNKPCAIRYPRGNGIGVELPSIDENIEIGKGRVIQEGKQ--VCILSIGTRLEECKIAAAELKNKGIESTIVDARFAKPLDQELILKCAREHEAMITVEE 563
>gi|167464889|ref|ZP_02329978.1| 1-deoxy-D-xylulose-5-phosphate synthase [Paenibacillus larvae subsp. larvae BRL-230010] (646 aa)
Score = 834, Expect = 5.1e-87, Identities = 181/489 (37%), Positives = 288/489 (58%)
  Q:     2 KKNKVKIDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKSKS--VIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGK--------NFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHS--LKLSDPNL--NSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFS---FGSW 490
           ++  V +D+I   +D K + L EL  L+  +R+ +I+       HLSSNLGIVEL++AL  +++SP+D   +D GHQ YVHK++T R D+  T+R+  G+ GF + +ES HD    GHS   LS   G     + + +   +I +IGD A++ G+A EA+N+I + +  M++I+NDN MSI+ NVGALH  ++K +  K     ++ +  +L      KKI  +I  + +K ++ FK           +FE LGF YFG +DG+N+ + +  +K+ + +   GP ++HV T KG GY  AE D    + +   K+    +  +  N  Y  V  N L +L E D+ I  I PAM   S  +  +++FP+   DVGIAE+HA T +AG+A    K   ++YSTF+QR+YD ++HD+ R  L +TF +DR      DG+TH G++DIGF++++PN ++    ++ EL  ++  A +    P   RY +     +E+ KE      GSW
  S:    13 EETSVLLDRINQPDDLKGLSLEELEQLSGEIRQFLIEKLSLSGGHLSSNLGIVELTIALHTLYNSPKDKFIFDVGHQSYVHKILTGRKDQFDTLRKYKGMCGFIKRSESEHDIWEAGHSSTSLSAAMGMAVARDFRGEKDKIIAIIGDGAMTGGMALEAMNHIGHEQRKMMVILNDNEMSIAPNVGALHNYLTKIRSDKHYRKAKEEVESLL------KKIP-AIGGTLAKTAEKFKDSLKYLLVSGVWFEELGFKYFGPVDGHNIHQLMETMKQAERVD--GPVLIHVVTKKGKGYTPAEKDSHKWHGAGPYKIESGQILKSVGNPMYTEVFGNTLIELAEKDDRIVTITPAMPGGSGLMKFAERFPDRMVDVGIAEQHAATFSAGLATEGLKPVFAVYSTFMQRAYDQIVHDICRPNLNVTFAIDRAGFVGPDGETHQGVFDIGFMRTLPNMVLMMPKDENELRHMMKTALEYDDGPIAYRYARTNGLGLELDKELRSIPIGSW 509
>gi|28897460|ref|NP_797065.1| 1-deoxy-D-xylulose-5-phosphate synthase [Vibrio parahaemolyticus RIMD 2210633] >gi|32129501|sp|Q87RU0|DXS_VIBPA 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|28805672|dbj|BAC58949.1| 1-deoxyxylulose-5-phosphate synthase [Vibrio parahaemolyticus RIMD 2210633] (621 aa)
Score = 834, Expect = 5.1e-87, Identities = 201/592 (33%), Positives = 327/592 (55%)
  Q:    15 EDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLT-----EKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLN------SNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYALQT-------KESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSI 606
           E+ + +    L  L   LR  +++     S HL+S LG VEL++AL YV+++P D + +D GHQ Y HK++T R D++ TIR+ +GL  F    ES +D +S GHS   +S   G     +   K + VI VIGD AI+ G+AFEA+N+       ML+I+NDN MSIS+NVGAL+  ++K  +S S++ +     +K+L  +   KE        + ++   L         FE  GF+Y G IDG+++ + +  LK ++ +   GP  LH+ T KG GY+ AE D  G YH +   DP+ N          T+  +  +FL  +   D  +  I PAM   S  +  SK+FP+ Y DV IAE+HAVT A GMAIA     V+IYSTFLQR YD L+HD+A ++LP+ F +DR  L  +DG TH G +D+ F++ IPN +I   S++ E  +++   +++ + P  +RY +      E++KEF+      AL+        K  K  I+S+G  + +  +  K  +  + +  F+    +  + ++   +  +  +E+   +   G  +I    + K+   +  + + +  I  G +E++ ++L +D   I
  S:    18 EELRLLPKETLPTLCDELRTYLLNSVSQSSGHLASGLGTVELTVALHYVYNTPVDKLIWDVGHQAYPHKILTGRRDQMPTIRQKDGLHPFPWREESEYDTLSVGHSSTSISAGLGLAISAQKEGKGRKVISVIGDGAITAGMAFEAMNHAGDVHPDMLVILNDNEMSISENVGALNNHLAKV-LSGSLYTSIREGGKKVLSGVPPIKEL-------VRRTEEHLKGMVVPGTLFEEFGFNYIGPIDGHDVNELVKTLKNMRELK--GPQFLHIMTKKGKGYEPAEKDPIG-YHGVPKFDPSHNCLPKSSGGKPTFSKIFGDFLCDMAAQDPKLMAITPAMREGSGMVRFSKEFPDQYFDVAIAEQHAVTLATGMAIAGDHPIVAIYSTFLQRGYDQLIHDIAIMDLPVMFAIDRAGLVGADGQTHQGAFDLSFMRCIPNMVIMAPSDENECRQMLYTGHKH-TGPSAVRYPRGSGMGTEIEKEFT------ALEIGKGRVVRKGEKVAILSFGTFLPNALEAAKNLNATVADMRFVKPLDEALIRQLADEHDVLVTLEENAIAGGAGAGVIEFMMKEKIIKPVLNLGLPDKFIHQGTQEELHEELGLDAKGI 611
>gi|110640681|ref|YP_668409.1| 1-deoxy-D-xylulose-5-phosphate synthase [Escherichia coli 536] >gi|118595579|sp|Q0TKM1|DXS_ECOL5 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|110342273|gb|ABG68510.1| 1-deoxy-D-xylulose 5-phosphate synthase [Escherichia coli 536] (620 aa)
Score = 834, Expect = 5.2e-87, Identities = 195/581 (33%), Positives = 332/581 (57%)
  Q:    32 LRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWS---IYKSFSKLSKFFKGK----NFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNL------NSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVK--KEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEK--VFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           LR+ ++D     S H +S LG VEL++AL YV+++P D + +D GHQ Y HK++T R DKI TIR+  GL  F    ES +D +S GHS   +S   G     +   K++  + VIGD AI+ G+AFEA+N+    +  ML+++NDN MSIS+NVGAL+  +++        L+ K+   +   +E  KK++     I +   +  +  KG       FE LGF+Y G +DG+++   I  LK ++++   GP  LH+ T KG GY+ AE  D   +H++   DP+       +    +Y  +  ++L +    DN +  I PAM   S  +  S+KFP+ Y DV IAE+HAVT AAG+AI   K  V+IYSTFLQR+YD +LHDVA  +LP+ F +DR  +  +DG TH G +D+ +L+ IP  +I   S++ E  +++   Y     P  +RY +     +E+   ++   G  +  ++ +  K  I+++G ++ +  K  ++ +  L++  F+    +  +L + ++++ +  VE+  +      G + +++A+   +S  +  I + +  I  G +E++  +L +D   + A+IK+
  S:    35 LRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQLIWDVGHQAYPHKILTGRRDKIGTIRQKGGLHPFPWRGESEYDVLSVGHSSTSISAGIGIAVAAEKEGKNRRTVCVIGDGAITAGMAFEAMNHAGDIRPDMLVVLNDNEMSISENVGALNNHLAQL-------LSGKLYSSL---REGGKKVFSGVPPIKELLKRTEEHIKGMVVPGTLFEELGFNYIGPVDGHDVLGLITTLKNMRDLK--GPQFLHIMTKKGRGYEPAE-KDPITFHAVPKFDPSSGCLPKSSGGLPSYSKIFGDWLCETAAKDNKLMAITPAMREGSGMVEFSRKFPDRYFDVAIAEQHAVTFAAGLAIGGYKPIVAIYSTFLQRAYDQVLHDVAIQKLPVLFAIDRAGIVGADGQTHQGAFDLSYLRCIPEMVIMTPSDENECRQMLYTGYHYNDGPSAVRYPRGNAVGVELTPLEKLPIGKGI--VKCRGEKLAILNFGTLMPEAAKVAESLNATLVDMRFVKPLDEALILEMAASHEALVTVEENAIMGGAGSGVNEVLMAHRKPVS--VLNIGLPDFFIPQGTQEEMRAELGLDATGMEAKIKA 617
>gi|94500550|ref|ZP_01307081.1| 1-deoxy-D-xylulose-5-phosphate synthase [Oceanobacter sp. RED65] >gi|94427340|gb|EAT12319.1| 1-deoxy-D-xylulose-5-phosphate synthase [Oceanobacter sp. RED65] (625 aa)
Score = 834, Expect = 5.5e-87, Identities = 203/604 (33%), Positives = 325/604 (53%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSI-YKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNSNNQTYGSVAANFLEKLIEY---DNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEV--KKEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKT----KSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIK 611
           +D I    D + +   +L  LA  LR  ++        H  + LG+VEL++AL +V+D+P+DL+ +D GHQ Y HK +T R +++ +IR+  GLS F +  ESI D    GHS   +S   G     +     K V  VIGD A++ G+AFEALN+  +  T ML+I+NDN MSIS+NVG L+K +SK   SK+  +  +  RK+L     +    W +  K+   +  F      FE LGF+Y G +DG+++   +  L+ ++ +   GP  LH+ T KG G++ AE  ++  YH+L      +N N +   S +  F E + +    D  +  I PAM   S+ +  S+ + + Y DV IAE+HAVT AAGMA    K  V+IYSTFLQR YD L+HDVA   L +TF VDR  +  +DG TH G YDI F++ IPN +I C S++ E   L+  AYQ  + P  +RY +   +++ V  K+E         LQ  +S   ++ +G ++ + +K +      + I L++  F     +  ++++ S ++    +E        G  +        +  N+  + I +  I  G++++   ++ ID   I A ++
  S:    15 LDTINEPADLRLLDAKQLPQLATELRHYLLYSVGQSGGHFGAGLGVVELTVALHFVYDTPEDLLVWDVGHQAYPHKALTGRREQLPSIRQKEGLSPFPKRKESIFDTFGVGHSSTSISAALGMAIAARQQGSDKKVAAVIGDGAMTAGMAFEALNHAGHTDTDMLVILNDNDMSISENVGGLNKYLSKILSSKTYAVMREGSRKVLSNIPHA----WELATKTEEHVKGFLTPGILFEELGFNYVGPVDGHDVDALVRTLRNMRELK--GPQFLHIITKKGKGFEPAE-QEQIKYHALSPQTTKVNPNQKKAKSFSNIFGEWICDQAAADKKLFGITPAMREGSDLVKFSEDYADRYFDVAIAEQHAVTLAAGMACEGSKPVVAIYSTFLQRGYDQLVHDVAIQNLDVTFAVDRAGVVGADGPTHAGAYDISFMRCIPNMVIACPSDENECRLLLNTAYQF-NGPAAVRYPRGSGKEVNVTAKQETLEIGKAKVLQKGQSGIAVLCFGPLLEEAEKALSELANGQDITLVDMRFAKPLDETLLIQLASDHRYFVTLEDNAIMGGAGSAVSEFFASKDIQTNVTFLGIPDECIEHGSQKEQWAEMGIDAAGIKATLE 622
>gi|91787629|ref|YP_548581.1| 1-deoxy-D-xylulose-5-phosphate synthase [Polaromonas sp. JS666] >gi|118595599|sp|Q12CQ9|DXS_POLSJ 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|91696854|gb|ABE43683.1| 1-Deoxy-D-xylulose-5-phosphate synthase [Polaromonas sp. JS666] (635 aa)
Score = 833, Expect = 6.4e-87, Identities = 192/546 (35%), Positives = 309/546 (56%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQG--FIEKNNSKSKSVIPVIGDAAISNGLAFEALNNIA-YNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKG----KNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLN------SNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVK---KEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEK 553
           ++ I +  D +++   +L  LA  LR  ++D       HLSSNLG VEL++AL YVF++P+D + +D GHQ Y HK++T R D++ ++R+  GLSGF   +ES +D   T HS   +S   G         + +  + +IGD A+S G+AFEALNN   ++   +L+++NDN MSIS  VGAL++ +++    +     + + +++L       ++   + +   +L    KG       FE+ GF+Y G IDG++L+  I  L+ IK++   GP  LHV T KG GYK AE D    YH     DP +          +T+  V   +L  + E D  +  I PAM   S  +   K+FP  Y DVGIAE+HAVT AAGMA    K  V+IYSTFLQR YD L+HDVA   LP+ F +DR  L  +DG TH G YDI FL+ IPN  + C +++ E  +L+  A++ +++P  +RY +     +E +   +   FG     ++ + S   I+++G ++    +  +   + ++N  +      E +L++ ++++ +  +E+
  S:     5 LETINSPADLRRLPRAQLKALADELRAFVLDSVSKTGGHLSSNLGTVELTVALHYVFNTPEDRLVWDVGHQTYPHKILTGRRDRMGSLRQFGGLSGFPRRDESPYDTFGTAHSSTSISAALGMALAAHQQGEDRHAVAIIGDGAMSAGMAFEALNNAGVHDDCKLLVVLNDNDMSISPPVGALNRYLAQLMSGRFYASAKNVGKQVL-------RVAPPLLELAKRLEAHAKGMVVPATLFENFGFNYIGPIDGHDLESLIPTLENIKHLK--GPQFLHVVTKKGQGYKLAEADPVA-YHGPGKFDPAMGLQKSSAPAKRTFTQVFGQWLCDMAEQDKRLVGITPAMREGSGMVEFHKRFPGRYHDVGIAEQHAVTFAAGMACEGLKPVVAIYSTFLQRGYDQLIHDVALQNLPVVFALDRAGLVGADGATHAGAYDIPFLRCIPNMSVACPADENECRKLLSSAFE-QNHPVAVRYPRGAGAGVEPEPGLQPLPFGKG--EIRREGSGVAILAFGTLLYPALQAAEKLGVTVVNMRWAKPLDTELLLKVAASHEALVTLEE 553
>gi|74310989|ref|YP_309408.1| 1-deoxy-D-xylulose-5-phosphate synthase [Shigella sonnei Ss046] >gi|118595618|sp|Q3Z4Y9|DXS_SHISS 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|73854466|gb|AAZ87173.1| 1-deoxyxylulose-5-phosphate synthase; flavoprotein [Shigella sonnei Ss046] (620 aa)
Score = 832, Expect = 8.2e-87, Identities = 195/581 (33%), Positives = 331/581 (56%)
  Q:    32 LRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGF--IEKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWS---IYKSFSKLSKFFKGK----NFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNL------NSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVK--KEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEK--VFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           LR+ ++D     S H +S LG VEL++AL YV+++P D + +D GHQ Y HK++T R DKI TIR+  GL  F    ES +D +S GHS   +S   G     +   K++  + VIGD AI+ G+AFEA+N+    +  ML+++NDN MSIS+NVGAL+  +++        L+ K+   +   +E  KK++     I +   +  +  KG       FE LGF+Y G +DG+++   I  LK ++++   GP  LH+ T KG GY+ AE  D   +H++   DP+       +    +Y  +  ++L +    DN +  I PAM   S  +  S+KFP+ Y DV IAE+HAVT AAG+AI   K  V+IYSTFLQR+YD +LHDVA  +LP+ F +DR  +  +DG TH G +D+ +L+ IP  +I   S++ E  +++   Y     P  +RY +     +E+   ++   G  +  ++ +  K  I+++G ++ D  K  ++ +  L++  F+    +  +L + ++++ +  VE+  +      G + +++A+   +   +  I + +  I  G +E++  +L +D   + A+IK+
  S:    35 LRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQLIWDVGHQAYPHKILTGRRDKIGTIRQKGGLHPFPWRGESEYDVLSVGHSSTSISAGIGIAVTAEKEGKNRRTVCVIGDGAITAGMAFEAMNHAGDIRPDMLVVLNDNEMSISENVGALNNHLAQL-------LSGKLYSSL---REGGKKVFSGVPPIKELLKRTEEHIKGMVVPGTLFEELGFNYIGPVDGHDVLGLITTLKNMRDLK--GPQFLHIMTKKGRGYEPAE-KDPITFHAVPKFDPSSGCLPKSSGGLPSYSKIFGDWLCETAAKDNKLMAITPAMREGSGMVEFSRKFPDRYFDVAIAEQHAVTFAAGLAIGGYKPIVAIYSTFLQRAYDQVLHDVAIQKLPVLFAIDRAGIVGADGQTHQGAFDLSYLRCIPEMVIMTPSDENECRQMLYTGYHYNDGPSAVRYPRGNAVGVELTPLEKLPIGKGI--VKRRGEKLAILNFGTLMPDAAKVAESLNATLVDMRFVKPLDEALILEMAASHEALVTVEENAIMGGAGSGVNEVLMAHRKPVP--VLNIGLPDFFIPQGTQEEMRAELGLDAAGMEAKIKA 617
>gi|55979975|ref|YP_143272.1| 1-deoxy-D-xylulose-5-phosphate synthase [Thermus thermophilus HB8] >gi|81600600|sp|Q5SMD7|DXS_THET8 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|55771388|dbj|BAD69829.1| 1-deoxy-D-xylulose-5-phosphate synthase [Thermus thermophilus HB8] (615 aa)
Score = 832, Expect = 8.3e-87, Identities = 212/599 (35%), Positives = 332/599 (55%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNN--SKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLN---SNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIE--VKKEFSFGSWVYALQTKESKTCIISYGDIIN-DLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSI 606
           +DK+ + ED K++ L ELL LA  +R +II ++     HL+S+LG VEL +AL  VFDSP+D I +D GHQ Y HK++T R D+  T+R+  G+SGF + +ES HD I+ GH+   L+   G +   +   +   V+ VIGD A++ G+A  ALN I   +  MLI++NDN MSIS+NVGAL+K   + Q+ K V   EK+ + IL  +  S +++  + ++          +N F + G  Y G +DG++LK  +++L+ +K +   GPT+LHV T KG GYK AE D    +H     DP      S   T+     + + +L   +  + ++ PAM   S  +  S + P  Y DVGI E+ AVT AAG+A+   K  V+IYSTFLQR+YD ++HDVA   LP+ F +DR  +  +DG THHG++DI +L+++PN  I    +  EL  ++  A +    P  IRY ++  E     V  E ++G W    +  E+   I+++G  +   L+       + ++NA F+    +E +LR LS YK +  VE        G  ++   NE  L   ++ + + +     G    + ++  ID   I
  S:     3 LDKVNSPEDLKRLSLEELLLLAEEIRSEIIRVTAQNGGHLASSLGAVELVLALHRVFDSPRDRILFDVGHQAYAHKLVTGRKDRFHTLRKEGGISGFTKVSESPHDAITAGHASTSLANALGMVLARDLMGEDYHVVAVIGDGALTGGMALAALNKIGELQKRMLIVLNDNEMSISENVGALNKYFKELQIRKWVQDAEKLGKNIL--ERISPQLFGLVDRAKEAAKFLLHQENPFYAWGIRYVGPVDGHDLKGLVHILEHLKALD--GPTLLHVVTKKGKGYKVAEADPI-YWHGPPGFDPKKPEKVSKGYTWSQAFGDAVTELAHMEPRLFVLTPAMREGSGLVRYSLEHPERYLDVGICEDVAVTTAAGLALRGMKPIVAIYSTFLQRAYDQVIHDVAIENLPVVFAIDRAGIVGADGATHHGVFDIAYLRTVPNLQIAAPKDALELRAMLKKALE-VGGPVAIRYPRDNVERAPEGVWPEIAWGKWEVLKEGTEAY--ILAFGKTLRYALEAAGDDPRVGVVNARFLKPLDRE-MLRELSRYK-LLTVEDHQKMGGFGSAVLEALNEMGLKPEVQILGLPDRFFEHGAIPSLHRQAGIDAEGI 599
>gi|157158400|ref|YP_001461602.1| 1-deoxy-D-xylulose-5-phosphate synthase [Escherichia coli E24377A] >gi|157159941|ref|YP_001457259.1| 1-deoxy-D-xylulose-5-phosphate synthase [Escherichia coli HS] >gi|170021208|ref|YP_001726162.1| deoxyxylulose-5-phosphate synthase [Escherichia coli ATCC 8739] >gi|188496009|ref|ZP_03003279.1| 1-deoxy-D-xylulose-5-phosphate synthase [Escherichia coli 53638] >gi|191166749|ref|ZP_03028576.1| 1-deoxy-D-xylulose-5-phosphate synthase [Escherichia coli B7A] >gi|166920139|sp|A7ZIH3|DXS_ECO24 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|166920140|sp|A7ZX72|DXS_ECOHS 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|189027774|sp|B1J029|DXS_ECOLC 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|157065621|gb|ABV04876.1| 1-deoxy-D-xylulose-5-phosphate synthase [Escherichia coli HS] >gi|157080430|gb|ABV20138.1| 1-deoxy-D-xylulose-5-phosphate synthase [Escherichia coli E24377A] >gi|169756136|gb|ACA78835.1| deoxyxylulose-5-phosphate synthase [Escherichia coli ATCC 8739] >gi|188491208|gb|EDU66311.1| 1-deoxy-D-xylulose-5-phosphate synthase [Escherichia coli 53638] >gi|190903260|gb|EDV62982.1| 1-deoxy-D-xylulose-5-phosphate synthase [Escherichia coli B7A] (620 aa)
Score = 832, Expect = 9.8e-87, Identities = 195/581 (33%), Positives = 331/581 (56%)
  Q:    32 LRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWS---IYKSFSKLSKFFKGK----NFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNL------NSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVK--KEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEK--VFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           LR+ ++D     S H +S LG VEL++AL YV+++P D + +D GHQ Y HK++T R DKI TIR+  GL  F    ES +D +S GHS   +S   G     +   K++  + VIGD AI+ G+AFEA+N+    +  ML+++NDN MSIS+NVGAL+  +++        L+ K+   +   +E  KK++     I +   +  +  KG       FE LGF+Y G +DG+++   I  LK ++++   GP  LH+ T KG GY+ AE  D   +H++   DP+       +    +Y  +  ++L +    DN +  I PAM   S  +  S+KFP+ Y DV IAE+HAVT AAG+AI   K  V+IYSTFLQR+YD +LHDVA  +LP+ F +DR  +  +DG TH G +D+ +L+ IP  +I   S++ E  +++   Y     P  +RY +     +E+   ++   G  +  ++ +  K  I+++G ++ D  K  ++ +  L++  F+    +  +L + ++++ +  VE+  +      G + +++A+   +   +  I + +  I  G +E++  +L +D   + A+IK+
  S:    35 LRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQLIWDVGHQAYPHKILTGRRDKIGTIRQKGGLHPFPWRGESEYDVLSVGHSSTSISAGIGIAVAAEKEGKNRRTVCVIGDGAITAGMAFEAMNHAGDIRPDMLVVLNDNEMSISENVGALNNHLAQL-------LSGKLYSSL---REGGKKVFSGVPPIKELLKRTEEHIKGMVVPGTLFEELGFNYIGPVDGHDVLGLITTLKNMRDLK--GPQFLHIMTKKGRGYEPAE-KDPITFHAVPKFDPSSGCLPKSSGGLPSYSKIFGDWLCETAAKDNKLMAITPAMREGSGMVEFSRKFPDRYFDVAIAEQHAVTFAAGLAIGGYKPIVAIYSTFLQRAYDQVLHDVAIQKLPVLFAIDRAGIVGADGQTHQGAFDLSYLRCIPEMVIMTPSDENECRQMLYTGYHYNDGPSAVRYPRGNAVGVELTPLEKLPIGKGI--VKRRGEKLAILNFGTLMPDAAKVAESLNATLVDMRFVKPLDEALILEMAASHEALVTVEENAIMGGAGSGVNEVLMAHRKPVP--VLNIGLPDFFIPQGTQEEMRAELGLDAAGMEAKIKA 617
>gi|194540229|ref|YP_002075270.1| 1-deoxy-D-xylulose-5-phosphate synthase [Vibrio sp. Ex25] >gi|151938784|gb|EDN57618.1| 1-deoxy-D-xylulose-5-phosphate synthase [Vibrio sp. Ex25] (621 aa)
Score = 831, Expect = 1.1e-86, Identities = 193/592 (32%), Positives = 327/592 (55%)
  Q:    15 EDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLT-----EKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLN------SNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYALQTKE-SKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSI 606
           E+ + +    L +L   LR  +++     S HL+S LG VEL++AL YV+++P D + +D GHQ Y HK++T R DK+ TIR+ +GL  F    ES +D +S GHS   +S   G     +   K + ++ VIGD AI+ G+AFEA+N+       ML+I+NDN MSIS+NVGAL+  ++K  +S S++ +     +K+L  +   KE        + ++   L         FE  GF+Y G IDG+++ + +  LK ++ +   GP  LH+ T KG GY+ AE D  G YH +   DP  N          TY  +  +FL  +   D  +  I PAM   S  +  SK++P+ Y DV IAE+HAVT A GMAIA     V+IYSTFLQR YD L+HD+A ++LP+ F +DR  L  +DG TH G +D+ F++ IPN +I   S++ E  +++   +++ + P  +RY +     +E++ EF+          ++  K  I+++G  + +  +  +  +  + +  F+    +  + ++ + +  +  +E+   +   G  ++    ++K+   +  I + +  I  G ++++ ++L +D   I
  S:    18 EELRLLPKETLPNLCDELRTYLLNSVSQSSGHLASGLGTVELTVALHYVYNTPIDKLIWDVGHQAYPHKILTGRRDKMPTIRQKDGLHPFPWREESEYDTLSVGHSSTSISAGLGMAISAQKEGKGRKIVSVIGDGAITAGMAFEAMNHAGDVHPDMLVILNDNEMSISENVGALNNHLAKV-LSGSLYTSIREGGKKVLSGVPPIKEL-------VRRTEEHLKGMVVPGTLFEEFGFNYIGPIDGHDVNELVKTLKNMRELK--GPQFLHIMTKKGKGYEPAEKDPIG-YHGVPKFDPTHNCLPKSSGGKPTYSKIFGDFLCDMAAQDPKLMAITPAMREGSGMVRFSKEYPDQYFDVAIAEQHAVTLATGMAIAGDHPIVAIYSTFLQRGYDQLIHDIAIMDLPVMFAIDRAGLVGADGQTHQGAFDLSFMRCIPNMVIMAPSDENECRQMLYTGHKH-TGPSAVRYPRGSGMGVEIETEFTALEIGKGRMVRQGEKVAILNFGTFLGNALEAAEYLNATVADMRFVKPLDEALIRQLAADHDVLVTLEENVIAGGAGAGVVEFMMKDKIIKPVLNIGLPDEFIHQGTQDELHEELGLDAKGI 611
>gi|186472775|ref|YP_001860117.1| deoxyxylulose-5-phosphate synthase [Burkholderia phymatum STM815] >gi|184195107|gb|ACC73071.1| deoxyxylulose-5-phosphate synthase [Burkholderia phymatum STM815] (632 aa)
Score = 831, Expect = 1.2e-86, Identities = 191/466 (40%), Positives = 270/466 (57%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAY-NKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLT-----EKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKG----KNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELD-----DKGLYHSLKLSDPNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTK 473
           +  I +  D +++   +L  LA  LR  ++D       HLSSNLG VEL++AL YVFD+P+D I +D GHQ Y HK++T R D++ST+R+  G+SGF + +ES +D   T HS   +S   G     K     +  I VIGD A++ G+AFEA+NN    +  P+L+I+NDN MSIS  VGAL++ +++  MS   +       E++LR      + ++K           L +  KG       FE  GF+Y G IDG++L   I  L+ IK +   GP  LHV T KG GYK AE D       G ++  +   P+     +TY  V   +L    E D+ +  I PAM   S  +   K+FP+ Y DVGIAE+HAVT A G+A    K  V+IYSTFLQR YD L+HDVA   LP+ F +DR  L  +DG TH G YD+ F++ IPN  I  AS++ E  +++  A Q + NP  +RY +
  S:     5 LKTIDDPADLRRLDRRQLQPLADELRAFVLDSVSQTGGHLSSNLGTVELTIALHYVFDTPRDRIVWDVGHQTYPHKILTGRRDQMSTLRQLGGISGFPKRDESPYDTFGTAHSSTSISAALGMAIGSKLRGDDRFAIAVIGDGAMTAGMAFEAMNNAGVEDDVPLLVILNDNDMSISPPVGALNRHLARL-MSGRFYAAARAGVERVLRHAPPVLDLARK-----------LEEHAKGMIVPATLFEEFGFNYIGPIDGHDLDSLIPTLQNIKELR--GPQFLHVVTKKGQGYKLAEADPVLYHGPGKFNPAEGIKPSTTPAKKTYTQVFGEWLCDAAELDSRVVGITPAMREGSGMVEFEKRFPDRYYDVGIAEQHAVTFAGGLATEGMKPVVAIYSTFLQRGYDQLIHDVALQNLPVVFAIDRAGLVGADGATHAGAYDLAFMRCIPNMTIMAASDENECRQMLYTALQ-QPNPTAVRYPR 472
>gi|126698803|ref|YP_001087700.1| 1-deoxy-D-xylulose 5-phosphate synthase [Clostridium difficile 630] >gi|118595503|sp|Q18B68|DXS_CLOD6 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|115250240|emb|CAJ68061.1| 1-deoxy-D-xylulose 5-phosphate synthase [Clostridium difficile 630] (621 aa)
Score = 831, Expect = 1.2e-86, Identities = 211/604 (34%), Positives = 338/604 (55%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKSK--SVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKN--FFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNSNNQTYGSVAANFLEKLIEYDN---NIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYALQTKESKTCIISYGDIIN---DLKKEIKTKSID--LINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIK 611
           +DK+ + ++ K M + E+  LA  +RK ++        HL+SNLG+VEL++AL  VFDSP+D I +D GHQ YVHK++T R D   ++R+ NGLSGF + NES HD   TGHS   +SI  G     + K +  SVI VIGD +I+ G+A EALN + Y  T M++I+NDN MSI KNVG + K +S    + +V      + KIL   +  + +  + ++   KL   F  ++  FF+SLG  Y+G IDG+N K+ I++L++ K+    GP +LHV T KG GY+ AE +    YH +   D      +    S++ +  EKL++  N   NI  I  AM   +        +P  Y DVGIAE+HA   AAG+A    K + ++YS+FLQR+YD ++HDV   + P+TFL+DR  L  +DG+THHG++D+ +L SIPN ++    +  E+E ++ L+ +    P  IRY +     ++  +        Y +      T I+  G ++    + K+ +  + I+  ++NA F+    +  +  +L  +KN+  +E    +   G  +     +N+ + NI  I I    +  GN +++   + +   SI  +I+
  S:     5 LDKVNSPKNIKNMSIEEMDLLAKDIRKFLVKSVSKTGGHLASNLGVVELTLALHKVFDSPKDKIVWDVGHQSYVHKIVTGRKDCFVSLRQFNGLSGFPKENESPHDIFDTGHSSTSISIATGIACARDIKKENYSVISVIGDGSITGGMALEALNQLGYIDTNMIVILNDNEMSIDKNVGGMSKYLSSIIRNSTVEKMTDEVDKILNVTQTGEILSKTAHRFKDKLMYSFSPQDCSFFDSLGIRYYGPIDGHNTKELIDILRKAKH--KKGPVLLHVITKKGKGYRFAE-EQPDKYHGVSKFDIKTGVTSAKVKSMSISVGEKLVDMANSNENIVAITAAMPSGTGLNLFESAYPKRYYDVGIAEQHATGFAAGLAKNGMKPYFAVYSSFLQRAYDQVIHDVCITKKPVTFLIDRAGLVGNDGETHHGMFDLSYLNSIPNIVVMAPKDTREMELMMDLSLKLDC-PLAIRYPRGSSYYLDKGEYGEIVLGKYEVLDDGQDTVILCIGSMVKHALEAKEILSREGINPTIVNARFLKPIDEGMLKALLKNHKNVVTIEDNIVTGGFGSRINKFIIDNEYNVNILNIAIPEEFVKHGNIDELYDFVGLSPKSIADKIR 616
>gi|31544557|ref|NP_853135.1| 1-deoxy-D-xylulose-5-phosphate synthase [Mycoplasma gallisepticum R] >gi|31541402|gb|AAP56703.1| Dxs [Mycoplasma gallisepticum R] (409 aa)
Score = 831, Expect = 1.3e-86, Identities = 183/430 (42%), Positives = 269/430 (62%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNN--SKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNSNNQTY----GSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKS 437
           ++ I +Y DF K+K   L  LA  +R  +I++ + KS H SSNLGIVELS+AL Y F+  +D + YDT HQ YVHKM+T R D++ +IRE+NGLSG Q+ NES +D+ + GH+ N LS+  G +  N    K + +IPVIGD +I+NG+AFEA+NNI+++   M+II+NDN MSIS+N G  +K+++  +  ++                                       NFF+ L + Y  + DG++L +    L++ K +V   P I+HVKTIKG G ++AE D  G YH       N N +N+TY    G +AA+ LE  ++      +INPAMT ++ F++L KK+P NY DVGI+EEHA++ A+G+++    VF+ IYSTFLQRSYD L+HD++RL L I  L+DRC L+ ++G +H G    G+LK+
  S:     6 LNTIKSYADFLKIKKAALKQLATEIRDYLINLGKEKSIHWSSNLGIVELSIALAYFFNLDRDKVFYDTSHQAYVHKMVTGRFDRMRSIRETNGLSGLQDLNESKYDYYAGGHTSNSLSVASGLVFSNQLLDKEQLIIPVIGDGSIANGIAFEAINNISFHHHKMIIILNDNQMSISENFGEFNKLLTNLKDDQA---------------------------------------NFFKQLNYEYLKIEDGHDLDQIFAGLEKAKELVKQKPVIVHVKTIKGKGVEQAEADLIGTYH-------NSNRSNKTYQDQSGFIAASHLEAKLKDKKQFCMINPAMTYATGFIDLIKKYPKNYIDVGISEEHALSMASGVSLNQVPVFLPIYSTFLQRSYDQLIHDLSRLNLGINLLIDRCGLNGTEGSSHQGSLMWGWLKT 395
>gi|94311551|ref|YP_584761.1| 1-deoxy-D-xylulose-5-phosphate synthase [Ralstonia metallidurans CH34] >gi|118595608|sp|Q1LK34|DXS_RALME 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|93355403|gb|ABF09492.1| 1-Deoxy-D-xylulose-5-phosphate synthase [Ralstonia metallidurans CH34] (637 aa)
Score = 830, Expect = 1.4e-86, Identities = 184/466 (39%), Positives = 269/466 (57%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIA-YNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKG----KNFFESLGFHYFGVIDGNNLKKTINVLKRIKN--IVPFGPTILHVKTIKGLGYKEAELD-----DKGLYHSLKLSDPNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTK 473
           ++KI +  D +K+   +L  LA  LR  +++       HLSSNLG VEL++AL YVFD+P D + +D GHQ Y HK++T R D++ST+R+  G+SGF    ES +D   T HS   +S   G     +   + +  I VIGD A++ G+AFEA+NN   Y   PML+++NDN MSIS  VG L+K +++    +    T+K + K+L        +   + +   +L +  KG       FE  GF Y G IDG++L+  +  L+ I+   +   GP  LHV T KG GYK AE D       G ++  +   P+   + +TY  V   +L  +   D  +  + PAM   S  +   K+FP+ Y DVGIAE+HAVT A G+A    K  V+IYSTFLQR YD L+HDVA   LP+ F +DR  L  +DG TH G+YDI FL+ IPN ++   +++ E  +L+  A+Q    P  +RY +
  S:     6 LNKIDDPADLRKLDRRQLDTLAEELRAYVLESVSQTGGHLSSNLGTVELTIALHYVFDTPNDRVVWDVGHQSYPHKILTGRRDRMSTLRQYGGISGFPRRAESEYDTFGTAHSSTSISAALGMALGARTRGEKRVGIAVIGDGAMTAGMAFEAMNNAGVYKDLPMLVVLNDNDMSISPPVGMLNKHLARLMSGQFYAATKKGIEKVL-------SVAPPVLEFAKRLEEHAKGMVVPATLFEEFGFDYVGPIDGHDLESLVPTLQNIRQRALEGHGPQFLHVVTKKGQGYKLAEADPILYHGPGKFNPAEGIRPSAKPSRKTYTQVFGEWLCDMAAADKRLIGVTPAMREGSGMVEFEKRFPDRYYDVGIAEQHAVTFAGGLACEGLKPVVAIYSTFLQRGYDQLIHDVALQNLPVVFALDRAGLVGADGATHAGVYDIPFLRCIPNMMVMVPADENECRQLLTTAFQQDC-PTAVRYPR 477
>gi|170680644|ref|YP_001742557.1| 1-deoxy-D-xylulose-5-phosphate synthase [Escherichia coli SMS-3-5] >gi|170518362|gb|ACB16540.1| 1-deoxy-D-xylulose-5-phosphate synthase [Escherichia coli SMS-3-5] (620 aa)
Score = 830, Expect = 1.5e-86, Identities = 195/581 (33%), Positives = 331/581 (56%)
  Q:    32 LRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWS---IYKSFSKLSKFFKGK----NFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNL------NSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVK--KEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEK--VFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           LR+ ++D     S H +S LG VEL++AL YV+++P D + +D GHQ Y HK++T R DKI TIR+  GL  F    ES +D +S GHS   +S   G     +   K++  + VIGD AI+ G+AFEA+N+    +  ML+++NDN MSIS+NVGAL+  +++        L+ K+   +   +E  KK++     I +   +  +  KG       FE LGF+Y G +DG+++   I  LK ++++   GP  LH+ T KG GY+ AE  D   +H++   DP+       +    +Y  +  ++L +    DN +  I PAM   S  +  S+KFP+ Y DV IAE+HAVT AAG+AI   K  V+IYSTFLQR+YD +LHDVA  +LP+ F +DR  +  +DG TH G +D+ +L+ IP  +I   S++ E  +++   Y     P  +RY +     +E+   ++   G  +  ++ +  K  I+++G ++ +  K  ++ +  L++  F+    +  +L I ++++ +  VE+  +      G + +++A+   +   +  I + +  I  G +E++  +L +D   + A+IK+
  S:    35 LRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQLIWDVGHQAYPHKILTGRRDKIGTIRQKGGLHPFPWRGESEYDVLSVGHSSTSISAGIGIAVAAEKEGKNRRTVCVIGDGAITAGMAFEAMNHAGDIRPDMLVVLNDNEMSISENVGALNNHLAQL-------LSGKLYSSL---REGGKKVFSGVPPIKELLKRTEEHIKGMVVPGTLFEELGFNYIGPVDGHDVLGLITTLKNMRDLK--GPQFLHIMTKKGRGYEPAE-KDPITFHAVPKFDPSSGCLPKSSGGLPSYSKIFGDWLCETAAKDNKLMAITPAMREGSGMVEFSRKFPDRYFDVAIAEQHAVTFAAGLAIGGYKPIVAIYSTFLQRAYDQVLHDVAIQKLPVLFAIDRAGIVGADGQTHQGAFDLSYLRCIPEMVIMTPSDENECRQMLYTGYHYNDGPSAVRYPRGNAVGVELTPLEKLPIGKGI--VKRRGEKLAILNFGTLMPEAAKVAESLNATLVDMRFVKPLDEALILEIAASHEALVTVEENAIMGGAGSGVNEVLMAHRKPVP--VLNIGLPDFFIPQGTQEEMRAELGLDAAGMEAKIKA 617
>gi|114566129|ref|YP_753283.1| deoxyxylulose-5-phosphate synthase [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|122318773|sp|Q0AZE2|DXS_SYNWW 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|114337064|gb|ABI67912.1| 1-Deoxy-D-xylulose-5-phosphate synthase [Syntrophomonas wolfei subsp. wolfei str. Goettingen] (638 aa)
Score = 830, Expect = 1.5e-86, Identities = 204/603 (33%), Positives = 329/603 (54%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNN--SKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNF-FESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPN----LNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYALQTKESK-------TCIISYG---DIINDLKKEIKTKSID--LINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEI 610
           ++ I +  D KK+ L E+  LA  +R+ ++        HL+SNLG+VELS+AL  VFDSP+D I +D GHQ YVHK++T R +++ST+R+  G+SGF +  ES +D  +TGHS   +S   G     +   +S SV+ VIGD A++ G+AFEALN+     + +++++NDN MSISKNVGA+   +++ +   S   T++ +  +L +              F    K+       FE LGF Y G ++G++L +   VL  IK +   GP +LH  T KG GY+ A      ++H +   D +    L  + +TY  +  +F+    + DN +  I  AMT  +     S+ FP  + DVGI E+HAVT AAGMA +  +  V++YSTFLQR+YD ++HDVA  +LP+ F +DR  L   DG THHG +D  +L+ IPN II   +++ EL  ++  A+ +   P  IRY +   E + +K E         L+  +S+         II+ G    I  D+   +  K ++  L++A F+    +  +      Y  +  +E    +   G  +  +  E  +   +  I + +  +  G  E + ++LN++ +SI   I
  S:     5 LNTINSPRDLKKLSLPEMTQLANEIRQLLVKSVAKCGGHLASNLGVVELSLALHTVFDSPEDKIIWDVGHQAYVHKILTGRREQMSTLRQYGGISGFPKVEESEYDAFNTGHSSTSISAALGMALARDLQGQSNSVVAVIGDGALTAGMAFEALNHAGQEDSDLIVVLNDNEMSISKNVGAMSAYLNRLRTDPSYSRTKEEIESVLNRIPGIGPNLARAAGKFKDTVKYLMVPGIIFEELGFTYIGPVNGHDLAELKAVLSNIKKMK--GPILLHTITQKGKGYEPA-FQKPDIFHGVGPFDVDTGTQLKKSLKTYTEIFGDFMLNQAQRDNKLVAITAAMTSGTGLSEFSRNFPERFFDVGICEQHAVTLAAGMASSGLRPVVAVYSTFLQRAYDQIVHDVALQKLPVIFAIDRAGLVGEDGPTHHGAFDFSYLRHIPNLIIMAPADENELVDMLHSAF-SMEGPVAIRYPRGVGEGVRIKSERQL------LEPGQSRLIAEGQDLAIIAVGRGVSIARDVVDLLAGKGVNPLLVDARFVKPLDRRVIAGAAQKYHRLLTIEDNSLAGGFGSAIGEMLVEEGIDAELLHIALPDEFVEHGRVELLFEQLNMNPDSILESI 616
>gi|120610695|ref|YP_970373.1| 1-deoxy-D-xylulose-5-phosphate synthase [Acidovorax avenae subsp. citrulli AAC00-1] >gi|166198591|sp|A1TNR1|DXS_ACIAC 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|120589159|gb|ABM32599.1| 1-Deoxy-D-xylulose-5-phosphate synthase [Acidovorax avenae subsp. citrulli AAC00-1] (622 aa)
Score = 830, Expect = 1.5e-86, Identities = 187/458 (40%), Positives = 262/458 (57%)
  Q:    16 DFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSK-FFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNL------NSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTK 473
           D ++M   +L +LA  LR  ++D       HLSSNLG VEL++AL  VFD+P+D + +D GHQ Y HK++T R D++ T+R+  GLSGF +  ES +D   T HS   +S   G     +   + +  + +IGD A++ G+AFEALNN       +L+I+NDN MSIS  VGAL++ +++  MS   +   K + K +            + K F + +K        FE  GF+Y G IDG++L   I  L+ IK +   GP  LHV T KG GYK AE D    YH     DP++          QT+  V   +L  +   D+ +  I PAM   S  +   K+FP  Y DVGIAE+HAVT AAGMA    K  V+IYSTFLQR+YD L+HDVA   LP+ F +DR  L  +DG TH G YDI F++ IPN  I C +++ E  +L+  AY  + +P  +RY +
  S:    17 DLRRMSRAQLKELAAELRAFVLDSVSKTGGHLSSNLGTVELTVALHTVFDTPRDRLVWDVGHQTYPHKILTGRRDRMPTLRQLGGLSGFPQRTESEYDTFGTAHSSTSISAALGMAMAARQRGEDRRAVAIIGDGAMTAGMAFEALNNAGVADANLLVILNDNDMSISPPVGALNRYLAQL-MSGQFYAAAKNVGKTVLG---PVPPLLELAKRFEQQAKGMVLPATLFEKFGFNYIGPIDGHDLDSLIPTLENIKGLK--GPQFLHVVTKKGQGYKLAEADPVA-YHGPGKFDPSVGLTKPATPPKQTFTQVFGQWLCDMAAQDDRLVGITPAMREGSGMVEFEKRFPGRYYDVGIAEQHAVTFAAGMACEGVKPVVAIYSTFLQRAYDQLIHDVALQNLPVVFALDRAGLVGADGATHAGAYDIPFVRCIPNMSIACPADERECRQLLSTAYA-QDHPVAVRYPR 475
>gi|121604407|ref|YP_981736.1| 1-deoxy-D-xylulose-5-phosphate synthase [Polaromonas naphthalenivorans CJ2] >gi|166198636|sp|A1VMD7|DXS_POLNA 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|120593376|gb|ABM36815.1| 1-Deoxy-D-xylulose-5-phosphate synthase [Polaromonas naphthalenivorans CJ2] (636 aa)
Score = 830, Expect = 1.7e-86, Identities = 196/546 (35%), Positives = 309/546 (56%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQG--FIEKNNSKSKSVIPVIGDAAISNGLAFEALNNIA-YNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKG----KNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFG--PTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLN------SNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVK---KEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEK 553
           ++ I +  D +++   +L  LA  LR  +ID       HLSSNLG VEL++AL YVF++P D + +D GHQ Y HK++T R +++ T+R+  GLSGF   +ES +D   T HS   +S   G     +   ++++ + VIGD ++S G+AFEALNN   ++   +L+++NDN MSIS  VGAL++ +++    +       + +K+L       ++   + +   +L    KG       FES GF+Y G IDG++L+  I  L+ I++++  G  P  LHV T KG GYK AE D    YH     DP++          QT+  V   +L  + E+D  +  I PAM   S  +   K+FP  Y DVGIAE+HAVT AAGMA    K  ++IYSTFLQR YD L+HDVA   LP+ F +DR  L  +DG TH G YDI +L+ IPN  I C +++ E  +L+  A++  S P  +RY +     +E +   K   FG     ++ + S   I+++G ++    +  +     ++N  +      E +L++ + ++ +  +E+
  S:     5 LETINSPADLRRLPRAQLKALADELRAYVIDSVSQTGGHLSSNLGTVELTVALHYVFNTPDDRLVWDVGHQTYPHKILTGRRERMGTLRQLGGLSGFPRRDESEYDTFGTAHSSTSISAALGMALAAEFKGENRNAVAVIGDGSMSAGMAFEALNNAGVHDHCKLLVVLNDNDMSISPPVGALNRHLAQLMSGRFYASARHVGKKVL-------QVAPPLLELARRLESHAKGMVVPAAVFESFGFNYIGPIDGHDLESLIPTLENIRHLMATGAGPQFLHVVTKKGQGYKLAEADPIA-YHGPGKFDPSMGLQKSSAPAKQTFTQVFGRWLCDMAEHDPRLVGITPAMREGSGMVEFHKRFPKRYHDVGIAEQHAVTFAAGMACEGLKPVLAIYSTFLQRGYDQLIHDVALQNLPVVFALDRAGLVGADGATHAGAYDIPYLRCIPNMGIACPADENECRKLLTTAFEQDS-PVAVRYPRGAGAGVEPEAGLKSLPFGKG--EIRREGSGIAILAFGTLLYPALQAAEKLGATVVNMRWAKPLDTELLLKVAAGHEVLVTLEE 557
>gi|191173517|ref|ZP_03035044.1| 1-deoxy-D-xylulose-5-phosphate synthase [Escherichia coli F11] >gi|190906226|gb|EDV65838.1| 1-deoxy-D-xylulose-5-phosphate synthase [Escherichia coli F11] (620 aa)
Score = 829, Expect = 2.1e-86, Identities = 194/581 (33%), Positives = 331/581 (56%)
  Q:    32 LRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWS---IYKSFSKLSKFFKGK----NFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNL------NSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVK--KEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEK--VFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           LR+ ++D     S H +S LG VEL++AL YV+++P D + +D GHQ Y HK++T R DKI TIR+  GL  F    ES +D +S GHS   +S   G     +   K++  + VIGD AI+ G+AFEA+N+    +  ML+++NDN MSIS+NVGAL+  +++        L+ K+   +   +E  KK++     I +   +  +  KG       FE LGF+Y G +DG+++   I  LK ++++   GP  LH+ T KG GY+ AE  D   +H++   DP+       +    +Y  +  ++L +    DN +  I PAM   S  +  S+KFP+ Y DV IAE+HAVT AAG+AI   K  V+IYSTFLQR+YD +LHDVA  +LP+ F +DR  +  +DG TH G +D+ +L+ IP  +I   S++ E  +++   Y     P  +RY +     +E+   ++   G  +  ++ +  K  I+++G ++ +  K  ++ +  L++  F+    +  +L + ++++ +  VE+  +      G + +++A+   +   +  I + +  I  G +E++  +L +D   + A+IK+
  S:    35 LRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQLIWDVGHQAYPHKILTGRRDKIGTIRQKGGLHPFPWRGESEYDVLSVGHSSTSISAGIGIAVAAEKEGKNRRTVCVIGDGAITAGMAFEAMNHAGDIRPDMLVVLNDNEMSISENVGALNNHLAQL-------LSGKLYSSL---REGGKKVFSGVPPIKELLKRTEEHIKGMVVPGTLFEELGFNYIGPVDGHDVLGLITTLKNMRDLK--GPQFLHIMTKKGRGYEPAE-KDPITFHAVPKFDPSSGCLPKSSGGLPSYSKIFGDWLCETAAKDNKLMAITPAMREGSGMVEFSRKFPDRYFDVAIAEQHAVTFAAGLAIGGYKPIVAIYSTFLQRAYDQVLHDVAIQKLPVLFAIDRAGIVGADGQTHQGAFDLSYLRCIPEMVIMTPSDENECRQMLYTGYHYNDGPSAVRYPRGNAVGVELTPLEKLPIGKGI--VKCRGEKLAILNFGTLMPEAAKVAESLNATLVDMRFVKPLDEALILEMAASHEALVTVEENAIMGGAGSGVNEVLMAHRKPVP--VLNIGLPDFFIPQGTQEEMRAELGLDATGMEAKIKA 617
>gi|91215471|ref|ZP_01252442.1| 1-deoxy-D-xylulose-5-phosphate synthase [Psychroflexus torquis ATCC 700755] >gi|91186423|gb|EAS72795.1| 1-deoxy-D-xylulose-5-phosphate synthase [Psychroflexus torquis ATCC 700755] (592 aa)
Score = 829, Expect = 2.1e-86, Identities = 212/605 (35%), Positives = 331/605 (54%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSK---SKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSL----KLSDPNLNSNNQ----TYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYALQTKESKT-CIISYGDIINDLKKEIKTKSIDLINAVFITNYQ-------KENVLR-ILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           +  I + +D +++   +L  LA  LR+ IIDI   K  HL ++LG++EL++AL Y F++P+DL+ +D GHQ Y HK++T R +   T R+ NG+SGF + +ES +D    GHS   +S   G    +  K    K  I VIGDA+I++G+AFE LN+     T +L+I+NDN + I  +VGAL   ++K                                   +K+ K  +  N  E+L F Y G IDG++L + + V +R+K I   GP +LH+ T KG G K+AE DD+  YH+     K +   L  NN+     +  V    L +L   D +I  I PAM   S+   + ++FP+   DVGIAE+HAVT +AGMA    KVF +IYSTFLQR+YD ++HDVA   LP+ F +DR  L  +DG THHG+YD+ FL+SIPN I+   SN  +L +++  A +   +P  IRY + +    E +++F        L+ ++ K   ++S G I ++++  + T    L N+  I +Y         E +L+ +   ++NI  +E        GD ++  A  +     I K+ I +  I  G+ +++     I    I  +IK+
  S:     6 LSNINSPKDLRQLDPRQLEQLARELREFIIDIVSTKEGHLGASLGVIELTIALHYCFNTPEDLLVWDVGHQAYGHKILTGRREVFGTNRKLNGISGFPKRDESPYDTFGVGHSSTSISAALGMAISSQLKGDFDKQHIAVIGDASIASGMAFEGLNHAGVTNTNLLVILNDNAIGIDPSVGALKTYLTK-----------------------------------AKIGKKPRQDNIIEALNFSYEGPIDGHDLPELLKVFERLKTIK--GPKLLHIITKKGKGLKQAE-DDQVRYHAPGKFDKTTGEVLPKNNEGLPPKFQDVFGLTLLELARKDTSIVGITPAMPTGSSLKFMMEEFPDRAFDVGIAEQHAVTLSAGMATQGHKVFCTIYSTFLQRAYDQVIHDVALQNLPVIFCIDRAGLVGNDGATHHGVYDLAFLRSIPNMIVFAPSNAIDLRQMLYTASKGLEHPIAIRYPRGRGTVKEWQQDFKAMEIGKGLKLRDGKDLAVLSLGSISSEVEDALNT----LDNSFSIAHYDLRFLKPLDEMLLQSVFDRFENIITIEDGCIKGGFGDAVLDYAQTSSYKGRIHKLGIPDKFIEQGDTKELYDLAGISSEKIKDKIKA 588
>gi|26246426|ref|NP_752465.1| 1-deoxy-D-xylulose-5-phosphate synthase [Escherichia coli CFT073] >gi|30315827|sp|Q8FKB9|DXS_ECOL6 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|26106824|gb|AAN79009.1|AE016756_192 1-deoxy-D-xylulose 5-phosphate synthase [Escherichia coli CFT073] (620 aa)
Score = 829, Expect = 2.2e-86, Identities = 194/581 (33%), Positives = 331/581 (56%)
  Q:    32 LRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWS---IYKSFSKLSKFFKGK----NFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNL------NSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVK--KEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEK--VFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           LR+ ++D     S H +S LG VEL++AL YV+++P D + +D GHQ Y HK++T R DKI TIR+  GL  F    ES +D +S GHS   +S   G     +   K++  + VIGD AI+ G+AFEA+N+    +  ML+++NDN MSIS+NVGAL+  +++        L+ K+   +   +E  KK++     I +   +  +  KG       FE LGF+Y G +DG+++   I  LK ++++   GP  LH+ T KG GY+ AE  D   +H++   DP+       +    +Y  +  ++L +    DN +  I PAM   S  +  S+KFP+ Y DV IAE+HAVT AAG+AI   K  V+IYSTFLQR+YD +LHDVA  +LP+ F +DR  +  +DG TH G +D+ +L+ IP  +I   S++ E  +++   Y     P  +RY +     +E+   ++   G  +  ++ +  K  I+++G ++ +  K  ++ +  L++  F+    +  +L + ++++ +  VE+  +      G + +++A+   +   +  I + +  I  G +E++  +L +D   + A+IK+
  S:    35 LRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQLIWDVGHQAYPHKILTGRRDKIGTIRQKGGLHPFPWRGESEYDVLSVGHSSTSISAGIGIAVAAEKEGKNRRTVCVIGDGAITAGMAFEAMNHAGDIRPDMLVVLNDNEMSISENVGALNNHLAQL-------LSGKLYSSL---REGGKKVFSGVPPIKELLKRTEEHIKGMVVPGTLFEELGFNYIGPVDGHDVLGLITTLKNMRDLK--GPQFLHIMTKKGRGYEPAE-KDPITFHAVPKFDPSSGCLPKSSGGLPSYSKIFGDWLCETAAKDNKLMAITPAMREGSGMVEFSRKFPDRYFDVAIAEQHAVTFAAGLAIGGYKPIVAIYSTFLQRAYDQVLHDVAIQKLPVLFAIDRAGIVGADGQTHQGAFDLSYLRCIPEMVIMTPSDENECRQMLYTGYHYNDGPSAVRYPRGNAVGVELTPLEKLPIGKGI--VKRRGEKLAILNFGTLMPEAAKVAESLNATLVDMRFVKPLDEALILEMAASHEALVTVEENAIMGGAGSGVNEVLMAHRKPVP--VLNIGLPDFFIPQGTQEEMRAELGLDATGMEAKIKA 617
>gi|16128405|ref|NP_414954.1| 1-deoxyxylulose-5-phosphate synthase, thiamine-requiring, FAD-requiring [Escherichia coli str. K-12 substr. MG1655] >gi|89107290|ref|AP_001070.1| 1-deoxyxylulose-5-phosphate synthase, thiamine-requiring, FAD-requiring [Escherichia coli W3110] >gi|170080006|ref|YP_001729326.1| 1-deoxyxylulose-5-phosphate synthase, thiamine-requiring, FAD-requiring [Escherichia coli str. K12 substr. DH10B] >gi|2501357|sp|P77488|DXS_ECOLI 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|1773104|gb|AAB40176.1| similar to H. influenzae HI1439 [Escherichia coli] >gi|1786622|gb|AAC73523.1| 1-deoxyxylulose-5-phosphate synthase, thiamine-requiring, FAD-requiring [Escherichia coli str. K-12 substr. MG1655] >gi|2665586|gb|AAC46162.1| D-1-deoxyxylulose 5-phosphate synthase [Escherichia coli] >gi|85674560|dbj|BAE76200.1| 1-deoxyxylulose-5-phosphate synthase, thiamine-requiring, FAD-requiring [Escherichia coli W3110] >gi|169887841|gb|ACB01548.1| 1-deoxyxylulose-5-phosphate synthase, thiamine-requiring, FAD-requiring [Escherichia coli str. K12 substr. DH10B] (620 aa)
Score = 829, Expect = 2.2e-86, Identities = 195/581 (33%), Positives = 331/581 (56%)
  Q:    32 LRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWS---IYKSFSKLSKFFKGK----NFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNL------NSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVK--KEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEK--VFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           LR+ ++D     S H +S LG VEL++AL YV+++P D + +D GHQ Y HK++T R DKI TIR+  GL  F    ES +D +S GHS   +S   G     +   K++  + VIGD AI+ G+AFEA+N+    +  ML+I+NDN MSIS+NVGAL+  +++        L+ K+   +   +E  KK++     I +   +  +  KG       FE LGF+Y G +DG+++   I  LK ++++   GP  LH+ T KG GY+ AE  D   +H++   DP+       +    +Y  +  ++L +    DN +  I PAM   S  +  S+KFP+ Y DV IAE+HAVT AAG+AI   K  V+IYSTFLQR+YD +LHDVA  +LP+ F +DR  +  +DG TH G +D+ +L+ IP  +I   S++ E  +++   Y     P  +RY +     +E+   ++   G  +  ++ +  K  I+++G ++ +  K  ++ +  L++  F+    +  +L + ++++ +  VE+  +      G + +++A+   +   +  I + +  I  G +E++  +L +D   + A+IK+
  S:    35 LRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQLIWDVGHQAYPHKILTGRRDKIGTIRQKGGLHPFPWRGESEYDVLSVGHSSTSISAGIGIAVAAEKEGKNRRTVCVIGDGAITAGMAFEAMNHAGDIRPDMLVILNDNEMSISENVGALNNHLAQL-------LSGKLYSSL---REGGKKVFSGVPPIKELLKRTEEHIKGMVVPGTLFEELGFNYIGPVDGHDVLGLITTLKNMRDLK--GPQFLHIMTKKGRGYEPAE-KDPITFHAVPKFDPSSGCLPKSSGGLPSYSKIFGDWLCETAAKDNKLMAITPAMREGSGMVEFSRKFPDRYFDVAIAEQHAVTFAAGLAIGGYKPIVAIYSTFLQRAYDQVLHDVAIQKLPVLFAIDRAGIVGADGQTHQGAFDLSYLRCIPEMVIMTPSDENECRQMLYTGYHYNDGPSAVRYPRGNAVGVELTPLEKLPIGKGI--VKRRGEKLAILNFGTLMPEAAKVAESLNATLVDMRFVKPLDEALILEMAASHEALVTVEENAIMGGAGSGVNEVLMAHRKPVP--VLNIGLPDFFIPQGTQEEMRAELGLDAAGMEAKIKA 617
>gi|157692926|ref|YP_001487388.1| 1-deoxy-D-xylulose-5-phosphate synthase [Bacillus pumilus SAFR-032] >gi|166920138|sp|A8FF11|DXS_BACP2 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|157681684|gb|ABV62828.1| 1-deoxy-D-xylulose-5-phosphate synthase [Bacillus pumilus SAFR-032] (633 aa)
Score = 828, Expect = 2.8e-86, Identities = 201/581 (34%), Positives = 322/581 (55%)
  Q:    11 IPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSK--SKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMS-KSVFLTEKILRKILFKK--EWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHS---LKLSDPNL---NSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFS---FGSWVYALQTKESKTCIISYGDIIN-------DLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLS-CNIKKINIRNNKIGFGN 591
           I N    K M   EL +L+  +R  +I+   N   H+  NLG+VEL++AL  VFDSP+D   +D GHQ YVHK++T R  +  T+R+  GL GF + NES HD   TGHS   LS   G     + K   + ++P+IGD A++ G+A EALN+I   K  M++I+NDN MSI+ NVGA+H ++ + + + K  ++ +++  + LFK+      K+  +  +    L        FFE +GF Y G +DG++ +     L+  K     GP +LHV T KG GY+ AE D  G +H     K+   +     +   ++  + +  + KL   D  I  I PAM + S     +K+FP    DVGIAE+HA T AAG+A  N K F++IYSTFLQR+YD +LHD+ R  L +   +DR  L  +DG+TH G++DI F++ +PN ++    ++ E + ++  A Q    P  +R+ +     +++ ++      GSW      K++   I+++G  I        +L+KE   KS+ ++NA FI    +  +  ILS    I  +E+       G  ++   ++ K S   ++++ I +  I  G+
  S:     6 IKNPTFLKGMSNAELEELSADIRMFLIESLANSGGHIGPNLGVVELTVALHKVFDSPKDKFLWDVGHQSYVHKLLTGRGSEFDTLRQYKGLCGFPKRNESEHDVWETGHSSTSLSGAMGMAAARDIKGTDEYILPIIGDGALTGGMALEALNHIGDEKKDMIVILNDNEMSIAPNVGAIHTMLGRLRTAGKYQWVKDEL--EYLFKRIPAVGGKLAATAERIKDSLKYLLVSGMFFEEMGFTYLGPVDGHSYEDLFENLEYAKKTK--GPVLLHVITKKGKGYQPAESDKIGTWHGTGPYKIDTGDFVKPAAAAPSWSGLVSETVRKLAREDERIVAITPAMPVGSKLEGFAKEFPERMFDVGIAEQHAATMAAGLATQNMKPFLAIYSTFLQRAYDQVLHDICRQNLNVFIGIDRAGLVGADGETHQGVFDIAFMRHMPNMVLMMPKDENEGQHMVNTAIQYDDGPIAMRFPRGNGLGVKMDEQLKTIPIGSWEVLHPGKDA--VILTFGTTIKMALQAAEELQKE--GKSVRVVNARFIKPLDEAMLNDILSEGIPILTIEEAVLQGGFGSSVLEYIHDKKASHIKVERMGIPDEFIEHGS 600
>gi|134298942|ref|YP_001112438.1| deoxyxylulose-5-phosphate synthase [Desulfotomaculum reducens MI-1] >gi|134051642|gb|ABO49613.1| 1-Deoxy-D-xylulose-5-phosphate synthase [Desulfotomaculum reducens MI-1] (635 aa)
Score = 828, Expect = 2.8e-86, Identities = 202/588 (34%), Positives = 320/588 (54%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKSK--SVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNS-----NNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYALQTKE-SKTCIISYGDIINDLKKEIKTKSID-----LINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLS-CNIKKINIRNNKIGFGNKEDI 595
           +  I + +D K + L +L  LA+ +R+ II        HL+ NLG+VEL++AL  VFD+  D I +D GHQ YVHK++T R  + ST+R+  GLSGF +P ESIHD  +TGHS   +S   G     + K +  SV+ VIGD +++ G+AFEALN   + KT M++++NDN MSI+ NVGAL   +S+ +        +  +  +L K     K+   + +    +         FE LGF Y G +DG++ K  + +L++ K +   GP ++HV T KG GY  AE  +   YH +   D    +        +Y  V    + KL + D+ I  I  AM   +   + +K+FP  Y DVGIAE+HAVT AAGMA    +   +IYSTFLQR+YD +LHDV    LP+TF +DR  L   DG THHG++DI FL++IPN ++    ++ EL+ ++  A    + P  IRY +     I + ++            +E +   +++ G+++ +  K  ++ S       +INA +     +E +L      KNI  +E+   +   G  ++ L   + L+   +K++ + +  I  G +  +
  S:     8 LKNIASPKDLKNLSLKQLQSLALEIRETIIKTVSKTGGHLAPNLGVVELTIALHCVFDTSVDRIIWDVGHQSYVHKLLTGRLAQFSTLRQYGGLSGFPKPEESIHDAFATGHSSTSISAALGMALTRDLKGEKHSVVAVIGDGSLTGGMAFEALNYAGHLKTNMIVVLNDNEMSIAPNVGALSGYLSRLRTDPKYSKGKDEIADLLQKIPHGPKLLKVVDRLKDSVKYLVVPGMLFEELGFTYLGPVDGHDTKAVLTMLQQAKAVS--GPVLVHVITKKGKGYLPAE-QNPDRYHGVGPFDLETGTVVKSQGPPSYTEVFGETIVKLAKEDDRIIGITAAMPSGTGLNSFAKEFPKRYFDVGIAEQHAVTMAAGMAATGYRPIAAIYSTFLQRAYDQVLHDVCMQNLPVTFALDRGGLVGDDGPTHHGVFDISFLRNIPNLVMMSPKDENELQHMLKTAV-TYNGPVAIRYPRGNGIGISMDEKLQCLPIGKGEVIREGNDVLLLAIGNMVQEALKAAESLSAQGIEATVINARYTKPLDEELILNYAGRIKNIVTIEEHVLAGGFGSSILELFESSGLTDVKMKRLGLPDEFIEHGTQNQL 605
>gi|158521673|ref|YP_001529543.1| deoxyxylulose-5-phosphate synthase [Desulfococcus oleovorans Hxd3] >gi|158510499|gb|ABW67466.1| deoxyxylulose-5-phosphate synthase [Desulfococcus oleovorans Hxd3] (626 aa)
Score = 828, Expect = 3.0e-86, Identities = 202/604 (33%), Positives = 333/604 (55%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI---EKNNSKSKSVIPVIGDAAISNGLAFEALNNIA--YNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFK-KEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSD-------PNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEF---SFGSWVYALQTKESKTCIISYGDIIND---LKKEIKTKSID--LINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLS-CNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIK 611
           ++ I +  D KK+ + +L  LA  +R+ I+ +      HL+S+LG VEL++A+ YVFD P D + +D GHQ Y HK++T R ++ ST+R+  GLSGF + +ES  D  STGHSG  +S   GF+    + N  SK V+ VIGD +++ GLA+E LN     +    +++I+N+N MSIS+NVGAL   +S+   +  +    K L ++L         +Y    +S      F      FE+    YFG I+G+ +K+ +N+L+ I+ I    P +LHV T KG GY+ AE  D   +H +   +       P+      TY  V    + +L E D  I  +  AM   +     +++FP+ + DVGIAE+H VT AAGMA    +  V+IYSTFLQRSYD ++HDV    LP+TF +DR  +   DG THHG++D+ +L+S+PN  I   +++ EL R+++ A  + + P  +RY + K     +       S G     + TK     I++ G  + +    +++++T+ I   ++N  F+    +E +  +      I  VE    +      ++   N+++++   +K++ I +  +  G++E +  K  ID  +I    K
  S:     4 LETIDSPADLKKLPVSDLPALAEEIRELIVRVVSETGGHLASSLGAVELAIAIHYVFDVPNDRVIWDVGHQSYAHKILTGRREQFSTLRQHGGLSGFTKRSESPFDSFSTGHSGTSISASLGFLCAKHQRNDPSK-VVAVIGDGSMTAGLAYEGLNQAGDRHKDKNLIVILNENDMSISQNVGALSSFLSRTLSATYLQDWRKELGELLRSLPGIGDDVYQFAKRSEESFKTFVTPGMLFEAFNLEYFGPINGHKIKQLVNILQNIREIRE--PVLLHVTTTKGKGYEPAE-RDPAYFHGVGAFEITTGSKRPDAAPCPSTYTQVFGRTMVELAEKDPAIVAVTAAMPEGTGLAEFAQRFPDRFYDVGIAEQHGVTFAAGMAADGLRPVVAIYSTFLQRSYDQIIHDVCLESLPVTFAIDRAGIVGEDGPTHHGLFDLSYLRSMPNMTIMAPADENELRRMLVTAISH-NGPAAVRYPRGKGTGAALADPLLPVSIGK--AKILTKGGDILILAIGRTVCEAMAARQQLETEGISATVVNCRFVKPLDEELICDLARAIPRILTVEDSMLAGGFSSAVLECLNDHRVTGVTVKRLGIGDTFVEHGSQEILRAKYAIDARAIVVAAK 622
>gi|118050819|ref|ZP_01519368.1| deoxyxylulose-5-phosphate synthase [Comamonas testosteroni KF-1] >gi|118001490|gb|EAV15645.1| deoxyxylulose-5-phosphate synthase [Comamonas testosteroni KF-1] (622 aa)
Score = 828, Expect = 3.0e-86, Identities = 209/596 (35%), Positives = 316/596 (53%)
  Q:    16 DFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQG--FIEKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKG----KNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNL------NSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEK---CEDIEVKKEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIK 611
           D + +   +L  LA  LR  +ID       HLSSNLG VEL++AL  VF++P D I +D GHQ Y HK++T R D ++T+R+  GLSGF +  ES +D   T HS   +S   G     K   + +  I VIGD A++ G+AFEALNN   +   +L+I+NDN MSIS  VGAL++ +++  MS   +   + + K + K+         + +   +L +  KG       FE  GF+Y G IDG++L   I  L+ IK +   GP  LHV T KG GYK AE D    YH     DP +          QT+  V  ++L  +   D  +  I PAM   S  +   K+FP  Y DVGIAE+HAVT A GMA    K  V+IYSTFLQR+YD L+HDVA   LP+ F +DR  L  +DG TH G YDI F++ IPN  + C +++ E  +L+  AY+ + +P  +RY +        +E  +   FG      ++   K  I+++G ++    +  +     + N  +     +  +L+I + ++ I  +E+       G  ++     N LS ++ ++ + +  I  G+   +     +D   I A I+
  S:    17 DMRGLSRAQLKTLAAELRTYVIDSVSRTGGHLSSNLGTVELTVALHSVFNTPYDRIVWDVGHQTYPHKILTGRRDHMATLRQFGGLSGFPQRAESEYDTFGTAHSSTSISAALGMALAAKQKGEDRRAIAVIGDGAMTAGMAFEALNNGGVHDANLLVILNDNDMSISPPVGALNRYLAQL-MSGQFYAKARDVGKSVLKQ------VPPLLELAKRLEQQAKGMVVPATMFEQFGFNYIGPIDGHDLDSLIPTLENIKGLK--GPQFLHVVTKKGQGYKLAEADPVA-YHGPGKFDPAVGLVKSATPAKQTFTQVFGHWLCDMAAKDQRLVGITPAMREGSGMVEFHKRFPGRYYDVGIAEQHAVTFAGGMACEGVKPVVAIYSTFLQRAYDQLIHDVALQNLPVVFALDRAGLVGADGATHAGAYDIAFVRCIPNMSMACPADERETRQLLTTAYE-QDHPVCVRYPRGAGVGMTPLESLEGLPFGKGEMRRESSSRKVAILAFGTLLYPALQAAEALDASVANMRWAKPLDEALLLKIAAEHELIVTLEEGCVMGGAGSAVMECLAANGLSRSVLQLGLPDAFIEHGDPAKLLALQGLDAAGIEASIR 616
>gi|117618937|ref|YP_857810.1| 1-deoxy-D-xylulose-5-phosphate synthase [Aeromonas hydrophila subsp. hydrophila ATCC 7966] >gi|166198594|sp|A0KNF9|DXS_AERHH 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|117560344|gb|ABK37292.1| 1-deoxy-D-xylulose-5-phosphate synthase [Aeromonas hydrophila subsp. hydrophila ATCC 7966] (621 aa)
Score = 827, Expect = 3.2e-86, Identities = 193/547 (35%), Positives = 309/547 (56%)
  Q:     6 VKIDKIPNYE------DFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKS--KSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLT-----EKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSL------KLSDPNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYALQTKESK-TCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVE 552
           V I   PN        + + +    L  L   LR+ ++      S HL+S LG VEL++AL YV+++P D + +D GHQ Y HK++T R D++ +IR+ +GL  F    ES +D +S GHS   +    G      S+   + V+ VIGD AI+ G+AFEALN+       ML+++NDN MSIS+NVGAL+  +++  MS  ++ T     +K+L  +   KE +K+       +   L         FE  GF+Y G IDG+++   +  L+ ++N+   GP +LHVKT KG GY+ AE D  G YH +      + + P  +    ++ ++   +L  +   D  +  I PAM   S  +  S+++P+ Y DV IAE+HAVT AAG+AIA++K  V+IYS+FLQR+YD L+HDVA  ELP+ F +DR  L  +DG TH G +DI FL+++PN +I   S++ E  +++   YQ  + P  +RY +     I+V+ E    +       ++ K T I+++G ++   K   +     L++  F+    +  V  + +T+     +E
  S:     3 VDISNFPNLALADTPVELRSLPFERLPVLCNELREYLLRSVSRSSGHLASGLGTVELTVALHYVYNTPFDRLVWDVGHQAYPHKILTGRRDRMQSIRQKDGLHPFPWRGESEYDVLSVGHSSTSIGAALGMAVAAESEGLGRKVVAVIGDGAITAGMAFEALNHAGDVHKDMLVVLNDNEMSISENVGALNNHLARI-MSGKLYTTIREGGKKVLAGLPPVKELAKR-------AEEHLKGMVVPGTLFEEFGFNYIGPIDGHDINALVETLRNMRNLK--GPQLLHVKTKKGKGYEPAEKDPIG-YHGVPKFNPDECTLPKASGGKPSFSAIFGQWLCDMAAKDERLVGITPAMREGSGLVKFSQQYPDRYFDVAIAEQHAVTFAAGLAIADQKPVVAIYSSFLQRAYDQLIHDVALQELPVLFAIDRAGLVGADGPTHQGAFDISFLRTVPNMVIMTPSDENECRQMLYTGYQC-NGPAAVRYPRGSGTGIQVESEMQALALGKGRIVRQGKGTAILAFGTLLQQAKAAAEALDATLVDMRFVKPMDEALVFSLAATHDQFVTLE 557
>gi|15800150|ref|NP_286162.1| 1-deoxy-D-xylulose-5-phosphate synthase [Escherichia coli O157:H7 EDL933] >gi|15829728|ref|NP_308501.1| 1-deoxy-D-xylulose-5-phosphate synthase [Escherichia coli O157:H7 str. Sakai] >gi|168706111|ref|ZP_02738388.1| 1-deoxy-D-xylulose-5-phosphate synthase [Escherichia coli O157:H7 str. EC4045] >gi|168717561|ref|ZP_02749838.1| 1-deoxy-D-xylulose-5-phosphate synthase [Escherichia coli O157:H7 str. EC4206] >gi|168735415|ref|ZP_02767692.1| 1-deoxy-D-xylulose-5-phosphate synthase [Escherichia coli O157:H7 str. EC4115] >gi|168749881|ref|ZP_02774903.1| 1-deoxy-D-xylulose-5-phosphate synthase [Escherichia coli O157:H7 str. EC4113] >gi|168756961|ref|ZP_02781968.1| 1-deoxy-D-xylulose-5-phosphate synthase [Escherichia coli O157:H7 str. EC4401] >gi|168761625|ref|ZP_02786632.1| 1-deoxy-D-xylulose-5-phosphate synthase [Escherichia coli O157:H7 str. EC4501] >gi|168768370|ref|ZP_02793377.1| 1-deoxy-D-xylulose-5-phosphate synthase [Escherichia coli O157:H7 str. EC4486] >gi|168776275|ref|ZP_02801282.1| 1-deoxy-D-xylulose-5-phosphate synthase [Escherichia coli O157:H7 str. EC4196] >gi|168783285|ref|ZP_02808292.1| 1-deoxy-D-xylulose-5-phosphate synthase [Escherichia coli O157:H7 str. EC4076] >gi|168786266|ref|ZP_02811273.1| 1-deoxy-D-xylulose-5-phosphate synthase [Escherichia coli O157:H7 str. EC869] >gi|168794203|ref|ZP_02819210.1| 1-deoxy-D-xylulose-5-phosphate synthase [Escherichia coli O157:H7 str. EC4042] >gi|168800302|ref|ZP_02825309.1| 1-deoxy-D-xylulose-5-phosphate synthase [Escherichia coli O157:H7 str. EC508] >gi|195938513|ref|ZP_03083895.1| 1-deoxy-D-xylulose-5-phosphate synthase [Escherichia coli O157:H7 str. EC4024] >gi|21263508|sp|Q8XE76|DXS_ECO57 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|12513276|gb|AAG54770.1|AE005221_7 1-deoxyxylulose-5-phosphate synthase; flavoprotein [Escherichia coli O157:H7 EDL933] >gi|13359931|dbj|BAB33897.1| 1-deoxy-D-xylulose 5-phosphate synthase [Escherichia coli O157:H7 str. Sakai] >gi|187768297|gb|EDU32141.1| 1-deoxy-D-xylulose-5-phosphate synthase [Escherichia coli O157:H7 str. EC4196] >gi|188015927|gb|EDU54049.1| 1-deoxy-D-xylulose-5-phosphate synthase [Escherichia coli O157:H7 str. EC4113] >gi|188999404|gb|EDU68390.1| 1-deoxy-D-xylulose-5-phosphate synthase [Escherichia coli O157:H7 str. EC4076] >gi|189356019|gb|EDU74438.1| 1-deoxy-D-xylulose-5-phosphate synthase [Escherichia coli O157:H7 str. EC4401] >gi|189362524|gb|EDU80943.1| 1-deoxy-D-xylulose-5-phosphate synthase [Escherichia coli O157:H7 str. EC4486] >gi|189367974|gb|EDU86390.1| 1-deoxy-D-xylulose-5-phosphate synthase [Escherichia coli O157:H7 str. EC4501] >gi|189373486|gb|EDU91902.1| 1-deoxy-D-xylulose-5-phosphate synthase [Escherichia coli O157:H7 str. EC869] >gi|189377438|gb|EDU95854.1| 1-deoxy-D-xylulose-5-phosphate synthase [Escherichia coli O157:H7 str. EC508] (620 aa)
Score = 827, Expect = 3.4e-86, Identities = 194/581 (33%), Positives = 331/581 (56%)
  Q:    32 LRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWS---IYKSFSKLSKFFKGK----NFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNL------NSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVK--KEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEK--VFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           LR+ ++D     S H +S LG VEL++AL YV+++P D + +D GHQ Y HK++T R DKI TIR+  GL  F    ES +D +S GHS   +S   G     +   K++  + VIGD AI+ G+AFEA+N+    +  ML+++NDN MSIS+NVGAL+  +++        L+ K+   +   +E  KK++     I +   +  +  KG       FE LGF+Y G +DG+++   I  LK ++++   GP  LH+ T KG GY+ AE  D   +H++   DP+       +    +Y  +  ++L +    DN +  I PAM   S  +  S+KFP+ Y DV IAE+HAVT AAG+AI   K  V+IYSTFLQR+YD +LHDVA  +LP+ F +DR  +  +DG TH G +D+ +L+ IP  +I   S++ E  +++   Y     P  +RY +     +E+   ++   G  +  ++ +  K  I+++G ++ +  K  ++ +  L++  F+    +  +L + ++++ +  VE+  +      G + +++A+   +   +  I + +  I  G +E++  +L +D   + A+IK+
  S:    35 LRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQLIWDVGHQAYPHKILTGRRDKIGTIRQKGGLHPFPWRGESEYDVLSVGHSSTSISAGIGIAVAAEKEGKNRRTVCVIGDGAITAGMAFEAMNHAGDIRPDMLVVLNDNEMSISENVGALNNHLAQL-------LSGKLYSSL---REGGKKVFSGVPPIKELLKRTEEHIKGMVVPGTLFEELGFNYIGPVDGHDVLGLITTLKNMRDLK--GPQFLHIMTKKGRGYEPAE-KDPITFHAVPKFDPSSGCLPKSSGGLPSYSKIFGDWLCETAAKDNKLMAITPAMREGSGMVEFSRKFPDRYFDVAIAEQHAVTFAAGLAIGGYKPIVAIYSTFLQRAYDQVLHDVAIQKLPVLFAIDRAGIVGADGQTHQGAFDLSYLRCIPEMVIMTPSDENECRQMLYTGYHYNDGPSAVRYPRGNAVGVELTPLEKLPIGKGI--VKRRGEKLAILNFGTLMPEAAKVAESLNATLVDMRFVKPLDETLILEMAASHEALVTVEENAIMGGAGSGVNEVLMAHRKPVP--VLNIGLPDFFIPQGTQEEMRAELGLDAAGMEAKIKA 617
>gi|82542908|ref|YP_406855.1| 1-deoxy-D-xylulose-5-phosphate synthase [Shigella boydii Sb227] >gi|91209489|ref|YP_539475.1| 1-deoxy-D-xylulose-5-phosphate synthase [Escherichia coli UTI89] >gi|117622681|ref|YP_851594.1| 1-deoxy-D-xylulose-5-phosphate synthase [Escherichia coli APEC O1] >gi|187732272|ref|YP_001879129.1| 1-deoxy-D-xylulose-5-phosphate synthase [Shigella boydii CDC 3083-94] >gi|193065234|ref|ZP_03046307.1| 1-deoxy-D-xylulose-5-phosphate synthase [Escherichia coli E22] >gi|193068686|ref|ZP_03049647.1| 1-deoxy-D-xylulose-5-phosphate synthase [Escherichia coli E110019] >gi|194428815|ref|ZP_03061350.1| 1-deoxy-D-xylulose-5-phosphate synthase [Escherichia coli B171] >gi|194438914|ref|ZP_03070999.1| 1-deoxy-D-xylulose-5-phosphate synthase [Escherichia coli 101-1] >gi|166198614|sp|A1A890|DXS_ECOK1 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|118595580|sp|Q1RFC0|DXS_ECOUT 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|118595616|sp|Q325I1|DXS_SHIBS 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|81244319|gb|ABB65027.1| 1-deoxyxylulose-5-phosphate synthase [Shigella boydii Sb227] >gi|91071063|gb|ABE05944.1| 1-deoxyxylulose-5-phosphate synthase [Escherichia coli UTI89] >gi|115511805|gb|ABI99879.1| 1-deoxy-D-xylulose-5-phosphate synthase [Escherichia coli APEC O1] >gi|187429264|gb|ACD08538.1| 1-deoxy-D-xylulose-5-phosphate synthase [Shigella boydii CDC 3083-94] >gi|192927208|gb|EDV81829.1| 1-deoxy-D-xylulose-5-phosphate synthase [Escherichia coli E22] >gi|192958049|gb|EDV88491.1| 1-deoxy-D-xylulose-5-phosphate synthase [Escherichia coli E110019] >gi|194413118|gb|EDX29405.1| 1-deoxy-D-xylulose-5-phosphate synthase [Escherichia coli B171] >gi|194422208|gb|EDX38210.1| 1-deoxy-D-xylulose-5-phosphate synthase [Escherichia coli 101-1] (620 aa)
Score = 827, Expect = 3.4e-86, Identities = 194/581 (33%), Positives = 331/581 (56%)
  Q:    32 LRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWS---IYKSFSKLSKFFKGK----NFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNL------NSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVK--KEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEK--VFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           LR+ ++D     S H +S LG VEL++AL YV+++P D + +D GHQ Y HK++T R DKI TIR+  GL  F    ES +D +S GHS   +S   G     +   K++  + VIGD AI+ G+AFEA+N+    +  ML+++NDN MSIS+NVGAL+  +++        L+ K+   +   +E  KK++     I +   +  +  KG       FE LGF+Y G +DG+++   I  LK ++++   GP  LH+ T KG GY+ AE  D   +H++   DP+       +    +Y  +  ++L +    DN +  I PAM   S  +  S+KFP+ Y DV IAE+HAVT AAG+AI   K  V+IYSTFLQR+YD +LHDVA  +LP+ F +DR  +  +DG TH G +D+ +L+ IP  +I   S++ E  +++   Y     P  +RY +     +E+   ++   G  +  ++ +  K  I+++G ++ +  K  ++ +  L++  F+    +  +L + ++++ +  VE+  +      G + +++A+   +   +  I + +  I  G +E++  +L +D   + A+IK+
  S:    35 LRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQLIWDVGHQAYPHKILTGRRDKIGTIRQKGGLHPFPWRGESEYDVLSVGHSSTSISAGIGIAVAAEKEGKNRRTVCVIGDGAITAGMAFEAMNHAGDIRPDMLVVLNDNEMSISENVGALNNHLAQL-------LSGKLYSSL---REGGKKVFSGVPPIKELLKRTEEHIKGMVVPGTLFEELGFNYIGPVDGHDVLGLITTLKNMRDLK--GPQFLHIMTKKGRGYEPAE-KDPITFHAVPKFDPSSGCLPKSSGGLPSYSKIFGDWLCETAAKDNKLMAITPAMREGSGMVEFSRKFPDRYFDVAIAEQHAVTFAAGLAIGGYKPIVAIYSTFLQRAYDQVLHDVAIQKLPVLFAIDRAGIVGADGQTHQGAFDLSYLRCIPEMVIMTPSDENECRQMLYTGYHYNDGPSAVRYPRGNAVGVELTPLEKLPIGKGI--VKRRGEKLAILNFGTLMPEAAKVAESLNATLVDMRFVKPLDEALILEMAASHEALVTVEENAIMGGAGSGVNEVLMAHRKPVP--VLNIGLPDFFIPQGTQEEMRAELGLDAAGMEAKIKA 617
>gi|24111798|ref|NP_706308.1| 1-deoxy-D-xylulose-5-phosphate synthase [Shigella flexneri 2a str. 301] >gi|41016962|sp|Q83SG2|DXS_SHIFL 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|24050586|gb|AAN42015.1| 1-deoxyxylulose-5-phosphate synthase; flavoprotein [Shigella flexneri 2a str. 301] (620 aa)
Score = 827, Expect = 3.5e-86, Identities = 194/581 (33%), Positives = 331/581 (56%)
  Q:    32 LRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWS---IYKSFSKLSKFFKGK----NFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNL------NSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVK--KEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEK--VFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           LR+ ++D     S H +S LG VEL++AL YV+++P D + +D GHQ Y HK++T R DKI TIR+  GL  F    ES +D +S GHS   +S   G     +   K++  + VIGD AI+ G+AFEA+N+    +  ML+++NDN MSIS+NVGAL+  +++        L+ K+   +   +E  KK++     I +   +  +  KG       FE LGF+Y G +DG+++   I  LK ++++   GP  LH+ T KG GY+ AE  D   +H++   DP+       +    +Y  +  ++L +    DN +  I PAM   S  +  S+KFP+ Y DV IAE+HAVT AAG+AI   K  V+IYSTFLQR+YD +LHDVA  +LP+ F +DR  +  +DG TH G +D+ +L+ IP  +I   S++ E  +++   Y     P  +RY +     +E+   ++   G  +  ++ +  K  I+++G ++ +  K  ++ +  L++  F+    +  +L + ++++ +  VE+  +      G + +++A+   +   +  I + +  I  G +E++  +L +D   + A+IK+
  S:    35 LRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQLIWDVGHQAYPHKILTGRRDKIGTIRQKGGLHPFPWRGESEYDVLSVGHSSTSISAGIGIAVAAEKEGKNRRTVCVIGDGAITAGMAFEAMNHAGDIRPDMLVVLNDNEMSISENVGALNNHLAQL-------LSGKLYSSL---REGGKKVFSGVPPIKELLKRTEEHIKGMVVPGTLFEELGFNYIGPVDGHDVLGLITTLKNMRDLK--GPQFLHIMTKKGRGYEPAE-KDPITFHAVPKFDPSSGCLPKSSGGLPSYSKIFGDWLCETAAKDNKLMAITPAMREGSGMVEFSRKFPDRYFDVAIAEQHAVTFAAGLAIGGYKPIVAIYSTFLQRAYDQVLHDVAIQKLPVLFAIDRAGIVGADGQTHQGAFDLSYLRCIPEMVIMTPSDENECRQMLYTGYHYNDGPSAVRYPRGNAVGVELTPLEKLPIGKGI--VKRRGEKLVILNFGTLMPETAKVAESLNATLVDMRFVKPLDEALILEMAASHEALVTVEENAIMGGAGSGVNEVLMAHRKPVP--VLNIGLPDFFIPQGTQEEMRAELGLDAAGMEAKIKA 617
>gi|30061914|ref|NP_836085.1| 1-deoxy-D-xylulose-5-phosphate synthase [Shigella flexneri 2a str. 2457T] >gi|30040158|gb|AAP15891.1| 1-deoxyxylulose-5-phosphate synthase; flavoprotein [Shigella flexneri 2a str. 2457T] (620 aa)
Score = 827, Expect = 3.5e-86, Identities = 194/581 (33%), Positives = 331/581 (56%)
  Q:    32 LRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWS---IYKSFSKLSKFFKGK----NFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNL------NSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVK--KEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEK--VFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           LR+ ++D     S H +S LG VEL++AL YV+++P D + +D GHQ Y HK++T R DKI TIR+  GL  F    ES +D +S GHS   +S   G     +   K++  + VIGD AI+ G+AFEA+N+    +  ML+++NDN MSIS+NVGAL+  +++        L+ K+   +   +E  KK++     I +   +  +  KG       FE LGF+Y G +DG+++   I  LK ++++   GP  LH+ T KG GY+ AE  D   +H++   DP+       +    +Y  +  ++L +    DN +  I PAM   S  +  S+KFP+ Y DV IAE+HAVT AAG+AI   K  V+IYSTFLQR+YD +LHDVA  +LP+ F +DR  +  +DG TH G +D+ +L+ IP  +I   S++ E  +++   Y     P  +RY +     +E+   ++   G  +  ++ +  K  I+++G ++ +  K  ++ +  L++  F+    +  +L + ++++ +  VE+  +      G + +++A+   +   +  I + +  I  G +E++  +L +D   + A+IK+
  S:    35 LRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQLIWDVGHQAYPHKILTGRRDKIGTIRQKGGLHPFPWRGESEYDVLSVGHSSTSISAGIGIAVAAEKEGKNRRTVCVIGDGAITAGMAFEAMNHAGDIRPDMLVVLNDNEMSISENVGALNNHLAQL-------LSGKLYSSL---REGGKKVFSGVPPIKELLKRTEEHIKGMVVPGTLFEELGFNYIGPVDGHDVLGLITTLKNMRDLK--GPQFLHIMTKKGRGYEPAE-KDPITFHAVPKFDPSSGCLPKSSGGLPSYSKIFGDWLCETAAKDNKLMAITPAMREGSGMVEFSRKFPDRYFDVAIAEQHAVTFAAGLAIGGYKPIVAIYSTFLQRAYDQVLHDVAIQKLPVLFAIDRAGIVGADGQTHQGAFDLSYLRCIPEMVIMTPSDENECRQMLYTGYHYNDGPSAVRYPRGNAVGVELTPLEKLPIGKGI--VKRRGEKLVILNFGTLMPETAKVAESLNATLVDMRFVKPLDEALILEMAASHEALVTVEENAIMGGAGSGVNEVLMAHRKPVP--VLNIGLPDFFIPQGTQEEMRAELGLDAAGMEAKIKA 617
>gi|62184933|ref|YP_219718.1| 1-deoxy-D-xylulose-5-phosphate synthase [Chlamydophila abortus S26/3] >gi|81312895|sp|Q5L6H4|DXS_CHLAB 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|62148000|emb|CAH63751.1| 1-deoxy-D-xylulose 5-phosphate synthase [Chlamydophila abortus S26/3] (644 aa)
Score = 827, Expect = 3.7e-86, Identities = 206/603 (34%), Positives = 332/603 (55%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDR-ADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKF-QMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNSNNQ---------TYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLI--ILAYQNKSNPFFIRYTK-------EKCEDIEVKKEFSFGSWVYALQTKESKTCIISYGDIIN---DLKKEIKTKSID--LINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEI 610
           + +I + ED KK+   EL  LA  +R KII +      HL+SNLGI+EL++AL YVF SP+D   +D GHQ Y HK++T R  ++   IR   GLSGF  P ES HD   +GH+GN LS+  G  +        V+P++GDAA S GL FEALNNI  + +  ++I+NDN MSISKNVG + K +S++    K   L+ K+ R +     + K I    +K  + L         FE     Y G +DG+++K  +++ ++++++ PF P ++HV T KG G + A+ ++   YH +K ++  L + ++         TY  +    + KL E   N+ ++ PAM+L S        FP  + DVGIAE HAVT +AG+A AN  V  SIYSTFL R+ DN+ HDV    LP+ F +DR  L+Y DG +HHGIYD+ FL+++PN II    +    ++L+   L +Q    P  IRY             DI + ++   G     + ++     I+  G + +    +K ++ +  I   +++ +FI  +       +L  +  + ++E+      L  +            ++    I ++    G+KE++ +++ +D++S+   I
  S:     9 LSQISSPEDLKKLSCSELSLLAEQIRHKIISVLIKTGGHLASNLGIIELTIALHYVFSSPEDKFIFDVGHQTYTHKLLTGRNIEEFERIRHDGGLSGFTSPLESAHDLFFSGHAGNALSLALGMAKATEKSRTHVLPILGDAAFSCGLTFEALNNIHTDLSKFIVILNDNNMSISKNVGVMSKSLSQWIHHPKFSLLSRKLERSLSKIPRYGKSIAKCSHKISTCLRSLVCPIPIFEQFNLAYMGPVDGHDIKALVSLFQKVRDL-PF-PILIHVCTKKGKGLEIAQ-ENPTKYHGVK-ANFKLTAEDKLLPTIQPQLTYPDIFGKTVCKLGEISPNLHVVTPAMSLGSRLETFKGTFPERFIDVGIAEGHAVTFSAGIAKANTPVICSIYSTFLHRAMDNVFHDVCLQNLPVIFGIDRAGLAYGDGCSHHGIYDLSFLRAMPNMIICQPRSSIVFQQLLQSSLHWQ---RPSAIRYPNIPALQGDPIATDINLYRDPGLGE----ILSQGEDVLIVGLGHMCSAALSIKLQLLSHGISATVVDPIFIKPFDNNLFSILLMHHSKVIIIEEHSIRGGLASEFNDFLATYNFKVDVLHFGIPDSIFSHGDKENLLQRVGLDVDSMVKRI 625
>gi|162139358|ref|YP_687962.2| 1-deoxy-D-xylulose-5-phosphate synthase [Shigella flexneri 5 str. 8401] (620 aa)
Score = 827, Expect = 3.8e-86, Identities = 194/581 (33%), Positives = 331/581 (56%)
  Q:    32 LRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWS---IYKSFSKLSKFFKGK----NFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNL------NSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVK--KEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEK--VFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           LR+ ++D     S H +S LG VEL++AL YV+++P D + +D GHQ Y HK++T R DKI TIR+  GL  F    ES +D +S GHS   +S   G     +   K++  + VIGD AI+ G+AFEA+N+    +  ML+++NDN MSIS+NVGAL+  +++        L+ K+   +   +E  KK++     I +   +  +  KG       FE LGF+Y G +DG+++   I  LK ++++   GP  LH+ T KG GY+ AE  D   +H++   DP+       +    +Y  +  ++L +    DN +  I PAM   S  +  S+KFP+ Y DV IAE+HAVT AAG+AI   K  V+IYSTFLQR+YD +LHDVA  +LP+ F +DR  +  +DG TH G +D+ +L+ IP  +I   S++ E  +++   Y     P  +RY +     +E+   ++   G  +  ++ +  K  I+++G ++ +  K  ++ +  L++  F+    +  +L + ++++ +  VE+  +      G + +++A+   +   +  I + +  I  G +E++  +L +D   + A+IK+
  S:    35 LRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQLIWDVGHQAYPHKILTGRRDKIGTIRQKGGLHPFPWRGESEYDVLSVGHSSTSISAGIGIAVAAEKEGKNRRTVCVIGDGAITAGMAFEAMNHAGDIRPDMLVVLNDNEMSISENVGALNNHLAQL-------LSGKLYSSL---REGGKKVFSGVPPIKELLKRTEEHIKGMVVPGTLFEELGFNYIGPVDGHDVLGLITTLKNMRDLK--GPQFLHIMTKKGRGYEPAE-KDPITFHAVPKFDPSSGCLPKSSGGLPSYSKIFGDWLCETAAKDNKLMAITPAMREGSGMVEFSRKFPDRYFDVAIAEQHAVTFAAGLAIGGYKPIVAIYSTFLQRAYDQVLHDVAIQKLPVLFAIDRAGIVGADGQTHQGAFDLSYLRCIPEMVIMTPSDENECRQMLYTGYHYNDGPSAVRYPRGNAVGVELTPLEKLPIGKGI--VKRRGEKLVILNFGTLMPEAAKVAESLNATLVDMRFVKPLDEALILEMAASHEALVTVEENAIMGGAGSGVNEVLMAHRKPVP--VLNIGLPDFFIPQGTQEEMRAELGLDAAGMEAKIKA 617
>gi|110613990|gb|ABF02657.1| 1-deoxyxylulose-5-phosphate synthase [Shigella flexneri 5 str. 8401] (598 aa)
Score = 827, Expect = 3.8e-86, Identities = 194/581 (33%), Positives = 331/581 (56%)
  Q:    32 LRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWS---IYKSFSKLSKFFKGK----NFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNL------NSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVK--KEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEK--VFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           LR+ ++D     S H +S LG VEL++AL YV+++P D + +D GHQ Y HK++T R DKI TIR+  GL  F    ES +D +S GHS   +S   G     +   K++  + VIGD AI+ G+AFEA+N+    +  ML+++NDN MSIS+NVGAL+  +++        L+ K+   +   +E  KK++     I +   +  +  KG       FE LGF+Y G +DG+++   I  LK ++++   GP  LH+ T KG GY+ AE  D   +H++   DP+       +    +Y  +  ++L +    DN +  I PAM   S  +  S+KFP+ Y DV IAE+HAVT AAG+AI   K  V+IYSTFLQR+YD +LHDVA  +LP+ F +DR  +  +DG TH G +D+ +L+ IP  +I   S++ E  +++   Y     P  +RY +     +E+   ++   G  +  ++ +  K  I+++G ++ +  K  ++ +  L++  F+    +  +L + ++++ +  VE+  +      G + +++A+   +   +  I + +  I  G +E++  +L +D   + A+IK+
  S:    13 LRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQLIWDVGHQAYPHKILTGRRDKIGTIRQKGGLHPFPWRGESEYDVLSVGHSSTSISAGIGIAVAAEKEGKNRRTVCVIGDGAITAGMAFEAMNHAGDIRPDMLVVLNDNEMSISENVGALNNHLAQL-------LSGKLYSSL---REGGKKVFSGVPPIKELLKRTEEHIKGMVVPGTLFEELGFNYIGPVDGHDVLGLITTLKNMRDLK--GPQFLHIMTKKGRGYEPAE-KDPITFHAVPKFDPSSGCLPKSSGGLPSYSKIFGDWLCETAAKDNKLMAITPAMREGSGMVEFSRKFPDRYFDVAIAEQHAVTFAAGLAIGGYKPIVAIYSTFLQRAYDQVLHDVAIQKLPVLFAIDRAGIVGADGQTHQGAFDLSYLRCIPEMVIMTPSDENECRQMLYTGYHYNDGPSAVRYPRGNAVGVELTPLEKLPIGKGI--VKRRGEKLVILNFGTLMPEAAKVAESLNATLVDMRFVKPLDEALILEMAASHEALVTVEENAIMGGAGSGVNEVLMAHRKPVP--VLNIGLPDFFIPQGTQEEMRAELGLDAAGMEAKIKA 595
>gi|52425114|ref|YP_088251.1| 1-deoxy-D-xylulose-5-phosphate synthase [Mannheimia succiniciproducens MBEL55E] >gi|81609544|sp|Q65TP4|DXS_MANSM 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|52307166|gb|AAU37666.1| Dxs protein [Mannheimia succiniciproducens MBEL55E] (617 aa)
Score = 826, Expect = 4.1e-86, Identities = 205/598 (34%), Positives = 331/598 (55%)
  Q:    15 EDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI---EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLT-----EKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGL-------YHSLKLSDPNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVK--KEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           ED + +   +L  +   LR+ +++     S HL+S LG VEL++AL Y+F +P D + +D GHQ Y HK++T R ++++TIR+ +G+  F    ES  D +S GHS   +S   G     EK N+  K +I VIGD AI+ G+AFEA+N+     T ML+I+NDN MSIS+NVG L+  +++   S S++ +     +KIL  +   K + KK    +    S +S        FE LGF+Y G IDG+N+++ I  L  +K +   GP  LH++T KG GY  AE D  G        YH+ +L     ++   TY  +   +L +  E D  +  I PAM   S  +  S +FP+ Y DV IAE+HAVT AAG+AI   K  V+IYSTFLQR+YD ++HDVA   LP+ F +DR  +  +DG TH G +D+ FL+ IPN II   SN+ E  RL++        P  +RY +     +E++  ++   G      Q ++    I+++G ++ +     +  +  +++  F+     E +  +  T++ +  +E+       G  +  + N  +   NI  + + +  +  G ++++ K+L +D   I  +IK+
  S:    14 EDLRLLNKDQLPQVCNELREYLLESVSRTSGHLASGLGTVELTVALHYIFKTPFDQLIWDVGHQAYPHKILTGRRERMTTIRQKDGIHPFPWREESEFDVLSVGHSSTSISAGLGIAIAAEKENAGRK-IICVIGDGAITAGMAFEAMNHAGALHTDMLVILNDNEMSISENVGGLNNHLARI-FSGSIYSSLRDSSKKILDTMPPIKNFMKKTEEHMKGVISPIS------TLFEELGFNYIGPIDGHNIEELIATLSNMKTLK--GPQFLHIRTKKGKGYTPAEQDPIGFHGVPKFDYHTGQLPK---STATPTYSQIFGEWLCETAEQDEKLIGITPAMREGSGMVEFSNRFPDQYFDVAIAEQHAVTLAAGLAIGGYKPVVAIYSTFLQRAYDQVIHDVAIQNLPVLFAIDRAGIVGADGPTHQGAFDLSFLRCIPNLIIMAPSNENEC-RLMLHTGYCCGKPAAVRYPRGNAIGVELEPLRKLEIGKSNLVRQGQD--IAILNFGTLLPNALDVAEKLNATVVDMRFVKPLDHERINELAKTHRTLVTLEENTIQGGAGSAVSEVVNIQQHHVNILHLGLPDEFVAQGTQQEVLKELKLDATGIEEQIKN 612
>gi|91776485|ref|YP_546241.1| 1-deoxy-D-xylulose-5-phosphate synthase [Methylobacillus flagellatus KT] >gi|118595589|sp|Q1GZD7|DXS_METFK 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|91710472|gb|ABE50400.1| 1-Deoxy-D-xylulose-5-phosphate synthase [Methylobacillus flagellatus KT] (614 aa)
Score = 826, Expect = 4.4e-86, Identities = 196/546 (35%), Positives = 306/546 (56%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI---EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLT-----EKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPN-----LNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSF-----------GSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEK 553
           ++ I + ED +++   EL +LA  LR  +I+       HLSSNLG+VEL++AL YVF++P+D + +D GHQ Y HK++T R   +  +R   G++GF   +ESI+D   TGHS   +S   G     +K  S   S I VIGD A++ G+AFEALNN       +L+I+NDN MSIS NVGAL   ++K  +S  ++ T     EK+L  +   +E++K+       +   +         FE  GF+Y G IDG+++   I  L+ I+ +   GP  LH+ T KG GY+ AE D+ G +H +   DP+       +  +TY  V +++L  +   D  +  I PAM   S     +++FP+ + DVGIAE+HA+T AAGMA    K  V+IYSTFLQR+YD  +HD+A   LP+ F +DR  L  +DG TH G +D+ +L+ IPN II   S++ E  +++  AY +   P  +RY +       + ++              GSWV           I+++G ++    +  +T    + N  F+       + ++ S++  I  VE+
  S:     5 LESINSPEDLRRLDRKELHELARQLRAFLINSVAQTGGHLSSNLGVVELTIALHYVFNTPEDRVVWDVGHQTYPHKILTGRRKDMGNLRRPGGIAGFPRRDESIYDTFGTGHSSTSISAALGMAVAAQKTGSDRHS-IAVIGDGAMTAGMAFEALNNAGAMDANILVILNDNDMSISPNVGALTNYLAKL-LSGPLYTTVRRSGEKVLGVVPPVREFAKR-------AEEHVKGMVTPGTLFEEFGFNYIGPIDGHDIDVLITTLRNIRELK--GPQFLHIATQKGHGYQPAE-DNPGKFHGVGKFDPSNGCSIAQAGKKTYTQVFSDWLVDMAARDERLVGITPAMCDGSGLNAFAEQFPDRFFDVGIAEQHALTFAAGMACDGLKPVVAIYSTFLQRAYDQFIHDIALQNLPVMFAIDRAGLVGADGPTHAGSFDLSYLRCIPNIIIMAPSDENECRQMLYTAYLH-DGPSAVRYPRGGGPGATITRDMQLLPIGKGELRRQGSWV----------AILAFGSMLAPALEAAETLDATVANMRFVKPLDANLINQLASSHTLIVTVEE 551
>gi|88801643|ref|ZP_01117171.1| 1-deoxy-D-xylulose-5-phosphate synthase [Polaribacter irgensii 23-P] >gi|88782301|gb|EAR13478.1| 1-deoxy-D-xylulose-5-phosphate synthase [Polaribacter irgensii 23-P] (588 aa)
Score = 826, Expect = 4.4e-86, Identities = 214/599 (35%), Positives = 320/599 (53%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSK---SKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSL----KLSDPNLNSNNQTYGSVAANFLEKLIEY---DNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEF---SFGSWVYALQTKESKTCIISYGDIINDLKKEIK----TKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSI 606
           +D I N +D +K+   +L +LA  LR+ IIDI   K  HL ++LG+VEL++AL Y+FD+P DL+ +D GHQ Y HK++T R     T R  NG+SGF    ES +D    GHS   +S   G    +N K    K  I VIGDA++++G+AFEALN+   +   +LII+NDN + I  +VGAL + +++ +  +                                  K     N  ++L F Y G IDG+NL K +  L R+K +   GP  LHV T KG G ++AE DD+  YH+     K+S   +      Y      F + ++E    + NI  I PAM   S+   + ++FP    DVGIAE+HAVT AAGMA      + +IYSTFLQR+YD ++HDVA   LP+ F +DR  L   DG THHG++D+ +L+SIPN I+   S + EL  ++  A     +P  IRY +   E I+ +K F     G  V AL+ K +K  I+S G I  ++   I        I   +  F+       + +I  ++  I+ VE        G  ++  A+EN+    ++ + I +N I  G+  ++  K+ +D NS+
  S:     5 LDHISNPKDLRKLNPIQLPELAKELREFIIDIVATKEGHLGASLGVVELTIALHYLFDTPNDLLVWDVGHQAYGHKILTGRKTVFHTNRRLNGISGFPSRKESPYDTFGVGHSSTSISAALGMAIASNLKGNTEKQHIAVIGDASLASGMAFEALNHAGVSNANLLIILNDNAIGIDPSVGALKEYLTRVKTDR----------------------------------KLAAQNNIIKALNFDYSGPIDGHNLPKLLAELARLKGVK--GPKFLHVITTKGKGLQQAE-DDQVTYHAPGKFDKISGERIQKVASLYTKYQDVFGKTIVELAANNENIVGITPAMLTGSSLKLMLEEFPKRTFDVGIAEQHAVTLAAGMATQGLIPYCNIYSTFLQRAYDQVIHDVALQNLPVIFCLDRAGLVGEDGATHHGVFDLAYLRSIPNLIVFAPSTEIELRNILYTAQLGLKSPIAIRYPRGTGEIIDWQKPFKEIEIGKGV-ALK-KGNKIAILSIGTIARNVSTAINLMKDPSEIAHFDMRFVKPLDTALLHQIFKSHTTIFTVEDGIIKGGFGTAVLEFASENEYYNKVRVLGIPDNFITHGSISELQNKIGLDPNSL 581
>gi|160871993|ref|ZP_02062125.1| 1-deoxy-D-xylulose-5-phosphate synthase [Rickettsiella grylli] >gi|159120792|gb|EDP46130.1| 1-deoxy-D-xylulose-5-phosphate synthase [Rickettsiella grylli] (625 aa)
Score = 826, Expect = 4.7e-86, Identities = 200/602 (33%), Positives = 334/602 (55%)
  Q:    10 KIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGF---IEKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSK--------FFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNSNN------QTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYALQTKESKT-CIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIK 611
           +I + +  +++   +L  LA  LR  +I        H ++NLG VEL++AL YVF++P D I +D GHQ Y HK++T R D++ +IR+++GL+ F   NES+ D    GHS   +S   GF    +KNN+K K+ I VIGD A++ G+AFEALN+       +L+++NDN MSIS NVGAL    ++        L+ K+   +   +  SKKI  SI +   KL+K         F     FE LGF+Y G +DG++L   +N  K ++ +   GP  +HV T KG GYK AE ++   YH++       NS        +TY ++   ++  +   D  +  I PAM   S+ +  S+++P+ Y DVGIAE+HAVT AAG+A A  K  V+IYSTFLQR+YD L+HDVA   LP+ F +DR  +   DG TH G +D+ +L+ IP+  +   SN+ EL +++   + + S P  +RY +       +++E S      A   ++ +T  ++++G +++            +IN  F+    ++ + R+  T++ +  +E+       G  +    ++  + C++  + + +  I  G+   +  +  ++  ++ + IK
  S:    13 RINSPQQLRELAPAQLPQLAAELRTFLIQTLNQCGGHFAANLGTVELTLALHYVFNTPHDAIIWDVGHQAYAHKILTGRRDQLDSIRKTHGLAPFPSRNESLFDSFGVGHSSTSISAALGFSIAAKKNNTKQKA-IAVIGDGALTAGMAFEALNHAGDIHADLLVVLNDNDMSISNNVGALSNYFARI-------LSSKLYSSV---RAGSKKILESIPR-IRKLAKRTEEHVKGMFVPGTLFEELGFNYIGPLDGHDLPLLLNTFKNLRQLQ--GPQFVHVITTKGRGYKPAE-ENPIAYHAVNPHFLTCNSTKTNPIKPKTYANIFGRWICDMAAIDERLIAITPAMREGSDLVEFSERYPDRYFDVGIAEQHAVTLAAGLACAGLKPVVAIYSTFLQRAYDQLIHDVALQNLPVLFALDRAGIVGGDGATHQGCFDLSYLRCIPHMTLMTPSNENELRQMLYTGF-HLSTPCAVRYPRGVGVGATIQQEMSLLPLGQAEICRKGQTIALLAFGSLLHPALHIGDQLDATVINMRFVKPLDEKMLSRLAKTHRLLVTLEENVKVGGAGSAVSEFLHQQGIFCDLLILGLPDEFIEHGDPSVLLAQAELETTALMSLIK 616
>gi|153872363|ref|ZP_02001280.1| Deoxyxylulose-5-phosphate synthase [Beggiatoa sp. PS] >gi|152071171|gb|EDN68720.1| Deoxyxylulose-5-phosphate synthase [Beggiatoa sp. PS] (619 aa)
Score = 826, Expect = 5.2e-86, Identities = 184/546 (33%), Positives = 314/546 (57%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNS--KSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEK-----ILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNL------NSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYA-LQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEK 553
           +++I   ++ + +  H+L  LA+ LR  +++       H +SNLG+VEL++AL Y+F++P+D + +D GHQ Y HK++T R + +ST+R++NG++GF +  ESI+D    GHS   +S   G    N+    ++ V+ +IGD A++ G+AFEALN+     T +L+I+NDN MSIS NVG L    +K  +S  ++ + +     +L ++   +E +K+       +   +         FE LGF+Y G IDG++L   ++ LK ++  V  GP  LH+ T KG G+  AE DD  +YH +   DP        +++  TY  + +++L  +  +D  +  I PAM   S  ++ S  FP+ Y DVGIAE+H+VT AAG+A    K  V+IYSTFLQR+YD L+HDVA   LP+ F +DR  L  +DG TH G +D+ +L+SIPN +I   +++ E  ++    +Q +  P  +RY +     + V  + +      A L+ +  +  ++ +G ++    +  +  +  ++N  F+     E + ++   +K +  VE+
  S:     6 LEQIETPQELRALPEHDLPQLAIELRHFLVETLSRTGGHFASNLGVVELTIALHYIFNTPEDRLVWDVGHQSYPHKILTKRREAMSTLRQTNGIAGFPKRRESIYDTFGVGHSSTSISAALGMAIANHQLDSNRKVVAIIGDGAMTAGMAFEALNHAGDMDTNILVILNDNDMSISPNVGGLSNYFAKI-LSSQLYTSMREGSKHLLERMPTVRELAKR-------TEEHVKGMVAPGTLFEELGFNYIGPIDGHDLPLLLSTLKNMR--VLEGPQFLHIITQKGKGFPSAE-DDPCVYHGVSAFDPKTGQMESKSTDAPTYTKIFSDWLCDMAAHDERLIGITPAMREGSGLVDFSTLFPDRYFDVGIAEQHSVTLAAGIACEGLKPVVAIYSTFLQRAYDQLIHDVALQNLPVLFAIDRAGLVGADGPTHAGSFDLAYLRSIPNMLIMAPADENECRQMFTTGFQYEG-PSAVRYPRGCGVGVPVMPKLTTLPIAQAQLRRQGEQVALLVFGTLLAMALEAAEQLNATVVNMRFVKPLDVEMITQMAKQHKLLVTVEE 553
>gi|29840069|ref|NP_829175.1| 1-deoxy-D-xylulose-5-phosphate synthase [Chlamydophila caviae GPIC] >gi|33301050|sp|Q823V1|DXS_CHLCV 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|29834417|gb|AAP05053.1| deoxyxylulose-5-phosphate synthase [Chlamydophila caviae GPIC] (644 aa)
Score = 825, Expect = 5.4e-86, Identities = 207/603 (34%), Positives = 324/603 (53%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDR-ADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFK-KEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNSNNQ-----------TYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTK-------EKCEDIEVKKEFSFGSWVYALQTKESKTCIISYGDIIN---DLKKEIKTKSID--LINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEI 610
           + +I +  D KK  L EL  LA  +R KII +  N   HL+SNLGI+EL++AL YVF S +D   +D GHQ Y HK++T R  ++   IR   GLSGF  P+ESIHD   +GH+GN LS+  G  +        ++P++GDAA S GL  EALNNI+ N +  ++++NDN MSIS+NVG + K +S++       L  + + K L K   +   I    +K    L   F     FE     Y G +DG+++K+ I+V +  +++ PF P ++HV T KG G + A+ ++   YH +     N NS+ +           TY  +    +  L E   N+ I+ PAM+L S      +KFPN + DVGIAE HAVT +AG+A A   V  SIYSTFL R+ DN+ HDV    LP+   +DR  L+Y DG +HHGIYD+ FL+++PN +I    +    ++L+  + Q  + P  IRY             D+ + ++   G     + ++     I+  G + N    +K ++ T  I   +++ VF+  +       +L  +  + ++E+      L  +            ++    I +     G+KE + K++ +D  S+   I
  S:     9 LSQISSPTDLKKFSLAELSLLAEQMRHKIISVLTNTGGHLASNLGIIELTIALHYVFSSTEDKFIFDVGHQAYPHKLLTGRNTEEFDRIRHDGGLSGFTSPSESIHDLFFSGHAGNALSLALGMAKATEDSRTHILPILGDAAFSCGLTLEALNNISSNLSKFIVVLNDNNMSISQNVGVMSKNLSRWIHHPKFNLFSRKIEKWLTKIPRYGNSISRRSHKLSICLKSLFCPIPIFEQFNLAYMGPVDGHDIKRLISVFQTARDL-PF-PVLIHVYTTKGKGLEIAQ-ENPEKYHGVT---ANFNSSKENKFLPTIKPQLTYPDIFGQTVCTLGEAFPNLHIVTPAMSLGSRLEAFKEKFPNRFIDVGIAEGHAVTFSAGIAKAKSPVICSIYSTFLHRALDNVFHDVCLQGLPVILAIDRAGLAYGDGCSHHGIYDLSFLRAMPNMVICQPRSAVVFQQLLQSSLQ-WNMPVAIRYPNIAATQRDPIATDVHMHRDPGVGE----ILSQGEDVLILGLGHMCNTALSIKLQLLTHGISATVVDPVFVKPFDNNLFSILLMHHSKVIIIEEHSIRGGLASEFNDFLATYSFKVDVLHFGIPDAFFAHGDKESLLKRVGLDTESMVKRI 625
>gi|82775671|ref|YP_402018.1| 1-deoxy-D-xylulose-5-phosphate synthase [Shigella dysenteriae Sd197] >gi|118595617|sp|Q32JH8|DXS_SHIDS 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|81239819|gb|ABB60529.1| 1-deoxyxylulose-5-phosphate synthase [Shigella dysenteriae Sd197] (620 aa)
Score = 825, Expect = 5.6e-86, Identities = 193/581 (33%), Positives = 327/581 (56%)
  Q:    32 LRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWS---IYKSFSKLSKFFKGK----NFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNL------NSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEK--VFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           LR+ ++D     S H +S LG VEL++AL YV+++P D + +D GHQ Y HK++T R DKI TIR+  GL  F    ES +D +S GHS   +S   G     +   K++  + VIGD AI+ G+AFEA+N+    +  ML+++NDN MSIS+NVGAL+  +++        L+ K+   +   +E  KK++     I +   +  +  KG       FE LGF+Y G +DG+++   I  LK ++++   GP  LH+ T KG GY+ AE  D   +H++   DP+       +    +Y  +  ++L +    DN +  I PAM   S  +  S+KFP+ Y DV IAE+HAVT AAG+AI   K  V+IYSTFLQR+YD +LHDVA  +LP+ F +DR  +  +DG TH G +D+ +L+ IP  +I   S++ E  +++   Y     P  +RY +     +E+            ++ +  K  I+++G ++ +  K  ++ +  L++  F+    +  +L + ++++ +  VE+  +      G + +++A+   +   +  I + +  I  G +E++  +L +D   + A+IK+
  S:    35 LRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQLIWDVGHQAYPHKILTGRRDKIGTIRQKGGLHPFPWRGESEYDVLSVGHSSTSISAGIGIAVAAEKEGKNRRTVCVIGDGAITAGMAFEAMNHAGDIRPDMLVVLNDNEMSISENVGALNNHLAQL-------LSGKLYSSL---REGGKKVFSGVPPIKELLKRTEEHIKGMVVPGTLFEELGFNYIGPVDGHDVLGLITTLKNMRDLK--GPQFLHIMTKKGRGYEPAE-KDPITFHAVPKFDPSSGCLPKSSGGLPSYSKIFGDWLCETAAKDNKLMAITPAMREGSGMVEFSRKFPDRYFDVAIAEQHAVTFAAGLAIGGYKPIVAIYSTFLQRAYDQVLHDVAIQKLPVLFAIDRAGIVGADGQTHQGAFDLSYLRCIPEMVIMTPSDENECRQMLYTGYHYNDGPSAVRYPRGNAVGVELTPLEKLPIGKGTVKRRGEKLAILNFGTLMPEAAKVAESLNATLVDMRFVKPLDETLILEMAASHEALVTVEENAIMGGAGSGVNEVLMAHRKPVP--VLNIGLPDFFIPQGTQEEMRAELGLDAAGMEAKIKA 617
>gi|57234479|ref|YP_181480.1| 1-deoxy-D-xylulose-5-phosphate synthase [Dehalococcoides ethenogenes 195] >gi|118595511|sp|Q3Z8G9|DXS_DEHE1 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|57224927|gb|AAW39984.1| 1-deoxy-D-xylulose-5-phosphate synthase [Dehalococcoides ethenogenes 195] (647 aa)
Score = 825, Expect = 5.7e-86, Identities = 208/605 (34%), Positives = 332/605 (54%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGF-IEKNNSKSK-SVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFS-KLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNSNNQ-TYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVK-----------KEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKL--SCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           +D I +  D KK+ L EL +LAV +R+++++       HL+S+LG+VEL++AL  VF+SP+D I +D GHQ Y HK++T R ++ +T+R+  GLSGF   +ES HD    GH+   +S   G  + ++ +K   SVI VIGD AIS G++FEA+NN  +  T  ++I+NDNGM+IS + GAL K ++  +        ++  ++ +    + K + W+  KS   K  K     + +E LGF Y G +DG+N+++    LK  K+     P ++H+ T KG GY +AE D    YH +      L S +  +Y  V    L K++  +  +  I  AMT       ++  FP+   DVGI E+HAVT AAGMA       V IYSTFLQRS+D ++HDV   +LP+ F +DR  +   DG TH GI+D+ F+  IP+ I+T  S++ +L+ L+  A  N   PF +RY +   E +E +           +  + GS +    T +S    +++     ++  E   K   L+N  +I+    E +L+I   +K +  VE+   S  LG  +  +  E  L  +  I  I + +  +  GN+  +  K  +D   I  ++ S
  S:    19 LDTINSPSDLKKLTLDELRELAVQIREELVNRVTLNGGHLASSLGVVELTIALHRVFESPKDKIIWDVGHQSYAHKLLTGRREQFATLRQHGGLSGFTCRDESPHDPFGAGHASTSISAGLGMAVARDLAKEDYSVISVIGDGAISGGMSFEAINNAGHLHTKFIVILNDNGMAISPSTGALSKFLNNVRFDPRFEFAKRGAKQTITNMPFGKSV-WAFTKSIKRKFEKSMLPGSLWEELGFIYLGPVDGHNIRELEAALKCAKDFES-QPVLIHMITKKGKGYDDAEADAVK-YHGIAPKSGGLKSGHGLSYSQVFGQTLHKIMSDNPKVVAITAAMTDGCGLSEVAADFPDRVFDVGICEQHAVTFAAGMATQGYIPVVVIYSTFLQRSFDQIIHDVCLQKLPVVFAIDRGGIVGDDGKTHQGIFDLSFMSLIPDMIVTAPSDENDLQHLLYTAV-NSGKPFALRYPRGFGEGVETEGTLRNIPIGENEVLASGSEIAIFATGKS----VAFAKEAMEILAESGIKPT-LVNNRYISPLDTELILKIAGNHKYLITVEENVLSGGLGSRINTILAEAGLVNAVKIANIAVPDKFVEHGNQSLLRAKYGLDGKGIAQKVLS 631
>gi|145632791|ref|ZP_01788524.1| 1-deoxy-D-xylulose-5-phosphate synthase [Haemophilus influenzae 3655] >gi|145634983|ref|ZP_01790690.1| 1-deoxy-D-xylulose-5-phosphate synthase [Haemophilus influenzae PittAA] >gi|144986447|gb|EDJ93013.1| 1-deoxy-D-xylulose-5-phosphate synthase [Haemophilus influenzae 3655] >gi|145267849|gb|EDK07846.1| 1-deoxy-D-xylulose-5-phosphate synthase [Haemophilus influenzae PittAA] (625 aa)
Score = 824, Expect = 7.5e-86, Identities = 192/459 (41%), Positives = 274/459 (59%)
  Q:    15 EDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI---EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLT-----EKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDP---NLNSNNQ--TYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTK 473
           ED + +   +L  L   LR  +++     S HL+S LG VEL++AL YV+ +P D + +D GHQ Y HK++T R +++STIR+ +G+  F    ES  D +S GHS   +S   G     E+ N+  K+V  VIGD AI+ G+AFEALN+     T ML+I+NDN MSIS+NVGAL+  +++   S S++ T     +KIL K+   K + KK      +   K   F      FE LGF+Y G +DG+N+ + + +L  ++N+   GP  LH+KT KG GY  AE D  G +H +   DP    L  NN   TY  +  ++L ++ E D  I  I PAM   S  +  S++FP  Y DV IAE+HAVT A G+AI   K  V+IYSTFLQR+YD L+HDVA   LP+ F +DR  +  +DG TH G +DI F++ IPN II   S++ E  +++   YQ    P  +RY +
  S:    18 EDLRLLNKDQLPQLCQELRAYLLESVSQTSGHLASGLGTVELTVALHYVYKTPFDQLIWDVGHQAYPHKILTGRREQMSTIRQKDGIHPFPWREESEFDVLSVGHSSTSISAGLGIAVAAERENAGRKTVC-VIGDGAITAGMAFEALNHAGALHTDMLVILNDNEMSISENVGALNNHLARI-FSGSLYSTLRDGSKKILDKVPPIKNFMKKT-----EEHMKGVMFSPESTLFEELGFNYIGPVDGHNIDELVAMLTNMRNLK--GPQFLHIKTKKGKGYAPAEKDPIG-FHGVPKFDPISGELPKNNSKPTYSKIFGDWLCEMAEKDAKIIGITPAMREGSGMVEFSQRFPKQYFDVAIAEQHAVTFATGLAIGGYKPVVAIYSTFLQRAYDQLIHDVAIQNLPVLFAIDRAGIVGADGATHQGAFDISFMRCIPNMIIMTPSDENECRQMLYTGYQC-GKPAAVRYPR 478
>gi|146310548|ref|YP_001175622.1| 1-deoxy-D-xylulose-5-phosphate synthase [Enterobacter sp. 638] >gi|166920141|sp|A4W791|DXS_ENT38 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|145317424|gb|ABP59571.1| 1-Deoxy-D-xylulose-5-phosphate synthase [Enterobacter sp. 638] (620 aa)
Score = 824, Expect = 8.3e-86, Identities = 195/602 (32%), Positives = 339/602 (56%)
  Q:    11 IPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI---EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWS---IYKSFSKLSKFFKGK----NFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNL------NSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVK--KEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEK--VFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           + + ++ + +    L  L+  LR+ ++D     S H +S LG VEL++AL YV+++P D + +D GHQ Y HK++T R DKI TIR+  GL  F    ES  D +S GHS   +S   G     EK N + ++V  VIGD AI+ G+AFEA+N+    K  ML+I+NDN MSIS+NVGAL+  +++        L+ K+   +   +E  KK++     I +   +  +  KG       FE LGF+Y G +DG+++   +  LK ++++   GP  LH+ T KG GY+ AE  D   +H++   DP        +    +Y  +  ++L +    DN +  + PAM   S  +  SKK+P+ Y DV IAE+HAVT AAG+AI   K  V+IYSTFLQR+YD ++HDVA  +LP+ F +DR  +  +DG TH G +D+ FL+ +P+ ++   S++ E  +++   Y  +  P  +RY +     +E++   +   G  +  ++    K  I+++G ++ +  K  ++ +  L++  F+    +  +L + S ++ +  +E+  +      G + +++AN   +   +  + + +  I  G +++   ++ +D   I A+I++
  S:    14 VDSTQELRLLPKESLPKLSDELRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQLIWDVGHQAYPHKILTGRRDKIGTIRQKGGLHPFPWRGESEFDVLSVGHSSTSISAGIGIAVAAEKENKQRRTVC-VIGDGAITAGMAFEAMNHAGDIKPDMLVILNDNEMSISENVGALNNHLAQL-------LSGKLYSTL---REGGKKVFSGVPPIKELLKRTEEHIKGMVVPGTLFEELGFNYIGPVDGHDVLGLVTTLKNMRDLK--GPQFLHIMTKKGRGYEPAE-KDPITFHAVPKFDPTSGCLPKSSGGMPSYSKIFGDWLCETAAKDNKLMAVTPAMREGSGMVEFSKKYPDQYFDVAIAEQHAVTFAAGLAIGGYKPIVAIYSTFLQRAYDQVIHDVAIQKLPVLFAIDRAGIVGADGQTHQGAFDLSFLRCVPDMVVMTPSDENECRQMLFTGYHYQDGPSAVRYPRGNAVGVELEPLTKMPIGKGI--VKRHGEKLAILNFGTLMPEAAKVAESMNATLVDMRFVKPLDETLILEMASRHEVLITLEENAIMGGAGSGVNEVLMANRKPIP--VLNLGLPDRFIPQGTQDEARAEIGLDAAGIEAKIRT 617
>gi|169350497|ref|ZP_02867435.1| hypothetical protein CLOSPI_01265 [Clostridium spiroforme DSM 1552] >gi|169292817|gb|EDS74950.1| hypothetical protein CLOSPI_01265 [Clostridium spiroforme DSM 1552] (624 aa)
Score = 824, Expect = 8.6e-86, Identities = 211/604 (34%), Positives = 336/604 (55%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILS--ICQGFIEKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKF-FKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSL---KLSDPNLNS----NNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKE--FSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSID--LINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIK 611
           ++ I +    K++ + +L  L+  +R+ +I        HLSSNLG+VEL++AL YVF+SP+D I +D GHQ YVHK++T RA++  T+R+ NGLSGFQ+  ES HD    GHS   LS  +        + +   VIPVIGDAA+  G + EALN++   K  ++II+NDN MSI K+VG   + +S  ++S +    ++  R I  K ++ + I+ +I K      K        FE  G  Y G ++G++ +  I VL   K        ++HV T KG GYK AE D KG +H +    + D  + +    +  ++  + A+ +E  +  D +I  I PAM   S   ++ + FPN   DVGIAEEHA+T  AG+AIA KK F+S+YS+FLQR+YD + HD+AR++L     VDRC    +DG THHG++D+G L  +PN II   SN  + ++ I    +N  +P+ +R  +   +D  VK +   + G W +     +    +I YG  +N ++   + K I   L++A+FI     E +  I+   K + + E     N L  ++    ++N +   I    + ++    G+ ++I K   +DM S + ++K
  S:     3 LNNIKDPSFLKELDIRQLNQLSSNIREFLITNISKTGGHLSSNLGVVELTIALHYVFNSPKDKIFFDVGHQSYVHKILTGRANRFDTLRKYNGLSGFQKQAESKHDVWEAGHSSTALSSAVAMAIARDLDHQDYEVIPVIGDAAMVGGESLEALNHLGSIKNKVIIILNDNQMSIGKSVGGFGEFLSSIRLSGTYNNLKQDYRNITSKNKFGQMIF-NISKRVKDFVKHGLIDDTIFEDFGVDYLGPVNGHDFEDLIRVLNLAKK--SKSSVVIHVVTKKGRGYKYAENDFKGNWHGIAPFNIVDGTIKTPPPKDKISWSKMVADHIELNMSKDKDIVAITPAMIHGSCMDDIFEHFPNRSFDVGIAEEHALTFTAGLAIAKKKPFISVYSSFLQRAYDQINHDIARMDLGCLICVDRCGFVGADGPTHHGVFDLGILNPLPNVIICTPSNSKDAKKFINTYIKNNDHPYILRIPRGDIKDEIVKDDDFLTIGKW-FIENDHDYDCTVICYGQNVNRVRSYFEDKDIKIRLVDALFIKPMDFEMLNHIVDD-KPLVIYETELKINSLASNIAYYYSQNGILKRIYSFGVDDHFSVQGSIDEILKDERLDMESFYQKVK 615
>gi|145636151|ref|ZP_01791821.1| 1-deoxy-D-xylulose-5-phosphate synthase [Haemophilus influenzae PittHH] >gi|148825982|ref|YP_001290735.1| 1-deoxy-D-xylulose-5-phosphate synthase [Haemophilus influenzae PittEE] >gi|166198620|sp|A5UC51|DXS_HAEIE 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|145270673|gb|EDK10606.1| 1-deoxy-D-xylulose-5-phosphate synthase [Haemophilus influenzae PittHH] >gi|148716142|gb|ABQ98352.1| 1-deoxy-D-xylulose-5-phosphate synthase [Haemophilus influenzae PittEE] (625 aa)
Score = 824, Expect = 8.7e-86, Identities = 192/459 (41%), Positives = 274/459 (59%)
  Q:    15 EDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI---EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLT-----EKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDP---NLNSNNQ--TYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTK 473
           ED + +   +L  L   LR  +++     S HL+S LG VEL++AL YV+ +P D + +D GHQ Y HK++T R +++STIR+ +G+  F    ES  D +S GHS   +S   G     E+ N+  K+V  VIGD AI+ G+AFEALN+     T ML+I+NDN MSIS+NVGAL+  +++   S S++ T     +KIL K+   K + KK      +   K   F      FE LGF+Y G +DG+N+ + + +L  ++N+   GP  LH+KT KG GY  AE D  G +H +   DP    L  NN   TY  +  ++L ++ E D  I  I PAM   S  +  S++FP  Y DV IAE+HAVT A G+AI   K  V+IYSTFLQR+YD L+HDVA   LP+ F +DR  +  +DG TH G +DI F++ IPN II   S++ E  +++   YQ    P  +RY +
  S:    18 EDLRLLNKDQLPQLCQELRAYLLESVSQTSGHLASGLGTVELTVALHYVYKTPFDQLIWDVGHQAYPHKILTGRREQMSTIRQKDGIHPFPWREESEFDVLSVGHSSTSISAGLGIAVAAERENAGRKTVC-VIGDGAITAGMAFEALNHAGALHTDMLVILNDNEMSISENVGALNNHLARI-FSGSLYSTLRDGSKKILDKVPPIKNFMKKT-----EEHMKGVMFSPESTLFEELGFNYIGPVDGHNIDELVAMLTNMRNLK--GPQFLHIKTKKGKGYAPAEKDPIG-FHGVPKFDPISGELPKNNSKPTYSKIFGDWLCEMAEKDAKIIGITPAMREGSGMVEFSQRFPKQYFDVAIAEQHAVTFATGLAIGGYKPVVAIYSTFLQRAYDQLIHDVAIQNLPVLFAIDRAGIVGADGATHQGAFDISFMRCIPNMIIMTPSDENECRQMLYTGYQC-GKPAAVRYPR 478
>gi|15602397|ref|NP_245469.1| 1-deoxy-D-xylulose-5-phosphate synthase [Pasteurella multocida subsp. multocida str. Pm70] >gi|13431439|sp|P57848|DXS_PASMU 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|12720795|gb|AAK02616.1| Dxs [Pasteurella multocida subsp. multocida str. Pm70] (614 aa)
Score = 824, Expect = 8.8e-86, Identities = 205/598 (34%), Positives = 327/598 (54%)
  Q:    15 EDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI---EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLT-----EKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSD-----PNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           ED + +   +L  +   LR  +++     S HL+S LG VEL++AL YV+ +P D + +D GHQ Y HK++T R D++STIR+ NG+  F    ES  D +S GHS   +S   G     ++ N+  K+V  VIGD AI+ G+AFEA+N+     T ML+I+NDN MSIS+NVGAL+  +++  ++ S + +     +KIL  +   KE+ KK    +    S +         FE LGF+Y G IDG+N+++ I+ LK ++ +   GP  LH+ T KG GY  AE D  G +   K        P  N+   TY  +  ++L ++ E D  +  I PAM   S  +  S +FP  Y DV IAE+HAVT AAG+AI   K  V+IYSTFLQR+YD ++HDVA   LP+ F +DR  +  +DG TH G +DI FL+ IPN +I   S++ E  +++   Y+  + P  +RY +     +E+            L  +  K  I+++G ++       +  +  +I+  F+     E + +I  T+  I  +E+       G  +  + +  +    + ++ + +  I  G +++I   L++D   I  +IK+
  S:    14 EDLRLLSKEQLPQICQELRAYLLESVSQSSGHLASGLGTVELTVALHYVYKTPFDQLIWDVGHQAYPHKILTGRRDQMSTIRQKNGIHPFPWREESEFDVLSVGHSSTSISAGLGIAVAAQRENAGRKTVC-VIGDGAITAGMAFEAMNHAGALHTDMLVILNDNEMSISENVGALNNHLARL-LTGSFYSSIREGGKKILSGMPPIKEFVKKTEEHVKGFVSPVG------TMFEQLGFNYIGPIDGHNIEELISTLKNMRALK--GPQFLHIMTKKGKGYAPAEKDPIGFHGVPKFDHLSGQLPKSNTT-PTYSKIFGDWLCEMAENDPKLIGITPAMREGSGMVEFSNRFPQQYFDVAIAEQHAVTFAAGLAIGGYKPVVAIYSTFLQRAYDQVIHDVAIQNLPVLFAIDRAGVVGADGQTHQGAFDISFLRCIPNMVIMTPSDENECRQMLYTGYK-LNQPAAVRYPRGNAIGVELTPLTMLALGKSNLIREGEKIAILNFGTLLPTAINVAEKLNATVIDMRFVKPIDVERIHQIAQTHDLIVTLEENVIQGGAGSAVAEVLHSQQHQTKLLQLGLPDFFIPQGTQQEILADLHLDEAGIETQIKN 612
>gi|150390271|ref|YP_001320320.1| deoxyxylulose-5-phosphate synthase [Alkaliphilus metalliredigens QYMF] >gi|149950133|gb|ABR48661.1| deoxyxylulose-5-phosphate synthase [Alkaliphilus metalliredigens QYMF] (636 aa)
Score = 823, Expect = 9.7e-86, Identities = 219/610 (35%), Positives = 334/610 (54%)
  Q:     1 MKKNKVKIDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKSK--SVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFK-KEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLY----HSLKLSDPNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRY-------TKEKC-EDIEVKKEFSFGSWVYALQTKESKTCIISYGDIIND----LKKEIKTKSI--DLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEI 610
           M+K    +++I + ED KK+K +E+  LA  +RK ++        HL+SNLG+VEL++AL  ++D+ +D I +D GHQ YVHK++T R ++  T+R+  GLSGF + +ES HD   TGHS   +S   G     + K +   V+ VIGD A++ G+AFEALN+   +K  + +++NDN MSIS+NVG L   +SK + +      +  L  +L       K +  +  K+   +  FF     FE LGF Y G IDG++       +K  KNI   GP ++HV T KG GYK AE      +      ++   P   + N ++  VA N L +  + +  I  I  AM   +   + +++FP  + DVGIAE+HAVT AAGMA    K F ++YSTFLQR++D ++HDV    LP+TFL+DR  L  +DG+THHG++DI FL  IPN  I  A +  EL+ +I  A +    P  IRY        KEK    I++ K      W            I++ G+ +N+    L +++  K I   +IN  FI    +  +L+   ++K IYV+E        G+ +    NE ++   +K   + +  I  GN   + K   ++   IF EI
  S:     1 MRKVYRYLEQINSPEDLKKLKENEVRLLAHDIRKFLVQSVSKTGGHLASNLGVVELTLALHTIYDTLKDKIIWDVGHQAYVHKILTGRREQFKTLRQYKGLSGFPKRHESSHDHFDTGHSSTSISAALGLASARDLKKEKHEVVAVIGDGALTGGMAFEALNHGGQSKKNITVVLNDNEMSISQNVGGLSNYLSKIRTAPIYAKVKDDLELLLGNIPAIGKSVKKTAEKAKDSIKYFFVPGILFEELGFTYIGPIDGHDYNALCTAIKNSKNIK--GPKLIHVITKKGKGYKLAEKSPAEFHGVSPFKIETGKPISLTKNLSFSEVAGNTLIEAAKTNPRIVTITAAMPSGTGLADFAEQFPERFFDVGIAEQHAVTFAAGMAAEGYKPFFAVYSTFLQRAFDQVIHDVCIQNLPVTFLIDRAGLVGNDGETHHGVFDISFLSCIPNLTILAAKDGNELQAMIQFA-EKHEGPVAIRYPRGTTALDKEKSILPIQLGKGEVICDW-------GKDALILTVGN-MNEIGVALCQQLNNKGIGATVINPRFIKPIDQHLILQHAKSHKRIYVLEDNAKIGGFGEQIRSFLNEYEVYKPVKLFALPDAFIEQGNVALLYKDCKLNQEEIFTEI 620
>gi|16273346|ref|NP_439591.1| 1-deoxy-D-xylulose-5-phosphate synthase [Haemophilus influenzae Rd KW20] >gi|145629448|ref|ZP_01785246.1| 1-deoxy-D-xylulose-5-phosphate synthase [Haemophilus influenzae 22.1-21] >gi|1175801|sp|P45205|DXS_HAEIN 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|1574278|gb|AAC23088.1| 1-deoxyxylulose-5-phosphate synthase (dxs) {Escherichia coli) [Haemophilus influenzae Rd KW20] >gi|144978291|gb|EDJ88055.1| 1-deoxy-D-xylulose-5-phosphate synthase [Haemophilus influenzae 22.1-21] (625 aa)
Score = 823, Expect = 1.1e-85, Identities = 192/459 (41%), Positives = 273/459 (59%)
  Q:    15 EDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI---EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLT-----EKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDP---NLNSNNQ--TYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTK 473
           ED + +   +L  L   LR  +++     S HL+S LG VEL++AL YV+ +P D + +D GHQ Y HK++T R +++STIR+ +G+  F    ES  D +S GHS   +S   G     E+ N+  K+V  VIGD AI+ G+AFEALN+     T ML+I+NDN MSIS+NVGAL+  +++   S S++ T     +KIL K+   K + KK      +   K   F      FE LGF+Y G +DG+N+ + +  L  ++N+   GP  LH+KT KG GY  AE D  G +H +   DP    L  NN   TY  +  ++L ++ E D  I  I PAM   S  +  S++FP  Y DV IAE+HAVT A G+AI   K  V+IYSTFLQR+YD L+HDVA   LP+ F +DR  +  +DG TH G +DI F++ IPN II   S++ E  +++   YQ    P  +RY +
  S:    18 EDLRLLNKDQLPQLCQELRAYLLESVSQTSGHLASGLGTVELTVALHYVYKTPFDQLIWDVGHQAYPHKILTGRREQMSTIRQKDGIHPFPWREESEFDVLSVGHSSTSISAGLGIAVAAERENAGRKTVC-VIGDGAITAGMAFEALNHAGALHTDMLVILNDNEMSISENVGALNNHLARI-FSGSLYSTLRDGSKKILDKVPPIKNFMKKT-----EEHMKGVMFSPESTLFEELGFNYIGPVDGHNIDELVATLTNMRNLK--GPQFLHIKTKKGKGYAPAEKDPIG-FHGVPKFDPISGELPKNNSKPTYSKIFGDWLCEMAEKDAKIIGITPAMREGSGMVEFSQRFPKQYFDVAIAEQHAVTFATGLAIGGYKPVVAIYSTFLQRAYDQLIHDVAIQNLPVLFAIDRAGIVGADGATHQGAFDISFMRCIPNMIIMTPSDENECRQMLYTGYQC-GKPAAVRYPR 478
>gi|170767729|ref|ZP_02902182.1| 1-deoxy-D-xylulose-5-phosphate synthase [Escherichia albertii TW07627] >gi|170123217|gb|EDS92148.1| 1-deoxy-D-xylulose-5-phosphate synthase [Escherichia albertii TW07627] (620 aa)
Score = 822, Expect = 1.2e-85, Identities = 194/581 (33%), Positives = 325/581 (55%)
  Q:    32 LRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWS---IYKSFSKLSKFFKGK----NFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNL------NSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVK--KEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           LR+ ++D     S H +S LG VEL++AL YV+++P D + +D GHQ Y HK++T R DKI TIR+  GL  F    ES +D +S GHS   +S   G     +   K +  + VIGD AI+ G+AFEA+N+    K  ML+I+NDN MSIS+NVGAL+  +++        L+ K+   +   +E  KK++     I +   +  +  KG       FE LGF+Y G +DG+++   I  LK ++++   GP  LH+ T KG GY+ AE  D   +H++   DP+       N    +Y  +  ++L +    D+ +  I PAM   S  +  S+KFP  Y DV IAE+HAVT AAG+AI   K  V+IYSTFLQR+YD +LHDVA  +LP+ F +DR  +  +DG TH G +D+ +L+ IP  +I   S++ E  +++   Y     P  +RY +     +E+   ++   G  +  ++ +  K  I+++G ++ +  K  ++ +  L++  F+    +  +L + ++++ +  VE+       G  +  +   ++    +  I + +  I  G ++++  +L +D   + A+IK+
  S:    35 LRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQLIWDVGHQAYPHKILTGRRDKIGTIRQKGGLHPFPWRGESEYDVLSVGHSSTSISAGIGIAVAAEKEGKDRRTVCVIGDGAITAGMAFEAMNHAGDIKPDMLVILNDNEMSISENVGALNNHLAQL-------LSGKLYSSL---REGGKKVFSGVPPIKELLKRTEEHIKGMVVPGTLFEELGFNYIGPVDGHDVLGLITTLKNMRDLK--GPQFLHIMTKKGRGYEPAE-KDPITFHAVPKFDPSSGCLPKSNGGLPSYSKIFGDWLCETAAKDDKLMAITPAMREGSGMVEFSRKFPERYFDVAIAEQHAVTFAAGLAIGGYKPVVAIYSTFLQRAYDQVLHDVAIQKLPVLFAIDRAGIVGADGQTHQGAFDLSYLRCIPEMVIMTPSDENECRQMLYTGYHYNDGPSAVRYPRGNALGVELTPLEKLPIGKGI--VKRRGEKLAILNFGTLMPEAAKVAESLNATLVDMRFVKPLDEALILEMAASHEALVTVEENAIMGGAGSSVNEVLMAHRKPVPVLNIGLPDFFIPQGTQQEMRAELGLDAAGMEAKIKA 617
>gi|167842190|ref|ZP_02468874.1| 1-deoxy-D-xylulose-5-phosphate synthase [Burkholderia thailandensis MSMB43] (634 aa)
Score = 822, Expect = 1.2e-85, Identities = 199/546 (36%), Positives = 293/546 (53%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNK-TPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKG----KNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELD-----DKGLYHSLKLSDPNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFS---FGSWVYALQTKE---SKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEK 553
           +  I +  D +++   +L  LA  LR  ++D       HLSSNLG VEL++AL YVFD+P D I +D GHQ Y HK++T R D + T+R+  G+SGF   +ES +D   T HS   +S   G     K N   +  I VIGD A++ G+AFEA+NN   ++   +L+I+NDN MSIS  VGAL++ +++    +        + ++L        +   + +   KL +  KG       FE  GF+Y G IDG++L   I  L+ IK +   GP  LHV T KG GYK AE D       G ++  +   P+     +TY  V   +L    E D  +  I PAM   S  +   K+FP  Y DVGIAE+HAVT A G+A    K  V+IYSTFLQR+YD L+HDVA   LP+ F +DR  L  +DG TH G YD+ FL+ IPN  +  AS++ E  +++  A Q + NP  +RY +     +   K F+    G      +T +    +  I+++G ++       +     + N  F+     E V  +  T+  +  VE+
  S:     5 LKTIDDPADLRRLDRRQLQPLADELRAFVLDSVSKTGGHLSSNLGTVELTIALHYVFDTPDDRIVWDVGHQTYPHKILTGRRDGMKTLRQLGGISGFPRRSESEYDTFGTAHSSTSISAALGMAIGSKLNGDDRFSIAVIGDGAMTAGMAFEAMNNAGVSEDAKLLVILNDNDMSISPPVGALNRHLARLMSGRFYAAARAGVERVL-------SVAPPVLELARKLEEHAKGMVVPATLFEEFGFNYIGPIDGHDLDSLIPTLQNIKELR--GPQFLHVVTKKGQGYKLAEADPVLYHGPGKFNPAEGIKPSTTPAKKTYTQVFGEWLCDAAELDARVVGITPAMREGSGMVEFEKRFPERYYDVGIAEQHAVTFAGGLATEGLKPVVAIYSTFLQRAYDQLIHDVALQNLPVVFAIDRAGLVGADGATHAGAYDLAFLRCIPNMTVMAASDENECRQMLYTALQ-QPNPTAVRYPRGAGTGVATVKAFTELPLGKGEVRRRTSQPDGKRIAILAFGTMVAPSIAAAEALDATVANMRFVKPIDAELVRELAQTHDYLVTVEE 558
>gi|194432557|ref|ZP_03064843.1| 1-deoxy-D-xylulose-5-phosphate synthase [Shigella dysenteriae 1012] >gi|194419118|gb|EDX35201.1| 1-deoxy-D-xylulose-5-phosphate synthase [Shigella dysenteriae 1012] (620 aa)
Score = 822, Expect = 1.3e-85, Identities = 194/581 (33%), Positives = 330/581 (56%)
  Q:    32 LRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWS---IYKSFSKLSKFFKGK----NFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNL------NSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVK--KEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEK--VFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           LR+ ++D     S H +S LG VEL++AL YV+++P D + +D GHQ Y HK++T R DKI TIR+  GL  F    ES +D +S GHS   +S   G     +   K++  + VIGD AI+ G+AFEA+N+       ML+++NDN MSIS+NVGAL+  +++        L+ K+   +   +E  KK++     I +   +  +  KG       FE LGF+Y G +DG+++   I  LK ++++   GP  LH+ T KG GY+ AE  D   +H++   DP+       +    +Y  +  ++L +    DN +  I PAM   S  +  S+KFP+ Y DV IAE+HAVT AAG+AI   K  V+IYSTFLQR+YD +LHDVA  +LP+ F +DR  +  +DG TH G +D+ +L+ IP  +I   S++ E  +++   Y     P  +RY +     +E+   ++   G  +  ++ +  K  I+++G ++ +  K  ++ +  L++  F+    +  +L + ++++ +  VE+  +      G + +++A+   +   +  I + +  I  G +E++  +L +D   + A+IK+
  S:    35 LRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQLIWDVGHQAYPHKILTGRRDKIGTIRQKGGLHPFPWRGESEYDVLSVGHSSTSISAGIGIAVAAEKEGKNRRTVCVIGDGAITAGMAFEAMNHAGDILPDMLVVLNDNEMSISENVGALNNHLAQL-------LSGKLYSSL---REGGKKVFSGVPPIKELLKRTEEHIKGMVVPGTLFEELGFNYIGPVDGHDVLGLITTLKNMRDLK--GPQFLHIMTKKGRGYEPAE-KDPITFHAVPKFDPSSGCLPKSSGGLPSYSKIFGDWLCETAAKDNKLMAITPAMREGSGMVEFSRKFPDRYFDVAIAEQHAVTFAAGLAIGGYKPIVAIYSTFLQRAYDQVLHDVAIQKLPVLFAIDRAGIVGADGQTHQGAFDLSYLRCIPEMVIMTPSDENECRQMLYTGYHYNDGPSAVRYPRGNAVGVELTPLEKLPIGKGI--VKRRGEKLAILNFGTLMPEAAKVAESLNATLVDMRFVKPLDEALILEMAASHEALVTVEENAIMGGAGSGVNEVLMAHRKPVP--VLNIGLPDFFIPQGTQEEMRAELGLDAAGMEAKIKA 617
>gi|46133487|ref|ZP_00157279.2| COG1154: Deoxyxylulose-5-phosphate synthase [Haemophilus influenzae R2866] >gi|145638944|ref|ZP_01794552.1| 1-deoxy-D-xylulose-5-phosphate synthase [Haemophilus influenzae PittII] >gi|145271916|gb|EDK11825.1| 1-deoxy-D-xylulose-5-phosphate synthase [Haemophilus influenzae PittII] (625 aa)
Score = 822, Expect = 1.3e-85, Identities = 192/459 (41%), Positives = 273/459 (59%)
  Q:    15 EDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI---EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLT-----EKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDP---NLNSNNQ--TYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTK 473
           ED + +   +L  L   LR  +++     S HL+S LG VEL++AL YV+ +P D + +D GHQ Y HK++T R +++STIR+ +G+  F    ES  D +S GHS   +S   G     E+ N+  K+V  VIGD AI+ G+AFEALN+     T ML+I+NDN MSIS+NVGAL+  +++   S S++ T     +KIL K+   K + KK      +   K   F      FE LGF+Y G +DG+N+ + +  L  ++N+   GP  LH+KT KG GY  AE D  G +H +   DP    L  NN   TY  +  ++L ++ E D  I  I PAM   S  +  S++FP  Y DV IAE+HAVT A G+AI   K  V+IYSTFLQR+YD L+HDVA   LP+ F +DR  +  +DG TH G +DI F++ IPN II   S++ E  +++   YQ    P  +RY +
  S:    18 EDLRLLNKDQLPQLCQELRAYLLESVSQTSGHLASGLGTVELTVALHYVYKTPFDQLIWDVGHQAYPHKILTGRREQMSTIRQKDGIHPFPWREESEFDVLSVGHSSTSISAGLGIAVAAERENAGRKTVC-VIGDGAITAGMAFEALNHAGALHTDMLVILNDNEMSISENVGALNNHLARI-FSGSLYSTLRDGSKKILDKVPPIKNFMKKT-----EEHMKGVMFSPESTLFEELGFNYIGPVDGHNIDELVATLTNMRNLK--GPQFLHIKTKKGKGYAPAEKDPIG-FHGVPKFDPISGELPKNNSKPTYSKIFGDWLCEMAEKDAKIIGITPAMREGSGMVEFSQRFPKQYFDVAIAEQHAVTFATGLAIGGYKPVVAIYSTFLQRAYDQLIHDVAIQNLPVLFAIDRAGIVGADGATHQGAFDISFIRCIPNMIIMTPSDENECRQMLYTGYQC-GKPAAVRYPR 478
>gi|138895963|ref|YP_001126416.1| 1-deoxy-D-xylulose-5-phosphate synthase [Geobacillus thermodenitrificans NG80-2] >gi|166198619|sp|A4IQR7|DXS_GEOTN 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|134267476|gb|ABO67671.1| 1-deoxyxylulose-5-phosphate synthase [Geobacillus thermodenitrificans NG80-2] (630 aa)
Score = 822, Expect = 1.3e-85, Identities = 195/605 (32%), Positives = 334/605 (55%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSK--SKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMS-KSVFLTEKILRKILFKK--EWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHS---LKLSDPNLNSNNQ---TYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDI---EVKKEFSFGSWVYALQTKESKTCIISYGDIIN---DLKKEIKTK--SIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKL-SCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           + KI +    K M + +L  L+  +R+ +I+       H+  NLG+VEL++AL   FDSP+D + +D GHQ YVHK++T RA +  T+R+  GLSGF + +ES HD   TGHS   LS   G     + K   + ++P+IGD A++ G+A EALN+I + KT M++I+NDN MSI+ NVGALH I+ + + + K  ++ +++  ++L K+      K+  +  +    L        FFE LGF Y G +DG++ +  +  L+  K +   GP ++HV T KG GY  AE D  G +H     K+         +   ++  + +  + ++   D  I  I PAM + S     + +FP+   DVGIAE+HA T AAG+A    K F++IYSTFLQR+YD ++HDV R  L + F +DR  L  +DG+TH G++DI FL+ +PN ++    ++ E + ++  A +    P  +R+ +     +   E  KE   G+W   +    S   I+++G  I+   +  +++     S+ ++NA F+    +  +  +L +   I  +E+       G  ++  A+++      I+++ I +  I  G+  ++  ++ +    +   IK+
  S:     3 LTKIEHPRVVKTMSIPQLKQLSADIRRFLIEKLSKTGGHIGPNLGVVELTIALHREFDSPKDKLIWDVGHQSYVHKILTGRAAEFDTLRQYKGLSGFPKRSESEHDVWETGHSSTSLSAAMGMAIARDLKGTDEYIVPIIGDGALTGGMALEALNHIGHEKTDMIVILNDNEMSIAPNVGALHNILGRLRTAGKYQWVKDEL--ELLLKRIPAVGGKLAATAERLKDSLKYLLVSGVFFEELGFTYLGPVDGHDFEDLLENLRYAKKVK--GPVLVHVITKKGKGYSPAENDKVGTWHGTGPYKIETGTFVKTKEGGPSWSGLVSETVRRIARTDPRIVAITPAMPVGSKLEGFASEFPDRMFDVGIAEQHATTLAAGLATQGMKPFLAIYSTFLQRAYDQVVHDVCRQNLNVFFAIDRAGLVGADGETHQGVFDIAFLRHVPNLVLMMPKDENEGQHMVYTALRYDDGPIAMRFPRGNGLGVPLDEELKEIPIGTW--EVLRDGSDAVILTFGTTISMALEAAEQLARDGVSVKVVNARFLKPMDEAMLHELLESRLPILTIEEAVLQGGFGSSVLEFAHDHGYHQAVIERMGIPDRFIEHGSVSELLDEIGLTAAHVADRIKT 621
>gi|187921414|ref|YP_001890446.1| deoxyxylulose-5-phosphate synthase [Burkholderia phytofirmans PsJN] >gi|187719852|gb|ACD21075.1| deoxyxylulose-5-phosphate synthase [Burkholderia phytofirmans PsJN] (653 aa)
Score = 822, Expect = 1.5e-85, Identities = 184/457 (40%), Positives = 264/457 (57%)
  Q:    17 FKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAY-NKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKG----KNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELD-----DKGLYHSLKLSDPNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTK 473
            +++   +L  LA  LR  ++D       HLSSNLG VEL++AL YVFD+P+D I +D GHQ Y HK++T R D++ T+R+  G+SGF + +ES +D   T HS   +S   G     K    +++ I VIGD A++ G+AFEA+NN    +  P+L+I+NDN MSIS  VGAL++ +++    +        + ++L       ++   +     KL +  KG       FE  GF+Y G IDG++L   I  L+ IK +   GP  LHV T KG GYK AE D       G ++  +   P    + +TY  V   +L    E D  +  I PAM   S  +   K+FP+ Y DVGIAE+HAVT A G+A    K  V+IYSTFLQR+YD L+HDVA   LP+ F +DR  L  +DG TH G YD+ FL+ IPN  +  AS++ E  +++  A Q + NP  +RY +
  S:    32 LRRLDRRQLQPLADELRAFVLDSVSQTGGHLSSNLGTVELTIALHYVFDTPRDRIVWDVGHQTYPHKILTGRRDQMHTLRQLGGISGFPKRDESEYDTFGTAHSSTSISAALGMAIASKLQGDNRTGIAVIGDGAMTAGMAFEAMNNAGVEDDVPLLVILNDNDMSISPPVGALNRHLARLMSGRFYAAARAGVERVL-------RVAPPMLDLARKLEEHAKGMIVPATLFEEFGFNYIGPIDGHDLDSLIPTLQNIKELR--GPQFLHVVTKKGQGYKLAEADPVLYHGPGKFNPAEGIKPATTPSKKTYTQVFGEWLCDAAELDARVVGITPAMREGSGMVEFEKRFPDRYFDVGIAEQHAVTFAGGLAAEGMKPVVAIYSTFLQRAYDQLIHDVALQNLPVVFAIDRAGLVGADGATHAGAYDLAFLRCIPNMTVMAASDENECRQMLYTALQ-QPNPTAVRYPR 490
>gi|196248854|ref|ZP_03147554.1| deoxyxylulose-5-phosphate synthase [Geobacillus sp. G11MC16] >gi|196211730|gb|EDY06489.1| deoxyxylulose-5-phosphate synthase [Geobacillus sp. G11MC16] (631 aa)
Score = 821, Expect = 1.7e-85, Identities = 195/607 (32%), Positives = 335/607 (55%)
  Q:     6 VKIDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSK--SKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMS-KSVFLTEKILRKILFKK--EWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHS---LKLSDPNLNSNNQ---TYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDI---EVKKEFSFGSWVYALQTKESKTCIISYGDIIN---DLKKEIKTK--SIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKL-SCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           + + KI +    K M + +L  L+  +R+ +I+       H+  NLG+VEL++AL   FDSP+D + +D GHQ YVHK++T RA +  T+R+  GLSGF + +ES HD   TGHS   LS   G     + K   + ++P+IGD A++ G+A EALN+I + KT M++I+NDN MSI+ NVGALH I+ + + + K  ++ +++  ++L K+      K+  +  +    L        FFE LGF Y G +DG++ +  +  L+  K +   GP ++HV T KG GY  AE D  G +H     K+         +   ++  + +  + ++   D  I  I PAM + S     + +FP+   DVGIAE+HA T AAG+A    K F++IYSTFLQR+YD ++HDV R  L + F +DR  L  +DG+TH G++DI FL+ +PN ++    ++ E + ++  A +    P  +R+ +     +   E  KE   G+W   +    S   I+++G  I+   +  +++     S+ ++NA F+    +  +  +L +   I  +E+       G  ++  A+++      I+++ I +  I  G+  ++  ++ +    +   IK+
  S:     2 LDLTKIEHPRVVKTMSIPQLKQLSADIRRFLIEKLSKTGGHIGPNLGVVELTIALHREFDSPKDKLIWDVGHQSYVHKILTGRAAEFDTLRQYKGLSGFPKRSESEHDVWETGHSSTSLSAAMGMAIARDLKGTDEYIVPIIGDGALTGGMALEALNHIGHEKTDMIVILNDNEMSIAPNVGALHNILGRLRTAGKYQWVKDEL--ELLLKRIPAVGGKLAATAERLKDSLKYLLVSGVFFEELGFTYLGPVDGHDFEDLLENLRYAKKVK--GPVLVHVITKKGKGYSPAENDKVGTWHGTGPYKIETGTFVKTKEGGPSWSGLVSETVRRIARTDPRIVAITPAMPVGSKLEGFASEFPDRMFDVGIAEQHATTLAAGLATQGMKPFLAIYSTFLQRAYDQVVHDVCRQNLNVFFAIDRAGLVGADGETHQGVFDIAFLRHVPNLVLMMPKDENEGQHMVYTALRYDDGPIAMRFPRGNGLGVPLDEELKEIPIGTW--EVLRDGSDAVILTFGTTISMALEAAEQLARDGVSVKVVNARFLKPMDEAMLDELLESRLPILTIEEAVLQGGFGSSVLEFAHDHGYHQAVIERMGIPDRFIEHGSVSELLDEIGLTAAHVADRIKT 622
>gi|56420927|ref|YP_148245.1| 1-deoxy-D-xylulose-5-phosphate synthase [Geobacillus kaustophilus HTA426] >gi|81703964|sp|Q75TB7|DXS_GEOKA 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|47076821|dbj|BAD18361.1| 1-deoxy-D-xylulose 5-phosphate synthase [Geobacillus kaustophilus] >gi|56380769|dbj|BAD76677.1| 1-deoxy-D-xylulose 5-phosphate synthase(1-deoxyxylulose-5-phosphate synthase) [Geobacillus kaustophilus HTA426] (628 aa)
Score = 821, Expect = 1.7e-85, Identities = 200/605 (33%), Positives = 331/605 (54%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSK--SKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMS-KSVFLTEKILRKILFKK--EWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHS---LKLSDPNLNSNNQ---TYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDI---EVKKEFSFGSWVYALQTKESKTCIISYGDII-------NDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKL-SCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           + KI +    K M + EL  L+  +R+ +I+       H+  NLG+VEL++AL   FDSP+D + +D GHQ YVHK++T RA    T+R+  GLSGF + +ES HD   TGHS   LS   G     + K   + ++P+IGD A++ G+A EALN+I + KT M++I+NDN MSI+ NVGALH I+ + + + K  ++ +++  ++L K+      K+  +  +    L        FFE LGF Y G +DG++ +     L+  K +   GP ++HV T KG GY  AE D  G +H     K+         +   ++ ++ +  + +L   D  I  I PAM + S     + +FP+   DVGIAE+HA T AAG+A    K F++IYSTFLQR+YD ++HDV R  L + F +DR  L  +DG+TH G++DI FL+ +PN ++    ++ E + ++  A +    P  +R+ +     +   E  KE   G+W   +        I+++G  I       ++L K+    S+ ++NA F+       +  +L +   I  VE+       G  ++  A+++      I+++ I +  I  G+  ++  ++ +    I   IK+
  S:     1 MTKIDHPRVVKNMSIPELKRLSAEIRRFLIEKLSKTGGHIGPNLGVVELTIALHREFDSPKDKLIWDVGHQSYVHKILTGRAAAFDTLRQYKGLSGFPKRSESEHDVWETGHSSTSLSAAMGMAIARDLKGTDEYIVPIIGDGALTGGMALEALNHIGHEKTDMIVILNDNEMSIAPNVGALHNILGRLRTAGKYQWVKDEL--ELLLKRIPAVGGKLAATAERLKDSLKYLLVSGVFFEELGFTYLGPVDGHDFEDLFENLRYAKKMK--GPVLVHVITKKGKGYSPAENDKVGTWHGTGPYKIETGAFVKTKEAGPSWSALVSETVRRLARTDPRIVAITPAMPVGSKLEGFASEFPDRMFDVGIAEQHATTLAAGLATQGMKPFLAIYSTFLQRAYDQVVHDVCRQNLNVFFAIDRAGLVGADGETHQGVFDIAFLRHVPNLVLMMPKDENEGQHMVYTAIRYDDGPIAMRFPRGNGLGVPLDEELKEIPIGTW--EVLRDGCDAAILTFGTTISMALKAADELAKD--GISVKVVNARFLKPMDVAMLHELLESRLPILTVEEAVLQGGFGSAVLEFAHDHGYHGAVIERMGIPDRFIEHGSVSELLNEIGLTSTHIIDRIKT 619
>gi|119945900|ref|YP_943580.1| deoxyxylulose-5-phosphate synthase [Psychromonas ingrahamii 37] >gi|166201532|sp|A1SWW6|DXS_PSYIN 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|119864504|gb|ABM03981.1| 1-Deoxy-D-xylulose-5-phosphate synthase [Psychromonas ingrahamii 37] (622 aa)
Score = 820, Expect = 2.3e-85, Identities = 209/600 (34%), Positives = 328/600 (54%)
  Q:    13 NY-EDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGF--IEKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFL-----TEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLN-----SNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYALQTKESKT-CIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIK----KINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           NY ED + +K  +L      LR  +++     S HL+S LG+VEL++AL Y++ +P D + +D GHQ Y HK++T R DK+ +IR   GL  F    ES +D +S GHS   +    G     +   + + V+ VIGD AI+ G+AFEALN+       ML+++NDN MSIS+NVGAL+  ++K  +S  ++      ++K+L  I   KE +K+       +   L         FE  GF+Y G +DG+N+   ++ L+ +++    GP  LHV T KG GYK+AELD    YH++    P+ +      ++ T+  V  ++L  + + DN +  I PAM   S  ++ SK+  + Y DV IAE+HAVT AAGMAIA     V+IYSTFLQR+YD L+HD+A   L + F +DR  +  +DG TH G++D+ FL+ +PN I+   S++ E   ++   +   + P  +RY +     IE+ K+ S  +   A   KE K   I+ +G  +       +  +  L++  F+    KE +  + ST+K    +E+    N +        NE  +S  IK     I I +  I  G +++I   L +D   I  +I S
  S:    15 NYPEDLRLLKKEQLPAFCNELRSFLLNTVSQTSGHLASGLGVVELTVALHYIYRTPFDNLIFDVGHQAYPHKILTGRRDKMGSIRNFKGLHPFPWREESEYDVLSVGHSSTSIGAALGMSIAAEKEQQGRKVVAVIGDGAITAGMAFEALNHAGSLHNDMLVVLNDNEMSISENVGALNNHLAKI-LSGDIYTQLREGSKKVLSNIPPVKELAKR-------TEEHLKGMISPATIFEEFGFNYIGPMDGHNVIDLVDTLRNMRS--HSGPQFLHVMTKKGKGYKQAELDPIK-YHAVPKFTPDQDLPKSPPSSATFSQVFGDWLNDMADQDNKLTAITPAMREGSGMVSFSKRHADKYYDVAIAEQHAVTLAAGMAIAGLNPVVAIYSTFLQRAYDQLIHDIAIQNLGVLFAIDRAGIVGADGPTHQGVFDLSFLRCVPNMIVMTPSDEQECRNMLYTGHM-LNQPAAVRYPRGTGTGIEINKQMSRLTIGKAKVVKEGKNLAILCFGTFLQQAYSVAEKLNATLVDMRFVKPLDKELLDNLASTHKEFVTIEE----NSIAGGAGSAVNEYFMSQQIKTSVLNIGIPDRFIEQGTQQEIYTLLELDSAGIEKQIVS 616
>gi|91777310|ref|YP_552518.1| 1-deoxy-D-xylulose-5-phosphate synthase [Burkholderia xenovorans LB400] >gi|118595499|sp|Q13RX1|DXS_BURXL 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|91689970|gb|ABE33168.1| 1-Deoxy-D-xylulose-5-phosphate synthase [Burkholderia xenovorans LB400] (635 aa)
Score = 820, Expect = 2.4e-85, Identities = 196/537 (36%), Positives = 293/537 (54%)
  Q:    17 FKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAY-NKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKG----KNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELD-----DKGLYHSLKLSDPNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFS---FGSWVYALQTKE---SKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEK 553
            +++   +L  LA  LR  ++D       HLSSNLG VEL++AL YVFD+P D I +D GHQ Y HK++T R D++ T+R+  G+SGF + +ES +D   T HS   +S   G     K    ++  I VIGD A++ G+AFEA+NN    +  P+L+I+NDN MSIS  VGAL++ +++    +        + ++L       ++   +     KL +  KG       FE  GF+Y G IDG++L   I  L+ IK +   GP  LHV T KG GYK AE D       G ++  +   P    + +TY  V   +L    E D  +  I PAM   S  +   K+FP+ Y DVGIAE+HAVT A G+A    K  V+IYSTFLQR+YD L+HDVA   LP+ F +DR  L  +DG TH G YD+ FL+ IPN  +  AS++ E  +++  A Q + NP  +RY +     +   K+ +    G      +T +    +  I+++G ++       +     + N  F+     + V ++  T+  I  VE+
  S:    14 LRRLDRRQLQPLADELRAFVLDSVSQTGGHLSSNLGTVELTIALHYVFDTPHDRIVWDVGHQTYPHKILTGRRDQMHTLRQLGGISGFPKRDESEYDTFGTAHSSTSISAALGMAVASKLKGDNRMGIAVIGDGAMTAGMAFEAMNNAGVEDDVPLLVILNDNDMSISPPVGALNRHLARLMSGRFYAAARAGVERVL-------RVAPPMLDLARKLEEHAKGMIVPATLFEEFGFNYIGPIDGHDLDSLIPTLQNIKELR--GPQFLHVVTKKGQGYKLAEADPVLYHGPGKFNPAEGIKPAATPSKKTYTQVFGEWLCDAAELDARVIGITPAMREGSGMVEFEKRFPDRYFDVGIAEQHAVTFAGGLAAEGMKPVVAIYSTFLQRAYDQLIHDVALQNLPVVFAIDRAGLVGADGATHAGAYDLAFLRCIPNMTVMAASDENECRQMLYTALQ-QPNPTAVRYPRGAGTGVATIKQMTALPLGKGEIRRETSQPAGKRIAILAFGTMVAPSLAAAEQLDATVANMRFVKPLDADLVRQLAETHDAIVTVEE 558
>gi|118595180|ref|ZP_01552527.1| 1-deoxy-D-xylulose-5-phosphate synthase [Methylophilales bacterium HTCC2181] >gi|118440958|gb|EAV47585.1| 1-deoxy-D-xylulose-5-phosphate synthase [Methylophilales bacterium HTCC2181] (613 aa)
Score = 819, Expect = 2.6e-85, Identities = 217/603 (35%), Positives = 340/603 (56%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIE---KNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGK----NFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDP----NLNSNNQ-TYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKC--EDIEVKKEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEI 610
           ++KI   +D K +   EL  LA  LR+ +I+       HLSSNLG++EL++AL YV+D+P+D + +D GHQ Y HK+IT R  ++ T+R  NGLSGF   +ES++D   TGHS   +S   G  E   K  SK+K+ I +IGD A++ G+AFE LN+       +L+I+NDN MSISKNVGAL+  ++K  +S  V+   K   K +F K         I +   K  +  KG       FE  GF+Y G IDG++L   I+ L+ IK I   GP  LHV T KG GY  A+ DD   +H +   +P    + +SN   TY  V + +L    + + ++  I PAM+  S     +KK+P+ Y DVGIAE+HA+T AAG+A++  K  V+IYSTF+QR+YD L+HD+A   +P+ F +DR  L  +DG TH G +DI F++ IPN I+   SN+ E   ++   Y+  +    +RY +       IE+  +         ++T + K  I+++G II   ++  +  +  LI+  FI    K+ + ++   ++ I  VE+   +   G  ++ + +E+ L      + I +      +++++ K   +D  SI  +I
  S:     4 LEKINYPKDLKNLSRDELKLLADELREFVIESVSKTGGHLSSNLGVIELTVALHYVYDAPKDKLVWDVGHQTYAHKIITGRKHEMHTLRRKNGLSGFPRRSESMYDEFGTGHSSTSISAALGMAEALRKRKSKNKA-IAIIGDGAMTAGMAFEGLNHSGSTDNNILVILNDNDMSISKNVGALNNYLAKL-LSGRVYDGLKRSGKAVFSK------VPPILELARKTEEHMKGMVIPGTLFEEFGFNYIGPIDGHDLDVLIDTLENIKKID--GPQFLHVATKKGFGYAPAQ-DDPNKFHGVGKFNPEDGLSKDSNKSLTYTQVFSLWLMDAAKKNMHLCAITPAMSDGSGLNAFAKKYPSRYYDVGIAEQHALTFAAGLALSGNKPVVAIYSTFMQRAYDQLIHDIAIQNIPMLFAIDRAGLVGADGATHSGNFDISFMRCIPNLILMAPSNESECFHMLSFGYK-YNGVCAVRYPRGNSPGSSIELLNDPIRIGCANKVRTGK-KVAILAFGPIIEVCREVAEEINASLIDMRFIKPIDKKMIKQVCKDHELIVSVEENAITGGAGSSVLEVISESNLLTKTLVLGIPDQFFEHASQQEVLKACGLDKQSIKRKI 607
>gi|167566510|ref|ZP_02359426.1| 1-deoxy-D-xylulose-5-phosphate synthase [Burkholderia oklahomensis EO147] >gi|167573591|ref|ZP_02366465.1| 1-deoxy-D-xylulose-5-phosphate synthase [Burkholderia oklahomensis C6786] (634 aa)
Score = 819, Expect = 2.7e-85, Identities = 198/546 (36%), Positives = 295/546 (54%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNK-TPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKG----KNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELD-----DKGLYHSLKLSDPNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFS---FGSWVYALQTKE---SKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEK 553
           +  I +  D +++   +L  LA  LR  ++D       HLSSNLG VEL++AL YVFD+P D I +D GHQ Y HK++T R D++ T+R+ +G+SGF   +ES +D   T HS   +S   G     K     +  I VIGD A++ G+AFEA+NN   ++   +L+I+NDN MSIS  VGAL++ +++    +        + ++L        +   + +   KL +  KG       FE  GF+Y G IDG++L   I  L+ IK +   GP  LHV T KG GYK AE D       G ++  +   P+     +TY  V   +L    E D+ +  I PAM   S  +   K+FP  Y DVGIAE+HAVT A G+A    K  V+IYSTFLQR+YD L+HDVA   LP+ F +DR  L  +DG TH G YD+ FL+ IPN  +  AS++ E  +++  A Q + NP  +RY +     +   K F+    G      +T +    +  I+++G ++       +     + N  F+     E V  +  T+  +  VE+
  S:     5 LKTIDDPADLRRLDRRQLQPLADELRAFVLDSVSKTGGHLSSNLGTVELTIALHYVFDTPDDRIVWDVGHQTYPHKILTGRRDEMKTLRQLDGISGFPRRSESEYDTFGTAHSSTSISAALGMAIGSKLKGDDRFSIAVIGDGAMTAGMAFEAMNNAGVSEDAKLLVILNDNDMSISPPVGALNRHLARLMSGRFYAAARAGVERVL-------SVAPPMLELARKLEEHAKGMVVPATLFEEFGFNYIGPIDGHDLDSLIPTLQNIKELR--GPQFLHVVTKKGQGYKLAEADPVLYHGPGKFNPAEGIKPSTTPAKKTYTQVFGEWLCDAAELDSRVVGITPAMREGSGMVEFEKRFPERYYDVGIAEQHAVTFAGGLATEGLKPVVAIYSTFLQRAYDQLIHDVALQNLPVVFAIDRAGLVGADGATHAGAYDLSFLRCIPNMTVMAASDENECRQMLHTALQ-QPNPTAVRYPRGAGTGVATVKAFTEIPLGKGEVRRRTSQPEGKRVAILAFGTMVAPSLAAAEALDATVANMRFVKPIDAELVQELAQTHDYLVTVEE 558
>gi|68250029|ref|YP_249141.1| 1-deoxy-D-xylulose-5-phosphate synthase [Haemophilus influenzae 86-028NP] >gi|81335547|sp|Q4QKG6|DXS_HAEI8 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|68058228|gb|AAX88481.1| 1-deoxy-D-xylulose 5-phosphate synthase [Haemophilus influenzae 86-028NP] (625 aa)
Score = 819, Expect = 2.7e-85, Identities = 191/459 (41%), Positives = 273/459 (59%)
  Q:    15 EDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI---EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLT-----EKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDP---NLNSNNQ--TYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTK 473
           ED + +   +L  L   LR  +++     S HL+S LG VEL++AL YV+ +P D + +D GHQ Y HK++T R +++STIR+ +G+  F    ES  D +S GHS   +S   G     E+ N+  K+V  VIGD AI+ G+AFEALN+     T ML+I+NDN MSIS+NVGAL+  +++   S S++ T     +KIL K+   K + KK      +   K   F      FE LGF+Y G +DG+N+ + + +L  ++N+   GP  LH+KT KG GY  AE D  G +H +   DP    L  NN   TY  +  ++L ++ E D  I  I PAM   S  +  S++FP  Y DV IAE+H VT A G+AI   K  V+IYSTFLQR+YD L+HDVA   LP+ F +DR  +  +DG TH G +DI F++ IPN II   S++ E  +++   YQ    P  +RY +
  S:    18 EDLRLLNKDQLPQLCQELRAYLLESVSQTSGHLASGLGTVELTVALHYVYKTPFDQLIWDVGHQAYPHKILTGRREQMSTIRQKDGIHPFPWREESEFDVLSVGHSSTSISAGLGIAVAAERENAGRKTVC-VIGDGAITAGMAFEALNHAGALHTDMLVILNDNEMSISENVGALNNHLARI-FSGSLYSTLRDGSKKILDKVPPIKNFMKKT-----EEHMKGVMFSPESTLFEELGFNYIGPVDGHNIDELVAMLTNMRNLK--GPQFLHIKTKKGKGYAPAEKDPIG-FHGVPKFDPISGELPKNNSKPTYSKIFGDWLCEMAEKDAKIIGITPAMREGSGMVEFSQRFPKQYFDVAIAEQHTVTFATGLAIGGYKPVVAIYSTFLQRAYDQLIHDVAIQNLPVLFAIDRAGIVGADGATHQGAFDISFMRCIPNMIIMTPSDENECRQMLYTGYQC-GKPAAVRYPR 478
>gi|148826942|ref|YP_001291695.1| 1-deoxy-D-xylulose-5-phosphate synthase [Haemophilus influenzae PittGG] >gi|166198621|sp|A5UEV6|DXS_HAEIG 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|148718184|gb|ABQ99311.1| 1-deoxy-D-xylulose-5-phosphate synthase [Haemophilus influenzae PittGG] (625 aa)
Score = 819, Expect = 2.7e-85, Identities = 191/459 (41%), Positives = 272/459 (59%)
  Q:    15 EDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI---EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLT-----EKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDP---NLNSNNQ--TYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTK 473
           ED + +   +L  L   LR  +++     S HL+S LG VEL++AL YV+ +P D + +D GHQ Y HK++T R +++STIR+  G+  F    ES  D +S GHS   +S   G     E+ N+  K+V  VIGD +I+ G+AFEALN+     T ML+I+NDN MSIS+NVGAL+  +++   S S++ T     +KIL K+   K + KK      +   K   F      FE LGF+Y G +DG+N+ + +  L  ++N+   GP  LH+KT KG GY  AE D  G +H +   DP    L  NN   TY  +  ++L ++ E D  I  I PAM   S  +  S++FP  Y DV IAE+HAVT A G+AI   K  V+IYSTFLQR+YD L+HDVA   LP+ F +DR  +  +DG TH G +DI F++ IPN II   S++ E  +++   YQ    P  +RY +
  S:    18 EDLRLLNKDQLPQLCQELRAYLLESVSQTSGHLASGLGTVELTVALHYVYKTPFDQLIWDVGHQAYPHKILTGRREQMSTIRQKGGIHPFPWREESEFDVLSVGHSSTSISAGLGIAVAAERENASRKTVC-VIGDGSITAGMAFEALNHAGALHTDMLVILNDNEMSISENVGALNNHLARI-FSGSLYSTLRDGSKKILDKVPPIKNFMKKT-----EEHMKGVMFSPESTLFEELGFNYIGPVDGHNIDELVATLTNMRNLK--GPQFLHIKTKKGKGYAPAEKDPIG-FHGVPKFDPISGELPKNNSKPTYSKIFGDWLCEMAEKDAKIIGITPAMREGSGMVEFSQRFPKQYFDVAIAEQHAVTFATGLAIGGYKPVVAIYSTFLQRAYDQLIHDVAIQNLPVLFAIDRAGIVGADGATHQGAFDISFMRCIPNMIIMTPSDENECRQMLYTGYQC-GKPAAVRYPR 478
>gi|67906635|gb|AAY82730.1| predicted 1-deoxy-d-xylulose-5-phosphate synthase [uncultured bacterium eBACmed86H08] (635 aa)
Score = 819, Expect = 2.7e-85, Identities = 209/522 (40%), Positives = 308/522 (59%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKN--NSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKIL--FKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNSNNQ--------TYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKE-----KCEDIEVKKEFSFGSWVYALQTKESK-TCIISYGDIINDLKK-----EIKTKSIDLINAVF 529
           +D +    D K  K  EL+ L+  LR+++I+       HL + LG++EL++AL YVFD+P D I +D GHQ Y HK++T R ++I T+R+ +GLSGF + +ES +D     HS   +S   G    N  + KS++V+ VIGD AIS G+A+EA+NN   +KT M++I+NDN MSI++ VGA+   ++K    K  F   +  + I+  F K +SKK      K+   L     G   F SLGF+Y G IDG+++   ++VLK  K+    GP ++HVKT KG GY+ AE + K  YH +  S  N+ +  Q        +Y SV AN L K  E D+ I  I  AM   +     +KKFPN   DVGIAE+HAVT +AG+A    K + +IYSTFLQR+YD ++HDVA   LP+ F +DR  L  +DG TH G +DI +L ++PN ++   S++ EL ++I  +      P   RY +      K  +I  K E   G  +     KE K   +I++G  + + +K     E K  ++ LI+A F
  S:     7 LDNVNFPSDIKNFKSSELIALSKELREELIEAVSFTGGHLGAGLGVIELTVALHYVFDTPNDKIVWDVGHQSYPHKILTGRKNRIKTLRQGDGLSGFTKRSESEYDPFGAAHSSTSISAALGIATANKLSKKSENVVAVIGDGAISAGMAYEAMNNAGTSKTKMIVILNDNDMSIAEPVGAMRSYLAKLLTGKIYFSLRETFKLIISAFSKRFSKKAG----KAEDFLRSAVTGGTLFNSLGFYYVGPIDGHDIDTLVSVLKNAKDTNFEGPIMIHVKTEKGKGYQFAE-NSKDKYHGV--SKFNVQTGVQEKSSSKIPSYTSVFANTLIKHAERDSKIIGITAAMPSGTGMDLFAKKFPNRMFDVGIAEQHAVTFSAGLATEGYKPYAAIYSTFLQRAYDQVVHDVAIQSLPVRFAIDRAGLVGADGPTHAGSFDITYLSTLPNFVVMAPSDESELVKMINTSVDINDKPSAFRYPRGTGIGIKLPEINEKIEIGKGRVI-----KEGKEIALINFGARLQECQKALNNLEKKGLNLTLIDARF 539
>gi|167577163|ref|ZP_02370037.1| 1-deoxy-D-xylulose-5-phosphate synthase [Burkholderia thailandensis TXDOH] (634 aa)
Score = 819, Expect = 2.8e-85, Identities = 198/546 (36%), Positives = 293/546 (53%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNK-TPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKG----KNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELD-----DKGLYHSLKLSDPNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFS---FGSWVYALQTKE---SKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEK 553
           +  I +  D +++   +L  LA  LR  ++D       HLSSNLG VEL++AL YVF++P D I +D GHQ Y HK++T R D + T+R+ +G+SGF   +ES +D   T HS   +S   G     K N   +  I VIGD A++ G+AFEA+NN   ++   +L+I+NDN MSIS  VGAL++ +++    +        + ++L        +   + +   KL +  KG       FE  GF+Y G IDG++L   I  L+ IK +   GP  LHV T KG GYK AE D       G ++  +   P+     +TY  V   +L    E D  +  I PAM   S  +   K+FP  Y DVGIAE+HAVT A G+A    K  V+IYSTFLQR+YD L+HDVA   LP+ F +DR  L  +DG TH G YD+ FL+ IPN  +  AS++ E  +++  A Q + NP  +RY +     +   K F+    G      +T +    +  I+++G ++             + N  F+     E V  +  T+  +  VE+
  S:     5 LKTIDDPADLRRLDRRQLQPLADELRAFVLDSVSKTGGHLSSNLGTVELTIALHYVFNTPDDRIVWDVGHQTYPHKILTGRRDGMKTLRQFDGISGFPRRSESEYDTFGTAHSSTSISAALGMAIGSKLNGDDRFSIAVIGDGAMTAGMAFEAMNNAGVSEDAKLLVILNDNDMSISPPVGALNRHLARLMSGRFYAAARAGVERVL-------SVAPPVLELARKLEEHAKGMVVPATLFEEFGFNYIGPIDGHDLDSLIPTLQNIKELR--GPQFLHVVTKKGQGYKLAEADPVLYHGPGKFNPAEGIKPSATPAKKTYTQVFGEWLCDAAELDARVVGITPAMREGSGMVEFEKRFPERYYDVGIAEQHAVTFAGGLATEGLKPVVAIYSTFLQRAYDQLIHDVALQNLPVVFAIDRAGLVGADGATHAGAYDLAFLRCIPNMTVMAASDENECRQMLHTALQ-QPNPTAVRYPRGAGTGVATVKAFTEIPLGKGEVRRRTSQPDGKRVAILAFGTMVAPSLAAADALDATVANMRFVKPIDAELVRELAQTHDYLVTVEE 558
>gi|83717976|ref|YP_438814.1| 1-deoxy-D-xylulose-5-phosphate synthase [Burkholderia thailandensis E264] >gi|167615333|ref|ZP_02383968.1| 1-deoxy-D-xylulose-5-phosphate synthase [Burkholderia thailandensis Bt4] >gi|118595498|sp|Q2T7N5|DXS_BURTA 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|83651801|gb|ABC35865.1| 1-deoxy-D-xylulose-5-phosphate synthase [Burkholderia thailandensis E264] (634 aa)
Score = 819, Expect = 2.8e-85, Identities = 198/546 (36%), Positives = 293/546 (53%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNK-TPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKG----KNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELD-----DKGLYHSLKLSDPNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFS---FGSWVYALQTKE---SKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEK 553
           +  I +  D +++   +L  LA  LR  ++D       HLSSNLG VEL++AL YVF++P D I +D GHQ Y HK++T R D + T+R+ +G+SGF   +ES +D   T HS   +S   G     K N   +  I VIGD A++ G+AFEA+NN   ++   +L+I+NDN MSIS  VGAL++ +++    +        + ++L        +   + +   KL +  KG       FE  GF+Y G IDG++L   I  L+ IK +   GP  LHV T KG GYK AE D       G ++  +   P+     +TY  V   +L    E D  +  I PAM   S  +   K+FP  Y DVGIAE+HAVT A G+A    K  V+IYSTFLQR+YD L+HDVA   LP+ F +DR  L  +DG TH G YD+ FL+ IPN  +  AS++ E  +++  A Q + NP  +RY +     +   K F+    G      +T +    +  I+++G ++             + N  F+     E V  +  T+  +  VE+
  S:     5 LKTIDDPADLRRLDRRQLQPLADELRAFVLDSVSKTGGHLSSNLGTVELTIALHYVFNTPDDRIVWDVGHQTYPHKILTGRRDGMKTLRQFDGISGFPRRSESEYDTFGTAHSSTSISAALGMAIGSKLNGDDRFSIAVIGDGAMTAGMAFEAMNNAGVSEDAKLLVILNDNDMSISPPVGALNRHLARLMSGRFYAAARAGVERVL-------SVAPPVLELARKLEEHAKGMVVPATLFEEFGFNYIGPIDGHDLDSLIPTLQNIKELR--GPQFLHVVTKKGQGYKLAEADPVLYHGPGKFNPAEGIKPSATPAKKTYTQVFGEWLCDAAELDARVVGITPAMREGSGMVEFEKRFPERYYDVGIAEQHAVTFAGGLATEGLKPVVAIYSTFLQRAYDQLIHDVALQNLPVVFAIDRAGLVGADGATHAGAYDLAFLRCIPNMTVMAASDENECRQMLHTALQ-QPNPTAVRYPRGAGTGVATVKAFTEIPLGKGEVRRRTSQPDGKRVAILAFGTMVAPSLAAADALDATVANMRFVKPIDAELVRELAQTHDYLVTVEE 558
>gi|167627944|ref|YP_001678444.1| 1-deoxy-D-xylulose-5-phosphate synthase [Francisella philomiragia subsp. philomiragia ATCC 25017] >gi|189027775|sp|B0U0B3|DXS_FRAP2 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|167597945|gb|ABZ87943.1| 1-deoxyxylulose-5-phosphate synthase [Francisella philomiragia subsp. philomiragia ATCC 25017] (618 aa)
Score = 819, Expect = 3.0e-85, Identities = 208/599 (34%), Positives = 328/599 (54%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLT-----EKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNN---LKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYH---SLKLSDPNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDL--IILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSI 606
           +DKI    D K +   +L +LA  LR  ++D  +    H +S+LG  EL++AL YVF++P D I +D GHQ Y+HK++T R DK+ TI++  G+SGF + +ES +D    GHS   +S   G    ++   K  S I VIGD AI+ G+AFEALN+    K  +L+I+NDN MSIS NVG L    SK  +S   + +     +++L+ I    E+ KKI        ++    F   NFFE LGF+Y G IDG+N   L KT+ +LK  K     GP +LHV T KG GY +AE D    +H   S    D    ++  TY ++  N++ +    D  +  + PAM   S+ +  S+++PN Y DV IAE+HAVT A G+A    K  V+IYSTFLQR+YD ++HD+A  +L + + VDR  L  +DG TH G +DI F++ IPN +I   S++ E   ++ L Y+ K  P  +RY +      E+            L  K S+  I+++G ++    +      I +++  F+    ++ + +I   +  ++ +E+   +   G  +   I AN+   +  ++   +++  +  G K+ +    N+  N I
  S:     7 LDKINTPSDLKLVPEGQLKELASELRTFLVDTLDVSGGHFASSLGATELTVALHYVFNTPYDNIVWDVGHQTYIHKILTGRKDKLITIKKDGGISGFPKRSESEYDTFGVGHSSTSISAALGMAIADRLQGKHSSSIAVIGDGAITGGMAFEALNHAGGIKEDILVILNDNEMSISDNVGGLSAHFSKI-ISGGFYNSIREKGKEVLKNIPPMFEFVKKIE-------TQTKGMFVPANFFEDLGFYYVGPIDGHNVVELVKTLRILKDHK-----GPKLLHVITKKGKGYTKAESDPIKFHHVAPSFHSGDAQSKASKPTYSNIFGNWICQKAAKDKRLVGVTPAMKEGSDLIRFSQQYPNRYFDVAIAEQHAVTFAGGLACQGLKPVVAIYSTFLQRAYDQVIHDIALQDLDVLYAVDRAGLVGADGATHDGSFDISFMRCIPNHVIMTPSDENETYHMLELGYEYKG-PAMVRYPRGAGIGAEITDNLDIKLGKAKLVKKGSRVAILNFGTLLPLANQLADKYHITVVDMRFVKPLDEQMINQICQNHNIVFTLEESSIAGGAGSAVNEYIFANDLSKNITVRNFGLKDEFLTHGTKDLLLDYSNLSFNKI 606
>gi|149191098|ref|ZP_01869357.1| 1-deoxy-D-xylulose-5-phosphate synthase [Vibrio shilonii AK1] >gi|148835026|gb|EDL52004.1| 1-deoxy-D-xylulose-5-phosphate synthase [Vibrio shilonii AK1] (621 aa)
Score = 818, Expect = 3.4e-85, Identities = 199/597 (33%), Positives = 326/597 (54%)
  Q:    15 EDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLT-----EKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPN------LNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYALQTKE-SKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIK 611
           E+ + M    L  L   LR  +++     S HL+S LG VEL++AL YV+++P D + +D GHQ Y HK++T R +K+STIR+ +GL  F    ES +D +S GHS   +S   G         K + V+ VIGD AI+ G+AFEALN+       ML+I+NDN MSIS+NVGAL+  +++  +S S++ +     +K L  +   KE        + ++   L         FE LGF+Y G +DG+++ + +  LK ++ +   GP  LH+ T KG GY+ AE D  G YH +   DP+       +S+  TY  +  +FL  +   D ++  I PAM   S  +  SK++P+ Y DV IAE+HAVT A GMAIA  +  V+IYSTFLQR YD L+HDVA ++LP+ F +DR  L  +DG TH G +D+ F++ IPN +I   S++ E  +++   + + + P  +RY +        + EF+          +E  K  I+S+G  +++     +  +  + +  F+    +  +  + +++  I  +E+   +   G  +I      KL   +  + + +  +  G ++++  +L +D   I   I+
  S:    18 EELRLMPKESLPKLCEELRTYLLNSVSQSSGHLASGLGTVELTVALHYVYNTPFDQLIWDVGHQAYPHKILTGRREKMSTIRQKDGLHPFPWREESEYDVLSVGHSSTSISAGLGIAISAAKEGKDRKVVSVIGDGAITAGMAFEALNHAGDVHPDMLVILNDNEMSISENVGALNNHLAQV-LSGSLYTSIREGGKKALSGLPPIKEL-------VRRTEEHLKGMIVPGTLFEELGFNYIGPVDGHDVNELVKTLKNMRELK--GPQFLHIMTKKGKGYEPAEKDPIG-YHGVPKFDPSHSCLPKSSSSKPTYSKIFGDFLCDMAAKDPSLMAITPAMREGSGMVRFSKEYPSQYFDVAIAEQHAVTLATGMAIAGNRPIVAIYSTFLQRGYDQLIHDVAIMDLPVMFAIDRAGLVGADGQTHQGAFDLSFMRCIPNMVIMAPSDENECRQMLYTGHMH-NGPSAVRYPRGGGNGTTPEAEFTALEIGKGRIVREGEKVAILSFGTFLDNALIAAENINATVADMRFVKPLDEALIRELCNSHDVIVTLEENAIAGGAGAGVIEFMMSEKLMKPVLNLGLPDRFVAQGTQDELHAELGLDAVGIEKSIR 616
>gi|194016733|ref|ZP_03055346.1| 1-deoxy-D-xylulose-5-phosphate synthase [Bacillus pumilus ATCC 7061] >gi|194011339|gb|EDW20908.1| 1-deoxy-D-xylulose-5-phosphate synthase [Bacillus pumilus ATCC 7061] (633 aa)
Score = 818, Expect = 3.7e-85, Identities = 200/581 (34%), Positives = 320/581 (55%)
  Q:    11 IPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSK--SKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMS-KSVFLTEKILRKILFKK--EWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHS---LKLSDPNL---NSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVK---KEFSFGSWVYALQTKESKTCIISYGDIIN-------DLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLS-CNIKKINIRNNKIGFGN 591
           I N    K M   EL +L+  +R  +I+   N   H+  NLG+VEL++AL  VFDSP+D   +D GHQ YVHK++T R  +  T+R+  GL GF + NES HD   TGHS   LS   G     + K   + ++P+IGD A++ G+A EALN+I   K  M++I+NDN MSI+ NVGA+H ++ + + + K  ++ +++  + LFK+      K+  +  +    L        FFE +GF Y G +DG++ +     L+  K     GP +LHV T KG GY+ AE D  G +H     K+   +     +   ++  + +  + KL   D  I  I PAM + S     +K+FP    DVGIAE+HA T AAG+A  + K F++IYSTFLQR+YD +LHD+ R  L +   +DR  L  +DG+TH G++DI F++ +PN ++    ++ E + ++  A Q    P  +R+ +     +++    K    GSW      K++   I+++G  I        +L+KE   KS+ ++NA FI    +  +  I S    I  +E+       G  ++   ++ K S   ++++ I +  I  G+
  S:     6 IKNPTFLKGMSNAELEELSADIRMFLIESLANSGGHIGPNLGVVELTVALHKVFDSPKDKFLWDVGHQSYVHKLLTGRGAEFDTLRQYKGLCGFPKRNESEHDVWETGHSSTSLSGAMGMAAARDIKGTDEYILPIIGDGALTGGMALEALNHIGDEKKDMIVILNDNEMSIAPNVGAIHTMLGRLRTAGKYQWVKDEL--EYLFKRIPAVGGKLAATAERIKDSLKYLLVSGMFFEEMGFTYLGPVDGHSYEDLFENLEYAKKTK--GPVLLHVITKKGKGYQPAESDKIGTWHGTGPYKIDTGDFVKPAAAAPSWSGLVSETVRKLAREDERIVAITPAMPVGSKLEGFAKEFPERMFDVGIAEQHAATMAAGLATQDMKPFLAIYSTFLQRAYDQVLHDICRQNLNVFIGIDRAGLVGADGETHQGVFDIAFMRHMPNMVLMMPKDENEGQHMVNTAIQYDDGPIAMRFPRGNGLGVKMDDQLKTIPIGSWEVLRPGKDA--VILTFGTTIKMALQAAEELQKE--GKSVRVVNARFIKPLDEAMLNDIFSEGIPILTIEEAVLQGGFGSSVLEYIHDKKASHIKVERMGIPDEFIEHGS 600
>gi|83648506|ref|YP_436941.1| 1-deoxy-D-xylulose-5-phosphate synthase [Hahella chejuensis KCTC 2396] >gi|118595584|sp|Q2SA08|DXS_HAHCH 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|83636549|gb|ABC32516.1| 1-deoxy-D-xylulose-5-phosphate synthase [Hahella chejuensis KCTC 2396] (643 aa)
Score = 817, Expect = 4.5e-85, Identities = 203/610 (33%), Positives = 326/610 (53%)
  Q:     2 KKNKVKIDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGK----NFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSL-------KLSDPNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEK---------CEDIEVKKEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCL----GDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIK 611
           + N   +DKI +    + +   ELL LA  LR  ++        H  + LG+VEL++AL Y F++P+D + +D GHQ Y HK++T R +++ TIR+ +GL+ F    ES +D    GHS   +S   G     +  ++ +  I VIGD A++ G+AFEALN+ A  K  +L+I+NDN MSIS+NVG L    ++   SK+        +++L           S+ +   K  + FKG       FE LGF+Y G IDG++L + +  L  IK +   GP  LHV T KG G+  AE D  G YH++       K+ D         Y ++   +L  + E D ++  I PAM   S+ +  SK+FP  Y DV IAE+HAVT AAG+A    K  V+IYSTFLQR+YD L+HDVA   L + F +DR  L   DG TH G +D+ FL+ IPN +I   S++ E  +++   YQ  + P  +RY +            E +E+ K          L+ + ++T I+++G ++       +  +  +++  FI    +  +L +  ++  +  +E+    NC+    G  +I       ++  + ++ + +  I  G   ++ K++ +D   I   IK
  S:    14 RPNTPLLDKIDSPAQLRLLNEAELLQLAHELRAFLLYSVGQSGGHFGAGLGVVELTVALHYAFNTPEDRLVWDVGHQAYPHKILTGRREQMLTIRQKDGLAAFPRREESPYDTFGVGHSSTSISAALGMAIAARLQNQPRKAIAVIGDGAMTAGMAFEALNHAADTKADLLVILNDNDMSISRNVGGLSNYFARLLASKTYNQMRDSGKRVLQGAP-------SLMELARKTEEHFKGMVAPGTLFEELGFNYIGPIDGHDLPRLVETLNNIKELN--GPQFLHVVTKKGKGFAHAESDPIG-YHAINKIEPKPKVQDTAKAPKKPRYSNIFGQWLCDMAEQDASLVGITPAMCEGSDLIEFSKRFPERYYDVAIAEQHAVTLAAGLACDGAKPVVAIYSTFLQRAYDQLIHDVAIQNLDVLFAIDRAGLVGEDGPTHAGSFDLTFLRCIPNMLIMAPSDEDETRKMLTTGYQ-YTGPAAVRYPRGNGPGADISPGLESLEIGKA--------NLRRRGAQTVILNFGALLPAALGVAEESNFTVVDMRFIKPLDQNMILEMAGSHDLLVTLEE----NCILGGAGSGVIEFLASQGIAMPVLQLGLPDEFIEHGKPAELHKEVGLDAQGIANAIK 626
>gi|53732746|ref|ZP_00155015.2| COG1154: Deoxyxylulose-5-phosphate synthase [Haemophilus influenzae R2846] (625 aa)
Score = 817, Expect = 5.1e-85, Identities = 190/459 (41%), Positives = 273/459 (59%)
  Q:    15 EDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI---EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLT-----EKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDP---NLNSNNQ--TYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTK 473
           ED + +   +L  L   LR  +++     S HL+S LG VEL++AL YV+ +P D + +D GHQ Y HK++T R +++STIR+  G+  F    ES  D +S GHS   +S   G     E+ N+  K+V  VIGD +I+ G+AFEALN+     T ML+I+NDN MSIS+NVGAL+  +++   S S++ T     +KIL K+   K + KK      +   K   F      FE LGF+Y G +DG+N+++ +  L  ++N+   GP  LH+KT KG GY  AE D  G +H +   DP    L  NN   TY  +  ++L ++ E D  I  I PAM   S  +  S++FP  Y DV IAE+HAVT A G+AI   K  V+IYSTFLQR+YD L+HDVA   LP+ F +DR  +  +DG TH G +D+ F++ IPN II   S++ E  +++   YQ    P  +RY +
  S:    18 EDLRLLNKDQLPQLCQELRAYLLESVSQTSGHLASGLGTVELTVALHYVYKTPFDQLIWDVGHQAYPHKILTGRREQMSTIRQKGGIHPFPWREESEFDVLSVGHSSTSISAGLGIAVAAERENASRKTVC-VIGDGSITAGMAFEALNHAGALHTDMLVILNDNEMSISENVGALNNHLARI-FSGSLYSTLRDGSKKILDKVPPIKNFMKKT-----EEHMKGVMFSPESTLFEELGFNYIGPVDGHNIEELVATLTNMRNLK--GPQFLHIKTKKGKGYAPAEKDPIG-FHGVPKFDPISGELPKNNSKPTYSKIFGDWLCEMAEKDAKIIGITPAMREGSGMVEFSQRFPKQYFDVAIAEQHAVTFATGLAIGGYKPVVAIYSTFLQRAYDQLIHDVAIQNLPVLFAIDRAGIVGADGATHQGAFDLSFMRCIPNMIIMTPSDENECRQMLYTGYQC-GKPAAVRYPR 478
>gi|121596455|ref|YP_991107.1| 1-deoxy-D-xylulose-5-phosphate synthase [Burkholderia mallei SAVP1] >gi|124381982|ref|YP_001025505.1| 1-deoxy-D-xylulose-5-phosphate synthase [Burkholderia mallei NCTC 10229] >gi|126445825|ref|YP_001077568.1| 1-deoxy-D-xylulose-5-phosphate synthase [Burkholderia mallei NCTC 10247] >gi|194314495|ref|YP_002010515.1| 1-deoxy-D-xylulose-5-phosphate synthase [Burkholderia mallei ATCC 10399] >gi|194522110|ref|YP_002057644.1| 1-deoxy-D-xylulose-5-phosphate synthase [Burkholderia mallei FMH] >gi|194574352|ref|YP_002109237.1| 1-deoxy-D-xylulose-5-phosphate synthase [Burkholderia mallei 2002721280] >gi|121224253|gb|ABM47784.1| 1-deoxy-D-xylulose-5-phosphate synthase [Burkholderia mallei SAVP1] >gi|124290002|gb|ABM99271.1| 1-deoxy-D-xylulose-5-phosphate synthase [Burkholderia mallei NCTC 10229] >gi|126238679|gb|ABO01791.1| 1-deoxy-D-xylulose-5-phosphate synthase [Burkholderia mallei NCTC 10247] >gi|147746120|gb|EDK53198.1| 1-deoxy-D-xylulose-5-phosphate synthase [Burkholderia mallei FMH] >gi|148028591|gb|EDK86551.1| 1-deoxy-D-xylulose-5-phosphate synthase [Burkholderia mallei 2002721280] >gi|160698293|gb|EDP88263.1| 1-deoxy-D-xylulose-5-phosphate synthase [Burkholderia mallei ATCC 10399] (651 aa)
Score = 817, Expect = 5.5e-85, Identities = 198/546 (36%), Positives = 293/546 (53%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNK-TPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKG----KNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELD-----DKGLYHSLKLSDPNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFS---FGSWVYALQTKE---SKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEK 553
           +  I +  D +++   +L  LA  LR  ++D       HLSSNLG VEL++AL YVF++P D I +D GHQ Y HK++T R D + T+R+ +G+SGF   +ES +D   T HS   +S   G     K N   +  I VIGD A++ G+AFEA+NN   ++   +L+I+NDN MSIS  VGAL++ +++    +        + ++L        +   + +   KL +  KG       FE  GF+Y G IDG++L   I  L+ IK +   GP  LHV T KG GYK AE D       G ++  +   P+     +TY  V   +L    E D  +  I PAM   S  +   K+FP  Y DVGIAE+HAVT A G+A    K  V+IYSTFLQR+YD L+HDVA   LP+ F +DR  L  +DG TH G YD+ FL+ IPN  +  AS++ E  +++  A Q + NP  +RY +     +   K F+    G      +T +    +  I+++G ++             + N  F+     E V  +  T+  +  VE+
  S:    22 LKTIDDPADLRRLDRRQLQPLADELRAFVLDSVSKTGGHLSSNLGTVELTIALHYVFNTPDDRIVWDVGHQTYPHKILTGRRDGMKTLRQFDGISGFPRRSESEYDTFGTAHSSTSISAALGMAIGSKLNGDDRFSIAVIGDGAMTAGMAFEAMNNAGVSEDAKLLVILNDNDMSISPPVGALNRHLARLMSGRFYAAARAGVERVL-------SVAPPVLELARKLEEHAKGMVVPATLFEEFGFNYIGPIDGHDLDSLIPTLQNIKELR--GPQFLHVVTKKGQGYKLAEADPVLYHGPGKFNPAEGIKPSTTPAKKTYTQVFGEWLCDAAELDARVVGITPAMREGSGMVEFEKRFPERYYDVGIAEQHAVTFAGGLATEGLKPVVAIYSTFLQRAYDQLIHDVALQNLPVVFAIDRAGLVGADGATHAGAYDLAFLRCIPNMTVMAASDENECRQMLHTALQ-QPNPTAVRYPRGAGTGVATVKAFTEIPLGKGEVRRRTSQPDGKRIAILAFGTMVAPSLAAADALDATVANMRFVKPIDAELVQALARTHDYLVTVEE 575
>gi|167724591|ref|ZP_02407827.1| 1-deoxy-D-xylulose-5-phosphate synthase [Burkholderia pseudomallei DM98] >gi|167743542|ref|ZP_02416316.1| 1-deoxy-D-xylulose-5-phosphate synthase [Burkholderia pseudomallei 14] >gi|167899159|ref|ZP_02486560.1| 1-deoxy-D-xylulose-5-phosphate synthase [Burkholderia pseudomallei 7894] >gi|167923680|ref|ZP_02510771.1| 1-deoxy-D-xylulose-5-phosphate synthase [Burkholderia pseudomallei BCC215] >gi|194501307|ref|YP_002030887.1| 1-deoxy-D-xylulose-5-phosphate synthase [Burkholderia pseudomallei 1655] >gi|184215516|gb|EDU12497.1| 1-deoxy-D-xylulose-5-phosphate synthase [Burkholderia pseudomallei 1655] (634 aa)
Score = 817, Expect = 5.6e-85, Identities = 198/546 (36%), Positives = 293/546 (53%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNK-TPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKG----KNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELD-----DKGLYHSLKLSDPNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFS---FGSWVYALQTKE---SKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEK 553
           +  I +  D +++   +L  LA  LR  ++D       HLSSNLG VEL++AL YVF++P D I +D GHQ Y HK++T R D + T+R+ +G+SGF   +ES +D   T HS   +S   G     K N   +  I VIGD A++ G+AFEA+NN   ++   +L+I+NDN MSIS  VGAL++ +++    +        + ++L        +   + +   KL +  KG       FE  GF+Y G IDG++L   I  L+ IK +   GP  LHV T KG GYK AE D       G ++  +   P+     +TY  V   +L    E D  +  I PAM   S  +   K+FP  Y DVGIAE+HAVT A G+A    K  V+IYSTFLQR+YD L+HDVA   LP+ F +DR  L  +DG TH G YD+ FL+ IPN  +  AS++ E  +++  A Q + NP  +RY +     +   K F+    G      +T +    +  I+++G ++             + N  F+     E V  +  T+  +  VE+
  S:     5 LKTIDDPADLRRLDRRQLQPLADELRAFVLDSVSKTGGHLSSNLGTVELTIALHYVFNTPDDRIVWDVGHQTYPHKILTGRRDGMKTLRQFDGISGFPRRSESEYDTFGTAHSSTSISAALGMAIGSKLNGDDRFSIAVIGDGAMTAGMAFEAMNNAGVSEDAKLLVILNDNDMSISPPVGALNRHLARLMSGRFYAAARAGVERVL-------SVAPPVLELARKLEEHAKGMVVPATLFEEFGFNYIGPIDGHDLDSLIPTLQNIKELR--GPQFLHVVTKKGQGYKLAEADPVLYHGPGKFNPAEGIKPSTTPAKKTYTQVFGEWLCDAAELDARVVGITPAMREGSGMVEFEKRFPERYYDVGIAEQHAVTFAGGLATEGLKPVVAIYSTFLQRAYDQLIHDVALQNLPVVFAIDRAGLVGADGATHAGAYDLAFLRCIPNMTVMAASDENECRQMLHTALQ-QPNPTAVRYPRGAGTGVATVKAFTEIPLGKGEVRRRTSQPDGKRIAILAFGTMVAPSLAAADALDATVANMRFVKPIDAELVQALARTHDYLVTVEE 558
>gi|126443346|ref|YP_001063527.1| 1-deoxy-D-xylulose-5-phosphate synthase [Burkholderia pseudomallei 668] >gi|134278298|ref|ZP_01765012.1| 1-deoxy-D-xylulose-5-phosphate synthase [Burkholderia pseudomallei 305] >gi|167915841|ref|ZP_02502932.1| 1-deoxy-D-xylulose-5-phosphate synthase [Burkholderia pseudomallei 112] >gi|166198605|sp|A3NMF6|DXS_BURP6 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|126222837|gb|ABN86342.1| 1-deoxy-D-xylulose-5-phosphate synthase [Burkholderia pseudomallei 668] >gi|134250082|gb|EBA50162.1| 1-deoxy-D-xylulose-5-phosphate synthase [Burkholderia pseudomallei 305] (634 aa)
Score = 817, Expect = 5.7e-85, Identities = 198/546 (36%), Positives = 293/546 (53%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNK-TPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKG----KNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELD-----DKGLYHSLKLSDPNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFS---FGSWVYALQTKE---SKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEK 553
           +  I +  D +++   +L  LA  LR  ++D       HLSSNLG VEL++AL YVF++P D I +D GHQ Y HK++T R D + T+R+ +G+SGF   +ES +D   T HS   +S   G     K N   +  I VIGD A++ G+AFEA+NN   ++   +L+I+NDN MSIS  VGAL++ +++    +        + ++L        +   + +   KL +  KG       FE  GF+Y G IDG++L   I  L+ IK +   GP  LHV T KG GYK AE D       G ++  +   P+     +TY  V   +L    E D  +  I PAM   S  +   K+FP  Y DVGIAE+HAVT A G+A    K  V+IYSTFLQR+YD L+HDVA   LP+ F +DR  L  +DG TH G YD+ FL+ IPN  +  AS++ E  +++  A Q + NP  +RY +     +   K F+    G      +T +    +  I+++G ++             + N  F+     E V  +  T+  +  VE+
  S:     5 LKTIDDPADLRRLDRRQLQPLADELRAFVLDSVSKTGGHLSSNLGTVELTIALHYVFNTPDDRIVWDVGHQTYPHKILTGRRDGMKTLRQFDGISGFPRRSESEYDTFGTAHSSTSISAALGMAIGSKLNGDDRFSIAVIGDGAMTAGMAFEAMNNAGVSEDAKLLVILNDNDMSISPPVGALNRHLARLMSGRFYAAARAGVERVL-------SVAPPVLELARKLEEHAKGMVVPATLFEEFGFNYIGPIDGHDLDSLIPTLQNIKELR--GPQFLHVVTKKGQGYKLAEADPVLYHGPGKFNPAEGIKPSTTPAKKTYTQVFGEWLCDAAELDARVVGITPAMREGSGMVEFEKRFPERYYDVGIAEQHAVTFAGGLATEGLKPVVAIYSTFLQRAYDQLIHDVALQNLPVVFAIDRAGLVGADGATHAGAYDLAFLRCIPNMTVMAASDENECRQMLHTALQ-QPNPTAVRYPRGAGTGVATVKAFTEIPLGKGEVRRRTSQPDGKRIAILAFGTMVAPSLAAADALDATVANMRFVKPIDAELVQALARTHDYLVTVEE 558
>gi|53716443|ref|YP_105137.1| 1-deoxy-D-xylulose-5-phosphate synthase [Burkholderia mallei ATCC 23344] >gi|53722783|ref|YP_111768.1| 1-deoxy-D-xylulose-5-phosphate synthase [Burkholderia pseudomallei K96243] >gi|67643213|ref|ZP_00441961.1| COG1154: Deoxyxylulose-5-phosphate synthase [Burkholderia mallei GB8 horse 4] >gi|76819327|ref|YP_336000.1| 1-deoxy-D-xylulose-5-phosphate synthase [Burkholderia pseudomallei 1710b] >gi|126456504|ref|YP_001076424.1| 1-deoxy-D-xylulose-5-phosphate synthase [Burkholderia pseudomallei 1106a] >gi|161355676|ref|ZP_02101555.1| 1-deoxy-D-xylulose-5-phosphate synthase [Burkholderia pseudomallei 1106b] >gi|161368368|ref|ZP_02107939.1| 1-deoxy-D-xylulose-5-phosphate synthase [Burkholderia pseudomallei 1710a] >gi|167000280|ref|ZP_02266099.1| 1-deoxy-D-xylulose-5-phosphate synthase [Burkholderia mallei PRL-20] >gi|167820730|ref|ZP_02452410.1| 1-deoxy-D-xylulose-5-phosphate synthase [Burkholderia pseudomallei 91] >gi|167829089|ref|ZP_02460560.1| 1-deoxy-D-xylulose-5-phosphate synthase [Burkholderia pseudomallei 9] >gi|167850566|ref|ZP_02476074.1| 1-deoxy-D-xylulose-5-phosphate synthase [Burkholderia pseudomallei B7210] >gi|167907502|ref|ZP_02494707.1| 1-deoxy-D-xylulose-5-phosphate synthase [Burkholderia pseudomallei NCTC 13177] >gi|194513287|ref|YP_002025810.1| 1-deoxy-D-xylulose-5-phosphate synthase [Burkholderia pseudomallei Pasteur 52237] >gi|194518888|ref|YP_002054311.1| 1-deoxy-D-xylulose-5-phosphate synthase [Burkholderia pseudomallei S13] >gi|194527085|ref|YP_002062609.1| 1-deoxy-D-xylulose-5-phosphate synthase [Burkholderia mallei JHU] >gi|194567296|ref|YP_002102305.1| 1-deoxy-D-xylulose-5-phosphate synthase [Burkholderia pseudomallei 406e] >gi|166198604|sp|A3P7W4|DXS_BURP0 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|81606250|sp|Q63JF4|DXS_BURPS 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|81684641|sp|Q62DU1|DXS_BURMA 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|119368198|sp|Q3JKA3|DXS_BURP1 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|52213197|emb|CAH39237.1| 1-deoxy-D-xylulose 5-phosphate synthase [Burkholderia pseudomallei K96243] >gi|52422413|gb|AAU45983.1| 1-deoxy-D-xylulose-5-phosphate synthase [Burkholderia mallei ATCC 23344] >gi|76583800|gb|ABA53274.1| 1-deoxy-D-xylulose-5-phosphate synthase [Burkholderia pseudomallei 1710b] >gi|126230272|gb|ABN93685.1| 1-deoxy-D-xylulose-5-phosphate synthase [Burkholderia pseudomallei 1106a] >gi|147751095|gb|EDK58163.1| 1-deoxy-D-xylulose-5-phosphate synthase [Burkholderia mallei JHU] >gi|157810695|gb|EDO87865.1| 1-deoxy-D-xylulose-5-phosphate synthase [Burkholderia pseudomallei 406e] >gi|157933839|gb|EDO89509.1| 1-deoxy-D-xylulose-5-phosphate synthase [Burkholderia pseudomallei Pasteur 52237] >gi|169651004|gb|EDS83697.1| 1-deoxy-D-xylulose-5-phosphate synthase [Burkholderia pseudomallei S13] (634 aa)
Score = 817, Expect = 5.7e-85, Identities = 198/546 (36%), Positives = 293/546 (53%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNK-TPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKG----KNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELD-----DKGLYHSLKLSDPNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFS---FGSWVYALQTKE---SKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEK 553
           +  I +  D +++   +L  LA  LR  ++D       HLSSNLG VEL++AL YVF++P D I +D GHQ Y HK++T R D + T+R+ +G+SGF   +ES +D   T HS   +S   G     K N   +  I VIGD A++ G+AFEA+NN   ++   +L+I+NDN MSIS  VGAL++ +++    +        + ++L        +   + +   KL +  KG       FE  GF+Y G IDG++L   I  L+ IK +   GP  LHV T KG GYK AE D       G ++  +   P+     +TY  V   +L    E D  +  I PAM   S  +   K+FP  Y DVGIAE+HAVT A G+A    K  V+IYSTFLQR+YD L+HDVA   LP+ F +DR  L  +DG TH G YD+ FL+ IPN  +  AS++ E  +++  A Q + NP  +RY +     +   K F+    G      +T +    +  I+++G ++             + N  F+     E V  +  T+  +  VE+
  S:     5 LKTIDDPADLRRLDRRQLQPLADELRAFVLDSVSKTGGHLSSNLGTVELTIALHYVFNTPDDRIVWDVGHQTYPHKILTGRRDGMKTLRQFDGISGFPRRSESEYDTFGTAHSSTSISAALGMAIGSKLNGDDRFSIAVIGDGAMTAGMAFEAMNNAGVSEDAKLLVILNDNDMSISPPVGALNRHLARLMSGRFYAAARAGVERVL-------SVAPPVLELARKLEEHAKGMVVPATLFEEFGFNYIGPIDGHDLDSLIPTLQNIKELR--GPQFLHVVTKKGQGYKLAEADPVLYHGPGKFNPAEGIKPSTTPAKKTYTQVFGEWLCDAAELDARVVGITPAMREGSGMVEFEKRFPERYYDVGIAEQHAVTFAGGLATEGLKPVVAIYSTFLQRAYDQLIHDVALQNLPVVFAIDRAGLVGADGATHAGAYDLAFLRCIPNMTVMAASDENECRQMLHTALQ-QPNPTAVRYPRGAGTGVATVKAFTEIPLGKGEVRRRTSQPDGKRIAILAFGTMVAPSLAAADALDATVANMRFVKPIDAELVQALARTHDYLVTVEE 558
>gi|56477948|ref|YP_159537.1| 1-deoxy-D-xylulose-5-phosphate synthase [Azoarcus sp. EbN1] >gi|81598684|sp|Q5P228|DXS_AZOSE 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|56313991|emb|CAI08636.1| 1-deoxy-D-xylulose 5-phosphate synthase (EC 2.2.1.7) (DXP synthase) (DXPS) [Azoarcus sp. EbN1] (621 aa)
Score = 816, Expect = 6.5e-85, Identities = 184/458 (40%), Positives = 265/458 (57%)
  Q:    16 DFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIA-YNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKG----KNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLN------SNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTK 473
           D +K+   EL  LA  LR  +I+       HLSSNLG VELS+AL Y+FD+P+D I +D GHQ Y HK++T R + +S +R+  G+SGF   +ES +D   T HS   +S   G     +N  + +  I VIGD A+S G+AFEALNN        +L+I+NDN MSIS  VGAL KI+++    ++     +   K+L        +   +     K+ +  KG       FE  GFHY+G IDG++L   I  L+ ++ +   GP  LHV T KG GYK AE D   LYH +   D          +   TY  V  ++L  +   D  +  I PAM   S  +  +++FPN Y DVGIAE+HA+T AAG+A    K  V+IYSTFLQR+YD L+HD+A   LP+ F +DR  L  +DG THHG +D+ +L  IPN ++   +++ E  +++  AY++ + P  +RY +
  S:    15 DLRKLDRRELPALAAELRAFLIESVSKTGGHLSSNLGTVELSIALHYIFDTPEDRIVWDVGHQTYGHKILTGRREAMSRLRQFGGISGFPRRSESSYDTFGTAHSSTSISAALGMAVAARNRGEQRRSIAVIGDGAMSAGMAFEALNNAGDMRDINLLVILNDNEMSISPPVGALTKILARMFSGRTYNAARRAGEKVL-------GVSPPMLDFARKVEEHVKGLITPGTLFEEFGFHYYGPIDGHDLDALIPTLQNLRKLN--GPHFLHVITRKGQGYKLAEADPV-LYHGVSTFDHTAGIQTAKGAAKLTYTQVFGDWLCDIAAQDEKVIGITPAMREGSGMVRFAQEFPNRYYDVGIAEQHALTFAAGLACEGFKPVVAIYSTFLQRAYDQLIHDIALQNLPVMFAIDRAGLVGADGATHHGAFDLSYLGCIPNLVVMAPADENECRQMLYTAYRH-NGPAAVRYPR 474
>gi|153853045|ref|ZP_01994454.1| hypothetical protein DORLON_00439 [Dorea longicatena DSM 13814] >gi|149753831|gb|EDM63762.1| hypothetical protein DORLON_00439 [Dorea longicatena DSM 13814] (620 aa)
Score = 816, Expect = 6.6e-85, Identities = 201/603 (33%), Positives = 326/603 (54%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKSK--SVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEW-SKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSL-----KLSDPNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDI--EVKKEFSFGSWVYALQTKESKTCIISYGDIIND---LKKEIKTKSID--LINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEI 610
           +++I    D KK+   EL +LA  +R+ +I+       HL+SNLG+VEL+MA+  VFD P+D I +D GHQ Y HK++T R D    +R+  G+SGF +  ES  D   TGHS   +S   G++   + + +  SVI VIGD +++ G+A+EALNN +  K   +I++NDN MSIS+NVG +   ++K + +      +K +  +L         +   I K+ S L +      FFE +G  Y G I G+++   +  LK  + I   GP +LHV T KG GY+ AE +    +H +     +  +P       +Y  V    +      ++ +  I  AM   +      KK+PN + DVGIAEEHAVT AAG+A    K   ++YS+FLQR+YD ++HDVA   LP+ F VDR  L  +DG+TH GI+D+ +L SIPN +I    +K+EL  ++      +  P  IRY +    D+  E +    +G     +  +ES   II  G +  +   +++++K K  D  LINA FI     + + R+   ++ I  +E+   S   G+ +            ++ + + ++ +  GN + + K+  +++ S+ A+I
  S:     2 LERIQKANDIKKLAPEELPELAQEIRQFLIEKISRTGGHLASNLGVVELTMAIHLVFDLPKDKIIWDVGHQSYTHKILTGRKDGFDDLRKYGGMSGFPKRKESACDAFDTGHSSTSISAGLGYVCARDLQKEDYSVISVIGDGSLTGGMAYEALNNASRLKKNFIIVLNDNHMSISENVGGMSDYLAKLRTADFYTDLKKGVTNMLHNVPVVGDPMIEHIRKTKSSLKQLIVPGMFFEDMGITYLGPIQGHSIPMLVRALKEARKIE--GPVLLHVLTKKGKGYEPAE-EQPDKFHGIGPFQVETGEPEKPKKKDSYTDVFGKVMCDEAARNDKLAAITAAMADGTGLARFRKKYPNRFFDVGIAEEHAVTFAAGLAAGGMKPVFAVYSSFLQRAYDQMIHDVALQNLPVMFAVDRAGLVGNDGETHQGIFDLSYLSSIPNMVIMSPKHKWELADMVRFGISYEG-PIAIRYPRGSACDVCPEFRSPIEYGK--SEILYEESDIAIIFVGHMFEEALKVREDLKEKGYDCSLINARFIKPLDAKMLDRLTKKHRLIVTIEENVKSGGFGEHVSEYLMRIGADVRVQILALPDDYVEHGNVDVLRKETGLEVESMTAQI 613
>gi|154686691|ref|YP_001421852.1| 1-deoxy-D-xylulose-5-phosphate synthase [Bacillus amyloliquefaciens FZB42] >gi|166198600|sp|A7Z6J5|DXS_BACA2 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|154352542|gb|ABS74621.1| Dxs [Bacillus amyloliquefaciens FZB42] (633 aa)
Score = 816, Expect = 7.2e-85, Identities = 193/554 (34%), Positives = 309/554 (55%)
  Q:    17 FKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKSKS--VIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMS-KSVFLTEKILRKILFKK--EWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHS---LKLSDPNL---NSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFS---FGSWVYALQTKESKTCIISYGDII-------NDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANE 570
            KKM + +L +L+  +R  +I        H+  NLG+VEL++AL   FDSP+D   +D GHQ YVHK++T R  +  T+R+  GL GF + +ES HD   TGHS   LS   G     + K     +IP+IGD A++ G+A EALN+I   K  M++I+NDN MSI+ NVGA+H ++ + + + K  ++ +++  + LFK+      K+  +  +    L        FFE LGF Y G +DG++  +    L+  K     GP +LHV T KG GYK AE D  G +H     K++  +     +   ++  + +  +++L   D+ I  I PAM + S     +K+FP    DVGIAE+HA T AAGMA+   K F++IYSTFLQR+YD ++HD+ R    +   +DR  L  +DG+TH G++DI FL+ IPN ++    ++ E   ++  A   +  P  +R+ +     +++ KE      G+W      K++   I+++G  I        +L+KE    S+ ++NA FI    K+ +  IL+    I  +E+       G  ++  A++
  S:    12 LKKMSIEQLEELSEEIRNFLITSLSASGGHIGPNLGVVELTIALHKEFDSPKDKFLWDVGHQSYVHKLLTGRGKEFETLRQYKGLCGFPKRSESEHDVWETGHSSTSLSGAMGMAAARDIKGSKEYIIPIIGDGALTGGMALEALNHIGDEKKDMIVILNDNEMSIAPNVGAIHSMLGRLRTAGKYQWVKDEL--EYLFKRIPAVGGKLAATAERIKDSLKYMLVSGMFFEELGFTYLGPVDGHSYHELFENLQYAKKTK--GPVLLHVITKKGKGYKPAETDTIGTWHGTGPYKINTGDFVKPKAAAPSWSGLVSGTVQELAREDDRIVAITPAMPVGSKLEGFAKEFPERMFDVGIAEQHAATMAAGMALQGMKPFLAIYSTFLQRAYDQVVHDICRQNANVFIGIDRAGLVGADGETHQGVFDIAFLRHIPNLVLMMPKDENEGRHMVNTALNYEEGPIAMRFPRGNGLGVKMDKELKTIPIGTWEVLRPGKDA--VILTFGTTIEMALEAAEELQKE--GLSVRVVNARFIKPIDKQMMKAILNEGLPILTIEEAVLEGGFGSTILEYAHD 578
>gi|121610224|ref|YP_998031.1| 1-deoxy-D-xylulose-5-phosphate synthase [Verminephrobacter eiseniae EF01-2] >gi|166201545|sp|A1WN06|DXS_VEREI 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|121554864|gb|ABM59013.1| 1-Deoxy-D-xylulose-5-phosphate synthase [Verminephrobacter eiseniae EF01-2] (631 aa)
Score = 815, Expect = 9.7e-85, Identities = 183/466 (39%), Positives = 268/466 (57%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQG--FIEKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKK-----EWSKKIYWSIYKSFSKLSK-FFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNL------NSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTK 473
           ++ I +    +++   +L  LA  LR  +++       HLSSNLG VEL++AL +VF +P D + +D GHQ Y HK++T R +++ T+R+  G+SGF +  ES++D   T HS   +S   G     K   +S+  + +IGD A+S G+AFEALNN       +L+++NDN MSIS  VGAL++ +++  MS   +   K + K + +      E++K+        F + +K        FE  GF+Y G IDG++L   I  L  IK +   GP  LHV T KG GYK AE D    YH     DP +       +   T+  V   +L  +  +D  +  I PAM   S  +   ++FP+ Y DVGIAE+HAVT AAGMA    K  V+IYSTFLQR YD L+HDVA   LP+ F +DR  L  +DG TH G YDI FL+ IPN  + C +++ E  +L+  AY  +++P  +RY +
  S:     9 LETIDDPAQLRQLARAQLKVLAAELRGFVLESVSRTGGHLSSNLGTVELTVALHHVFQTPHDRLVWDVGHQTYAHKILTGRRERMHTLRQQGGISGFPQRGESVYDTFGTAHSSTSISAALGMALAAKRKGESRHTVAIIGDGAMSAGMAFEALNNAGVADCNLLVVLNDNDMSISPPVGALNRYLAQL-MSGRFYAAAKNMGKTVLRPMPPLLEFAKR--------FEQQAKGLVVPATLFEKFGFNYIGPIDGHDLDSLIPTLDNIKGLQ--GPQFLHVVTKKGQGYKLAEADPVA-YHGPARFDPAVGLVKSSTAPRLTFTQVFGQWLCDMAAHDERLVGITPAMREGSGMVEFEQRFPDRYYDVGIAEQHAVTFAAGMACEGAKPVVAIYSTFLQRGYDQLIHDVALQNLPVVFALDRAGLVGADGATHAGAYDIAFLRCIPNMGLACPADERECRQLLSSAYA-QNHPVAVRYPR 475
>gi|119502849|ref|ZP_01624934.1| deoxyxylulose-5-phosphate synthase [marine gamma proteobacterium HTCC2080] >gi|119461195|gb|EAW42285.1| deoxyxylulose-5-phosphate synthase [marine gamma proteobacterium HTCC2080] (639 aa)
Score = 814, Expect = 1.1e-84, Identities = 188/530 (35%), Positives = 299/530 (56%)
  Q:    24 ELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSK--SKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNSNNQT-----YGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFS---FGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEK 553
           +L  LA  +R+ ++        H  + LG+VELS+AL +V ++P+D I +D GHQ Y HK++T R ++++TIR++ GLSGF +  ES  D    GHS   +S   G     N +   + V+ VIGD AI+ G+AFEAL +  + +  ML+I+NDN MSI  N G L    +K   S +     +  ++IL   E  +  +    K+  ++         FE LGF+Y G +DG++L + +  L+ +  +   GP +LH++T+KG G+  AE D  G YH++   + N +S+ +      Y  V   +L      DN +  I PAM   S  +  S+++P+ Y DV IAE+HAVT AAGMA    K  V+IYSTFLQR+YD L+HDVA   L +TF +DR  L   DG THHG+YD+ +L+ IPN II C SN+ E  +L+  AYQ+   P  +RY +       +++E +    G  V  L+T  +   I+++G ++++ +   +     LI+  +     +  +L++  ++  +  VE+
  S:    38 DLQTLANEVRQYMLFSVSQTGGHFGAGLGVVELSIALHHVLNTPEDRIVWDVGHQTYPHKILTGRMERLATIRQAEGLSGFPKRTESGFDTFGVGHSSTSISAAMGMAIAANQQGLDRKVVAVIGDGAITGGMAFEALAHAGHVRPNMLVILNDNQMSIGHNTGGLANYFAKIWASPTYIALREGSKRIL---EHVRTAWDFAKKTEEQMKSLVAPGMLFEELGFNYVGPLDGHDLPQLVQTLEAMIELK--GPQLLHIRTVKGKGFSPAESDPVG-YHAINKIEANPDSSTKKPSPPKYQDVFGRWLCDTAATDNRLIGITPAMCEGSGMVQFSQEYPSRYHDVAIAEQHAVTLAAGMACDGLKPVVAIYSTFLQRAYDQLIHDVALQNLDVTFAIDRGGLVGQDGATHHGVYDLSYLRCIPNMIIACPSNENECRQLLHTAYQH-DGPAAVRYPRGAGTGALIEEEMTALPIGQAV-TLRTGHN-VAILNFGVLLDEAEAAARVLKATLIDMRWAKPLDETLLLQVARSHDRLITVEE 568
>gi|168232395|ref|ZP_02657453.1| hypothetical protein Sententerica_15538 [Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191] >gi|194470796|ref|ZP_03076780.1| 1-deoxy-D-xylulose-5-phosphate synthase [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|194457160|gb|EDX45999.1| 1-deoxy-D-xylulose-5-phosphate synthase [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] (620 aa)
Score = 814, Expect = 1.1e-84, Identities = 194/581 (33%), Positives = 326/581 (56%)
  Q:    32 LRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWS---IYKSFSKLSKFFKGK----NFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNSNNQT------YGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVK--KEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEK--VFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           LR+ ++D     S H +S LG VEL++AL YV+++P D + +D GHQ Y HK++T R DKI TIR+  GL  F    ES +D +S GHS   +S   G     +   K +  + VIGD AI+ G+AFEA+N+    +  ML+I+NDN MSIS+NVGAL+  +++        L+ K+   +   +E  KK++     I +   +  +  KG       FE LGF+Y G +DG+++   I+ LK ++++   GP  LH+ T KG GY+ AE  D   +H++   DP+     ++      Y  +  ++L +    D+ +  I PAM   S  +  S+KFP+ Y DV IAE+HAVT AAG+AI   K  V+IYSTFLQR+YD ++HDVA  +LP+ F +DR  +  +DG TH G +D+ +L+ IP+ +I   S++ E  +++   Y     P  +RY +   + + +   ++   G  V  ++    K  I+++G +I +  K  +  +  L++  F+       +L + + +  +  +E+  +      G + +++A+   +   +  I + +  I  G +E+   +L +D   I A+IK+
  S:    35 LRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQLIWDVGHQAYPHKILTGRRDKIGTIRQKGGLHPFPWRGESEYDVLSVGHSSTSISAGIGIAVAAEKEGKDRRTVCVIGDGAITAGMAFEAMNHAGDIRPDMLVILNDNEMSISENVGALNNHLAQL-------LSGKLYSSL---REGGKKVFSGVPPIKELLKRTEEHIKGMVVPGTLFEELGFNYIGPVDGHDVMGLISTLKNMRDLK--GPQFLHIMTKKGRGYEPAE-KDPITFHAVPKFDPSSGCLPKSSGGLPGYSKIFGDWLCETAAKDSKLMAITPAMREGSGMVEFSRKFPDRYFDVAIAEQHAVTFAAGLAIGGYKPVVAIYSTFLQRAYDQVIHDVAIQKLPVMFAIDRAGIVGADGQTHQGAFDLSYLRCIPDMVIMTPSDENECRQMLFTGYHYNDGPTAVRYPRGNAQGVALTPLEKLPIGKGV--VKRHGEKLAILNFGTLIPEAAKVAEALNATLVDMRFVKPLDDTLILEMAAQHDALVTLEENAIMGGAGSGVNEVLMAHRKPVP--VLNIGLPDFFIPQGTQEEARAELGLDAAGIEAKIKA 617
>gi|54308000|ref|YP_129020.1| 1-deoxy-D-xylulose-5-phosphate synthase [Photobacterium profundum SS9] >gi|81615459|sp|Q6LU07|DXS_PHOPR 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|46912426|emb|CAG19218.1| putative deoxyxylulose-5-phosphate synthase [Photobacterium profundum SS9] (620 aa)
Score = 814, Expect = 1.2e-84, Identities = 194/597 (32%), Positives = 333/597 (55%)
  Q:    15 EDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKS--KSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWS---IYKSFSKLSKFFKGK----NFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSD------PNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFS---FGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIK 611
           ++ + + +  L ++   LR  +++     S H +S LG VEL++AL +V+++P D + +D GHQ Y HK++T R D++STIR+ +G+  F    ES +D +S GHS   +S   G     N +   + V+ VIGD AI+ G+AFEA+N+     + ML+I+NDN MSIS+NVGAL+  +++  +S S++ T          +E  KK+      I +   +  +  KG       FE LGF+Y G +DG+++ + +  LK ++N+   GP  LH+ T KG GY  AE D    YH++   D      P   +   T+  +  ++L  +   D  +  I PAM   S  +  SK++P+ Y DV IAE+HAVT A+GMAI      V+IYSTFLQR YD L+HDVA +ELP+ F +DR  L  +DG TH G +D+ F++ IPN +I   S++ E  +++   ++++  P  +RY +      E++KE +    G  +  ++ +  K  I+++G ++    +  +  +  + +  F+    +E +L + + +  +  VE+   +   G  +I    ++K    +  I + +  +  G ++++   L ID   I  +I+
  S:    18 DELRLLPVESLPEVCDELRTYLLNSVSQSSGHFASGLGAVELTVALHHVYNTPFDHLIWDVGHQAYPHKILTGRRDQMSTIRQKDGIHPFPWRGESEYDVLSVGHSSTSISAGLGMAIAANKEGLGRKVVSVIGDGAITAGMAFEAMNHAGDVHSDMLVILNDNEMSISENVGALNNHLARL-LSGSLYTT---------IREGGKKVLAGAPPIKELVKRAEEHIKGMVVPGTMFEELGFNYIGPVDGHDVTELVKTLKNMRNLK--GPQFLHIMTKKGKGYAPAEADPIN-YHAVPKFDLSQNPLPKAANAKPTFSKIFGDWLCDMAAEDEKLMAITPAMREGSGMVRFSKEYPSQYFDVAIAEQHAVTLASGMAIGGYNPIVAIYSTFLQRGYDQLIHDVAIMELPVMFAIDRGGLVGADGQTHQGAFDLSFMRCIPNIVIMAPSDENECRQMLYTGHKHQG-PSAVRYPRGNGLGAEIQKEMTALEIGKGI--IRRQGEKIAILNFGTMLEYALEAAEKLNATVADMRFVKPLDEELILELAANHDVLVTVEENAIAGGAGSGVIEFMMKSKCLKPVLNIGLPDRFVEQGTQQELHTALEIDAAGIEKKIR 616
>gi|148323140|gb|EDK88390.1| 1-deoxy-D-xylulose-5-phosphate synthase [Fusobacterium nucleatum subsp. polymorphum ATCC 10953] (600 aa)
Score = 813, Expect = 1.3e-84, Identities = 207/561 (36%), Positives = 321/561 (57%)
  Q:    32 LRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTP-MLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKG--KNFF--ESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSL---KLSDPNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYALQTKESKTCIISYG---DIINDLKKEIKTKSID--LINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNK 592
           +RKK+I++      HL  NLG+VEL++ L  +FD  +D++ +D GHQ YV+K++TDRA+K  TIR   GLS F +PNES +D   +GH+G  L    GF   N    K VI V+GDA+ISNG + EALN I Y K   +L+I+NDN MSI +NVG + K + K   S       + ++  + + +  +     + ++  ++ +  KG    F+  ESLGF +F V +GNN++K + +LK+ K++   GP IL VKT KG GY  AE ++K  +H +    +   N   N+ +Y  V  N + +L + D NI  ++ AM   +     S++FP    D GIAE  AVT AAG+A + KK +V IYSTF+QR+   L+HDV+   LP+ F++DR  +   DG TH+GIYD+ F  SI N  + C +   ELE+ + ++    S P  IR  ++   DIE +K    G W      K SK   I+ G    II ++  E+K + ID  +++A  +    +  +L  +  Y NI+V+E+ +  N     ++   N+N +   I +I +++  I  G +
  S:    12 IRKKLIEVVSKNGGHLGPNLGVVELTVCLDEIFDFKEDIVLFDVGHQAYVYKILTDRAEKFDTIRTRKGLSPFLDPNESSYDHFVSGHAGTALPAAVGFAIAN--PDKKVIVVVGDASISNGHSLEALNYIGYKKLENILVIVNDNEMSIGENVGFISKFLKKVISSGKYQNFREDVKSFINRIKADR-----VKRTLERMERSIKGYVTPFYALESLGFRFFNVSEGNNIEKLLPMLKKAKDLK--GPVILLVKTEKGKGYCFAE-ENKEKFHGIAPFNIETGNTYKNSVSYSEVFGNKILELGKEDENIYTLSAAMIKGTGLYKFSEEFPERCIDTGIAEGFAVTLAAGLAKSEKKPYVCIYSTFIQRAVSQLIHDVSIQNLPVRFIIDRSGIVGEDGKTHNGIYDLSFFLSIQNFTVLCPTTSKELEQALEISKDFNSGPLVIRIPRDSIFDIEDEKPLEIGRWKEI--KKGSKNLFIATGTMLKIILEIYDELKNRGIDCTIVSAASVKPLDENYLLNYIKEYDNIFVLEENYVKNSFSTSILEFLNDNGIQKLIHRIALKSAIIPHGKR 573
>gi|114563955|ref|YP_751469.1| 1-deoxy-D-xylulose-5-phosphate synthase [Shewanella frigidimarina NCIMB 400] >gi|122299142|sp|Q07ZD4|DXS_SHEFN 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|114335248|gb|ABI72630.1| deoxyxylulose-5-phosphate synthase [Shewanella frigidimarina NCIMB 400] (621 aa)
Score = 813, Expect = 1.4e-84, Identities = 197/598 (32%), Positives = 321/598 (53%)
  Q:    15 EDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKS--KSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLT-----EKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSL------KLSDPNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTK---EKCEDIEVKKEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           E+ +K+    L  ++  LR+ ++      S H +S LG VEL++AL YV+++P D + +D GHQ Y HK++TDR +++ TIR+ NGL  F    ES +D  S GHSG  +S   G       +   + V+ VIGD A++ G+ FEALN+       ML+++NDN MSIS+NVGAL+  +++  MS   + T     +K+L+ +   KE +K+       +   L         FE LGF+Y G IDG+++   +  ++ ++N+   GP ILH+ T KG GY+ AE D  G +H++      +   P       T+  V   +L  +   D+ +  I PAM   S  +  S++FP+ Y D  IAE+HAVT AAG A A  K  V+IYSTFLQR YD L+HDVA   LP+ F +DR  +  +DG TH G +D+ F++ IPN II   S++ E  +++   Y  +  P  +RY +      E I+       G  V   Q +  K  I+++G  +       +     + +  F+       + ++ +++  I  VE+       G  +I   ++ ++   + +I + +  I  G  ++I  +L +D   I A+I++
  S:    18 EELRKLPQGLLPQVSDELRQFLLQSVAISSGHFASGLGTVELTVALHYVYNTPFDQLVWDVGHQAYPHKILTDRREQMHTIRQKNGLHPFPWREESPYDTFSVGHSGTSVSAALGMAIAAGKEGVGRKVVAVIGDGAMTGGMVFEALNHAGDLHNDMLVVLNDNEMSISENVGALNNHLAQL-MSGRFYTTIRENSKKVLKGMPVIKEMAKR-------TEEHLKGMVVPATLFEELGFNYIGPIDGHDVDSLVETMRNMRNLK--GPQILHIMTKKGRGYEPAEKDPIG-WHAVPKFDPSQFKKPTTKPGLPTFSQVFGKWLCDMAATDDKLVAITPAMREGSGMVEFSQRFPSQYFDAAIAEQHAVTLAAGFACAGLKPVVAIYSTFLQRGYDQLIHDVALQRLPVLFAIDRGGIVGADGPTHQGAFDLSFMRCIPNMIIMAPSDENECRQMLYTGYCYQDGPTAVRYPRGFATGAEQIDTMTMIPIGKGVLTRQGQ--KIAIVNFGTTLEAATDAAEKLDATIADMRFVKPLDLGLLEQLANSHDVIVTVEENAIMGGAGSGVIEALHKMRIVKPVLQIGLPDEFIKHGAPDEITAELQLDAQGILAQIQA 618
>gi|169831189|ref|YP_001717171.1| deoxyxylulose-5-phosphate synthase [Candidatus Desulforudis audaxviator MP104C] >gi|169638033|gb|ACA59539.1| deoxyxylulose-5-phosphate synthase [Candidatus Desulforudis audaxviator MP104C] (634 aa)
Score = 813, Expect = 1.5e-84, Identities = 177/466 (37%), Positives = 271/466 (58%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNN--SKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQM----SKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELD-DKGLYHSLKLSDPNLNSN----NQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTK 473
           +D I +  D + +   +L +LA  LR  I+        HL+ NLG+VEL++AL YVF +P D I +D GHQCYVHK++T R  +  T+R+  GLSGF   NES +D   TGHS   +S   G     +   + ++V+ VIGD A+S G+AFEALN   +    +++++NDN MSI++NVGA+ + +S+ +     S+S    E +LR+I        ++   I +    L         FE LGF Y G IDG+N+   +NV ++ + +   GP ++HV T KG GY  AE + DK  +H +   DP   +       ++  V    L +L E D+ I  I  AMT  +     S++FP  + DVGIAE+HAVT AAG+A+   +  V+IYSTFLQR+YD +LHDV   +LP+ F +DR  +   DG TH G++D  FL+ +PN ++    ++ E + ++  A +++  P  +RY +
  S:     4 LDGISHLTDLRALTPDQLDELAAELRDLIVSTVSRTGGHLAPNLGVVELTLALHYVFRAPDDRIVWDVGHQCYVHKILTGRKSQFHTLRQFEGLSGFPNRNESEYDCFGTGHSSTSISAALGMALARDLSGEDRNVVAVIGDGALSGGMAFEALNQAGHLGCRLIVVLNDNEMSIARNVGAMARYLSRLRTDPMYSRSKDEVESLLRRI---PAIGPRVLGWIERIKDSLKYLVVAGMLFEELGFTYLGPIDGHNIPAMLNVFRQAQAVE--GPVLVHVLTKKGKGYAPAEKNPDK--FHGVGPFDPATGNTPTDARVSFTEVFGRTLVQLAEADSRILAITAAMTSGTGLGPFSRRFPQRFFDVGIAEQHAVTLAAGLAVEGYRPVVAIYSTFLQRAYDQVLHDVCLQKLPVVFALDRGGIVGEDGVTHQGVFDFSFLRPVPNLVMMAPKDENEFQHMLKTAVEHEG-PIAVRYPR 472
>gi|153953856|ref|YP_001394621.1| 1-deoxy-D-xylulose-5-phosphate synthase [Clostridium kluyveri DSM 555] >gi|189027772|sp|A5N7J2|DXS_CLOK5 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|146346737|gb|EDK33273.1| Dxs [Clostridium kluyveri DSM 555] (624 aa)
Score = 813, Expect = 1.5e-84, Identities = 206/603 (34%), Positives = 326/603 (54%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKSK--SVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQM----SKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPN----LNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVK--KEFSFGSWVYALQTKESKTCIISYGDIINDL-----KKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEI 610
           +D   +  D KKM L E   LA+ +R+ +I+       HL+SNLG+VEL+++L  +FD   D + +D GHQ YVHK++T R DK  T+R+  G+SGF +  ES++DF  TGHS   +S   G     + K +  +V+ VIGD A++ G+A EALN++ Y KT ++II+NDN MSI KNVG + + ++K ++    +K     E  L+KI       K +   + +  + + K      FFE +G  Y G IDG+N+K    V+   K +    P I+HV T KG GY+ AE  + G +H +   + N      ++  TY  V  + +  L   D  I +I  AM   +   N +K+FP  + DVGIAE+HAVT A GMA+   K   ++YSTFLQRSYD LLHD+   +LP+ F VDR  +   DG+TH GI+D+ +L  +PN  +       EL  ++  A  N++ P  IRY +   +++ +   ++F FG W Y L   + K  +++ G ++        K E     + +I+A FI    K  + +++     I  +E       LG  ++   N      ++  +  ++  +  G    + K   +D  SI  ++
  S:     5 LDNYKDVNDIKKMSLDEKKQLALEIREFLIENVSKTGGHLASNLGVVELTLSLFSIFDLNHDKLIWDVGHQAYVHKLLTGRKDKFHTLRQFGGISGFPKKCESVYDFFETGHSSTSISAALGMARARDLKGEKHNVVAVIGDGALTGGMALEALNDVGYRKTKLIIILNDNQMSIGKNVGGVSRYLNKLRVDPKYNKFKEEVESTLKKI---PNIGKGMAKYLERLKNGIKKMVVSGMFFEDIGIKYLGPIDGHNIKDLTEVMTAAKKVN--NPVIIHVITKKGKGYEFAE-KNPGKFHGIGPFNCNNGEIAATSTNTYSKVFGDEMVNLAREDKKIVVITAAMRDGTGLQNFAKEFPERFFDVGIAEQHAVTLAGGMAVEGLKPVFAVYSTFLQRSYDQLLHDICIQKLPVVFAVDRAGIVGDDGETHQGIFDLSYLTEMPNMTVMSPKCMAELTHMLKWAL-NQNCPIAIRYPRGG-DNVYLTPLEDFEFGRWEYILN--KGKIALVAQGRMVEHAVLAAEKLEQMGILVRVISACFIKPLDKVMLKKLIEEDVTIITIEDNIIRGGLGSYILEYVNTLHRKVDVINLGFKDEFVRHGKPSILYKLYGLDTGSIVDKV 614
>gi|153887750|ref|ZP_02008899.1| deoxyxylulose-5-phosphate synthase [Ralstonia pickettii 12D] >gi|151575864|gb|EDN40271.1| deoxyxylulose-5-phosphate synthase [Ralstonia pickettii 12D] (636 aa)
Score = 813, Expect = 1.5e-84, Identities = 197/546 (36%), Positives = 301/546 (55%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIA-YNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKK----EWSKKIYWSIYKSFSKLSK-FFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVP--FGPTILHVKTIKGLGYKEAELD-----DKGLYHSLKLSDPNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEV----------KKEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEK 553
           ++ I +  D +++   +L  LA  LR  ++D       HLSSNLG VEL++AL YVF++P+D I +D GHQ Y HK++T R D++ ++R+ +G+SGF   +ES +D   T HS   +S   G     K N + +  I VIGD A+S G+AFEA+NN   Y   P+++++NDN MSIS  VGAL++ +++    +    T+K + K+L       E++K+        F + +K  F     FE  GF+Y G IDG++L+  +  L+ I+       GP  LHV T KG GYK AE D       G ++  +   P+      TY  V   +L  +   D  +  I PAM   S  +   ++FP+ Y DVGIAE+HAVT A G+A    K  V+IYSTFLQR YD L+HDVA   LP+ F +DR  L  +DG TH G YDI +L+ IPN ++   +++ E  +L+  A+  +  P  +RY +     + V          K E    S   A Q    +  I+++G ++       +     ++N  F+       VL +  T+  +  VE+
  S:     6 LNTIDDPADLRRLDRRQLGPLADELRAFVLDSVSQTGGHLSSNLGTVELTIALHYVFNTPEDRIVWDVGHQSYPHKILTGRRDQMGSLRQLDGISGFPRRSESPYDTFGTAHSSTSISAALGMALGAKTNGEDRVAIAVIGDGAMSAGMAFEAMNNAGVYKDLPLVVVLNDNDMSISPPVGALNRYLARLMSGQFYAATKKGVEKLLSVAPPVLEFAKR--------FEEHTKGMFVPATMFEEFGFNYIGPIDGHDLESLVPTLQNIRQRAREGGGPQFLHVVTKKGQGYKLAEADPILYHGPGKFNPQEGIKPSGRPAKVTYTQVFGQWLCDMAAADKRLVGITPAMREGSGMVEFEQRFPDRYYDVGIAEQHAVTFAGGLACEGLKPVVAIYSTFLQRGYDQLIHDVALQNLPVVFALDRAGLVGADGATHAGAYDIAYLRCIPNMMVMTPADENECRQLLSTAFA-QDGPTAVRYPRGAGTGVAVQPTLEPLPVGKAEVRRASTAPAGQ----RVAILAFGSMVAPASAAAERLDATVVNMRFVKPLDVACVLEMARTHDYVVTVEE 563
>gi|154498043|ref|ZP_02036421.1| hypothetical protein BACCAP_02024 [Bacteroides capillosus ATCC 29799] >gi|150273033|gb|EDN00190.1| hypothetical protein BACCAP_02024 [Bacteroides capillosus ATCC 29799] (615 aa)
Score = 812, Expect = 1.8e-84, Identities = 189/546 (34%), Positives = 300/546 (54%)
  Q:    16 DFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNN--SKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLY----HSLKLSDPNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYALQTKESKTCIISYGDIINDLKK--EIKTK---SIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLG 561
           D K +   E   L   +R  +ID       HL+SNLG VE+++AL  VFD  +D + +D GHQCY HK++T RAD++S++R   G+SGF +P ES  D    GH+ N +S+  G         +   VI +IGD A++ GLA+E L++   +   ML+I+NDNGMSI+KNVG +   +++ ++       +K  RK+       K +Y   ++    + +     +FFE +GF Y G +DG+++K+   +L+  K+I   GP +LH++T+KG GY  AE +    +      ++  +P L++ +  + S     L  L E D  I  I  AM   +   + S++FP  Y DVGIAE HA   AAGMA        ++YSTFLQRSYD L+HDVA   L + F VDR  L   DG+THHG+ D+ FL ++P   + C S+  EL+ ++  A ++   P  +RY +      E       G+    L  + S   ++ YG +IN++ +  E+  +   S +++    IT    + + R +S   ++ V E V ++NC+G
  S:     9 DIKSITDCEAEALCTRIRAGLIDSVSKTGGHLASNLGAVEITVALHRVFDFTRDRLVFDVGHQCYTHKILTGRADQMSSLRTFGGMSGFPKPVESCCDAFIAGHASNSVSVATGMARGRTLLGEDYYVIALIGDGALTGGLAYEGLSDAGNSGEKMLVILNDNGMSITKNVGGIADHLARQRLKPQYLRFKKGYRKVTSTVPGGKTLYRITHRIKKAVKETLLPCSFFEDMGFTYLGPVDGHDVKRLTGLLRYAKDIE--GPVLLHIRTVKGNGYTPAERNPDQFHGVGRFCVQTGEP-LSAGSPNFSSAFGVALCGLAENDRRICAITAAMRDGTGLGDFSRRFPTRYFDVGIAEGHATAMAAGMAKQGLVPVFAVYSTFLQRSYDMLIHDVAIQGLHVVFAVDRAGLVGEDGETHHGVLDVAFLDTVPGMTVLCPSSFAELKTMLAYAVKDVRGPVALRYPRGG----EGAYTADSGTEPAVLLQQGSDITLVGYGVMINEVIRCAELLQQHGISAEIVKLNTITPIDTQVIQRSVSKTGSLLVAEDVMETNCVG 558
>gi|161504394|ref|YP_001571506.1| 1-deoxy-D-xylulose-5-phosphate synthase [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] >gi|189027784|sp|A9MM42|DXS_SALAR 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|160865741|gb|ABX22364.1| hypothetical protein SARI_02505 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] (620 aa)
Score = 812, Expect = 1.9e-84, Identities = 192/581 (33%), Positives = 329/581 (56%)
  Q:    32 LRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWS---IYKSFSKLSKFFKGK----NFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNSNNQTYGS------VAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVK--KEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEK--VFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           LR+ ++D     S H +S LG VEL++AL YV+++P D + +D GHQ Y HK++T R DKI TIR+  GL  F    ES +D +S GHS   +S   G     +   K +  + VIGD AI+ G+AFEA+N+    +  ML+I+NDN MSIS+NVGAL+  +++        L+ K+   +   +E  KK++     I +   +  +  KG       FE LGF+Y G +DG+++   I+ LK ++++   GP  LH+ T KG GY+ AE  D   +H++   DP+     ++ GS      +  ++L +    D+ +  I PAM   S  +  S+KFP+ Y DV IAE+HAVT AAG+AI   K  V+IYSTFLQR+YD ++HD+A  +LP+ F +DR  +  +DG TH G +D+ +L+ IP+ +I   S++ E  +++   Y     P  +RY +   + + +   ++   G  +  ++    K  I+++G ++ +  K  +  +  L++  F+    +  +L + + ++ +  +E+  +      G + +++A+   +   +  I + +  I  G +E+   +L +D   I A+IK+
  S:    35 LRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQLIWDVGHQAYPHKILTGRRDKIGTIRQKGGLHPFPWRGESEYDVLSVGHSSTSISAGIGIAVAAEKEGKDRRTVCVIGDGAITAGMAFEAMNHAGDIRPDMLVILNDNEMSISENVGALNNHLAQL-------LSGKLYSSL---REGGKKVFSGVPPIKELLKRTEEHIKGMVVPGTLFEELGFNYIGPVDGHDVMGLISTLKNMRDLK--GPQFLHIMTKKGRGYEPAE-KDPITFHAVPKFDPSSGCLPKSSGSLPGYSKIFGDWLCETAAKDSKLMAITPAMREGSGMVEFSRKFPDRYFDVAIAEQHAVTFAAGLAIGGYKPVVAIYSTFLQRAYDQVIHDIAIQKLPVMFAIDRAGIVGADGQTHQGAFDLSYLRCIPDMVIMTPSDENECRQMLFTGYHYNDGPTAVRYPRGNAQGVALTPLEKLPIGKGI--VKRHGEKLAILNFGTLMPEAAKVAEALNATLVDMRFVKPLDETLILEMAARHEALATLEENAIMGGAGSGVNEVLMAHRKPVP--VLNIGLPDFFIPQGTQEEARAELGLDAAGIEAKIKA 617
>gi|88711406|ref|ZP_01105494.1| 1-deoxy-D-xylulose-5-phosphate synthase [Flavobacteriales bacterium HTCC2170] >gi|88710347|gb|EAR02579.1| 1-deoxy-D-xylulose-5-phosphate synthase [Flavobacteriales bacterium HTCC2170] (591 aa)
Score = 812, Expect = 1.9e-84, Identities = 214/597 (35%), Positives = 314/597 (52%)
  Q:    16 DFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI---EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHS-----------LKLSDPNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYALQTKE-SKTCIISYGDIINDLKKEIKTKS----IDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           D + +   +L  LA  LRK IIDI   K  HL ++LG+VEL++AL YVF++P D + +D GHQ Y HK++T R +   T R+  G+SGF   +ES +D   TGHS   +S   G     + N    ++ I VIGDA+I++G+AFE LN+       ML+++NDN + I  +VGAL K ++  +   +                                    K +N FE L F Y G IDG+NL   +  L+R+KN+   GP +LH+ T KG G KEAE +++ +YH+            K SD NL      Y  V  + + +L + + NI  I PAM   S+   +  + P    DVGIAE+HAVT +AGMA      F +IYSTFLQR+YD ++HDVA  +LP+ F +DR  L   DG THHG+YD+ FL  IPN II    N+ EL  ++  +    S P  IRY + +      +K F       A + K+ ++  ++S G I N + + I + S    +   +  FI       +L + S+Y NI  VE    +   G  ++  AN +  S  +  + I +N I  G  E++ K   ID  SI   I +
  S:    13 DLRNLAKDDLPKLAKELRKFIIDIIAVKEGHLGASLGVVELTIALHYVFNTPDDKLIWDVGHQAYGHKILTGRKNLFETNRQLGGISGFPNKSESNYDPFGTGHSSTSISAILGMAIAAQLNGDTQRNHIAVIGDASIASGMAFEGLNHAGVTNANMLVVLNDNAIGIDPSVGALKKYLTNVKKGTA------------------------------------KDENIFECLNFDYTGPIDGHNLNSLLRELERLKNVS--GPKLLHIITTKGKGLKEAE-ENQVVYHAPGKFDKHSGVLQKESDLNLPPK---YQDVFGHTIVELAKKNKNIVGITPAMPTGSSLKFMMNEIPERAFDVGIAEQHAVTLSAGMAAEGLVPFCNIYSTFLQRAYDQVIHDVAIQKLPVVFCLDRAGLVGQDGATHHGVYDLAFLGCIPNLIIFAPMNEVELRNIMYTSQLGLSQPIAIRYPRGRGNSTGWQKPFEKIEIGKATELKKGTQIAVLSIGHIGNMISETIPSTSNPNKVGHYDMRFIKPLDMNLLLEVFSSYSNIITVEDGCKAGGFGSSVLEFANASGYSGKLDILGIPDNFIEHGTTEELQKIAQIDSQSIKEHINN 586
>gi|74316897|ref|YP_314637.1| 1-deoxy-D-xylulose-5-phosphate synthase [Thiobacillus denitrificans ATCC 25259] >gi|118595629|sp|Q3SKF1|DXS_THIDA 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|74056392|gb|AAZ96832.1| deoxyxylulose-5-phosphate synthase [Thiobacillus denitrificans ATCC 25259] (618 aa)
Score = 812, Expect = 2.0e-84, Identities = 180/466 (38%), Positives = 264/466 (56%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNS--KSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGK----NFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDP-----NLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTK 473
           +D I +  D + +   EL  LA  +R  +ID       HL+SNLG VEL++AL YVFD+P+D I +D GHQ Y HK++T R D +  +R+  G++GF    ES  D   TGHS   +S   G  E  +     +  + VIGD A++ G+AFEALNN    + P+L+++NDN MSIS NVGAL+  +++    +      +   K+L        +   I +   +  +  KG       FE  GF+Y G IDG++L   +N L+ I+++   GP  LHV T KG GY  AE  +  LYH +   DP        +   +Y  V  ++L  +   D  +  I PAM   S  +  S++FP  Y DVGIAE+HA+T AAG+A    K  V+IYSTFLQR+YD L+HD+A   LP+T  +DR  L  +DG TH G +D+ FL+ +P+ +I   S++ E  RL+  A+ +   P  +RY +
  S:     6 LDTIESPADLRALPAAELPGLAAEVRAFLIDSVAGTGGHLASNLGAVELTLALHYVFDTPRDRIVWDVGHQSYTHKILTGRRDAMQGLRQRGGIAGFPRRAESEFDAFGTGHSSTSISAALGMAEAFHQLGSDQRAVAVIGDGAMTAGMAFEALNNAGATELPLLVVLNDNDMSISPNVGALNNYLARLMSGRFYAAARRAGDKVL-------SVAPPIRELAKRAEEHMKGMVTPGTLFEEFGFNYIGPIDGHDLDVLVNTLRNIRHLR--GPQFLHVVTRKGKGYTPAE-TNPCLYHGVARFDPAAGVAEKRAGKPSYTEVFGDWLCDMAASDPRLVGITPAMREGSGLVRFSQEFPERYFDVGIAEQHALTFAAGLACEGVKPVVAIYSTFLQRAYDQLIHDIALQNLPVTLAIDRAGLVGADGPTHAGSFDLSFLRCVPDLVIAAPSDENECRRLLSTAFLH-DGPAAVRYPR 471
>gi|161702975|ref|YP_372966.2| 1-deoxy-D-xylulose-5-phosphate synthase [Burkholderia sp. 383] >gi|118595497|sp|Q393P4|DXS_BURS3 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) (634 aa)
Score = 811, Expect = 2.3e-84, Identities = 190/503 (37%), Positives = 282/503 (56%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNK-TPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKG----KNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELD-----DKGLYHSLKLSDPNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFS---FGSWVYALQTKE---SKTCIISYGDII 510
           +  I +  D +++   +L  LA  LR  ++D       HLSSNLG VEL++AL YVF++P D I +D GHQ Y HK++T R D++ ++R+ +G+SGF   +ES +D   T HS   +S   G     + N   +  I VIGD A++ G+AFEA+NN   ++   +L+I+NDN MSIS  VGAL++ +++    +        + ++L        +   + +   KL +  KG       FE  GF+Y G IDG++L   I  L+ I+ +   GP  LHV T KG GYK AE D       G ++  +   P+     +TY  V   +L    E D  +  I PAM   S  +   K+F + Y DVGIAE+HAVT A GMA    K  V+IYSTFLQR+YD L+HDVA   LP+ F +DR  L  +DG TH G YD+ F++ IPN  I  AS++ E  +++  A Q + NP  +RY +     +   KEF+    G      QT +    +  I+++G ++
  S:     5 LKTIDDPADLRRLDRRQLQPLADELRAFVLDSVSKTGGHLSSNLGTVELTIALHYVFNTPNDRIVWDVGHQTYPHKILTGRRDQMHSLRQQDGISGFPRRSESEYDTFGTAHSSTSISAALGMAIGSQLNGDDRFSIAVIGDGAMTAGMAFEAMNNAGVSEDAKVLVILNDNDMSISPPVGALNRHLARLMSGRFYAAARAGVERVL-------SVAPPVLELARKLEEHAKGMVVPATLFEEFGFNYIGPIDGHDLDSLIPTLQNIRELR--GPQFLHVVTKKGQGYKLAEADPVLYHGPGKFNPAEGIKPSTTPAKKTYTQVFGEWLCDEAERDTRVVGITPAMREGSGMVEFEKRFKDRYYDVGIAEQHAVTFAGGMATEGLKPVVAIYSTFLQRAYDQLIHDVALQNLPVVFAIDRAGLVGADGATHAGAYDLAFMRCIPNMTIMAASDENECRQMLHTALQ-QPNPTAVRYPRGAGTGVPTVKEFTEIPLGKGEVRRQTSQPEGKRVAILAFGTMV 515
>gi|77970943|gb|ABB12322.1| 1-Deoxy-D-xylulose-5-phosphate synthase [Burkholderia sp. 383] (646 aa)
Score = 811, Expect = 2.3e-84, Identities = 190/503 (37%), Positives = 282/503 (56%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNK-TPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKG----KNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELD-----DKGLYHSLKLSDPNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFS---FGSWVYALQTKE---SKTCIISYGDII 510
           +  I +  D +++   +L  LA  LR  ++D       HLSSNLG VEL++AL YVF++P D I +D GHQ Y HK++T R D++ ++R+ +G+SGF   +ES +D   T HS   +S   G     + N   +  I VIGD A++ G+AFEA+NN   ++   +L+I+NDN MSIS  VGAL++ +++    +        + ++L        +   + +   KL +  KG       FE  GF+Y G IDG++L   I  L+ I+ +   GP  LHV T KG GYK AE D       G ++  +   P+     +TY  V   +L    E D  +  I PAM   S  +   K+F + Y DVGIAE+HAVT A GMA    K  V+IYSTFLQR+YD L+HDVA   LP+ F +DR  L  +DG TH G YD+ F++ IPN  I  AS++ E  +++  A Q + NP  +RY +     +   KEF+    G      QT +    +  I+++G ++
  S:    17 LKTIDDPADLRRLDRRQLQPLADELRAFVLDSVSKTGGHLSSNLGTVELTIALHYVFNTPNDRIVWDVGHQTYPHKILTGRRDQMHSLRQQDGISGFPRRSESEYDTFGTAHSSTSISAALGMAIGSQLNGDDRFSIAVIGDGAMTAGMAFEAMNNAGVSEDAKVLVILNDNDMSISPPVGALNRHLARLMSGRFYAAARAGVERVL-------SVAPPVLELARKLEEHAKGMVVPATLFEEFGFNYIGPIDGHDLDSLIPTLQNIRELR--GPQFLHVVTKKGQGYKLAEADPVLYHGPGKFNPAEGIKPSTTPAKKTYTQVFGEWLCDEAERDTRVVGITPAMREGSGMVEFEKRFKDRYYDVGIAEQHAVTFAGGMATEGLKPVVAIYSTFLQRAYDQLIHDVALQNLPVVFAIDRAGLVGADGATHAGAYDLAFMRCIPNMTIMAASDENECRQMLHTALQ-QPNPTAVRYPRGAGTGVPTVKEFTEIPLGKGEVRRQTSQPEGKRVAILAFGTMV 527
>gi|114320537|ref|YP_742220.1| 1-deoxy-D-xylulose-5-phosphate synthase [Alkalilimnicola ehrlichei MLHE-1] >gi|122311762|sp|Q0A8V7|DXS_ALHEH 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|114226931|gb|ABI56730.1| 1-Deoxy-D-xylulose-5-phosphate synthase [Alkalilimnicola ehrlichei MLHE-1] (628 aa)
Score = 811, Expect = 2.3e-84, Identities = 174/464 (37%), Positives = 268/464 (57%)
  Q:    10 KIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQG--FIEKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGK----NFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNSNNQTYGSVAAN-----FLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTK 473
           ++P+ E  + +  H L  LA  LR  ++        HL++ LG VEL++AL YVF++P+D + +D GHQCY HK++T R +++ TIR+  GL+GF +  ES +D    GHS   +S   G     +   + +  + +IGD  ++ G AFEA+N+       +L+++NDN MSIS+NVGAL + +++    +         +++L      +++   +++   +  +  KG       FE LGF YFG +DG+N+   + VL  + +    GP +LHV T KG GY+ AE D    YH +   DP      ++ GS+A N     +L  + E D  +  I PAM   S  +  +++FP  Y DVGIAE+HAVT AAG+A  + K  ++IYSTFLQR YD L+HDVA   LP+ F VDR  L  +DG THHG +D+ +L+ +PN  I   S++ E  RL+   Y +   PF +RY +
  S:    13 QVPDPEALRTLPAHRLPALAKELRHYLLHSVARSGGHLAAGLGAVELTLALHYVFNTPEDRLVWDVGHQCYPHKILTGRRERLGTIRKYGGLAGFPKRAESPYDTFGVGHSSTSISAALGMALAARQAGEQRKAVAIIGDGGMTAGEAFEAMNHAGDAGADLLVVLNDNEMSISENVGALSQHLTRILSGRWYHQLRSGSKEVL------RRLPPPVHELARRTEEHLKGMVVPGTLFEELGFQYFGPVDGHNVDALVEVLGNLAH--QRGPRLLHVVTCKGKGYRPAEQDPIA-YHGVGQFDPEQGLPKKSGGSLAYNQVFGRWLCAMAEQDPRLVAITPAMREGSGMVEYARRFPERYHDVGIAEQHAVTLAAGLACESVKPVLAIYSTFLQRGYDQLVHDVALQNLPVLFAVDRAGLVGADGPTHHGSFDLSYLRCVPNMTIAAPSDEAECWRLLSTGYHH-DGPFAVRYPR 477
>gi|121593454|ref|YP_985350.1| 1-deoxy-D-xylulose-5-phosphate synthase [Acidovorax sp. JS42] >gi|166198592|sp|A1W4U9|DXS_ACISJ 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|120605534|gb|ABM41274.1| 1-Deoxy-D-xylulose-5-phosphate synthase [Acidovorax sp. JS42] (629 aa)
Score = 811, Expect = 2.4e-84, Identities = 182/466 (39%), Positives = 268/466 (57%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQG--FIEKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKG----KNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNL------NSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTK 473
           ++++ +  D +++   EL  LA  LR  +++       HLSSNLG VEL++AL  VFD+P+D + +D GHQ Y HK++T R D++ ++R+  GLSGF +  ES +D   T HS   +S   G     K     +  + +IGD A++ G+AFEALNN       +L+I+NDN MSIS  VGAL++ +++  MS   +   + + K + K          + +   +L +  KG       FE  GF+Y G IDG++L   I  L+ I+ +   GP  LHV T KG GYK AE D    YH     DP +          QT+  V   +L  + + D  +  I PAM   S  +   ++FP+ Y DVGIAE+HAVT AAGMA    K  V+IYSTFLQR+YD L+HDVA   LP+ F +DR  L  +DG TH G YDI F++ IP+  + C +++ E  +L+  AY+ + +P  +RY +
  S:     9 LERVNDPADLRRLPRAELKTLAHELRAFVLESVSKTGGHLSSNLGTVELTVALHAVFDTPRDRLVWDVGHQTYPHKILTGRRDRMPSLRQLGGLSGFPQRAESEYDTFGTAHSSTSISAALGMALAAKQRGDERRCVAIIGDGAMTAGMAFEALNNAGVADANLLVILNDNDMSISPPVGALNRYLAQL-MSGQFYAKARDMGKSVLKNAPP------LLELAKRLEQQAKGMVVPATLFEKFGFNYIGPIDGHDLDSLIPTLENIRGLK--GPQFLHVVTKKGQGYKLAEADPVA-YHGPGKFDPRVGLVKPATPPKQTFTQVFGQWLCDMADKDKRLVGITPAMREGSGMVEFHQRFPDRYYDVGIAEQHAVTFAAGMACEGVKPVVAIYSTFLQRAYDQLIHDVALQNLPVVFALDRAGLVGADGATHAGAYDIAFVRCIPHMSMACPADERECRQLLTTAYE-QDHPVAVRYPR 475
>gi|134292966|ref|YP_001116702.1| 1-deoxy-D-xylulose-5-phosphate synthase [Burkholderia vietnamiensis G4] >gi|134136123|gb|ABO57237.1| 1-Deoxy-D-xylulose-5-phosphate synthase [Burkholderia vietnamiensis G4] (646 aa)
Score = 811, Expect = 2.6e-84, Identities = 185/479 (38%), Positives = 271/479 (56%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNK-TPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKG----KNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELD-----DKGLYHSLKLSDPNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFS 486
           +  I +  D +++   +L  LA  LR  ++D       HLSSNLG VEL++AL YVF++P D I +D GHQ Y HK++T R D++ T+R+ +G+SGF   +ES +D   T HS   +S   G     + N   +  I VIGD A++ G+AFEA+NN   ++   +L+I+NDN MSIS  VGAL++ +++    +        + ++L        +   + +   KL +  KG       FE  GF+Y G IDG++L   I  L+ I+ +   GP  LHV T KG GYK AE D       G ++  +   P+     +TY  V   +L    E D+ +  I PAM   S  +   K+F + Y DVGIAE+HAVT A G+A    K  V+IYSTFLQR+YD L+HDVA   LP+ F +DR  L  +DG TH G YD+ F++ IPN  I  AS++ E  +++  A Q + NP  +RY +     +   KEF+
  S:    17 LKTIDDPADLRRLDRRQLQPLADELRAFVLDSVSKTGGHLSSNLGTVELTIALHYVFNTPNDRIVWDVGHQTYPHKILTGRRDQMHTLRQYDGISGFPRRSESEYDTFGTAHSSTSISAALGMAIGSQLNGDDRFSIAVIGDGAMTAGMAFEAMNNAGVSEDAKLLVILNDNDMSISPPVGALNRHLARLMSGRFYAAARAGVERVL-------SVAPPVLELARKLEEHAKGMVVPATLFEEFGFNYIGPIDGHDLDSLIPTLQNIRELR--GPQFLHVVTKKGQGYKLAEADPVLYHGPGKFNPAEGIKPSATPAKKTYTQVFGEWLCDEAERDSRVVGITPAMREGSGMVEFEKRFKDRYYDVGIAEQHAVTFAGGLATEGLKPVVAIYSTFLQRAYDQLIHDVALQNLPVVFAIDRAGLVGADGATHAGAYDLAFMRCIPNMTIMAASDENECRQMLHTALQ-QPNPTAVRYPRGSGTGVATVKEFT 497
>gi|168818967|ref|ZP_02830967.1| hypothetical protein Salentericaenterica_06245 [Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537] (620 aa)
Score = 811, Expect = 2.6e-84, Identities = 193/581 (33%), Positives = 326/581 (56%)
  Q:    32 LRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWS---IYKSFSKLSKFFKGK----NFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNSNNQT------YGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVK--KEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEK--VFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           LR+ ++D     S H +S LG VEL++AL YV+++P D + +D GHQ Y HK++T R DKI TIR+  GL  F    ES +D +S GHS   +S   G     +   K +  + VIGD AI+ G+AFEA+N+    +  ML+I+NDN MSIS+NVGAL+  +++        L+ K+   +   +E  KK++     I +   +  +  KG       FE LGF+Y G +DG+++   I+ LK ++++   GP  LH+ T KG GY+ AE  D   +H++   DP+     ++      Y  +  ++L +    D+ +  I PAM   S  +  S+KFP+ Y DV IAE+HAVT AAG+AI   K  V+IYSTFLQR+YD ++HDVA  +LP+ F +DR  +  +DG TH G +D+ +L+ IP+ +I   S++ E  +++   Y     P  +RY +   + + +   ++   G  V  ++    K  I+++G ++ +  K  +  +  L++  F+       +L + + +  +  +E+  +      G + +++A+   +   +  I + +  I  G +E+   +L +D   I A+IK+
  S:    35 LRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQLIWDVGHQAYPHKILTGRRDKIGTIRQKGGLHPFPWRGESEYDVLSVGHSSTSISAGIGIAVAAEKEGKDRRTVCVIGDGAITAGMAFEAMNHAGDIRPDMLVILNDNEMSISENVGALNNHLAQL-------LSGKLYSSL---REGGKKVFSGVPPIKELLKRTEEHIKGMVVPGTLFEELGFNYIGPVDGHDVMGLISTLKNMRDLK--GPQFLHIMTKKGRGYEPAE-KDPITFHAVPKFDPSSGCLPKSSGGLPGYSKIFGDWLCETAAKDSKLMAITPAMREGSGMVEFSRKFPDRYFDVAIAEQHAVTFAAGLAIGGYKPVVAIYSTFLQRAYDQVIHDVAIQKLPVMFAIDRAGIVGADGQTHQGAFDLSYLRCIPDMVIMTPSDENECRQMLFTGYHYNDGPTAVRYPRGNAQGVALTPLEKLPIGKGV--VKRHGEKLAILNFGTLMPEAAKVAEALNATLVDMRFVKPLDDTLILEMAAQHDALVTLEENAIMGGAGSGVNEVLMAHRKPVP--VLNIGLPDFFIPQGTQEEARAELGLDAAGIEAKIKA 617
>gi|149909333|ref|ZP_01897989.1| 1-deoxy-D-xylulose-5-phosphate synthase [Moritella sp. PE36] >gi|149807650|gb|EDM67598.1| 1-deoxy-D-xylulose-5-phosphate synthase [Moritella sp. PE36] (621 aa)
Score = 811, Expect = 2.6e-84, Identities = 197/598 (32%), Positives = 322/598 (53%)
  Q:    15 EDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKF--QMSKSVFLT--EKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNS------NNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKK---EFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           E+ +++    L DL   LR  ++        H +S LG+VEL++AL YV+++P D + +D GHQ Y HK++T R D++STIR+  GL  F   +ES +D ++ GHS   +S   G         K++  + +IGD AI+ G+AFEALN+  +    +L+I+NDN MSIS NVGA++K ++K    ++ S F    +K+L  I   KE +++       +   L         FE  GF+Y G IDG+++   +  L+ ++N+   GP  LHV T KG GY  AE D  G YH++   +P  ++      +  T+  +  N+L  +   D  +  + PAM   S  +  S+ +P  Y DV IAE+H VT AAG+AI   K  V+IYSTFLQR YD L+HDVA  ++P+ F +DR  L  +DG TH G +DI F++ IP  +I   S++ E  +++   YQ    P  +RY +     I+V++   EF  G  +   Q +  K  I+ +G ++++     K  +  +++  F     +  +  + +++  +  +E        G  +      NKL      + + +  I  G +++I  +L +D   I A IK+
  S:    18 EELRQLPADRLDDLCDELRSYLLHTVGKSGGHFASGLGVVELTVALHYVYNTPYDKLLWDVGHQAYPHKILTGRRDRMSTIRQKGGLHPFPWRDESEYDHLNVGHSSTSISAALGLAVAADQEDKNRKTVAIIGDGAITGGMAFEALNHAGHIDKDVLVILNDNDMSISANVGAVNKHLAKLLSGVAYSSFRENGKKVLSGIPPIKELARR-------AEEHLKGMVVPSTLFEEFGFNYIGPIDGHDVNGLVETLRNMRNLK--GPQFLHVITKKGKGYAPAEQDQLG-YHAVPKFNPAEDTLPVAAPSKPTFSKIFGNWLCDVAATDKKLAAVTPAMGAGSGMIKFSETYPKQYFDVAIAEQHCVTFAAGLAIGGHKPVVAIYSTFLQRGYDQLIHDVAIQDIPVLFAIDRAGLVGADGQTHQGAFDISFMRCIPKMVIMTPSDENECRQMLHTGYQYHG-PAAVRYPRGSGTGIDVEQAFTEFEIGKGIVRRQGE--KVAILCFGTLMHNAMPAAKRLNATVVDMRFAKPLDEALLAEMANSHDILVTIEDGAIMGGAGSGVNEYLMANKLMTPTLNLGLPDKFIHQGTQDEIYAELGLDDIGIEASIKA 617
>gi|168237535|ref|ZP_02662593.1| hypothetical protein Senteenterica_15221 [Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480] (620 aa)
Score = 810, Expect = 3.1e-84, Identities = 192/581 (33%), Positives = 327/581 (56%)
  Q:    32 LRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWS---IYKSFSKLSKFFKGK----NFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNSNNQT------YGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVK--KEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEK--VFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           LR+ ++D     S H +S LG VEL++AL YV+++P D + +D GHQ Y HK++T R DKI TIR+  GL  F    ES +D +S GHS   +S   G     +   K +  + VIGD AI+ G+AFEA+N+    +  ML+I+NDN MSIS+NVGAL+  +++        L+ K+   +   +E  KK++     I +   +  +  KG       FE LGF+Y G +DG+++   I+ LK ++++   GP  LH+ T KG GY+ AE  D   +H++   DP+     ++      Y  +  ++L +    D+ +  I PAM   S  +  S+KFP+ Y DV IAE+HAVT AAG+AI   K  V+IYSTFLQR+YD ++HDVA  +LP+ F +DR  +  +DG TH G +D+ +L+ IP+ +I   S++ E  +++   Y     P  +RY +   + + +   ++   G  +  ++    K  I+++G ++ +  K  +  +  L++  F+       +L + + +  +  +E+  +      G + +++A+   +  ++  I + +  I  G +E+   +L +D   I A+IK+
  S:    35 LRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQLIWDVGHQAYPHKILTGRRDKIGTIRQKGGLHPFPWRGESEYDVLSVGHSSTSISAGIGIAVAAEKEGKDRRTVCVIGDGAITAGMAFEAMNHAGDIRPDMLVILNDNEMSISENVGALNNHLAQL-------LSGKLYSSL---REGGKKVFSGVPPIKELLKRTEEHIKGMVVPGTLFEELGFNYIGPVDGHDVMGLISTLKNMRDLK--GPQFLHIMTKKGRGYEPAE-KDPITFHAVPKFDPSSGCLPKSSGGLPGYSKIFGDWLCETAAKDSKLMAITPAMREGSGMVEFSRKFPDRYFDVAIAEQHAVTFAAGLAIGGYKPVVAIYSTFLQRAYDQVIHDVAIQKLPVMFAIDRAGIVGADGQTHQGAFDLSYLRCIPDMVIMTPSDENECRQMLFTGYHYNDGPTAVRYPRGNAQGVALTPLEKLPIGKGL--VKRHGEKLAILNFGTLMPEAAKVAEALNATLVDMRFVKPLDDTLILEMAAQHDALVTLEENAIMGGAGSGVNEVLMAHRKPV--HVLNIGVPDFFIPQGTQEEARAELGLDAAGIEAKIKA 617
>gi|149197843|ref|ZP_01874892.1| 1-deoxy-D-xylulose-5-phosphate synthase [Lentisphaera araneosa HTCC2155] >gi|149139064|gb|EDM27468.1| 1-deoxy-D-xylulose-5-phosphate synthase [Lentisphaera araneosa HTCC2155] (623 aa)
Score = 810, Expect = 3.2e-84, Identities = 203/532 (38%), Positives = 291/532 (54%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSK--SKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFK-KEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLK---------LSDPNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCED-------IEVKKEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVL 539
           +DKI   +D K+    EL  L   +R  ++D+      HL SNLGIVEL++AL  VF+SP D I YD  HQ YVHK++T R D ++T+R   G SGF +  ES HD    GH+G  LS   GF    + +  S+ VI ++GDAA+  G++ EALNNIA     M++I+NDN MSIS NVGAL K +++    K+     + +++ L K  ++ + I   + K              FE LGFHY G +DG+NL   I +L+ I       P +LHV T KG G+ EAE   + L H  K         +  P++ S +Q++G  A     K    D+ +  I   M   +      ++FP+   DVGIAEEHAV  AAGMA    +  V+IY+TF+QR+ D + HDV   ELP+ F +DR  L   DG THHGIYDIGF +S+P+  I    +  E++ ++ LA     +   IRY K    D       +E+ K         A+     + C ++   +  DL+K  K  SI ++NA F+  + KE  L
  S:     6 LDKIKQPDDLKQYNTEELKGLCEEIRAYLVDVCSTHGGHLGSNLGIVELTVALHKVFNSPSDKILYDISHQGYVHKILTGRKDYLNTLRSYQGCSGFLQREESSHDHFGAGHAGTALSAGLGFAAARDQRGASEKVISIVGDAALGCGVSLEALNNIAETTDDMIVILNDNKMSISPNVGALSKYLNRIITDKNYRHVRENVKQFLTKIPKFGQAIRSGVAKVEDAAKSILVPGAIFEELGFHYIGPVDGHNLDSLIPILEAIA--TDKKPVLLHVMTEKGHGFHEAESCPERL-HGFKKKVPAEPDAVPQPSVKSFSQSFGDAACQLASK----DSRVVSITAGMLSGTGMTVFKERFPDKTYDVGIAEEHAVVFAAGMAANGLRPIVAIYATFMQRAMDCVYHDVCLQELPVIFCLDRAGL-VEDGPTHHGIYDIGFWRSLPHIHIMQPRDDSEMKAMMDLALI-LDHATVIRYPKSSSADLTCPRAKVELGKSEVLREGTDAVIWAVGRECELAL-QLAEDLQK--KDFSIKVVNARFLKPFDKEAFL 544
>gi|89099257|ref|ZP_01172135.1| 1-deoxy-D-xylulose-5-phosphate synthase [Bacillus sp. NRRL B-14911] >gi|89086103|gb|EAR65226.1| 1-deoxy-D-xylulose-5-phosphate synthase [Bacillus sp. NRRL B-14911] (630 aa)
Score = 810, Expect = 3.6e-84, Identities = 198/592 (33%), Positives = 325/592 (54%)
  Q:    10 KIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKSKS--VIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMS-KSVFLTEKILRKILFKK--EWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHS-----------LKLSDPNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDI---EVKKEFSFGSWVYALQTKESKTCIISYGDIIN---DLKKEIKTK--SIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKL-SCNIKKINIRNNKIGFGNKEDIDKKLNI 601
           K P++   K +   EL DL+  +R  +I+       H+  NLG+VEL++AL   F+SP+D   +D GHQ YVHK++T RA +  T+R+  GL GF +  ES HD   TGHS   LS   G +   + K +   ++P+IGD A++ G+A EALN+I + +  M++I+NDN MSI+ NVGALH ++ K + + K  ++ +++  ++L KK      K+  +  +    L        FFE +GF Y G IDG+N ++    L   K     GP +LHV T KG GY  AE D  G +H            +K  +P        +  + +  + KL   D+ I  I PAM + S     + +FP+   DVGIAE+HA T AAG+A  N K F++IYSTFLQR+YD ++HD+ R  L +   +DR  L  +DG+TH G++DI F++ +PN ++    ++ E + ++  A      P  +R+ +     +   E   +   G+W   +  +     I+++G  I    D   +++ +  SI ++NA FI    K+ +  IL     I  +E+       G  ++  A+EN      I+++ I +  I  G+ +++ +++ +
  S:     7 KDPSF--LKGLSNKELEDLSQDIRNFLIEKLSVTGGHIGPNLGVVELTIALHKCFESPKDKFLWDVGHQSYVHKILTGRACEFDTLRQYKGLCGFPKRIESEHDVWETGHSSTSLSAAMGMVIARDLKKEDSHIVPIIGDGALTGGMALEALNHIGHEQKNMIVILNDNEMSIAPNVGALHNVLGKLRTAGKYQWVKDEL--ELLLKKIPAVGGKLASTAERVKDSLKYLLVSGMFFEEMGFTYLGPIDGHNFEELFETLSYAKKTE--GPVLLHVITKKGKGYSPAEKDTVGTWHGTGPYKIDTGDFVKPINPP-----PAWSKLVSETVRKLARKDSRIVAITPAMPVGSKLEGFASEFPDRMFDVGIAEQHATTVAAGLATQNMKPFLAIYSTFLQRAYDQVVHDICRQNLNVFIGIDRAGLVGADGETHQGVFDIAFMRHVPNLVMMMPKDENEGQHMVNTALAYDDGPIAMRFPRGNGIGVPMDETLIKIPIGTW--EVLKEGDDAAILTFGTTIPMAMDAAAQLERQGYSIKVVNARFIKPLDKKMLTEILGLNMPILTIEEAILQGGFGSAVLEFAHENGFHQAAIERMGIPDEYIEHGSVKELLEEIGL 610
>gi|168240245|ref|ZP_02665177.1| hypothetical protein Senterienterica_01300 [Salmonella enterica subsp. enterica serovar Heidelberg str. SL486] >gi|194451900|ref|YP_002044457.1| 1-deoxy-D-xylulose-5-phosphate synthase [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194410204|gb|ACF70423.1| 1-deoxy-D-xylulose-5-phosphate synthase [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] (620 aa)
Score = 809, Expect = 3.8e-84, Identities = 192/581 (33%), Positives = 327/581 (56%)
  Q:    32 LRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWS---IYKSFSKLSKFFKGK----NFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNSNNQT------YGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVK--KEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEK--VFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           LR+ ++D     S H +S LG VEL++AL YV+++P D + +D GHQ Y HK++T R DKI TIR+  GL  F    ES +D +S GHS   +S   G     +   K +  + VIGD AI+ G+AFEA+N+    +  ML+I+NDN MSIS+NVGAL+  +++        L+ K+   +   +E  KK++     I +   +  +  KG       FE LGF+Y G +DG+++   I+ LK ++++   GP  LH+ T KG GY+ AE  D   +H++   DP+     ++      Y  +  ++L +    D+ +  I PAM   S  +  S+KFP+ Y DV IAE+HAVT AAG+AI   K  V+IYSTFLQR+YD ++HDVA  +LP+ F +DR  +  +DG TH G +D+ +L+ IP+ +I   S++ E  ++++  Y     P  +RY +   + + +   ++   G  +  ++    K  I+++G ++ +  K  +  +  L++  F+       +L + + +  +  +E+  +      G + +++A+   +   +  I + +  I  G +E+   +L +D   I A+IK+
  S:    35 LRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQLIWDVGHQAYPHKILTGRRDKIGTIRQKGGLHPFPWRGESEYDVLSVGHSSTSISAGIGIAVAAEKEGKDRRTVCVIGDGAITAGMAFEAMNHAGDIRPDMLVILNDNEMSISENVGALNNHLAQL-------LSGKLYSSL---REGGKKVFSGVPPIKELLKRTEEHIKGMVVPGTLFEELGFNYIGPVDGHDVMGLISTLKNMRDLK--GPQFLHIMTKKGRGYEPAE-KDPITFHAVPKFDPSSGCLPKSSGGLPGYSKIFGDWLCETAAKDSKLMAITPAMREGSGMVEFSRKFPDRYFDVAIAEQHAVTFAAGLAIGGYKPVVAIYSTFLQRAYDQVIHDVAIQKLPVMFAIDRAGIVGADGQTHQGAFDLSYLRCIPDMVIMTPSDENECRQMLLTGYHYNDGPTAVRYPRGNAQGVALTPLEKLPIGKGL--VKRHGEKLAILNFGTLMPEAAKVAEALNATLVDMRFVKPLDDTLILEMAAQHDALVTLEENAIMGGAGSGVNEVLMAHRKPVP--VLNIGLPDFFIPQGTQEEARAELGLDAAGIEAKIKA 617
>gi|167543449|ref|ZP_02339023.1| hypothetical protein Sentent_09241 [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23] (620 aa)
Score = 809, Expect = 4.0e-84, Identities = 192/581 (33%), Positives = 327/581 (56%)
  Q:    32 LRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWS---IYKSFSKLSKFFKGK----NFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNSNNQT------YGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVK--KEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEK--VFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           LR+ ++D     S H +S LG VEL++AL YV+++P D + +D GHQ Y HK++T R DKI TIR+  GL  F    ES +D +S GHS   +S   G     +   K +  + VIGD AI+ G+AFEA+N+    +  ML+I+NDN MSIS+NVGAL+  +++        L+ K+   +   +E  KK++     I +   +  +  KG       FE LGF+Y G +DG+++   I+ LK ++++   GP  LH+ T KG GY+ AE  D   +H++   DP+     ++      Y  +  ++L +    D+ +  I PAM   S  +  S+KFP+ Y DV IAE+HAVT AAG+AI   K  V+IYSTFLQR+YD ++HDVA  +LP+ F +DR  +  +DG TH G +D+ +L+ IP+ +I   S++ E  +++   Y     P  +RY +   + + +   ++   G  +  ++    K  I+++G ++ +  K  +  +  L++  F+       +L + + +  +  +E+  +      G + +++A+   +   +  I + +  I  G +E+  ++L +D   I A+IK+
  S:    35 LRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQLIWDVGHQAYPHKILTGRRDKIGTIRQKGGLHPFPWRGESEYDVLSVGHSSTSISAGIGIAVAAEKEGKDRRTVCVIGDGAITAGMAFEAMNHAGDIRPDMLVILNDNEMSISENVGALNNHLAQL-------LSGKLYSSL---REGGKKVFSGVPPIKELLKRTEEHIKGMVVPGTLFEELGFNYIGPVDGHDVMGLISTLKNMRDLK--GPQFLHIMTKKGRGYEPAE-KDPITFHAVPKFDPSSGCLPKSSGGLPGYSKIFGDWLCETAAKDSKLMAITPAMREGSGMVEFSRKFPDRYFDVAIAEQHAVTFAAGLAIGGYKPVVAIYSTFLQRAYDQVIHDVAIQKLPVMFAIDRAGIVGADGQTHQGAFDLSYLRCIPDMVIMTPSDENECRQMLFTGYHYNDGPTAVRYPRGNAQGVALTPLEKLPIGKGL--VKRHGEKLAILNFGTLMPEAAKVAEALNATLVDMRFVKPLDDTLILEMAAQHDALVTLEENAIMGGAGSGVNEVLMAHRKPVP--VLNIGLPDFFIPQGTQEEAREELGLDAAGIEAKIKA 617
>gi|121534495|ref|ZP_01666318.1| deoxyxylulose-5-phosphate synthase [Thermosinus carboxydivorans Nor1] >gi|121306988|gb|EAX47907.1| deoxyxylulose-5-phosphate synthase [Thermosinus carboxydivorans Nor1] (628 aa)
Score = 809, Expect = 4.3e-84, Identities = 187/480 (38%), Positives = 280/480 (58%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNN--SKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQM----SKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFK----GKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELD-DKGLYHSL-----KLSDPNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSF 487
           +D +    D KK+ L+EL +LA  +R+ +I        HL+ NLG+VEL++A+  VFDSP+D I +D GHQ YVHK++T R  +  T+R+  GLSGF + +ES HD   TGHS   +S   G     +       V+ VIGD +++ G A+EALN+  +  + + +I+NDN MSI+KNVGA+ + +++ +     S+     E +LR+I         I  S+ K+  ++    K        FE LGF Y G IDG+N+   ++VL++ KN+   GP ++HV T KG GY+ AE + DK  +H +     +  +   N  N TY +V  + L +L E D+ I  I  AM   +     + +FP  + DVGIAE HAVT AAGMA    +  V+IYSTFLQR+YD ++HDV    LP+ F +DR  +   DG THHG++D+ FL+ IPN +I    ++ EL  ++  A +    P  IRY +     + + K FS 
  S:     5 LDTMEQPGDLKKLSLNELENLASEVRELLIHTVAKTGGHLAPNLGVVELTIAIHKVFDSPRDKIIWDVGHQAYVHKLLTGRRAQFETLRQLGGLSGFPKRSESEHDVFGTGHSSTSISSALGMALARDLLGAKYHVVAVIGDGSLTGGQAYEALNHAGHMGSNLTVILNDNEMSIAKNVGAMSQYLARMRTAPTYSRVKHDIEYLLRRI-------PAIGDSVAKTAERVKDSLKYLLVPGVIFEELGFTYIGPIDGHNIASLVDVLQQAKNVR--GPVLIHVLTQKGKGYRPAECNADK--FHGVGPFCVETGEIIKNGVNPTYTAVFGDALVELAEKDDRIIAITAAMPEGTGLKKFAARFPARFFDVGIAEPHAVTMAAGMATQGLRPVVAIYSTFLQRAYDQIVHDVCLQNLPVVFALDRAGIVGEDGPTHHGVFDLSFLRHIPNMVIMAPKDENELRHMLHTALKLNC-PVAIRYPRGNGVGVSLDKVFSL 488
>gi|156973483|ref|YP_001444390.1| 1-deoxy-D-xylulose-5-phosphate synthase [Vibrio harveyi ATCC BAA-1116] >gi|166201546|sp|A7MYC6|DXS_VIBHB 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|156525077|gb|ABU70163.1| hypothetical protein VIBHAR_01173 [Vibrio harveyi ATCC BAA-1116] (621 aa)
Score = 809, Expect = 4.8e-84, Identities = 195/592 (32%), Positives = 330/592 (55%)
  Q:    15 EDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLT-----EKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNSNNQTYG------SVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYALQT-------KESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSI 606
           E+ + +    L  L   LR  +++     S HL+S LG VEL++AL YV+++P D + +D GHQ Y HK++T R D++ TIR+ +GL  F    ES +D +S GHS   +S   G     +   + + V+ VIGD AI+ G+AFEA+N+       ML+I+NDN MSIS+NVGAL+  ++K  +S S++ +     +K+L  +   KE        + ++   L         FE LGF+Y G IDG+++ + +  LK ++ +   GP  LH+ T KG GY+ AE D  G YH++    P+ NS  ++ G       +  +FL  +   D  +  I PAM   S  +  SK++P  Y DV IAE+HAVT A GMAIA     V+IYSTFLQR YD L+HDVA ++LP+ F +DR  L  +DG TH G +D+ F++ IPN +I   S++ E  +++   +++ + P  +RY +      +++K+F+      AL+        K  K  I+S+G  + +  +  +  +  + +  F+    +  + ++ + +  +  +E+   +   G  +I    ++K+   +  + + +  +  G ++++ + L +D   I
  S:    18 EELRLLPKETLPTLCDELRTYLLNSVSQSSGHLASGLGTVELTVALHYVYNTPVDQLIWDVGHQAYPHKILTGRRDQMPTIRQKDGLHPFPWREESEYDTLSVGHSSTSISAGLGMAISAQKEGEGRKVVSVIGDGAITAGMAFEAMNHAGDVHPDMLVILNDNEMSISENVGALNNHLAKV-LSGSLYTSIREGGKKVLSGVPPIKEL-------VRRTEEHLKGMVVPGTLFEELGFNYIGPIDGHDVNELVKTLKNMRELK--GPQFLHIMTKKGKGYEPAEKDPIG-YHAVPKFAPSNNSLPKSSGGKPNFSKIFGDFLCDMAAQDPKLMAITPAMREGSGMVRFSKEYPEQYFDVAIAEQHAVTLATGMAIAGDHPIVAIYSTFLQRGYDQLIHDVAIMDLPVMFAIDRAGLVGADGQTHQGAFDLSFMRCIPNMVIMAPSDENECRQMLYTGHKH-TGPSAVRYPRGSGMGTDIEKDFT------ALEIGKGRIVRKGEKVAILSFGTFLGNALEAAENLNATVADMRFVKPLDEALIRQLAAEHDVLVTLEENAIAGGAGAGVIEFMMQDKIIKPVLNLGLPDRFVPQGTQDELHEDLGLDAKGI 611
>gi|16759399|ref|NP_455016.1| 1-deoxy-D-xylulose-5-phosphate synthase [Salmonella enterica subsp. enterica serovar Typhi str. CT18] >gi|29142829|ref|NP_806171.1| 1-deoxy-D-xylulose-5-phosphate synthase [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] >gi|21263521|sp|Q8Z8X3|DXS_SALTI 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|25311148|pir||AF0554 1-deoxyxylulose-5-phosphate synthase [imported] - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) >gi|16501690|emb|CAD08878.1| 1-deoxyxylulose-5-phosphate synthase [Salmonella enterica subsp. enterica serovar Typhi] >gi|29138461|gb|AAO70031.1| 1-deoxyxylulose-5-phosphate synthase [Salmonella enterica subsp. enterica serovar Typhi Ty2] (620 aa)
Score = 808, Expect = 4.9e-84, Identities = 192/581 (33%), Positives = 326/581 (56%)
  Q:    32 LRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWS---IYKSFSKLSKFFKGK----NFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNSNNQT------YGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVK--KEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEK--VFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           LR+ ++D     S H +S LG VEL++AL YV+++P D + +D GHQ Y HK++T R DKI TIR+  GL  F    ES +D +S GHS   +S   G     +   K +  + VIGD AI+ G+AFEA+N+    +  ML+I+NDN MSIS+NVGAL+  +++        L+ K+   +   +E  KK++     I +   +  +  KG       FE LGF+Y G +DG+++   I+ LK ++++   GP  LH+ T KG GY+ AE  D   +H++   DP+     ++      Y  +  ++L +    D+ +  I PAM   S  +  S+KFP+ Y DV IAE+HAVT AAG+AI   K  V+IYSTFLQR+YD ++HDVA  +LP+ F +DR  +  +DG TH G +D+ +L+ IP+ +I   S++ E  +++   Y     P  +RY +   + + +   ++   G  +  ++    K  I+++G ++ +  K  +  +  L++  F+       +L + + +  +  +E+  +      G + +++A+   +   +  I + +  I  G +E+   +L +D   I A+IK+
  S:    35 LRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQLIWDVGHQAYPHKILTGRRDKIGTIRQKGGLHPFPWRGESEYDVLSVGHSSTSISAGIGIAVAAEKEGKDRRTVCVIGDGAITAGMAFEAMNHAGDIRPDMLVILNDNEMSISENVGALNNHLARL-------LSGKLYSSL---REGGKKVFSGVPPIKELLKRTEEHIKGMVVPGTLFEELGFNYIGPVDGHDVMGLISTLKNMRDLK--GPQFLHIMTKKGRGYEPAE-KDPITFHAVPKFDPSSGCLPKSSGGLPGYSKIFGDWLCETAAKDSKLMAITPAMREGSGMVEFSRKFPDRYFDVAIAEQHAVTFAAGLAIGGYKPVVAIYSTFLQRAYDQVIHDVAIQKLPVMFAIDRAGIVGADGQTHQGAFDLSYLRCIPDMVIMTPSDENECRQMLFTGYHYNDGPTAVRYPRGNAQGVALTPLEKLPIGKGL--VKRHGEKLAILNFGTLMPEAAKVAEALNATLVDMRFVKPLDDTLILEMAAQHDALVTLEENAIMGGAGSGVNEVLMAHRKPVP--VLNIGLPDFFIPQGTQEEARAELGLDAAGIEAKIKA 617
>gi|124522050|ref|ZP_01696805.1| deoxyxylulose-5-phosphate synthase [Bacillus coagulans 36D1] >gi|124496344|gb|EAY43947.1| deoxyxylulose-5-phosphate synthase [Bacillus coagulans 36D1] (530 aa)
Score = 808, Expect = 5.8e-84, Identities = 180/483 (37%), Positives = 275/483 (56%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKSKS--VIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKK--EWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNN---LKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYH---SLKLSDPNL---NSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDI---EVKKEFSFGSW 490
           ++ I +    K+M +  L  L+  +R+ +I+       H+  NLG+VEL++AL   FDSP D I +D GHQ YVHK++T RA +  ++R+ +GLSGF + NESIHD   TGHS   LS   G     + K +   ++PVIGD A++ G+AFEALN+I + K  +++++NDN MSI+ NVGALH+++ K + +   +   K   + L KK      K+  +  +    L        FFE LGF Y G +DG++   L + I   K+ K     GP +LHV T KG GY+ AE D KG +H     K+   +          +  + ++ +  L + D  I  I PAMT+ S      ++ P    DVGIAE+HA T AAG+A    K F++IYSTFLQR+YD ++HD+ R  L +   +DR  L  +DG++H G++DI FL S+PN ++    ++ E   ++  A +    P  +R+ +     +   E  KE   G+W
  S:     3 LESIKDPSFLKQMDIPALKQLSAEIRRFLIETLSKTGGHIGPNLGVVELTLALHKCFDSPNDKILWDVGHQSYVHKILTGRAGEFGSLRQYHGLSGFPKRNESIHDVWETGHSSTSLSAAMGMAVARDLKGEKSYIVPVIGDGALTGGMAFEALNHIGHEKRDIIVVLNDNEMSIAPNVGALHQVLGKLRTANK-YRRAKDELEFLLKKIPAVGGKLAATAERLKDSLKYLLVSGIFFEELGFTYLGPVDGHHFDALLENIQYAKKTK-----GPVLLHVVTKKGKGYEPAENDTKGAWHGTGQYKIETGDFIKPADAPPAWSKLVSDTVLSLAKEDARIVAITPAMTVGSKLERFQQELPERVYDVGIAEQHAATFAAGLATQGMKPFLAIYSTFLQRAYDQVVHDICRQNLNVFIGIDRAGLVGADGESHQGVFDIAFLLSLPNMVLMMPKDENEGHYMVYTALKYDGGPIAMRFPRGNGLGVALDEELKEIPLGTW 495
>gi|194564587|ref|YP_002099609.1| Deoxyxylulose-5-phosphate synthase [Burkholderia dolosa AUO158] >gi|124898247|gb|EAY70090.1| Deoxyxylulose-5-phosphate synthase [Burkholderia dolosa AUO158] (646 aa)
Score = 808, Expect = 6.0e-84, Identities = 185/479 (38%), Positives = 270/479 (56%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNK-TPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKG----KNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELD-----DKGLYHSLKLSDPNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFS 486
           +  I +  D +++   +L  LA  LR  ++D       HLSSNLG VEL++AL YVF++P D I +D GHQ Y HK++T R D++ T+R+  G+SGF   +ES +D   T HS   +S   G     + N   +  I VIGD A++ G+AFEA+NN   ++   +L+I+NDN MSIS  VGAL++ +++    +        + ++L        +   + +   KL +  KG       FE  GF+Y G IDG++L   I  L+ I+ +   GP  LHV T KG GYK AE D       G ++  +   P+     +TY  V   +L    E D+ +  I PAM   S  +   K+F + Y DVGIAE+HAVT A G+A    K  V+IYSTFLQR+YD L+HDVA   LP+ F +DR  L  +DG TH G YD+ F++ IPN  I  AS++ E  +++  A Q + NP  +RY +     +   KEF+
  S:    17 LKTIDDPADLRRLDRRQLQPLADELRAFVLDSVSKTGGHLSSNLGTVELTIALHYVFNTPNDRIVWDVGHQTYPHKILTGRRDQMHTLRQFGGISGFPRRSESEYDTFGTAHSSTSISAALGMAIGSQLNGDDRFSIAVIGDGAMTAGMAFEAMNNAGVSEDAKLLVILNDNDMSISPPVGALNRHLARLMSGRFYAAARAGVERVL-------SVAPPVLELARKLEEHAKGMVVPATLFEEFGFNYIGPIDGHDLDSLIPTLQNIRELR--GPQFLHVVTKKGQGYKLAEADPVLYHGPGKFNPAEGIKPSATPAKKTYTQVFGEWLCDEAERDSRVVGITPAMREGSGMVEFEKRFKDRYYDVGIAEQHAVTFAGGLATEGLKPVVAIYSTFLQRAYDQLIHDVALQNLPVVFAIDRAGLVGADGATHAGAYDLAFMRCIPNMTIMAASDENECRQMLHTALQ-QPNPTAVRYPRGAGTGVATVKEFT 497
>gi|168226934|ref|ZP_02652165.1| hypothetical protein Sententeric_14250 [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433] (620 aa)
Score = 808, Expect = 6.3e-84, Identities = 192/581 (33%), Positives = 326/581 (56%)
  Q:    32 LRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWS---IYKSFSKLSKFFKGK----NFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNSNNQT------YGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVK--KEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEK--VFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           LR+ ++D     S H +S LG VEL++AL YV+++P D + +D GHQ Y HK++T R DKI TIR+  GL  F    ES +D +S GHS   +S   G     +   K +  + VIGD AI+ G+AFEA+N+    +  ML+I+NDN MSIS+NVGAL+  +++        L+ K+   +   +E  KK++     I +   +  +  KG       FE LGF+Y G +DG+++   I+ LK ++++   GP  LH+ T KG GY+ AE  D   +H++   DP+     ++      Y  +  ++L +    D+ +  I PAM   S  +  S+KFP+ Y DV IAE+HAVT AAG+AI   K  V+IYSTFLQR+YD ++HDVA  +LP+ F +DR  +  +DG TH G +D+ +L+ IP+ +I   S++ E  +++   Y     P  +RY +   + + +   ++   G  +  ++    K  I+++G ++ +  K  +  +  L++  F+       +L + + +  +  +E+  +      G + +++A+   +   +  I + +  I  G +E+   +L +D   I A+IK+
  S:    35 LRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQLIWDVGHQAYPHKILTGRRDKIGTIRQKGGLHPFPWRGESEYDVLSVGHSSTSISAGIGIAVAAEKEGKDRRTVCVIGDGAITAGMAFEAMNHAGDIRPDMLVILNDNEMSISENVGALNNHLAQL-------LSGKLYSSL---REGGKKVFSGVPPIKELLKRTEEHIKGMVVPGTLFEELGFNYIGPVDGHDVMGLISTLKNMRDLK--GPQFLHIMTKKGRGYEPAE-KDPITFHAVPKFDPSSGCLPKSSGGLPGYSKIFGDWLCETAAKDSKLMAITPAMREGSGMVEFSRKFPDRYFDVAIAEQHAVTFAAGLAIGGYKPVVAIYSTFLQRAYDQVIHDVAIQKLPVMFAIDRAGIVGADGQTHQGAFDLSYLRCIPDMVIMTPSDENECRQMLFTGYHYNDGPTAVRYPRGNAQGVALTPLEKLPIGKGL--VKRHGEKLAILNFGTLMPEAAKVAEALNATLVDMRFVKPLDDTLILEMAAQHDALVTLEENAIMGGAGSGVNEVLMAHRKPVP--VLNIGLPDFFIPQGTQEEARAELGLDAAGIEAKIKA 617
>gi|168221989|ref|ZP_02647221.1| hypothetical protein Senterenterica_16441 [Salmonella enterica subsp. enterica serovar Agona str. SL483] (620 aa)
Score = 808, Expect = 6.3e-84, Identities = 192/581 (33%), Positives = 326/581 (56%)
  Q:    32 LRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWS---IYKSFSKLSKFFKGK----NFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNSNNQT------YGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVK--KEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEK--VFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           LR+ ++D     S H +S LG VEL++AL YV+++P D + +D GHQ Y HK++T R DKI TIR+  GL  F    ES +D +S GHS   +S   G     +   K +  + VIGD AI+ G+AFEA+N+    +  ML+I+NDN MSIS+NVGAL+  +++        L+ K+   +   +E  KK++     I +   +  +  KG       FE LGF+Y G +DG+++   I+ LK ++++   GP  LH+ T KG GY+ AE  D   +H++   DP+     ++      Y  +  ++L +    D+ +  I PAM   S  +  S+KFP+ Y DV IAE+HAVT AAG+AI   K  V+IYSTFLQR+YD ++HDVA  +LP+ F +DR  +  +DG TH G +D+ +L+ IP+ +I   S++ E  +++   Y     P  +RY +   + + +   ++   G  +  ++    K  I+++G ++ +  K  +  +  L++  F+       +L + + +  +  +E+  +      G + +++A+   +   +  I + +  I  G +E+   +L +D   I A+IK+
  S:    35 LRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQLIWDVGHQAYPHKILTGRRDKIGTIRQKGGLHPFPWRGESEYDVLSVGHSSTSISAGIGIAVAAEKEGKDRRTVCVIGDGAITAGMAFEAMNHAGDIRPDMLVILNDNEMSISENVGALNNHLAQL-------LSGKLYSSL---REGGKKVFSGVPPIKELLKRTEEHIKGMVVPGTLFEELGFNYIGPVDGHDVMGLISTLKNMRDLK--GPQFLHIMTKKGRGYEPAE-KDPITFHAVPKFDPSSGCLPKSSGGLPGYSKIFGDWLCETAAKDSKLMAITPAMREGSGMVEFSRKFPDRYFDVAIAEQHAVTFAAGLAIGGYKPVVAIYSTFLQRAYDQVIHDVAIQKLPVMFAIDRAGIVGADGQTHQGAFDLSYLRCIPDMVIMTPSDENECRQMLFTGYHYNDGPTAVRYPRGNAQGVALTPLEKLPIGKGL--VKRHGEKLAILNFGTLMPEAAKVAEALNATLVDMRFVKPLDDTLILEMAAQHDALVTLEENAIMGGAGSGVNEVLMAHRKPVP--VLNIGLPDFFIPQGTQEEARAELGLDAAGIEAKIKA 617
>gi|16763802|ref|NP_459417.1| 1-deoxy-D-xylulose-5-phosphate synthase [Salmonella typhimurium LT2] >gi|62179033|ref|YP_215450.1| 1-deoxy-D-xylulose-5-phosphate synthase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|161615390|ref|YP_001589355.1| 1-deoxy-D-xylulose-5-phosphate synthase [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|167558927|ref|ZP_02351936.1| hypothetical protein Sententeri_19054 [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853] >gi|167992272|ref|ZP_02573370.1| hypothetical protein Sententer_01000012_0100012540 [Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701] >gi|168261145|ref|ZP_02683118.1| hypothetical protein Salmentericaenterica_08659 [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] >gi|168465512|ref|ZP_02699394.1| 1-deoxy-D-xylulose-5-phosphate synthase [Salmonella enterica subsp. enterica serovar Newport str. SL317] >gi|168476032|ref|ZP_02705055.1| hypothetical protein Salmoentericaenterica_15321 [Salmonella enterica subsp. enterica serovar Virchow str. SL491] >gi|194443160|ref|YP_002039664.1| 1-deoxy-D-xylulose-5-phosphate synthase [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194738296|ref|YP_002113455.1| 1-deoxy-D-xylulose-5-phosphate synthase [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|189027785|sp|A9MX09|DXS_SALPB 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|21263525|sp|Q8ZRD1|DXS_SALTY 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|75484590|sp|Q57SE2|DXS_SALCH 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|16418927|gb|AAL19376.1| 1-deoxyxylulose-5-phosphate synthase; flavoprotein [Salmonella typhimurium LT2] >gi|62126666|gb|AAX64369.1| 1-deoxyxylulose-5-phosphate synthase; flavoprotein [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|161364754|gb|ABX68522.1| hypothetical protein SPAB_03161 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|194401823|gb|ACF62045.1| 1-deoxy-D-xylulose-5-phosphate synthase [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194713798|gb|ACF93019.1| 1-deoxy-D-xylulose-5-phosphate synthase [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|195631764|gb|EDX50284.1| 1-deoxy-D-xylulose-5-phosphate synthase [Salmonella enterica subsp. enterica serovar Newport str. SL317] (620 aa)
Score = 808, Expect = 6.3e-84, Identities = 192/581 (33%), Positives = 326/581 (56%)
  Q:    32 LRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWS---IYKSFSKLSKFFKGK----NFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNSNNQT------YGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVK--KEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEK--VFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           LR+ ++D     S H +S LG VEL++AL YV+++P D + +D GHQ Y HK++T R DKI TIR+  GL  F    ES +D +S GHS   +S   G     +   K +  + VIGD AI+ G+AFEA+N+    +  ML+I+NDN MSIS+NVGAL+  +++        L+ K+   +   +E  KK++     I +   +  +  KG       FE LGF+Y G +DG+++   I+ LK ++++   GP  LH+ T KG GY+ AE  D   +H++   DP+     ++      Y  +  ++L +    D+ +  I PAM   S  +  S+KFP+ Y DV IAE+HAVT AAG+AI   K  V+IYSTFLQR+YD ++HDVA  +LP+ F +DR  +  +DG TH G +D+ +L+ IP+ +I   S++ E  +++   Y     P  +RY +   + + +   ++   G  +  ++    K  I+++G ++ +  K  +  +  L++  F+       +L + + +  +  +E+  +      G + +++A+   +   +  I + +  I  G +E+   +L +D   I A+IK+
  S:    35 LRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQLIWDVGHQAYPHKILTGRRDKIGTIRQKGGLHPFPWRGESEYDVLSVGHSSTSISAGIGIAVAAEKEGKDRRTVCVIGDGAITAGMAFEAMNHAGDIRPDMLVILNDNEMSISENVGALNNHLAQL-------LSGKLYSSL---REGGKKVFSGVPPIKELLKRTEEHIKGMVVPGTLFEELGFNYIGPVDGHDVMGLISTLKNMRDLK--GPQFLHIMTKKGRGYEPAE-KDPITFHAVPKFDPSSGCLPKSSGGLPGYSKIFGDWLCETAAKDSKLMAITPAMREGSGMVEFSRKFPDRYFDVAIAEQHAVTFAAGLAIGGYKPVVAIYSTFLQRAYDQVIHDVAIQKLPVMFAIDRAGIVGADGQTHQGAFDLSYLRCIPDMVIMTPSDENECRQMLFTGYHYNDGPTAVRYPRGNAQGVALTPLEKLPIGKGL--VKRHGEKLAILNFGTLMPEAAKVAEALNATLVDMRFVKPLDDTLILEMAAQHDALVTLEENAIMGGAGSGVNEVLMAHRKPVP--VLNIGLPDFFIPQGTQEEARAELGLDAAGIEAKIKA 617
>gi|189352477|ref|YP_001948104.1| 1-deoxy-D-xylulose-5-phosphate synthase [Burkholderia multivorans ATCC 17616] >gi|189336499|dbj|BAG45568.1| 1-deoxy-D-xylulose-5-phosphate synthase [Burkholderia multivorans ATCC 17616] (634 aa)
Score = 807, Expect = 6.9e-84, Identities = 185/479 (38%), Positives = 270/479 (56%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNK-TPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKG----KNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELD-----DKGLYHSLKLSDPNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFS 486
           +  I +  D +++   +L  LA  LR  ++D       HLSSNLG VEL++AL YVF++P D I +D GHQ Y HK++T R D++ T+R+  G+SGF   +ES +D   T HS   +S   G     + N   +  I VIGD A++ G+AFEA+NN   ++   +L+I+NDN MSIS  VGAL++ +++    +        + ++L        +   + +   KL +  KG       FE  GF+Y G IDG++L   I  L+ I+ +   GP  LHV T KG GYK AE D       G ++  +   P+     +TY  V   +L    E D+ +  I PAM   S  +   K+F + Y DVGIAE+HAVT A G+A    K  V+IYSTFLQR+YD L+HDVA   LP+ F +DR  L  +DG TH G YD+ F++ IPN  I  AS++ E  +++  A Q + NP  +RY +     +   KEF+
  S:     5 LKTIDDPADLRRLDRRQLQPLADELRAFVLDSVSKTGGHLSSNLGTVELTIALHYVFNTPNDRIVWDVGHQTYPHKILTGRRDEMPTLRQLGGISGFPRRSESEYDTFGTAHSSTSISAALGMAIGSQLNGDDRFSIAVIGDGAMTAGMAFEAMNNAGVSEDAKLLVILNDNDMSISPPVGALNRHLARLMSGRFYAAARAGVERVL-------SVAPPVLELARKLEEHAKGMVVPATLFEEFGFNYIGPIDGHDLDSLIPTLQNIRELR--GPQFLHVVTKKGQGYKLAEADPVLYHGPGKFNPAEGIKPSATPAKKTYTQVFGEWLCDEAERDSRVVGITPAMREGSGMVEFEKRFKDRYYDVGIAEQHAVTFAGGLATEGLKPVVAIYSTFLQRAYDQLIHDVALQNLPVVFAIDRAGLVGADGATHAGAYDLAFMRCIPNMTIMAASDENECRQMLHTALQ-QPNPTAVRYPRGAGTGVATVKEFT 485
>gi|161521356|ref|YP_001584783.1| 1-deoxy-D-xylulose-5-phosphate synthase [Burkholderia multivorans ATCC 17616] >gi|160345406|gb|ABX18491.1| deoxyxylulose-5-phosphate synthase [Burkholderia multivorans ATCC 17616] (646 aa)
Score = 807, Expect = 6.9e-84, Identities = 185/479 (38%), Positives = 270/479 (56%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNK-TPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKG----KNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELD-----DKGLYHSLKLSDPNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFS 486
           +  I +  D +++   +L  LA  LR  ++D       HLSSNLG VEL++AL YVF++P D I +D GHQ Y HK++T R D++ T+R+  G+SGF   +ES +D   T HS   +S   G     + N   +  I VIGD A++ G+AFEA+NN   ++   +L+I+NDN MSIS  VGAL++ +++    +        + ++L        +   + +   KL +  KG       FE  GF+Y G IDG++L   I  L+ I+ +   GP  LHV T KG GYK AE D       G ++  +   P+     +TY  V   +L    E D+ +  I PAM   S  +   K+F + Y DVGIAE+HAVT A G+A    K  V+IYSTFLQR+YD L+HDVA   LP+ F +DR  L  +DG TH G YD+ F++ IPN  I  AS++ E  +++  A Q + NP  +RY +     +   KEF+
  S:    17 LKTIDDPADLRRLDRRQLQPLADELRAFVLDSVSKTGGHLSSNLGTVELTIALHYVFNTPNDRIVWDVGHQTYPHKILTGRRDEMPTLRQLGGISGFPRRSESEYDTFGTAHSSTSISAALGMAIGSQLNGDDRFSIAVIGDGAMTAGMAFEAMNNAGVSEDAKLLVILNDNDMSISPPVGALNRHLARLMSGRFYAAARAGVERVL-------SVAPPVLELARKLEEHAKGMVVPATLFEEFGFNYIGPIDGHDLDSLIPTLQNIRELR--GPQFLHVVTKKGQGYKLAEADPVLYHGPGKFNPAEGIKPSATPAKKTYTQVFGEWLCDEAERDSRVVGITPAMREGSGMVEFEKRFKDRYYDVGIAEQHAVTFAGGLATEGLKPVVAIYSTFLQRAYDQLIHDVALQNLPVVFAIDRAGLVGADGATHAGAYDLAFMRCIPNMTIMAASDENECRQMLHTALQ-QPNPTAVRYPRGAGTGVATVKEFT 497
>gi|56414423|ref|YP_151498.1| 1-deoxy-D-xylulose-5-phosphate synthase [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|81599422|sp|Q5PFR6|DXS_SALPA 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|56128680|gb|AAV78186.1| 1-deoxyxylulose-5-phosphate synthase [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] (620 aa)
Score = 807, Expect = 7.2e-84, Identities = 192/581 (33%), Positives = 326/581 (56%)
  Q:    32 LRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWS---IYKSFSKLSKFFKGK----NFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNSNNQT------YGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVK--KEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEK--VFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           LR+ ++D     S H +S LG VEL++AL YV+++P D + +D GHQ Y HK++T R DKI TIR+  GL  F    ES +D +S GHS   +S   G     +   K +  + VIGD AI+ G+AFEA+N+    +  ML+I+NDN MSIS+NVGAL+  +++        L+ K+   +   +E  KK++     I +   +  +  KG       FE LGF+Y G +DG+++   I+ LK ++++   GP  LH+ T KG GY+ AE  D   +H++   DP+     ++      Y  +  ++L +    D+ +  I PAM   S  +  S+KFP+ Y DV IAE+HAVT AAG+AI   K  V+IYSTFLQR+YD ++HDVA  +LP+ F +DR  +  +DG TH G +D+ +L+ IP+ +I   S++ E  +++   Y     P  +RY +   + + +   ++   G  +  ++    K  I+++G ++ +  K  +  +  L++  F+       +L + + +  +  +E+  +      G + +++A+   +   +  I + +  I  G +E+   +L +D   I A+IK+
  S:    35 LRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQLIWDVGHQAYPHKILTGRRDKIGTIRQKGGLHPFPWRGESEYDVLSVGHSSTSISAGIGIAVAAEKEGKDRHTVCVIGDGAITAGMAFEAMNHAGDIRPDMLVILNDNEMSISENVGALNNHLAQL-------LSGKLYSSL---REGGKKVFSGVPPIKELLKRTEEHIKGMVVPGTLFEELGFNYIGPVDGHDVMGLISTLKNMRDLK--GPQFLHIMTKKGRGYEPAE-KDPITFHAVPKFDPSSGCLPKSSGGLPGYSKIFGDWLCETAAKDSKLMAITPAMREGSGMVEFSRKFPDRYFDVAIAEQHAVTFAAGLAIGGYKPVVAIYSTFLQRAYDQVIHDVAIQKLPVMFAIDRAGIVGADGQTHQGAFDLSYLRCIPDMVIMTPSDENECRQMLFTGYHYNDGPTAVRYPRGNAQGVALTPLEKLPIGKGL--VKRHGEKLAILNFGTLMPEAAKVAEALNATLVDMRFVKPLDDTLILEMAAQHDALVTLEENAIMGGAGSGVNEVLMAHRKPVP--VLNIGLPDLFIPQGTQEEARAELGLDAAGIEAKIKA 617
>gi|194559764|ref|YP_002094789.1| Deoxyxylulose-5-phosphate synthase [Burkholderia cenocepacia PC184] >gi|124875280|gb|EAY65270.1| Deoxyxylulose-5-phosphate synthase [Burkholderia cenocepacia PC184] (646 aa)
Score = 807, Expect = 8.1e-84, Identities = 184/479 (38%), Positives = 270/479 (56%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTP-MLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKG----KNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELD-----DKGLYHSLKLSDPNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFS 486
           +  I +  D +++   +L  LA  LR  ++D       HLSSNLG VEL++AL YVF++P D I +D GHQ Y HK++T R D++ ++R+ +G+SGF   +ES +D   T HS   +S   G     + N   +  I VIGD A++ G+AFEA+NN   ++   +L+I+NDN MSIS  VGAL++ +++    +        + ++L        +   + +   KL +  KG       FE  GF+Y G IDG++L   I  L+ I+ +   GP  LHV T KG GYK AE D       G ++  +   P+     +TY  V   +L    E D  +  I PAM   S  +   K+F + Y DVGIAE+HAVT A G+A    K  V+IYSTFLQR+YD L+HDVA   LP+ F +DR  L  +DG TH G YD+ F++ IPN  I  AS++ E  +++  A Q + NP  +RY +     +   KEF+
  S:    17 LKTIDDPADLRRLDRRQLQPLADELRAFVLDSVSKTGGHLSSNLGTVELTIALHYVFNTPNDRIVWDVGHQTYPHKILTGRRDQMHSLRQYDGISGFPRRSESEYDTFGTAHSSTSISAALGMAIGSQLNGDDRFSIAVIGDGAMTAGMAFEAMNNAGVSENAKLLVILNDNDMSISPPVGALNRHLARLMSGRFYAAARAGVERVL-------SVAPPVLELARKLEEHAKGMVVPATLFEEFGFNYIGPIDGHDLDSLIPTLQNIRELR--GPQFLHVVTKKGQGYKLAEADPVLYHGPGKFNPAEGIKPSTTPAKKTYTQVFGEWLCDEAERDTRVVGITPAMREGSGMVEFEKRFKDRYYDVGIAEQHAVTFAGGLATEGLKPVVAIYSTFLQRAYDQLIHDVALQNLPVVFAIDRAGLVGADGATHAGAYDLAFMRCIPNMTIMAASDENECRQMLHTALQ-QPNPTAVRYPRGAGTGVATVKEFT 497
>gi|170736030|ref|YP_001777290.1| deoxyxylulose-5-phosphate synthase [Burkholderia cenocepacia MC0-3] >gi|119368197|sp|Q1BLY7|DXS_BURCA 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|169818218|gb|ACA92800.1| deoxyxylulose-5-phosphate synthase [Burkholderia cenocepacia MC0-3] (634 aa)
Score = 806, Expect = 8.6e-84, Identities = 184/479 (38%), Positives = 270/479 (56%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNK-TPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKG----KNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELD-----DKGLYHSLKLSDPNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFS 486
           +  I +  D +++   +L  LA  LR  ++D       HLSSNLG VEL++AL YVF++P D I +D GHQ Y HK++T R D++ ++R+ +G+SGF   +ES +D   T HS   +S   G     + N   +  I VIGD A++ G+AFEA+NN   ++   +L+I+NDN MSIS  VGAL++ +++    +        + ++L        +   + +   KL +  KG       FE  GF+Y G IDG++L   I  L+ I+ +   GP  LHV T KG GYK AE D       G ++  +   P+     +TY  V   +L    E D  +  I PAM   S  +   K+F + Y DVGIAE+HAVT A G+A    K  V+IYSTFLQR+YD L+HDVA   LP+ F +DR  L  +DG TH G YD+ F++ IPN  I  AS++ E  +++  A Q + NP  +RY +     +   KEF+
  S:     5 LKTIDDPADLRRLDRRQLQPLADELRAFVLDSVSKTGGHLSSNLGTVELTIALHYVFNTPNDRIVWDVGHQTYPHKILTGRRDQMHSLRQYDGISGFPRRSESEYDTFGTAHSSTSISAALGMAIGSQLNGDDRFSIAVIGDGAMTAGMAFEAMNNAGVSEDAKLLVILNDNDMSISPPVGALNRHLARLMSGRFYAAARAGVERVL-------SVAPPVLELARKLEEHAKGMVVPATLFEEFGFNYIGPIDGHDLDSLIPTLQNIRELR--GPQFLHVVTKKGQGYKLAEADPVLYHGPGKFNPAEGIKPSTTPAKKTYTQVFGEWLCDEAERDTRVVGITPAMREGSGMVEFEKRFKDRYYDVGIAEQHAVTFAGGLATEGLKPVVAIYSTFLQRAYDQLIHDVALQNLPVVFAIDRAGLVGADGATHAGAYDLAFMRCIPNMTIMAASDENECRQMLHTALQ-QPNPTAVRYPRGAGTGVATVKEFT 485
>gi|107026830|ref|YP_624341.1| 1-deoxy-D-xylulose-5-phosphate synthase [Burkholderia cenocepacia AU 1054] >gi|116691976|ref|YP_837509.1| 1-deoxy-D-xylulose-5-phosphate synthase [Burkholderia cenocepacia HI2424] >gi|123461833|sp|A0AYZ0|DXS_BURCH 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|105896204|gb|ABF79368.1| 1-Deoxy-D-xylulose-5-phosphate synthase [Burkholderia cenocepacia AU 1054] >gi|116649976|gb|ABK10616.1| 1-Deoxy-D-xylulose-5-phosphate synthase [Burkholderia cenocepacia HI2424] (646 aa)
Score = 806, Expect = 8.6e-84, Identities = 184/479 (38%), Positives = 270/479 (56%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNK-TPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKG----KNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELD-----DKGLYHSLKLSDPNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFS 486
           +  I +  D +++   +L  LA  LR  ++D       HLSSNLG VEL++AL YVF++P D I +D GHQ Y HK++T R D++ ++R+ +G+SGF   +ES +D   T HS   +S   G     + N   +  I VIGD A++ G+AFEA+NN   ++   +L+I+NDN MSIS  VGAL++ +++    +        + ++L        +   + +   KL +  KG       FE  GF+Y G IDG++L   I  L+ I+ +   GP  LHV T KG GYK AE D       G ++  +   P+     +TY  V   +L    E D  +  I PAM   S  +   K+F + Y DVGIAE+HAVT A G+A    K  V+IYSTFLQR+YD L+HDVA   LP+ F +DR  L  +DG TH G YD+ F++ IPN  I  AS++ E  +++  A Q + NP  +RY +     +   KEF+
  S:    17 LKTIDDPADLRRLDRRQLQPLADELRAFVLDSVSKTGGHLSSNLGTVELTIALHYVFNTPNDRIVWDVGHQTYPHKILTGRRDQMHSLRQYDGISGFPRRSESEYDTFGTAHSSTSISAALGMAIGSQLNGDDRFSIAVIGDGAMTAGMAFEAMNNAGVSEDAKLLVILNDNDMSISPPVGALNRHLARLMSGRFYAAARAGVERVL-------SVAPPVLELARKLEEHAKGMVVPATLFEEFGFNYIGPIDGHDLDSLIPTLQNIRELR--GPQFLHVVTKKGQGYKLAEADPVLYHGPGKFNPAEGIKPSTTPAKKTYTQVFGEWLCDEAERDTRVVGITPAMREGSGMVEFEKRFKDRYYDVGIAEQHAVTFAGGLATEGLKPVVAIYSTFLQRAYDQLIHDVALQNLPVVFAIDRAGLVGADGATHAGAYDLAFMRCIPNMTIMAASDENECRQMLHTALQ-QPNPTAVRYPRGAGTGVATVKEFT 497
>gi|127513699|ref|YP_001094896.1| 1-deoxy-D-xylulose-5-phosphate synthase [Shewanella loihica PV-4] >gi|166201537|sp|A3QGN9|DXS_SHELP 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|126638994|gb|ABO24637.1| deoxyxylulose-5-phosphate synthase [Shewanella loihica PV-4] (622 aa)
Score = 806, Expect = 8.7e-84, Identities = 200/598 (33%), Positives = 323/598 (54%)
  Q:    15 EDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI---EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLT-----EKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNSN------NQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCE---DIEVKKEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           ++ +++    L  LA  LR  ++      S H +S LG VEL++AL YV+++P D + +D GHQ Y HK++T R DK+ TIR+  G+  F    ES +D  S GHSG  +S         EK  +  K V+ VIGD A++ G+ FEA+N+       ML+++NDN MSIS+NVGAL+  +++  MS  ++ T     +K+L+ +   KE +K+       +   L         FE LGF+Y G IDG+++   +  L+ ++N+   GP ILH+ T KG GY+ AE D  G +H++   DP+  +       N T+  V   +L  + + D+ +  I PAM   S  +  S++FPN Y D  IAE+HAVT AAG A    K  ++IYSTFLQR YD L+HDVA  +LP+ F +DR  +   DG TH G +D+ ++++IPN +I   S++ E  +++   Y     P  IRY +        +E    +  G  +   + K  K  I+++G  +    +  +     L +  F+     E V ++ +++  +  VE+       G  ++ L  + KL   +  I + +  I  G   +I  +L +D   I A+I++
  S:    18 DELRQLPQGVLPKLADELRSYLLQSVGISSGHFASGLGTVELTVALHYVYNTPFDRLIWDVGHQAYPHKILTGRRDKMPTIRQKGGIHPFPWREESEYDTFSVGHSGTSISAALAMAVAAEKEQAGRK-VVAVIGDGAMTGGMVFEAMNHAGDLHNDMLVVLNDNEMSISENVGALNNHLAQL-MSGRLYTTIRENSKKVLKGMPVIKEMAKR-------TEEHLKGMVVPGTMFEELGFNYIGPIDGHDVDALVETLRNMRNLS--GPQILHIMTKKGRGYEPAEKDPIG-WHAVPKFDPSTFAKPAAKPANPTFSQVFGRWLCDMAQKDDKVLGITPAMREGSGMVEFSQRFPNQYFDAAIAEQHAVTLAAGFACEGYKPVLAIYSTFLQRGYDQLIHDVALQKLPVIFAIDRGGIVGPDGPTHQGAFDLSYMRAIPNMVIMAPSDENECRQMLYTGYCYNEGPTAIRYPRGSATGEPQVETMTAYEIGKGLIKREGK--KIAILNFGTTLASASQAAEALDATLADMRFVKPLDVELVKQLATSHDLLVTVEENAIMGGAGSGVLELLQQLKLPMPVLNIGLPDEFIKHGECGEILAELQLDGPGIEAQIRA 618
>gi|88799590|ref|ZP_01115166.1| 1-deoxy-D-xylulose-5-phosphate synthase [Reinekea sp. MED297] >gi|88777675|gb|EAR08874.1| 1-deoxy-D-xylulose-5-phosphate synthase [Reinekea sp. MED297] (626 aa)
Score = 806, Expect = 9.5e-84, Identities = 187/599 (31%), Positives = 324/599 (54%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFL----TEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPF-GPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLN-----SNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYALQTKESKT-------CIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSI 606
           +D +    D +++ +H+L  LA  LR+ ++        H  + LG+VEL++AL YV+D+P+D + +D GHQ Y HK++T R +++ TIR+  GL  F    ES +D    GHS   +S   G    ++    ++  + VIGD A++ G+AFEALN+  ++   ML+++NDN MSIS+NVGAL+K  ++   SK+       ++K+L+ +    E+++K       +   +         FE LGF+Y G +DG+++   I++++ ++NI  F GP  LHV T KG G+  AE ++   YH++   +P        +    Y +V   +L  +   D  +  + PAM   S+ +  S  +P  Y DV IAE+HAVT A GMA    K  V+IYSTFLQR+YD L+HD+A   L + F +DR  L   DG TH G +D  +L+ IPN ++    ++ E   ++   Y+    P  +RY +     +++ K         ALQ  +S+T        I+++G ++   ++  +     L+N  FI    ++ V+++  +++ +  VE+       G  +    N+N+L+C   ++ + +  I       +  ++ +D   I
  S:    17 LDTVETPADLRQLPMHQLPQLADELREYLLFSVGQSGGHFGAGLGVVELTIALHYVYDTPEDKLVWDVGHQAYPHKVLTGRREQLPTIRQEGGLHAFPHRGESEYDTFGVGHSSTSISAALGMAIADRRKGNARQTVAVIGDGALTAGMAFEALNHAGHDGANMLVVLNDNDMSISENVGALNKAFARVFSSKTYSHLRENSKKVLKNLPPMLEFARK-------AEEHMKGMVAPGTLFEELGFNYVGPVDGHDV---IDLVQTLQNIRTFSGPQFLHVATQKGKGFIPAE-NEPIKYHAITKIEPQSEQAGAAAAKPKYSNVFGQWLCDMAARDERLLGVTPAMREGSDLVAFSSLYPERYHDVAIAEQHAVTVAGGMACEGMKPVVAIYSTFLQRAYDQLIHDIALQNLDVLFAIDRAGLVGEDGPTHAGSFDYTYLRCIPNMVVMAPKDEAECRAMLTTGYE-YPGPAAVRYPRGTGPGVDIPKTLE------ALQIGQSETLREGRRIAILAFGSMVEPCRQVAEALDATLVNMRFIKPLDQDRVIQLAQSHELLVTVEENAIMGGAGSAVTETLNQNQLTCACLQLGLPDAYIDHAKPARMLSQVGLDATGI 616
>gi|118579621|ref|YP_900871.1| 1-deoxy-D-xylulose-5-phosphate synthase [Pelobacter propionicus DSM 2379] >gi|118502331|gb|ABK98813.1| 1-Deoxy-D-xylulose-5-phosphate synthase [Pelobacter propionicus DSM 2379] (624 aa)
Score = 806, Expect = 9.5e-84, Identities = 201/599 (33%), Positives = 317/599 (52%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILS--ICQGFIEKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEK-----ILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSD-----PNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEF-SFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKS-----IDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLS-CNIKKINIRNNKIGFGNKEDIDKKLNIDMNSI 606
           ++ I + +D KK+K   LLDLA  +R+ +++       HL SNLG VELS+ALLY FDSP D I +D GHQ Y HK++T R D+  T R+  GLSGF + +ES HD    GHS   +S  +               I VIGD +++ G+AFEALN   + K  +++I+NDN MSISKNVGA    +S+ +M+   F   K     +LR I         I     ++ + L  F    + FE+LGF Y G +DG++L + I V   I  +   GP ++HV T KG GYK AE ++   +H +   D        +++ ++Y  +    +  L E D  +  I  AM   +     S++FP  + DVGIAE+HA+T AAG+A    +   +IYSTF+QR+YD + HD+   +LP+T  +DR  L   DG THHG+ D  FL+ IP   +    ++ EL  ++  A  +   P  +RY +     +E+ ++  +       L  + S  C+I+ G  +    +   +       + ++NA FI     E +L +  +   I  VE+       G  ++ L N+N +    ++++ I +  +  G++  + + L ID   I
  S:     5 LNHIDSPDDLKKLKPEHLLDLAAEVRRFLLEKVSVTGGHLGSNLGTVELSIALLYCFDSPNDKIIWDVGHQAYTHKILTGRRDRFHTQRQYKGLSGFPKRSESEHDAFGVGHSSTSISAALGMAAAADLAGAKNHAIAVIGDGSLTGGMAFEALNQAGHLKKDLIVILNDNEMSISKNVGAFSSFISR-KMTGRYFRDLKKEMQGLLRNI---PAIGSDILHFARRAENSLKSFLTPGSLFEALGFDYLGPLDGHDLPQLIEVFNNINQLD--GPLLVHVMTTKGKGYKPAE-ENPDKFHGVGPFDIVTGKATSSTSARSYTELFGEAMVDLAEQDPRVVAITAAMRDGTGLKTFSERFPKRFFDVGIAEQHAMTFAAGLAADGFRPVTAIYSTFVQRAYDQVFHDICLQKLPVTIAMDRAGLVGDDGPTHHGVMDYSFLRHIPGLALMAPKDENELRHMLKTAVTS-GVPISLRYPRGAGMGVELDRDLKTLDIGRGELLMEGSDICLIAIGSTVYPALQAAHSLQGLGVRVGVVNARFIKPLDAELILSVAGSCGRIMTVEENLLQGGFGSAVLELLNDNNMQDVIVRRLGIPDRFVEHGSQARLRQDLGIDAEGI 614
>gi|118444521|ref|YP_878056.1| 1-deoxy-D-xylulose-5-phosphate synthase [Clostridium novyi NT] >gi|166198611|sp|A0Q0A4|DXS_CLONN 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|118134977|gb|ABK62021.1| 1-deoxy-D-xylulose-5-phosphate synthase [Clostridium novyi NT] (623 aa)
Score = 806, Expect = 1.0e-83, Identities = 206/595 (34%), Positives = 330/595 (55%)
  Q:    16 DFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKSK--SVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNS----NNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTK-EKCEDIEVKKEFSFGSWVYALQTKESKTCIISYGDII-NDLKKEIKTKS----IDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANE----NKLSCNIKKINI--RNNKIGFGNKEDIDKKLNIDMNSIFAEI 610
           + +KM   +L   A  +R  +I+       HL+SNLG+VEL++AL  VFD  +D I +D GHQ YVHK++T RAD+   +R+  G+SGF +  ES +DF  TGHS   +S   G     + K++  +V+ VIGD A++ G+A EALN++   KT +++I+NDN MSI KNVG +   +S+ ++       +     +L K      +  S+ K  S + +      FFE +G  Y G IDG+N+K+   V+   KN+   GP ++H  T KG GYK AE  D   +H +   + +       +  TY     + + +L E D  I  I  AM   +     S+K+P  + DVGIAE+HAVT AAGMA +  K   ++YSTFLQR+YD ++HDV    LP+ F +DR  +  SDG+TH G++D+ FL  +PN  I C  +  E++ ++  A  N+++P  IRY +     ++  K ++  G W   L+T E    +I+ G ++   +K + K K+    I +INA F+    K  + +++S    I  +E    S   G+ ++  AN     N ++   K +N+   +  I  G+ + + K  N+D++ +   I
  S:    13 ELRKMSFSDLDKFAQEIRNFLINKISKTGGHLASNLGVVELTLALYKVFDLDKDKIVWDVGHQTYVHKILTGRADRFDNLRQFGGMSGFPKRCESKYDFFETGHSSTSISAALGMARARDLKNEKCNVVAVIGDGALTGGMAIEALNDVGDKKTNLIVILNDNQMSIGKNVGGVSTYLSRIRIDPKYNKFKADFNDVLRKTNIGTGVADSLSKLKSGIKQMLVPGMFFEEMGIKYLGPIDGHNIKELTEVINTAKNLN--GPVLIHTITQKGKGYKFAE-KDPNRFHGIGAFNLDTGKVSKISGDTYSKAFGDAIVELAEEDKRIVAITAAMRDGTGLKKFSEKYPKRFFDVGIAEQHAVTLAAGMAQSGLKPIFAVYSTFLQRAYDQVIHDVCHQNLPVVFAIDRAGIVGSDGETHQGVFDLSFLNHMPNMTIMCPKSLHEVKYMLKWA-ANQNSPVAIRYPRGGDSIELSAKTDYIVGKW-EVLKT-EGNIALIATGKMVATAIKVQEKMKAMGVNITVINACFVKPIDKSIIKKLVSKNYKIITLEDNVLSGGFGESVLQYANSLITTNSINSESKVVNLGFDDKFIPHGSVDILYKANNLDVDGVVKNI 619
>gi|78045077|ref|YP_360804.1| 1-deoxy-D-xylulose-5-phosphate synthase [Carboxydothermus hydrogenoformans Z-2901] >gi|118595500|sp|Q3AAN0|DXS_CARHZ 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|77997192|gb|ABB16091.1| 1-deoxy-D-xylulose-5-phosphate synthase [Carboxydothermus hydrogenoformans Z-2901] (622 aa)
Score = 806, Expect = 1.0e-83, Identities = 196/546 (35%), Positives = 300/546 (54%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKSKS--VIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQM----SKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKL---SDPNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYALQTKESKTCIISYGDIIN-----DLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEK 553
           +++I   ED KK+K  EL+ LA  LR+ II ++     HL+ +LG+VEL++AL +VF++P+D I +D GHQ Y HK++T R  +  T+R   GLSGF + +ES +D    GHS   +S   G     + K +   V+ VIGD A++ G+AFEALN+  + +  +++++NDN MSI++NVGAL   +S+ +     S+     E +++KI        KI   +  SF  L     G   FE LGF Y G IDG+N+K+ I V  R K     GP ++HV T KG GY  AE +  G +   K    +   + +   ++  V    L +L +    +  I  AM   +     ++ +P  + DVGIAE+HAVT AAGMA    K  V+IYSTFLQRS+D ++HDV    LP+ F VDR  +   DG THHGI+D+ +L+ IPN  I    N+  L +++  A  N S P  +RY +     +E+            +  + S   +I  G  +N       K E +  S+ +I+A F+     + +  + S +K +  VE+
  S:     5 LERISLPEDIKKLKPSELMALAQELREYIITVASQNGGHLAPSLGVVELTIALHFVFEAPKDKIIWDVGHQAYAHKILTGRKKQFKTLRTFGGLSGFPKRDESPYDAFGVGHSSTSISAALGMALARDLKGEQYEVVAVIGDGALTGGMAFEALNHAGHLQKKLIVVVNDNEMSIAQNVGALSAYLSRIRTDPKYSRGKDELEALIKKIPHIGPTMVKIGERLKDSFKYL--LVPGM-LFEELGFTYLGPIDGHNIKEMIEVFSRAKTFA--GPVVVHVITKKGKGYHWAEENPDGFHGVGKFYISTGEPVEAPRVSFTEVFGKALVELAQDRPEVVAITAAMPTGTGLNYFAQNYPERFYDVGIAEQHAVTMAAGMACEGLKPVVAIYSTFLQRSFDQIIHDVCLQNLPVVFAVDRAGIVGEDGPTHHGIFDLSYLRMIPNLTIMVPRNEDMLRKMLFTAL-NHSGPVALRYPRGAAVGVELTPYEQLPIGTAEILKEGSDGVVIGVGRPLNYALKAAQKLENEGISLTVIDARFVKPLDYKLLEEVGSLHKPVITVEE 558
>gi|154493755|ref|ZP_02033075.1| hypothetical protein PARMER_03096 [Parabacteroides merdae ATCC 43184] >gi|154086505|gb|EDN85550.1| hypothetical protein PARMER_03096 [Parabacteroides merdae ATCC 43184] (635 aa)
Score = 805, Expect = 1.1e-83, Identities = 207/609 (33%), Positives = 323/609 (53%)
  Q:     3 KNKVKIDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKN---NSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSV----FLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDK-----GLYHS--------LKLSDPNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYALQTKE-SKTCIISYGDIINDLKKEIKTKSIDLI-----NAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIK 611
           K++  ++ I   ED +K+   +L ++   LR+ IID+      HL ++LG VEL++AL YVF++P D I +D GHQ Y HK++T R +   T+R+  G+SGF  P ES +D    GH+ N +S   G    +     K + VI VIGD A++ GLAFE LNN + N   +LII+NDN M+I   VG L + +     S++     +   + LRK+       +        S   L    +  N FE     YFG IDG+++   I VL  IK++   GP +LH+KT KG G+K AE         GL++          KL++P      Q Y  V  + L +L E D  I  + PAM    +   + K FP    DVGIAE H+VT +AG+A      F ++YS+F+QR+YD ++HDVA   L +   +DR  L   DG THHG++D+ +L+ +PN +I+   N+ +L  L+   Y+  + PF IRY + K E  + + E          + ++     I+S G I N++ K IK    D I     + +F+    +E +  +   +  +  VE       LG  ++    +N  +  +K+I + +  +  G+  ++ K   +D  SI  EIK
  S:     5 KDEHILNSIDYPEDLRKLSPDKLGEVCAELRQYIIDVLSENPGHLGASLGTVELTVALHYVFNTPYDRIVWDVGHQAYGHKILTGRREAFHTLRKFKGISGFPNPLESPYDAFVAGHASNSISAAMGMSVASALKGEKDRHVIAVIGDGAMTGGLAFEGLNNASANPNNLLIILNDNDMAIDHAVGGLSQYLVDITTSQAYNKMRYDVYRGLRKMKLINNDRRGNILRFNNSLKAL--LTQQHNLFEGFSIRYFGPIDGHDVGYMIKVLNDIKDME--GPKLLHIKTKKGKGFKPAEKSATEWHAPGLFNKETGERIIVHKLNEP------QLYQDVFGHTLVELAEQDERIVGVTPAMPTGCSMTYMMKAFPKRAFDVGIAEGHSVTFSAGLAKEGMIPFCNVYSSFMQRAYDMVIHDVALQNLHMVICLDRAGLVGEDGATHHGVFDLAYLRPVPNLVISSPLNELDLRNLMYTGYKECNGPFVIRYPRGKGEMADWRNEMHILPIGKGKKLRDGDDIAILSLGPIGNEVIKAIKEVESDGISIAHYDMIFLKPMDEELLHEVGKRFSRVITVENGVIKGGLGSAVLEFMADNGYAPQVKRIGVPDEFVEHGSIPELYKLCGMDAKSIAGEIK 629
>gi|172062808|ref|YP_001810459.1| deoxyxylulose-5-phosphate synthase [Burkholderia ambifaria MC40-6] >gi|171995325|gb|ACB66243.1| deoxyxylulose-5-phosphate synthase [Burkholderia ambifaria MC40-6] (634 aa)
Score = 805, Expect = 1.1e-83, Identities = 184/479 (38%), Positives = 271/479 (56%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNK-TPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKG----KNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELD-----DKGLYHSLKLSDPNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFS 486
           +  I +  D +++   +L  LA  LR  ++D       HLSSNLG VEL++AL YVF++P D I +D GHQ Y HK++T R D++ ++R+ +G+SGF   +ES +D   T HS   +S   G     + N   +  I VIGD A++ G+AFEA+NN   ++   +L+I+NDN MSIS  VGAL++ +++    +        + ++L        +   + +   KL +  KG       FE  GF+Y G IDG++L   I  L+ I+ +   GP  LHV T KG GYK AE D       G ++  +   P+     +TY  V   +L    E D+ +  I PAM   S  +   K+F + Y DVGIAE+HAVT A G+A    K  V+IYSTFLQR+YD L+HDVA   LP+ F +DR  L  +DG TH G YD+ F++ IPN  I  AS++ E  +++  A Q + NP  +RY +     +   KEF+
  S:     5 LKTIDDPADLRRLDRRQLQPLADELRAFVLDSVSKTGGHLSSNLGTVELTIALHYVFNTPNDRIVWDVGHQTYPHKILTGRRDQMHSLRQYDGISGFPRRSESEYDTFGTAHSSTSISAALGMAIGSQLNGDDRFSIAVIGDGAMTAGMAFEAMNNAGVSEDAKLLVILNDNDMSISPPVGALNRHLARLMSGRFYAAARAGVERVL-------SVAPPVLELARKLEEHAKGMVVPATLFEEFGFNYIGPIDGHDLDSLIPTLQNIRELR--GPQFLHVVTKKGQGYKLAEADPVLYHGPGKFNPAEGIKPSPTPAKKTYTQVFGEWLCDEAERDSRVVGITPAMREGSGMVEFEKRFKDRYYDVGIAEQHAVTFAGGLATEGLKPVVAIYSTFLQRAYDQLIHDVALQNLPVVFAIDRAGLVGADGATHAGAYDLAFMRCIPNMTIMAASDENECRQMLHTALQ-QPNPTAVRYPRGAGTGVATVKEFT 485
>gi|171320201|ref|ZP_02909261.1| deoxyxylulose-5-phosphate synthase [Burkholderia ambifaria MEX-5] >gi|171094553|gb|EDT39607.1| deoxyxylulose-5-phosphate synthase [Burkholderia ambifaria MEX-5] (634 aa)
Score = 805, Expect = 1.1e-83, Identities = 184/479 (38%), Positives = 271/479 (56%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNK-TPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKG----KNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELD-----DKGLYHSLKLSDPNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFS 486
           +  I +  D +++   +L  LA  LR  ++D       HLSSNLG VEL++AL YVF++P D I +D GHQ Y HK++T R D++ ++R+ +G+SGF   +ES +D   T HS   +S   G     + N   +  I VIGD A++ G+AFEA+NN   ++   +L+I+NDN MSIS  VGAL++ +++    +        + ++L        +   + +   KL +  KG       FE  GF+Y G IDG++L   I  L+ I+ +   GP  LHV T KG GYK AE D       G ++  +   P+     +TY  V   +L    E D+ +  I PAM   S  +   K+F + Y DVGIAE+HAVT A G+A    K  V+IYSTFLQR+YD L+HDVA   LP+ F +DR  L  +DG TH G YD+ F++ IPN  I  AS++ E  +++  A Q + NP  +RY +     +   KEF+
  S:     5 LKTIDDPADLRRLDRRQLQPLADELRAFVLDSVSKTGGHLSSNLGTVELTIALHYVFNTPNDRIVWDVGHQTYPHKILTGRRDQMHSLRQYDGISGFPRRSESEYDTFGTAHSSTSISAALGMAIGSQLNGDDRFSIAVIGDGAMTAGMAFEAMNNAGVSEDAKLLVILNDNDMSISPPVGALNRHLARLMSGRFYAAARAGVERVL-------SVAPPVLELARKLEEHAKGMVVPATLFEEFGFNYIGPIDGHDLDSLIPTLQNIRELR--GPQFLHVVTKKGQGYKLAEADPVLYHGPGKFNPAEGIKPSPTPAKKTYTQVFGEWLCDEAERDSRVVGITPAMREGSGMVEFEKRFKDRYYDVGIAEQHAVTFAGGLATEGLKPVVAIYSTFLQRAYDQLIHDVALQNLPVVFAIDRAGLVGADGATHAGAYDLAFMRCIPNMTIMAASDENECRQMLHTALQ-QPNPTAVRYPRGAGTGVATVKEFT 485
>gi|115358001|ref|YP_775139.1| 1-deoxy-D-xylulose-5-phosphate synthase [Burkholderia ambifaria AMMD] >gi|122321876|sp|Q0BAL8|DXS_BURCM 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|115283289|gb|ABI88805.1| 1-Deoxy-D-xylulose-5-phosphate synthase [Burkholderia ambifaria AMMD] (646 aa)
Score = 805, Expect = 1.1e-83, Identities = 184/479 (38%), Positives = 271/479 (56%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNK-TPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKG----KNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELD-----DKGLYHSLKLSDPNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFS 486
           +  I +  D +++   +L  LA  LR  ++D       HLSSNLG VEL++AL YVF++P D I +D GHQ Y HK++T R D++ ++R+ +G+SGF   +ES +D   T HS   +S   G     + N   +  I VIGD A++ G+AFEA+NN   ++   +L+I+NDN MSIS  VGAL++ +++    +        + ++L        +   + +   KL +  KG       FE  GF+Y G IDG++L   I  L+ I+ +   GP  LHV T KG GYK AE D       G ++  +   P+     +TY  V   +L    E D+ +  I PAM   S  +   K+F + Y DVGIAE+HAVT A G+A    K  V+IYSTFLQR+YD L+HDVA   LP+ F +DR  L  +DG TH G YD+ F++ IPN  I  AS++ E  +++  A Q + NP  +RY +     +   KEF+
  S:    17 LKTIDDPADLRRLDRRQLQPLADELRAFVLDSVSKTGGHLSSNLGTVELTIALHYVFNTPNDRIVWDVGHQTYPHKILTGRRDQMHSLRQYDGISGFPRRSESEYDTFGTAHSSTSISAALGMAIGSQLNGDDRFSIAVIGDGAMTAGMAFEAMNNAGVSEDAKLLVILNDNDMSISPPVGALNRHLARLMSGRFYAAARAGVERVL-------SVAPPVLELARKLEEHAKGMVVPATLFEEFGFNYIGPIDGHDLDSLIPTLQNIRELR--GPQFLHVVTKKGQGYKLAEADPVLYHGPGKFNPAEGIKPSPTPAKKTYTQVFGEWLCDEAERDSRVVGITPAMREGSGMVEFEKRFKDRYYDVGIAEQHAVTFAGGLATEGLKPVVAIYSTFLQRAYDQLIHDVALQNLPVVFAIDRAGLVGADGATHAGAYDLAFMRCIPNMTIMAASDENECRQMLHTALQ-QPNPTAVRYPRGAGTGVATVKEFT 497
>gi|91793922|ref|YP_563573.1| 1-deoxy-D-xylulose-5-phosphate synthase [Shewanella denitrificans OS217] >gi|123356622|sp|Q12L26|DXS_SHEDO 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|91715924|gb|ABE55850.1| deoxyxylulose-5-phosphate synthase [Shewanella denitrificans OS217] (622 aa)
Score = 805, Expect = 1.2e-83, Identities = 197/597 (32%), Positives = 320/597 (53%)
  Q:    15 EDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLT-----EKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPN------LNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTK---EKCEDIEVKKEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIK 611
           ED +K+  + L  ++  LR+ ++    N S H +S LG VEL++AL YV+++P D + +D GHQ Y HK++T R D++ TIR+ NGL  F    ES +D  S GHSG  +S   G        +  + V+ VIGD A++ G+ FEA+N+       ML+++NDN MSIS+NVGAL+  +++  MS  ++ T     +K+L+ +   KE +K+       +   L         FE LGF+Y G IDG+++   +  ++ ++++   GP ILH+ T KG GY+ AE D  G +H++   DP+            T+  V   +L  +   D+ +  I PAM   S  +  S++FP  Y D  IAE+HAVT AAG A    K  V+IYSTFLQR YD L+HDVA   LP+ F +DR  +  +DG TH G +D+ F++ IPN +I   +++ E  +++   Y+ +  P  +RY +      E IE       G      Q K  K  I+++G  +    +  +     + +  FI     + +  +   +  I  +E+       G  +I   ++ K+   + +I + +  I  G  ++I  +L +D   I A+I+
  S:    18 EDLRKLPQNMLSQVSTELRQFLLQSVGNSSGHFASGLGTVELTVALHYVYNTPFDRLIWDVGHQAYPHKIMTGRRDEMHTIRQKNGLHPFPWREESEYDTFSVGHSGTSVSAALGMAIAADKEAAGRKVVAVIGDGAMTGGMVFEAMNHAGDLHKDMLVVLNDNEMSISENVGALNNHLAQL-MSGRLYTTIREGSKKVLQGMPVIKEMAKR-------TEEHLKGMVVPGTLFEELGFNYIGPIDGHDVDALVETMRNMRSLK--GPQILHIMTKKGRGYEPAEKDPIG-WHAVPKFDPDQFKKPATKPGLPTFSQVFGKWLCDVAAQDDKLLAITPAMREGSGMVEFSQRFPEQYFDAAIAEQHAVTLAAGFACEGFKSVVAIYSTFLQRGYDQLIHDVALQRLPVLFAIDRGGIVGADGATHQGAFDLSFMRCIPNLVIMAPADENECRQMLYTGYRYQDGPTAVRYPRGFATGAEQIEQMTALPIGKGRVCRQGK--KIAILNFGTTLASALEVAEQLDASVADMRFIKPLDVDLLHTLALEHDVIVTIEENAIMGGAGSGVIEALHKLKICKPVLQIGLPDEFIKHGAPDEIIAELRLDSKGILAQIQ 617
>gi|167551767|ref|ZP_02345520.1| hypothetical protein Sentente_14843 [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] (620 aa)
Score = 805, Expect = 1.2e-83, Identities = 192/581 (33%), Positives = 325/581 (55%)
  Q:    32 LRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWS---IYKSFSKLSKFFKGK----NFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNSNNQT------YGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVK--KEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEK--VFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           LR+ ++D     S H +S LG VEL++AL YV+++P D + +D GHQ Y HK++T R DKI TIR+  GL  F    ES +D +S GHS   +S   G     +   K +  + VIGD AI+ G+AFEA+N+    +  ML+I+NDN MSIS+NVGAL+  +++        L+ K+   +   +E  KK++     I +   +  +  KG       FE LGF+Y G +DG+++   I+ LK ++++   GP  LH+ T KG GY+ AE  D   +H++   DP+     ++      Y  +  ++L +    D+ +  I PAM   S  +  S+KFP+ Y DV IAE+HAVT AAG+AI   K  V+IYSTFLQR+YD ++HDVA  +LP+ F +DR  +  +DG TH G +D+ +L+ IP  +I   S++ E  +++   Y     P  +RY +   + + +   ++   G  +  ++    K  I+++G ++ +  K  +  +  L++  F+       +L + + +  +  +E+  +      G + +++A+   +   +  I + +  I  G +E+   +L +D   I A+IK+
  S:    35 LRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQLIWDVGHQAYPHKILTGRRDKIGTIRQKGGLHPFPWRGESEYDVLSVGHSSTSISAGIGIAVAAEKEGKDRRTVCVIGDGAITAGMAFEAMNHAGDIRPNMLVILNDNEMSISENVGALNNHLAQL-------LSGKLYSSL---REGGKKVFSGVPPIKELLKRTEEHIKGMVVPGTLFEELGFNYIGPVDGHDVMGLISTLKNMRDLK--GPQFLHIMTKKGRGYEPAE-KDPITFHAVPKFDPSSGCLPKSSGGLPGYSKIFGDWLCETAAKDSKLMAITPAMREGSGMVEFSRKFPDRYFDVAIAEQHAVTFAAGLAIGGYKPVVAIYSTFLQRAYDQVIHDVAIQKLPVMFAIDRAGIVGADGQTHQGAFDLSYLRCIPGMVIMTPSDENECRQMLFTGYHYNDGPTAVRYPRGNAQGVALTPLEKLPIGKGL--VKRHGEKLAILNFGTLMPEAAKVAEALNATLVDMRFVKPLDDTLILEMAAQHDALVTLEENAIMGGAGSGVNEVLMAHRKPVP--VLNIGLPDFFIPQGTQEEARAELGLDAAGIEAKIKA 617
>gi|118727596|ref|ZP_01576191.1| deoxyxylulose-5-phosphate synthase [Clostridium cellulolyticum H10] >gi|118662994|gb|EAV69660.1| deoxyxylulose-5-phosphate synthase [Clostridium cellulolyticum H10] (623 aa)
Score = 805, Expect = 1.3e-83, Identities = 210/603 (34%), Positives = 331/603 (54%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKSK--SVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFK-KEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNSNNQTYGSVAANFLE-------KLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYALQTKESKTCIISYGDIIN---DLKKEIKTKSID--LINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCL----GDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEI 610
           +D I   ED  K++L +L  LA  +R  +I        HL+SNLGIVEL++A+   F++ +D I +D GHQ YVHK++T R     T+R+  GL+GF +  ES+HD  +TGHS   +S   G     + K +  SV+ VIGD A++ G+A+EALN+     +  ++++NDN MSI++NVG + + +SK +       T++ +   L K      K   ++ K  S +        FFE LG+ Y+G +DG+NL +    L+  K I   GP ++HV T KG GY  AE +    +H +    P      +TYG    ++ E       +  E +N +  I+ AMT  +     S  FP  + DVGIAE+HAVT AAGMAI      V+IYS+FLQR+YD L+HDVA  +L +   VDR  +   DG+TH G +DI FL  IP+  I   ++ +EL  ++  A    + P  IRY + + ++I +K E    +   A+  +    CI++ G ++     + +++K K I+  +++A FI     E +    + YKNI  +E+    NC+    G  ++   N   L   I    +    I  G++E++ KKL +D +S+  +I
  S:     4 LDSIKFPEDIGKLELEQLKVLAEEIRTFLIYKVSKTGGHLASNLGIVELTLAIHSNFNTNKDRIVWDVGHQSYVHKILTGRKADFDTLRKLGGLAGFPKTCESLHDCFNTGHSSTSISAALGIARARDIKKEDYSVMAVIGDGAMTGGMAYEALNDAGRLASNFIVVLNDNEMSIAQNVGGMSRYLSKLRTDPFYTKTKEDIDNFLDKMPNIGTKTRRAVRKLKSTVKYLITPGMFFEQLGYRYYGPVDGHNLDELNKALQAAKKIK--GPVLIHVCTQKGKGYSYAE-ESPDRFHGIA---PFEIETGETYGKRLPDYSEVFGEAVLEAAEKNNRVVAISAAMTKGTGLAKFSTTFPRRFFDVGIAEQHAVTSAAGMAINGIIPVVAIYSSFLQRAYDQLIHDVALQKLHVVIGVDRAGIVGEDGETHQGEFDISFLNHIPDFTIMAPADYYELREMVNYAINIHTGPIAIRYPRGRGKEI-IKHEVPLVNGKGAVLKEGQDVCILAVGRMVETAFKVSEKLKEKGINAGVVSARFIKPLDVELITECANKYKNIVTMEE----NCVIGGFGSRVLDTLNRLDLKARILIKGLPEQFIPQGSREELIKKLKLDADSVTNDI 614
>gi|118595506|sp|Q894H0|DXS_CLOTE 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) (618 aa)
Score = 805, Expect = 1.3e-83, Identities = 217/603 (35%), Positives = 326/603 (54%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKSKS--VIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQM----SKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELD-DKGLYHSLK----LSDPNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTK-EKCEDIEVKKEFSFGSWVYALQTKESKTCIISYGDIIN---DLKKEIKTKSID--LINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEI 610
           +D+  +  D K M L EL  L+  LR  II+       HL+SNLG+VEL+++L  VFD   D + +D GHQCYVHK++T R      +R+ NGLSGF +  ES  D   TGHS   +S   G     + K ++  V+ VIGD A++ G+A EALN++  NKT + II+NDN MSI KNVG L   +S  ++    +K     E I++KI       K +  ++ +    + +       FE++G  YFG IDG+N+K+   V+ + KN+    P I+HV T KG GYK AE + DK  +H +     ++  +  S   TY       +  +   D  +  I  AM   +     S KF N   DVGIAE+HAVT AAGMA A  +   S+YSTFLQR+YD +LHDV    LP+ F +DR  L   DG+TH G++D+ +L  +PN  I       ELE ++  A   +S P  IRY K E   +++  K F  G W   +   + K  II+ G ++    ++K+ +K ++ID  LINA F+    KE + +I+   K I  +E        G+ ++    +   +  +  +  ++  I  G  +D+ K   +D  +I  E+
  S:     5 LDRYKDVYDIKNMSLDELNLLSRELRNFIIESVSQNGGHLASNLGVVELTLSLYNVFDFSYDKLIWDVGHQCYVHKILTGRRSGFQNLRKINGLSGFPKRCESKFDHFETGHSSTSISSALGMARARDLKGENYNVVAVIGDGALTGGMALEALNDVGDNKTKLTIILNDNQMSIGKNVGGLSTYLSSLRIDPNYNKFKRDVEGIIKKI---PNIGKGVAKNLERVKDGVKQVLVPGMLFENMGIKYFGPIDGHNIKQLSKVMDKAKNMKE--PVIIHVVTTKGKGYKFAEQNPDK--FHGIGSFDYMTGCSKKSKGVTYSKAFGKAMVSIASKDKRVVAITAAMKDGTGLNEFSNKFKNRIFDVGIAEQHAVTMAAGMATAGLRPVFSVYSTFLQRAYDQVLHDVCIQNLPVVFAIDRAGLVGEDGETHQGVFDMSYLSHMPNMTIMAPKCVEELEFMLNWALSQES-PIAIRYPKGESRLNLKPIKNFQKGKW--EVLEDKGKISIIATGRMVEKAFNVKETLKERNIDIGLINATFVKPIDKEMLNKIIDEEKTIITLEDNVILGGFGNSVLNYVRDTNSNIKVVNLGFKDEFIPHGKVDDLFKMYGLDEEAILKEV 614
>gi|28211241|ref|NP_782185.1| 1-deoxy-D-xylulose-5-phosphate synthase [Clostridium tetani E88] >gi|28203681|gb|AAO36122.1| 1-deoxyxylulose-5-phosphate synthase [Clostridium tetani E88] (620 aa)
Score = 805, Expect = 1.3e-83, Identities = 217/603 (35%), Positives = 326/603 (54%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKSKS--VIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQM----SKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELD-DKGLYHSLK----LSDPNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTK-EKCEDIEVKKEFSFGSWVYALQTKESKTCIISYGDIIN---DLKKEIKTKSID--LINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEI 610
           +D+  +  D K M L EL  L+  LR  II+       HL+SNLG+VEL+++L  VFD   D + +D GHQCYVHK++T R      +R+ NGLSGF +  ES  D   TGHS   +S   G     + K ++  V+ VIGD A++ G+A EALN++  NKT + II+NDN MSI KNVG L   +S  ++    +K     E I++KI       K +  ++ +    + +       FE++G  YFG IDG+N+K+   V+ + KN+    P I+HV T KG GYK AE + DK  +H +     ++  +  S   TY       +  +   D  +  I  AM   +     S KF N   DVGIAE+HAVT AAGMA A  +   S+YSTFLQR+YD +LHDV    LP+ F +DR  L   DG+TH G++D+ +L  +PN  I       ELE ++  A   +S P  IRY K E   +++  K F  G W   +   + K  II+ G ++    ++K+ +K ++ID  LINA F+    KE + +I+   K I  +E        G+ ++    +   +  +  +  ++  I  G  +D+ K   +D  +I  E+
  S:     7 LDRYKDVYDIKNMSLDELNLLSRELRNFIIESVSQNGGHLASNLGVVELTLSLYNVFDFSYDKLIWDVGHQCYVHKILTGRRSGFQNLRKINGLSGFPKRCESKFDHFETGHSSTSISSALGMARARDLKGENYNVVAVIGDGALTGGMALEALNDVGDNKTKLTIILNDNQMSIGKNVGGLSTYLSSLRIDPNYNKFKRDVEGIIKKI---PNIGKGVAKNLERVKDGVKQVLVPGMLFENMGIKYFGPIDGHNIKQLSKVMDKAKNMKE--PVIIHVVTTKGKGYKFAEQNPDK--FHGIGSFDYMTGCSKKSKGVTYSKAFGKAMVSIASKDKRVVAITAAMKDGTGLNEFSNKFKNRIFDVGIAEQHAVTMAAGMATAGLRPVFSVYSTFLQRAYDQVLHDVCIQNLPVVFAIDRAGLVGEDGETHQGVFDMSYLSHMPNMTIMAPKCVEELEFMLNWALSQES-PIAIRYPKGESRLNLKPIKNFQKGKW--EVLEDKGKISIIATGRMVEKAFNVKETLKERNIDIGLINATFVKPIDKEMLNKIIDEEKTIITLEDNVILGGFGNSVLNYVRDTNSNIKVVNLGFKDEFIPHGKVDDLFKMYGLDEEAILKEV 616
>gi|94676593|ref|YP_588725.1| 1-deoxy-D-xylulose-5-phosphate synthase [Baumannia cicadellinicola str. Hc (Homalodisca coagulata)] >gi|118595493|sp|Q1LTI9|DXS_BAUCH 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|94219743|gb|ABF13902.1| 1-deoxy-D-xylulose-5-phosphate synthase [Baumannia cicadellinicola str. Hc (Homalodisca coagulata)] (623 aa)
Score = 805, Expect = 1.3e-83, Identities = 197/587 (33%), Positives = 324/587 (55%)
  Q:    25 LLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKS--KSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFL-----TEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLN-------SNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVK--KEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIK 611
           LL L   LR+ ++      S H +S LG VEL++AL YV+++P D + +D GHQ Y HK++T R + I+TIR+ NGL  F    ES +D +S GHS   +S   G       +   +  + VIGD A++ G+AFEALN+    K+ +L+I+NDN MSIS+NVGAL+  +++  +S  ++L     ++K L  + + KE +K+    I       +        FE LGF+Y G +DG++++  +++LK ++ +   GP +LH+ T KG GY  AE  D   +H++   DP +        SN  TY  V  ++L      +  +  I PAM   S     + +FP  Y DV IAE+HAVT AAG+AI+  K  V+IYSTFLQR+YD ++HDVA  +LP+ F +DR  +  +DG TH G +D+ +L+ +PN +I   S++ E   ++   Y   + P  +RY +     +E    +    G  +   Q   +K  I+++G ++   KK  KT    L++  F+     E + ++  +++ +  +E+       G  +       +L   +  I + +  I  G++E+I  +L +D + I  +IK
  S:    28 LLTLCDELRQFLLTSVSGSSGHFASGLGTVELTVALHYVYNTPFDNVIWDVGHQAYPHKILTGRRECIATIRQRNGLHPFPWREESEYDILSVGHSSTSISAGLGMAVAATYEGIGRKTVCVIGDGAMTAGMAFEALNHAGDIKSDLLVILNDNKMSISRNVGALNNHLAQI-LSGKLYLRINESSKKALHGMPYLKELAKRTKEQIK------NIIVPNCTLFEELGFNYIGPVDGHDVQGMVHILKNMRCMK--GPQLLHIITQKGRGYAPAE-KDPTTWHAVPKFDPAIGQLPYQNISNYPTYSDVFGDWLCNAATSNKKLIAITPAMREGSGMAKFANQFPQQYFDVAIAEQHAVTFAAGLAISGYKPVVAIYSTFLQRAYDQVIHDVAIQKLPVLFAIDRGGVVGADGQTHQGAFDLSYLRCVPNMVIMTPSDENECRLMLHTGYHYNNGPSAVRYPRGNGIGVEYSLLRILPLGKAIVCRQG--TKIAILNFGTLLTQAKKVAKTFDATLVDMRFVKPLDIELINQLAISHQALVTLEENAVIGGAGSGVNEYLMRQRLLVPVLNIGLPDYFIPQGSQEEIRAELKLDSDGIMEQIK 618
>gi|170699440|ref|ZP_02890484.1| deoxyxylulose-5-phosphate synthase [Burkholderia ambifaria IOP40-10] >gi|170135640|gb|EDT03924.1| deoxyxylulose-5-phosphate synthase [Burkholderia ambifaria IOP40-10] (634 aa)
Score = 805, Expect = 1.3e-83, Identities = 184/479 (38%), Positives = 271/479 (56%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNK-TPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKG----KNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELD-----DKGLYHSLKLSDPNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFS 486
           +  I +  D +++   +L  LA  LR  ++D       HLSSNLG VEL++AL YVF++P D I +D GHQ Y HK++T R D++ ++R+ +G+SGF   +ES +D   T HS   +S   G     + N   +  I VIGD A++ G+AFEA+NN   ++   +L+I+NDN MSIS  VGAL++ +++    +        + ++L        +   + +   KL +  KG       FE  GF+Y G IDG++L   I  L+ I+ +   GP  LHV T KG GYK AE D       G ++  +   P+     +TY  V   +L    E D+ +  I PAM   S  +   K+F + Y DVGIAE+HAVT A G+A    K  V+IYSTFLQR+YD L+HDVA   LP+ F +DR  L  +DG TH G YD+ F++ IPN  I  AS++ E  +++  A Q + NP  +RY +     +   KEF+
  S:     5 LKTIDDPADLRRLDRRQLQPLADELRAFVLDSVSKTGGHLSSNLGTVELTIALHYVFNTPNDRIVWDVGHQTYPHKILTGRRDQMHSLRQYDGISGFPRRSESEYDTFGTAHSSTSISAALGMAIGSQLNGDDRFSIAVIGDGAMTAGMAFEAMNNAGVSEDAKLLVILNDNDMSISPPVGALNRHLARLMSGRFYAAARAGVERVL-------SVAPPVLELARKLEEHAKGMVVPATLFEEFGFNYIGPIDGHDLDSLIPTLQNIRELR--GPQFLHVVTKKGQGYKLAEADPVLYHGPGKFNPAEGIKPSPTPAKKTYTQVFGEWLCDEAERDSRVVGITPAMREGSGMVEFEKRFKDRYYDVGIAEQHAVTFAGGLATEGLKPVVAIYSTFLQRAYDQLIHDVALQNLPVVFAIDRAGLVGADGATHAGAYDLAFMRCIPNMTIMAASDEDECRQMLHTALQ-QPNPTAVRYPRGAGTGVATVKEFT 485
>gi|85375331|ref|YP_459393.1| 1-deoxy-D-xylulose-5-phosphate synthase [Erythrobacter litoralis HTCC2594] >gi|123099471|sp|Q2N6U5|DXS_ERYLH 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|84788414|gb|ABC64596.1| 1-D-deoxyxylulose 5-phosphate synthase [Erythrobacter litoralis HTCC2594] (640 aa)
Score = 805, Expect = 1.3e-83, Identities = 194/546 (35%), Positives = 303/546 (55%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKSK--SVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNSNNQT------YGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTK---------EKCEDIEVKKEFSFGSWVYALQTKESKTCIISYGDIINDLKK-----EIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEK 553
           +D +   ED +K++  +L  L+  LR ++I        HL S LG+VEL+ A+ YVF++P+D + +D GHQCY HK++T R D+I T+R+  GLSGF + +ES +D     HS   +S   GF   N  K +    I VIGD A+S G+A+EA+NN       +++I+NDN MSI+  VG L   +++  MS S +L  + L   +  K  S++++ S+ K+         G   FE LGF+Y G IDG+NL   I VL+ +++    GP ++HV+T+KG GY  AE +    YH +   D       ++      Y +V    L KL + D  I  I  AM   +     +K  P+   DVGIAE+H VT AAG+A    + F +IYSTFLQR+YD ++HDVA   LP+ F +DR  L  +DG TH G +D+ +L ++PN ++  A+++ EL  +   A ++ S P   RY +         E  E +E+ K    G  V       SK  ++S G  + + K+     E K  S  + +  F      E + +++  ++ +  +E+
  S:    10 LDTVSYPEDLRKLEPGQLRQLSDELRAEMISAVGVTGGHLGSGLGVVELTAAIHYVFNTPEDRLIWDVGHQCYPHKILTGRRDRIRTLRQGGGLSGFTKRSESEYDPFGAAHSSTSISAGLGFAVANKLKGEPGKAIAVIGDGAMSAGMAYEAMNNAEQAGNRLIVILNDNDMSIAPPVGGLSGYLARL-MSSSEYLGLRSLASRMTAKV-SRRVHTSLGKAEEYTKGLVTGGTLFEELGFYYVGPIDGHNLDHLIPVLENVRD-AEEGPFLIHVRTVKGKGYAPAE-NSADKYHGVAKFDVVTGEQKKSTGGPPAYQNVFGETLAKLADSDPRICAITAAMPSGTGVDKFAKAHPDRAFDVGIAEQHGVTFAAGLAAQGMRPFAAIYSTFLQRAYDQVVHDVAIQNLPVRFAIDRAGLVGADGSTHAGSFDVTYLATLPNFVVMAAADEAELVHMTYTAAEHDSGPIAFRYPRGGGIGIDLPETPEKLEIGK----GRIV----KHGSKVALLSLGTRLEEAKRAADELEAKGLSTTIADMRFAKPLDTELIAQLMKNHEVVVTIEE 565
>gi|157146964|ref|YP_001454283.1| 1-deoxy-D-xylulose-5-phosphate synthase [Citrobacter koseri ATCC BAA-895] >gi|166198610|sp|A8AK34|DXS_CITK8 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|157084169|gb|ABV13847.1| hypothetical protein CKO_02741 [Citrobacter koseri ATCC BAA-895] (620 aa)
Score = 805, Expect = 1.4e-83, Identities = 194/580 (33%), Positives = 324/580 (55%)
  Q:    32 LRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWS---IYKSFSKLSKFFKGK----NFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNL------NSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVK--KEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEK--VFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIK 611
           LR+ ++D     S H +S LG VEL++AL YV+++P D + +D GHQ Y HK++T R DKI TIR+  GL  F    ES +D +S GHS   +S   G     +   K +  + VIGD AI+ G+AFEA+N+    K  ML+I+NDN MSIS+NVGAL+  +++        L+ K+   +   +E  KK++     I +   +  +  KG       FE LGF+Y G +DG+++   I  LK ++++   GP  LH+ T KG GY+ AE  D   +H++   DP+       +    +Y  +  ++L +    D+ +  I PAM   S  +  S+KFP+ Y DV IAE+HAVT AAG+AI   K  V+IYSTFLQR+YD +LHDVA  +LP+ F +DR  +  +DG TH G +D+ +L+ IP  +I    ++ E  +++   Y     P  +RY +     +E+   ++   G  +   Q +  K  I+++G ++ +  K  ++ +  L++  F+    +  +L +   ++ +  +E+  +      G + +++A+   +   +  I + +  I  G +++   +L +D   I A+IK
  S:    35 LRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQLIWDVGHQAYPHKILTGRRDKIGTIRQKGGLHPFPWRGESEYDVLSVGHSSTSISAGIGIAVAAEKEGKDRRTVCVIGDGAITAGMAFEAMNHAGDIKPDMLVILNDNEMSISENVGALNNHLAQL-------LSGKLYSSL---REGGKKVFSGVPPIKELLKRTEEHIKGMVVPGTLFEELGFNYIGPVDGHDVLGLITTLKNMRDLK--GPQFLHIMTKKGRGYEPAE-KDPITFHAVPKFDPSSGCLPKSSGGLPSYSKIFGDWLCETAAKDSKLMAITPAMREGSGMVEFSRKFPDRYFDVAIAEQHAVTFAAGLAIGGYKPIVAIYSTFLQRAYDQVLHDVAIQKLPVMFAIDRAGIVGADGQTHQGAFDLSYLRCIPEMVIMTPGDENECRQMLYTGYHYNDGPTAVRYPRGNAVGVELTPLEKLPIGKGLVKRQGE--KLAILNFGTLLPEAAKVAESLNATLVDMRFVKPLDETLILEMAERHEVLITLEENAIMGGAGSGVNEVLMAHRKVVP--VLNIGLPDFFIPQGTQDEARAELGLDAAGIEAKIK 616
>gi|149185145|ref|ZP_01863462.1| 1-deoxy-D-xylulose-5-phosphate synthase [Erythrobacter sp. SD-21] >gi|148831256|gb|EDL49690.1| 1-deoxy-D-xylulose-5-phosphate synthase [Erythrobacter sp. SD-21] (640 aa)
Score = 804, Expect = 1.4e-83, Identities = 194/546 (35%), Positives = 299/546 (54%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKSK--SVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNSNNQT------YGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVK---KEFSFGSWVYALQTKESKTCIISYGDIINDLKK-----EIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEK 553
           +D +    D +K+K  +L  L+  LR ++ID       HL S LG+VEL+ A+ YVFD+P D + +D GHQCY HK++T R D+I T+R+  GLSGF + +ES +D     HS   +S   GF   N  + +    I VIGD A+S G+A+EA+NN       +++I+NDN MSI+  VG L   +++  +S S +L  + L   L KK  S++++ S+ K+         G   FE LGF+Y G IDG+NL   I VL+ +++    GP ++HV T KG GY  AE +    YH +   D       ++      Y +V    L KL   D  I  I  AM   +     ++  P+   DVGIAE+H VT AAG+A    + F +IYSTFLQR+YD ++HDVA   LP+ F +DR  L  +DG TH G +DI +L ++PN ++  A+++ EL  +   A +    P   RY +     +E+    ++F  G     +  + SK  I+S G  + + KK     E K  S  + +  F        + +I+ +++ +  +E+
  S:    10 LDTVDTPADLRKLKQDQLRQLSDELRTEMIDAVGTTGGHLGSGLGVVELTTAIHYVFDTPTDKLVWDVGHQCYPHKILTGRRDRIRTLRQGGGLSGFTKRSESEYDPFGAAHSSTSISAALGFAMANKMQGRPGRGIAVIGDGAMSAGMAYEAMNNAEQAGNRLVVILNDNDMSIAPPVGGLSAYLAR-TVSSSEYLGLRSLASRLSKK-LSRRVHSSLEKAEEYARGMVTGGTLFEELGFYYVGPIDGHNLDHLIPVLENVRD-SEQGPVLIHVVTQKGKGYAPAE-NSADKYHGVAKFDVVTGEQKKSSGGPPAYQNVFGETLAKLANDDPRICAITAAMPSGTGVDKFAQAHPDKAFDVGIAEQHGVTFAAGLAAEGMRPFAAIYSTFLQRAYDQVVHDVAIQNLPVRFAIDRAGLVGADGCTHAGSFDITYLATLPNFVVMAAADEAELAHMTYTAAEYDDGPIAFRYPRGAGTGVEIPEKLEKFEIGKG--RIMREGSKVAILSLGARLEEAKKAADQLEAKGLSTTVADMRFAKPLDTALIEQIMRSHEVVVTIEE 565
>gi|189219548|ref|YP_001940189.1| Deoxyxylulose-5-phosphate synthase [Methylokorus infernorum V4] >gi|189186406|gb|ACD83591.1| Deoxyxylulose-5-phosphate synthase [Methylacidiphilum infernorum V4] (630 aa)
Score = 804, Expect = 1.5e-83, Identities = 182/476 (38%), Positives = 272/476 (57%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSK--SKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKG----KNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDP----NLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKK 483
           +D+I +  D KK+++ EL  LA  +R+++I +      HL  NLG+VEL++AL YVFD P+D   +D  HQ YVHK+IT R ++  TIR+  G+SGF    ES +D    GH+G  LS   G     + +   + VI + GDAA + G+ FEALNN+A     +++I+NDN  SI KNVGA+    +K   + +       + K+L  ++W  K   ++ K   K  + FK        FE LG  Y G IDG+++ + I+  + +KN     P +LHV T KG G+  A L+ +  +H L   +P      +S  +T+  V A  + KL + + N+  I  AM   +       KFP+ Y DVGIAEEHAV  AAGMA    K + +IYSTFLQR+YD ++HDV   +LP+ F +DR  LS  DG THHG++D+ +L+++PN  I    ++ EL  ++  A  +   P  IRY +     + VK+
  S:     5 LDRIDSPADLKKLQVSELTKLAEEIRQEMITVLSKCGGHLGPNLGVVELTLALHYVFDVPRDHFVFDVSHQAYVHKLITGRKNRFHTIRQHGGISGFMSREESEYDCYGAGHAGTALSAALGMAVARDRRGGKEHVIALCGDAAFTCGITFEALNNVASTTQRLIVILNDNEWSIDKNVGAIASYFNKIVTNPAYSYLRDRVEKVL--EKWPGK---NVLKVARKAEEAFKSLLWPSVIFEELGLTYHGPIDGHDIARLISTFEFLKN--QEYPVLLHVITQKGRGFPPA-LEKQKKFHGLGPYNPITGETPSSPRKTFSEVFAETMIKLADMNRNVVAITAAMPNGTALDKFQPKFPDRYFDVGIAEEHAVIFAAGMATKGFKPYCAIYSTFLQRAYDPIIHDVCLQKLPVVFCLDRGGLSGDDGPTHHGLFDVAYLRTVPNITIMHPKDEDELADMLFTAMHH-PGPVAIRYPRGSGSGVAVKE 481
>gi|189468072|ref|ZP_03016857.1| hypothetical protein BACINT_04466 [Bacteroides intestinalis DSM 17393] >gi|189436336|gb|EDV05321.1| hypothetical protein BACINT_04466 [Bacteroides intestinalis DSM 17393] (652 aa)
Score = 804, Expect = 1.6e-83, Identities = 201/603 (33%), Positives = 325/603 (53%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI---EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSV----FLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNL------NSNN--QTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVK---KEFSFGSWVYALQTKESKT-CIISYGDIINDLKKEI------KTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEI 610
           ++ I + ED +K+ + +L ++   LR+ II        H +++LG VEL++AL YVF++P D I +D GHQ Y HK++T R +  ST R+  G+  F  P+ES +D  + GH+ N +S   G     E+   K + V+ VIGD ++S GLAFE LNN + +   +LII+NDN M+I ++VG + + +     S       F   K+L K+    E  +K       S   ++   + +N FE +   YFG I+G+++K    +L+ IK++   GP ILH+ T+KG G++ AE    G++H+    DP        +++N    Y  V    L +L E +  I  + PAM    +   L K  P+   DVGIAE HA T + GMA    + F +IYS+F+QR+YDN++HD+A L+LP+   +DR  L   DG THHG++D+ + + IPN  I+   N+ EL RL+  A      PF IRY + +   I+ K   +E   G      + K+ K   I++ G I N   K I      K  SI   +  F+    +E +  I  ++  I  +E       +G  ++    +N  + ++++I + +  I  G  +++     +D   I   I
  S:    29 LNSISDPEDLRKLSVEQLPEVCKELRQDIIKEVSCNPGHFAASLGTVELTVALHYVFNTPYDRIVWDVGHQAYGHKILTGRRETFSTNRKFKGIRPFPSPDESDYDTFTCGHASNSISAALGMAVAAEEKGEKDRHVVAVIGDGSMSGGLAFEGLNNASASSNNLLIILNDNDMAIDRSVGGMKQYLFNLTTSNRYNQLRFKISKMLFKVGILNEDRRKALIRFGNSLKSMAA--QQQNIFEGMNIRYFGPINGHDVKNIARILRDIKDMK--GPKILHLHTVKGKGFEPAE-KAPGIWHAPGKFDPETGERFTADTHNLPPLYQDVFGETLVELAEQNPRIVGVTPAMPTGCSMNMLMKAMPDRAFDVGIAEGHAATFSGGMAKEGMQPFCNIYSSFMQRAYDNVIHDIAILKLPVVLCLDRAGLVGEDGPTHHGVFDLAYFRPIPNLTISSPMNEHELRRLMYTAQLPDKGPFVIRYPRGRGALIDWKCPLEEIPVGK---GRKLKDGKDLAILTLGPIGNIAAKAIERAEKEKDISIAHYDLRFLKPLDEEMLHEIGHSFSRIITIEDGIRKGGMGSAVLEFMADNGYTPHVQRIGVPDTFIEHGTVQELYHLCGMDEKGILESI 648
>gi|166030418|ref|ZP_02233247.1| hypothetical protein DORFOR_00079 [Dorea formicigenerans ATCC 27755] >gi|166029776|gb|EDR48533.1| hypothetical protein DORFOR_00079 [Dorea formicigenerans ATCC 27755] (620 aa)
Score = 804, Expect = 1.6e-83, Identities = 208/603 (34%), Positives = 319/603 (52%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKSK--SVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSK-SVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAEL-DDKGLYHSLKLSDPN-----LNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCED--IEVKKEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSID------LINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEI 610
           +++I    D KK+   EL  LA  +R+ +++       HL+SNLG+VEL+MAL  + D P+D I +D GHQ Y HK++T R +    +R   G+SGF +  ES  D   TGHS   +S   G++   + K +  +VI VIGD +++ G+A+EALNN +  KT  ++++NDN MSIS+NVG + + ++  + +     L + +   +        ++   I K+ S + +      FFE +G  Y G I G+NL      LK  K +   GP +LHV T KG GY+ AE   DK  +H +   D          +  TY  V    L      + +I  I  AM   +      K +PN + DVGIAEEH VT AAG+A    K   ++YS+FLQR YD L+HDVA   LP+ F VDR  L  SDG+TH GI+D+ FL +IPN  +    NK+EL  ++  A Q  S P  IRY + K  D     ++  S+G   +  + KE    I+S G +  +  K  + K I+      LIN  FI    +  + ++  T+K I V+E+   +   G+ +        L  ++  + + ++ I  G+ + + K   ID  S+  +I
  S:     2 LERIQKENDIKKLNSEELECLAGEIREFLVEKVSKTGGHLASNLGVVELTMALHLICDLPKDKIIWDVGHQSYTHKLLTGRKEGFEDLRSYGGMSGFPKRKESQCDAFDTGHSSTSISAGLGYVRARDLKHEDYTVISVIGDGSLTGGMAYEALNNASNLKTNFIVVLNDNHMSISENVGGMSRYLANLRTADIYTGLKKGVTNALQQVPVMGDRMIEHIRKTKSSIKQLVVPGMFFEDMGITYLGPIPGHNLPMLCKALKEAKKVE--GPVLLHVMTTKGKGYEPAETAPDK--FHGIGPFDIESGKVLAKKDGDTYTDVFGKVLCDEASRNPDIVAITAAMADGTGLARFKKHYPNRFFDVGIAEEHGVTFAAGLAAGGLKPVFAVYSSFLQRGYDQLIHDVALQNLPVVFGVDRAGLVGSDGETHQGIFDLSFLSNIPNMTVMSPKNKWELADMLRFALQMNS-PVAIRYPRGKAYDGYEGCRERISYGKSEWIFEGKE--IAILSVGHMFEEAVK-TRDKLIEQGYEPTLINMRFIKPIDEAMIEKVCQTHKLIAVIEENVQTGACGERVSEYVMRKMLPSHVLTLALPDDYIEHGSVDVLRKMTGIDSESMSEKI 613
>gi|188995944|ref|YP_001930196.1| 1-deoxy-D-xylulose 5-phosphate synthase [Porphyromonas gingivalis ATCC 33277] >gi|188595624|dbj|BAG34599.1| 1-deoxy-D-xylulose 5-phosphate synthase [Porphyromonas gingivalis ATCC 33277] (634 aa)
Score = 804, Expect = 1.7e-83, Identities = 180/468 (38%), Positives = 265/468 (56%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSK--SKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSV----FLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHS-----LKLSDPNLNSNNQ---TYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEK 475
           ID I +  D + +K  +L  +   LR+ I+++      HL S+LG V+ ++AL YVFD+P D I +D GHQ Y HK++T R +    +R+  G+SGF  P ES +D    GH+ N +S   G    + +K   + VI VIGD +++ G+AFE LNN +     +LII+NDN MSI +NVG L++ M     SK+     +   K LRKI    E ++K       SF  L    +  N FE     YFG +DGNN+ + + VL +IK++   GP ILH++TIKG GY  AE     ++H+     +K  +     N      +  V  + L +L + D  I  + PAM    +   L KK+PN   DVGIAE HAVT +AG+A      F +IYS+F+QR YD ++HDVA     +   +DR  L   DG THHG++D+ FL+ +P+ ++    N+ EL  L++ AY+    P  IRY + K
  S:    10 IDHINSPADLRALKPEQLPQVCRELRRYILEVLSVTPGHLGSSLGAVDFTVALHYVFDTPYDRIVWDVGHQAYSHKILTGRREDFRHLRQWGGISGFPSPKESEYDTFPAGHASNSISAALGMAVASAAKDEKRKVIAVIGDGSMTGGMAFEGLNNASSFPNNLLIILNDNNMSIDRNVGGLNRYMVDILTSKTYNTIRYDLYKGLRKINLISETNRKNLLRFNNSFKAL--LARESNLFEGFSIRYFGPVDGNNVLRLVEVLNQIKDMA--GPKILHLRTIKGKGYSPAE-KQATIWHAPGEFDIKSGERKKGENKPEPPKFQDVFGHTLVELADRDERIVGVTPAMPTGCSMTFLMKKYPNRAYDVGIAEGHAVTFSAGLAKEGLIPFCNIYSSFIQRGYDQVIHDVALSGSHVVICLDRAGLVGEDGATHHGVFDMAFLRCVPDIVVASPLNEHELRNLMLTAYKGYDGPMVIRYPRGK 486
>gi|149194461|ref|ZP_01871558.1| 1-deoxy-D-xylulose-5-phosphate synthase [Caminibacter mediatlanticus TB-2] >gi|149135636|gb|EDM24115.1| 1-deoxy-D-xylulose-5-phosphate synthase [Caminibacter mediatlanticus TB-2] (605 aa)
Score = 804, Expect = 1.7e-83, Identities = 213/596 (35%), Positives = 329/596 (55%)
  Q:    16 DFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKSKSVIPV--IGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYH--------SLKLSDPNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKC---EDIEVKKEFSFGSWVYALQTKESKTCIISYG-------DIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIK 611
           D K M + EL +LA  +R++I+D+   K  HLSS LG VEL + + YVFD  +D   +D  HQ Y HK++T R ++  T+R+  G+SG+  P+ES +D+ S GHS   +S+  G  +    K++  IPV  IGD A+S G+ +EALN +   K P++II+NDN MSI + +GA+ K ++K +  + V+   K   K L  K  S   Y +  K F +L  F     FFE +G  Y G IDG+NL++ I VLK  K +    P I+H KTIKG GYK+AE    G Y         ++K  +P L  +      V +  L +L   D  I  +  AM   +    L K+FP  + DVGIAE+HAVT  A +A      FV+IYSTFLQR YD ++HDV     P+ F +DR  +  +DG+TH G++D+G+L+ +PN  +    +   L++ +  AY+    P   RY +      ++I   K++  G     + +K+    +I+YG       ++ N LK E     I L++  F+  + KE +L+ L   K  YV+        + + L   AN+  L+  I      +  I  G+ + +++ L +D++SI  +IK
  S:     5 DVKNMNIIELENLAKKIRERILDVVSRKGGHLSSTLGAVELIIGMHYVFDVEKDPFIFDVSHQAYAHKLLTGRWEEFETLRQFGGISGYTRPSESKYDYFSAGHSSTSISVAVGAAKAIKLKNEDRIPVVLIGDGAMSAGMVYEALNELGDLKLPVVIILNDNEMSIGRPIGAISKYLTKLKAGR-VYQNFKERFKKLLDKAPSDVKYAA--KKFEEL--FSVNGVFFEEMGLEYIGPIDGHNLEEIIEVLKVAKELKK--PVIVHAKTIKGKGYKQAE----GYYEHWHGVSPFNIKTGEP-LKKSTLNATKVFSKKLLELAREDKKIVGVTAAMPSGTGMKELMKEFPERFWDVGIAEQHAVTSMAPLAKEGFIPFVAIYSTFLQRGYDQIIHDVCLDNYPVRFAIDRAGIVGADGETHQGVFDVGYLRILPNITLFAPRDFESLKKAVEFAYKFDKGPIAFRYPRGAFSLEDEIFEAKDYELGKGEVLIDSKD--IMLIAYGNGVGKAYEVYNILKDEF---DIGLVDLRFVKPFDKE-LLKNLKA-KKWYVISDNAKEGGIAEMLSEFANKENLNVKIDSFEYPDKFIPHGDVKSVERLLRVDVDSIVKKIK 601
>gi|56461238|ref|YP_156519.1| 1-deoxy-D-xylulose-5-phosphate synthase [Idiomarina loihiensis L2TR] >gi|81599973|sp|Q5QVE8|DXS_IDILO 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|56180248|gb|AAV82970.1| Deoxyxylulose-5-phosphate synthase [Idiomarina loihiensis L2TR] (618 aa)
Score = 804, Expect = 1.8e-83, Identities = 193/599 (32%), Positives = 328/599 (54%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSI--YKSF-SKLSKFFKGK----NFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNSNNQ------TYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSI 606
           +DKI +  D +++   +L +L   +R+ ++      S HL+S LG VEL++AL YV+ +P+D + +D GHQ Y HK++T R  ++ +IR+ +GL  F    ES +D +S GHS   +S   G     +  S  + V+ +IGD A++ G+AFEA+N+    K  ML+++NDN MSIS+NVGAL+   ++    +  F T          +E SKK+   +   + F S+  +  KG       FE LGF+Y G IDG+++   ++ L  ++++   GP +LH+ T KG GY+ AE D  G YH +   DP  +S  +      +Y  +   +L      D ++  I PAM   S  +  S+++P  Y DV IAE+H+VT AAG+AI+  K  V+IYSTFLQR YD L+HDVA   L + F +DR  +  +DG TH G +D+ +L+ IPN ++   SN+ E   ++   YQ K  P  +RY +     +E++K            T+      +++G ++ +++      +  +++  FI       + ++++T+  +  VE+   +   G  +     ++K S  +  I + +  I  G++ ++  +L +D   I
  S:     8 LDKINSPADLRRLPRTQLPELCAEIRQFLLTSVSQSSGHLASGLGTVELTVALHYVYHTPEDKLVWDVGHQAYPHKILTGRKQRLHSIRQKDGLHPFPWREESEYDVLSVGHSSTSISAALGMAVAAQRQSLRQKVVSIIGDGAMTAGMAFEAMNHAGDIKPDMLVVLNDNDMSISENVGALNHHFARLLSGR--FYTSL--------REGSKKLLSPLPHIRHFASRAEEHMKGMMAPGTIFEELGFNYIGPIDGHDVDTLVDTLSNMRSL--GGPQLLHIVTQKGKGYRPAERDPIG-YHGVPKFDPKESSLPEKAPGIPSYSEIFGQWLCDTASNDKSLMAITPAMREGSGMVTFSQQYPQQYFDVAIAEQHSVTYAAGLAISGLKPVVAIYSTFLQRGYDQLIHDVALQNLDVLFAIDRAGIVGADGPTHQGAFDLSYLRCIPNMVVMAPSNEQECLDMLTTGYQYKG-PAAVRYPRGAGVGLELRKGKVIDIGKAQTLTEGQNIAFLNFGTLLPEVEAAAAKFNATVVDMRFIKPLDTACLDQLMTTHSVLVTVEENVIAGGAGGAVSEYVAQHKASPQVLTIGLPDEFIKHGSQGEVRAELGLDAAGI 607
>gi|124545103|ref|ZP_01704330.1| deoxyxylulose-5-phosphate synthase [Shewanella putrefaciens 200] >gi|124511290|gb|EAY55355.1| deoxyxylulose-5-phosphate synthase [Shewanella putrefaciens 200] (622 aa)
Score = 804, Expect = 1.8e-83, Identities = 197/601 (32%), Positives = 319/601 (53%)
  Q:    12 PNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI---EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLT-----EKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSL------KLSDPNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEK---CEDIEVKKEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           PN  + +++    L  +A  LR+ ++      S H +S LG VEL++AL YV+++P D + +D GHQ Y HK++T R DK+ TIR+ NGL  F    ES +D  S GHSG  +S         EK  +  K V+ VIGD A++ G+ FEA+N+       ML+++NDN MSIS+NVGAL+  +++  MS   + T     +K+L+ +   KE +K+       +   L         FE LGF+Y G IDG+++   +  ++ ++N+   GP +LH+ T KG GY+ AE D  G +H++      +   P+      T+  V   +L  + E D+ +  I PAM   S  +  S++FPN Y D  IAE+HAVT  AG A    K  V+IYSTFLQR YD L+HDVA   LP+ F +DR  +  +DG TH G +D+ F++ IPN +I   S++ E  +++   Y   + P  +RY +        +E       G  V  ++    +  ++++G  +             +++  F+     E V  +  T+  +  VE+       G  ++ L  + K+   + +I + +  I  G+ E++   L +D   I A+I +
  S:    17 PN--ELRQLPQALLPQVADELREFLLKSVGMSSGHFASGLGTVELTVALHYVYNTPFDRLIWDVGHQAYPHKILTGRRDKMHTIRQKNGLHPFPWREESEYDTFSVGHSGTSISAALAMAVAAEKEQAGRK-VVAVIGDGAMTGGMVFEAMNHAGDLHNDMLVVLNDNEMSISENVGALNNHLAQL-MSGRFYTTLREGGKKVLKGMPVIKEMAKR-------TEEHLKGMVVPGTLFEELGFNYIGPIDGHDVDALVETMRNMRNLK--GPQVLHIMTKKGRGYEPAEKDPIG-WHAVPKFDPTQFKKPSTTPGLPTFSQVFGKWLCDIAEQDDKVLGITPAMREGSGMVEFSQRFPNQYFDAAIAEQHAVTLGAGFACEGYKPVVAIYSTFLQRGYDQLIHDVALQRLPVLFAIDRGGIVGADGPTHQGAFDLSFMRCIPNMVIMAPSDENECRQMLYTGYCYNAGPSAVRYPRGSATGATQVEAMTALPIGKGV--IKRVGKRIALLNFGTTLASALTAADNLDATVVDMRFVKPLDAELVTEMAQTHDILVTVEENAIMGGAGSGVLELLQKLKMPKPVLQIGLPDEFIKHGSPEEVTHDLQLDAEGILAQINA 618
>gi|158320639|ref|YP_001513146.1| deoxyxylulose-5-phosphate synthase [Alkaliphilus oremlandii OhILAs] >gi|166920136|sp|A8MFI7|DXS_ALKOO 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|158140838|gb|ABW19150.1| deoxyxylulose-5-phosphate synthase [Alkaliphilus oremlandii OhILAs] (624 aa)
Score = 803, Expect = 1.9e-83, Identities = 219/602 (36%), Positives = 331/602 (54%)
  Q:    10 KIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKN--NSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEW--------SKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELD-DKGLYHS-----LKLSDPNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFS-----FGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSI--DLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIK 611
           +I + EDFKK+  +E+  LA  +R  +I+       HL+SNLG+VEL++AL   F+SP+D I +D GHQ YVHK++T R D+ ST+R+  GLSGF +  ES HD   TGHS   +S   G       N     VI VIGD A++ G+AFEALN+I  ++  +++I+NDN MSIS NVG L   ++K +       T  I  K+    E+         K +  +  K+   +  FF     FE LGF Y G +DG+N     +V+ R KNI   GP +LHV T KG GY  AE   DK  YH      ++  +P   + N +Y  +A   L +    D  I  I  AM   +   N +KK P  + DVGIAE+HA T AAG+A    K F ++YSTF QR+YD ++HD    +LP+T+L+DR  L  +DG+THHG  DI FL  IPN       +  EL  ++  A ++ + P  IRY +    +++ ++ FS      G   Y          + ++  +  ++ K+++  +I   L+N  FI    +E ++ ++  +K IY +E        G  + +L N+N++   +K   + +  I  GN ED+ ++L +    I  +IK
  S:     7 EINSIEDFKKLNSNEIKVLAEEIRHFLIESVSKTGGHLASNLGVVELTLALHQAFNSPEDKIIWDVGHQAYVHKILTGRRDQFSTLRQYKGLSGFPKRYESEHDQFDTGHSSTSISAAMGLATARDLNKDKYKVIAVIGDGAMTGGMAFEALNHIGQSQKDIIVILNDNEMSISPNVGGLSNYLNKIR-------TAPIYSKVKDDVEYLISNIPAIGKSVMKTAEKAKDSIKYFFVPGVLFEELGFTYIGPVDGHNYHSLYDVMNRTKNIK--GPVLLHVMTTKGKGYTLAEKHPDK--YHGVNSFHIETGEPISCNENLSYSEIAGKTLVECAAEDEKIVAITAAMPSGTGLNNFAKKHPERFFDVGIAEQHAATFAAGLAANGFKPFFAVYSTFFQRAYDQVIHDACIQDLPVTYLIDRAGLVGNDGETHHGSLDISFLSCIPNLTFMAPKDGIELSEMVRFAAKH-NGPVAIRYPRGH-SNMDSQENFSPLALGKGEITYHSGNDVLILALGTFNKMGLEICKDLEENNIFSTLMNPRFIKPMDEELIVEMVQKHKIIYTIEDNSKIGGFGTLVQVLLNDNQILKPVKVCALPDRFIEHGNVEDLYEELGLTKKQIVDQIK 618
>gi|149928101|ref|ZP_01916348.1| 1-deoxy-D-xylulose-5-phosphate synthase [Limnobacter sp. MED105] >gi|149823187|gb|EDM82424.1| 1-deoxy-D-xylulose-5-phosphate synthase [Limnobacter sp. MED105] (639 aa)
Score = 803, Expect = 2.1e-83, Identities = 188/454 (41%), Positives = 267/454 (58%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTP---MLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYW---SIYKSFSKLSKFFKG----KNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNSNNQT------YGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQ 461
           + KI    D +++  ++L  LA  LR  I++       HLSSNLG VEL++AL YVF++P D + +D GHQ Y HK++T R D +  +R+  G+SGF + +ES +D   T HS   +S   G     +N   ++  I VIGD +++ G+AFEALNN     TP   +L+I+NDN MSIS  VGAL+K ++K        L+ ++L  +   KE  K I      +Y+   +L +  KG       FE  GF+Y+G IDG++L   +  L+ ++ +   GP  LHV T KG GYK AE  D  LYH     DP++     T      Y  +   +L  + + D  +  I PAM   S  +   ++FP+ Y DVGIAE+HAVT AAG+A    K  V+IYSTFLQR+YD L+HDVA   L +TF +DR  L  +DG TH G YDI +L+ IPN +I   SN+ E  +L+  AY 
  S:     5 LKKIDCPADLRRLSENQLPKLADELRNYIVEQVAKTGGHLSSNLGTVELTVALHYVFNTPNDRVVWDVGHQTYPHKILTGRRDAMPGLRQYGGISGFPKRSESEYDAFGTAHSSTSISAALGMAVASRNLGVNRKHIAVIGDGSMTAGMAFEALNNAGV--TPDIDLLVILNDNDMSISPPVGALNKYLAKL-------LSGRMLNNV---KEVGKGILGVAPPLYELAHRLEEHVKGMMSPATLFEEFGFNYYGPIDGHDLDALVPTLQNLRAMK--GPIFLHVITKKGAGYKLAE-QDPVLYHGPGKFDPSIGIQKSTTPKPPTYTQIFGKWLCDMAQSDRKLVGITPAMREGSGMVEFERRFPSRYFDVGIAEQHAVTFAAGLACEGMKPVVAIYSTFLQRAYDQLIHDVALQNLDVTFALDRAGLVGADGATHAGNYDIAYLRCIPNMVIAAPSNEDECRKLLTTAYH 461
>gi|148244515|ref|YP_001219209.1| 1-deoxy-D-xylulose-5-phosphate synthase [Candidatus Vesicomyosocius okutanii HA] >gi|146326342|dbj|BAF61485.1| 1-deoxy-D-xylulose-5-phosphate synthase [Candidatus Vesicomyosocius okutanii HA] (600 aa)
Score = 803, Expect = 2.1e-83, Identities = 199/545 (36%), Positives = 301/545 (55%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI---EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTK--EKCEDIEVKKEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVE 552
           ++ I +  D K++ + +L  LA  +R  +I+  +    HL+ NLGI+E+++A+ Y+FD+P D + +D GHQ Y HK++T R DK+ T+R+  GLSGF + +ES HD    GHS   +S   G       NNSK KS I VIGD A++ G++FEALN+   +   +LII+NDN MSISKNVGA++K +++  +S  V+ T K   K L   E   +I+    +S   L         FE LG  YFG IDG++L   I  LK +K      P +LH+ T KG G K AE +D   +H +  +  N  S+  +Y +V   +L     +  N+  I PAM   S      K +P  Y DVGIAE+HA+T A G+A+   K  V+IYSTFLQR YD L+HD+A   L + F +DR  L  +DG TH G +D+ FL+ IPN II   SN  ++ ++   A++  +N   IRY +     +D    K+ S G     L  K S   I ++G  +       K  +  +++  F+    K+ +  + +++  +  +E
  S:     2 LNSITSPTDIKQLNIVQLQSLAKKVRTFLIENIQRTGGHLAPNLGIIEMTIAIHYIFDTPYDSLVFDVGHQAYTHKILTGRFDKMHTLRQKGGLSGFTKHSESEHDSFGAGHSSTSISAALGIAIGNSINNSKGKS-IAVIGDGALTGGMSFEALNHAGDSDADLLIILNDNDMSISKNVGAMNKYLTRL-ISGKVYSTMK--SKSLGFLEKIPQIHKFAKRSEEHLKGMVLPSTLFEELGLDYFGPIDGHDLPTLIQTLKNLKKQTK--PRLLHIITKKGYGLKIAE-NDPCKFHGVTPASSN-TSSFPSYSTVFGTWLNNTALHHKNLVAITPAMCAGSGMSEFEKNYPKQYFDVGIAEQHAITFAGGLAMQGLKPIVAIYSTFLQRGYDQLIHDIALQNLNVIFAIDRAGLVGADGATHAGSFDLSFLRCIPNLIIMTPSNAMQMYQMFNTAFKT-NNTICIRYPRGVSNIQDYVTDKQISLGKAKIIL--KGSDVAIFAFGTTVESAFSAGKKLNATVVDMRFVKPLDKDLITELANSHIKLISIE 540
>gi|103487835|ref|YP_617396.1| 1-deoxy-D-xylulose-5-phosphate synthase [Sphingopyxis alaskensis RB2256] >gi|118595621|sp|Q1GQK9|DXS_SPHAL 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|98977912|gb|ABF54063.1| 1-Deoxy-D-xylulose-5-phosphate synthase [Sphingopyxis alaskensis RB2256] (642 aa)
Score = 803, Expect = 2.1e-83, Identities = 203/566 (35%), Positives = 310/566 (54%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKSK--SVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGK----NFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELD-DKGLYHSLKLSDPNLNSNNQT------YGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEV-----KKEFSFGSWVYALQTKESKT-CIISYGDIINDLKK-----EIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKL 573
           +D +    D +K+K  +L   A  LR ++I        HL S LG+VEL+ A+ YVFD+P+D + +D GHQCY HK+IT R D+I T+R+  GLSGF + +ES +D     HS   +S   GF   N  K +    I VIGD ++S G+A+EA+NN       +++I+NDN MSI+  VG L   ++K   S+      +I R+      +++K+   ++K+  K  ++ +G       FE LGF+Y G IDG+NL   I +L+ +++    GP ++H  T KG GY  AE   DK  YH ++  D       +       Y +V    L KL E D  I  I  AM   +     +K  P+   DVGIAE+HAVT AAG+A    + F +IYSTFLQR+YD ++HDVA   LP+ F +DR  L  +DG TH G +DI +L ++PN ++  A+++ EL  +   A ++ + P   RY +     + +     K E   G  V     +E KT  I+S G  + +  K     E +  S  +I+  F     +E + R L+ ++    VE+      LG  ++ LA++  L
  S:    10 LDTVDVPADLRKLKPEDLRQFADELRAEMISAVGTTGGHLGSGLGVVELTTAIHYVFDTPRDKLVWDVGHQCYPHKIITGRRDRIRTLRQGGGLSGFTKRSESEYDPFGAAHSSTSISAALGFAIANKLKDEPGRAIAVIGDGSMSAGMAYEAMNNAKQAGNRLIVILNDNDMSIAPPVGGLSAYLAKLVSSRPFLELREIARR------FARKLPEPLHKAAKKTDEYARGMAMGGTLFEELGFYYVGPIDGHNLDHLIPILENVRD-SDHGPVLIHAVTKKGKGYAPAEAAADK--YHGVQKFDVITGEQAKAPPGPPAYQNVFGETLAKLAETDKRIVAITAAMPSGTGVDKFAKVHPDRSFDVGIAEQHAVTFAAGLAAQGMRPFAAIYSTFLQRAYDQVVHDVAIQNLPVRFAIDRAGLVGADGSTHAGSFDITYLATLPNMVVMAAADEAELVHMTYTAAEHDAGPIAFRYPRGNGTGVALPAVPQKLEIGKGRVV-----REGKTVAILSLGTRLAEALKAADTLEARGLSTSVIDLRFAKPLDEELIRRTLAAHEVCVTVEE-GSIGGLGAHVLTLASDEGL 584
>gi|157369321|ref|YP_001477310.1| 1-deoxy-D-xylulose-5-phosphate synthase [Serratia proteamaculans 568] >gi|166920143|sp|A8GAP2|DXS_SERP5 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|157321085|gb|ABV40182.1| deoxyxylulose-5-phosphate synthase [Serratia proteamaculans 568] (621 aa)
Score = 803, Expect = 2.3e-83, Identities = 192/599 (32%), Positives = 325/599 (54%)
  Q:    13 NYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLT-----EKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNSNNQ------TYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIK 611
           N ++ + +    L  L   LR+ ++D     S H +S LG VEL++AL YV+ +P D + +D GHQ Y HK++T R DKI+TIR+ NGL  F    ES +D +S GHS   +S   G         K++  + VIGD AI+ G+AFEA+N+       ML+++NDN MSIS+NVGAL+  +++  +S  ++ T     +K+L  +   KE  K+       +   L         FE LGF+Y G +DG++++  +  LK ++++   GP +LH+ T KG GY  AE D    +H++   DP   +  +      TY  V  ++L +    D+++  I PAM   S  +  S+ +P  Y DV IAE+HAVT AAG+AI   K  V+IYSTFLQR+YD L+HDVA  +LP+ F +DR  +  +DG TH G +D+ F++ IP  +I   S++ E  +++   Y     P  +RY +       ++   S       ++ +  K  I+++G ++ +  +  +T +  L++  F+    ++ +L + +++  +  +E+       G  +  L    +    +  I + +  +  G++E++   L +D   I  +I+
  S:    16 NPDELRSLPKESLPKLCDELRQYLLDSVSRSSGHFASGLGTVELTVALHYVYQTPFDHLVWDVGHQAYPHKILTGRRDKIATIRQKNGLHPFPWRAESEYDVLSVGHSSTSISAGLGMAVAAAREGKNRRTVCVIGDGAITAGMAFEAMNHAGDIDPDMLVVLNDNEMSISENVGALNNHLAQL-LSGKLYSTLREGGKKVLSGLPPIKELVKR-------TEEHLKGMVVPGTLFEELGFNYIGPVDGHDVQGLVATLKNMRDLK--GPQLLHIMTKKGRGYAPAEKDPIS-FHAVPKFDPASGTLPKSAGGLPTYSKVFGDWLCETAAKDSSLMAITPAMREGSGMVQFSRDYPQQYFDVAIAEQHAVTFAAGLAIGGYKPVVAIYSTFLQRAYDQLIHDVAIQKLPVMFAIDRGGIVGADGQTHQGAFDLSFMRCIPTMVIMTPSDENECRQMLYTGYHYNEGPSAVRYPRGNGTGAPLEPLNSLPIGKGVVRREGEKLAILNFGTLLPEAAQVAETLNATLVDMRFVKPLDEQLILELAASHDALVTLEENAIMGGAGSGVNELLMARRRVVPVLNIGLPDFFVSQGSQEEVRSDLGLDAAGIQRQIE 616
>gi|153215988|ref|ZP_01950210.1| 1-deoxy-D-xylulose-5-phosphate synthase [Vibrio cholerae 1587] >gi|124114501|gb|EAY33321.1| 1-deoxy-D-xylulose-5-phosphate synthase [Vibrio cholerae 1587] (626 aa)
Score = 802, Expect = 2.5e-83, Identities = 183/479 (38%), Positives = 280/479 (58%)
  Q:    32 LRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILS------ICQGFIEKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLT-----EKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPN------LNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYALQTKESKTC------IISYGDII 510
           LR  +++     S HL+S LG VEL++AL YV+ +P D + +D GHQ Y HK++T R D++ TIR+ +GL  F    ES +D +S GHS   +S      IC G       K + V+ VIGD AI+ G+AFEA+N+       ML+++NDN MSIS+NVGAL+  +++  +S S++ +     +K+L  I   KE        + ++   L         FE LGF+Y G +DG+++ + I  LK ++ +   GP  LHV T KG GY  AE D  G YH +   DP+       N+   T+  +  +FL  +   D  +  I PAM   S  +  SK++P+ Y DV IAE+HAVT A GMAIA     V+IYSTFLQR YD L+HDVA + LP+ F +DR  +  +DG TH G +D+ +++ IPN +I   +++ E  +++   +Q++  P  +RY +     +E++  F+          +ES  C      I+S+G ++
  S:    35 LRTYLLNSVSQSSGHLASGLGTVELTVALHYVYHTPFDHLIWDVGHQAYPHKILTGRRDQMPTIRQKDGLHPFPWREESEYDTLSVGHSSTSISAALGMAICAG----KEGKDRKVVSVIGDGAITAGMAFEAMNHAGDVHPDMLVVLNDNEMSISENVGALNNHLAQV-LSGSLYTSIREGGKKVLSGIPPIKEL-------VRRTEEHLKGMVVPGTLFEELGFNYIGPVDGHDVLELIKTLKNMRELK--GPQFLHVMTKKGKGYAPAEKDPIG-YHGVPKFDPSHHSLPKSNNTKPTFSKIFGDFLCDMAAQDPKLMAITPAMREGSGMVRFSKEYPSQYFDVAIAEQHAVTLATGMAIAGYHPIVAIYSTFLQRGYDQLIHDVAIMNLPVMFAIDRAGIVGADGQTHQGAFDLSYMRCIPNMLIMAPADENECRQMLYTGHQHQG-PSAVRYPRGNGMGVELESSFTALEIGKGRLMRESTACEGEKVAILSFGTLL 520
>gi|19704543|ref|NP_604105.1| 1-deoxy-D-xylulose-5-phosphate synthase [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >gi|30315834|sp|Q8R639|DXS_FUSNN 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|19714829|gb|AAL95404.1| 1-deoxyxylulose-5-phosphate synthase [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] (600 aa)
Score = 802, Expect = 2.5e-83, Identities = 206/580 (35%), Positives = 330/580 (56%)
  Q:    32 LRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTP-MLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKG--KNFF--ESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSL---KLSDPNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYALQTKESKTCIISYG---DIINDLKKEIKTKSI--DLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIK 611
           +RK +I++      HL SNLG+VEL++ L  +FD  +D++ +D GHQ Y++K++TDRA++  +IR   GLS F +PNES +D   +GH+G  L    GF   N    K VI V+GDA+ISNG + EALN I Y K   +LII+NDN MSI +NVG + K + K   S       + ++  + + +  +     + ++  +L +  KG    F+  ESLGF +F V +GNN++K + +LK+IK++   GPTIL VKT KG GY  AE +DK  +H +    +   N   +  +Y  V  N + +L + D NI  ++ AM   +     S++FP    D GIAE   VT AAG+A + KK +V IYSTF+QR+   L+HDV+   LP+ F++DR  +   DG TH+GIYD+ F  SI N  + C +   EL + + ++      P  IR  ++   DIE ++    G W   +  K SK   I+ G    II ++  +++ + I   +I+A  +    +  +L  +  Y NI+V+E+ +  N  G  ++   N+N +   + +I +++  I  G +E++ K+  +   S+   I+
  S:    12 IRKNLIEVVSKNGGHLGSNLGVVELTVCLDEIFDFKEDIVLFDVGHQAYIYKILTDRAERFDSIRTRKGLSPFLDPNESSYDHFISGHAGTALPAAVGFAIAN--PDKKVIVVVGDASISNGHSLEALNYIGYKKLENILIIVNDNEMSIGENVGFISKFLKKVISSGKYQNFREDVKSFINRIKADR-----VKRTLERLERSIKGYVTPFYALESLGFRFFNVFEGNNIEKLLPMLKKIKDLK--GPTILLVKTEKGKGYCFAE-EDKEKFHGIAPFNIETGNTYKSLVSYSEVFGNKILELGKEDENIYTLSAAMIKGTGLHKFSEEFPERCIDTGIAEGFTVTLAAGLAKSGKKPYVCIYSTFIQRAISQLIHDVSIQNLPVRFIIDRSGIVGEDGKTHNGIYDLSFFLSIQNFTVLCPTTAKELGQALEISKNFNLGPLVIRIPRDSIFDIENEEPLEIGRW--KVIKKGSKNLFIATGTMLKIILEIYDKLQNRGIYCTIISAASVKPLDENYLLNYIKEYDNIFVLEENYVKNSFGTAILEFFNDNGIQKPLHRIALKSAIIPHGKREELLKEERLKGESLIERIE 592
>gi|194290325|ref|YP_002006232.1| 1-deoxy-D-xylulose 5-phosphate synthase; flavoprotein, thiamin-binding [Cupriavidus taiwanensis] >gi|193224160|emb|CAQ70169.1| 1-deoxy-D-xylulose 5-phosphate synthase; flavoprotein, thiamin-binding [Cupriavidus taiwanensis] (638 aa)
Score = 802, Expect = 2.5e-83, Identities = 180/466 (38%), Positives = 266/466 (57%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIA-YNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKG----KNFFESLGFHYFGVIDGNNLKKTINVLKRIKN--IVPFGPTILHVKTIKGLGYKEAELD-----DKGLYHSLKLSDPNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTK 473
           ++KI    D +K+   EL  LA  LR  +++       HLSSNLG VEL++AL YVF++P D + +D GHQ Y HK++T R +++ T+R+  G+SGF   +ES +D   T HS   +S   G     +   + +  + VIGD A++ G+AFEALNN   Y   P+++++NDN MSIS  VGAL++ +++    +    T+K + K+L        +   + +   +  +  KG       FE  GF+Y G IDG++L   +  L+ I+   +   GP  LHV T KG GYK AE D       G ++  +   P      +TY  V  ++L  +   D  +  I PAM   S  +   K+FP+ Y DVGIAE+HAVT A G+A    K  V+IYSTFLQR YD L+HDVA   LP+ F +DR  L  +DG TH G YDI +L+ IPN ++   S++ E  +L+  A+Q    P  +RY +
  S:     6 LNKIDAPADLRKLDRRELQTLADELRAYVLESVSQTGGHLSSNLGTVELTIALHYVFNTPDDRLVWDVGHQSYPHKILTGRRERMRTLRQWGGISGFPRRSESEYDTFGTAHSSTSISAALGMALGARTLGQKRVSVAVIGDGAMTAGMAFEALNNAGVYKDLPLVVVLNDNDMSISPPVGALNRHLARLLSGQFYAATKKGIEKVL-------SVAPPVLEFAKRFEEHAKGMMVPATLFEEFGFNYIGPIDGHDLNSLVPTLQNIRERALEGGGPQFLHVVTKKGQGYKLAEADPILYHGPGKFNPAEGIRPAAKPARKTYTQVFGDWLCDMAAADKRLVGITPAMREGSGMVEFEKRFPDRYYDVGIAEQHAVTFAGGLACEGLKPVVAIYSTFLQRGYDQLIHDVALQNLPVVFALDRAGLVGADGATHAGAYDIAYLRCIPNMMVMTPSDENECRQLLTTAFQQDC-PTAVRYPR 477
>gi|134093560|ref|YP_001098635.1| 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) [Herminiimonas arsenicoxydans] >gi|133737463|emb|CAL60506.1| 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) [Herminiimonas arsenicoxydans] (609 aa)
Score = 802, Expect = 2.5e-83, Identities = 196/530 (36%), Positives = 300/530 (56%)
  Q:    24 ELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQG--FIEKNNSKSKSVIPVIGDAAISNGLAFEALNNIA-YNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSK-FFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPN-----LNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYALQTKE-----SKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEK 553
           +L  LA  LR  +++       HLSSNLG VEL++AL  VF++P+D I +D GHQ Y HK++T R D++ ++R+ +G+SGF   +ES++D   T HS   +S   G     +   +++  I VIGD A++ G+AFEALNN   ++   +L+I+NDN MSIS  VGAL++ +++  MS   +   K + K +      +     + K F + +K        FE  GF+Y G IDG++L   I  L+ +K++   GP  LHV T KG GYK AE D   LYH     DP        ++  TY SV  ++L  +   D+ +  I PAM   S  +   ++FP  Y DVGIAE+HAVT AAGMA    K  V+IYSTFLQR+YD L+HDVA   L +TF +DR  L  +DG TH G YDI +L+ IPN ++  AS++ E  +++   + + + P  +RY +      +V+K  +       L T E      +  I+++G ++    +  +     + N  F+     E + R+ +T++ I  VE+
  S:     8 QLKQLADELRAFVLESVSATGGHLSSNLGTVELTIALHNVFNTPEDRIIWDVGHQTYPHKILTGRRDQMHSLRQRDGISGFPRRDESVYDTFGTAHSSTSISAALGMALAARTKGENRHAIAVIGDGAMTAGMAFEALNNAGIHDDINLLVILNDNDMSISPPVGALNRYLARL-MSGQFYAAAKNVGKTVLPAPVRE-----LAKRFEEHAKGMIVPATMFEEFGFNYIGPIDGHDLDSLIPTLQNLKHLK--GPQFLHVVTKKGQGYKLAEADPV-LYHGPGKFDPAEGIKPAAASKVTYTSVFGDWLCDMAAADDKLIGITPAMREGSGMVEFERRFPGRYYDVGIAEQHAVTFAAGMACEGLKPVVAIYSTFLQRAYDQLIHDVALQNLDVTFALDRAGLVGADGATHAGNYDIAYLRCIPNMVVMAASDENECRQMLSTGF-HYNGPAAVRYPRGGGIGAKVEKNLA----TIPLGTGEIRREGKRIAILAFGTMVAPSLRAGEELDATVANMRFVKPLDVELLKRLAATHEAIVTVEE 537
>gi|34541779|ref|NP_906258.1| 1-deoxy-D-xylulose-5-phosphate synthase [Porphyromonas gingivalis W83] >gi|41016941|sp|Q7MSZ3|DXS_PORGI 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|34398097|gb|AAQ67157.1| deoxyxylulose-5-phosphate synthase [Porphyromonas gingivalis W83] (634 aa)
Score = 802, Expect = 2.5e-83, Identities = 179/468 (38%), Positives = 265/468 (56%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSK--SKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSV----FLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHS-----LKLSDPNLNSNNQ---TYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEK 475
           ID I +  D + +K  +L  +   LR+ I+++      HL S+LG V+ ++AL YVFD+P D I +D GHQ Y HK++T R +    +R+  G+SGF  P ES +D    GH+ N +S   G    + +K   + VI VIGD +++ G+AFE LNN +     +LII+NDN MSI +NVG L++ M     SK+     +   K LRKI    E ++K       SF  L    +  N FE     YFG +DGNN+ + + VL +IK++   GP ILH++TIKG GY  AE     ++H+     +K  +     N      +  V  + L +L + D  +  + PAM    +   L KK+PN   DVGIAE HAVT +AG+A      F +IYS+F+QR YD ++HDVA     +   +DR  L   DG THHG++D+ FL+ +P+ ++    N+ EL  L++ AY+    P  IRY + K
  S:    10 IDHINSPADLRALKPEQLPQVCRELRRYILEVLSVTPGHLGSSLGAVDFTVALHYVFDTPYDRIVWDVGHQAYSHKILTGRREDFRHLRQWGGISGFPSPKESEYDTFPAGHASNSISAALGMAVASAAKDEKRKVIAVIGDGSMTGGMAFEGLNNASSFPNNLLIILNDNNMSIDRNVGGLNRYMVDILTSKTYNTIRYDLYKGLRKINLISETNRKNLLRFNNSFKAL--LARESNLFEGFSIRYFGPVDGNNVLRLVEVLNQIKDMA--GPKILHLRTIKGKGYSPAE-KQATIWHAPGEFDIKSGERKKGENKPEPPKFQDVFGHTLVELADRDERVVGVTPAMPTGCSMTFLMKKYPNRAYDVGIAEGHAVTFSAGLAKEGLIPFCNIYSSFIQRGYDQVIHDVALSGSHVVICLDRAGLVGEDGATHHGVFDMAFLRCVPDIVVASPLNEHELRNLMLTAYKGYDGPMVIRYPRGK 486
>gi|34763178|ref|ZP_00144144.1| 1-deoxy-D-xylulose 5-phosphate synthase [Fusobacterium nucleatum subsp. vincentii ATCC 49256] >gi|27887147|gb|EAA24252.1| 1-deoxy-D-xylulose 5-phosphate synthase [Fusobacterium nucleatum subsp. vincentii ATCC 49256] (601 aa)
Score = 802, Expect = 2.6e-83, Identities = 205/561 (36%), Positives = 322/561 (57%)
  Q:    32 LRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTP-MLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKG--KNFF--ESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSD---PNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYALQTKESKTCIISYG---DIINDLKKEIKTKSID--LINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCN-IKKINIRNNKIGFGNK 592
           +RKK+I++      HL SNLG+VEL++ L  VFD  +D++ +D GHQ YV+K++TDRA+K  TIR   GLS F +PNES +D   +GH+G  L    GF   N    K VI V+GDA++SNG + EALN I Y K   +L+I+NDN MSI +NVG + K + +   S       + ++  + + +  +     + K+  +L +  KG    F+  ESLGF +F V +GNN++K + +LK+IK++   GP +L VKT KG GY  AE ++K  +H +   D    N + ++ +Y  V  N + +L + D +I  ++ AM   +      ++FP    D GIAE  AVT A G+A + KK +V IYSTF+QR+   L+HD++   LP+ F++DR  +   DG TH+GIYD+ F  SI N  + C +   ELE+ + ++      P  IR  ++   DIE +K    G W      K SK   I+ G    II ++  E+K + ID  +++A  +    +  +L  +  Y NI+V+E+ +  N  G  ++   N+N +    I +I +++  I  G +
  S:    12 IRKKLIEVVSKNGGHLGSNLGVVELTVCLDEVFDFKEDIVLFDVGHQAYVYKILTDRAEKFDTIRTRKGLSPFLDPNESKYDHFVSGHAGTALPAAVGFAIAN--PDKKVIAVVGDASLSNGHSLEALNYIGYKKLENILVIVNDNEMSIGENVGFISKFLKRVITSGKYLNFREDVKSFINRVKADR-----VKKTLERLERSIKGYVTPFYALESLGFRFFNVCEGNNIEKLLPMLKKIKDLK--GPIVLLVKTEKGKGYCFAE-ENKEKFHGIAPFDIKTGNTHKSSVSYSEVFGNKILELGKEDKDIYTLSAAMIKGTGLHKFLEEFPERCIDTGIAEGFAVTLAGGLAKSRKKPYVCIYSTFIQRAVSQLIHDISLQNLPVRFIIDRSGIVGEDGKTHNGIYDLSFFLSIQNFTVLCPTTSKELEQALDISKNFNLGPLVIRIPRDSIFDIEDEKPLEIGRWKEI--KKGSKNLFIATGTMLKIILEIYDELKNRGIDCTIVSAASVKPLDENYLLNYIKGYDNIFVLEENYVRNSFGTSILEFLNDNGIQKKIIHRIALKSAIIPHGKR 574
>gi|73540585|ref|YP_295105.1| 1-deoxy-D-xylulose-5-phosphate synthase [Ralstonia eutropha JMP134] >gi|118595607|sp|Q474C2|DXS_RALEJ 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|72117998|gb|AAZ60261.1| 1-Deoxy-D-xylulose-5-phosphate synthase [Ralstonia eutropha JMP134] (638 aa)
Score = 802, Expect = 3.1e-83, Identities = 182/466 (39%), Positives = 265/466 (56%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIA-YNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKG----KNFFESLGFHYFGVIDGNNLKKTINVLKRIKN--IVPFGPTILHVKTIKGLGYKEAELD-----DKGLYHSLKLSDPNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTK 473
           + KI    D +K+   EL  LA  LR  +++       HLSSNLG VEL++AL YVF +P D + +D GHQ Y HK++T R ++++T+R+  G+SGF   +ES +D   T HS   +S   G     +   + +  I VIGD A++ G+AFEALNN   Y   P+++++NDN MSIS  VGAL+K +++    +    T+K + K+L        +   + +   +  +  KG       FE  GF+Y G IDG++L   +  L+ I+   +   GP  LHV T KG GYK AE D       G ++  +   P      +TY  V   +L  +   D  +  I PAM   S  +   K+FP  Y DVGIAE+HAVT A GMA    K  V+IYSTFLQR YD L+HDVA   LP+ F +DR  L  +DG TH G YDI +L+ IPN ++   S++ E  +L+  A+ +++ P  +RY +
  S:     6 LKKIDAPADLRKLDRRELRTLADELRAYVLESVSQTGGHLSSNLGTVELTIALHYVFHTPDDRVVWDVGHQSYPHKILTGRRERMNTLRQFGGISGFPRRSESQYDTFGTAHSSTSISAALGMALGARTLGEQRVSIAVIGDGAMTAGMAFEALNNAGVYKDLPLVVVLNDNDMSISPPVGALNKHLARLLSGQFYAATKKGIEKVL-------SVAPPVLEFAKRFEEHAKGMMVPATLFEEFGFNYIGPIDGHDLDSLVPTLQNIRKRALEGAGPQFLHVVTKKGQGYKLAEADPILYHGPGKFNPAEGIRPAAKPARKTYTQVFGEWLCDMAAADKRLIGITPAMREGSGMVEFEKRFPERYYDVGIAEQHAVTFAGGMACEGLKPIVAIYSTFLQRGYDQLIHDVALQNLPVVFALDRAGLVGADGATHAGAYDIAYLRCIPNMMVMTPSDENECRQLLTTAF-HQNCPTAVRYPR 477
>gi|82701370|ref|YP_410936.1| 1-deoxy-D-xylulose-5-phosphate synthase [Nitrosospira multiformis ATCC 25196] >gi|118595593|sp|Q2YCH7|DXS_NITMU 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|82409435|gb|ABB73544.1| 1-Deoxy-D-xylulose-5-phosphate synthase [Nitrosospira multiformis ATCC 25196] (614 aa)
Score = 801, Expect = 3.3e-83, Identities = 184/460 (40%), Positives = 267/460 (58%)
  Q:    25 LLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNN--SKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLT-----EKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLN-----SNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKE 484
           L  LA  LR+ +++       HLSSNLG VEL++AL YVF++P D + +D GHQ YVHK++T R + +S +R   G++GF   +ES +D   T HS   +S   G    +    K +SV+ VIGD A+S G+AFEALNN     T +L+I+NDN MSIS+ VGAL+  +++  MS   + T     EK+L  +    E +K+       +   +         FE  GF+Y G IDG++L   ++ L  I+N+   GP  LHV T KG GYK AE DD  LYH +   +P+       S   +Y  V  ++L  +   D  +  I PAM   S  +  S ++ + Y DVGIAE+HAVT AAG+A    K  V+IYSTFLQR+YD L+HDVA   LP+ F +DR  L  +DG TH G +D+ +L+ IPN  +   S++ E  +++  A+Q  + P  +RY +     +  +KE
  S:    22 LPQLADELRQFLVESVAKTGGHLSSNLGTVELTIALHYVFNTPYDRLVWDVGHQTYVHKILTGRREGMSKLRMRGGIAGFPRRDESEYDAFGTAHSSTSISAALGMAVASQWEGKKRSVVAVIGDGAMSAGMAFEALNNAGAMDTNLLVILNDNDMSISRPVGALNNYLARL-MSGQFYATARRAGEKMLGVVPHVLELAKR-------AEEHVKGMVTPSTLFEEFGFNYIGPIDGHDLDVLVSTLNNIRNLR--GPQFLHVVTRKGAGYKAAE-DDPILYHGVTRFNPDAGIIPKASVKPSYTQVFGDWLCDMAALDQRLVGITPAMREGSGMVRFSHEYADRYFDVGIAEQHAVTFAAGLACDGLKPVVAIYSTFLQRAYDQLIHDVAIQNLPVVFAIDRAGLVGADGPTHAGSFDLTYLRCIPNITVMAPSDENECRQMLYTAFQ-MNTPAAVRYPRGSGSGVAQQKE 481
>gi|163782598|ref|ZP_02177595.1| 1-deoxy-D-xylulose-5-phosphate synthase [Hydrogenivirga sp. 128-5-R1-1] >gi|159882171|gb|EDP75678.1| 1-deoxy-D-xylulose-5-phosphate synthase [Hydrogenivirga sp. 128-5-R1-1] (628 aa)
Score = 801, Expect = 3.3e-83, Identities = 182/476 (38%), Positives = 276/476 (57%)
  Q:    15 EDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKSKS--VIPVIGDAAISNGLAFEALNNIAYNK-TPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSK-FFKG----KNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSL---KLSDPNL--NSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVK--KEFSFGSW 490
           ED K++   +L  LA  +R  II+++     H+   LG+VEL++ALL VF  P D + +D GHQ Y  K++TDR D   T+R+  G++GF    ES +D    GHS   +S   GF    + K     VI VIGD A++ G+AFEALNN  + +    ++I+NDN MSIS NVGA+   +++      V  + + ++ +L       K +      F KL++ F KG       FE LGF+Y GV+DG+N+      LK +K+I   GP +LHV T KG GY  AE +D   +H +   K+    +    +  ++ SV    + +L E D+ I +I PAM   S  +  SK+FP+ + DVGIAE+HA T A G+A    +   S YSTFLQR+YD ++HD+A  +LP+TF +DR  L   DG THHG++D+ +L+ +PN +++   ++ EL  L+  A ++   PF +RY +     +  +  +E   GSW
  S:    15 EDLKELSEEDLKRLAQEVRDYIIEVTSKNGGHVGPGLGVVELTIALLRVFSPPADTVVWDIGHQGYPWKILTDRKDLFHTLRQHGGIAGFLRREESPYDAFGAGHSSTSISAALGFRVAKDMKGDDSHVIAVIGDGAMTAGMAFEALNNAGHLRPNRFIVILNDNEMSISPNVGAISTYLNRIISGHFVQESRQRIKSLL-------KHFGETPLRFMKLTEEFLKGLISPGVLFEELGFNYIGVVDGHNIAALEKTLKNVKDIE--GPVLLHVATKKGKGYPHAE-EDPVKWHGVAPYKVESGEIIKKPSPPSWTSVFGKAVVELAEMDDRIVVITPAMREGSGLVEFSKRFPDRFFDVGIAEQHAATFAGGLACEGMRPIASYYSTFLQRAYDQVIHDIALQKLPVTFAIDRGGLVGDDGPTHHGVFDLSYLRCVPNMVVSAPKDEQELRNLLYTAVKS-GLPFSVRYPRGAAYGVPTEDFQEIEIGSW 494
>gi|170691119|ref|ZP_02882285.1| deoxyxylulose-5-phosphate synthase [Burkholderia graminis C4D1M] >gi|170144368|gb|EDT12530.1| deoxyxylulose-5-phosphate synthase [Burkholderia graminis C4D1M] (635 aa)
Score = 801, Expect = 3.3e-83, Identities = 193/537 (35%), Positives = 293/537 (54%)
  Q:    17 FKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAY-NKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKG----KNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELD-----DKGLYHSLKLSDPNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFS---FGSWVYALQTKE---SKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEK 553
            +++   +L  LA  LR  ++D       HLSSNLG VEL++AL YVFD+P D I +D GHQ Y HK++T R +++ T+R+  G+SGF + +ES +D   T HS   +S   G     K    ++  I VIGD A++ G+AFEA+NN    +  P+L+I+NDN MSIS  VGAL++ +++    +        + ++L       ++   +     KL +  KG       FE  GF+Y G IDG++L   I  L+ IK +   GP  LHV T KG GYK AE D       G ++  +   P    + +TY  V   +L    E D  +  I PAM   S  +   K+FP+ Y DVGIAE+HAVT A G+A    K  V+IYSTFLQR+YD L+HDVA   LP+ F +DR  L  +DG TH G YD+ F++ IPN ++   S++ E  +++  A Q +S P  +RY +     +   K+ +    G      +T +    +  I+++G ++       +     + N  F+     + V ++  T+  I  VE+
  S:    14 LRRLDRRQLQPLADELRAFVLDSVSQTGGHLSSNLGTVELTIALHYVFDTPHDRIVWDVGHQTYPHKILTGRRERMHTLRQLGGISGFPKRDESEYDTFGTAHSSTSISAALGMAIASKLQGDNRMGIAVIGDGAMTAGMAFEAMNNAGVEDDVPLLVILNDNDMSISPPVGALNRHLARLMSGRFYAAARAGVERVL-------RVAPPMLDLARKLEEHAKGMIVPATLFEEFGFNYIGPIDGHDLDSLIPTLQNIKELR--GPQFLHVVTKKGQGYKLAEADPVLYHGPGKFNPAEGIKPASAPSKKTYTQVFGEWLCDAAELDARVVGITPAMREGSGMVEFEKRFPDRYFDVGIAEQHAVTFAGGLAADGMKPVVAIYSTFLQRAYDQLIHDVALQNLPVVFAIDRAGLVGADGATHAGAYDLAFMRCIPNMMVMVPSDENESRQMLYTALQ-QSCPTAVRYPRGAGTGVATVKQMAALPVGKGEVRRETSQPAGKRIAILAFGTMVAPSLAAAEQLDATVANMRFVKPLDADLVRQLAETHDAIVTVEE 558
>gi|89901646|ref|YP_524117.1| 1-deoxy-D-xylulose-5-phosphate synthase [Rhodoferax ferrireducens T118] >gi|118595611|sp|Q21UG7|DXS_RHOFD 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|89346383|gb|ABD70586.1| 1-Deoxy-D-xylulose-5-phosphate synthase [Rhodoferax ferrireducens T118] (632 aa)
Score = 801, Expect = 3.3e-83, Identities = 196/538 (36%), Positives = 298/538 (55%)
  Q:    16 DFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQG--FIEKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKG----KNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNL------NSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVK---KEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEK 553
           D + +   +L  LA  LR  ++        HLSSNLG VEL++AL YVF++P D + +D GHQ Y HK++T R ++++T+R+  GLSGF +  ES +D   T HS   +S   G     K   + +  I VIGD A++ G+AFEALNN       +L+I+NDN MSIS  VGAL++ ++K  MS   +   K + K + K          +++   +L +  KG       FE  GF+Y G IDG++L   I  L+ IK++   GP  LHV T KG GYK AE D    YH     DP +       S  QT+  V   +L  +   D  +  I PAM   S  +   ++FP  + DVGIAE+HAVT AAG+A    K  V+IYSTFLQR YD L+HDVA   LP+ F +DR  L  +DG TH G YDI FL+ IPN  + C +++ E  +L+  A+  +++P  +RY +       V+   +   FG     ++   S   I+++G +++   +  +  ++ ++N  ++       +L++ + +  +  VE+
  S:    17 DLRLVPRAQLGALADELRAYLLHSVAKTGGHLSSNLGTVELTVALHYVFNTPHDRVVWDVGHQTYPHKILTGRRERMATLRQLGGLSGFPQRGESEYDDFGTAHSSTSISAALGMALAAKIRGEERYAIAVIGDGALTAGMAFEALNNAGVADCNLLVILNDNDMSISPPVGALNRHLAKL-MSGQFYAAAKNVGKTVLKGAPP------LFELAKRLEESAKGMVVPATLFEKFGFNYIGPIDGHDLDALIPTLENIKHLK--GPQFLHVVTKKGQGYKLAEADPVA-YHGPGKFDPAVGLQAPATSPKQTFTQVFGQWLCDMAAVDPRLVGITPAMREGSGMVEFEQRFPQRFFDVGIAEQHAVTFAAGLACEGLKPVVAIYSTFLQRGYDQLIHDVAIQNLPVVFALDRAGLVGADGATHAGAYDIPFLRCIPNVSVACPADENECRQLLSTAFA-QNHPVAVRYPRGAGAGTVVQAGLEALPFGQG--EIRRAGSSVAILAFGTLLHPALQVAEKLNVTVVNMRWVKPLDVALLLQVAADHDALVTVEE 556
>gi|121728344|ref|ZP_01681374.1| 1-deoxyxylulose-5-phosphate synthase [Vibrio cholerae V52] >gi|121629399|gb|EAX61829.1| 1-deoxyxylulose-5-phosphate synthase [Vibrio cholerae V52] (626 aa)
Score = 801, Expect = 3.4e-83, Identities = 183/479 (38%), Positives = 280/479 (58%)
  Q:    32 LRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILS------ICQGFIEKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLT-----EKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNS------NNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYALQTKESKTC------IISYGDII 510
           LR  +++     S HL+S LG VEL++AL YV+ +P D + +D GHQ Y HK++T R D++ TIR+ +GL  F    ES +D +S GHS   +S      IC G       K + V+ VIGD AI+ G+AFEA+N+       ML+++NDN MSIS+NVGAL+  +++  +S S++ +     +K+L  I   KE        + ++   L         FE LGF+Y G +DG+++ + I  LK ++ +   GP  LHV T KG GY  AE D  G YH +   DP+ +S         T+  +  +FL  +   D  +  I PAM   S  +  SK++P+ Y DV IAE+HAVT A GMAIA     V+IYSTFLQR YD L+HDVA + LP+ F +DR  +  +DG TH G +D+ +++ IPN +I   +++ E  +++   +Q++  P  +RY +     +E++  F+          +ES  C      I+S+G ++
  S:    35 LRTYLLNSVSQSSGHLASGLGTVELTVALHYVYHTPFDHLIWDVGHQAYPHKILTSRRDQMPTIRQKDGLHPFPWREESEYDTLSVGHSSTSISAALGMAICAG----KEGKDRKVVSVIGDGAITAGMAFEAMNHAGDVHPDMLVVLNDNEMSISENVGALNNHLAQV-LSGSLYTSIREGGKKVLSGIPPIKEL-------VRRTEEHLKGMVVPGTLFEELGFNYIGPVDGHDVLELIKTLKNMRELK--GPQFLHVMTKKGKGYAPAEKDPIG-YHGVPKFDPSHHSLPKSSNTKPTFSKIFGDFLCDMAAQDPKLMAITPAMREGSGMVRFSKEYPSQYFDVAIAEQHAVTLATGMAIAGYHPIVAIYSTFLQRGYDQLIHDVAIMNLPVMFAIDRAGIVGADGQTHQGAFDLSYMRCIPNMLIMAPADENECRQMLYTGHQHQG-PSAVRYPRGNGMGVELESSFTALEIGKGRLMRESTACEGEKVAILSFGTLL 520
>gi|153802281|ref|ZP_01956867.1| 1-deoxyxylulose-5-phosphate synthase [Vibrio cholerae MZO-3] >gi|124122163|gb|EAY40906.1| 1-deoxyxylulose-5-phosphate synthase [Vibrio cholerae MZO-3] >gi|150424424|gb|EDN16361.1| 1-deoxyxylulose-5-phosphate synthase [Vibrio cholerae AM-19226] (626 aa)
Score = 801, Expect = 3.4e-83, Identities = 196/580 (33%), Positives = 321/580 (55%)
  Q:    32 LRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILS------ICQGFIEKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLT-----EKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNS------NNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYALQTKESKTC------IISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIK 611
           LR  +++     S HL+S LG VEL++AL YV+ +P D + +D GHQ Y HK++T R D++ TIR+ +GL  F    ES +D +S GHS   +S      IC G       K + V+ VIGD AI+ G+AFEA+N+       ML+++NDN MSIS+NVGAL+  +++  +S S++ +     +K+L  I   KE        + ++   L         FE LGF+Y G +DG+++ + I  LK ++ +   GP  LHV T KG GY  AE D  G YH +   DP+ +S         T+  +  +FL  +   D  +  I PAM   S  +  SK++P+ Y DV IAE+HAVT A GMAIA     V+IYSTFLQR YD L+HDVA + LP+ F +DR  +  +DG TH G +D+ +++ IPN +I   +++ E  +++   +Q++  P  +RY +     +E++  F+          +ES  C      I+S+G ++ +  +  +  +  + +  F+    +  + ++  T+  +  +E+   +   G  +I    + K    +  + + +  I  G +E++  +L +D   I   I+
  S:    35 LRTYLLNSVSQSSGHLASGLGTVELTVALHYVYHTPFDHLIWDVGHQAYPHKILTGRRDQMPTIRQKDGLHPFPWREESEYDTLSVGHSSTSISAALGMAICAG----KEGKDRKVVSVIGDGAITAGMAFEAMNHAGDVHPDMLVVLNDNEMSISENVGALNNHLAQV-LSGSLYTSIREGGKKVLSGIPPIKEL-------VRRTEEHLKGMVVPGTLFEELGFNYIGPVDGHDVLELIKTLKNMRELK--GPQFLHVMTKKGKGYAPAEKDPIG-YHGVPKFDPSHHSLPKSSNTKPTFSKIFGDFLCDMAAQDPKLMAITPAMREGSGMVRFSKEYPSQYFDVAIAEQHAVTLATGMAIAGYHPIVAIYSTFLQRGYDQLIHDVAIMNLPVMFAIDRAGIVGADGQTHQGAFDLSYMRCIPNMLIMAPADENECRQMLYTGHQHQG-PSAVRYPRGNGMGVELESSFTALEIGKGRLMRESTACEGEKVAILSFGTLLPNALQAAEKLNATVADMRFVKPLDEALIKQLAQTHDVLVTLEENAIAGGAGAGVIEFLMKEKQLKPVLNLGLPDQFIVQGTQEEMHAELGLDAAGIERAIR 621
>gi|77919266|ref|YP_357081.1| 1-deoxy-D-xylulose-5-phosphate synthase [Pelobacter carbinolicus DSM 2380] >gi|118595596|sp|Q3A3Z6|DXS_PELCD 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|77545349|gb|ABA88911.1| 1-Deoxy-D-xylulose-5-phosphate synthase [Pelobacter carbinolicus DSM 2380] (634 aa)
Score = 801, Expect = 3.6e-83, Identities = 175/466 (37%), Positives = 268/466 (57%)
  Q:    16 DFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKS--KSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKIL-FKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNSNNQTYGSVAA------NFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEV 481
           + K + + EL  LA  +R KIID       HL+S+LG+VEL++AL +V ++P D I +D GHQ Y HK++T R D+  T+R+  G+SGF +  ES +D    GHS   +S   G     + K+  +  + VIGD +++ G+AFEALN        +++I+NDN MSIS+NVGAL  ++++   S+ V   +K     L       K +     K+   L  FF     FE+ GF Y G ++G+ L+  I  L+ + N+   GP ++HV T KG G++ AE  +  L+H +   D        + G  A+      + L  + E D+ I  I  AM   +     SK++P+ + DVGIAE+HAVT AAG+A    +  V++YSTFLQR+YDN++HDVA   LP+TF +DR  L  +DG THHG++D  FL+ IPN ++    ++ EL+R ++   Q+   P   RY + K   +E+
  S:    12 ELKGLSVKELEVLAGEIRTKIIDTVSQTGGHLASSLGVVELTIALHHVLNTPVDKIVWDVGHQAYAHKLLTGRLDRFDTLRQLGGISGFPKREESPYDAFDVGHSSTSISAALGMAAARDCKNGKEKFVAVIGDGSLTGGMAFEALNQAGDQNKNLIVILNDNEMSISQNVGALSSLINRKMTSELVVRLKKEAENFLGHVPRIGKDLLKVARKAEESLKGFFTPGMLFEAFGFDYVGPLNGHRLETLIPALENVANLE--GPVLVHVVTRKGKGFEPAE-KNPSLFHGVGPFDKETGEVRASKGGPASFTGVFGSTLTAMAEKDDRIVAITAAMLEGTGLKEFSKRYPSRFFDVGIAEQHAVTFAAGLACQGMRPVVALYSTFLQRAYDNVVHDVALQRLPVTFAIDRGGLVGADGPTHHGVFDYSFLRHIPNMVVIAPRDEIELQRAMLTGTQH-DGPLAYRYPRGKALGLEL 482
>gi|37527746|ref|NP_931091.1| 1-deoxy-D-xylulose-5-phosphate synthase [Photorhabdus luminescens subsp. laumondii TTO1] >gi|41016942|sp|Q7N0J7|DXS_PHOLL 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|36787182|emb|CAE16259.1| 1-deoxy-D-xylulose 5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) [Photorhabdus luminescens subsp. laumondii TTO1] (621 aa)
Score = 801, Expect = 3.6e-83, Identities = 194/594 (32%), Positives = 321/594 (54%)
  Q:    13 NYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWS---IYKSFSKLSKFFKGK----NFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNS------NNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVK--KEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSI 606
           N E+ + +    L  L   LR+ +++     S H +S LG VEL++AL YV+ +P D + +D GHQ Y HK++T R D+I TIR+ NGL  F   +ES +D +  GHS   +S   G     +   K +  + VIGD AI+ G+AFEA+N+       +L+I+NDN MSIS+NVGAL+  +++  +S  ++ T          +E  KK++ +   I +   K  +  KG       FE LGF+Y G IDG+++      LK ++ +   GP +LH+ T KG GY  AE D    +H++   DP   +      N  T+  +  ++L +    D  +  I PAM   S  +  S+++P+ Y DV IAE+HAVT AAG+AI   +  V+IYSTFLQR+YD ++HD+A   LP+ F +DR  +  +DG TH G +D+ FL+ IPN +I   S++ E  +++   Y  +  P  +RY +      E +  ++   G  V  ++ + +K  I+++G ++ D     ++    +++  F+    KE +L +   +  +  +E+       G  +  L  +      I  I + +  +  G++E+I   L +D   I
  S:    16 NPEELRMLPKESLPKLCDELRQFLLNSVSRSSGHFASGLGTVELTVALHYVYKTPFDKLVWDVGHQAYPHKILTGRRDRIDTIRQKNGLHPFPWRDESEYDTLCVGHSSTSISAGLGMAIAAQREGKGRRTVCVIGDGAITAGMAFEAMNHAGDIDPDILVILNDNEMSISENVGALNNHLAQL-LSGKLYTT---------LREGGKKVFSNLPPIKELLKKTEEHIKGMVVPGTLFEELGFNYIGPIDGHDVLTLTQTLKNMRELK--GPQLLHIMTKKGRGYAPAEKDPIS-WHAVPKFDPTTGALPKSSDNRPTFSKIFGDWLCEEAANDKKLMAITPAMREGSGMVRFSREYPDQYFDVAIAEQHAVTFAAGLAIGGYRPIVAIYSTFLQRAYDQVIHDIAIQNLPVLFAIDRGGIVGADGQTHQGAFDLSFLRCIPNMVIMAPSDENECRQMLHTGYHYQQGPVAVRYPRGTGTGAEPQPFEQLPIGKGV--IRRQGNKVAILNFGTLLPDAITAAESLDATVVDMRFVKPLDKELILDMADNHDLLVTLEENAIMGGAGSGVNELLMQKGRLVQILNIGLPDQFVPQGSQEEIKADLGLDAAGI 611
>gi|120437790|ref|YP_863476.1| 1-deoxy-D-xylulose-5-phosphate synthase [Gramella forsetii KT0803] >gi|117579940|emb|CAL68409.1| 1-deoxy-D-xylulose-5-phosphate synthase [Gramella forsetii KT0803] (592 aa)
Score = 801, Expect = 3.7e-83, Identities = 216/605 (35%), Positives = 318/605 (52%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSK---SKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNSNNQ--------TYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYALQTKE-SKTCIISYGDI-------INDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           ++ I + ED +K+   EL  L++ LRK IIDI   K  HL ++LG++EL++AL Y+F++P+DL+ +D GHQ Y HK++T R D   T R+ NGLSGF + +ES  D    GHS   +S   G    +N K    K  I VIGDA+I++G+AFE LN+       +L+I+NDN + I  +VGAL + ++K ++                            YK  S         N  E+L F YFG +DG++L+  +  LK +K I   GP  LHV T KG G K+AE +D+  YH+    +PN     +         Y  V    L +L E +  I  I PAM   S+   + K FP    DVGIAE+HAVT +AGMA     VF +IYSTFLQR+YD L+HDVA   LP+ F +DR  L   DG THHG++DI + + IPN +I    N+ EL  L+  A      P  IRY + +    E K  +       A   KE S+  I+S G++       I  L KE + K I   +  F+    K+ + +I   +  I  VE        G  ++  A       +++ + I +  I  G+ + + +   I++  I  +++S
  S:     6 LNHIDSPEDLRKLNKKELDLLSIELRKFIIDIVATKEGHLGASLGVIELTIALHYIFNTPEDLLVWDVGHQAYGHKILTGRRDIFETNRQLNGLSGFPKRDESEFDTFGVGHSSTSISAALGMAIASNLKGETEKQHIAVIGDASIASGMAFEGLNHAGVTNANLLVILNDNAIGIDPSVGALKEYLTKARVG---------------------------YKPASD--------NIIEALNFKYFGPVDGHDLEGLLKTLKEMKQIK--GPKFLHVITKKGKGLKKAE-EDQVKYHAPGKFEPNTGELLKYDTDGLPLKYQDVFGLTLVELAEKNEKIIGITPAMPTGSSLKYMMKAFPERAFDVGIAEQHAVTLSAGMATQGFTVFCAIYSTFLQRAYDQLIHDVAIQNLPVVFCLDRAGLVGEDGATHHGVFDIAYARPIPNLMIAAPRNEVELRNLLYTAQLGLDAPMIIRYPRGRGVLKEWKLPYEKAEIGKAECLKEGSEIAILSLGNMAGNVEMAIEKLNKEDRDK-IAHYDMKFVKPLDKKILNKIFGKFSKIITVEDGVIQGGFGSAILEYAASTGFKRDLELLGIPDKFIEQGSVDQLQEMAKINVQGIQQKLES 590
>gi|167583905|ref|ZP_02376293.1| 1-deoxy-D-xylulose-5-phosphate synthase [Burkholderia ubonensis Bu] (634 aa)
Score = 801, Expect = 3.7e-83, Identities = 183/479 (38%), Positives = 270/479 (56%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNK-TPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKG----KNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELD-----DKGLYHSLKLSDPNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFS 486
           +  I +  D +++   +L  LA  LR  ++D       HLSSNLG VEL++AL YVF++P D I +D GHQ Y HK++T R D++ ++R+ +G+SGF   +ES +D   T HS   +S   G     + N   +  I VIGD A++ G+AFEA+NN   ++   +L+I+NDN MSIS  VGAL++ +++    +        + ++L        +   + +   KL +  KG       FE  GF+Y G IDG++L   I  L+ IK +   GP  LHV T KG GYK AE D       G ++  +   P+     +TY  V   +L    E D+ +  I PAM   S  +   K+F + Y DVGIAE+HAVT A G+A    K  V+IYSTFLQR+YD L+HDVA   LP+ F +DR  L  +DG TH G YD+ F++ IPN  +   S++ E  +++  A Q + NP  +RY +     +   KEF+
  S:     5 LKTIDDPADLRRLDRRQLQPLADELRAFVLDSVSKTGGHLSSNLGTVELTIALHYVFNTPNDRIVWDVGHQTYPHKILTGRRDQMHSLRQLDGISGFPRRSESEYDTFGTAHSSTSISAALGMAIGSQLNGDDRFSIAVIGDGAMTAGMAFEAMNNAGVSEDAKLLVILNDNDMSISPPVGALNRHLARLMSGRFYAAARAGVERVL-------SVAPPVLELARKLEEHAKGMVVPATLFEEFGFNYIGPIDGHDLDSLIPTLQNIKELR--GPQFLHVVTKKGQGYKLAEADPVLYHGPGKFNPAEGIKPSATPAKKTYTQVFGEWLCDEAERDSRVVGITPAMREGSGMVEFEKRFKDRYYDVGIAEQHAVTFAGGLATEGLKPVVAIYSTFLQRAYDQLIHDVALQNLPVVFAIDRSGLVGADGATHAGAYDLAFMRCIPNMTVMVPSDENECRQMLHTALQ-QPNPTAVRYPRGAGTGVATVKEFT 485
>gi|90410904|ref|ZP_01218918.1| 1-deoxy-D-xylulose-5-phosphate synthase [Photobacterium profundum 3TCK] >gi|90328117|gb|EAS44428.1| 1-deoxy-D-xylulose-5-phosphate synthase [Photobacterium profundum 3TCK] (620 aa)
Score = 800, Expect = 4.2e-83, Identities = 192/597 (32%), Positives = 330/597 (55%)
  Q:    15 EDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKS--KSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWS---IYKSFSKLSKFFKGK----NFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSD------PNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFS---FGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIK 611
           ++ + + +  L ++   LR  +++     S H +S LG VEL++AL +V+++P D + +D GHQ Y HK++T R D++STIR+ +G+  F    ES +D +S GHS   +S   G     N +   + V+ VIGD AI+ G+AFEA+N+     + ML+I+NDN MSIS+NVGAL+  +++  +S S++ T          +E  KK+      I +   +  +  KG       FE LGF+Y G +DG+++ + +  LK ++N+   GP  LH+ T KG GY  AE D    YH++   D      P   +   T+  +  ++L  +   D  +  I PAM   S  +  SK++P+ Y DV IAE+HAVT A+GMAI      V+IYSTFLQR YD L+HDVA +ELP+ F +DR  L  +DG TH G +D+ F++ IPN +I   S++ E  +++   ++++  P  +RY +      +++ E +    G  +   Q +  +  I+S+G ++    +  +  +  + +  F+    +  +L + + +  +  VE+   +   G  +I    ++K    +  I + +  +  G ++++   L ID   I  +I+
  S:    18 DELRLLPVESLPEVCDELRTYLLNSVSQSSGHFASGLGAVELTVALHHVYNTPFDHLIWDVGHQAYPHKILTGRRDQMSTIRQKDGIHPFPWRGESEYDVLSVGHSSTSISAGLGMAIAANKEGLGRKVVSVIGDGAITAGMAFEAMNHAGDVHSDMLVILNDNEMSISENVGALNNHLARL-LSGSLYTT---------IREGGKKVLAGAPPIKELVKRAEEHIKGMVVPGTMFEELGFNYIGPVDGHDVAELVKTLKNMRNLK--GPQFLHIMTKKGKGYAPAEADPIN-YHAVPKFDLSQNPLPKATNAKPTFSKIFGDWLCDMAAEDEKLMAITPAMREGSGMVRFSKEYPSQYFDVAIAEQHAVTLASGMAIGGYNPVVAIYSTFLQRGYDQLIHDVAIMELPVMFAIDRGGLVGADGQTHQGAFDLSFMRCIPNIVIMAPSDENECRQMLYTGHKHQG-PSAVRYPRGNGLGADIQHEMTALEIGKGIVRRQGE--RIAILSFGTMLGYTLEAAEKLNATVADMRFVKPLDEALILELAANHDVLVTVEENAIAGGAGSGVIEFMMKSKCLKPVLNIGLPDRFVEQGTQQELHTALEIDAAGIEKQIR 616
>gi|15640905|ref|NP_230536.1| 1-deoxy-D-xylulose-5-phosphate synthase [Vibrio cholerae O1 biovar eltor str. N16961] >gi|121588122|ref|ZP_01677869.1| 1-deoxyxylulose-5-phosphate synthase [Vibrio cholerae 2740-80] >gi|147675127|ref|YP_001216367.1| 1-deoxy-D-xylulose-5-phosphate synthase [Vibrio cholerae O395] >gi|153223426|ref|ZP_01953868.1| 1-deoxyxylulose-5-phosphate synthase [Vibrio cholerae MAK 757] >gi|153823691|ref|ZP_01976358.1| 1-deoxyxylulose-5-phosphate synthase [Vibrio cholerae B33] >gi|194533699|ref|YP_002069115.1| 1-deoxyxylulose-5-phosphate synthase [Vibrio cholerae MO10] >gi|172047425|sp|A5F331|DXS_VIBC3 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|13124140|sp|Q9KTL3|DXS_VIBCH 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|9655344|gb|AAF94051.1| 1-deoxyxylulose-5-phosphate synthase [Vibrio cholerae O1 biovar El Tor str. N16961] >gi|121547613|gb|EAX57712.1| 1-deoxyxylulose-5-phosphate synthase [Vibrio cholerae 2740-80] >gi|124118234|gb|EAY36977.1| 1-deoxyxylulose-5-phosphate synthase [Vibrio cholerae MAK 757] >gi|125619751|gb|EAZ48278.1| 1-deoxyxylulose-5-phosphate synthase [Vibrio cholerae MO10] >gi|126518794|gb|EAZ76017.1| 1-deoxyxylulose-5-phosphate synthase [Vibrio cholerae B33] >gi|146317010|gb|ABQ21549.1| 1-deoxyxylulose-5-phosphate synthase [Vibrio cholerae O395] (626 aa)
Score = 800, Expect = 4.6e-83, Identities = 183/479 (38%), Positives = 280/479 (58%)
  Q:    32 LRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILS------ICQGFIEKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLT-----EKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNS------NNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYALQTKESKTC------IISYGDII 510
           LR  +++     S HL+S LG VEL++AL YV+ +P D + +D GHQ Y HK++T R D++ TIR+ +GL  F    ES +D +S GHS   +S      IC G       K + V+ VIGD AI+ G+AFEA+N+       ML+++NDN MSIS+NVGAL+  +++  +S S++ +     +K+L  I   KE        + ++   L         FE LGF+Y G +DG+++ + I  LK ++ +   GP  LHV T KG GY  AE D  G YH +   DP+ +S         T+  +  +FL  +   D  +  I PAM   S  +  SK++P+ Y DV IAE+HAVT A GMAIA     V+IYSTFLQR YD L+HDVA + LP+ F +DR  +  +DG TH G +D+ +++ IPN +I   +++ E  +++   +Q++  P  +RY +     +E++  F+          +ES  C      I+S+G ++
  S:    35 LRTYLLNSVSQSSGHLASGLGTVELTVALHYVYHTPFDHLIWDVGHQAYPHKILTGRRDQMPTIRQKDGLHPFPWREESEYDTLSVGHSSTSISAALGMAICAG----KEGKDRKVVSVIGDGAITAGMAFEAMNHAGDVHPDMLVVLNDNEMSISENVGALNNHLAQV-LSGSLYTSIREGGKKVLSGIPPIKEL-------VRRTEEHLKGMVVPGTLFEELGFNYIGPVDGHDVLELIKTLKNMRELK--GPQFLHVMTKKGKGYAPAEKDPIG-YHGVPKFDPSHHSLPKSSNTKPTFSKIFGDFLCDMAAQDPKLMAITPAMREGSGMVRFSKEYPSQYFDVAIAEQHAVTLATGMAIAGYHPIVAIYSTFLQRGYDQLIHDVAIMNLPVMFAIDRAGIVGADGQTHQGAFDLSYMRCIPNMLIMAPADENECRQMLYTGHQHQG-PSAVRYPRGNGMGVELESSFTALEIGKGRLMRESTACEGEKVAILSFGTLL 520
>gi|187929505|ref|YP_001899992.1| deoxyxylulose-5-phosphate synthase [Ralstonia pickettii 12J] >gi|187726395|gb|ACD27560.1| deoxyxylulose-5-phosphate synthase [Ralstonia pickettii 12J] (636 aa)
Score = 800, Expect = 4.8e-83, Identities = 202/604 (33%), Positives = 319/604 (52%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIA-YNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKK----EWSKKIYWSIYKSFSKLSK-FFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVP--FGPTILHVKTIKGLGYKEAELD-----DKGLYHSLKLSDPNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEV----------KKEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIK 611
           ++ I +  D +++   +L  LA  LR  ++D       HLSSNLG VEL++AL YVF++P+D I +D GHQ Y HK++T R D++ ++R+ +G+SGF   +ES +D   T HS   +S   G     K   + +  I VIGD A+S G+AFEA+NN   Y   P+++++NDN MSIS  VGAL++ +++    +    T+K + K+L       E++K+        F + +K  F     FE  GF+Y G IDG++L+  +  L+ I+       GP  LHV T KG GYK AE D       G ++  +   P+      TY  V   +L  +   D  +  I PAM   S  +   ++FP+ Y DVGIAE+HAVT A G+A    K  V+IYSTFLQR YD L+HDVA   LP+ F +DR  L  +DG TH G YDI +L+ IPN ++   +++ E  +L+  A+     P  +RY +     + V          K E    S   A Q    +  I+++G ++       +     ++N  F+       VL +  T+  +   E+       G   +       ++  + ++ + +  +  G+   +  +  +D N I A I+
  S:     6 LNTIDDPADLRRLDRRQLGPLANELRAFVLDSVSQTGGHLSSNLGTVELTIALHYVFNTPEDRIVWDVGHQSYPHKILTGRRDQMGSLRQLDGISGFPRRSESPYDTFGTAHSSTSISAALGMALGAKTKGEDRVAIAVIGDGAMSAGMAFEAMNNAGVYKDLPLVVVLNDNDMSISPPVGALNRYLARLMSGQFYAATKKGVEKLLSVAPPVLEFAKR--------FEEHTKGMFVPATMFEEFGFNYIGPIDGHDLESLVPTLQNIRQRAREGGGPQFLHVVTKKGQGYKLAEADPILYHGPGKFNPQEGIKPSGRPAKVTYTQVFGQWLCDMAAADKRLVGITPAMREGSGMVEFEQRFPDRYYDVGIAEQHAVTFAGGLACEGLKPVVAIYSTFLQRGYDQLIHDVALQNLPVVFALDRAGLVGADGATHAGAYDIAYLRCIPNMMVMTPADENECRQLLSTAFAQDC-PTAVRYPRGAGTGVTVQPTLEPLPVGKAEVRRTSTAPAGQ----RVAILAFGSMVAPASAAAERLDATVVNMRFVKPLDVACVLEMARTHDFVVTAEEGCVMGGAGSACLEALAAAGVATPVLQLGLPDRFVDHGDHAALLAQCGLDANGILASIR 621
>gi|157376461|ref|YP_001475061.1| 1-deoxy-D-xylulose-5-phosphate synthase [Shewanella sediminis HAW-EB3] >gi|189027789|sp|A8FYL0|DXS_SHESH 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|157318835|gb|ABV37933.1| deoxyxylulose-5-phosphate synthase [Shewanella sediminis HAW-EB3] (621 aa)
Score = 800, Expect = 4.9e-83, Identities = 197/597 (32%), Positives = 321/597 (53%)
  Q:    15 EDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI---EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLT-----EKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNL------NSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCE---DIEVKKEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIK 611
           ++ +++    L  LA  LR  ++      S H +S LG VEL++AL YV+++P D + +D GHQ Y HK++T R DK+ TIR+  G+  F    ES +D  S GHSG  +S         EK  +  K V+ VIGD A++ G+ FEA+N+       ML+++NDN MSIS+NVGAL+  +++  MS   + T     +K+L  +   KE +K+       +   L         FE LGF+Y G IDG+++   +  ++ ++N+   GP ILH+ T KG GY+ AE D  G +H++   DP+         +N T+  V   +L  + E D+ +  I PAM   S  +  S++FP  Y D  IAE+HAVT  AG A    K  V+IYSTFLQR YD L+HDVA  +LP+ F +DR  +  +DG TH G +D+ F++++PN +I   S++ E  +++   Y  +  P  +RY +        +E  +    G  +   Q +  K  I+++G ++ D+    ++    + +  F+     E V  + S++  +  VE+       G  ++ L  + K    + +I + +  I  G   +I  +L +D   I  +I+
  S:    18 DELRQLPQAVLPQLADELRGFLLKSVGKSSGHFASGLGTVELTVALHYVYNTPFDRLIWDVGHQAYPHKILTGRRDKMHTIRQKGGIHPFPWREESEYDTFSVGHSGTSISAALAMAVAAEKEQAGRK-VVSVIGDGAMTGGMVFEAMNHAGDLHNDMLVVLNDNEMSISENVGALNNHLAQL-MSGRFYTTIRESSKKVLEGMPVIKEMAKR-------TEEHLKGMVVPGTMFEELGFNYIGPIDGHDVDALVETMRNMRNLS--GPQILHIMTKKGRGYEPAEKDPIG-WHAVPKFDPSTFEKPASKPSNPTFSQVFGKWLCDVAEKDDKVLGITPAMREGSGMVEFSQRFPKQYFDAAIAEQHAVTLGAGFACEGLKPVVAIYSTFLQRGYDQLIHDVALQKLPVLFAIDRGGIVGADGPTHQGAFDLSFMRTVPNMVIMAPSDENECRQMLYTGYCYREGPTAVRYPRGSATGEPQVEEMQALPIGKGLIKRQGQ--KVAILNFGTLLADVLTAAESIDATVADMRFVKPLDVELVKELASSHDLLVTVEENAIMGGAGSGVLELLQQLKQPMPVLQIGLPDEFIKHGASGEILAELRLDAAGILEQIE 617
>gi|182625661|ref|ZP_02953430.1| 1-deoxy-D-xylulose-5-phosphate synthase [Clostridium perfringens D str. JGS1721] >gi|177909063|gb|EDT71538.1| 1-deoxy-D-xylulose-5-phosphate synthase [Clostridium perfringens D str. JGS1721] (619 aa)
Score = 799, Expect = 5.4e-83, Identities = 217/593 (36%), Positives = 317/593 (53%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNN--SKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSD------PNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSN-PFFIRYTKEKCEDIEVK--KEFSFGSWVYALQTKESKTCIISYGDIINDLK------KEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLN 600
           + +I + ++ K +   EL  LA  LR+ +I+   N   H +SNLG+++L++AL   FD  +D I +D GHQ Y +K++T R DK +T+R+  GL GF +  ES +DF +TGHS   LS   G         K   VI VIGD A++ G+A EALN+I Y K  ++II+NDN MSI KNVG L   ++K +M       +  +   L    + K++  S+ K    + K      +FE +G  YFG++DG+N+++   VL   KNI   GP I+H  T KG GY+ AE  +   YH +   D          S N  Y S     + KL + D+ +  I  AM   +   +  ++FP+ + DVGIAE+HAVT AAGMA    K F ++YSTFLQR+YD +LHDV   +LP+T  +DR  L   DG+TH GI+DI FL  +PN  I       E+E  +IL + +  N P  IRY +    D+ +K   +  +G W   +Q  E K  I++ G ++          KE K   I +INA FI    KE +  +      I  +E        G+ ++   NE      I  +   +  I  G K DI  K+N
  S:     5 LQRITDPKEIKDLDEKELEILAEDLREFLIESVSNTGGHFASNLGVIDLTVALFKNFDFSEDRIIWDVGHQSYAYKILTGRKDKFNTLRQYGGLCGFPKRTESEYDFFATGHSSTSLSSAAGMARAQRLLGKDNKVIAVIGDGALTGGMALEALNDIGYRKDNLIIILNDNQMSICKNVGGLATYLNKLRMGVGYNKLKSDIGSTLDTTSFGKRVKNSLSKLKDGIKKIVVPSMYFEDIGLKYFGIVDGHNIRELNEVLSIAKNIK--GPVIIHTVTKKGKGYELAE-KNPNKYHGVSPFDLGEGVISKFASRN--YSSTFGEEMIKLAKNDDKVVAITAAMPDGTGLKDFREEFPDRFFDVGIAEQHAVTLAAGMAAEGLKPFFAVYSTFLQRAYDQVLHDVCIQKLPVTLCLDRAGLVGEDGETHQGIFDISFLSPMPNMTIVAPKCIDEME--VILKWASNFNAPLAIRYPRGGDIDVNLKPLSKIEYGKW-EKVQEGE-KIAIVATGKMVQHAMIAAQKIKEEKNIDILIINATFIKPIDKELLNSLSKDGFKIVTIEDNIKKGGFGEGVLEYLNEIGHKEKIVTLAFNDKFIEHG-KPDILYKIN 604
>gi|119897489|ref|YP_932702.1| 1-deoxy-D-xylulose-5-phosphate synthase [Azoarcus sp. BH72] >gi|166198599|sp|A1K4R0|DXS_AZOSB 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|119669902|emb|CAL93815.1| probable 1-deoxy-D-xylulose 5-phosphate synthase [Azoarcus sp. BH72] (619 aa)
Score = 799, Expect = 5.8e-83, Identities = 184/466 (39%), Positives = 269/466 (57%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVF-----LTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNL------NSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTK 473
           +++I +  D +  +  EL  +A  LR  +I+       HLSSNLG VEL++AL YVF++P D I +D GHQ Y HK++T R + +S +R   G+SGF    ES +D   T HS   +S   G     ++  + +  I VIGD A+S G+AFEALNN       +L+I+NDN MSIS  VGAL KI+++  MS S +     + EK+L  +    E ++K+     + ++K          FE  GFHY+G IDG++L   I  L+ I+ +   GP  LHV T KG GYK AE D   LYH +   D         +    TY  V +++L  +   D  I  I PAM   S  +  +++FP+ Y DVGIAE+HA+T AAG+A    K  V+IYSTFLQR+YD L+HD+A   LP+   +DR  L  +DG THHG +D+ FL  +PN ++   +++ E  +++  A  +   P  +RY +
  S:     7 LERIGSPADLRATERRELAQVASELRAFLIESVSKTGGHLSSNLGTVELTIALHYVFNTPDDRIVWDVGHQTYGHKILTGRREAMSGLRHWGGISGFPRRCESEYDTFGTAHSSTSISAALGMAVAARDRGEDRRAIAVIGDGAMSAGMAFEALNNAGDMDANLLVILNDNEMSISPPVGALTKILARL-MSGSTYNAARRVGEKVLGTVPPMAELARKV-----EEYAK--GMIAPGTLFEEFGFHYYGPIDGHDLDALIPTLQNIRKLK--GPQFLHVITKKGQGYKLAEADPI-LYHGVSKFDHTAGIQTGKSGGKLTYTQVFSDWLCDIAAADPRIVGITPAMREGSGLVEFAQRFPDRYYDVGIAEQHALTFAAGLACEGLKPVVAIYSTFLQRAYDQLIHDIALQNLPVVLAIDRGGLVGADGATHHGAFDLSFLACVPNLVVMAPADENECRQMLYTAVCH-DGPTAVRYPR 473
>gi|195953435|ref|YP_002121725.1| deoxyxylulose-5-phosphate synthase [Hydrogenobaculum sp. Y04AAS1] >gi|195933047|gb|ACG57747.1| deoxyxylulose-5-phosphate synthase [Hydrogenobaculum sp. Y04AAS1] (627 aa)
Score = 799, Expect = 6.4e-83, Identities = 202/599 (33%), Positives = 329/599 (54%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGF-IEKNNSKSKS-VIPVIGDAAISNGLAFEALNNIAY-NKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSL-----KLSDPNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKC---EDIEVKKEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKS---------IDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSI 606
           ++ I +  D K++   EL  LA  +R+ IID++     H++  LG VEL++ALL VFD P+D++ +D GHQ Y  K++TDR +   T+R+  G+SGF    ES++D    GHS   +S  +GF + K+  K  S V+ VIGD A++ G+ +EALNNI + +   ++II+NDN MSISKN+GA+   ++K    + +  T   ++ IL K  +  + +  + + F K   F      FE LG +Y G+IDG+N +     LK  K+I   GP ++H+ T KG GY+ AE ++   +H +     +  + +  S  +++    +  L K+ E D  +  I PAM   S  ++ +KK+P+ + DVGIAE+HA T +AG+A    K  ++ YSTF+QR+YD ++HD+A   L + F VDR  L   DG THHG++DI FL  IPN +I+   +  EL  L+  A  N + PF IRY + +    ++    K    G W       +      SY      L KE    S         I+++NA FI    ++ +  I   +  +  +E        G  ++   N+N L   + +I I +  +   +++++ +  N+  + I
  S:     4 LEHINSVLDLKELSKEELKLLAEEIREFIIDVTSKNGGHVAPGLGTVELTIALLRVFDVPKDVVVWDIGHQAYPWKILTDRKEVFHTLRKKGGISGFLRIEESLYDAFGAGHSSTSISAAEGFRVAKDLLKDDSYVVAVIGDGAMTAGMVYEALNNIGHLHHNKLIIILNDNEMSISKNIGAISTYLNKLITGRHIQDTRNKIKNILDKAGFVPRRFAKLTEEFVK--GFATPGILFEELGLNYIGIIDGHNEEALETTLKNAKSID--GPVLIHIVTKKGKGYEPAE-ENPVKWHGVAPYKKESGEASKMSGGKSWTQCFSEALLKIAELDERVVAITPAMKEGSGLVDFAKKYPDRFFDVGIAEQHAATFSAGLAAGGLKPVLAYYSTFMQRAYDQIIHDIALQNLNVVFAVDRAGLVGEDGPTHHGVFDISFLNCIPNIVISSPKDNLELLDLLYTAI-NSNKPFAIRYPRGEAVLSKEERAPKLIKIGKWEVLKPGTDIAILTNSY------LLKEALEASYELLEHGINIEVVNARFIKPLDEDMLFDIAKRFNAVLSIEDGVLKGGFGASILEFFNDNMLDVKMYRIGIPDKFVEHASQKELREMFNLTKDGI 610
>gi|21672713|ref|NP_660780.1| 1-deoxy-D-xylulose-5-phosphate synthase [Buchnera aphidicola str. Sg (Schizaphis graminum)] >gi|25008399|sp|Q8K9A1|DXS_BUCAP 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|21623356|gb|AAM67991.1| 1-deoxyxylulose-5-phosphate synthase [Buchnera aphidicola str. Sg (Schizaphis graminum)] (585 aa)
Score = 799, Expect = 6.7e-83, Identities = 203/594 (34%), Positives = 317/594 (53%)
  Q:    17 FKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGF--IEKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVK--KEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEI 610
            + + + +L  L   LRK ++D+      H +S LG++E+++AL YV+D+P D + +D GHQ Y HK++T RA+KI +IR+ NGL  F    ES +D +S GHS   +S   G         K++  I V+GD +++ G+AFEA+N+    ++ +L+++NDN MSISKN+GAL+K +             K LR I               K  SK+  F    + FESL F Y G  DG+N+ K I + K+ K+       +LH+ T KG GY  AELD    +H++  S  + +S   TY  V  ++L ++ E+D  I  I PAM   S  L  S+ FPN Y DV IAE+HAVT AAG+AIA  K  VSIYSTFLQR+YD ++HDVA  +LP+ F +DR  +   DG TH GI+D+ +L+ IP  +I   SN+ E  +++   Y  K  P  +RY K K   + +   K    G  +  ++    K  I+++G ++ +     +  +  LI+  F+       +L++   Y  +  +E+   +   G  +       K+   +  I + +  I  G++E+I     +D   I  +I
  S:    20 LRLLSIEQLPQLCTELRKYLLDVVSITQGHFASGLGVIEITVALHYVYDTPFDNLLWDVGHQSYPHKILTGRAEKIGSIRKKNGLHPFPFREESKYDILSVGHSSTSISAGLGLSIAAGKEGKNRKTICVVGDGSMTAGMAFEAMNHAGIIQSDLLVVLNDNQMSISKNIGALNKHL-------------KFLRDI---------------KKSSKIFNF----SIFESLNFKYLGPFDGHNIFKLIEIFKKTKDYRK--TCLLHLITKKGKGYLPAELDPIK-WHTISQSF-SSSSKILTYSDVFGSWLCEIAEFDKKIMAITPAMCEGSGMLKFSRLFPNQYFDVAIAEQHAVTFAAGLAIAGYKPVVSIYSTFLQRAYDQIIHDVALQKLPVLFAIDRGGIVGHDGPTHQGIFDLSYLRCIPGIVIMTPSNENECRQMLYTGYMYKEGPSVVRYPKGKGIGMSLSPMKLIPLGKSL--IKRVGEKIAILNFGALLQNAYLAAEKLNATLIDMRFVKPLDTNMILKLSLKYNFLVTIEEGVIAGGAGSAVNEFIMMRKILLPVLNIGLPDMFIAHGSQEEIKHDYQLDPEGIQNKI 579
>gi|18310801|ref|NP_562735.1| 1-deoxy-D-xylulose-5-phosphate synthase [Clostridium perfringens str. 13] >gi|21263510|sp|Q8XJE1|DXS_CLOPE 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|18145482|dbj|BAB81525.1| 1-deoxyxylulose-5-phosphate synthase [Clostridium perfringens str. 13] (619 aa)
Score = 799, Expect = 6.7e-83, Identities = 217/593 (36%), Positives = 317/593 (53%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNN--SKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSD------PNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSN-PFFIRYTKEKCEDIEVK--KEFSFGSWVYALQTKESKTCIISYGDIINDLK------KEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLN 600
           + +I + ++ K +   EL  LA  LR+ +I+   N   H +SNLG+++L++AL   FD  +D I +D GHQ Y +K++T R DK +T+R+  GL GF +  ES +DF +TGHS   LS   G         K   VI VIGD A++ G+A EALN+I Y K  ++II+NDN MSI KNVG L   ++K +M       +  +   L      K++  S+ K    + K      +FE +G  YFG++DG+N+++   VL   KNI   GP I+H  T KG GY+ AE  +   YH +   D         +S N  Y S     + KL + D+ +  I  AM   +   +  ++FP+ + DVGIAE+HAVT AAGMA    K F ++YSTFLQR+YD +LHDV   +LP+T  +DR  L   DG+TH GI+DI FL  +PN  I       E+E  +IL + +  N P  IRY +    D+ +K   +  +G W   +Q  E K  I++ G ++          KE K   I +INA FI    KE +  +      I  +E        G+ ++   NE      I  +   +  I  G K DI  K+N
  S:     5 LQRITDPKEIKDLDEKELEILAEDLREFLIESVSNTGGHFASNLGVIDLTVALFKNFDFSEDRIIWDVGHQSYAYKILTGRKDKFNTLRQYGGLCGFPKRTESEYDFFATGHSSTSLSSAAGMARAQRLLGKDNKVIAVIGDGALTGGMALEALNDIGYRKDNLIIILNDNQMSICKNVGGLATYLNKLRMGVGYNKLKSDIGSTLDTTSLGKRVKNSLSKLKDGIKKIVVPSMYFEDIGLKYFGIVDGHNIRELNEVLSIAKNIK--GPVIIHTVTKKGKGYELAE-KNPNKYHGVSPFDLGEGVISKFSSRN--YSSTFGEEMIKLAKNDDKVVAITAAMPDGTGLKDFREEFPDRFFDVGIAEQHAVTLAAGMAAEGLKPFFAVYSTFLQRAYDQVLHDVCIQKLPVTLCLDRAGLVGEDGETHQGIFDISFLSPMPNMTIVAPKCIDEME--VILKWASNFNAPLAIRYPRGGDIDVNLKPLSKIEYGKW-EKVQEGE-KIAIVATGKMVQHAMIAAQKIKEEKNIDILIINATFIKPIDKELLNSLSKDGFKIVTIEDNIKKGGFGEGVLEYLNEIGHKEKIVTLAFNDKFIEHG-KPDILYKIN 604
>gi|71908674|ref|YP_286261.1| 1-deoxy-D-xylulose-5-phosphate synthase [Dechloromonas aromatica RCB] >gi|118595510|sp|Q47BJ0|DXS_DECAR 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|71848295|gb|AAZ47791.1| 1-Deoxy-D-xylulose-5-phosphate synthase [Dechloromonas aromatica RCB] (618 aa)
Score = 798, Expect = 7.2e-83, Identities = 181/466 (38%), Positives = 267/466 (57%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQG--FIEKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSL-KLSDPNLNSNNQ-----TYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTK 473
           ++ I +  D +++   +L  LA  LR  +ID       HLSSNLG VEL++AL  VF++P+D + +D GHQCY HK++T R + +ST+R   G+SGF +  ES +D    GHS   +S   G     K+  + +  I +IGD A+S G+AFEA+NN       ML+I+NDN MSIS  VGAL+ I+++   SK+  +  +  R +L    ++  +     ++   +         FE  GFHY+G IDG++L   I  L+ +K +   GP  LHV T KG GYK AE +D  LYH + K +  +   + +     TY  V  ++L  + + D+ +  I PAM   S  +  S +  + Y DVGIAE+HAVT AAG+A    K  V+IYSTFLQR YD L+HDVA   LP+ F VDR  L  +DG THHG +D+ F+  IPN  +   +++ E  +++  A      P  +RY +
  S:     7 LETINSPADLRRLDRKQLPQLASELRAFLIDSVSKTGGHLSSNLGTVELTIALHAVFNTPEDRLVWDVGHQCYAHKVLTGRREGMSTLRMHGGVSGFPKRAESPYDTFGVGHSSTSISAALGMALAAKHKGEDRKAIAIIGDGAMSAGMAFEAMNNAGVADADMLVILNDNEMSISPPVGALNNILTRLTSSKTYNVAREAGRHML---GFAPPLLELARRAEEHVKGMIAPGTLFEEFGFHYYGPIDGHDLDALIPTLENLKKLK--GPKFLHVITKKGQGYKLAE-NDPILYHGVGKFAACDGIQSAKGPAKLTYTQVFGDWLCDMAKADSRLVGITPAMREGSGMVRFSAEHADRYFDVGIAEQHAVTFAAGLACEGLKPVVAIYSTFLQRGYDQLVHDVALQNLPVIFAVDRGGLVGADGPTHHGTFDLSFVTCIPNMTVMAPADEAECRKMLSTA-MTIDGPSMVRYPR 473
>gi|168214393|ref|ZP_02640018.1| 1-deoxy-D-xylulose-5-phosphate synthase [Clostridium perfringens CPE str. F4969] >gi|168215447|ref|ZP_02641072.1| 1-deoxy-D-xylulose-5-phosphate synthase [Clostridium perfringens NCTC 8239] >gi|170714157|gb|EDT26339.1| 1-deoxy-D-xylulose-5-phosphate synthase [Clostridium perfringens CPE str. F4969] >gi|182382315|gb|EDT79794.1| 1-deoxy-D-xylulose-5-phosphate synthase [Clostridium perfringens NCTC 8239] (619 aa)
Score = 798, Expect = 8.6e-83, Identities = 217/593 (36%), Positives = 316/593 (53%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNN--SKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSD------PNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSN-PFFIRYTKEKCEDIEVK--KEFSFGSWVYALQTKE-SKTCIISYGDIINDLK------KEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLN 600
           + +I + ++ K +   EL  LA  LR+ +I+   N   H +SNLG+++L++AL   FD  +D I +D GHQ Y +K++T R DK +T+R+  GL GF +  ES +DF +TGHS   LS   G         K   VI VIGD A++ G+A EALN+I Y K  ++II+NDN MSI KNVG L   ++K +M       +  +   L    + K++  S+ K    + K      +FE +G  YFG++DG+N+++   VL   KNI   GP I+H  T KG GY+ AE  +   YH +   D          S N  Y S     + KL + D+ +  I  AM   +      ++FP+ + DVGIAE+HAVT AAGMA    K F ++YSTFLQR+YD +LHDV   +LP+T  +DR  L   DG+TH GI+DI FL  +PN  I       E+E  +IL + +  N P  IRY +    D+ +K   +  +G W    + KE  K  I++ G ++          KE K   I +INA FI    KE +  +      I  +E        G+ ++   NE      I  +   +  I  G K DI  K+N
  S:     5 LQRITDPKEIKDLDEKELEILAEDLREFLIESVSNTGGHFASNLGVIDLTVALFKNFDFSEDRIIWDVGHQSYAYKILTGRKDKFNTLRQYGGLCGFPKRTESEYDFFATGHSSTSLSSAAGMARAQRLLGKDNKVIAVIGDGALTGGMALEALNDIGYRKDNLIIILNDNQMSICKNVGGLATYLNKLRMGVGYNKLKSDIGSTLDTTSFGKRVKNSLSKLKDGIKKIVVPSMYFEDIGLKYFGIVDGHNIRELNEVLSIAKNIK--GPVIIHTVTKKGKGYELAE-KNPNKYHGVSPFDLGEGVISKFASRN--YSSTFGEEMIKLAKNDDKVVAITAAMPDGTGLKEFREEFPDRFFDVGIAEQHAVTLAAGMAAEGLKPFFAVYSTFLQRAYDQVLHDVCIQKLPVTLCLDRAGLVGEDGETHQGIFDISFLSPMPNMTIVAPKCIDEME--VILKWASNFNAPLAIRYPRGGDIDVNLKPLSKIEYGKWE---KVKEGEKIAIVATGKMVQHAMIAAQKIKEEKNIDILIINATFIKPIDKELLNSLSKDGFKIVTIEDNIKKGGFGEGVLEYLNEIGHKEKIVTLAFNDKFIEHG-KPDILYKIN 604
>gi|85709905|ref|ZP_01040970.1| 1-deoxy-D-xylulose-5-phosphate synthase [Erythrobacter sp. NAP1] >gi|85688615|gb|EAQ28619.1| 1-deoxy-D-xylulose-5-phosphate synthase [Erythrobacter sp. NAP1] (641 aa)
Score = 798, Expect = 8.7e-83, Identities = 209/591 (35%), Positives = 322/591 (54%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKN--NSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLN----------SNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDI---EVKKEFSFGSWVYALQTKESKTCIISYGDIINDLKK-----EIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKK 598
           +D IP  ++ +K+K  +L  LA  LR ++ID       HL S LG+VEL++A+ YVF++P D + +D GHQCY HK+IT R D+I TIR+  GLSGF +  ES +D     HS   +S   GF   N  N K    I VIGD A+S G+A+EA+NN A     +++I+NDN MSI+  VG L   +++  +S S +L  + L     KK  S++++ ++ K+         G   FE LGF+Y G IDG+NL   I VL+ +++    GP ++HV T KG GYK AE +    YH +    P  N          +    Y +V  + L  L + D  I  I  AM   +     +++ P+   DVGIAE+H VT AAG+A    + F +IYSTFLQR+YD ++HDVA   LP+ F +DR  L  +DG TH G +DI +L ++PN ++  A+++ EL  +   A +    P   RY +     +   E  ++   G     L  + SK  I+S G  + + KK     E K  S  + +  F     ++ + R++ T++ +  +E+      LG  ++  A +  L+ N  K+        F +++  DK+
  S:    10 LDTIPTPDELRKLKPEQLRQLADELRAEMIDAVSVSGGHLGSGLGVVELTVAIHYVFNTPDDKLIWDVGHQCYPHKIITGRRDRIRTIRQGGGLSGFTKRAESEYDPFGAAHSSTSISAALGFAIANKLNDKPGRGIAVIGDGAMSAGMAYEAMNNAAQAGNRLVVILNDNDMSIAPPVGGLSAYLARM-VSSSEYLGLRSLASKAVKK-MSRRLHDALGKAEEYSRGMVTGGTLFEELGFYYVGPIDGHNLDHLIPVLENVRDTSE-GPVLIHVVTEKGKGYKPAE-ESADKYHGV----PKFNVVTGEKQKGSAGAPAYQNVFGDTLADLADTDKRICAITAAMPSGTGVDRFAQRHPDRSFDVGIAEQHGVTFAAGLAAQGMRPFAAIYSTFLQRAYDQVVHDVAIQNLPVRFAIDRAGLVGADGCTHAGSFDITYLATLPNMVVMAAADEAELVHMTYTAVEYDEGPIAFRYPRGSGVGVPLPETPQKLEIGKG--RLVREGSKVAILSLGARLEEAKKAADQLEAKGLSTTVADMRFAKPLDEDLIARLMRTHEVVVTIEEGAIGG-LGAHVLTYATDEGLTDNGLKVRTMRLPDTFQDQDSPDKQ 609
>gi|152968945|ref|YP_001334054.1| 1-deoxy-D-xylulose-5-phosphate synthase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] >gi|166198622|sp|A6T5F3|DXS_KLEP7 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|150953794|gb|ABR75824.1| 1-deoxy-D-xylulose-5-phosphate synthase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] (620 aa)
Score = 798, Expect = 8.8e-83, Identities = 191/580 (32%), Positives = 319/580 (55%)
  Q:    32 LRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEK--NNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWS---IYKSFSKLSKFFKGK----NFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSD------PNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEK--VFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIK 611
           LR+ ++D     S H +S LG VEL++AL YV+++P D + +D GHQ Y HK++T R DKI TIR+  GL  F    ES +D +S GHS   +S   G         K +  + VIGD AI+ G+AFEA+N+    K  +L+++NDN MSIS+NVGAL+  +++        L+ K+   +   +E  KK++     I +   +  +  KG       FE LGF+Y G +DG+++   ++ LK ++++   GP  LH+ T KG GY+ AE  D   +H++   D      P  +    +Y  +  ++L +    DN +  I PAM   S  +  SKKFP+ Y DV IAE+HAVT AAG+AI + K  V+IYSTFLQR+YD ++HDVA  +LP+ F +DR  +  +DG TH G +D+ FL+ IP+ ++   S++ E  +++   Y     P  +RY +       ++   S       ++ +  K  I+++G ++ +        +  L++  F+       +L++   +  +  +E+  +      G + +++A+   +   +  I + +  I  G +E+I   L +D   I A+I+
  S:    35 LRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDRLIWDVGHQAYPHKILTGRRDKIGTIRQKGGLHPFPWRGESEYDVLSVGHSSTSISAGIGVAIAAAKEDKQRRAVCVIGDGAITAGMAFEAMNHAGDIKPDLLVVLNDNEMSISENVGALNNHLAQL-------LSGKLYSTL---REGGKKVFSGVPPIKELLKRTEEHIKGMVVPGTLFEELGFNYIGPVDGHDVLGLVSTLKNMRDLK--GPQFLHIMTKKGRGYEPAE-KDPITFHAVPKFDHTSGVLPKSSGGLPSYSKIFGDWLCETAAKDNKLMAITPAMREGSGMVEFSKKFPDRYFDVAIAEQHAVTFAAGLAIGDYKPVVAIYSTFLQRAYDQVIHDVAIQKLPVLFTIDRAGIVGADGQTHQGAFDLSFLRCIPDMVVMTPSDENECRQMLYTGYHYSDGPCAVRYPRGSGTGATLEPLASLPIGKGVVKRQGEKIAILNFGTLLPEAAAVADKLNATLVDMRFVKPLDTALILQLAGEHDALVTLEENAIMGGAGSGVNEVLMAHRRAVP--VLNIGLPDYFIPQGTQEEIRADLGLDAAGIEAKIR 616
>gi|90579834|ref|ZP_01235642.1| 1-deoxy-D-xylulose-5-phosphate synthase [Vibrio angustum S14] >gi|90438719|gb|EAS63902.1| 1-deoxy-D-xylulose-5-phosphate synthase [Vibrio angustum S14] (621 aa)
Score = 797, Expect = 9.8e-83, Identities = 193/581 (33%), Positives = 317/581 (54%)
  Q:    32 LRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWS---IYKSFSKLSKFFKG----KNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSD------PNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVK---KEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           LR  ++      S H +S LG VEL++AL YV+++P D + +D GHQ Y HK++T R D ++TIR+  GL  F    ES +D +S GHS   +S   G     +    ++ V+ +IGD AI+ G+AFEA+N+     + ML+I+NDN MSIS+NVGAL+  ++   +S + + +          +E  KK+  +   I +   +  +  KG       FE LGF+Y G +DG+++ + +  LK ++N+   GP  LH+ T KG GY  AE D    YH++   D      P     + T+  +  ++L  +   D+ +  I PAM   S  +  SK+FP+ Y DV IAE+HAVT A GMAI      V+IYSTFLQR YD L+HDVA ++LP+ F +DR  L  +DG TH G +DI F++ IPN +I   S++ E  +++   +Q +  P  +RY +    +++V     E   G  +  ++    K  I+++G ++    +  +  +  + +  F+    +  VL +  T+  +  VE+   +   G  +I    + K    +  I + +  I  G + ++ + L ID   I  +I++
  S:    35 LRTYLLKSVSQTSGHFASGLGTVELTVALHYVYNTPFDKVIWDVGHQAYPHKILTGRRDDMATIRQKGGLHPFPWRGESEYDTLSVGHSSTSISAGLGLAIAAEKEGLNRKVVSIIGDGAITAGMAFEAMNHAGDVHSDMLVILNDNEMSISENVGALNNHLAHL-LSGNFYTS---------IREGGKKVLSNAPPIKEMVKRAEEHIKGMVVPSTMFEELGFNYIGPVDGHDVHELVKTLKNMRNLK--GPQFLHIMTKKGKGYAPAEADPIN-YHAVPKFDLSQKPLPKAKDASPTFSKIFGDWLCDMAAVDDKLMAITPAMREGSGMVRFSKEFPDQYFDVAIAEQHAVTLATGMAIGGYHPIVAIYSTFLQRGYDQLIHDVAIMDLPVMFAIDRAGLVGADGQTHQGAFDISFMRCIPNMVIMAPSDENECRQMLYTGHQYQG-PSAVRYPRGCGMEVDVDPKMTELEIGKGI--IRRHGEKIAILNFGSMLGYALEAAENLNATVADMRFVKPLDETLVLELAKTHDVLVTVEENAIAGGAGSGVIEFLMKEKTLKPVLNIGLPDRFIEQGTQAELHEMLEIDGAGIEKQIRT 617
>gi|120599628|ref|YP_964202.1| 1-deoxy-D-xylulose-5-phosphate synthase [Shewanella sp. W3-18-1] >gi|146292378|ref|YP_001182802.1| 1-deoxy-D-xylulose-5-phosphate synthase [Shewanella putrefaciens CN-32] >gi|166201538|sp|A4Y4X0|DXS_SHEPC 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|166201540|sp|A1RLV3|DXS_SHESW 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|120559721|gb|ABM25648.1| deoxyxylulose-5-phosphate synthase [Shewanella sp. W3-18-1] >gi|145564068|gb|ABP75003.1| deoxyxylulose-5-phosphate synthase [Shewanella putrefaciens CN-32] (622 aa)
Score = 797, Expect = 1.0e-82, Identities = 196/601 (32%), Positives = 318/601 (52%)
  Q:    12 PNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI---EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLT-----EKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSL------KLSDPNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEK---CEDIEVKKEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           PN  + +++    L  +A  LR+ ++      S H +S LG VEL++AL YV+++P D + +D GHQ Y HK++T R DK+ TIR+ NGL  F    ES +D  S GHSG  +S         EK  +  K V+ VIGD A++ G+ FEA+N+       ML+++NDN MSIS+NVGAL+  +++  MS   + T     +K+L+ +   KE +K+       +   L         FE LGF+Y G IDG+++   +  ++ ++N+   GP +LH+ T KG GY+ AE D  G +H++      +   P+      T+  V   +L  + E D+ +  I PAM   S  +  S++FP  Y D  IAE+HAVT  AG A    K  V+IYSTFLQR YD L+HDVA   LP+ F +DR  +  +DG TH G +D+ F++ IPN +I   S++ E  +++   Y   + P  +RY +        +E       G  V  ++    +  ++++G  +             +++  F+     E V  +  T+  +  VE+       G  ++ L  + K+   + +I + +  I  G+ E++   L +D   I A+I +
  S:    17 PN--ELRQLPQALLPQVADELREFLLKSVGMSSGHFASGLGTVELTVALHYVYNTPFDRLIWDVGHQAYPHKILTGRRDKMHTIRQKNGLHPFPWREESEYDTFSVGHSGTSISAALAMAVAAEKEQAGRK-VVAVIGDGAMTGGMVFEAMNHAGDLHNDMLVVLNDNEMSISENVGALNNHLAQL-MSGRFYTTLREGGKKVLKGMPVIKEMAKR-------TEEHLKGMVVPGTLFEELGFNYIGPIDGHDVDALVETMRNMRNLK--GPQVLHIMTKKGRGYEPAEKDPIG-WHAVPKFDPTQFKKPSTTPGLPTFSQVFGKWLCDIAEQDDKVLGITPAMREGSGMVEFSQRFPKQYFDAAIAEQHAVTLGAGFACEGYKPVVAIYSTFLQRGYDQLIHDVALQRLPVLFAIDRGGIVGADGPTHQGAFDLSFMRCIPNMVIMAPSDENECRQMLYTGYCYNAGPSAVRYPRGSATGATQVEAMTALPIGKGV--IKRVGKRIALLNFGTTLASALTAADNLDATVVDMRFVKPLDAELVTEMAQTHDILVTVEENAIMGGAGSGVLELLQKLKMPKPVLQIGLPDEFIKHGSPEEVTHDLQLDAEGILAQINA 618
>gi|113868690|ref|YP_727179.1| 1-deoxy-D-xylulose-5-phosphate synthase [Ralstonia eutropha H16] >gi|123032800|sp|Q0K860|DXS_RALEH 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|113527466|emb|CAJ93811.1| Deoxyxylulose-5-phosphate synthase [Ralstonia eutropha H16] (638 aa)
Score = 797, Expect = 1.1e-82, Identities = 178/466 (38%), Positives = 268/466 (57%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIA-YNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKG----KNFFESLGFHYFGVIDGNNLKKTINVLKRIKN--IVPFGPTILHVKTIKGLGYKEAELD-----DKGLYHSLKLSDPNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTK 473
           ++KI    D +K+   EL  LA  LR  +++       HLSSNLG VEL++AL YVF++P D + +D GHQ Y HK++T R +++ T+R+  G+SGF   +ES +D   T HS   +S   G     +   + +  + VIGD A++ G+AFEALNN   Y   P+++++NDN MSIS  VGAL++ +++    +    T+K + K+L        +   + +   +  +  KG       FE  GF+Y G IDG++L   +  L+ I+   +   GP  LHV T KG GYK AE D       G ++  +   P      +TY  V  ++L  +   D  +  I PAM   S  +   ++FP+ Y DVGIAE+HAVT A G+A    K  V+IYSTFLQR YD L+HDVA   LP+ F +DR  L  +DG TH G YDI +L+ IPN ++   S++ E  +L+  A+ +++ P  +RY +
  S:     6 LNKIDAPADLRKLDRRELRTLADELRAYVLESVSQTGGHLSSNLGTVELTIALHYVFNTPDDRLVWDVGHQSYPHKILTGRRERMGTLRQWGGISGFPRRSESEYDTFGTAHSSTSISAALGMALGARTLGEKRVSVAVIGDGAMTAGMAFEALNNAGVYKDLPLVVVLNDNDMSISPPVGALNRHLARLLSGQFYAATKKGIEKVL-------SVAPPVLEFAKRFEEHAKGMMVPATLFEEFGFNYIGPIDGHDLNSLVPTLQNIRERALEGAGPQFLHVVTKKGQGYKLAEADPILYHGPGKFNPAEGIRPAAKPARKTYTQVFGDWLCDMAAADKRLVGITPAMREGSGMVEFERRFPDRYYDVGIAEQHAVTFAGGLACEGLKPVVAIYSTFLQRGYDQLIHDVALQNLPVVFALDRAGLVGADGATHAGAYDIAYLRCIPNMMVMTPSDENECRQLLTTAF-HQACPSAVRYPR 477
>gi|169343692|ref|ZP_02864691.1| 1-deoxy-D-xylulose-5-phosphate synthase [Clostridium perfringens C str. JGS1495] >gi|169298252|gb|EDS80342.1| 1-deoxy-D-xylulose-5-phosphate synthase [Clostridium perfringens C str. JGS1495] (619 aa)
Score = 797, Expect = 1.1e-82, Identities = 217/593 (36%), Positives = 316/593 (53%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNN--SKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSD------PNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSN-PFFIRYTKEKCEDIEVK--KEFSFGSWVYALQTKE-SKTCIISYGDIINDLK------KEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLN 600
           + +I + ++ K +   EL  LA  LR+ +I+   N   H +SNLG+++L++AL   FD  +D I +D GHQ Y +K++T R DK +T+R+  GL GF +  ES +DF +TGHS   LS   G         K   VI VIGD A++ G+A EALN+I Y K  ++II+NDN MSI KNVG L   ++K +M       +  +   L      K++  S+ K    + K      +FE +G  YFG++DG+N+++   VL   KNI   GP I+H  T KG GY+ AE  +   YH +   D          S N  Y S     + KL + D+ +  I  AM   +   +  ++FP+ + DVGIAE+HAVT AAGMA    K F ++YSTFLQR+YD +LHDV   +LP+T  +DR  L   DG+TH GI+DI FL  +PN  I       E+E  +IL + +  N P  IRY +    D+ +K   +  +G W    + KE  K  I++ G ++          KE K   I +INA FI    KE +  +      I  +E        G+ ++   NE      I  +   +  I  G K DI  K+N
  S:     5 LQRITDPKEIKDLDEKELEILAEDLREFLIESVSNTGGHFASNLGVIDLTVALFKNFDFSEDRIIWDVGHQSYAYKILTGRKDKFNTLRQYGGLCGFPKRTESEYDFFATGHSSTSLSSAAGMARAQRLLGKDNKVIAVIGDGALTGGMALEALNDIGYRKDNLIIILNDNQMSICKNVGGLATYLNKLRMGVGYNKLKSDIGSTLDTTSLGKRVKNSLSKLKDGIKKIVVPSMYFEDIGLKYFGIVDGHNIRELNEVLSIAKNIK--GPVIIHTVTKKGKGYELAE-KNPNKYHGVSPFDLGEGVISKFASRN--YSSTFGEEMIKLAKNDDKVVAITAAMPDGTGLKDFREEFPDRFFDVGIAEQHAVTLAAGMAAEGLKPFFAVYSTFLQRAYDQVLHDVCIQKLPVTLCLDRAGLVGEDGETHQGIFDISFLSPMPNMTIVAPKCIDEME--VILKWASNFNAPLAIRYPRGGDIDVNLKPLSKIEYGKWE---KVKEGEKIAIVATGKMVQHAMIAAQKIKEEKNIDILIINATFIKPIDKELLNSLSKDGFKIVTIEDNIKKGGFGEGVLEYLNEIGHKEKIVTLAFNDKFIEHG-KPDILYKIN 604
>gi|147677531|ref|YP_001211746.1| deoxyxylulose-5-phosphate synthase [Pelotomaculum thermopropionicum SI] >gi|189027780|sp|A5D2Z6|DXS_PELTS 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|146273628|dbj|BAF59377.1| deoxyxylulose-5-phosphate synthase [Pelotomaculum thermopropionicum SI] (637 aa)
Score = 796, Expect = 1.2e-82, Identities = 191/546 (34%), Positives = 302/546 (55%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKSK--SVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQM----SKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGK--------NFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNL-----NSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYALQTKE-SKTCIISYGDIINDLKKE---IKTKSID--LINAVFITNYQKENVLRILSTYKNIYVVEK 553
           +++I +  D + +   +L +LA  +R+ +I+       HL+ NLG+VEL++ L  VF SP D I +D GHQ YVHK+IT R  +  T+R+  G+SGF  P+ES+HD   TGHS   +S   G     + K +  SV+ VIGD A++ G+AFEALN+  + K  +++++NDN MSI++NVGA+   +++ +     S+     E++LR+I             I  +  +L +  K            FE LGF Y G +DG++L+    VL+  +     GP ++HV T KG GY  AE  +   +H +   D         SN  TY  V    + KL    +N+  I  AMT  +     ++ +P  + DVGIAE+HAVT AAGMA    +  V+IYSTFLQR+YD +LHDV    LP+TF +DR  +   DG THHG++D  +L+ IPN +I    ++ EL+ ++  A  +   P  +RY +       +   F       A   ++ ++  +++ G ++    K    +    ID  +INA F+    KE +LR     + ++ +E+
  S:     5 LEQISSSRDIRSLTFKQLNELAGEIRQVLINTVSKTGGHLAPNLGVVELTLGLHRVFHSPVDKIIWDVGHQSYVHKLITGRYKEFYTLRQFGGISGFPRPSESVHDAFGTGHSSTSISAALGMAIARDLKGEKYSVVAVIGDGAMTGGIAFEALNHAGHLKCNLIVVLNDNEMSIAQNVGAMSGYLTRLRTDPMYSRGKEEIEQLLRRI------------PIGSALLRLGERVKDSLKYLVVPGMIFEELGFTYLGPVDGHDLRAITTVLQHAR--ARKGPVLVHVLTKKGKGYSPAE-SNPDRFHGIGAFDVATGEAVKKSNIPTYTEVFGRTMVKLAREFDNMLAITAAMTGGTGLTEFARLYPKRFFDVGIAEQHAVTLAAGMATGGFRPVVAIYSTFLQRAYDQILHDVCLQNLPVTFAIDRAGIVGEDGATHHGLFDFSYLRPIPNMVIMAPKDENELQHMLYTALSH-PGPAAVRYPRSAGTGCRMDDSFKIIPLGRAEVLRDGTEVTLLAVGSMVCLAVKAAEILAGHGIDAAVINARFVKPLDKECILRYARRTREVFTLEE 559
>gi|192359149|ref|YP_001983790.1| 1-deoxy-D-xylulose-5-phosphate synthase [Cellvibrio japonicus Ueda107] >gi|190685314|gb|ACE82992.1| 1-deoxy-D-xylulose-5-phosphate synthase [Cellvibrio japonicus Ueda107] (636 aa)
Score = 796, Expect = 1.3e-82, Identities = 180/466 (38%), Positives = 269/466 (57%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFS---KLSKFFKG----KNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNS-------NNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTK 473
           +D I +  + + +   +L  LA  LR  ++        H  + LG+VEL++AL YV+D+P+D + +D GHQ Y HK++T R +++ +IR+  GLSGF +  ES +D    GHS   +S  QG     K     + V  +IGD A++ G+AFEALN+ A+ +T ML+++NDN MSIS NVG L   +SK   SK  F            +E SK++   I  ++    +  + FKG       FE +GF+Y G I+G++L   +  L+ ++ I   GP +LHV T KG G++ AELD  G YH+L   +P   +           +  V   +L  +   D+ +  I PAM   S  +  +++FP  + DV IAE+HAVT AAGMA   +K  V+IYSTFLQR+YD L+HDVA   L +TF +DR  L   DG TH G +DI +L+ IP  ++   S++ E  +L+  AYQ    P  +RY +
  S:    15 LDSIDSPAELRALSEKQLPQLADELRAFLLYTVGQTGGHFGAGLGVVELTIALHYVYDTPEDRLVWDVGHQTYPHKILTSRRERMHSIRQGGGLSGFPKREESPYDTFGVGHSSTSISAAQGMAIGAKMAGTERKVAAIIGDGAMTAGMAFEALNHAAHTETDMLVVLNDNNMSISPNVGGLSTYLSKIWASK--FYNSL--------REGSKQVLGKIPPAWEFARRTEEHFKGFMSPGTLFEEMGFNYVGPINGHDLGDLVRCLRNLREIK--GPKLLHVITQKGKGFEPAELDPVG-YHALNKIEPKKAAIGAVDAPKKVKFQDVFGQWLCDMAARDDKLIGITPAMCEGSGMVGFAQQFPERFYDVAIAEQHAVTLAAGMACEGQKPVVAIYSTFLQRAYDQLIHDVALQNLDVTFAIDRAGLVGEDGPTHSGSFDISYLRCIPQMLLATPSDENECRQLLYTAYQ-YPGPAAVRYPR 482
>gi|196156241|ref|YP_002125730.1| 1-deoxy-D-xylulose-5-phosphate synthase [Alteromonas macleodii 'Deep ecotype'] >gi|88772447|gb|EAR03733.1| 1-deoxy-D-xylulose-5-phosphate synthase [Alteromonas macleodii 'Deep ecotype'] >gi|196112020|gb|ACG65736.1| 1-deoxy-D-xylulose-5-phosphate synthase [Alteromonas macleodii 'Deep ecotype'] (625 aa)
Score = 796, Expect = 1.3e-82, Identities = 197/598 (32%), Positives = 333/598 (55%)
  Q:    15 EDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSI--YKSF-SKLSKFFKGK----NFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNS------NNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYALQTKESKTC------------IISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           +  +++   +L +LA  LR+ +++     S H +S LG VEL++AL YV+++P D + +D GHQ Y HK++T RA+++STIR+ NGL  F  P ES +D  + GHS   +S   G     +   K + V+ VIGD A++ G+AFEALN+    K  M++++NDN MSIS+NVGAL+  +++        LT      I   ++  KK+  ++   K F S+  +  KG       FE LGF+Y G IDG+++   ++ L+ ++N    GP +LHV T KG GY  AE +D   +H++   +P  N+      +  TY ++   +L  +   D  +  + PAM   S  +  S++FP  Y DV IAE+HAVT  AG+A       V+IYS+FLQR+YD L+HDVA  +LP+ F +DR  +  +DG TH G +DI FL+ IPN ++   S++ E  +++   ++ +  P  +RY +     +   +  +      AL+  +S+TC            I+++G ++    +        +I+  FI     + VL+  + +  +  +E        G  ++    +N +   +K + + ++ I  G ++++ K+  +D   I A  KS
  S:    18 DKLRQLPQDKLRELADELREYLLNSVSQTSGHFASGLGTVELTVALHYVYNTPFDRLLWDVGHQAYPHKILTGRAERMSTIRQKNGLHPFPWPPESEYDTFAVGHSSTSISAALGMAVAAEKEGKDRKVVSVIGDGAMTAGMAFEALNHAGDIKKDMVVVLNDNEMSISENVGALNSHLARL-------LTGNFFNSI---RDGGKKLLSNVPPIKEFASRAEEHLKGMVVPGTIFEELGFNYIGPIDGHDVNAVVDTLRNMRNFD--GPQLLHVVTKKGKGYAVAE-EDPIKFHAVPKFNPADNALPKSKPSAPTYSAIFGQWLCDMAAQDPKLMAVTPAMREGSGMVEFSQRFPEQYFDVAIAEQHAVTFGAGLAKDGMNAVVAIYSSFLQRAYDQLIHDVAIQDLPVLFAIDRAGIVGADGPTHQGAFDIAFLRCIPNMVVMAPSDENECRQMLYTGHKLQ-KPAAVRYPRGAGMGVTPDEAMT------ALEIGKSRTCRETAKDKSESVAILNFGCLLPYALEAAVAIDATVIDMRFIKPLDGDAVLKAANEHSALITLEDGCIMGGAGSAVLEHLQQNGVLKAVKMLGLPDSFILQGTQQEMYKEHGLDAEGIIAAAKS 622
>gi|50120070|ref|YP_049237.1| 1-deoxy-D-xylulose-5-phosphate synthase [Pectobacterium atrosepticum SCRI1043] >gi|81645875|sp|Q6D844|DXS_ERWCT 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|49610596|emb|CAG74041.1| 1-deoxy-D-xylulose 5-phosphate synthase [Erwinia carotovora subsp. atroseptica SCRI1043] (621 aa)
Score = 796, Expect = 1.3e-82, Identities = 188/575 (32%), Positives = 310/575 (53%)
  Q:    32 LRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDP-------NLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVK--KEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSI 606
           LR+ ++D     S H +S LG VEL++AL YV+++P D + +D GHQ Y HK++T R D+ISTIR+  GL  F   +ES +D +S GHS   +S   G     +   K +  + VIGD AI+ G+AFEA+N+    K+ +L+++NDN MSIS+NVGAL+  +++    K      +  +K+L      K++   + ++   L         FE LGF+Y G +DG++++   + LK ++++   GP +LH+ T KG GY  AE D    +H++   DP       +      TY  +   +L++    D+ +  I PAM   S  L  S+ +P  Y DV IAE+HAVT AAG+A+      V+IYSTFLQR+YD ++HDVA   LP+ F +DR  +  +DG TH G +D+ FL+ IPN II   S++ E  +++   Y  +  P  +RY +      E+    E   G  V   Q K     I+++G ++ + +   +  +  L++  F+    +  +  +  ++     +E+       G  +       +L+ ++  I + +  I  G++E+I   L +D   I
  S:    35 LRQYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDHLVWDVGHQAYPHKILTGRRDRISTIRQKGGLHPFPWRDESEYDVLSVGHSSTSISAGLGMAVAAEREGKGRRTVCVIGDGAITAGMAFEAMNHAGDIKSDLLVVLNDNEMSISENVGALNNHLAQLLSGKLYASLREGGKKVLSGLPPIKEL---VKRTEEHLKGMVVPGTLFEELGFNYIGPVDGHDVQALSHTLKNMRSLK--GPQLLHIMTKKGKGYAPAEQDPIS-WHAVPKFDPASGTLPKSKEGAQPTYSKIFGQWLQETAAKDSKLMAITPAMREGSGMLQFSRDYPQQYFDVAIAEQHAVTFAAGLAVGGYHPIVAIYSTFLQRAYDQVIHDVAIQSLPVLFAIDRGGIVGADGQTHQGAFDLSFLRCIPNMIIMTPSDENECRQMLHTGYHYQKGPTAVRYPRGNGTGTELTPLSELPIGKGVVRRQGK--TVAILNFGTLLPEAQAVAEKLNATLVDMRFVKPLDEALLEELAQSHSTFVTLEENAVMGGAGSGVNEFLMAKRLAVSVLNIGLPDVFIPQGSQEEIRVDLGLDAAGI 612
>gi|89898506|ref|YP_515616.1| 1-deoxy-D-xylulose-5-phosphate synthase [Chlamydophila felis Fe/C-56] >gi|118595501|sp|Q253R7|DXS_CHLFF 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|89331878|dbj|BAE81471.1| 1-deoxy-D-xylulose 5-phosphate synthase [Chlamydophila felis Fe/C-56] (644 aa)
Score = 796, Expect = 1.3e-82, Identities = 209/603 (34%), Positives = 324/603 (53%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDR-ADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFK-KEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNSNNQ-----------TYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTK-------EKCEDIEVKKEFSFGSWVYALQTKESKTCIISYGDIIN---DLKKEIKTKSID--LINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEI 610
           + +I +  D K + L EL  LA  +R KII +  N   HL+SNLGI+E+++AL YVF S +D   +D GHQ Y HK++T R  ++   IR   GLSGF  P+ES+HD   +GH+GN LS+  G  +        ++P++GDAA S GL  EALNNI+ N +  ++I+NDN MSIS+NVG + K +S++       L  + + K L K   +   I    +K  + L   F     FE     Y G +DG+N+K+ I+V +  +++ PF P ++H+ T KG G + A+ ++   YH +     N NS+ +           TY  V    + KL E   N+ I+ PAM+L S      +KFP  + DVGIAE HAVT +AG+A A   V  SIYSTFL R+ DN+ HDV    LP+   +DR  L+Y DG +HHGIYDI FL+++PN II C      + + ++ +    + P  IRY             D+ + ++   G     + ++     II  G + N    +K ++ T  I   +++ VFI  +       +L  +  + ++E+      L  +            ++    I +     G+KE + K++ +D  S+   I
  S:     9 LSRISSPTDLKNLSLAELSLLAEQMRHKIISVLTNTGGHLASNLGIIEVTIALHYVFSSTEDKFIFDVGHQAYPHKLLTGRNTEEFDRIRHDGGLSGFTSPSESMHDLFFSGHAGNALSLALGMAKATEDSRTHILPILGDAAFSCGLTLEALNNISSNLSKFIVILNDNNMSISQNVGVMSKNLSRWIHHPKFSLFSRKIEKWLTKIPRYGNGISKRSHKLSTCLKSLFCPIPIFEQFNLAYMGPVDGHNIKRLISVFQTARDL-PF-PVLIHICTTKGKGLEIAQ-ENPEKYHGVT---ANFNSSEKNKLLPTIKPQLTYPDVFGQTVCKLGETSPNLHIVTPAMSLGSRLEAFKEKFPKRFIDVGIAEGHAVTFSAGIAKAKSPVICSIYSTFLHRALDNVFHDVCLQGLPVILAIDRAGLAYGDGCSHHGIYDISFLRAMPNMII-CQPRSAIVLQQLLQSSLQWNMPSAIRYPNIAAIQRDPIATDVNMHRDPGLGE----ILSQGEDILIIGLGHMCNTALSIKLQLLTHGISATVVDPVFIKPFDNNLFSILLMHHSKVIIIEEHSIRGGLASEFNDFLATYGFKVDVLHFGIPDAFFSHGDKESLLKRVGLDTESMVKRI 625
>gi|160874500|ref|YP_001553816.1| 1-deoxy-D-xylulose-5-phosphate synthase [Shewanella baltica OS195] >gi|189027786|sp|A9KTL5|DXS_SHEB9 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|160860022|gb|ABX48556.1| deoxyxylulose-5-phosphate synthase [Shewanella baltica OS195] (622 aa)
Score = 796, Expect = 1.3e-82, Identities = 190/569 (33%), Positives = 310/569 (54%)
  Q:    44 SAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI---EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLT-----EKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNL------NSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCE---DIEVKKEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           S H +S LG VEL++AL YV+++P D + +D GHQ Y HK++T R DK+ TIR+ +GL  F    ES +D  S GHSG  +S         EK  +  K V+ VIGD A++ G+ FEA+N+       ML+++NDN MSIS+NVGAL+  +++  MS   + T     +K+L+ +   KE +K+       +   L         FE LGF+Y G IDG+++   +  ++ ++N+   GP +LH+ T KG GY+ AE D  G +H++   DP+L           T+  V   +L  + E D  +  I PAM   S  +  S++FP  Y D  IAE+HAVT AAG A    K  V+IYSTFLQR+YD L+HDVA  +LP+ F +DR  +  +DG TH G +D+ F++ IPN +I   S++ E  +++   Y   + P  +RY +        +E       G  V  ++    +  I+++G ++       ++    +++  F+     + V  +  T++ +  VE+       G  ++    + ++   + +I + +  I  G+ E++   L +D   I A+I +
  S:    47 SGHFASGLGTVELTVALHYVYNTPFDRLIWDVGHQAYPHKILTGRRDKMHTIRQKDGLHPFPWREESEYDTFSVGHSGTSISAALAMAIAAEKEQAGRK-VVAVIGDGAMTGGMVFEAMNHAGDLHNDMLVVLNDNEMSISENVGALNNHLAQL-MSGRFYTTLREGGKKVLKGMPVIKEMAKR-------TEEHLKGMVVPGTLFEELGFNYIGPIDGHDVDALVETMRNMRNLK--GPQVLHIMTKKGRGYEPAEKDPIG-WHAVPKFDPSLFKKPATKPGLPTFSQVFGKWLCDIAEQDEKVLAITPAMREGSGMVEFSQRFPKQYFDAAIAEQHAVTLAAGFACEGFKPVVAIYSTFLQRAYDQLIHDVALQQLPVLFAIDRGGIVGADGPTHQGAFDLSFMRCIPNMVIMAPSDENECRQMLYTGYCYDAGPSAVRYPRGSATGAMQVEAMTALPIGKGV--IKRVGKRIAILNFGTLLASALTAAESLDATVVDMRFVKPLDVDLVKEMAQTHEVLVTVEENAIMGGAGAGVLEQLQKLRMPKAVLQIGLPDEFIKHGSPEEVTHDLQLDAEGILAQINA 618
>gi|16123339|ref|NP_406652.1| 1-deoxy-D-xylulose-5-phosphate synthase [Yersinia pestis CO92] >gi|22124915|ref|NP_668338.1| 1-deoxy-D-xylulose-5-phosphate synthase [Yersinia pestis KIM] >gi|45440603|ref|NP_992142.1| 1-deoxy-D-xylulose-5-phosphate synthase [Yersinia pestis biovar Microtus str. 91001] >gi|108808662|ref|YP_652578.1| 1-deoxy-D-xylulose-5-phosphate synthase [Yersinia pestis Antiqua] >gi|108811076|ref|YP_646843.1| 1-deoxy-D-xylulose-5-phosphate synthase [Yersinia pestis Nepal516] >gi|145600071|ref|YP_001164147.1| 1-deoxy-D-xylulose-5-phosphate synthase [Yersinia pestis Pestoides F] >gi|149364977|ref|ZP_01887012.1| 1-deoxy-D-xylulose 5-phosphate synthase [Yersinia pestis CA88-4125] >gi|162418311|ref|YP_001607440.1| 1-deoxy-D-xylulose-5-phosphate synthase [Yersinia pestis Angola] >gi|165926583|ref|ZP_02222415.1| 1-deoxy-D-xylulose-5-phosphate synthase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165936091|ref|ZP_02224661.1| 1-deoxy-D-xylulose-5-phosphate synthase [Yersinia pestis biovar Orientalis str. IP275] >gi|166010970|ref|ZP_02231868.1| 1-deoxy-D-xylulose-5-phosphate synthase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166212944|ref|ZP_02238979.1| 1-deoxy-D-xylulose-5-phosphate synthase [Yersinia pestis biovar Antiqua str. B42003004] >gi|167399442|ref|ZP_02304966.1| 1-deoxy-D-xylulose-5-phosphate synthase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167421708|ref|ZP_02313461.1| 1-deoxy-D-xylulose-5-phosphate synthase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167423788|ref|ZP_02315541.1| 1-deoxy-D-xylulose-5-phosphate synthase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167470228|ref|ZP_02334932.1| 1-deoxy-D-xylulose-5-phosphate synthase [Yersinia pestis FV-1] >gi|166201548|sp|A4TPG2|DXS_YERPP 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|21263523|sp|Q8ZC45|DXS_YERPE 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|118595635|sp|Q1C4I9|DXS_YERPA 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|118595636|sp|Q1CL87|DXS_YERPN 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|21957752|gb|AAM84589.1|AE013704_6 1-deoxyxylulose-5-phosphate synthase [Yersinia pestis KIM] >gi|45435460|gb|AAS61019.1| 1-deoxy-D-xylulose 5-phosphate synthase [Yersinia pestis biovar Microtus str. 91001] >gi|108774724|gb|ABG17243.1| 1-Deoxy-D-xylulose-5-phosphate synthase [Yersinia pestis Nepal516] >gi|108780575|gb|ABG14633.1| 1-Deoxy-D-xylulose-5-phosphate synthase [Yersinia pestis Antiqua] >gi|115348818|emb|CAL21772.1| 1-deoxy-D-xylulose 5-phosphate synthase [Yersinia pestis CO92] >gi|145211767|gb|ABP41174.1| 1-Deoxy-D-xylulose-5-phosphate synthase [Yersinia pestis Pestoides F] >gi|149291390|gb|EDM41464.1| 1-deoxy-D-xylulose 5-phosphate synthase [Yersinia pestis CA88-4125] >gi|162351126|gb|ABX85074.1| 1-deoxy-D-xylulose-5-phosphate synthase [Yersinia pestis Angola] >gi|165916236|gb|EDR34843.1| 1-deoxy-D-xylulose-5-phosphate synthase [Yersinia pestis biovar Orientalis str. IP275] >gi|165921511|gb|EDR38708.1| 1-deoxy-D-xylulose-5-phosphate synthase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165989970|gb|EDR42271.1| 1-deoxy-D-xylulose-5-phosphate synthase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166205731|gb|EDR50211.1| 1-deoxy-D-xylulose-5-phosphate synthase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166960627|gb|EDR56648.1| 1-deoxy-D-xylulose-5-phosphate synthase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167051946|gb|EDR63354.1| 1-deoxy-D-xylulose-5-phosphate synthase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167057958|gb|EDR67704.1| 1-deoxy-D-xylulose-5-phosphate synthase [Yersinia pestis biovar Mediaevalis str. K1973002] (619 aa)
Score = 796, Expect = 1.3e-82, Identities = 188/541 (34%), Positives = 303/541 (56%)
  Q:    13 NYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWS---IYKSFSKLSKFFKG----KNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDP------NLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCED--IEVKKEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEK 553
           N E+ + +    L  L   LR+ ++      S H +S LG+VEL++AL YV+++P D + +D GHQ Y HK++T R D+ISTIR+ +GL  F    ES +D +S GHS   +S   G     +   K +  + VIGD AI+ G+AFEA+++     + ML+I+NDNGMSIS+NVG L+  +++        L+ K+   +   +E  KK + +   I     +  +  KG       FE LGF+Y G +DG+++      LK ++++    P +LH+ T KG GY  AE D  G +H++   DP         S+  TY  +   +L +    D+ +  + PAM   S  +  S+++P  Y DV IAE+HAVT AAG+AI   K  V+IYSTFLQR+YD L+HDVA   LP+ F +DR  L  +DG TH G +D+ F++ IPN +I   S++ E  +++   Y + + P  +RY +       +E  +    G  V  L+ +  K  I+ +G ++   +   +  +  L++  F+    +E VL + + ++ +  VE+
  S:    16 NPEELRMLPKESLPKLCDELRQYLLTCVSRSSGHFASGLGVVELTVALHYVYNTPFDHLIWDVGHQAYPHKILTGRRDRISTIRQKDGLHPFPWRGESEYDVLSVGHSSTSISAGLGMAVAAEREGKGRRTVCVIGDGAITAGMAFEAMSHAGDIHSDMLVILNDNGMSISENVGGLNNHLAQL-------LSGKLYASL---REGGKKAFSALPPIKDLLKRTEEHLKGMVVPSTLFEELGFNYIGPVDGHDVHTLTQTLKNMRDLK--SPQLLHIMTKKGKGYAPAEKDPIG-WHAVPKFDPASGTLPKSQSSLPTYSKIFGEWLCETAAKDSKLMAVTPAMREGSGMVRFSREYPQQYFDVAIAEQHAVTFAAGLAIGGYKPVVAIYSTFLQRAYDQLIHDVAIQNLPVLFAIDRGGLVGADGQTHQGAFDLSFMRCIPNMVIMAPSDENECRQMLYTGYHH-NGPAAVRYPRGNGTSAVLEPLEMLPIGKGV--LRREGEKIAILCFGTLLAQAQLAAENLNATLVDMRFVKPLDEELVLEMAAKHQVLVTVEE 557
>gi|110799458|ref|YP_696502.1| 1-deoxy-D-xylulose-5-phosphate synthase [Clostridium perfringens ATCC 13124] >gi|168210818|ref|ZP_02636443.1| 1-deoxy-D-xylulose-5-phosphate synthase [Clostridium perfringens B str. ATCC 3626] >gi|118595504|sp|Q0TPD8|DXS_CLOP1 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|110674105|gb|ABG83092.1| 1-deoxy-D-xylulose-5-phosphate synthase [Clostridium perfringens ATCC 13124] >gi|170711161|gb|EDT23343.1| 1-deoxy-D-xylulose-5-phosphate synthase [Clostridium perfringens B str. ATCC 3626] (619 aa)
Score = 796, Expect = 1.4e-82, Identities = 215/593 (36%), Positives = 314/593 (52%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNN--SKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSD------PNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSN-PFFIRYTKEKCEDIEVK--KEFSFGSWVYALQTKESKTCIISYGDIINDLK------KEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLN 600
           + +I + ++ K +   EL  LA  LR+ +I+   N   H +SNLG+++L++AL   FD  +D I +D GHQ Y +K++T R DK +T+R+  GL GF +  ES +DF +TGHS   LS   G         K   VI VIGD A++ G+A EALN+I Y K  ++II+NDN MSI KNVG L   ++K +M       +  +   L    + K++  S+ K    + K      +FE +G  YFG++DG+N+++   VL   KNI   GP I+H  T KG GY+ AE  +   YH +   D          S N  Y S     + KL + D+ +  I  AM   +      ++FP+ + DVGIAE+HAVT AAGMA    K F ++YSTFLQR+YD +LHDV   +LP+T  +DR  L   DG+TH GI+DI FL  +PN  I       E+E  +IL + +  N P  IRY +    D+ +K   +  +G W    +    K  I++ G ++          KE K   I +INA FI    KE +  +      I  +E        G+ ++   NE      I  +   +  I  G K DI  K+N
  S:     5 LQRITDPKEIKDLDEKELEILAEDLREFLIESVSNTGGHFASNLGVIDLTVALFKNFDFSEDRIIWDVGHQSYAYKILTGRKDKFNTLRQYGGLCGFPKRTESEYDFFATGHSSTSLSSAAGMARAQRLLGKDNKVIAVIGDGALTGGMALEALNDIGYRKDNLIIILNDNQMSICKNVGGLATYLNKLRMGVGYNKLKSDIGSTLDTTSFGKRVKNSLSKLKDGIKKIVVPSMYFEDIGLKYFGIVDGHNIRELNEVLSIAKNIK--GPVIIHTVTKKGKGYELAE-KNPNKYHGVSPFDLGEGVISKFASRN--YSSTFGEEMIKLAKNDDKVVAITAAMPDGTGLKEFREEFPDRFFDVGIAEQHAVTLAAGMAAEGLKPFFAVYSTFLQRAYDQVLHDVCIQKLPVTLCLDRAGLVGEDGETHQGIFDISFLSPMPNMTIVAPKCIDEME--VILKWASNFNAPLAIRYPRGGDIDVNLKPLSKIEYGKWEKVQEG--DKIAIVATGKMVQHAMIAAQKIKEEKNIDILIINATFIKPIDKELLNSLSKDGFKIVTIEDNIKKGGFGEGVLEYLNEIGHKEKIVTLAFNDKFIEHG-KPDILYKIN 604
>gi|170789971|gb|EDT31015.1| 1-deoxy-D-xylulose-5-phosphate synthase [Oligotropha carboxidovorans OM5] (638 aa)
Score = 796, Expect = 1.4e-82, Identities = 183/477 (38%), Positives = 277/477 (58%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNN--SKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGK----NFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNSNNQ------TYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKE 484
           +D+I    D +K+K  EL  LA  LR + I+       HL S LG+VEL++AL +VF++P D I +D GHQ Y HK++T R D+I T+R+  GLSGF +  ES +D   T HS   +S   G     +   +++SV+ VIGD A+S G+A+EA+NN     + +++I+NDN MSI+  VGA+   +++   S +     + LR+I   K+ ++++   + K   +  ++ +G       FE LGF+Y G IDG+NL + + VLK +++    GPT++HV T KG GY  AE   K  YH +   D      N+      +Y SV  + L +L E D+ I  I  AM   +      K  P    DVGIAE+HAVT AAG+A    K FV++YSTFLQR+YD ++HDVA   LP+ F++DR  L  +DG TH G +DI +L  +P+ +I  A+++ EL  ++  A      P   R+ +     I++  E
  S:     8 LDQINCPSDLRKLKESELTQLAQELRAETINTVAVTGGHLGSGLGVVELTVALHHVFNTPDDRIIWDVGHQAYPHKILTSRRDRIRTLRQGGGLSGFTKRAESEYDCFGTAHSSTSISAGLGMAVARDLAGENRSVVAVIGDGAMSAGMAYEAMNNAGAMDSRLIVILNDNEMSIAPPVGAMSSYLTRLTSSNAY----RSLREI--GKQVARRLPKFMEKGAQRAEEYARGMISGGTLFEELGFYYVGPIDGHNLDQLLPVLKNVRD-SKVGPTLVHVVTQKGKGYSHAE-TAKDKYHGVVKFDVATGKQNKAKANAPSYTSVFGSTLARLAETDDKIVGITAAMPSGTGIDLFQKVHPERTFDVGIAEQHAVTFAAGLATEGMKPFVALYSTFLQRAYDQVVHDVAIQRLPVRFVIDRAGLVGADGPTHAGSFDIAYLGCLPDMVIMAAADEAELVHMVATAAAINDRPSAFRFPRGDGVGIDLPTE 488
>gi|153827056|ref|ZP_01979723.1| 1-deoxyxylulose-5-phosphate synthase [Vibrio cholerae MZO-2] >gi|149739097|gb|EDM53393.1| 1-deoxyxylulose-5-phosphate synthase [Vibrio cholerae MZO-2] (626 aa)
Score = 796, Expect = 1.4e-82, Identities = 183/479 (38%), Positives = 280/479 (58%)
  Q:    32 LRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILS------ICQGFIEKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLT-----EKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNS------NNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYALQTKES------KTCIISYGDII 510
           LR  +++     S HL+S LG VEL++AL YV+ +P D + +D GHQ Y HK++T R D++ TIR+ +GL  F    ES +D +S GHS   +S      IC G       K + V+ VIGD AI+ G+AFEA+N+       ML+++NDN MSIS+NVGAL+  +++  +S S++ +     +K+L  I   KE        + ++   L         FE LGF+Y G +DG+++ + I  LK ++ +   GP  LHV T KG GY  AE D  G YH +   DP+ +S         T+  +  +FL  +   D  +  I PAM   S  +  SK++P+ Y DV IAE+HAVT A GMAIA     V+IYSTFLQR YD L+HDVA + LP+ F +DR  +  +DG TH G +D+ +++ IPN +I   +++ E  +++   +Q++  P  +RY +     +E++  F+          +ES      K  I+S+G ++
  S:    35 LRTYLLNSVSQSSGHLASGLGTVELTVALHYVYHTPFDHLIWDVGHQAYPHKILTGRRDQMPTIRQKDGLHPFPWREESEYDTLSVGHSSTSISAALGMAICAG----KEGKDRKVVSVIGDGAITAGMAFEAMNHAGDVHPDMLVVLNDNEMSISENVGALNNHLAQV-LSGSLYTSIREGGKKVLSGIPPIKEL-------VRRTEEHLKGMVVPGTLFEELGFNYIGPVDGHDVLELIKTLKNMRELK--GPQFLHVMTKKGKGYAPAEKDPIG-YHGVPKFDPSHHSLPKSSNTKPTFSKIFGDFLCDMAAQDPKLMAITPAMREGSGMVRFSKEYPSQYFDVAIAEQHAVTLATGMAIAGYHPIVAIYSTFLQRGYDQLIHDVAIMNLPVMFAIDRAGIVGADGQTHQGAFDLSYMRCIPNMLIMAPADENECRQMLYTGHQHQG-PSAVRYPRGNGMGVELESSFTALEIGKGRLMRESTASEGEKVAILSFGTLL 520
>gi|153830552|ref|ZP_01983219.1| 1-deoxyxylulose-5-phosphate synthase [Vibrio cholerae 623-39] >gi|148873950|gb|EDL72085.1| 1-deoxyxylulose-5-phosphate synthase [Vibrio cholerae 623-39] (626 aa)
Score = 796, Expect = 1.4e-82, Identities = 183/479 (38%), Positives = 280/479 (58%)
  Q:    32 LRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILS------ICQGFIEKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLT-----EKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNS------NNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYALQTKES------KTCIISYGDII 510
           LR  +++     S HL+S LG VEL++AL YV+ +P D + +D GHQ Y HK++T R D++ TIR+ +GL  F    ES +D +S GHS   +S      IC G       K + V+ VIGD AI+ G+AFEA+N+       ML+++NDN MSIS+NVGAL+  +++  +S S++ +     +K+L  I   KE        + ++   L         FE LGF+Y G +DG+++ + I  LK ++ +   GP  LHV T KG GY  AE D  G YH +   DP+ +S         T+  +  +FL  +   D  +  I PAM   S  +  SK++P+ Y DV IAE+HAVT A GMAIA     V+IYSTFLQR YD L+HDVA + LP+ F +DR  +  +DG TH G +D+ +++ IPN +I   +++ E  +++   +Q++  P  +RY +     +E++  F+          +ES      K  I+S+G ++
  S:    35 LRTYLLNSVSQSSGHLASGLGTVELTVALHYVYHTPFDHLIWDVGHQAYPHKILTGRRDQMPTIRQKDGLHPFPWREESEYDTLSVGHSSTSISAALGMAICAG----KEGKDRKVVSVIGDGAITAGMAFEAMNHAGDVHPDMLVVLNDNEMSISENVGALNNHLAQV-LSGSLYTSIREGGKKVLSGIPPIKEL-------VRRTEEHLKGMVVPGTLFEELGFNYIGPVDGHDVLELIKTLKNMRELK--GPQFLHVMTKKGKGYAPAEKDPIG-YHGVPKFDPSHHSLPKSSNTKPTFSKIFGDFLCDMAAQDPKLMAITPAMREGSGMVRFSKEYPSQYFDVAIAEQHAVTLATGMAIAGYHPIVAIYSTFLQRGYDQLIHDVAIMNLPVMFAIDRAGIVGADGQTHQGAFDLSYMRCIPNMLIMAPADENECRQMLYTGHQHQG-PSAVRYPRGNGMGVELESSFTALEIGKGRLMRESTASEGEKVAILSFGTLL 520
>gi|194537888|ref|YP_002073027.1| 1-deoxyxylulose-5-phosphate synthase [Vibrio cholerae V51] >gi|125622501|gb|EAZ50821.1| 1-deoxyxylulose-5-phosphate synthase [Vibrio cholerae V51] (626 aa)
Score = 796, Expect = 1.5e-82, Identities = 196/580 (33%), Positives = 321/580 (55%)
  Q:    32 LRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILS------ICQGFIEKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLT-----EKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNS------NNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYALQTKES------KTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIK 611
           LR  +++     S HL+S LG VEL++AL YV+ +P D + +D GHQ Y HK++T R D++ TIR+ +GL  F    ES +D +S GHS   +S      IC G       K + V+ VIGD AI+ G+AFEA+N+       ML+++NDN MSIS+NVGAL+  +++  +S S++ +     +K+L  I   KE        + ++   L         FE LGF+Y G +DG+++ + I  LK ++ +   GP  LHV T KG GY  AE D  G YH +   DP+ +S         T+  +  +FL  +   D  +  I PAM   S  +  SK++P+ Y DV IAE+HAVT A GMAIA     V+IYSTFLQR YD L+HDVA + LP+ F +DR  +  +DG TH G +D+ +++ IPN +I   +++ E  +++   +Q++  P  +RY +     +E++  F+          +ES      K  I+S+G ++ +  +  +  +  + +  F+    +  + ++  T+  +  +E+   +   G  +I    + K    +  + + +  I  G +E++  +L +D   I   I+
  S:    35 LRTYLLNSVSQSSGHLASGLGTVELTVALHYVYHTPFDHLIWDVGHQAYPHKILTGRRDQMPTIRQKDGLHPFPWREESEYDTLSVGHSSTSVSAALGMAICAG----KEGKDRKVVSVIGDGAITAGMAFEAMNHAGDVHPDMLVVLNDNEMSISENVGALNNHLAQV-LSGSLYTSIREGGKKVLSGIPPIKEL-------VRRTEEHLKGMVVPGTLFEELGFNYIGPVDGHDVLELIKTLKNMRELK--GPQFLHVMTKKGKGYAPAEKDPIG-YHGVPKFDPSHHSLPKSSNTKPTFSKIFGDFLCDMAAQDPKLMAITPAMREGSGMVRFSKEYPSQYFDVAIAEQHAVTLATGMAIAGYHPIVAIYSTFLQRGYDQLIHDVAIMNLPVMFAIDRAGIVGADGQTHQGAFDLSYMRCIPNMLIMAPADENECRQMLYTGHQHQG-PSAVRYPRGNGMGVELESNFTALEIGKGRLMRESTASEGEKVAILSFGTLLPNALEAAEKLNATVADMRFVKPLDEALIKQLAQTHDVLVTLEENAIAGGAGAGVIEFLMKEKQLKPVLNLGLPDQFIVQGTQEEMHAELGLDAAGIERAIR 621
>gi|49475232|ref|YP_033273.1| 1-deoxy-D-xylulose-5-phosphate synthase [Bartonella henselae str. Houston-1] >gi|81648131|sp|Q6G4D1|DXS_BARHE 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|49238037|emb|CAF27244.1| 1-deoxyxylulose-5-phosphate synthase [Bartonella henselae str. Houston-1] (640 aa)
Score = 795, Expect = 1.6e-82, Identities = 177/466 (37%), Positives = 270/466 (57%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNN---SKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSK-FFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELD-DKGLYHSLKLSD------PNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTK 473
           +D++   +D +     +L  LA  LR + ID+      HL + LG++EL++AL YVF++P+D I +D GHQ Y HK++T R +KI T+R+  GLSGF + +ES++D    GHS   +S   G    +     K ++++ VIGD A+S G+A+EA+NN       +++++NDN MSI+   GA+   +++  +S+  + + +   K+L +K    K +    +   + ++ F  G   FE LGF+Y G IDG+NLK  + VLK ++   P GP ++HV T KG GY  AE   DK  YH +   D         +SN   Y  V +  L +   YD+ I  I  AM   +     ++KFP    DVGIAE+HAVT AAGMA    K FV+IYSTFLQR+YD ++HDV+  +LP+ F +DR     +DG TH G +DI FL ++P  ++   S++ EL  ++  A      P   RY +
  S:     9 LDRVCEPQDLRAFPESDLARLADELRAETIDVVSVTGGHLGAGLGVIELTVALHYVFNTPEDRIIWDVGHQAYPHKILTGRREKIRTLRQEGGLSGFTKRSESVYDPFGAGHSSTSISAGLGMAVASALKAEKRRNIVAVIGDGAMSAGMAYEAMNNAGALNARLIVVLNDNDMSIAPPTGAMSAHLARL-VSRPAYRSLRERVKVLGEK--LPKFFLDKARRSEEFARGFLVGGTLFEELGFYYVGPIDGHNLKHLLPVLKNVRE-YPTGPVLIHVVTHKGKGYAPAEASLDK--YHGVNRFDIITGKQVKASSNVLPYTKVFSKALREEASYDDKIVAITAAMPTGTGLDFFAEKFPERMFDVGIAEQHAVTFAAGMACEGYKPFVAIYSTFLQRAYDQIIHDVSIQKLPVRFAIDRAGFVGADGATHAGSFDIVFLTTLPEFVVMAPSDEVELMHMVRTAAAYDQGPISFRYPR 479
>gi|49473998|ref|YP_032040.1| 1-deoxy-D-xylulose-5-phosphate synthase [Bartonella quintana str. Toulouse] >gi|81647185|sp|Q6G0D4|DXS_BARQU 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|49239501|emb|CAF25854.1| 1-deoxyxylulose-5-phosphate synthase [Bartonella quintana str. Toulouse] (640 aa)
Score = 795, Expect = 1.7e-82, Identities = 183/466 (39%), Positives = 268/466 (57%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNN---SKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVF--LTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELD-DKGLYHSLKLSDP------NLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTK 473
           +D+I   +D + +   +L+ LA  LR + ID       HL + LG+VEL++AL YVF++P+D I +D GHQ Y HK++T R D+I T+R+  GLSGF + +ES++D    GHS   +S   G    +     K +++I VIGD A+S G+A+EA+NN       +++I+NDN MSI+   GA+   +++  +S+  +  L E+I    +F K+  K       +S      F  G   F+ LGF+Y G IDG+NLK  + VLK ++   P GP ++HV T KG GY  AE   DK  YH +   D          SN   Y  V +  L +   +DN I  I  AM   +     ++KFP    DVGIAE+HAVT AAGMA    K FV+IYSTFLQR+YD ++HDV+  +LP+ F +DR     +DG TH G +DI FL ++P  ++   S++ EL  ++  A      P   RY +
  S:     9 LDRICLPQDLRALPESDLVRLADELRTETIDAVSVTGGHLGAGLGVVELTVALHYVFNTPEDRIIWDVGHQTYPHKILTGRRDRIRTLRQEGGLSGFTKRSESVYDPFGAGHSSTSISAGLGMTVASALKAEKRRNIIAVIGDGAMSAGMAYEAMNNAGALDARLIVILNDNDMSIAPPTGAMSAHLARL-VSRPAYRSLRERIK---MFSKKMPKFFLDKARRSEEFARGFLVGGTLFDELGFYYVGPIDGHNLKHLLPVLKNVRE-YPNGPVLVHVVTHKGKGYAPAEASSDK--YHGVNSFDVVTGKQIKTQSNALAYTKVFSKALIEEATHDNKIVGITAAMPTGTGLDAFAEKFPERMFDVGIAEQHAVTFAAGMACEGYKPFVAIYSTFLQRAYDQVIHDVSIQKLPVRFAIDRAGFVGADGATHAGSFDIVFLATLPEFVVMAPSDEVELMHMVRTAAAYDQGPISFRYPR 479
>gi|168206127|ref|ZP_02632132.1| 1-deoxy-D-xylulose-5-phosphate synthase [Clostridium perfringens E str. JGS1987] >gi|170662471|gb|EDT15154.1| 1-deoxy-D-xylulose-5-phosphate synthase [Clostridium perfringens E str. JGS1987] (619 aa)
Score = 795, Expect = 1.7e-82, Identities = 217/593 (36%), Positives = 315/593 (53%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNN--SKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSD------PNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSN-PFFIRYTKEKCEDIEVK--KEFSFGSWVYALQTKE-SKTCIISYGDIINDLK------KEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLN 600
           + +I + ++ K +   EL  LA  LR+ +I+   N   H +SNLG+++L++AL   FD  +D I +D GHQ Y +K++T R DK +T+R+  GL GF +  ES +DF +TGHS   LS   G         K   VI VIGD A++ G+A EALN+I Y K  ++II+NDN MSI KNVG L   ++K +M       +  +   L      K++  S+ K    + K      +FE +G  YFG++DG+N+++   VL   KNI   GP I+H  T KG GY+ AE  +   YH +   D          S N  Y S     + KL + D+ +  I  AM   +      ++FP+ + DVGIAE+HAVT AAGMA    K F ++YSTFLQR+YD +LHDV   +LP+T  +DR  L   DG+TH GI+DI FL  +PN  I       E+E  +IL + +  N P  IRY +    D+ +K   +  +G W    + KE  K  I++ G ++          KE K   I +INA FI    KE +  +      I  +E        G+ ++   NE      I  +   +  I  G K DI  K+N
  S:     5 LQRITDPKEIKDLDEKELEILAEDLREFLIESVSNTGGHFASNLGVIDLTVALFKNFDFSEDRIIWDVGHQSYAYKILTGRKDKFNTLRQYGGLCGFPKRTESEYDFFATGHSSTSLSSAAGMARAQRLLGKDNKVIAVIGDGALTGGMALEALNDIGYRKDNLIIILNDNQMSICKNVGGLATYLNKLRMGVGYNKLKSDIGSTLDTTSLGKRVKNSLSKLKDGIKKIVVPSMYFEDIGLKYFGIVDGHNIRELNEVLSIAKNIK--GPVIIHTVTKKGKGYELAE-KNPNKYHGVSPFDLGEGVISKFASRN--YSSTFGEEMIKLAKNDDKVVAITAAMPDGTGLKEFREEFPDRFFDVGIAEQHAVTLAAGMAAEGLKPFFAVYSTFLQRAYDQVLHDVCIQKLPVTLCLDRAGLVGEDGETHQGIFDISFLSPMPNMTIVAPKCIDEME--VILKWASNFNAPLAIRYPRGGDIDVNLKPLSKIEYGKWE---KVKEGEKIAIVATGKMVQHAMIAAQKIKEEKNIDILIINATFIKPIDKELLNSLSKDGFKIVTIEDNIKKGGFGEGVLEYLNEIGHKEKIVTLAFNDKFIEHG-KPDILYKIN 604
>gi|152979790|ref|YP_001352021.1| 1-deoxy-D-xylulose-5-phosphate synthase [Janthinobacterium sp. Marseille] >gi|151279867|gb|ABR88277.1| 1-deoxy-D-xylulose-5-phosphate synthase [Janthinobacterium sp. Marseille] (621 aa)
Score = 795, Expect = 1.8e-82, Identities = 183/466 (39%), Positives = 269/466 (57%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQG--FIEKNNSKSKSVIPVIGDAAISNGLAFEALNNIA-YNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSK-FFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPN-----LNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTK 473
           ++ I +  D +++   +L  LA  LR  +++       HLSSNLG VEL++AL  VF++P+D I +D GHQ Y HK++T R D++ ++R+ +G+SGF   +ES +D   T HS   +S   G     K   + +  I VIGD A++ G+AFEA+NN   ++   +L+++NDN MSIS  VGAL++ +++  MS   +   K + K +      +     + K F + +K        FE  GF+Y G IDG++L   I  L+ +KN+   GP  LHV T KG GYK AE D   LYH     DP        +   TY SV  ++L  +   D  +  I PAM   S  +   ++FP+ Y DVGIAE+HAVT AAGMA    K  V+IYSTFLQR YD L+HDVA   L +TF +DR  L  +DG TH G YDI +L+ IPN ++  AS++ E  +++   + +   P  +RY +
  S:     4 LETINDPADVRQLTRPQLKQLADELRAFVLESVSATGGHLSSNLGTVELTIALHNVFNTPEDRIIWDVGHQTYPHKILTGRRDQMHSLRQIDGISGFPRRDESPYDTFGTAHSSTSISAALGMALAAKTKGEDRHAIAVIGDGAMTAGMAFEAMNNAGIHDDINLLVVLNDNDMSISPPVGALNRYLARL-MSGQFYAAAKNVGKTVLPAPMRE-----LAKRFEEHAKGMIVPATMFEEFGFNYIGPIDGHDLDSLIPTLQNLKNLK--GPQFLHVVTRKGQGYKLAEADPV-LYHGPGKFDPAEGIKPSTAKKVTYTSVFGDWLCDMAAADKRLVGITPAMREGSGMVEFERRFPDRYYDVGIAEQHAVTFAAGMACEGLKPVVAIYSTFLQRGYDQLIHDVALQNLDVTFALDRSGLVGADGATHAGNYDIAYLRCIPNMVVMAASDENECRQMLSTGF-DYQGPAAVRYPR 468
>gi|109897644|ref|YP_660899.1| deoxyxylulose-5-phosphate synthase [Pseudoalteromonas atlantica T6c] >gi|123171493|sp|Q15W93|DXS_PSEA6 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|109699925|gb|ABG39845.1| 1-Deoxy-D-xylulose-5-phosphate synthase [Pseudoalteromonas atlantica T6c] (621 aa)
Score = 795, Expect = 1.9e-82, Identities = 193/538 (35%), Positives = 308/538 (57%)
  Q:    15 EDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSI--YKSF-SKLSKFFKGK----NFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNS------NNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQ-NKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYALQTKESKT-------CIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVE 552
           E  +++   +L  +A  LR+ ++      S H +S LG VEL++AL YV+++P D + +D GHQ Y HK++T R D++ TIR+ NGL  F  PNES +D  + GHS   +S   G     +  +  + V+ VIGD A++ G+AFEALN+       ML+I+NDN MSIS+NVGAL+  +++        LT      I   ++  KK+  S+   K F S+  +  KG       FE LGF+Y G IDG+++   ++ LK ++NI   G  ILHV T KG GY+ AE  D   +H++   +P+ +       ++ T+ ++   +L  + + D N+  + PAM   S  +  S+KFP  Y DV IAE+HAVT AAG+A   +   V+IYSTFLQR+YD L+HDVA   LP+ F +DR  L  +DG TH G +DI FL+ IPN +I   +++ E  +++   ++ NK  P  +RY +     ++            AL+  +S+T        I+++G ++   +K  +  +  +I+  F+     E V  +   ++ +  +E
  S:    18 EQLRELPQDKLKQVAKELRQYLLTSVSQSSGHFASGLGTVELTVALHYVYNTPFDRLIWDVGHQAYPHKILTGRRDRMPTIRQKNGLHPFPWPNESEYDTFAVGHSSTSISAAVGMAVAAEKEALGRKVVAVIGDGAMTAGMAFEALNHGGDIDKDMLVILNDNEMSISENVGALNSHLARL-------LTGNFFNSI---RDGGKKLLSSVPPIKEFASRAEEHIKGMVVPGTIFEELGFNYIGPIDGHDVNGVVDTLKNMRNIK--GAQILHVVTKKGKGYELAE-KDPIKFHAVPKFNPSADGLPKAAPSDPTFSNIFGRWLCDMAQQDPNLMAVTPAMREGSGMVEFSQKFPAQYFDVAIAEQHAVTFAAGLAKEGQNAVVAIYSTFLQRAYDQLIHDVALQNLPVLFAIDRAGLVGADGPTHQGAFDIPFLRCIPNMVIMTPADENECRQMLYTGHKLNK--PAAVRYPRGSGTGVKPDNTMQ------ALEIGKSRTIRQGEKVAILNFGVLLPYAEKAAEVLNATVIDMRFVKPLDTEAVANVAKNHELLITLE 557
>gi|114773086|ref|ZP_01450370.1| 1-deoxy-D-xylulose-5-phosphate synthase [alpha proteobacterium HTCC2255] (626 aa)
Score = 795, Expect = 2.0e-82, Identities = 197/598 (32%), Positives = 330/598 (55%)
  Q:    15 EDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKS--KSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSI--YKSF-SKLSKFFKGK----NFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNS------NNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYA--LQTKESKT---CIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           E+ + +   +L  +A  LR+ ++      S H +S LG VEL++AL YV+++P D + +D GHQ Y HK++TDR ++++TIR+  GL  F  P ES +D  + GHS   +S   G     + +   +  + VIGD A++ GLAFEALN+       +++++NDN MSIS+NVGAL+  +++        LT      I   ++ SKK+  ++   K F SK  +  KG       FE LGF+Y G IDG+++K  ++ LK ++NI   GP ILHV T KG GY  AE +D   +H++   +P   +      ++ +Y  +  ++L  +   D  +  I PAM   S  +  SK +P  Y DV IAE+HAVT AAGMAI   K  V+IYSTFLQR+YD L+HDVA   LP+ F +DR  +  +DG TH G +DI +L+ IPN +I    ++ E  +++   +Q  + P  +RY +   E + ++ + +  +   +  L T  + T    I+++G ++ + K+  +  +  LI+  F+    ++ ++   + +     +E        G ++      N +   + +  + +  I    +  +  +L ID   I  ++K+
  S:    18 EELRTLPKDKLPQVADELRQFLLSSVSQSSGHFASGLGTVELTVALHYVYNTPVDQLIWDVGHQAYPHKILTDRRERMTTIRQQGGLHPFPWPPESQYDTFAVGHSSTSISAAVGMAIAADKEGLGRKTVAVIGDGALTAGLAFEALNHGGDIAKDLVVVLNDNEMSISENVGALNSHLARL-------LTGNFYNTI---RDGSKKVLSTVPPLKEFASKAEEHIKGMVVPGTIFEELGFNYIGPIDGHDVKGMVDTLKNMRNIS--GPQILHVVTKKGKGYTVAE-NDPIKFHAVPKFNPEEATLPKSAPSSPSYSDIFGDWLCDMAAQDPLLNAITPAMREGSGMVKFSKDYPEQYFDVAIAEQHAVTLAAGMAIRGLKPVVAIYSTFLQRAYDQLIHDVAIQNLPVLFAIDRAGIVGADGPTHQGAFDISYLRCIPNMVIMTPGDENECRQMLYTGHQ-LNQPAAVRYPRGGGEGVPIEPQMTALAIGVSRTLNTSSATTQRVAILNFGTLLPEAKQAAEILNATLIDMRFVKPLDQQALISAATEHDLFVTIEDGAIKGGAGSEVAEFILANDIDVKLLQCGLPDEFIMQATQAQMYAQLQIDAAGIVNQVKA 621
>gi|110835027|ref|YP_693886.1| deoxyxylulose-5-phosphate synthase [Alcanivorax borkumensis SK2] >gi|118595490|sp|Q0VMI4|DXS_ALCBS 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|110648138|emb|CAL17614.1| deoxyxylulose-5-phosphate synthase [Alcanivorax borkumensis SK2] (645 aa)
Score = 795, Expect = 2.0e-82, Identities = 188/610 (30%), Positives = 330/610 (54%)
  Q:     2 KKNKVKIDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWS-IYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPN-------------LNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYALQTKESKT-------CIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIK 611
           + N   +D + +  D +K+   +L  +   LR+ ++        H  + LG+VEL++AL Y++ +P D + +D GHQCY HK++T R + +++IR++ GLSGF + +ES +D    GHS   +S   G     +     +  + +IGD A++ G AFEA+++ A+ ++ +L+I+NDN MSIS NVG L    ++   SKS     +  +K+L     +    W  I ++   +         FE++GF+Y G IDG+N+ + ++ L+ ++++   GP +LHV T KG G+  AE D  G YH++   +P                     Y  +   +L  + E D  +  I PAM   S  +  S++FP  Y DV I E+HAVT A G+A  N+K  V+IYSTFLQR YD L+HDVA  EL +TF +DR  L   DG TH G++D+ +L+++PN II   S++ E  +L+  AYQ++  P  +RY +       +++  +      AL   +S+T        I+++G ++    +     +  +I+  ++    ++ +LR  + +  +  VE        G  +  L +E  +  ++  + + ++ I  G ++ +  +  +D   I  +I+
  S:    12 RPNTPLLDTLASPADLRKLPTPQLERVVDELREYLLYAVGQCGGHFGAGLGVVELTVALHYLYHTPDDKLVWDVGHQCYPHKILTGRRESLTSIRQAGGLSGFPKRSESEYDTFGVGHSSTSISAALGMALGAEMAGSDRRAVAIIGDGAMTAGQAFEAMSHAAHTRSNLLVILNDNNMSISHNVGGLSNYFARIWASKSYIALREGGKKVLS----TMPAAWDFIRRTEESMKNMVSPDMLFEAIGFNYIGPIDGHNVNELVSTLRNLRDLE--GPQLLHVYTTKGKGFAPAEADPVG-YHAINKIEPKPKVQVAVPSKPSAAKQKLPKYQDIFGQWLCDMAEQDPRLVGITPAMCEGSGMVEFSRRFPGRYHDVAICEQHAVTLAGGLACENQKPVVAIYSTFLQRGYDQLIHDVALQELDVTFGLDRAGLVGEDGATHGGVFDLAYLRTVPNMIIAAPSDENECRQLLYSAYQHEG-PAAVRYPRGTGPGATIEQTMT------ALPIGQSRTLREGLQVAILAFGAMVPAALEAAIPLNATVIDMRWVKPLDRDAILRAAAQHTLLVTVEDHQQMGGAGSAVNELLHEEAVVLDVLNLALPDHFIHHGKRDVLLAQAGLDAAGIERQIR 630
>gi|34498147|ref|NP_902362.1| 1-deoxy-D-xylulose-5-phosphate synthase [Chromobacterium violaceum ATCC 12472] >gi|41016944|sp|Q7NUK5|DXS_CHRVO 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|34104002|gb|AAQ60362.1| 1-deoxy-D-xylulose 5-phosphate synthase [Chromobacterium violaceum ATCC 12472] (616 aa)
Score = 794, Expect = 2.1e-82, Identities = 186/546 (34%), Positives = 297/546 (54%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDP-------NLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFS---FGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEK 553
           ++ I +  D + +   +L  LA  LR+ +++       H +SNLG +EL++AL YVFD+P D + +D GHQ Y HK++T R +++ T+R+ NGL+GF +  ES +D    GHS   +    G     K     +  + +IGD A++ G AFEALNN     T +L+I+NDN MSIS NVGAL+  ++K    +      +   K+L      K+I   + +    +  FF     FE  GF+Y G IDG+++   ++ LK I+++   GP  LH+ T KG GYK AE +D   YH +   DP          +    Y  V  ++L  + + D  +  I PAM   S  +   K+ P+ Y DV IAE+HAVT A GMA    K  V+IYSTFLQR YD L+HDVA   LP+ F +DR  L  +DG TH G +D+ +L+ IPN  +   S++ E  +L+  A+Q  + P  +RY +      E++++ +    G  V  ++ +  +  I+++G +++      +     + +  F+     E + ++  T++ I  VE+
  S:     5 LENINSPADLRLLPRTQLPQLAGELREFLVESVSKTGGHFASNLGSIELTIALHYVFDTPHDRLVWDVGHQTYPHKILTGRRERMHTMRQHNGLAGFPKREESEYDTFGVGHSSTSIGAALGMAVAAKTLGVDRKSVAIIGDGAMTAGQAFEALNNAGAMDTDLLVILNDNDMSISPNVGALNNYLAKLMSGRFYAAMREGSSKVLGIAPPLKEIASKVEE---HVKGFFTPGTLFEEFGFNYIGPIDGHDVDVLVDTLKNIRSLK--GPQFLHIVTKKGQGYKLAE-NDPVKYHGVTKFDPANGLASGKGGAGKPQYTQVFGDWLCDMAKLDKRLVGITPAMREGSGMVRFEKEHPDRYYDVAIAEQHAVTFAGGMACDGLKPVVAIYSTFLQRGYDQLIHDVALQNLPVMFALDRAGLVGADGPTHAGAFDLSYLRCIPNMTVMAPSDENECRQLLYTAFQLDT-PTAVRYPRGTGPGAEIQQQMAALPIGKGV--VRRRGKQVAILAFGSMVHPALAAAEALDATVADMRFVKPLDAELIRKLAQTHELIVTVEE 553
>gi|110600151|ref|ZP_01388378.1| deoxyxylulose-5-phosphate synthase [Geobacter sp. FRC-32] >gi|110549136|gb|EAT62335.1| deoxyxylulose-5-phosphate synthase [Geobacter sp. FRC-32] (636 aa)
Score = 794, Expect = 2.2e-82, Identities = 198/599 (33%), Positives = 318/599 (53%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKS--KSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVF--LTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNS------NNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDI---EVKKEFSFGSWVYALQTKESKTCIISYGDIIN---DLKKEIKTKSID--LINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSI 606
           +++I +  D K +K  ELL LA  +R+ ++D       HL+SNLG VEL++AL Y F+SP D I +D GHQ Y HK++T R D   T R+  G+SGF + +ES HD    GHS   +S   G    N  K     VI VIGD +++ G+AFEALN   + +  +++++NDN MSISKNVGAL   +S+ +++ + +  L +++ R +         I     K+ + L  F      FE+LGF Y G + G++L + I +++ ++++   GP ++HV T KG GY+ AE D    +H +   D              +Y  +  + L KL E D  I  I  AM   +     S+ FP+ + DVGIAE+HA+T AAGMA    +   +IYSTF QR+YD + HD+   +LP+T  +DR  L   DG THHG++D+ +L+ +P   +    ++ EL+ ++  A  +   P  +RY +     +    + K    G  V     K     +I+ G  +    +  +++K K I   +INA F+    +  +L        +  VE+       G  ++ L ++      +K+I I +  I  G++  + K L +D   I
  S:     5 LNRINSPADLKTLKEDELLLLAGEIRQFLLDTVSRTGGHLASNLGCVELTLALHYCFNSPSDSIIWDVGHQAYTHKILTGRRDVFHTQRQYQGISGFPKRSESAHDAFGAGHSSTSISAGLGMAVANCLKGDPSKVIAVIGDGSLTGGMAFEALNQAGHLRKNLVVVLNDNEMSISKNVGALSTFISR-KLTGNYYRDLKKEMQRLLQNIPAIGGNILHFARKAENSLKGFLTPGTLFEALGFEYIGPVHGHDLPQLIEIMQNVRSLE--GPVLVHVVTTKGKGYQPAE-DTPDKFHGVGPFDIKTGKVTGGKPGAASYTGIFGDTLCKLAEEDEKIVAITAAMPDGTGLTKFSRTFPDRFFDVGIAEQHALTFAAGMATEGFRPVAAIYSTFAQRAYDQIFHDICLQKLPVTLALDRAGLVGDDGPTHHGVFDLSYLRHLPEMTVMAPKDENELQHMLKTAIYS-DQPIALRYPRGAGYGVAMDSILKTIPLG--VAEQLAKGEDITLIAIGSTVYPAMEAAEQLKAKGIKACVINARFVKPLDRNLILSAAGRSGCVVTVEENALQGGFGTAIMELLSDEGAGIKVKRIGIPDRFIEQGSQAQLRKDLGLDAAGI 614
>gi|153950304|ref|YP_001402072.1| 1-deoxy-D-xylulose-5-phosphate synthase [Yersinia pseudotuberculosis IP 31758] >gi|170025470|ref|YP_001721975.1| deoxyxylulose-5-phosphate synthase [Yersinia pseudotuberculosis YPIII] >gi|166920144|sp|A7FLE4|DXS_YERP3 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|152961799|gb|ABS49260.1| 1-deoxy-D-xylulose-5-phosphate synthase [Yersinia pseudotuberculosis IP 31758] >gi|169752004|gb|ACA69522.1| deoxyxylulose-5-phosphate synthase [Yersinia pseudotuberculosis YPIII] (619 aa)
Score = 794, Expect = 2.3e-82, Identities = 188/541 (34%), Positives = 303/541 (56%)
  Q:    13 NYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWS---IYKSFSKLSKFFKG----KNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDP------NLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCED--IEVKKEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEK 553
           N E+ + +    L  L   LR+ ++      S H +S LG+VEL++AL YV+++P D + +D GHQ Y HK++T R D+ISTIR+ +GL  F    ES +D +S GHS   +S   G     +   K +  + VIGD AI+ G+AFEA+++     + ML+I+NDN MSIS+NVG L+  +++        L+ K+   +   +E  KK + +   I     +  +  KG       FE LGF+Y G +DG+++      LK ++++   GP +LH+ T KG GY  AE D  G +H++   DP         S+  TY  +   +L +    D+ +  + PAM   S  +  S+++P  Y DV IAE+HAVT AAG+AI   K  V+IYSTFLQR+YD L+HDVA   LP+ F +DR  L  +DG TH G +D+ F++ IPN +I   S++ E  +++   Y + + P  +RY +       +E  +    G  V  L+ +  K  I+ +G ++   +   +  +  L++  F+    +E VL + + ++ +  VE+
  S:    16 NPEELRMLPKESLPKLCDELRQYLLTCVSRSSGHFASGLGVVELTVALHYVYNTPFDHLIWDVGHQAYPHKILTGRRDRISTIRQKDGLHPFPWRGESEYDVLSVGHSSTSISAGLGMAVAAEREGKGRRTVCVIGDGAITAGMAFEAMSHAGDIHSDMLVILNDNEMSISENVGGLNNHLAQL-------LSGKLYASL---REGGKKAFSALPPIKDLLKRTEEHLKGMVVPSTLFEELGFNYIGPVDGHDVHTLTQTLKNMRDLK--GPQLLHIMTKKGKGYAPAEKDPIG-WHAVPKFDPASGTLPKSQSSLPTYSKIFGEWLCETAAKDSKLMAVTPAMREGSGMVRFSREYPQQYFDVAIAEQHAVTFAAGLAIGGYKPVVAIYSTFLQRAYDQLIHDVAIQNLPVLFAIDRGGLVGADGQTHQGAFDLSFMRCIPNMVIMAPSDENECRQMLYTGYHH-NGPAAVRYPRGNGTSAVLEPLEMLPIGKGV--LRREGEKIAILCFGTLLAQAQLAAENLNATLVDMRFVKPLDEELVLEMAAKHQVLVTVEE 557
>gi|46446253|ref|YP_007618.1| 1-deoxy-D-xylulose-5-phosphate synthase [Candidatus Protochlamydia amoebophila UWE25] >gi|81627396|sp|Q6MDK6|DXS_PARUW 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|46399894|emb|CAF23343.1| putative 1-deoxy-D-xylulose 5-phosphate synthase [Candidatus Protochlamydia amoebophila UWE25] (635 aa)
Score = 794, Expect = 2.3e-82, Identities = 193/467 (41%), Positives = 267/467 (57%)
  Q:    12 PNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKSKS---VIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFK-KEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLK---------LSDPNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANK-KVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCED 478
           PN  D K +   +L  LA  +R++II++      HL+SNLG+VEL++AL  VF+SP D   +D  HQ YVHK++T R D+   IR+  GL GF  P ESIHD    GH+G  LS+  G + KN   +K    +IP+IGDA ++ GL  EALNNI+      ++I+NDN MSISKNVGA+  I+S+   + +     + L  I+ K   +   +    +K    L        +FE  G  Y G IDG++ KK ++VL+ +K+     P I+HV T KG G  EA + +   YH  K         L +P       T+  +  + L K+ E D +I  I PAM+  S   +  K FP    DVGIAE HA+T A GMA   K K+  SIY+TFLQR++DN+ HD+   ELP+ F +DR  +S  DG THHGIYDI FL ++PN II    N   L+ L+  A+  K  P  IRY     E+
  S:    12 PN--DIKNLSYSDLKYLAHEIRQRIIEVLSVNGGHLASNLGVVELTLALHKVFESPDDKFIWDVSHQTYVHKLLTGRNDRFHEIRQFKGLCGFSHPKESIHDHFHAGHAGTALSLALG-VAKNRDLTKRKDYIIPIIGDATLTCGLTLEALNNISRELKRFIVILNDNAMSISKNVGAITHILSRLLSNPTTNKIHQELDTIVSKIPNYGPILSQQGHKITESLKNLVSPAVYFEQYGLSYIGPIDGHDTKKLVDVLEGVKD--SNWPVIIHVLTRKGEGMDEA-IKNPISYHGAKPFSKDTGKFLPNP---VTKPTFPKIFGSHLLKMAEKDPSIVAITPAMSAGSCLDDFMKTFPERCIDVGIAESHAITFAGGMAYGGKMKIVASIYATFLQRAFDNVFHDICLQELPVVFAIDRAGISGPDGSTHHGIYDISFLNAMPNMIIAQPRNGQVLKELMESAFSWK-RPTAIRYPNLMTEE 482
>gi|188586311|ref|YP_001917856.1| 1-Deoxy-D-xylulose-5-phosphate synthase [Natranaerobius thermophilus JW/NM-WN-LF] >gi|179350998|gb|ACB85268.1| 1-Deoxy-D-xylulose-5-phosphate synthase [Natranaerobius thermophilus JW/NM-WN-LF] (631 aa)
Score = 794, Expect = 2.4e-82, Identities = 191/543 (35%), Positives = 302/543 (55%)
  Q:    11 IPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNN--SKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFK----GKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAE-LDDK----GLYHSLKLSDPNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYALQTKE-SKTCIISYGDIINDL---KKEIKTKSID--LINAVFITNYQKENVLRILSTYKNIYVVEK 553
           I   ED K +   +L  LA  LR+ +I        HL+ NLG+VEL++A+  VF   QD I +D GHQ Y+HK++T R ++ ST+R+  GLSGF +P ES +D   TGHS   +S   G  +  +    ++ V+ VIGD A++ G+AFEA+N+  + +  M +I+NDN MSI  NVGAL   +S+ +         +I   + F  +    I   + KS  ++    K        FE LGF Y G IDG+N+ + + VL   K+    GP ++HV T KG GY+ AE   DK    G +     + P       +Y  V  + + ++   + ++  I  AM   +   N +++FP  + DVGIAE+HA+T AAG+A    K  V+IYSTFLQR+YD ++HDV   + P+ F +DR  +   DG+TH G+YD+ +L+SIPN I+    ++ EL+R++  A  N + P  IRY + K E + + +  +          +E S+  +I  G ++ D+      +K + I+  + NA F+    + ++L I   ++ IY  E+
  S:     8 INTSEDLKHLSTEDLNKLAEELREFLISSISITGGHLAPNLGVVELTLAIHKVFSPIQDKIVWDVGHQSYIHKILTGRKEQFSTLRQFGGLSGFPKPEESRYDAFGTGHSSTSISAALGMAKARDLQGSNEEVLAVIGDGAMTGGMAFEAMNHAGHEQANMTVILNDNEMSIGTNVGALSSYLSRLRTDPKY---HRIKEDVEFLLKRIPAIGGKMMKSVERVKDSMKYLMVSGMLFEELGFTYIGPIDGHNIPQLMEVLNNAKD--KNGPVLVHVITKKGKGYEPAEKFPDKFHGTGPFEIETGNAPKKAETAPSYSKVFGDTISEIARKNESVVAITAAMKDGTGLTNFAREFPERFFDVGIAEQHAITFAAGLARKGFKPVVAIYSTFLQRAYDQIIHDVCMQDNPVIFAIDRAGIVGGDGETHQGLYDLSYLRSIPNLIVMAPKDEAELQRMLNTAV-NINKPVAIRYPRGKGEGVTLWENMTPIPLYKGETIREGSQVAMIGVGKMVPDMLEVADMLKKEGIEPTVFNARFVKPLDESSILEIAQKHEYIYTFEE 561
>gi|56964227|ref|YP_175958.1| 1-deoxy-D-xylulose-5-phosphate synthase [Bacillus clausii KSM-K16] >gi|81600832|sp|Q5WF63|DXS_BACSK 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|56910470|dbj|BAD64997.1| 1-deoxy-D-xylulose 5-phosphate synthase [Bacillus clausii KSM-K16] (628 aa)
Score = 794, Expect = 2.5e-82, Identities = 194/596 (32%), Positives = 322/596 (54%)
  Q:     6 VKIDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSK--SKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMS------KFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHS---LKLSDPNL--NSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFS---FGSWVYALQTKESKTCIISYGDIINDLKKEIKT-----KSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNI 601
           + +++I +    K     +L +LA  +R+ +I+       H+  NLG+VEL++AL  +FDSP+D + +D GHQ YVHK++T RA +  T+R+  GL GF +  ES HD   TGHS   LS   G     + K  +++++ +IGD A++ G+A EALN+I + +  +++++NDN MSI+ NVGALH I+       K+Q +K     E I+RKI     +  K+  +  +    L        FFE +GF Y G +DG++L    + L   K     GP ++HV T KG GYK AE D  G +H     K+    +       +Y SV AN L+++   D  +  I PAM   S     +++FP+   DVGIAE+HA T +AG+A    K   ++YSTFLQR YD ++HD+ R  L +   +DR  L  +DG+TH G++DI FL+S+PN  I    ++ E + ++         P  IRY +     +++    S    G W   LQ + +   I+++G +I   +K +        +I LINA  +    ++ +  +      +  +E+       G  ++   NE  +   +K++ I +  +  G+  ++ +++ +
  S:     1 MNLEEIQDPSFLKNYSNKQLEELAADIRRFLIEKLSATGGHIGPNLGVVELTLALHQLFDSPKDKLLWDVGHQAYVHKILTGRAPQFDTLRQYKGLCGFPKRTESEHDVWETGHSSTSLSGAMGMATARDLKGTNENIVAIIGDGALTGGMALEALNHIGHEQKHLIVVLNDNEMSIAPNVGALHSILGRLRTAGKYQKAKEDL--ETIIRKI---PAFGGKLADTAERLKDSLKYLMVSGMFFEEMGFTYLGPVDGHDLDDLKHQLSYAKKTS--GPVLVHVLTKKGKGYKPAEEDATGAWHGTGPYKMESGEMVKKPGPPSYPSVFANTLKRIAREDERVVAITPAMPGGSKLDLFAEEFPDRMFDVGIAEQHAATMSAGLATQGMKPVYAVYSTFLQRGYDQVVHDICRQNLNVLIAIDRAGLVGADGETHQGVFDIAFLRSLPNITILNPKDENEFQHMLYTGICYDDGPIAIRYPRGNGTGVKMDASLSRLPIGKW-NVLQ-EGTDAAILTFGTMIPVAEKALAQLKQAGYNIRLINANSVKPLDEKLLEALAEEELPLLTIEESVLQGGFGSAVLEFYNEKGMHVELKRMGIPDYFVEHGSVSELYQEVGL 608
>gi|161869348|ref|YP_001598515.1| 1-deoxy-D-xylulose-5-phosphate synthase [Neisseria meningitidis 053442] >gi|189027779|sp|A9M1G3|DXS_NEIM0 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|161594901|gb|ABX72561.1| 1-deoxyxylulose-5-phosphate synthase [Neisseria meningitidis 053442] (635 aa)
Score = 793, Expect = 2.8e-82, Identities = 192/546 (35%), Positives = 307/546 (56%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNN--SKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKF-------QMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSL----KLSDPNLNSNNQ-----TYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTK---------EKCEDIEVKKEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEK 553
           +D I + +D +++   +L  LA  LR  +++       H +SNLG VEL++AL YV+D+P+D + +D GHQ Y HK++T R +++ T+R+  GL+GF +  ES +D    GHS   +    G    +      +  + +IGD A++ G AFEALN        +L+++NDN MSIS NVGAL K ++          +S     T K+L KI    E+++K+   I     +     +  + FE+ GF Y G +DG+N++  ++VLK +++    GP +LHV T KG GYK AE +D   YH++    K S   + S N+     TY  V   +L      D+ +  I PAM   S  +   ++FP+ Y DVGIAE+HAVT A G+A    K  V+IYSTFLQR+YD L+HD+A   LP+ F VDR  +  +DG TH G+YD+ FL+ IPN I+   S++ E   L+   YQ  + P  +RY +         +  E +E+ K          ++ +  KT  I++G ++       +  +  + +  F+    +E ++R+  ++  I  +E+
  S:     7 LDLIDSPQDLRRLDKKQLPRLAGELRTFLLESVGQTGGHFASNLGAVELTIALHYVYDTPEDKLVWDVGHQSYPHKILTGRKNQMHTMRQYGGLAGFPKRCESEYDAFGVGHSSTSIGAALGMAAADKLLGSDRRSVAIIGDGAMTAGQAFEALNCAGDMDVDLLVVLNDNEMSISPNVGALPKYLASNVVRDMHGLLSTVKAQTGKVLDKIPGAMEFAQKVEHKIKTLAEEAEHAKQSLSLFENFGFRYTGPVDGHNVENLVDVLKDLRS--RKGPQLLHVITKKGNGYKLAE-NDPVKYHAVANLPKESAAQMPSENKPAAKPTYTQVFGKWLCDRAAADSRLVAITPAMREGSGLVEFEQRFPDRYFDVGIAEQHAVTFAGGLACEGMKPVVAIYSTFLQRAYDQLVHDIALQNLPVLFAVDRAGIVGADGPTHAGLYDLSFLRCIPNMIVAAPSDENECRLLLSTCYQADA-PAAVRYPRGTGTGVPVSDGMETVEIGKGI--------IRREGEKTAFIAFGSMVAPALAVAEKLNATVADMRFVKPIDEELIVRLARSHDRIVTLEE 567
>gi|163749511|ref|ZP_02156759.1| 1-deoxy-D-xylulose-5-phosphate synthase [Shewanella benthica KT99] >gi|161330920|gb|EDQ01847.1| 1-deoxy-D-xylulose-5-phosphate synthase [Shewanella benthica KT99] (621 aa)
Score = 793, Expect = 3.0e-82, Identities = 197/580 (33%), Positives = 320/580 (55%)
  Q:    32 LRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI---EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLT-----EKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNL------NSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCE---DIEVKKEFSFGSWVYALQTKESKTCIISYGDII-NDLKKEIKTKSID--LINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIK 611
           LR  ++      S H +S LG VEL++AL YV+++P D + +D GHQ Y HK++T R D++ TIR+  G+  F    ES +D  S GHSG  +S         EK  +  K V+ VIGD A++ G+ FEA+N+       ML+++NDN MSIS+NVGAL+  +++  MS  ++ T     +K+L+ +   KE +K+       +   L         FE LGF+Y G IDG+++   +  ++ ++N+   GP ILH+ T KG GY+ AE D  G +H++   DP+         +N T+  V   +L  + E D+ +  I PAM   S  +  S++FP  Y D  IAE+HAVT AAG A    K  V+IYSTFLQR YD L+HDVA  +LP+ F +DR  +  +DG TH G +D+ F+++IPN +I   S++ E  +++   Y  K  P  +RY +        +E       G  +  ++ + +K  I+++G ++ N L   I  +S+D  + +  F+     E + ++  ++  +  VE+       G  ++      K    + +I + +  I  G +++I   L +D   I A+I+
  S:    35 LRSFLLKSVARSSGHFASGLGTVELTVALHYVYNTPFDRLIWDVGHQAYPHKILTGRRDRMHTIRQKGGIHPFPWREESEYDIFSVGHSGTSISAALAMAVAAEKEQAGRK-VVAVIGDGAMTGGMVFEAMNHAGDLHNDMLVVLNDNEMSISENVGALNNHLAQL-MSGRLYTTIREGSKKVLQGMPVIKEMAKR-------TEEHLKGMVVPGTMFEELGFNYIGPIDGHDIDALVETMRNMRNLS--GPQILHIMTKKGRGYEPAEKDPIG-WHAVPKFDPSTFEKPASKPSNPTFSQVFGKWLCDISEQDDKVLGITPAMREGSGMVEFSQRFPKQYFDAAIAEQHAVTLAAGFACEGLKPVVAIYSTFLQRGYDQLIHDVALQKLPVLFAIDRGGIVGADGPTHQGAFDLSFMRTIPNMVIMAPSDENECRQMLYTGYCYKDGPTAVRYPRGSATGEPQVEEMTALPIGKGL--IKRQGTKIAILNFGTLLANSL---IAAESLDATVADMRFVKPLDIELIKQLSDSHDLLVTVEENAIMGGAGSGVLEELQRLKRPMPVLQIGLPDEFIKHGEQKEILADLRLDSAGILAQIE 617
>gi|152999875|ref|YP_001365556.1| 1-deoxy-D-xylulose-5-phosphate synthase [Shewanella baltica OS185] >gi|166201536|sp|A6WL04|DXS_SHEB8 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|151364493|gb|ABS07493.1| deoxyxylulose-5-phosphate synthase [Shewanella baltica OS185] (622 aa)
Score = 793, Expect = 3.0e-82, Identities = 189/569 (33%), Positives = 310/569 (54%)
  Q:    44 SAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI---EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLT-----EKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNL------NSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTK---EKCEDIEVKKEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           S H +S LG VEL++AL YV+++P D + +D GHQ Y HK++T R DK+ TIR+ +GL  F    ES +D  S GHSG  +S         EK  +  K V+ VIGD A++ G+ FEA+N+       ML+++NDN MSIS+NVGAL+  +++  MS   + T     +K+L+ +   KE +K+       +   L         FE LGF+Y G IDG+++   +  ++ ++N+   GP +LH+ T KG GY+ AE D  G +H++   DP+L           T+  V   +L  + E D  +  I PAM   S  +  S++FP  Y D  IAE+HAVT +AG A    K  V+IYSTFLQR+YD L+HDVA  +LP+ F +DR  +  +DG TH G +D+ F++ IPN +I   S++ E  +++   Y   + P  +RY +        +E       G  V  ++    +  I+++G ++       ++    +++  F+     + V  +  T++ +  VE+       G  ++    + ++   + +I + +  I  G+ E++   L +D   I A+I +
  S:    47 SGHFASGLGTVELTVALHYVYNTPFDRLIWDVGHQAYPHKILTGRRDKMHTIRQKDGLHPFPWREESEYDTFSVGHSGTSISAALAMAIAAEKEQAGRK-VVAVIGDGAMTGGMVFEAMNHAGDLHNDMLVVLNDNEMSISENVGALNNHLAQL-MSGRFYTTLREGGKKVLKGMPVIKEMAKR-------TEEHLKGMVVPGTLFEELGFNYIGPIDGHDVDALVETMRNMRNLK--GPQVLHIMTKKGRGYEPAEKDPIG-WHAVPKFDPSLFKKPATKPGLPTFSQVFGKWLCDIAEQDEKVLAITPAMREGSGMVEFSQRFPKQYFDAAIAEQHAVTLSAGFACEGFKPVVAIYSTFLQRAYDQLIHDVALQQLPVLFAIDRGGIVGADGPTHQGAFDLSFMRCIPNMVIMAPSDENECRQMLYTGYCYDAGPSAVRYPRGCATGATQVEAMTALPIGKGV--IKRVGKRIAILNFGTLLASALTAAESLDATVVDMRFVKPLDVDLVKEMAQTHEVLVTVEENAIMGGAGAGVLEQLQKLRMPKAVLQIGLPDEFIKHGSPEEVTHDLQLDAEGILAQINA 618
>gi|51595289|ref|YP_069480.1| 1-deoxy-D-xylulose-5-phosphate synthase [Yersinia pseudotuberculosis IP 32953] >gi|186894306|ref|YP_001871418.1| deoxyxylulose-5-phosphate synthase [Yersinia pseudotuberculosis PB1/+] >gi|81640216|sp|Q66DV4|DXS_YERPS 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|51588571|emb|CAH20179.1| 1-deoxyxylulose-5-phosphate synthase; flavoprotein, thiamin-binding [Yersinia pseudotuberculosis IP 32953] >gi|186697332|gb|ACC87961.1| deoxyxylulose-5-phosphate synthase [Yersinia pseudotuberculosis PB1/+] (619 aa)
Score = 793, Expect = 3.1e-82, Identities = 188/541 (34%), Positives = 303/541 (56%)
  Q:    13 NYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWS---IYKSFSKLSKFFKG----KNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDP------NLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCED--IEVKKEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEK 553
           N E+ + +    L  L   LR+ ++      S H +S LG+VEL++AL YV+++P D + +D GHQ Y HK++T R D+ISTIR+ +GL  F    ES +D +S GHS   +S   G     +   K +  + VIGD AI+ G+AFEA+++     + ML+I+NDN MSIS+NVG L+  +++        L+ K+   +   +E  KK + +   I     +  +  KG       FE LGF+Y G +DG+++      LK ++++   GP +LH+ T KG GY  AE D  G +H++   DP         S+  TY  +   +L +    D+ +  + PAM   S  +  S+++P  Y DV IAE+HAVT AAG+AI   K  V+IYSTFLQR+YD L+HDVA   LP+ F +DR  L  +DG TH G +D+ F++ IPN +I   S++ E  +++   Y + + P  +RY +       +E  +    G  V  L+ +  K  I+ +G ++   +   +  +  L++  F+    +E VL + + ++ +  VE+
  S:    16 NPEELRMLPKESLPKLCDELRQYLLTCVSRSSGHFASGLGVVELTVALHYVYNTPFDHLIWDVGHQAYPHKILTGRRDRISTIRQKDGLHPFPWRGESEYDVLSVGHSSTSISAGLGMAVAAEREGKGRRTVCVIGDGAITAGMAFEAMSHAGDIHSDMLVILNDNEMSISENVGGLNNHLAQL-------LSGKLYASL---REGGKKAFSALPPIKDLLKRTEEHLKGMVVPSTLFEELGFNYIGPVDGHDVHTLTQTLKNMRDLK--GPQLLHIMTKKGKGYAPAEKDPIG-WHAVPKFDPASGTLPKSQSSLPTYSKIFGEWLCETAAKDSKLMAVTPAMREGSGMVRFSREYPQQYFDVAIAEQHAVTFAAGLAIGGYKPVVAIYSTFLQRAYDQLIHDVAIQNLPVLFAIDRGGLVGADGQTHQGAFDLSFMRCIPNMVIMAPSDENECRQMLYTGYHH-NGPAAVRYPRGNGTGAVLEPLEMLPIGKGV--LRREGEKIAILCFGTLLAQAQLAAENLNATLVDMRFVKPLDEELVLEMAAKHQVLVTVEE 557
>gi|153814705|ref|ZP_01967373.1| hypothetical protein RUMTOR_00920 [Ruminococcus torques ATCC 27756] >gi|145847736|gb|EDK24654.1| hypothetical protein RUMTOR_00920 [Ruminococcus torques ATCC 27756] (619 aa)
Score = 793, Expect = 3.4e-82, Identities = 205/603 (33%), Positives = 326/603 (54%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKSK--SVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWS-KKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVL---KRIKNIVPFGPTILHVKTIKGLGYKEAE-----LDDKGLYHSLKLSDPNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFS----FGSWVYALQTKESKTCIISYG---DIINDLKKEIKTKS--IDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEI 610
           I+ I    D KK+   +L +LA  +R  ++D       HL+SNLG+VEL+MAL    D PQD + +D GHQ Y HK++T R D    +R+  G+SGF +  ES  D   TGHS   +S   G++     K +  +V+ VIGD A++ G+AFEALNN +  K+  +I++NDN MSIS+NVG + K +   + +++    +K +   L K   +  +I   + K+ S + + F    FFE +   Y G +DG+++K+ + V    KR+ + V     ++HV T KG GY  AE         G +H L+  D   +    TY  V +  L  + + D  I  I  AM   +     +K FPN + DVGIAEEHA+T AAG+A    K   ++YS+FLQR+YD  LHDV    LP+   VDR  L  SDG+TH G++D+ FL  IPN  I    N++E+  +I  A  +   P  +RY +   E  E  K+F     +G     L  +E K  II  G   ++ + ++K +K K     L+NA F+     E + R+   +     +E+   +   G+ ++   +   ++  +K   I ++ +  GN + + +++ +D ++I  +I
  S:     3 IEMIQKENDIKKLDHTQLKELAEEIRGFLLDKISCTGGHLASNLGVVELTMALHLTLDFPQDKLIWDVGHQSYTHKLLTGRKDGFDDLRKYGGMSGFPKRKESECDAFDTGHSSTSISAGLGYVAARELKGEKYNVVSVIGDGAMTGGMAFEALNNASRLKSNFIIVLNDNNMSISENVGGVSKYLGCLRTAQAYTDLKKGVEDTLKKIPGTGDRIVSRLKKTKSGIKQLFVPGMFFEDMDITYLGPVDGHDVKEMVRVFNEAKRVDHAV-----LVHVLTKKGKGYLPAEENPAKFHGTGPFH-LETGDAKESKGADTYTEVFSKVLLDIAKKDERIVAITAAMADGTGLTPFAKHFPNRFFDVGIAEEHAMTFAAGLAAGGMKPIFAVYSSFLQRAYDQTLHDVCLQNLPVVIAVDRAGLVGSDGETHQGVFDLSFLSMIPNMTIISPKNRWEMADMIRFA-ADFPYPIAVRYPRG--EAYEGMKQFRSPICYGK--SELLYEEEKIVIIFVGHMAELADQVRKGLKEKGYCCSLVNARFVKPLDTELLERLAENHDLYVTIEENMLTGGFGEQVLDYISGAGINVRVKNFGIADDYVEHGNVDLLRREVGLDKDTIVKQI 614
>gi|89889506|ref|ZP_01201017.1| deoxyxylulose-5-phosphate synthase [Flavobacteria bacterium BBFL7] >gi|89517779|gb|EAS20435.1| deoxyxylulose-5-phosphate synthase [Flavobacteria bacterium BBFL7] (589 aa)
Score = 792, Expect = 3.7e-82, Identities = 209/592 (35%), Positives = 313/592 (52%)
  Q:    16 DFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSK--SKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHS----------LKLSDPNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEF---SFG-SWVYALQTKESKTCIISYGDIINDL--KKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIF 607
           D K   + +L  +A  LR  II++   K  HL ++LG++EL++AL YVFD+P+DL+ +D GHQ Y HK++T R D   T R+ NG+SGF + +ES++D    GHS   +S   G    +  K   +  I V+GDA+I++G+AFEALN+   +   +L+I+NDN + I   VGAL   ++K                                   +K  K     N FESL F Y G IDG++L   +  LKR K++   GP +LHV+T KG G K+AE+D +  YH+          L  SD +L      +  V  + + +L + + NI  I PAM   S+   +    P+   DVGIAE+HAVT AAGMA      F +IYSTFLQR+YD ++HDVA  +LP+ F +DR  L   DG THHG +D+ +L  IP+ II    +  EL  ++  A      P  IRY + +   +  ++ F   S G S V    TK +   I S G +I+DL   +E+    +D+    F+     + +  I   +++I  +E       LG  ++  A+      NI K+ I +  I  G  +D+ K   ID  ++F
  S:    14 DLKGCDVDQLPQIAQELRDFIIEVVATKEGHLGASLGVIELTIALHYVFDTPEDLLVWDVGHQAYGHKILTGRRDVFHTNRDLNGISGFPKRDESVYDTFGVGHSSTAISAALGMAMASQLKGTDRKHIAVVGDASIASGMAFEALNHAGVSGADLLVILNDNAIGIDPAVGALKDYLTK-----------------------------------TKSGKETGRDNIFESLNFDYSGPIDGHDLPLLLEELKRQKSLK--GPRLLHVRTTKGKGLKQAEID-QVRYHAPGKFDKTTGDLTPSDTSLLP--PKFQDVFGHTIVELAQQNENIIGITPAMPTGSSMKIMMDVMPDRAFDVGIAEQHAVTLAAGMATQGLVPFCNIYSTFLQRAYDQVIHDVALQKLPVIFCLDRAGLVGQDGATHHGNFDLAYLNCIPDLIIAAPMDAIELRNMMYTAQLGLELPIVIRYPRGRGRILNWQQPFQKLSIGQSRVIHASTKIAVLSIGSIGAMIDDLISDEELDVTHVDM---RFLKPLDHDMLDDIFEQHEHIITIEDGTVIGGLGSVVVDYASAKAYKNNIYKLGIPDAFIQHGPTKDLHKIAGIDSETVF 580
>gi|188588267|ref|YP_001921547.1| 1-deoxy-D-xylulose-5-phosphate synthase [Clostridium botulinum E3 str. Alaska E43] >gi|188498548|gb|ACD51684.1| 1-deoxy-D-xylulose-5-phosphate synthase [Clostridium botulinum E3 str. Alaska E43] (619 aa)
Score = 792, Expect = 3.8e-82, Identities = 208/602 (34%), Positives = 326/602 (54%)
  Q:     5 KVKIDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKSK--SVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNSNNQ----TYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEK---CEDIEVKKEFSFGSWVYALQTKESKTCIISYGDIIND--LKKEI-KTKSID--LINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSI 606
           K  +D +   +D K +   +   L+  +R+ +I+       HLSSNLG+VEL+++L+  FD  +D I +D GHQ YV+K++T R D    +R+ NGLSGF + NES +D+  TGHS   +S   G     + K +  +V+ VIGD A++ G+A EALN++ + KT M+II+NDN MSIS NVG L + ++K +M ++    +  +   L   +  K +   + K    + +      FFE++G  Y G IDG+++K    V  ++K+I   GP I+H  T KG GY  AE      YH +  S+      N+    +Y     N L  + + +  +  I  AM   +   + +  +P  + DVGIAE+HAVT AAGMA    K   ++YSTFLQR +D ++HDV   +LP+TF +DR  +   DG+TH GI D+ +L  +PN  I       E+  ++  A + K++P  IRY + K   C +++  +E S+G W    + K  K CII+ G ++    L KEI K K ID  ++NA FI    K  +  +     +I  +E       LG  ++   N    + N+K +   +  I  GN E + +   +D  SI
  S:     2 KSLLDSLNFPKDLKNLSDSDTEILSKEIRQFLIESVSKTGGHLSSNLGVVELTLSLMKSFDFEKDKIVWDVGHQSYVYKILTGRKDGFKNLRQFNGLSGFPKRNESKYDYFDTGHSSTSISAGLGMARARDLKGEKYTVVSVIGDGALTGGMALEALNDVGFRKTKMVIILNDNQMSISVNVGGLSRYLNKLRMGETYNRLKTNINTSLGSSDLGKDLISKMSKVKDSIKQLVVPSMFFENMGVKYIGPIDGHDIKAMNEVFSKVKDIE--GPVIIHTVTQKGRGYSLAE-KSPSKYHGIPPSNDKKEEPNKACRDSYSKAFGNALIDIAKEEKEVVAITAAMPDGTGLKDFATTYPERFFDVGIAEQHAVTLAAGMAANGLKPVFAVYSTFLQRGFDQVIHDVCIQDLPVTFAIDRAGIVGDDGETHQGIMDVSYLSMMPNMTIVAPKCTEEIPSMLRWAIK-KNSPVAIRYPRGKDIVC-NLDALQEISYGKWEVVSEGK--KICIIASGRMLQHALLAKEILKEKGIDPKIVNATFIKPIDKCLLENLKEDGYDILTIEDNIICGGLGISILEYLNYIDYNGNMKLLGYNDEFIPQGNVEILYRTYGLDPVSI 610
>gi|126173595|ref|YP_001049744.1| deoxyxylulose-5-phosphate synthase [Shewanella baltica OS155] >gi|166201535|sp|A3D2B2|DXS_SHEB5 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|125996800|gb|ABN60875.1| deoxyxylulose-5-phosphate synthase [Shewanella baltica OS155] (622 aa)
Score = 792, Expect = 4.2e-82, Identities = 189/569 (33%), Positives = 310/569 (54%)
  Q:    44 SAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI---EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLT-----EKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNSNNQT------YGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTK---EKCEDIEVKKEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           S H +S LG VEL++AL YV+++P D + +D GHQ Y HK++T R DK+ TIR+ +GL  F    ES +D  S GHSG  +S         EK  +  K V+ VIGD A++ G+ FEA+N+       ML+++NDN MSIS+NVGAL+  +++  MS   + T     +K+L+ +   KE +K+       +   L         FE LGF+Y G IDG+++   +  ++ ++N+   GP +LH+ T KG GY+ AE D  G +H++   DP+L     T      +  V   +L  + E D  +  I PAM   S  +  S++FP  Y D  IAE+HAVT +AG A    K  V+IYSTFLQR+YD L+HDVA  +LP+ F +DR  +  +DG TH G +D+ F++ IPN +I   S++ E  +++   Y   + P  +RY +        +E       G  V  ++    +  I+++G ++       ++    +++  F+     + V  +  T++ +  VE+       G  ++    + ++   + +I + +  I  G+ E++   L +D   I A+I +
  S:    47 SGHFASGLGTVELTVALHYVYNTPFDRLIWDVGHQAYPHKILTGRRDKMHTIRQKDGLHPFPWREESEYDTFSVGHSGTSISAALAMAIAAEKEQAGRK-VVAVIGDGAMTGGMVFEAMNHAGDLHNDMLVVLNDNEMSISENVGALNNHLAQL-MSGRFYTTLREGGKKVLKGMPVIKEMAKR-------TEEHLKGMVVPGTLFEELGFNYIGPIDGHDVDALVETMRNMRNLK--GPQVLHIMTKKGRGYEPAEKDPIG-WHAVPKFDPSLFKKPTTKPGLPTFSQVFGKWLCDIAEQDEKVLAITPAMREGSGMVEFSQRFPKQYFDAAIAEQHAVTLSAGFACEGFKPVVAIYSTFLQRAYDQLIHDVALQKLPVLFAIDRGGIVGADGPTHQGAFDLSFMRCIPNMVIMAPSDENECRQMLYTGYCYDAGPSAVRYPRGCATGATQVEAMTALPIGKGV--IKRVGKRIAILNFGTLLASALTAAESLDATVVDMRFVKPLDVDLVKEMAQTHEVLVTVEENAIMGGAGAGVLEQLQKLRMPKAVLQIGLPDEFIKHGSPEEVTHDLQLDAEGILAQINA 618
>gi|83746514|ref|ZP_00943565.1| 1-deoxy-D-xylulose 5-phosphate synthase [Ralstonia solanacearum UW551] >gi|83726845|gb|EAP73972.1| 1-deoxy-D-xylulose 5-phosphate synthase [Ralstonia solanacearum UW551] (636 aa)
Score = 792, Expect = 4.2e-82, Identities = 200/604 (33%), Positives = 318/604 (52%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIE--KNNSKSKSVIPVIGDAAISNGLAFEALNNIA-YNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKG----KNFFESLGFHYFGVIDGNNLKKTINVLKRIKN--IVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNSNNQT------YGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEV----------KKEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIK 611
           ++ I +  + +++   +L  LA  LR  +++       HLSSNLG +EL++AL YVF++P D I +D GHQ Y HK++T R ++++T+R+ +G+SGF   +ES +D   T HS   +S   G  +  K   +S+  I VIGD A+S G+AFEA+NN   Y   P+++++NDN MSIS  VGAL++ +++    +    T+K + K+L        +   + +   +  +  KG       FE  GF+Y G IDG++L   +  L+ I+   +   GP  LHV T KG GYK AE D   LYH     +P       T      Y  V   +L  +   D  +  I PAM   S  +   ++FP+ Y DVGIAE+HAVT A G+A    K  V+IYSTFLQR YD L+HDVA   LP+ F +DR  L  +DG TH G YD+ +L+ IPN ++   +++ E  +L+  A+     P  +RY +     + V          K E    S   A Q    +  I+++G ++       +     ++N  F+       VL +  T+  +  VE+       G   + +     ++  + ++ + +  I  G+   +     +D N I A I+
  S:     6 LNTIDDPAELRRLDRRQLGTLADELRAFVLESVSQTGGHLSSNLGTIELTIALHYVFNTPDDRIVWDVGHQSYPHKILTGRREQMATLRQLDGISGFPRRSESPYDTFGTAHSSTSISAALGMAQGAKTQGESRVAIAVIGDGAMSAGMAFEAMNNAGVYKDLPLVVVLNDNDMSISPPVGALNRYLARLMSGQFYAATKKGVEKLL-------SVAPPVLEFAKRFEEHAKGMLVPATMFEEFGFNYIGPIDGHDLGSLVPTLQNIRQRALEGGGPQFLHVVTKKGQGYKLAEADPI-LYHGPGKFNPQEGIKPATRPAKVSYTQVFGQWLCDMAAADKRLVGITPAMREGSGMVEFEQRFPDRYYDVGIAEQHAVTFAGGLACEGLKPVVAIYSTFLQRGYDQLIHDVALQNLPVVFALDRAGLVGADGATHAGAYDMAYLRCIPNMMVMAPADENECRQLLSTAFAQDC-PTAVRYPRGAGPGVAVQPTLDPLPVGKAEVRRASTAPAGQ----RVAILAFGSMVAPATAAAERLDATVVNMRFVKPLDVACVLEMARTHDYVVTVEEGCVMGGAGSACLEVLAAAGVATPVLQLGLPDRFIDHGDHAALLALCGLDANGILASIR 621
>gi|89073139|ref|ZP_01159678.1| 1-deoxy-D-xylulose-5-phosphate synthase [Photobacterium sp. SKA34] >gi|89051092|gb|EAR56549.1| 1-deoxy-D-xylulose-5-phosphate synthase [Photobacterium sp. SKA34] (621 aa)
Score = 791, Expect = 5.0e-82, Identities = 192/581 (33%), Positives = 318/581 (54%)
  Q:    32 LRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWS---IYKSFSKLSKFFKG----KNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSD------PNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVK---KEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           LR  ++      S H +S LG VEL++AL YV+++P D + +D GHQ Y HK++T R D ++TIR+  GL  F    ES +D +S GHS   +S   G     +    ++ V+ +IGD AI+ G+AFEA+N+     + ML+I+NDN MSIS+NVGAL+  ++   +S + + +          +E  KK+  +   I +   +  +  KG       FE LGF+Y G +DG+++ + +  LK ++N+   GP  LH+ T KG GY  AE D    YH++   D      P     + T+  +  ++L  +   D+ +  I PAM   S  +  SK+FP  Y DV IAE+HAVT A GMAI      V+IYSTFLQR YD L+HDVA ++LP+ F +DR  L  +DG TH G +DI F++ IPN +I   S++ E  +++   ++ +  P  +RY +    +++V     E   G  +  ++ +  K  I+++G +++   +  +  +  + +  F+    +  VL +  T+  +  VE+   +   G  +I    + K    +  I + +  I  G + ++ + L ID   I  +I++
  S:    35 LRTYLLKSVSQTSGHFASGLGTVELTVALHYVYNTPFDKVIWDVGHQAYPHKILTGRRDDMATIRQKGGLHPFPWRGESEYDTLSVGHSSTSISAGLGIAIAAEKEGLNRKVVSIIGDGAITAGMAFEAMNHAGDVHSDMLVILNDNEMSISENVGALNNHLAHL-LSGNFYTS---------IREGGKKVLSNAPPIKEMVKRAEEHIKGMVVPSTMFEELGFNYIGPVDGHDVHELVKTLKNMRNLK--GPQFLHIMTKKGKGYAPAEADPIN-YHAVPKFDLSQKPLPKAKDASPTFSKIFGDWLCDMAAVDDKLMAITPAMREGSGMVRFSKEFPEQYFDVAIAEQHAVTLATGMAIGGYHPIVAIYSTFLQRGYDQLIHDVAIMDLPVMFAIDRAGLVGADGQTHQGAFDISFMRCIPNMVIMAPSDENECRQMLYTGHRYQG-PSAVRYPRGCGMEVDVDPTMTELEIGKGI--IRRQGEKIAILNFGSMLSYGLEAAENLNATVADMRFVKPLDEALVLELAKTHDVLVTVEENAIAGGAGSGVIEFLMKEKTLKPVLNIGLPDRFIEQGTQAELHEMLEIDGAGIEKQIRT 617
>gi|86140823|ref|ZP_01059382.1| 1-deoxy-D-xylulose-5-phosphate synthase [Flavobacterium sp. MED217] >gi|85832765|gb|EAQ51214.1| 1-deoxy-D-xylulose-5-phosphate synthase [Leeuwenhoekiella blandensis MED217] (590 aa)
Score = 791, Expect = 5.0e-82, Identities = 210/605 (34%), Positives = 321/605 (53%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGF-----IEKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHS---LKLSDPNLNSNNQT-----YGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYALQ-TKESKTCIISYGDIINDLKK--EIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           ++ I + +D +K+++ EL  LA  LR+ II I   K  HL ++LG+VEL++AL Y F++P D + +D GHQ Y HK+IT R D   T R+  GLSGF +  ES++D   TGHS   +S   G      I+ N  +    I VIGDA+I++G+AFEALN+   +   +L+I+NDN + I  +VGAL                               K Y +  K+ S+     + +N FE+L F YFG +DG+++ K + ++K +K I   GP  LHV T KG G K+AE  ++ LYH+      +   LN  + T     Y  V    L +L + +  I  I PAM   S+   + ++FP    DVGIAE+HAVT AAG+A A    F +IYSTFLQR+YD L+HDVA  +LP+ F VDR  L  +DG THHG++D+ +L+ IPN I+    N+  L  ++  A      P  IRY + +   I+ K  F       A + T+  K  ++  G +     +  E+  ++I +    F+     E +  + S Y  I  +E    S   G  +   A     +  ++ + I +  I  G  E++   + +D  S+ A++ S
  S:     6 LETINDPQDLRKLQVAELNTLAAELRRFIIAIVATKEGHLGASLGVVELTLALHYAFNTPDDQLIWDVGHQAYGHKIITGRRDIFETNRQLGGLSGFPKREESVYDAFGTGHSSTSISAALGMAIAAKIQGNTRRQH--IAVIGDASIASGMAFEALNHAGDSDANLLVILNDNAIGIDPSVGAL-------------------------------KNYLTNVKTGSQ-----RQENIFEALNFKYFGPVDGHDIDKLLEIIKTLKKIK--GPKFLHVITTKGKGLKQAE-KEQVLYHAPGKFDAATGELNPKSTTPQPPKYQDVFGLTLVELTKKNEKIVGITPAMPTGSSLKYMMQEFPERAFDVGIAEQHAVTLAAGIAAAGGVAFCAIYSTFLQRAYDQLIHDVALQKLPVIFCVDRAGLVGADGATHHGVFDLAYLRCIPNLILFAPRNEESLRNIMYTAQLGLEQPIAIRYPRGRGTTIDWKTSFQELQIGKAEKLTEGDKIAVLVTGSLTETALQLAEVYPEAIAVYYFGFVKPLDLEALQEVFSNYSTIITLEDGVVSGGFGSAIAEEAIRQSYTGKLELLGIPDRFIEQGTTEELKTSVGLDFESLKAQLAS 585
>gi|85711192|ref|ZP_01042252.1| Deoxyxylulose-5-phosphate synthase [Idiomarina baltica OS145] >gi|85695105|gb|EAQ33043.1| Deoxyxylulose-5-phosphate synthase [Idiomarina baltica OS145] (615 aa)
Score = 791, Expect = 5.3e-82, Identities = 192/604 (31%), Positives = 332/604 (54%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWS---IYKSFSKLSKFFKGK----NFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNS------NNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVK---KEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIK 611
           +D I    D +K+  H+L  L   +R  ++D     S HL+S LG VEL++AL YV+++P+D + +D GHQ Y HK++T R   + TIR+ +GL  F    ES +D +S GHS   +S   G     + +  ++ V+ +IGD A++ G+ FEA+N+    K  ML+++NDN MSIS+NVGAL++  ++        L+ +   KI   +E  KK+      I+   S+  +  KG       FE LGF+Y G IDG+++   +  L+ +K++   GP +LHV T KG GY+ AE D  G YH +   DP+L+          +Y  V  ++L    + D  +  I PAM   S  +  SK +P  Y DV IAE+H+VT AAG+AIA  K  V+IYSTFLQR+YD ++HDVA   L + F +DR  +  +DG TH G +D+ +L+ IPN ++   SN+ E   ++   Y ++  P  +RY +     + ++   K  + G      Q  +    I+++G ++ +     +  +  +++  F+    K+  +     ++ +  +E+   +   G  +      + ++  +  I + +  I  G+++++ +++ ++  +I + I+
  S:     5 LDGIEYPTDLRKLPTHQLNALCEEVRAYLLDSVSRSSGHLASGLGTVELTVALHYVYNTPKDKLVWDVGHQAYPHKILTGRKKALHTIRQKDGLHPFPWREESEYDVLSVGHSSTSISAALGMAVAAQRSGSNEKVVSIIGDGAMTAGMVFEAMNHAGDIKPDMLVVLNDNDMSISENVGALNQHFARL-------LSGRFYTKI---REQGKKLLKPLPPIHHLASRAEEHMKGMMAPGTIFEELGFNYIGPIDGHDVDTLVETLRNMKHLR--GPQLLHVVTQKGKGYRPAEADPIG-YHGVPKFDPSLSKLPAKKPGIPSYSEVFGDWLCDHAQDDAKLMAITPAMREGSGMVKFSKLYPEQYFDVAIAEQHSVTYAAGLAIAGLKPVVAIYSTFLQRAYDQVIHDVALQNLDVLFAIDRAGIVGADGPTHQGAFDLSYLRCIPNMVVMTPSNEQECRDMLYTGYCHQG-PAAVRYPRGSGTGVTLREHDKLLTLGEANIIRQGND--VAILNFGTLLPEAIAVAEDINATVVDMRFVKPLDKQVAIDCARRHQLVVTLEENAIAGGAGSAVNEALANSGINTQVLNIGLPDEFIKHGSQDEVKQEIGLNATAIKSRIQ 610
>gi|125973346|ref|YP_001037256.1| 1-deoxy-D-xylulose-5-phosphate synthase [Clostridium thermocellum ATCC 27405] >gi|196252471|ref|ZP_03151128.1| deoxyxylulose-5-phosphate synthase [Clostridium thermocellum DSM 4150] >gi|125713571|gb|ABN52063.1| 1-Deoxy-D-xylulose-5-phosphate synthase [Clostridium thermocellum ATCC 27405] >gi|196198080|gb|EDX92920.1| deoxyxylulose-5-phosphate synthase [Clostridium thermocellum DSM 4150] (627 aa)
Score = 790, Expect = 6.2e-82, Identities = 184/466 (39%), Positives = 272/466 (58%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKSK--SVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNF----FESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSL---KLSDPNLNSNN-QTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTK 473
           +D I   +D KK+ L +L  LA  +R  +I+       HL+SNLG+VEL++AL  VF++P+D I +D GHQCYVHK+IT R D+  TIR+  GLSGF +  ES +D  +TGHS   +S   G  +  + + +  SV+ VIGD A++ G+AFEALN+   +   +++++NDN MSISKNVG L   +SK +     F  ++ +  IL K     K   S  K+  ++    K        FE LGF Y G IDG+N+ +  NVL R KN    GP ++HV T KG GY  AE  +  ++H +   ++    + +N    Y  V  + + ++ E +  +  +  AM   +  +  SK+FP  + DVGIAE+HAVT  AG+A       +++YS+FLQR+YD ++HDVA   L + F +DR  +   DG+TH GIYDI FL+ IPN  I    +  EL +++  A    S P  IRY +
  S:     1 MDSINFPDDIKKLNLEQLKQLAGEIRSFLIEKVSKTGGHLASNLGVVELTLALHRVFNTPEDKIIWDVGHQCYVHKIITGRKDRFDTIRKLGGLSGFPKSAESEYDAFNTGHSSTSISAALGIAKARDLRKEKYSVVAVIGDGALTGGMAFEALNDAGRSPNNLIVVLNDNEMSISKNVGGLSVYLSKIRTEPFYFKVKEDIDIILNKIPAIGK---SAVKALGRVKGTIKYMIMPGIVFEELGFKYLGPIDGHNIAELENVLTRAKNTK--GPVLVHVCTQKGRGYTYAE-KNPAVFHGISPFEVETGEVIANKVPGYSDVFGSEIVRIAEKEERVVALTAAMPHGTGLIKFSKRFPERFFDVGIAEQHAVTFGAGLAKNGMIPVIALYSSFLQRAYDQVVHDVALQNLHVVFAIDRAGIVGEDGETHQGIYDISFLRHIPNMTILAPCDYNELAKMLEYAVLEHSGPIAIRYPR 470
>gi|194559372|ref|YP_002094397.1| Deoxyxylulose-5-phosphate synthase [Burkholderia cenocepacia PC184] >gi|124874888|gb|EAY64878.1| Deoxyxylulose-5-phosphate synthase [Burkholderia cenocepacia PC184] (639 aa)
Score = 790, Expect = 7.0e-82, Identities = 175/458 (38%), Positives = 262/458 (57%)
  Q:    16 DFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIE--KNNSKSKSVIPVIGDAAISNGLAFEALNNIA-YNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLN------SNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTK 473
           D +K+   +L DLA  LR  ++        HL+SNLG VEL++AL YVFD+P+D I +D GHQ Y HK++T R + + T+R+  G+SGF   +ES +D   T HS   +S   G     + N +++  + VIGD A+S G+AFEA+NN+A  N   +L+++NDN MSIS  VGAL    +K   ++  FL  +        +     +  + ++  +++         FE  GF+Y G IDG++L   I  L+ ++ +   GP +LHV T KG GY  AE  D  LYH     DP++           TY  V  N+L    E D  +  I PAM   S  ++  ++FP+ Y DVGIAE+HA+T A G+A    K  V+IYSTFLQR YD L+HD+A   LP+TF +DR  +  +DG TH G +DI FL+ IP+ ++   +++ E  +++  A  +   P  +RY +
  S:    12 DLRKLARTQLPDLATQLRDFVLHGVAATGGHLASNLGSVELAIALHYVFDTPRDRIVWDVGHQSYPHKILTGRREAMKTLRQGGGISGFPRRSESPYDAFGTAHSSTSISAVLGMAHAARINGEARHCVAVIGDGALSAGIAFEAMNNLAGCNDLRLLVVLNDNDMSISPTVGALRDCFAKLTANR--FLNRRKADAKSVLQAMPAPLAGAAHRLKAQVKGVLLPATLFEEFGFNYVGPIDGHDLDALIPALETMRTLK--GPQLLHVITRKGRGYALAE-KDPVLYHGPGKFDPDVGIVPPSPPGKPTYTQVFGNWLCDEAERDRRVVAITPAMREGSGLVDFERRFPDRYFDVGIAEQHAITFAGGLAADGLKPVVAIYSTFLQRGYDQLIHDIAIQRLPVTFAIDRAGIVGADGATHMGAFDIAFLRCIPDLVLMAPADENECRQMLHTAL-DHDGPAAVRYPR 472
>gi|126665231|ref|ZP_01736214.1| 1-deoxy-D-xylulose-5-phosphate synthase [Marinobacter sp. ELB17] >gi|126630601|gb|EBA01216.1| 1-deoxy-D-xylulose-5-phosphate synthase [Marinobacter sp. ELB17] (656 aa)
Score = 790, Expect = 7.6e-82, Identities = 181/480 (37%), Positives = 272/480 (56%)
  Q:     2 KKNKVKIDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSK--SKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGK----NFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDP----NLNSNNQT----------YGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEV 481
           + N   +D+I +  D +++   +L  LA  LR  ++        H  + LG++EL++AL YVF++P+D + +D GHQ Y HK++T R +++ +IR  NGL+GF +  ES +D    GHS   +S   G    +N +  ++  I VIGD A++ G+AFEALN+  + K  ML+I+NDN MSIS+NVG L    +K   S++        +K+L       +I   + +   K  + FKG       FE LGF+Y G IDG++L   +  L+ I+ +   GP  LH+ T KG G+  AE D  G YH++   +P     + S N T          Y +V   +L      D  +  I PAM   S+ L  +++FP  Y DV IAE+HAVT AAGMA    K  V+IYSTFLQR YD L+HDVA   L + F +DR  L   DG TH G +DI +L+ IPN ++   S++ E  +L+     ++  P  +RY +     +E+
  S:    14 RPNTPMLDRIGSPADMRQLPADQLTQLARELRSFLLWSVGTTGGHFGAGLGVLELTVALHYVFNTPEDRLVWDVGHQAYPHKILTGRREQMGSIRRKNGLAGFPKRTESPYDTFGVGHSSTSISAALGMAIASNQQGLTRKSIAVIGDGAMTAGMAFEALNHAGHLKADMLVILNDNDMSISRNVGGLSNYFAKLLSSRTYHQMRDSSKKVL-------EIAPGLRELAKKTEEHFKGMIAPGTLFEELGFNYIGPIDGHDLPLLVETLENIRELS--GPQFLHIVTTKGKGFAPAEADPIG-YHAINKIEPMAATTVASGNPTPVKSGPAALKYANVFGQWLCDAAAADERVMGITPAMCEGSDLLAFAERFPARYFDVAIAEQHAVTLAAGMACDGAKPVVAIYSTFLQRGYDQLIHDVAIQNLDVLFAIDRAGLVGEDGPTHAGAFDISYLRCIPNMVLMTPSDENETRQLLHTGLVHEG-PAAVRYPRGSGSGVEI 502
>gi|110802844|ref|YP_699102.1| 1-deoxy-D-xylulose-5-phosphate synthase [Clostridium perfringens SM101] >gi|118595505|sp|Q0SS05|DXS_CLOPS 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|110683345|gb|ABG86715.1| 1-deoxy-D-xylulose-5-phosphate synthase [Clostridium perfringens SM101] (619 aa)
Score = 789, Expect = 7.9e-82, Identities = 208/563 (36%), Positives = 306/563 (54%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNS----NNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSN-PFFIRYTKEKCEDIEVK--KEFSFGSWVYALQTKESKTCIISYGDIINDLK------KEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANE 570
           + KI + ++ K +   EL  LA  LR+ +I+   N   H +SNLG+++L++AL   FD  ++ I +D GHQ Y +K++T R DK +T+R+  GL GF +  ES +DF +TGHS   LS   G    +K   K   VI VIGD A++ G+A EALN+I Y K  ++II+NDN MSI KNVG L   ++K +M       +  +   L      K++  S+ K    + K      +FE +G  YFG++DG+N+++   VL   K+I   GP I+H  T KG GY+ AE  +   YH +   D          N+ Y S     + KL + D+ +  I  AM   +   +  ++FP+ + DVGIAE+HAVT AAGMA    K F ++YSTFLQR+YD +LHDV    LP+T  +DR  L   DG+TH GI+DI FL  +PN  I       E+E  +IL + +  N P  IRY +    D+ +K   +  +G W   +Q  E K  I++ G ++          KE K   I +INA FI    KE +  +      I  +E        G+ ++   NE
  S:     5 LQKITDPKEIKDLDEKELEMLAKELREFLIESVSNTGGHFASNLGVIDLTVALFKNFDFSENRIIWDVGHQSYAYKILTGRKDKFNTLRQYGGLCGFPKRTESEYDFFATGHSSTSLSSAAGMARAQKILGKDNKVIAVIGDGALTGGMALEALNDIGYRKDNLIIILNDNQMSICKNVGGLATYLNKLRMGVGYNKLKSDIGSTLDTTSLGKRVKNSLSKLKDGIKKIVVPSMYFEDIGLKYFGIVDGHNIRELNEVLSIAKSIK--GPVIIHTVTKKGKGYELAE-KNPNKYHGVSPFDLGEGVISKFANRNYSSTFGEEMIKLAKNDDKVVAITAAMPDGTGLKDFREEFPDRFFDVGIAEQHAVTLAAGMAAEGLKPFFAVYSTFLQRAYDQVLHDVCIQNLPVTLCLDRAGLVGEDGETHQGIFDISFLSPMPNMTIVAPKCIDEME--VILKWASNFNAPLAIRYPRGGDIDVNLKPLSKIEYGKW-EKVQEGE-KIAIVATGKMVQHAMIAAQKIKEEKNIDILIINATFIKPIDKELLNSLSKDGFKIVTIEDNIKKGGFGEGVLEYLNE 575
>gi|188534652|ref|YP_001908449.1| 1-deoxy-D-xylulose 5-phosphate synthase [Erwinia tasmaniensis] >gi|188029694|emb|CAO97573.1| 1-deoxy-D-xylulose 5-phosphate synthase [Erwinia tasmaniensis] (621 aa)
Score = 789, Expect = 8.1e-82, Identities = 185/579 (31%), Positives = 317/579 (54%)
  Q:    32 LRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPN---LNSNNQ---TYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCED--IEVKKEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEI 610
           LR+ ++D     S H +S LG+VEL++AL YV+++P D + +D GHQ Y HK++T R D+I TIR+ NGL  F   +ES +D ++ GHS   +S   G        ++ +    VIGD AI+ G+AFEA+N+    K  +L+++NDN MSIS+NVGAL+  +++    K+     +  +K+L      K++   + ++   L         FE LGF+Y G +DG+++   ++ L+ ++ +   GP  LHV T KG GY  AE D    +H++   DP    L  + +   +Y  +   +L +    D+ +  + PAM   S  ++ S+ +P  Y DV IAE+HAVT AAG+AI   K  V+IYSTFLQR+YD L+HDVA  +LP+ F +DR  +  +DG TH G +DI FL+ IP+ +I   S++ E  +++   Y ++  P  +RY +       +E       G  V  ++ +  K  I+++G ++    +  +  +  L++  F+    +  VL + + ++++  +E+       G  +  L    + +  +  I + +  I  G +++I     +D + I  +I
  S:    35 LRQYLLDSVSRSSGHFASGLGVVELTVALHYVYNTPFDHLIWDVGHQAYPHKILTGRRDRIGTIRQKNGLHPFPWRDESEYDVLNVGHSSTSISAGLGMAVAAGKEAQGRRTACVIGDGAITAGMAFEAMNHAGDCKADLLVVLNDNEMSISENVGALNNRLAQILSGKTYSRLRESGKKVLDGLPPIKEL---VKRTEEHLKGMVVPGTLFEELGFNYIGPVDGHDVLALVHTLRNMRALK--GPQFLHVMTKKGKGYAPAEKDPIS-WHAVPKFDPASGLLPKSAEGLPSYSKIFGQWLSETAAADDRLMAVTPAMREGSGMVSFSRDYPQQYFDVAIAEQHAVTFAAGLAIGGYKPVVAIYSTFLQRAYDQLIHDVAIQKLPVLFAIDRGGIVGADGQTHQGAFDIAFLRCIPDMVIMTPSDENECRQMLYTGYHHQGGPSAVRYPRGNGTGAPLEALASLPLGKGV--VKRRGEKMAILNFGTLLPQAAEVAEAINATLVDMRFVKPLDEALVLELAAQHQSLITLEEGSIKGGAGSGVNELLMAKRRAIPVLNIGLPDEFIPPGTQDEIRSDYQLDADGIQRQI 615
>gi|187478667|ref|YP_786691.1| 1-deoxy-D-xylulose-5-phosphate synthase [Bordetella avium 197N] >gi|118595495|sp|Q2KZ15|DXS_BORA1 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|115423253|emb|CAJ49786.1| 1-deoxy-D-xylulose-5-phosphate synthase [Bordetella avium 197N] (620 aa)
Score = 789, Expect = 8.4e-82, Identities = 185/466 (39%), Positives = 266/466 (57%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAY-NKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSK-FFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNL------NSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTK 473
           +D+I +  D +K+   +L  +A  LR  +++       HLSSNLG VEL++AL YVFD+P D I +D GHQ Y HK++T R D+++T+R+  G+SGF + +ES +D   T HS   +S   G     +N   ++  I VIGD A+S G+AFEA+NN    +   +L+I+NDN MSIS  VGAL++ +++  MS   +   K + K + +          + + F + +K        FE  GF+Y G IDG++L   I  L+ +K +   G   LHV T KG GYK AE+D   LYH     DP +          +T+  V   +L    E D  +  I PAM   S  +   ++FP  Y DVGIAE+HAVT AAG+A   +K  V+IYSTFLQR YD ++HDVA   L +TF +DR  L  +DG TH G YDI FL+ +PN +I   S++ E   L+   Y     P  +RY +
  S:     6 LDRIHSPADLRKLDRRDLKPIADELRAFVLESVSKTGGHLSSNLGTVELTLALHYVFDTPHDRIVWDVGHQTYPHKILTGRRDRMATLRQEGGISGFPKRSESEYDDFGTAHSSTSISAALGMAVASRNAGVARQHIAVIGDGAMSAGMAFEAMNNAGVTSDINLLVILNDNDMSISPPVGALNRYLARL-MSGRFYAAAKNMGKAVLQH---VPPVLELARRFEEHAKGMITSATMFEEFGFNYVGPIDGHDLDALIPTLQNLKTLQ--GLQFLHVVTRKGRGYKLAEVDPV-LYHGPGKFDPAVGIQAAKTPAKRTFTQVFGAWLCDQAEADPRLVGITPAMREGSGLVEFEQRFPKRYFDVGIAEQHAVTFAAGLACEGQKPVVAIYSTFLQRGYDQVVHDVALQNLDVTFALDRAGLVGADGATHAGNYDIAFLRCVPNMVIATPSDENETRLLLSTCYA-YPGPASVRYPR 473
>gi|27363790|ref|NP_759318.1| 1-deoxy-D-xylulose-5-phosphate synthase [Vibrio vulnificus CMCP6] >gi|30315821|sp|Q8DFA3|DXS_VIBVU 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|27359907|gb|AAO08845.1|AE016798_5 Deoxyxylulose-5-phosphate synthase [Vibrio vulnificus CMCP6] (621 aa)
Score = 789, Expect = 8.5e-82, Identities = 193/580 (33%), Positives = 323/580 (55%)
  Q:    32 LRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGF--IEKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLT-----EKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNS------NNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFS---FGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYV-VEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIK 611
           LR  +++     S HL+S LG VEL++AL YV+++P D + +D GHQ Y HK++T R +++ TIR+  GL  F    ES +D +S GHS   +S   G     +   +++ V+ VIGD AI+ G+AFEA+N+     + ML+I+NDN MSIS+NVGAL+  +++  +S +++ +     +K+L  +   KE        + ++   L         FE LGF+Y G IDG+++ + +  LK ++ +   GP  LH+ T KG GY+ AE D  G YH +   DP  NS         ++ ++  +FL  +   D  +  I PAM   S  +  SK++P  Y DV IAE+HAVT A GMAI      V+IYSTFLQR YD L+HDVA + LP+ F +DR  L  +DG TH G +D+ +++ IPN +I   S++ E  +++   ++++  P  +RY +       ++ EF+    G      Q +  K  I+S+G  + +  +  +  +  + +  F+     E +LR L+   ++ + +E+   +   G  +I    + K+   +  + + +  I  G +E++ ++L +D   I   I+
  S:    35 LRTYLLNSVSQSSGHLASGLGTVELTVALHYVYNTPFDQLIWDVGHQAYPHKILTGRREQMPTIRQKGGLHPFPWREESEYDTLSVGHSSTSISAALGMAICAEKEGQNRKVVSVIGDGAITAGMAFEAMNHAGDVHSDMLVILNDNEMSISENVGALNNHLARV-LSGNLYTSIREGGKKVLSGVPPIKEL-------VRRTEEHLKGMVVPGTLFEELGFNYIGPIDGHDVVELVKTLKNMRELK--GPQFLHIMTKKGKGYEPAEKDPIG-YHGVPKFDPAHNSLPKSSGGKPSFSNIFGDFLCDMAAQDPKLMAITPAMREGSGMVRFSKEYPEQYFDVAIAEQHAVTLATGMAIGGYNPIVAIYSTFLQRGYDQLIHDVAIMNLPVMFAIDRAGLVGADGQTHQGAFDLSYMRCIPNMVIMAPSDENECRQMLYTGHKHQG-PSAVRYPRGNGMGTPIESEFTALEIGKGRLVRQGE--KVAILSFGTFLANALEAAEALNATVADMRFVKPLD-EALLRQLANEHDVLITIEENAIAGGAGAGVIEFMMQEKIMKPVLNLGLPDKFIHQGTQEELHEELGLDAKGIEQAIR 616
>gi|121308567|dbj|BAF43667.1| 1-deoxyxylulose-5-phosphate synthase [Photobacterium phosphoreum] (621 aa)
Score = 789, Expect = 9.3e-82, Identities = 189/579 (32%), Positives = 309/579 (53%)
  Q:    32 LRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSD------PNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTK-----EKCEDIEVKKEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEI 610
           LR  ++      S H +S LG VEL++AL YV+++P D + +D GHQ Y HK++T R D++STIR+  GL  F    ES +D +S GHS   +S   G     +  +  + V+ VIGD AI+ G+AFEA+N+     + ML+I+NDN MSIS+NVG L   ++            +  +K+L      K+I   + ++   +         FE LGF+Y G IDG+++ + +  LK ++++   GP  LH+ T KG GY  AE D    YH++   D      P   + + T+  +  ++L  +   D+ +  I PAM   S  +  SK++P+ Y DV IAE+HAVT A+GMAI      V+IYSTFLQR YD L+HDVA + LP+ F +DR  L  +DG TH G +DI F++ IPN +I   S++ E  +++   +Q++  P  +RY +      + ED     E   G     ++ +  K  I+++G ++       +  +  + +  F+    +  +L + + +  +  VE+   +   G  +I    + K    +  I + +  I  G + ++ + L ID   I  +I
  S:    35 LRTYLLKTVSQTSGHFASGLGTVELTVALHYVYNTPFDHVIWDVGHQAYPHKILTGRRDQMSTIRQKGGLHPFPWRGESEYDVLSVGHSSTSISAGLGMAIAAEKEALGRKVVSVIGDGAITAGMAFEAMNHAGDIHSDMLVILNDNEMSISENVGGLSNHLAHLLAGNFYASIREGGKKVLSNAPPIKEI---VKRAEEHIKGMVVPSTMFEELGFNYIGPIDGHDIDELVKTLKNMRHLK--GPQFLHIMTKKGKGYAPAEADPIN-YHAVPKFDLSEKPLPKAKNTSPTFSKIFGDWLCDMAAVDDKLMAITPAMREGSGMVRFSKEYPDQYFDVAIAEQHAVTLASGMAIGGYHPIVAIYSTFLQRGYDQLIHDVAIMNLPVMFAIDRAGLVGADGQTHQGAFDISFMRCIPNMVIMAPSDENECRQMLYTGHQHQG-PTAVRYPRGCGLGTEVEDTMTALEIGKG----IVRRQGEKVAILNFGAMLGYSLDAAENLNATVADMRFVKPLDEALILELAANHDVLVTVEENAIAGGAGSGVIEFLMQQKCIKPVLTIGLPDRFIEQGTQAELHQMLEIDGPGIEKQI 615
>gi|85058634|ref|YP_454336.1| 1-deoxy-D-xylulose-5-phosphate synthase [Sodalis glossinidius str. 'morsitans'] >gi|118595620|sp|Q2NV94|DXS_SODGM 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|84779154|dbj|BAE73931.1| 1-deoxy-D-xylulose-5-phosphate synthase [Sodalis glossinidius str. 'morsitans'] (620 aa)
Score = 789, Expect = 9.6e-82, Identities = 191/599 (31%), Positives = 327/599 (54%)
  Q:    13 NYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLT-----EKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNSNNQ------TYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVK--KEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIK 611
           N  + +++    L+ L   LR+ ++D     S H +S LG VEL++AL YV+++P D + +D GHQ Y HK++T R D+I+TIR+ NGL  F    ES +D +S GHS   +S   G     ++    +  + VIGD AI+ G+AFEA+N+    K+ +L+++NDN MSIS+NVGAL+  +++  +S  ++ T     +K+L  I   KE  K+       +   +         FE LGF+Y G +DG++++  +  LK ++     GP +LH+ T KG GY  AE D    +H++   DP++ +  +      TY ++  ++L      D+ +  I PAM   S  +  S+++P  Y DV IAE+HAVT AAG+AI      V+IYSTFLQR+YD ++HDVA   LP+ F +DR  +  +DG TH G +D+ +L+ IPN +I   S++ E   ++   Y  ++ P  +RY +       +    E   G  V  +  + +   I+++G ++   +   +  +  L++  F+       +  + ++++ +  VE+       G  +     + +L   +  I + ++ I  G++E+I   L +D   I  +IK
  S:    16 NPMELRQLPKESLVALCDELRQFLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDRLIWDVGHQAYPHKILTGRRDRIATIRQRNGLHPFPWRGESEYDQLSVGHSSTSISAGLGMAVAAEHEGLGRRTVCVIGDGAITAGMAFEAMNHAGDIKSDLLVVLNDNEMSISENVGALNNHLAQI-LSGKLYSTLREGGKKVLSGIPPIKELVKR-------TEEHIKGMVVPGTLFEELGFNYIGPVDGHDVQGLVQTLKNMR--AKKGPQLLHIMTKKGRGYAPAEKDPIS-WHAVPKFDPHMGTLPKSGDGCPTYSAIFGDWLCATAADDDKLMAITPAMREGSGMVAFSRQYPRQYFDVAIAEQHAVTFAAGLAIGGYHPVVAIYSTFLQRAYDQVIHDVAIQNLPVLFAIDRGGVVGADGQTHQGAFDLSYLRCIPNMVIMTPSDENECRLMLHTGYHYQAGPSTVRYPRGNSTGAPLTDLHELPLGKGV--VHRQGAGVAILNFGTLLPQAEHAAQAINATLVDMRFVKPLDDTLISELAASHQALVTVEENAIMGGAGSGVNEYVMQQRLQVPVLNIGLPDHFIPQGSQEEIRADLGLDGAGIQRQIK 616
>gi|114331489|ref|YP_747711.1| 1-deoxy-D-xylulose-5-phosphate synthase [Nitrosomonas eutropha C91] >gi|122313705|sp|Q0AFY6|DXS_NITEC 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|114308503|gb|ABI59746.1| 1-Deoxy-D-xylulose-5-phosphate synthase [Nitrosomonas eutropha C91] (614 aa)
Score = 788, Expect = 1.2e-81, Identities = 193/604 (31%), Positives = 319/604 (52%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLT-----EKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLN-----SNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYA-LQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIK 611
           +D+I      + +K  +L  LA  LR  +I+       HLSSNLG +EL++AL Y+FD+P D + +D GHQ Y HK++T R   ++ +R   G++GF   +ES +D   T HS   +S   G     + N   +  I +IGD A+S G+AFEALNN       +L+I+NDN MSIS  VGAL+  ++K  MS   + T     E++L  +    E +K+       +   +         FE  GF+Y G IDG++L   +  L  IK +   GP  LH+ T KG GYK AE +D  LYH +   +P        S    Y  +  ++L  +   D+ +  I PAM   S  +  SK++P+ Y DVGIAE+HAVT AAG A    K  V+IYSTFLQR+YD L+HDVA   LP+ F +DR  L  +DG TH G +D+ +L+ IPN  +   +++ E  +++  A+Q  + P  +RY +     +++K+E          ++ + ++  ++++G +++   +        ++N  F+    +E V+ + + ++ +  VE+       G  ++       ++  + ++ + +N +  G+   +     +D   I   +K
  S:     5 LDRIEIPAQLRNLKRSQLPQLADELRSFLIESVAKTGGHLSSNLGTIELTIALHYIFDTPFDRLVWDVGHQTYAHKILTGRRTGMAHLRMQGGIAGFPRRDESEYDAFGTAHSSTSISAALGMAVAARINKIKQHAIAIIGDGAMSAGMAFEALNNAGVMDADLLVILNDNDMSISPPVGALNHYLAKL-MSGRFYATARRAGERMLGVVPPVLELAKR-------AEEHVKGMVTPGTLFEEFGFNYIGPIDGHDLDILLTTLNNIKQLD--GPQFLHIVTRKGKGYKPAE-EDPVLYHGVGKFEPGKGVIPKPSTRPAYTQIFGDWLCDMAAKDSRLIGITPAMREGSGLIRFSKEYPDRYFDVGIAEQHAVTFAAGAACEGLKPVVAIYSTFLQRAYDQLIHDVAIQNLPVVFAIDRAGLVGADGPTHAGSFDLSYLRCIPNITVMMPADENECRQMLYTAFQLDT-PTAVRYPRGTGPGVQIKQEMQIVPLGKGEIRRQGTRIALLAFGSMLSPCLEAGDELDATVVNMRFVKPLDQELVMTLAAEHELLVTVEENTIMGGAGSAVLECLASQGVNIRLLQLGLSDNFLDQGDPAQMLSDCGLDKTGIIKSVK 609
>gi|148554381|ref|YP_001261963.1| 1-deoxy-D-xylulose-5-phosphate synthase [Sphingomonas wittichii RW1] >gi|166201541|sp|A5V6A9|DXS_SPHWW 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|148499571|gb|ABQ67825.1| 1-Deoxy-D-xylulose-5-phosphate synthase [Sphingomonas wittichii RW1] (639 aa)
Score = 788, Expect = 1.2e-81, Identities = 182/466 (39%), Positives = 272/466 (58%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNN--SKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFF-----KGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELD-DKGLYHSLKLSD------PNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTK 473
           +D +   ED +++K  +L  LA  LR ++I        HL + LG+VEL++AL YVFD+P+D++ +D GHQ Y HK++T R D+I T+R+  GLSGF + +ES +D     HS   +S   GF   N   +K    I VIGD A+S G+A+EA+NN       +++I+NDN MSI+  VGAL   ++K   S+  FL+ +      F K  ++K+   I+  F+K S+ +      G   FE LGF+Y G +DG+NL   + +L+ +++    GP ++HV T KG GY  AE   DK  YH ++  D              +Y  V A+ L    + D+ I  I  AM   +      K FP    DVGIAE+HAVT AAG+A    + F +IYSTFLQR+YD ++HDVA   LP+ F +DR  L  +DG TH G +DI +L ++PN ++  A+++ EL  ++  A  + S P  +RY +
  S:    10 LDTVSTPEDLRRLKPADLRQLADELRAEMISAVSVTGGHLGAGLGVVELTVALHYVFDTPRDVLIWDVGHQAYPHKILTGRRDRIRTLRQGGGLSGFTKRSESEYDPFGAAHSSTSISAALGFAVANKLANKEGRAIAVIGDGAMSAGMAYEAMNNAKQAGNRLIVILNDNDMSIAPPVGALSAYLAKIVSSRP-FLSMR-----GFAKRVAQKLPRPIH-DFAKRSEEYARGMATGGTLFEELGFYYVGPVDGHNLDHLLPILENVRD-GDHGPILIHVVTNKGKGYAPAEAAADK--YHGVQKFDVVSGVQAKAPPGPPSYTGVFADALVAEAKRDDRICAITAAMPSGTGLDKFGKAFPERSFDVGIAEQHAVTFAAGLAAQGYRPFCAIYSTFLQRAYDQVVHDVAIQNLPVRFAIDRAGLVGADGSTHAGSFDITYLATLPNMVVMAAADEAELVHMVHTAAVHDSGPIALRYPR 479
>gi|194337242|ref|YP_002019036.1| deoxyxylulose-5-phosphate synthase [Pelodictyon phaeoclathratiforme BU-1] >gi|194309719|gb|ACF44419.1| deoxyxylulose-5-phosphate synthase [Pelodictyon phaeoclathratiforme BU-1] (659 aa)
Score = 788, Expect = 1.3e-81, Identities = 200/604 (33%), Positives = 326/604 (53%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNN--SKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKIL--FKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHS------------LKLSDPNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYALQTKE-SKTCIISYG-------DIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIK 611
           +  I + +D KK+ + EL  LA   RK++I I      H +S+LG+VEL++AL +V+ +P D I +D GHQ YVHK++T+R +++ T R+  GL+GF + +ES HD    GH+   +S   G    ++     + VI VIGD +++ G+AFEA+N++   K+ +L+I+NDN M+IS N GAL   +    ++K+     K++ K L         K   ++ K    +        FFE+LG  YFG IDG+N+++ +  LK ++ +    P +LHV T KG G+K AE +++  +H+            LK +D +L      Y  V    L +L   D+ I  I  AM   ++        PN + DVGIAE HAVT AAG+A    K   ++YSTFLQR+YD L+HDVA   L + F +DR  L   DG THHG +D+ +L ++P  +I   +++ EL  ++  A      P  IRY +     I + K+F+      A+  +E S   ++  G       ++   L+KE    ++  +N  F+     E +  + S   +  V+E+      LG  +I   N   L+  + KI + +  +  GN   + K++  D  ++  +I+
  S:    32 LSAIRSTDDLKKLTIAELQTLADECRKEVIKIVSLNGGHFASSLGVVELTVALHHVYSTPHDKIIWDVGHQAYVHKILTERRERMQTNRQFGGLAGFPKRSESAHDAFGVGHASTSISAAAGIAVASDLAGGDEKVIAVIGDGSMTGGMAFEAMNHLGDLKSDVLVILNDNQMAISSNTGALRHHLVNISLNKTYNRARKLVWKSLSLLNNGLGDKAKKAVRKIEDGVKAALTPGAFFEALGLRYFGPIDGHNMEQLVKALKEMQTLP--NPKLLHVITTKGKGFKPAE-ENQSKWHAHNGGFDTTTGKLLKTADTSLPPK---YQEVFGEALVELALKDSTITAITAAMPSGTSLDLFQNAIPNRFYDVGIAEAHAVTFAAGLATQGFKPVFAVYSTFLQRAYDQLIHDVALQNLHVVFAIDRAGLVGEDGPTHHGAFDLSWLHAVPGLVIMAPADEQELRDMLYTALYEVKGPVAIRYPRGNGTGITLHKKFTSLPIGKAVMAREGSGLALLCMGTMTGKALEVATILEKEEINATV--VNMRFLKPLDTEVIEELASRSTHFVVLEENSAIGGLGSAVIDHINSKGLNRPVLKIALPDAFVTHGNMNALYKEIGFDTPTMTEKIR 651
>gi|24373099|ref|NP_717142.1| 1-deoxy-D-xylulose-5-phosphate synthase [Shewanella oneidensis MR-1] >gi|30315824|sp|Q8EGR9|DXS_SHEON 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|24347285|gb|AAN54586.1|AE015598_5 deoxyxylulose-5-phosphate synthase [Shewanella oneidensis MR-1] (622 aa)
Score = 787, Expect = 1.4e-81, Identities = 196/601 (32%), Positives = 320/601 (53%)
  Q:    12 PNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI---EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLT-----EKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNL------NSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEK---CEDIEVKKEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           PN  + +++    L  LA  LR+ ++      S H +S LG VEL++AL YV+++P D + +D GHQ Y HK++T R D++ TIR+ NGL  F    ES +D  S GHSG  +S         EK  +  K V+ VIGD A++ G+ FEA+N+       ML+++NDN MSIS+NVGAL+  +++  MS   + T     +K+L+ +   KE +K+       +   L         FE LGF+Y G IDG+++   +  L+ ++N+   GP +LH+ T KG GY+ AE D  G +H++   DP+L           T+  V   +L  + E D  +  I PAM   S  +  S++FP  Y D  IAE+HAVT  AG A    K  V+IYSTFLQR YD L+HDVA   LP+ F +DR  +  +DG TH G +D+ F++ IPN +I   S++ E  +++   Y   + P  +RY +        +E       G  V  ++    +  ++++G  +       ++    +++  F+     + V  +  T+  +  VE+       G  ++ L  + K+   + +I + +  I  G+ +++   L +D   + A+I +
  S:    17 PN--ELRQLPQALLPQLADELREFLLKSVGMSSGHFASGLGTVELTVALHYVYNTPFDRLIWDVGHQAYPHKILTGRRDRMHTIRQKNGLHPFPWREESEYDTFSVGHSGTSISAALAMAVAAEKEQAGRK-VVAVIGDGAMTGGMVFEAMNHAGDLHNDMLMVLNDNEMSISENVGALNNHLAQL-MSGRFYTTIRESSKKVLKGMPVIKEMAKR-------TEEHLKGMVVPGTLFEELGFNYIGPIDGHDVDALVETLRNMRNLK--GPQVLHIMTKKGRGYEPAEKDPIG-WHAVPKFDPSLFKKPATKPGLPTFSQVFGKWLCDIAEQDEKVLGITPAMREGSGMVEFSQRFPKQYFDAAIAEQHAVTLGAGFACEGYKPVVAIYSTFLQRGYDQLIHDVALQRLPVLFAIDRGGIVGADGPTHQGAFDLSFMRCIPNMVIMAPSDENECRQMLYTGYCYDAGPSAVRYPRGSATGATQVEAMTALPIGKGV--IKRLGKRIALLNFGTTLAAALTAAESLDATVVDMRFVKPLDVDLVKEMAQTHDVLVTVEENAIMGGAGSGVLELLQQLKMPKPVLQIGLPDEFIKHGSPDEVIHDLQLDAEGMLAQINA 618
>gi|163763735|ref|ZP_02170795.1| exodeoxyribonuclease VII, small subunit [Bacillus selenitireducens MLS10] >gi|160355560|gb|EDP82213.1| exodeoxyribonuclease VII, small subunit [Bacillus selenitireducens MLS10] (480 aa)
Score = 787, Expect = 1.4e-81, Identities = 177/455 (38%), Positives = 259/455 (56%)
  Q:    17 FKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKSKS--VIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMS------KFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNL---KKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSL---KLSDPNL--NSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRY 471
            K+    EL  LA  +R  +I        HL  NLG+VEL++ L  +FDSP+D   +D GHQ YVHK++T RA +   +R+  GL GF + +ES HD   TGHS   LS   G     + K ++  V+P+IGD A++ G+A EALN+I + +T + +++NDN MSI+ NVGALH ++       K+Q +K     E ++RKI     +  ++  +  +    L        FFE +GF Y G +DG++L   KK     K+ K     GP ++HV T KG GY  AE D KG +H L   K+    +       +Y  V A+ L+K+   DN +  I  AM   +     ++ FP    DVGIAE+HA T +AG+A    K   ++YSTFLQR YD L+HDV R  L + F +DR  L  +DG+TH G++DI +L+ +PN  I    ++ EL+ ++  A QN   P  +RY
  S:    12 LKECSDEELESLAQDIRDFLISHLSVTGGHLGPNLGVVELTLVLHQLFDSPKDKFLFDVGHQAYVHKILTGRAGQFEQLRQYEGLCGFPKRSESEHDVWETGHSSTSLSGAMGMALARDLKGENSHVVPIIGDGALTGGMALEALNHIGHEQTDVTVVLNDNEMSIAPNVGALHSMLGRMRTAGKYQRAKEDL--EMLIRKI---PAFGGRLAATAERVKDSLKYLLVSGMFFEEMGFTYLGPVDGHDLEDLKKNFLYAKKTK-----GPVLVHVITKKGKGYGPAENDAKGTWHGLGPYKIESGEVVKKPGPPSYSGVFASTLKKIAANDNRVVAITAAMPGGTGLDKFAQDFPERTFDVGIAEQHATTMSAGLATQGMKPVFAVYSTFLQRGYDQLVHDVCRQNLNVVFAIDRAGLVGADGETHQGVFDISYLRHLPNMKIIQPKDENELQHMLYTAVQNDDGPMAVRY 472
>gi|15606220|ref|NP_213598.1| 1-deoxy-D-xylulose-5-phosphate synthase [Aquifex aeolicus VF5] >gi|8134411|sp|O67036|DXS_AQUAE 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|2983421|gb|AAC07004.1| hypothetical protein aq_881 [Aquifex aeolicus VF5] (628 aa)
Score = 787, Expect = 1.4e-81, Identities = 187/489 (38%), Positives = 280/489 (57%)
  Q:    16 DFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGF-IEKN--NSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTP-MLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKG----KNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSL---KLSDPNL--NSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILA-YQNKSNPFFIRYTKEKCEDIEVK--KEFSFGSWVYALQTKESKTCII 504
           D K      L  LA  +R  II+++     H+  +LG+VEL++ALL VF+ P+D+I +D GHQ Y  K++TDR ++  T+R+  G+SGF    ESI+D    GHS   +S   GF I K+    K   VI VIGD A++ G+A+EALNN  + +    ++I+NDN MSIS NVGA+   +++      V  T + ++  L      +    +  +      +F KG       FE LGF+Y G IDG+++K   + L  +K+I   GP +LHV T KG GYK AE ++   +H +   K+    +   S+  T+ SV    L +L E D  I  I PAM   S  +  +K+FP+ + DVGIAE+HA T AAG+A    +   + YSTFLQR+YD ++HDVA   LP+TF +DR  L   DG THHG++D+ +L+ +PN ++    ++ EL  L+    Y  K  PF +RY +     +  +  K+   G+W   L   E + C+I
  S:    16 DIKNYDYETLQKLAQEVRDYIINVTSKNGGHVGPSLGVVELTIALLRVFNPPEDVIVWDIGHQGYPWKILTDRKEQFPTLRQYKGISGFLRREESIYDAFGAGHSSTSISAALGFRIGKDLKGEKEDYVIAVIGDGALTAGMAYEALNNAGHIRPDRFIVILNDNEMSISPNVGAISTYLNRIISGHFVQETRQKIKNFL------QHFGETPLRIMKLTEEFLKGLISPGVIFEELGFNYIGPIDGHDIKALEDTLNNVKDIK--GPVLLHVYTKKGKGYKPAE-ENPVKWHGVAPYKVESGEIIKKSSPPTWTSVFGKALVELAERDEKIVAITPAMREGSGLVEFAKRFPDRFFDVGIAEQHACTFAAGLAAEGLRPVAAYYSTFLQRAYDQVIHDVALQNLPVTFAIDRAGLVGDDGPTHHGVFDLSYLRCVPNMVVCAPKDEQELRDLLYTGIYSGK--PFALRYPRGAAYGVPTEGFKKIEIGTWEELL---EGEDCVI 506
>gi|119775570|ref|YP_928310.1| 1-deoxy-D-xylulose-5-phosphate synthase [Shewanella amazonensis SB2B] >gi|166201534|sp|A1S8D4|DXS_SHEAM 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|119768070|gb|ABM00641.1| deoxyxylulose-5-phosphate synthase [Shewanella amazonensis SB2B] (622 aa)
Score = 787, Expect = 1.6e-81, Identities = 199/598 (33%), Positives = 320/598 (53%)
  Q:    15 EDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGF--IEKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLT-----EKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPN------LNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEK---CEDIEVKKEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLI-ILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           E+ +++    L  L+  LR+ ++      S H +S LG VEL++AL YV+++P D + +D GHQ Y HK++T R DK+ TIR+ NGL  F    ES +D  S GHS   +S   G     +  +  + V+ VIGD AI+ G+AFEALN+       ML+++NDN MSIS+NVGAL+  ++K  MS  ++ T     +K+L+ +   KE +K+       +   L         FE LGF+Y G IDG+++   +  L  ++++   GP  LH+ T KG GY+ AE D  G +H++   DP             T+  V   +L  +   D  +  I PAM   S  +  S++FP  Y D  IAE+HAVT  AG A    K  V+IYS+FLQR YD L+HDVA   LP+ F +DR  +  +DG TH G +D+ +++ IPN +I   S++ E  ++    Y     P  +RY +      E IE       G  V  ++ +  K  I+++G  +       ++ +  + +  F+    +  +L + +++  +  VE+       G  ++  LA++N+L   + +I I +  I  G  E+I  +L +D   I  +I++
  S:    18 EELRQLPQSALKQLSDELRQFLLTSVGISSGHFASGLGTVELTVALHYVYNTPFDRLIWDVGHQAYPHKILTGRRDKMHTIRQKNGLHPFPWREESQYDTFSVGHSSTSISAALGMAVTAEKEALGRKVVAVIGDGAITGGMAFEALNHAGDLHKDMLVVLNDNEMSISENVGALNNHLAKL-MSGRLYTTIREGGKKVLKGMPVIKEMAKR-------TEEHLKGMVVPGTLFEELGFNYIGPIDGHDVNGLVETLSNMRDLK--GPQFLHIMTKKGKGYEPAEKDPIG-WHAVPKFDPTQFRKPATKPGLPTFSQVFGKWLCDIAAKDEKVLAITPAMREGSGMVEFSQRFPQQYFDAAIAEQHAVTLGAGFACEGYKAVVAIYSSFLQRGYDQLIHDVALQRLPVLFAIDRGGIVGADGATHQGAFDLSYMRCIPNMVIMAPSDENECRQMFYTGYCYNEGPSAVRYPRGSATGAEQIEEMTALPIGKGV--MRRQGQKIAILNFGTTLAAALTAAESLNATVADMRFVKPLDEALLLELAASHDVLVTVEENAIMGGAGSGVLEFLASKNRLK-PLLQIGIPDEFIKHGGPEEILSELGLDAAGIEGQIRA 618
>gi|182702006|ref|ZP_02619231.2| 1-deoxy-D-xylulose-5-phosphate synthase [Clostridium botulinum Bf] >gi|182672378|gb|EDT84339.1| 1-deoxy-D-xylulose-5-phosphate synthase [Clostridium botulinum Bf] (622 aa)
Score = 786, Expect = 1.8e-81, Identities = 211/608 (34%), Positives = 330/608 (54%)
  Q:     3 KNKVKIDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKSKS--VIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFK-KEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELD-DKGLYHSLKLSDPNLNSNNQ----TYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKE---KCEDIEVKKEFSFGSWVYALQTKESKTCIISYGDIIN------DLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEI 610
           K K  +DK  +++  K M ++EL   +  +R+ +ID       HL+SNLG+VEL++++  VFD  +D + +D GHQ YVHK++T R DK +T+R+  GLSGF +  ES +D   TGHS   +S   G     + K ++  VI VIGD A++ G+AFEALN++ +NKT ++II+NDN MSI++NVG +   +SK ++  +    +K +   L K     K +  S+ +  + + +      FFE+LG  Y G IDG+++K+   V+K  K+I   GP ++H  T KG GY  AE   DK  +H +   D      N     TY  V    L K+ + DN +  I  AM   +      + FP  + DVGIAE+HAVT AAG+A    K   ++YSTFLQR+YD +LHD+    LP+ F +DR  +  SDG+TH GI+D+ +L S+PN  I       E++ ++  A  N+++P  IRY +    K  ++   K    G W   +  +E    II+ G ++       +  KE   KS  ++NA FI    KE +   +     I  VE        G  ++   +E K +  +  +  ++  +  G+ + + K   +D   I   I
  S:     2 KMKNILDKYQDFDSIKSMSINELNQFSYDIREFLIDNVSKTGGHLASNLGVVELTLSIFNVFDLNKDKVIWDVGHQAYVHKILTGRKDKFNTLRQYGGLSGFPKKCESPYDVFETGHSSTSISAALGMARARDIKGENNKVIAVIGDGALTGGMAFEALNDLGFNKTDLIIILNDNQMSIAENVGGMSSYLSKVRLDPTYNKLKKEVNNTLNKIPNVGKGMARSLERVKNGIKQMIVPGMFFENLGIKYLGPIDGHDIKELSKVMKMAKDIK--GPVLIHTITKKGKGYAYAEKKPDK--FHGIGPFDCTSGEINSKACLTYSGVFGEELTKIGKEDNRVVAITAAMKDGTGLRKFGETFPKRFFDVGIAEQHAVTLAAGIATEGLKPVFAVYSTFLQRAYDQILHDICIQNLPVVFAIDRAGIVGSDGETHQGIFDLSYLSSLPNMTIMAPKCLREMKPMLKWAL-NENSPVAIRYPRGGDIKSLEMTPIKNIEKGEW--EIICEEGDIAIIATGKMVQHAIIAREKLKEYGIKST-IVNANFIKPIDKELIKNFVKKGYKIVTVEDNVIKGGFGSLVLQYISELKANNTVLNLGFKDKFVPHGSTDILYKIEGLDPEGIVKNI 618
>gi|148270191|ref|YP_001244651.1| 1-deoxy-D-xylulose-5-phosphate synthase [Thermotoga petrophila RKU-1] >gi|166201544|sp|A5ILK2|DXS_THEP1 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|147735735|gb|ABQ47075.1| 1-Deoxy-D-xylulose-5-phosphate synthase [Thermotoga petrophila RKU-1] (608 aa)
Score = 786, Expect = 2.1e-81, Identities = 190/501 (37%), Positives = 278/501 (55%)
  Q:    15 EDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNN--SKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKE----KCEDI-EVKKEFSFGSWVYALQTKESKTCIISYGDIINDLKK 515
           ++ K+M   EL  LA  +RKKI ++      HL+SNLG +EL++AL  VFD  +D I +DTGHQ Y HK++T R +   TIR   GLSGF    ES  D+  TGH+G  ++   GF +      + + V+ VIGD A+++G+A EALN +    + M II+NDNGMSIS NVG L   +SK + S      +K+L+++L K E   ++   +      L    +G NFFESLG  YFG  DG+N++    V KRI++     P+++HV T KG G+  AE +D   YHS   + P+      +Y  +    L ++   D  I  I  AM   +      K+ P+ + D+GI E+  VT  A + +   K  V+IYSTFLQR+YD ++HDVA    P+ F +D+  +   DG THHG++DI +L  +PN  I   S+  E    +    +N   P  IRY KE    + E I E  K+   G W    + KE+   II+ G I+N++ K
  S:     4 DEIKRMSYDELKRLAEDIRKKITEVVLKNGGHLASNLGTIELTLALYRVFDPREDAIIWDTGHQAYTHKILTGRDELFHTIRTFGGLSGFVTRRESPLDWFGTGHAGTSIAAGLGFEKAFELLGEKRHVVVVIGDGALTSGMALEALNQLKNINSKMKIILNDNGMSISPNVGGLAYHLSKLRTSPIYLKGKKVLKEVLEKTEIGFEVEEEMKYLRDSLKGMIQGTNFFESLGLKYFGPFDGHNIELLEKVFKRIRDYDY--PSVIHVVTKKGKGFTAAE-EDPTKYHS---APPSEKPKMLSYSELLGYTLSRIAREDKKIVAITAAMADGTGLSIFQKEHPDRFFDLGITEQTCVTFGAALGLHGMKPVVAIYSTFLQRAYDQIVHDVALQNAPVLFAIDKSGVVGEDGPTHHGLFDINYLLPVPNMKIISPSSPEEFVSSLYTILKNLDGPVAIRYPKESFYGEVESILENMKKIDLG-WKILRRGKEA--AIIATGTILNEVLK 502
>gi|24215984|ref|NP_713465.1| 1-deoxy-D-xylulose-5-phosphate synthase [Leptospira interrogans serovar Lai str. 56601] >gi|45656754|ref|YP_000840.1| 1-deoxy-D-xylulose-5-phosphate synthase [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] >gi|30315826|sp|Q8F153|DXS_LEPIN 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|67460121|sp|Q72U01|DXS_LEPIC 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|24197206|gb|AAN50483.1|AE011489_5 1-deoxyxylulose-5-phosphate synthase [Leptospira interrogans serovar Lai str. 56601] >gi|45599990|gb|AAS69477.1| 1-deoxyxylulose-5-phosphate synthase protein [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] (634 aa)
Score = 785, Expect = 2.4e-81, Identities = 201/612 (32%), Positives = 336/612 (54%)
  Q:     1 MKKNKVKIDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNN--SKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKG----KNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSL---KLSDPNLNSNNQT---YGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCE--DIEVKKEFSFGSWVYALQTKESKTCIISYGDIINDLKK-----EIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVF-DSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           M++    +D+I    + + + L +L  +   +R  IID       H +SNLG+VEL++AL YVFD+P+D + +D GHQ Y HK++T R DK++T+R+ NGLSGF +  ES +D  +TGH+G  +S   G     +   ++ +V+ +IGDA+I+ G+A EA+N+  + K  M++I+NDN MSISKNVG++   ++    S      +++    L   +W   I  +  + F K+ K FK        FE LGF Y G  DG+++ + + +L+++K +   GP +LH+ T KG GY  AE D    YH +   +  D  ++S + +   Y  +    L  L E +  I  I PAM   S     ++K+P +  DVGIAE+H+V  A  M   N   ++ IYSTFL R+ D L+ DV+ + LP+ F++DR      DG+TH G++D+G+L  +PN  +   SN  +L   +    +   +P  IR+ K   +   ++  KE       + +  + +   +IS G +I++ KK     E +  S+ LI+ V++     E +   L   +   ++++ + DS   G  L  +  EN LS  IK        I  G ++++ +K  +D  SI  ++ +
  S:     1 MQQELTLLDRINYPAELRNIPLEKLPQICKEVRNYIIDTLSGIGGHFASNLGVVELTVALHYVFDTPKDRLVWDVGHQTYPHKILTGRKDKLNTVRKFNGLSGFPKREESPYDLYNTGHAGTSISQALGEAAARDLVKENYNVVAIIGDASIATGMALEAMNHAGHLKKDMIVILNDNYMSISKNVGSISNYLNNIITSHFYNHWKRVFYTFL---KWLPIIGPATERFFKKVEKGFKDVLTPGGLFEDLGFGYIGPEDGHDVIRLVKMLEKVKKMK--GPILLHIITQKGKGYDPAERDPIK-YHGVTPFRKEDGAMDSGDTSKIAYSKIVGKMLAILTETNPKIAAITPAMIEGSGLKEYAEKYPEHLFDVGIAEQHSVAFAGAMTNGNIIPYMCIYSTFLTRAMDQLVQDVSLMNLPVRFVIDRAGCVGPDGETHQGLFDLGYLLGLPNMDVFVPSNGQDLIDALRWMEKYDKSPVAIRFPKSSVDLKTLDFYKETELQPGTFRVFKRGTDVALISIGSMIDEAKKASERLENEGLSVTLIDLVWLRPLGAEALNEELVNVRCFVILDESYIDSGVTGYLLNRMTREN-LSKYIKTFGFPPEPIHHGERKEVFQKYRLDGESIAEQVAA 625
>gi|28199179|ref|NP_779493.1| 1-deoxy-D-xylulose-5-phosphate synthase [Xylella fastidiosa Temecula1] >gi|182681910|ref|YP_001830070.1| deoxyxylulose-5-phosphate synthase [Xylella fastidiosa M23] >gi|32129498|sp|Q87C03|DXS_XYLFT 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|28057285|gb|AAO29142.1| deoxyxylulose-5-phosphate synthase [Xylella fastidiosa Temecula1] >gi|182632020|gb|ACB92796.1| deoxyxylulose-5-phosphate synthase [Xylella fastidiosa M23] (635 aa)
Score = 785, Expect = 2.5e-81, Identities = 195/606 (32%), Positives = 321/606 (52%)
  Q:     7 KIDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGF--IEKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTP---MLIIINDNGMSISKNVGALHKIMSKFQMSKS----------VFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPN-----LNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFS-FGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           ++ +I   ED +  +  EL  +A  LR  +I+       H ++ LG+VEL++AL Y++ +P D + +D GHQ Y HK++T R DKIST++   GL+ F +  ESI+D    GHS   +S   G   + + N   + V+ +IGD A++ G+A+EALN+ A   +P   +L+I+NDN MSIS+ VG L K++ +   SK+          +F  +K      F + W +  +W            F     FE +GFHY G IDG++L   +  LK ++ +   GP +LHV T KG GY+ AE D  G YH++   DP        +  QTY  V + +L  +   +  +  I PAM   S  +  S+++P  Y DV IAE+HA+T AAGMA    K  V+IYSTFLQR YD L+HDVA  +L + F VDR  +   DG TH G  D+ FL+ +PN ++   +++ E  +++   + + S P  +RY +     +    E       V  L+   ++  ++ +G  +   ++  +   + ++N  FI    +  +L +  T++    +E    +   G  +  L N   +   I  + + +      ++ED+  +  ID   ++A + S
  S:     9 RLSRIQTPEDLRAFQESELRAVADELRNYLIESVGLSGGHFAAGLGVVELTIALHYLYCTPIDQLVWDVGHQTYPHKILTGRRDKISTVKHQGGLAPFPKREESIYDTFGVGHSSTSISAALGMAIVAQRNGDERKVVAIIGDGAMTAGMAYEALNH-AGGMSPAPNLLVILNDNRMSISEAVGGLTKMLGRATGSKALNAIREGGKRIFGDKKTNATARFLRRWEE--HWK---------GMFVPSTLFEEMGFHYTGPIDGHDLPALLGALKTLRTLK--GPQLLHVITTKGKGYELAEGDQIG-YHAVAPFDPQKGLIKAGAKKQTYTDVFSEWLCDMAAVEPRLLAITPAMREGSGLVRFSQEYPQRYFDVAIAEQHAITLAAGMATQGAKPVVAIYSTFLQRGYDQLVHDVALQKLDVLFAVDRGGVVGPDGATHAGNLDLSFLRCVPNMMLMAPADEAECRKMLSTGF-HYSGPVAVRYPRGTGPGVVPSAELDVLPVGVAQLRHSGTRIALLGFGVCVAPAEQVGRRLGLTVVNMRFIKPLDRTLLLELARTHEVFVTIEDNVVAGGAGSGVAELLNAEGIVLPIVHLGLPDAFQQHASREDLLAEAGIDAAGVYAALLS 619
>gi|71274465|ref|ZP_00650753.1| Deoxyxylulose-5-phosphate synthase [Xylella fastidiosa Dixon] >gi|170730567|ref|YP_001776000.1| deoxyxylulose-5-phosphate synthase [Xylella fastidiosa M12] >gi|71164197|gb|EAO13911.1| Deoxyxylulose-5-phosphate synthase [Xylella fastidiosa Dixon] >gi|167965360|gb|ACA12370.1| deoxyxylulose-5-phosphate synthase [Xylella fastidiosa M12] (635 aa)
Score = 785, Expect = 2.5e-81, Identities = 195/606 (32%), Positives = 321/606 (52%)
  Q:     7 KIDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGF--IEKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTP---MLIIINDNGMSISKNVGALHKIMSKFQMSKS----------VFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPN-----LNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFS-FGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           ++ +I   ED +  +  EL  +A  LR  +I+       H ++ LG+VEL++AL Y++ +P D + +D GHQ Y HK++T R DKIST++   GL+ F +  ESI+D    GHS   +S   G   + + N   + V+ +IGD A++ G+A+EALN+ A   +P   +L+I+NDN MSIS+ VG L K++ +   SK+          +F  +K      F + W +  +W            F     FE +GFHY G IDG++L   +  LK ++ +   GP +LHV T KG GY+ AE D  G YH++   DP        +  QTY  V + +L  +   +  +  I PAM   S  +  S+++P  Y DV IAE+HA+T AAGMA    K  V+IYSTFLQR YD L+HDVA  +L + F VDR  +   DG TH G  D+ FL+ +PN ++   +++ E  +++   + + S P  +RY +     +    E       V  L+   ++  ++ +G  +   ++  +   + ++N  FI    +  +L +  T++    +E    +   G  +  L N   +   I  + + +      ++ED+  +  ID   ++A + S
  S:     9 RLSRIQTPEDLRAFQESELRAVADELRNYLIESVGLSGGHFAAGLGVVELTIALHYLYCTPIDQLVWDVGHQTYPHKILTGRRDKISTVKHQGGLAPFPKREESIYDTFGVGHSSTSISAALGMAIVAQRNGDERKVVAIIGDGAMTAGMAYEALNH-AGGMSPAPNLLVILNDNRMSISEAVGGLTKMLGRATGSKALNAIREGGKRIFGDKKTNATARFLRRWEE--HWK---------GMFVPSTLFEEMGFHYTGPIDGHDLPALLGALKTLRTLK--GPQLLHVITTKGKGYELAEGDQIG-YHAVAPFDPQKGLIKAGAKKQTYTDVFSEWLCDMAAVEPRLLAITPAMREGSGLVRFSQEYPQRYFDVAIAEQHAITLAAGMATQGAKPVVAIYSTFLQRGYDQLVHDVALQKLDVLFAVDRGGVVGPDGATHAGNLDLSFLRCVPNMMLMAPADEAECRKMLSTGF-HYSGPVAVRYPRGTGPGVVPSAELDVLPVGVAQLRHSGTRIALLGFGVCVAPAEQVGRRLGLTVVNMRFIKPLDRTLLLELARTHEVFVTIEDNVVAGGAGSGVAELLNAEGIVLPIVHLGLPDAFQQHASREDLLAEAGIDAAGVYAALLS 619
>gi|121634219|ref|YP_974464.1| 1-deoxy-D-xylulose-5-phosphate synthase [Neisseria meningitidis FAM18] >gi|166198631|sp|A1KS32|DXS_NEIMF 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|120865925|emb|CAM09662.1| putative 1-deoxyxylulose-5-phosphate synthase [Neisseria meningitidis FAM18] (637 aa)
Score = 785, Expect = 2.7e-81, Identities = 191/546 (34%), Positives = 306/546 (56%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKF-------QMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSL----KLSDPNLNSNNQ-------TYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTK---------EKCEDIEVKKEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEK 553
           +D I + +D +++   +L  LA  LR  +++       H +SNLG VEL++AL YV+D+P+D + +D GHQ Y HK++T R +++ T+R+  GL+GF + +ES +D    GHS   +    G    +K    ++  + +IGD A++ G AFEALN        +L+++NDN MSIS NVGAL K ++          +S     T K+L KI    E+++K+   I     +     +  + FE+ GF Y G +DG+N++  ++VLK +++    GP +LHV T KG GYK AE +D   YH++    K     + S  +       TY  V   +L      D  +  I PAM   S  +   ++FP+ Y DVGIAE+HAVT A G+A    K  V+IYSTFLQR+YD L+HD+A   LP+ F VDR  +  +DG TH G+YD+ FL+ IPN I+   S++ E   L+   YQ  + P  +RY +         +  E +E+ K          ++ +  KT  I++G ++          +  + +  F+    +E ++R+  ++  I  +E+
  S:     7 LDLIDSPQDLRRLDKKQLPRLAGELRAFLLESVGQTGGHFASNLGAVELTIALHYVYDTPEDKLVWDVGHQSYPHKILTGRKNQMHTMRQYGGLAGFPKRSESEYDAFGVGHSSTSIGAALGMAVADKQLGNNRRSVAIIGDGAMTAGQAFEALNCAGDMDVDLLVVLNDNEMSISPNVGALPKYLASNVVRDMHGLLSTVKAQTGKVLDKIPGAMEFAQKVEHKIKTLAEEAEHAKQSLSLFENFGFRYTGPVDGHNVENLVDVLKDLRS--RKGPQLLHVITKKGNGYKLAE-NDPVKYHAVAKLPKEGAAQMPSEKEPKPVAKPTYTQVFGKWLCDRAAADERLIAITPAMREGSGLVEFEQRFPDRYFDVGIAEQHAVTFAGGLACEGMKPVVAIYSTFLQRAYDQLVHDIALQNLPVLFAVDRAGIVGADGPTHAGLYDLSFLRCIPNMIVAAPSDENECRLLLSTCYQADA-PAAVRYPRGTGTGAPVSDGMETVEIGKGI--------IRREGGKTAFIAFGSMVAPALAVAGKLNATVADMRFVKPIDEELIVRLARSHDRIVTLEE 569
>gi|118589273|ref|ZP_01546679.1| 1-deoxy-D-xylulose-5-phosphate synthase [Stappia aggregata IAM 12614] >gi|118437973|gb|EAV44608.1| 1-deoxy-D-xylulose-5-phosphate synthase [Stappia aggregata IAM 12614] (639 aa)
Score = 785, Expect = 2.8e-81, Identities = 178/466 (38%), Positives = 266/466 (57%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSK--SKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSL--------KLSDPNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTK 473
           +D++ +  D +++   +L  LA  LR + ID       HL + LG+VEL++AL YVF++P D + +D GHQCY HK++T+R D+I T+R+ +GLSGF +  ES  D     HS   +S   G     + K  S +VI VIGD A+S G+A+EA+NN  +  + +++I+NDN MSI+  VGA+   ++K  +S   + T +   K L K    K ++    ++      F+ G   FE LGF+Y G +DG+NL+  + VLK +++    GP ++H  T KG GY  AE   K  YH +        K + P  N+   +Y +V A  L K  E D+ +  I  AM   +      + +P    DVGIAE+HAVT AAG+A    K F +IYSTFLQR+YD ++HDVA   LP+ F +DR  L  +DG TH G +D  FL  +P  ++  AS++ EL  ++  A      P   RY +
  S:    10 LDQVKSPADLRQLDESDLKQLADELRAETIDAVSITGGHLGAGLGVVELTVALHYVFNTPDDKLIWDVGHQCYPHKILTERRDRIRTLRQGDGLSGFTKRAESPFDPFGAAHSSTSISAGLGMAAGRDLKGGSNNVIAVIGDGAMSAGMAYEAMNNAGHLGSRLIVILNDNDMSIAPPVGAMSAYLAKL-VSGPTYQTFRDAAKNLVKN-LPKPVFEKAARAEEYARGFWTGGTLFEELGFYYVGPVDGHNLEHLLPVLKNVRD-THHGPILIHAVTQKGKGYAPAE-GAKDKYHGVAKFDVVTGKQAKPKANA--PSYTNVFATSLIKEAETDDRVLAITAAMPDGTGLDLFGEAYPKRTFDVGIAEQHAVTFAAGLATEGFKPFCAIYSTFLQRAYDQVVHDVAIQGLPVRFPIDRAGLVGADGPTHAGAFDTAFLTCLPGFVVMAASDEVELRHMVATAVAYDEGPISFRYPR 479
>gi|71901686|ref|ZP_00683762.1| Deoxyxylulose-5-phosphate synthase [Xylella fastidiosa Ann-1] >gi|71728556|gb|EAO30711.1| Deoxyxylulose-5-phosphate synthase [Xylella fastidiosa Ann-1] (659 aa)
Score = 784, Expect = 3.1e-81, Identities = 195/606 (32%), Positives = 321/606 (52%)
  Q:     7 KIDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGF--IEKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTP---MLIIINDNGMSISKNVGALHKIMSKFQMSKS----------VFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPN-----LNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFS-FGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           ++ +I   ED +  +  EL  +A  LR  +I+       H ++ LG+VEL++AL Y++ +P D + +D GHQ Y HK++T R DKIST++   GL+ F +  ESI+D    GHS   +S   G   + + N   + V+ +IGD A++ G+A+EALN+ A   +P   +L+I+NDN MSIS+ VG L K++ +   SK+          +F  +K      F + W +  +W            F     FE +GFHY G IDG++L   +  LK ++ +   GP +LHV T KG GY+ AE D  G YH++   DP        +  QTY  V + +L  +   +  +  I PAM   S  +  S+++P  Y DV IAE+HA+T AAGMA    K  V+IYSTFLQR YD L+HDVA  +L + F VDR  +   DG TH G  D+ FL+ +PN ++   +++ E  +++   + + S P  +RY +     +    E       V  L+   ++  ++ +G  +   ++  +   + ++N  FI    +  +L +  T++    +E    +   G  +  L N   +   I  + + +      ++ED+  +  ID   ++A + S
  S:    33 RLSRIQTPEDLRAFQESELPAVADELRNYLIESVGLSGGHFAAGLGVVELTIALHYLYCTPIDQLVWDVGHQTYPHKILTGRRDKISTVKHQGGLAPFPKREESIYDTFGVGHSSTSISAALGMAIVAQRNGDERKVVAIIGDGAMTAGMAYEALNH-AGGMSPAPNLLVILNDNRMSISEAVGGLTKMLGRATGSKALNAIREGGKRIFGDKKTNATARFLRRWEE--HWK---------GMFVPSTLFEEMGFHYTGPIDGHDLPALLGALKTLRTLK--GPQLLHVITTKGKGYELAEGDQIG-YHAVAPFDPQKGLIKAGAKKQTYTDVFSEWLCDMAAVEPRLLAITPAMREGSGLVRFSQEYPQRYFDVAIAEQHAITLAAGMATQGAKPVVAIYSTFLQRGYDQLVHDVALQKLDVLFAVDRGGVVGPDGATHAGNLDLSFLRCVPNMMLMAPADEAECRKMLSTGF-HYSGPVAVRYPRGTGPGVVPSAELDVLPVGVAQLRHSGTRIALLGFGVCVAPAEQVGRRLGLTVVNMRFIKPLDRTLLLELARTHEVFVTIEDNVVAGGAGSGVAELLNAEGIVLPIVHLGLPDAFQQHASREDLLAEAGIDAAGVYAALLS 643
>gi|15677702|ref|NP_274863.1| 1-deoxy-D-xylulose-5-phosphate synthase [Neisseria meningitidis MC58] >gi|13124129|sp|Q9JXV7|DXS_NEIMB 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|7227124|gb|AAF42201.1| 1-deoxyxylulose-5-phosphate synthase [Neisseria meningitidis MC58] (637 aa)
Score = 784, Expect = 3.3e-81, Identities = 190/546 (34%), Positives = 306/546 (56%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNN--SKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKF-------QMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSL----KLSDPNLNSNNQ-------TYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTK---------EKCEDIEVKKEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEK 553
           +D I + +D +++   +L  LA  LR  +++       H +SNLG VEL++AL YV+D+P+D + +D GHQ Y HK++T R +++ T+R+  GL+GF +  ES +D    GHS   +    G    +      +  + +IGD A++ G AFEALN        +L+++NDN MSIS NVGAL K ++          +S     T K+L KI    E+++K+   I     +     +  + FE+ GF Y G +DG+N++  ++VLK +++    GP +LHV T KG GYK AE +D   YH++    K S   + S  +       TY  V   +L      D+ +  I PAM   S  +   ++FP+ Y DVGIAE+HAVT A G+A    K  V+IYSTFLQR+YD L+HD+A   LP+ F VDR  +  +DG TH G+YD+ FL+ +PN I+   S++ E   L+   YQ  + P  +RY +         +  E +E+ K          ++ +  KT  I++G ++       +  +  + +  F+    +E ++R+  ++  I  +E+
  S:     7 LDLIDSPQDLRRLDKKQLPRLAGELRTFLLESVGQTGGHFASNLGAVELTIALHYVYDTPEDKLVWDVGHQSYPHKILTGRKNQMHTMRQYGGLAGFPKRCESEYDAFGVGHSSTSIGAALGMAAADKLLGSDRRSVAIIGDGAMTAGQAFEALNCAGDMDVDLLVVLNDNEMSISPNVGALPKYLASNVVRDMHGLLSTVKAQTGKVLDKIPGAMEFAQKVEHKIKTLAEEAEHAKQSLSLFENFGFRYTGPVDGHNVENLVDVLKDLRS--RKGPQLLHVITKKGNGYKLAE-NDPVKYHAVANLPKESAAQMPSEKEPKPAAKPTYTQVFGKWLCDRAAADSRLVAITPAMREGSGLVEFEQRFPDRYFDVGIAEQHAVTFAGGLACEGMKPVVAIYSTFLQRAYDQLVHDIALQNLPVLFAVDRAGIVGADGPTHAGLYDLSFLRCVPNMIVAAPSDENECRLLLSTCYQADA-PAAVRYPRGTGTGAPVSDGMETVEIGKGI--------IRREGEKTAFIAFGSMVAPALAVAEKLNATVADMRFVKPIDEELIVRLARSHDRIVTLEE 569
>gi|189485329|ref|YP_001956270.1| 1-deoxy-D-xylulose-5-phosphate synthase [uncultured Termite group 1 bacterium phylotype Rs-D17] >gi|170287288|dbj|BAG13809.1| 1-deoxy-D-xylulose-5-phosphate synthase [uncultured Termite group 1 bacterium phylotype Rs-D17] (614 aa)
Score = 784, Expect = 3.3e-81, Identities = 193/466 (41%), Positives = 275/466 (59%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKSK--SVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSF-SKLSKFFKGKN-------FFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPN----LNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTK 473
           +D I N +D KK+K   L+DLA  +R++II+       HL+S+LG+V+LS+A+ YVFDSP D I +D GHQ Y HK++T R  K  TIR  +GLSGF + +ES +D  S GHS   +S   GF    + K++   ++ VIGD +++ GLAFE L N  + K  ML+I+NDN M IS+ VGA+   ++K        LT  + RK  F+++  K +  S +  F S + KF K          FFE +GF Y G + G+N+   I +L+ +K++    P +LHV T KG GY  AE +D   +HS+   D            TY  V ++ L +L + D+ I  +  AM   +     S+KFP+ Y DVGIAE HAVT AA MA        +IYSTF+QR+ DN++HDVA   LP+ F VDR  L   DG THHG +D+ +L  IPN ++   S++ EL  ++  A  N + P  IRY K
  S:     4 LDSINNPQDLKKLKKENLIDLAKEIREEIINTVSKNGGHLASSLGVVDLSIAIHYVFDSPHDKIIWDVGHQSYAHKILTGRKSKFKTIRTHSGLSGFPKRSESEYDAFSVGHSSTSISAALGFAAARDLKNEDYKIVAVIGDGSMTCGLAFEGLQNAGHLKKNMLVILNDNEMFISQKVGAVAGYLAK-------LLTAGMARK--FEEKVMKTV--SRFHGFGSPVGKFIKRVKVMLFPGMFFEEMGFTYIGPVQGHNINNLIVILENLKDVKT--PVLLHVITKKGKGYAPAE-EDPVKFHSVGKFDIKSGRIAKGEAITYTKVFSDTLIELAQSDDKIVAVTAAMPEGTGLDKFSEKFPDRYFDVGIAEGHAVTFAAAMAAGGMHPVCAIYSTFMQRAIDNIIHDVALQNLPVVFAVDRAGLVGEDGGTHHGAFDLSYLNYIPNLVVMSPSDENELRNMLKTAL-NSNTPCVIRYPK 468
>gi|170727813|ref|YP_001761839.1| deoxyxylulose-5-phosphate synthase [Shewanella woodyi ATCC 51908] >gi|169813160|gb|ACA87744.1| deoxyxylulose-5-phosphate synthase [Shewanella woodyi ATCC 51908] (621 aa)
Score = 784, Expect = 3.4e-81, Identities = 194/598 (32%), Positives = 319/598 (53%)
  Q:    15 EDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI---EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLT-----EKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNL------NSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCE---DIEVKKEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           ++ +++    L  LA  LR  ++      S H +S LG VEL++AL YV+++P D + +D GHQ Y HK++T R D + TIR+  G+  F    ES +D  S GHSG  +S         EK  +  K V+ VIGD A++ G+ FEA+N+       ML+++NDN MSIS+NVGAL+  +++  MS   + T     +K+L+ +   KE +K+       +   L         FE LGF+Y G IDG+++   +  ++ ++N+   GP ILH+ T KG GY+ AE D  G +H++   DP+         +N T+  V   +L  + E D  +  I PAM   S  +  S++FP  Y D  IAE+HAVT  AG A    K  V+IYSTFLQR YD L+HDVA  +LP+ F +DR  +  +DG TH G +D+ F++++PN +I   S++ E  +++   Y     P  +RY +        IE       G  +   Q +  K  I+++G ++  +    ++    + +  F+     E +  + +++  +  VE+       G  ++ L  + K    + ++ + +  I  G+  +I  +L +D   I  +I+S
  S:    18 DELRQLPQAVLPQLADELRGFLLKSVGKSSGHFASGLGTVELTVALHYVYNTPFDRLIWDVGHQAYPHKILTGRRDAMHTIRQKGGIHPFPWREESEYDTFSVGHSGTSISAALAMAVAAEKEQAGRK-VVSVIGDGAMTGGMVFEAMNHAGDLHNDMLVVLNDNEMSISENVGALNNHLAQL-MSGRFYTTIRESSKKVLKGMPVIKEMAKR-------TEEHLKGMVVPGTMFEELGFNYIGPIDGHDVDALVETMRNMRNLS--GPQILHIMTKKGRGYEPAEKDPIG-WHAVPKFDPSTFEKPASKPSNPTFSQVFGKWLCDVAEKDKKVLGITPAMREGSGMVEFSQRFPKQYFDAAIAEQHAVTLGAGFACEGLKPVVAIYSTFLQRGYDQLIHDVALQKLPVLFAIDRGGIVGADGPTHQGAFDLSFMRTVPNMVIMAPSDENECRQMLYTGYCYNDGPTAVRYPRGSATGAPQIEEMTALPIGKGLIKRQGQ--KVAILNFGTLLASVLTAGESLDATVADMRFVKPLDVELIKELANSHDVLVTVEENAIMGGAGSGVLELLQQLKQPMPVLQLGLPDEFIKHGDSGEIIAELKLDAAGILEQIES 618
>gi|156935031|ref|YP_001438947.1| 1-deoxy-D-xylulose-5-phosphate synthase [Enterobacter sakazakii ATCC BAA-894] >gi|166198615|sp|A7MFG0|DXS_ENTS8 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|156533285|gb|ABU78111.1| hypothetical protein ESA_02882 [Enterobacter sakazakii ATCC BAA-894] (620 aa)
Score = 784, Expect = 3.5e-81, Identities = 175/522 (33%), Positives = 298/522 (57%)
  Q:    32 LRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEK--NNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWS---IYKSFSKLSKFFKGK----NFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNS------NNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVK--KEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEK 553
           LR+ ++D     S H +S LG VEL++AL YV+++P D + +D GHQ Y HK++T R D+I TIR+  GL  F    ES +D +S GHS   +S   G         K++  + VIGD AI+ G+AFEA+N+    +  ML+I+NDN MSIS+NVGAL+  +++        L+ K+   +   +E  K+++ +   I +   +  +  KG       FE LGF+Y G +DG+++   +N LK ++++   GP  LH+ T KG GY+ AE  D   +H++   DP   +         +Y  +  ++L +    D+ +  I PAM   S  +  S+K+P  Y DV IAE+HAVT AAG+AI   K  V+IYSTFLQR+YD ++HDVA  +LP+ F +DR  +  +DG TH G +D+ +L+ IP+ +I   S++ E  +++   Y     P  +RY +     + ++  ++   G  V  ++    K  ++++G ++ +  +  +  +  L++  F+    +  ++ +   ++ +  +E+
  S:    35 LRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQLIWDVGHQAYPHKILTGRRDRIGTIRQKGGLHPFPWRGESEYDVLSVGHSSTSISAGIGIAVAAAREEKNRRTVCVIGDGAITAGMAFEAMNHAGDIRPDMLVILNDNEMSISENVGALNNHLAQL-------LSGKLYSTL---REGGKRVFSNVPPIKELLKRTEEHIKGMVVPGTLFEELGFNYIGPVDGHDVLGLVNTLKNMRDLK--GPQFLHIMTKKGRGYEPAE-KDPITFHAVPKFDPESGTLPKSSGGQPSYSKIFGDWLCETAAKDDKLMAITPAMREGSGMVEFSRKYPAQYFDVAIAEQHAVTFAAGLAIGGYKPVVAIYSTFLQRAYDQVIHDVAIQKLPVLFAIDRAGIVGADGQTHQGAFDLSYLRCIPDMVIMTPSDENECRQMLFTGYHYNDGPSAVRYPRGNALGVTLEPLQKLPIGKGV--VKRHGEKVALLNFGTLLPEATQAAEALNATLVDMRFVKPLDEALIMELAGRHEALVTIEE 558
>gi|83945404|ref|ZP_00957752.1| 1-deoxy-D-xylulose-5-phosphate synthase [Oceanicaulis alexandrii HTCC2633] >gi|83851238|gb|EAP89095.1| 1-deoxy-D-xylulose-5-phosphate synthase [Oceanicaulis alexandrii HTCC2633] (635 aa)
Score = 783, Expect = 4.1e-81, Identities = 177/478 (37%), Positives = 277/478 (57%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI---EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKI---LFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAEL-DDKGLYHSLKLSDPNLNSNNQ--------TYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEF 485
           +D+I + +D K   L  L  +A  LR + ID       HL + LG+VE+++AL +VFD+P D++ +D GHQCY HK++T R D+I T+R+  GLSGF + +ES +D     H+   +S   GF    +  + + + V+ VIGD ++S G+A+EA+NN    K  +++I+NDN MSI+  VGA+    ++   SKS     K+ R +   L  KE +++       +   L     G   FE +GF Y G IDG+++ + + VL+ +++    GP ++H  T KG GY  AE  DDK  YH +  +  N+ +  Q        +Y  V AN L +L E D  I  +  AM   +     +  +P+   DVGIAE+HAVT AAG+A    K + +IYSTFLQR YD ++HDVA   LP+ F +DR  L  +DG TH G +D+G++ ++P  ++  A+++ EL R++  A +    P   RY + +   +E+ KE 
  S:     7 LDQISSPQDLKNRDLSFLKAVAEELRAETIDAVSVTGGHLGAGLGVVEMTVALHHVFDTPSDILIWDVGHQCYPHKILTGRRDRIRTLRQGGGLSGFTKRSESDYDPFGAAHASTSISAGLGFAVGRDLKHEEGRKVVAVIGDGSMSAGMAYEAMNNAGDMKKDLIVILNDNDMSIAPPVGAMSHYFARQVSSKSYNSIRKLGRGVAEALGVKEHARR-------AEEYLRGMAMGGTLFEEMGFRYVGPIDGHDMDQLVAVLRNVRD-AGEGPILIHAVTQKGKGYAPAEAADDK--YHGV--AKFNVVTGEQQKSKPAAPSYTGVFANALIQLAETDEKICAVTAAMPGGTGVDKFAAAYPDRAFDVGIAEQHAVTFAAGLAAEGLKPYAAIYSTFLQRGYDQVVHDVAIQSLPVRFAIDRAGLVGADGATHAGAFDVGYMGALPGMVLMAAADEAELARMVATANEIDDRPSAFRYPRGEGLGVEIPKEL 487
>gi|122921297|pdb|2O1S|A Chain A, 1-Deoxy-D-Xylulose 5-Phosphate Synthase (Dxs) From Escherichia Coli >gi|122921298|pdb|2O1S|B Chain B, 1-Deoxy-D-Xylulose 5-Phosphate Synthase (Dxs) From Escherichia Coli >gi|122921299|pdb|2O1S|C Chain C, 1-Deoxy-D-Xylulose 5-Phosphate Synthase (Dxs) From Escherichia Coli >gi|122921300|pdb|2O1S|D Chain D, 1-Deoxy-D-Xylulose 5-Phosphate Synthase (Dxs) From Escherichia Coli (621 aa)
Score = 783, Expect = 4.2e-81, Identities = 191/581 (32%), Positives = 316/581 (54%)
  Q:    32 LRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWS---IYKSFSKLSKFFKGK----NFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNL------NSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVK--KEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           LR+ ++D     S H +S LG VEL++AL YV+++P D + +D GHQ Y HK++T R DKI TIR+  GL  F    ES +D +S GHS   +S   G     +   K++  + VIGD AI+ G AFEA N+    +   L+I+NDN  SIS+NVGAL+  +++        L+ K+   +   +E  KK++     I +   +  +  KG       FE LGF+Y G +DG+++   I  LK  +++   GP  LH+ T KG GY+ AE  D   +H++   DP+       +    +Y  +  ++L +    DN +  I PA    S  +  S+KFP+ Y DV IAE+HAVT AAG+AI   K  V+IYSTFLQR+YD +LHDVA  +LP+ F +DR  +  +DG TH G +D+ +L+ IP  +I   S++ E  + +   Y     P  +RY +     +E+   ++   G  +  ++ +  K  I+++G +  +  K  ++ +  L++  F+    +  +L   ++++ +  VE+       G  +  +   ++    +  I + +  I  G +E+   +L +D     A+IK+
  S:    35 LRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQLIWDVGHQAYPHKILTGRRDKIGTIRQKGGLHPFPWRGESEYDVLSVGHSSTSISAGIGIAVAAEKEGKNRRTVCVIGDGAITAGXAFEAXNHAGDIRPDXLVILNDNEXSISENVGALNNHLAQL-------LSGKLYSSL---REGGKKVFSGVPPIKELLKRTEEHIKGXVVPGTLFEELGFNYIGPVDGHDVLGLITTLKNXRDLK--GPQFLHIXTKKGRGYEPAE-KDPITFHAVPKFDPSSGCLPKSSGGLPSYSKIFGDWLCETAAKDNKLXAITPAXREGSGXVEFSRKFPDRYFDVAIAEQHAVTFAAGLAIGGYKPIVAIYSTFLQRAYDQVLHDVAIQKLPVLFAIDRAGIVGADGQTHQGAFDLSYLRCIPEXVIXTPSDENECRQXLYTGYHYNDGPSAVRYPRGNAVGVELTPLEKLPIGKGI--VKRRGEKLAILNFGTLXPEAAKVAESLNATLVDXRFVKPLDEALILEXAASHEALVTVEENAIXGGAGSGVNEVLXAHRKPVPVLNIGLPDFFIPQGTQEEXRAELGLDAAGXEAKIKA 617
>gi|167729156|emb|CAO80067.1| 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) [Candidatus Cloacamonas acidaminovorans] (622 aa)
Score = 783, Expect = 4.4e-81, Identities = 190/545 (34%), Positives = 306/545 (56%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAY-NKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSF--------SKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSD----PNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFS-FGSWVYALQTKESKTCIISYGD------IINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVE 552
           +++I   +  + + + EL  LA  +R +I+++      HL+ +LG V+L++ALL++FD  +D I +D GHQ Y  K++T R  +  T+R+  GLSGF    ES +D  +TGHS   +S   G       N++    I VIGD A++ G++FEALN+  +  K   ++I+NDN MSISKNVG L K M++   SKS      +L+K ++  ++S  +  +I +SF          +         FE LGF Y G IDG+++++ + ++KR+KN +  GP ++H+ T KG GY  AE + + L+H     D      ++   QT+  +  + L  L + D  I  I  AMT  +      + +P+ + DVGIAE+H+VT AAGM+    K FV+IYSTFLQR+ D ++HDVA  +LP+ F +DR  L   DG THHG +D+ +L  +PN II   S   EL  ++  A   +  P  IRY +       V K  + F  +   + + + K  +++ GD       +++L  + K  +  LI  + +    +  +L + ST   I+  E
  S:     3 LEQITEPKQIQALTVSELKILAKEVRSRIVEVVSKTGGHLAPSLGTVDLTIALLHLFDPLKDRIVWDVGHQAYSWKILTGRNAQFDTLRQYKGLSGFTNREESPYDAFTTGHSSTSISAALGIACARDLNNEQGHCIAVIGDGALTGGMSFEALNHGGHLQKDKFIVILNDNEMSISKNVGGLQKYMARMLASKSY----NVLKKQVW--DFSYTLPANIRRSFIYGAQKLEESMMNILVPNIIFEDLGFKYVGPIDGHDIEQLLKIIKRVKNFM-VGPVLIHIVTQKGKGYPPAEKNSE-LFHGTGPFDLKTGKQISDGKQTWSELMGSTLITLAQKDPKIIAITAAMTAGTGLTKFEETYPDRFFDVGIAEQHSVTLAAGMSTKGLKPFVAIYSTFLQRALDQIIHDVALPKLPVVFCIDRAGLVGEDGATHHGAFDLSYLNFVPNMIILTPSTAEELSAMLFWAASYQEGPVAIRYPRGTAIHSSVHKSLTNFNPFPAIIHSNKGKIALVACGDAFFTAEAVHNLLAKDKIPA-QLIQLLSVKPLDENTLLSLASTCNYIFTFE 560
>gi|37679052|ref|NP_933661.1| 1-deoxy-D-xylulose-5-phosphate synthase [Vibrio vulnificus YJ016] >gi|41016940|sp|Q7MN49|DXS_VIBVY 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|37197794|dbj|BAC93632.1| deoxyxylulose-5-phosphate synthase [Vibrio vulnificus YJ016] (621 aa)
Score = 783, Expect = 4.7e-81, Identities = 188/580 (32%), Positives = 320/580 (55%)
  Q:    32 LRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGF--IEKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLT-----EKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNS------NNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFS---FGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIK 611
           LR  +++     S HL+S LG VEL++AL YV+++P D + +D GHQ Y HK++T R +++ TIR+  GL  F    ES +D +S GHS   +S   G     +   +++ V+ VIGD AI+ G+AFEA+N+     + ML+I+NDN MSIS+NVGAL+  +++  +S +++ +     +K+L  +   KE        + ++   L         FE LGF+Y G IDG+++ + +  LK ++ +   GP  LH+ T KG GY+ AE D  G YH +   DP   S         ++ ++  +FL  +   D  +  I PAM   S  +  SK++P  Y DV IAE+HAVT A GMAI      V+IYSTFLQR YD L+HDVA + LP+ F +DR  L  +DG TH G +D+ +++ IPN +I   S++ E  +++   ++++  P  +RY +       ++ EF+    G      Q +  K  I+S+G  + +  +  +  +  + +  F+    +  + ++ + +  +  +E+   +   G  +I    + K+   +  + + +  I  G +E++ ++L +D   I   I+
  S:    35 LRTYLLNSVSQSSGHLASGLGTVELTVALHYVYNTPFDQLIWDVGHQAYPHKILTGRREQMPTIRQKGGLHPFPWREESEYDTLSVGHSSTSISAALGMAICAEKEGQNRKVVSVIGDGAITAGMAFEAMNHAGDVHSDMLVILNDNEMSISENVGALNNHLARV-LSGNLYTSIREGGKKVLSGVPPIKEL-------VRRTEEHLKGMVVPGTLFEELGFNYIGPIDGHDVVELVKTLKNMRELK--GPQFLHIMTKKGKGYEPAEKDPIG-YHGVPKFDPAHTSLPKSSGGKPSFSNIFGDFLCDMAAQDPKLMAITPAMREGSGMVRFSKEYPEQYFDVAIAEQHAVTLATGMAIGGYNPIVAIYSTFLQRGYDQLIHDVAIMNLPVMFAIDRAGLVGADGQTHQGAFDLSYMRCIPNMVIMAPSDENECRQMLYTGHKHQG-PSAVRYPRGNGMGTPIESEFTALEIGKGRLVRQGE--KVAILSFGTFLANALEAAEALNATVADMRFVKPLDEALIRQLANEHDVLITIEENAIAGGAGAGVIEFMMQEKIMKPVLNLGLPDKFIHQGTQEELHEELGLDAKGIEQAIR 616
>gi|83593951|ref|YP_427703.1| 1-deoxy-D-xylulose-5-phosphate synthase [Rhodospirillum rubrum ATCC 11170] >gi|118595487|sp|Q2RR29|DXS2_RHORT 1-deoxy-D-xylulose-5-phosphate synthase 2 (1-deoxyxylulose-5-phosphate synthase 2) (DXP synthase 2) (DXPS 2) >gi|83576865|gb|ABC23416.1| 1-Deoxy-D-xylulose-5-phosphate synthase [Rhodospirillum rubrum ATCC 11170] (645 aa)
Score = 782, Expect = 5.6e-81, Identities = 176/477 (36%), Positives = 279/477 (58%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNN--SKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGK-----NFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAE-LDDKGLYHSLKLSDPNLNSNNQ--------TYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKE 484
           +D I    D + + + +L  LA  +R ++ID       HL S LG+VEL++AL +VFD+P D I +D GHQCY HK++T R D+I T+R+  GLSGF    ES +D    GHS   +S   G    +     ++ V+ VIGD ++S G+A+EA+NN    K+ +++I+NDN MSI+  VGA+   +S+   SKS +L+ + L      KE   ++  ++ ++  +  ++ +G        FE +GF+Y G IDG+ +   + VL+ ++     GP ++HV T KG GY  AE   DK  YH +  S  N+ +  Q        +Y +V    L      D+ I  +  AM   +    L+  +P    DVGIAE+HAVT AAG+A    K FV++YS+FLQR YD ++HDV   +LP+ F +DR     +DG TH G++D+ FL  +PN ++ CA+++ EL R+++ A  + S P  +RY + +   +E+ ++
  S:    10 LDTIRGPSDTRGLSVAQLEQLAREVRAEMIDAVSVTGGHLGSGLGVVELTVALHHVFDTPDDRIIWDVGHQCYPHKILTGRRDRIRTLRQGGGLSGFTLREESPYDPFGAGHSSTSISAGLGMAIGSALAGDARDVVAVIGDGSMSAGMAYEAMNNAGAAKSRLIVILNDNDMSIAPPVGAMSAYLSRLLSSKS-WLSIRTL-----AKEIVARLPDALERTAKRAEEYARGMVTGGGTLFEEMGFYYVGPIDGHRMDHLVPVLRNVREAGRDGPVLIHVVTQKGKGYAPAENAPDK--YHGV--SRFNVVTGVQEKAKPQAPSYTAVFGKQLVAAAAKDHRIVAVTAAMPGGTGLDKLAAAYPQRCFDVGIAEQHAVTFAAGLACEGLKPFVALYSSFLQRGYDQVVHDVVLQKLPVRFAIDRAGFVGADGATHGGVFDMAFLGCLPNLVVMCAADEAELARMVVTAAGHDSGPIALRYPRGEGVGVEIPED 492
>gi|169182628|ref|ZP_02843143.1| deoxyxylulose-5-phosphate synthase [Thauera sp. MZ1T] >gi|169010254|gb|EDS57021.1| deoxyxylulose-5-phosphate synthase [Thauera sp. MZ1T] (622 aa)
Score = 782, Expect = 5.7e-81, Identities = 188/462 (40%), Positives = 266/462 (57%)
  Q:    12 PNYE------DFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIA-YNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLT-EKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGK----NFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLN------SNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTK 473
           PN E      D + +   EL  LA  LR  +I+       HLSSNLG VEL++AL +VF++P D I +D GHQ Y HK++T R + ++ +R   G+SGF    ES +D   T HS   +S   G     +   + +  I VIGD A+S G+AFEALNN        +L+I+NDN MSIS  VGAL KI+++  MS S + T  ++  K+L        +   + +   K+ ++ KG       FE  GFHY+G IDG++L   I  L+ ++ +   GP  LHV T KG GYK AE D   LYH +   D              TY  V  ++L  + + D  I  I PAM   S  +  +++FP  Y DVGIAE+HAVT AAG+A       V+IYSTFLQR+YD L+HDVA   LP+ F +DR  L  +DG THHG +D+ FL  +PN ++   S++ E  +++  A Q+ + P  +RY +
  S:     5 PNLERVGCPADVRALDRRELGALASELRAFLIESVSKTGGHLSSNLGTVELTIALHHVFNTPHDRIVWDVGHQTYGHKVLTGRREAMTGLRHFGGISGFPRRCESEYDTFGTAHSSTSISAALGMAVAARARGEDRHAIAVIGDGAMSAGMAFEALNNAGDMENLNLLVILNDNEMSISPPVGALTKILARM-MSGSTYNTARRVGEKVL-------GVAPPVAELARKVEEYAKGMIGPGTLFEEFGFHYYGPIDGHDLDALIPTLQNLRKLK--GPQFLHVITRKGQGYKLAEADPV-LYHGVSKFDHTAGIQTGKGGGKLTYTQVFGDWLCDMAKADPRIVGITPAMREGSGLVRFAQEFPERYFDVGIAEQHAVTFAAGLACEGFVPVVAIYSTFLQRAYDQLIHDVALQNLPVVFAIDRGGLVGADGATHHGAFDLSFLSCVPNMVVMAPSDEDECRQMLYTAVQH-AGPSAVRYPR 474
>gi|85859631|ref|YP_461833.1| 1-deoxy-D-xylulose 5-phosphate synthase [Syntrophus aciditrophicus SB] >gi|118595622|sp|Q2LUA7|DXS_SYNAS 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|85722722|gb|ABC77665.1| 1-deoxy-D-xylulose 5-phosphate synthase [Syntrophus aciditrophicus SB] (650 aa)
Score = 782, Expect = 6.2e-81, Identities = 199/612 (32%), Positives = 325/612 (53%)
  Q:     1 MKKNKVK--IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKSK--SVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFK-KEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLY----HSLKLSDPNLNSNNQ---TYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKE-FSFGSWVYALQTKESKTCIISYGDIIN---DLKKEIKTKSI--DLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKL-SCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           +KKN     + +I   ED + + + +L  LA  +R  II+       HL+S+LG VEL++A+  VFD+P+D + +D GHQ Y HK+IT R D  ST+R+  G+SGF +  ES +D  + GHS   +S   G  E  + K +   V+ +IGD +++ GLAFE LN     K  ++II+NDN MSIS NVGAL   ++     ++     K +R  L       +++     ++   L         FE LGF Y G ++G+ L   I  L+ ++N+   GP ++HV T KG GYK AE +    +     S +   P   S +    +Y  V  N + KL   +  +  I  AM   +     +++FP  + DVGIAE+H+VT AAG+A       V+IYS+FLQR+YD +LHDV    LP+ F +DR      DG THHG++D+ +L+SIPN ++    ++ EL+ ++  A      P  +RY +     + +  + FS       +  +     I++ GD ++       +++ + I   ++NA F+    +E +LRI+ ++K I  VE+   +   G  ++    EN +    +K++ IR+       + +  +   ID   I A ++S
  S:     9 VKKNNSGGILSRIQFPEDIRMLDIGDLTLLASDIRSAIIETVSRTGGHLASSLGTVELTLAVHKVFDTPKDRVIWDVGHQAYAHKLITGRRDVFSTLRQKGGISGFPKREESPYDVFNVGHSSTSISAASGIAEARDLKKERFKVVAIIGDGSMTAGLAFEGLNWSGDRKKDLVIILNDNEMSISPNVGALSSYLNHIMTGQTANKIRKDIRNFLKTIPSIGEQVLEFSRRAEESLKALIVPGALFEDLGFTYVGPLEGHRLDHLIRNLEDVRNME--GPVLVHVITRKGKGYKFAEAEPLRFHGICPFSPETGKPAAASESPVPPSYTQVFGNTIVKLARQNPRLVAITAAMCEGTGLNAFAEEFPERFFDVGIAEQHSVTFAAGLATEGILPVVAIYSSFLQRAYDQILHDVCLQNLPVVFALDRAGFVGEDGPTHHGLFDLSYLRSIPNMVVMAPKDENELQHMLHTAVAC-GKPAAVRYPRGSGVGVTMDSQPFSLELGKGEVLCEGGSLAILAVGDPVHPALTAAVQLREEGIYATVVNARFVKPLDRELLLRIVRSFKKILTVEENVLTGGFGSAILEFLEENDIHGIQVKRLGIRDEFAEQATQAEQRRLYGIDEQGIAAAVRS 636
>gi|83591394|ref|YP_425146.1| 1-deoxy-D-xylulose-5-phosphate synthase [Rhodospirillum rubrum ATCC 11170] >gi|118595483|sp|Q2RYD6|DXS1_RHORT 1-deoxy-D-xylulose-5-phosphate synthase 1 (1-deoxyxylulose-5-phosphate synthase 1) (DXP synthase 1) (DXPS 1) >gi|83574308|gb|ABC20859.1| 1-Deoxy-D-xylulose-5-phosphate synthase [Rhodospirillum rubrum ATCC 11170] (645 aa)
Score = 782, Expect = 6.4e-81, Identities = 177/477 (37%), Positives = 279/477 (58%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNN--SKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGK-----NFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAE-LDDKGLYHSLKLSDPNLNSNNQ--------TYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKE 484
           +D I    D + + + +L  LA  +R ++ID       HL S LG+VEL++AL +VFD+P D I +D GHQCY HK++T R D+I T+R+  GLSGF    ES +D    GHS   +S   G    +     ++ V+ VIGD ++S G+A+EA+NN    K+ +++I+NDN MSI+  VGA+   +S+   SKS +L+ + L      KE   ++  ++ ++  +  ++ +G        FE LGF+Y G IDG+ +   + VL+ ++     GP ++HV T KG GY  AE   DK  YH +  S  N+ +  Q        +Y +V    L      D+ I  +  AM   +    L+  +P    DVGIAE+HAVT AAG+A    K FV++YS+FLQR YD ++HDV   +LP+ F +DR     +DG TH G++D+ FL  +PN ++ CA+++ EL R+++ A  + S P  +RY + +   +E+ ++
  S:    10 LDTIRGPSDTRGLSVAQLEQLAREVRAEMIDAVSVTGGHLGSGLGVVELTVALHHVFDTPDDRIIWDVGHQCYPHKILTGRRDRIRTLRQGGGLSGFTLREESPYDPFGAGHSSTSISAGLGMAIGSALAGDARDVVAVIGDGSMSAGMAYEAMNNAGAAKSRLIVILNDNDMSIAPPVGAMSAYLSRLLSSKS-WLSIRTL-----AKEIVARLPDALERTAKRAEEYARGMVTGGGTLFEELGFYYVGPIDGHRMDHLVPVLRNVREAGRDGPVLIHVVTQKGKGYAPAENAPDK--YHGV--SRFNVVTGVQEKAKPQAPSYTAVFGKQLVAAAAKDHRIVGVTAAMPGGTGLDKLATAYPQRCFDVGIAEQHAVTFAAGLACEGLKPFVALYSSFLQRGYDQVVHDVVLQKLPVRFAIDRAGFVGADGATHGGVFDMAFLGCLPNLVVMCAADEAELARMVVTAAGHDSGPIALRYPRGEGVGVEIPED 492
>gi|71892018|ref|YP_277748.1| 1-deoxy-D-xylulose-5-phosphate synthase [Candidatus Blochmannia pennsylvanicus str. BPEN] >gi|118595494|sp|Q493G7|DXS_BLOPB 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|71796124|gb|AAZ40875.1| 1-deoxyxylulose-5-phosphate synthase [Candidatus Blochmannia pennsylvanicus str. BPEN] (624 aa)
Score = 781, Expect = 7.0e-81, Identities = 209/596 (35%), Positives = 334/596 (56%)
  Q:    15 EDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHK----IMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKL-----SDPNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYALQ-----TKESKTC--IISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLG------DDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEI 610
           ++ +++    L  L   LR+ ++      S H +S LG +EL++AL YV+++P D + +D GHQ Y HK++T R ++I +IR  NGL  F   +ES +D +S GHS   +S   G     +     +  + VIGD AI+ G+AFEA+N+  + K+ +LII+NDN MSIS+NVGAL+     I+SK   S       KIL  +L      K I   I K+F+  S      + F  LGF+Y G ++G+++ + + +L+ I+++   GP  LH+ T KG GY+ AE D    +   K      S P  +S N TY ++  ++L ++   DN I  I PAM   S     S+K+P  Y DV IAE+HAVT AAG+AIA  K  V+IYSTFLQR+YD ++HDVA   LP+ F VDR  +  +DG TH G +D+ +L+ IPN II   S+  E + ++   Y+ +  P  +RY K       V    +  + +Y L       +    C  I+++G ++          +  L++  F+     EN+++ L+  KN  V+  + ++  +G      ++ I+   +NKLS  +  I + +  I  G++ +I  +L +D   I+ +I
  S:    18 KELRQLSEDHLAKLCNELRQFLLTSVSKSSGHFASGLGTIELTVALHYVYNTPFDYLIWDVGHQAYPHKILTGRRERIFSIRRKNGLHPFPCRDESEYDVLSVGHSSTSISAGLGLAIAAEREMLGRRTVCVIGDGAITAGMAFEAMNHAGFTKSDLLIILNDNEMSISENVGALNNHHTHILSKKVYSNLKVDNNKILSDVLSTNTLIKHIGNQI-KNFNGTSS-----SLFSQLGFNYIGPVNGHDVLELVYILRNIRDMK--GPQFLHIITKKGCGYEPAEKDPIKWHAVPKFNPESGSLPVEHSKNITYSAIFGDWLCQVAARDNKIIGITPAMREGSGMSIFSQKYPKQYFDVAIAEQHAVTFAAGLAIAGYKPIVAIYSTFLQRAYDQVIHDVAIQNLPVLFAVDRGGIVGADGQTHQGAFDLSYLRCIPNMIIMTPSDACECKLMLYTGYRYRYGPSVVRYPK----GYAVPGNLADTTKLYTLPLSKGVIRRQGNCIAILNFGTLLQSAYNVASKLNATLVDMRFVKPLD-ENLIKTLA--KNHQVLITLEENTVMGGAGSGVNEFIM---QNKLSIPVLNIGLPDFFISQGSQSEILSELGLDSIGIYKKI 619
>gi|33593754|ref|NP_881398.1| 1-deoxy-D-xylulose-5-phosphate synthase [Bordetella pertussis Tohama I] >gi|41016953|sp|Q7VV87|DXS_BORPE 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|33563827|emb|CAE43071.1| 1-deoxy-D-xylulose 5-phosphate synthase [Bordetella pertussis Tohama I] (620 aa)
Score = 781, Expect = 7.0e-81, Identities = 183/466 (39%), Positives = 266/466 (57%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTP---MLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKG----KNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNSNN------QTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTK 473
           +D+I +  D +++   EL  LA  LR  +++       HLSSNLG VELS+AL YVFD+P D I +D GHQ Y HK++T R + ++ +R+  G+SGF + +ES +D   T HS   +S   G     +N    +  I VIGD A+S G+AFEA+NN     TP   +L+++NDN MSIS  VGAL++ +++    +     + + R +L       +    + +   +L +  KG       FE  GF+Y G IDG++L   +  L+ ++ +   G   LHV T KG GYK AE D   LYH     DP +          +T+  V   +L  + E D  +  I PAM   S  +   ++FP  Y DVGIAE+HAVT AAG+A   +K  V+IYSTFLQR YD L+HDVA   L +TF +DR  L  +DG TH G YDI FL+ +PN ++   S++ E   L+   Y++   P  +RY +
  S:     6 LDRILSPADLRQLDRRELKRLADELRGFVLESVSRTGGHLSSNLGTVELSLALHYVFDTPHDRIVWDVGHQSYPHKILTGRREGMAHLRQQGGISGFPKRSESEYDAFGTAHSSTSISAALGMAVASRNAGVQRQHIAVIGDGAMSAGMAFEAMNNAGV--TPNINLLVVLNDNDMSISPPVGALNRYLARLMSGQFYAAAKNVGRAVL-------QHVPPVLELARRLEEHAKGMVTPATLFEEFGFNYVGPIDGHDLDALVPTLQNLRALP--GLQFLHVVTRKGQGYKLAEADPV-LYHGPGKFDPAVGIQQAKAPARKTFTQVFGQWLCDMAERDERLVGITPAMREGSGLVEFEQRFPQRYFDVGIAEQHAVTFAAGLACEGQKPVVAIYSTFLQRGYDQLVHDVALQNLDVTFALDRAGLVGADGATHAGNYDIAFLRCVPNMVVAAPSDESEARLLLSTCYEH-PGPASVRYPR 473
>gi|33597052|ref|NP_884695.1| 1-deoxy-D-xylulose-5-phosphate synthase [Bordetella parapertussis 12822] >gi|33600897|ref|NP_888457.1| 1-deoxy-D-xylulose-5-phosphate synthase [Bordetella bronchiseptica RB50] >gi|41016954|sp|Q7W7Q0|DXS_BORPA 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|41016955|sp|Q7WL37|DXS_BORBR 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|33566503|emb|CAE37759.1| 1-deoxy-D-xylulose 5-phosphate synthase [Bordetella parapertussis] >gi|33568497|emb|CAE32409.1| 1-deoxy-D-xylulose 5-phosphate synthase [Bordetella bronchiseptica RB50] (620 aa)
Score = 781, Expect = 7.0e-81, Identities = 183/466 (39%), Positives = 266/466 (57%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTP---MLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKG----KNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNSNN------QTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTK 473
           +D+I +  D +++   EL  LA  LR  +++       HLSSNLG VELS+AL YVFD+P D I +D GHQ Y HK++T R + ++ +R+  G+SGF + +ES +D   T HS   +S   G     +N    +  I VIGD A+S G+AFEA+NN     TP   +L+++NDN MSIS  VGAL++ +++    +     + + R +L       +    + +   +L +  KG       FE  GF+Y G IDG++L   +  L+ ++ +   G   LHV T KG GYK AE D   LYH     DP +          +T+  V   +L  + E D  +  I PAM   S  +   ++FP  Y DVGIAE+HAVT AAG+A   +K  V+IYSTFLQR YD L+HDVA   L +TF +DR  L  +DG TH G YDI FL+ +PN ++   S++ E   L+   Y++   P  +RY +
  S:     6 LDRILSPADLRQLDRRELKRLADELRGFVLESVSRTGGHLSSNLGTVELSLALHYVFDTPHDRIVWDVGHQSYPHKILTGRREGMAHLRQQGGISGFPKRSESEYDAFGTAHSSTSISAALGMAVASRNAGVQRQHIAVIGDGAMSAGMAFEAMNNAGV--TPNINLLVVLNDNDMSISPPVGALNRYLARLMSGQFYAAAKNVGRAVL-------QHVPPVLELARRLEEHAKGMVTPATLFEEFGFNYVGPIDGHDLDALVPTLQNLRALP--GLQFLHVVTRKGQGYKLAEADPV-LYHGPGKFDPAVGIQQAKAPARKTFTQVFGQWLCDMAERDERLVGITPAMREGSGLVEFEQRFPQRYFDVGIAEQHAVTFAAGLACEGQKPVVAIYSTFLQRGYDQLVHDVALQNLDVTFALDRAGLVGADGATHAGNYDIAFLRCVPNMVVAAPSDESEARLLLSTCYEH-PGPASVRYPR 473
>gi|30249148|ref|NP_841218.1| 1-deoxy-D-xylulose-5-phosphate synthase [Nitrosomonas europaea ATCC 19718] >gi|41016959|sp|Q82VD3|DXS_NITEU 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|30180467|emb|CAD85072.1| Transketolase [Nitrosomonas europaea ATCC 19718] (614 aa)
Score = 781, Expect = 7.2e-81, Identities = 192/546 (35%), Positives = 297/546 (54%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSK--SKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLT-----EKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLN-----SNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFS---FGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEK 553
           +D+I      + +K ++L  LA  LR  +++       HLSSNLG VEL++AL YVFD+P D + +D GHQ Y HK++T R   ++ +R   G++GF   +ES +D   T HS   +S   G       K   +  I VIGD A+S G+AFEALNN       +L+I+NDN MSIS  VGAL+  ++K  MS   + T     EK+L  +    E +K+       +   +         FE  GF+Y G IDG++L   +  L  IK +   GP  LHV T KG GYK+AE +D  LYH +    P+       S    Y  +  ++L  +   D+ +  I PAM   S  +  SK++P+ Y DVGIAE+HAVT AAG A    K  V+IYSTFLQR+YD L+HDVA   LP+ F +DR  L  +DG TH G +D+ +L+ IPN  +   +++ E  +++  A+Q  + P  +RY +     +++++E      G      Q K+    ++++G ++    +        ++N  F+    +E V  + + ++ +  +E+
  S:     5 LDRIEIPAQLRTLKRNQLPQLADELRNFLVESVAGTGGHLSSNLGTVELTIALHYVFDTPFDRLIWDVGHQTYAHKILTGRRTGMARLRMQGGIAGFPRRDESEYDAFGTAHSSTSISAALGMAVAARLKGVKQHAIAVIGDGAMSAGMAFEALNNAGVMDANLLVILNDNDMSISPPVGALNNYLAKL-MSGRFYATARRAGEKMLGVVPPVLELAKR-------AEEHVKGMVTPSTLFEEFGFNYIGPIDGHDLDILLTTLNNIKQLD--GPQFLHVVTRKGKGYKQAE-EDPILYHGVGKFQPDQGIVSKPSAKLAYTQIFGDWLCDMAAKDSRLIGITPAMREGSGLVRFSKEYPDRYFDVGIAEQHAVTFAAGAACEGLKPVVAIYSTFLQRAYDQLIHDVAIQNLPVVFAIDRAGLVGADGPTHAGSFDLSYLRCIPNITVMTPADENECRQMLYTAFQLDT-PAAVRYPRGSGPGVQIQQEMQTIPLGKGEIRRQGKQ--IALLAFGSMLTPCLEAGDELDATVVNMRFVKPLDQELVATLAAEHELLVTIEE 551
>gi|113971066|ref|YP_734859.1| 1-deoxy-D-xylulose-5-phosphate synthase [Shewanella sp. MR-4] >gi|114048296|ref|YP_738846.1| 1-deoxy-D-xylulose-5-phosphate synthase [Shewanella sp. MR-7] >gi|122944500|sp|Q0HSW6|DXS_SHESR 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|123029465|sp|Q0HGL5|DXS_SHESM 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|113885750|gb|ABI39802.1| deoxyxylulose-5-phosphate synthase [Shewanella sp. MR-4] >gi|113889738|gb|ABI43789.1| deoxyxylulose-5-phosphate synthase [Shewanella sp. MR-7] (622 aa)
Score = 781, Expect = 7.6e-81, Identities = 195/601 (32%), Positives = 320/601 (53%)
  Q:    12 PNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI---EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLT-----EKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPN------LNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEK---CEDIEVKKEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           PN  + +++    L  LA  LR+ ++      S H +S LG VEL++AL YV+++P D + +D GHQ Y HK++T R D++ TIR+ NGL  F    ES +D  S GHSG  +S         EK  +  K V+ VIGD A++ G+ FEA+N+       ML+++NDN MSIS+NVGAL+  +++  MS  ++ T     +K+L+ +   KE +K+       +   L         FE LGF+Y G IDG+++   +  L+ ++++   GP +LH+ T KG GY+ AE D  G +H++   DP+            T+  V   +L  + E D  +  I PAM   S  +  S++FP  Y D  IAE+HAVT  AG A    K  V+IYSTFLQR YD L+HDVA   LP+ F +DR  +  +DG TH G +D+ F++ IPN +I   S++ E  +++   Y   + P  +RY +        +E       G  V  ++    +  ++++G  +       ++    +++  F+     + V  +  T+  +  VE+       G  ++ L  + K+   + +I + +  I  G+ E++   L +D   + A+I +
  S:    17 PN--ELRQLPQALLPQLADELREFLLKSVGMSSGHFASGLGTVELTVALHYVYNTPFDRLIWDVGHQAYPHKILTGRRDRMHTIRQKNGLHPFPWREESEYDTFSVGHSGTSISAALAMAVAAEKEQAGRK-VVAVIGDGAMTGGMVFEAMNHAGDLHNDMLMVLNDNEMSISENVGALNNHLAQL-MSGRLYTTIRESSKKVLKGMPVIKEMAKR-------TEEHLKGMVVPGTLFEELGFNYIGPIDGHDVDALVETLRNMRSLK--GPQVLHIMTKKGRGYEPAEKDPIG-WHAVPKFDPSQFKKPATKPGLPTFSQVFGKWLCDIAEQDEKVLGITPAMREGSGMVEFSQRFPKQYFDAAIAEQHAVTLGAGFACEGFKPVVAIYSTFLQRGYDQLIHDVALQRLPVLFAIDRGGIVGADGPTHQGAFDLSFMRCIPNMVIMAPSDENECRQMLYTGYCYDAGPSAVRYPRGSATGATQVEAMTALPIGKGV--IKRLGKRIAMLNFGTTLAAALTAAESLDATVVDMRFVKPLDVDLVKEMAQTHDVLVTVEENAIMGGAGSGVLELLQKLKMPKPVLQIGLPDEFIKHGSPEEVTHDLQLDAEGMLAQINA 618
>gi|167628426|ref|YP_001678925.1| 1-deoxy-d-xylulose-5-phosphate synthase [Heliobacterium modesticaldum Ice1] >gi|167591166|gb|ABZ82914.1| 1-deoxy-d-xylulose-5-phosphate synthase [Heliobacterium modesticaldum Ice1] (647 aa)
Score = 780, Expect = 8.8e-81, Identities = 195/584 (33%), Positives = 315/584 (53%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKSK--SVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLT----EKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKG----KNFFESLGFHYFGVIDGNNLKKTINVLK---RIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNSNNQ-----TYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFS---FGSWVYALQTKESKTCIISYGDIINDLKK-----EIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGN 591
           + +I N  D +++   EL  LA  +R+ II  +     HL+ NLG+VEL++AL  VF SP+D I +D GHQ YVHK++T R +   T+R   G++GF + +ES HD  +TGHS   +S   GF    + K +  +VI VIGD A++ G+A EALN+  +    M++++NDN  SI+ NVGA+   +S+ +     F      E+I+R+I         I   + K   K+   FK        FE LGF Y G IDG+NL +   V+    R+K     GP ++HV T KG GY  AE  +  ++H +   D       +     TY  V ++ L +L   D  I  +  AM   +     ++ FP+ + DVGIAE+HAV  +A +A+   K  V+IYSTFLQR+YD + HDV     P+ F +DR  +   DG+THHG++DI FL+ IP  ++    ++ EL+ ++  A + +  P  +RY +     + + +E +    G     L  + S   I++ G ++   ++     E +     ++NA F+    KE +++       I  VE+   +   G  ++ L     + C +++I I +  +  G+
  S:     5 LSRISNPGDLQRLSATELDQLAKEIREVIIQTTSKNGGHLAPNLGVVELTLALHLVFQSPKDKIIWDVGHQSYVHKLLTGRYNHFHTLRRYKGMAGFPKRSESEHDVFNTGHSSTSISAALGFAFARDLKKEDGAVIAVIGDGALTGGIALEALNHAGHAGNDMIVVLNDNEKSIADNVGAMSTYLSRIRTDPRYFRNKEEVEEIVRRI-------PSIGNHVLKVMEKMKDSFKHLVVPGILFEELGFSYLGPIDGHNLSQLREVMTNACRLK-----GPILVHVLTKKGKGYGPAE-TNPSVFHGVGPFDVETGKVKKHLGPPTYTQVFSDTLLRLAREDERIVGVTAAMPDGTGMTPFARAFPSRFFDVGIAEQHAVNMSAALALQGLKPVVAIYSTFLQRAYDQVFHDVCLQRAPVVFAIDRGGIVGDDGETHHGLFDIAFLRHIPELVMMAPKDENELQHMLRTALEYEG-PIAVRYPRGTGVGVTLDEELTTVPIGRG--ELLRQGSDVTIVAIGAMVGIAEEAADLLEAEGIRAAVVNARFVKPLDKELIIKQARETGRIVTVEEHVLAGGFGSAILELLEMEGVHCAVRRIGIPDEYVQHGS 598
>gi|94985099|ref|YP_604463.1| 1-deoxy-D-xylulose-5-phosphate synthase [Deinococcus geothermalis DSM 11300] >gi|118595513|sp|Q1IZP0|DXS_DEIGD 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|94555380|gb|ABF45294.1| deoxyxylulose-5-phosphate synthase [Deinococcus geothermalis DSM 11300] (633 aa)
Score = 780, Expect = 9.7e-81, Identities = 183/483 (37%), Positives = 282/483 (58%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNS--KSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFK--GKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDP----NLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIE--VKKEFSFGSW 490
           +D++ + ED K++   +L  LA  LR++I+ +      HL+S+LG  +L +AL YV  SP+D I +D GHQ Y HKM+T R   + T+++  GLSGF + +ES HD I+ GH+   L+   G     ++  +   V  VIGD +++ G+A  ALN I      MLI++NDN MSIS+NVGA+++ M   Q+ K     E+  +K +  +  SK +   + ++ S    FF     N F ++G  Y G +DG+N+++ + +++R+ ++   GPTILHV T KG G   AE D    +H     DP    ++ SN  ++ S   + + +L   D    +I PAM   S  +  S+  P+ Y DVGIAE+ AVT AAGMA+   +  V+IYSTFLQR+YD +LHDVA   L +TF +DR  +  +DG TH+G++D+ +L+SIPN  I    +  EL  ++  A Q  + PF IRY +   E +      E  +G+W
  S:    17 LDRVNSPEDLKRLGRDQLPQLAAELREEIVRVCSVGGLHLASSLGATDLIVALHYVLHSPRDRILFDVGHQAYAHKMLTGRRHLMHTVKKEGGLSGFTKVSESEHDAITVGHASTSLANALGMALARDALGQDYKVAAVIGDGSLTGGMALAALNTIGDLGRRMLIVLNDNEMSISENVGAINRFMRGLQVQKWFQEGEEAGKKAV--QAVSKPLANLMSRAKSSTRHFFDPASVNPFAAMGVRYVGPVDGHNVQELVWLIERLVDLD--GPTILHVVTKKGKGLSYAEADPIK-WHGPGKFDPATGESVPSNAYSWSSAFGDAVTELARLDPRTFVITPAMREGSGLVRYSQVHPHRYLDVGIAEDVAVTTAAGMALQGMRPIVAIYSTFLQRAYDQVLHDVAIENLNVTFAIDRGGIVGADGATHNGVFDLSYLRSIPNVGIGLPKDAAELRGMLKYA-QEHAGPFAIRYPRGNVERVPEGTWPELRWGTW 503
>gi|196194966|gb|EDX89925.1| 1-deoxy-D-xylulose-5-phosphate synthase [Alcanivorax sp. DG881] (640 aa)
Score = 780, Expect = 9.8e-81, Identities = 165/466 (35%), Positives = 269/466 (57%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWS-IYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNSNNQT--------YGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTK 473
           +D + +  D +++   +L  +   LR+ ++        H  + LG+VEL++AL Y++ +P D + +D GHQCY HK++T R + +++IR++ GLSGF + +ES +D    GHS   +S   G     +     +  + +IGD A++ G AFEA+++ A+ ++ +L+I+NDN MSIS NVG L    ++   SKS     +  +K+L     +    W  I ++   +         FE++GF+Y G IDG+N+ + +  L  ++++   GP +LH+ T KG G+  AE D  G YH++   +P                Y  +   +L  + E D+ +  I PAM   S  +  S++FP+ Y DV I E+HAVT A G+A  N+K  V+IYSTFLQR YD L+HDVA  EL +TF +DR  L   DG TH G++D+ +L+++PN II   S++ E  +L+  AY ++  P  +RY +
  S:    18 LDTLSSPADLRQLPASQLERVVDELREYLLYAVGQCGGHFGAGLGVVELTVALHYLYHTPDDKLVWDVGHQCYPHKILTGRRESLTSIRQAGGLSGFPKRSESEYDTFGVGHSSTSISAALGMALGAEMAGSDRRAVAIIGDGAMTAGQAFEAMSHAAHTRSNLLVILNDNNMSISHNVGGLSNYFARIWASKSYIALREGGKKVLS----TMPAAWDFIRRTEESMKNMVSPDMLFEAIGFNYIGPIDGHNVDELVRTLGNLRDLE--GPQLLHIYTTKGKGFAPAEADPVG-YHAINKIEPKPKVQVAVPSKPKLPKYQDIFGQWLCDMAEQDSRLVGITPAMCEGSGMVEFSRRFPDRYHDVAICEQHAVTLAGGLACENQKPVVAIYSTFLQRGYDQLIHDVALQELDVTFGLDRAGLVGEDGATHGGVFDLAYLRTVPNMIIAAPSDENECRQLLYSAYLHEG-PAAVRYPR 486
>gi|183601042|ref|ZP_02962535.1| hypothetical protein PROSTU_04663 [Providencia stuartii ATCC 25827] >gi|188019380|gb|EDU57420.1| hypothetical protein PROSTU_04663 [Providencia stuartii ATCC 25827] (622 aa)
Score = 780, Expect = 1.0e-80, Identities = 181/539 (33%), Positives = 297/539 (55%)
  Q:    15 EDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWS---IYKSFSKLSKFFKGK----NFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNL------NSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEK 553
           E+ + +    L  L   LR+ ++      S H +S LG VEL++AL YV+ +P D + +D GHQ Y HK++T R D+I TIR+ NGL  F   +ES +D +S GHS   +S   G     +   K++  + VIGD AI+ G+AFEA+N+       ML+I+NDN MSIS+NVGAL+  ++   +S  ++ T          +E  KK++ +   I +   K  +  KG       FE LGF+Y G +DG+++   +  LK ++++   GP  LH+ T KG GY+ AE D    +H++   DP+            T+  +  ++L +  + D+ +  I PAM   S  +  SK++PN Y DV IAE+HAVT AAG+AI      V+IYSTFLQR YD ++HDVA  + PI F +DR  +  +DG TH G +DI +L+ IP  +I   S++ E  +++   Y  K  P  +RY +      E++           ++ +  K  I+ +G ++       +  +  +++  F+    +  +L +++++  +  +E+
  S:    18 EELRLLPKESLPKLCDELRQFLLSSVGRSSGHFASGLGAVELTVALHYVYKTPFDNLVWDVGHQAYPHKILTGRRDRIDTIRQKNGLHPFPWRDESEYDVLSVGHSSTSISAGLGMAIAAEKEDKNRKTVCVIGDGAITAGMAFEAMNHAGDVAPDMLVILNDNEMSISENVGALNNHLAHL-LSGKLYTT---------LREGGKKVFSNMPPIKELLKKTEEHIKGMVVPGTMFEELGFNYIGPVDGHDVVALVQTLKNMRDLK--GPQFLHIMTKKGRGYEPAEKDPIS-WHAVPKFDPSTFTLPKSKETRPTFSKIFGDWLCEEAQNDDKLMAITPAMREGSGMVRFSKEYPNQYFDVAIAEQHAVTFAAGLAIGGYNPIVAIYSTFLQRGYDQVIHDVAIQKTPILFAIDRAGIVGADGQTHQGAFDISYLRCIPTLVIMTPSDENECRQMLHTGYHYKDGPSAVRYPRGTGTGAELQPLAPLPIGKGVIRRQGEKIAILCFGTLLKHALDAAEALNATVVDMRFVKPLDEALILDMVNSHDMLVTLEE 558
>gi|155369183|dbj|BAF75640.1| 1-deoxy-D-xylulose-5-phosphate synthase [Croton stellatopilosus] (720 aa)
Score = 780, Expect = 1.1e-80, Identities = 181/456 (39%), Positives = 274/456 (60%)
  Q:    18 KKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKSK--SVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNG-MSISKN--------VGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKG------KNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAE-LDDKGLYHSLKLSDPNLNSNNQTYGSVAAN---FLEKLI---EYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTK 473
           K + + EL  LA  LR  +I        HL S+LG+VEL++AL Y+F++PQD I +D GHQ Y HK++T R D++ TIR++NGLSGF +  ES HD   TGHS   +S   G     + K +  +V+ VIGD A++ G A+EA+NN  Y  + M++I+NDN  +S+           VGAL   +S+ Q ++ +    + LR+I   K  +K+I   +++  +K+ ++ +G       + FE LG +Y G +DG+N++  +++LK +K+    GP ++HV T KG GY  AE   DK  YH +   DP      ++ GS  +    F E LI   E D +I  I+ AM   +      ++FPN   DVGIAE+HAVT AAG+A    K F +IYS+F+QR+YD ++HDV   +LP+ F +DR  L  +DG TH G +D+ F+   PN ++   SN+ EL  ++  A      P   RY +
  S:    86 KNLSIKELKQLAEELRSDVIFNVSKTGGHLGSSLGVVELTVALHYIFNTPQDKILWDVGHQSYPHKILTGRRDRMRTIRQTNGLSGFTKRAESEHDCFGTGHSSTTISAGLGMAVGRDLKERKNNVVAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPIPPVGALSSALSRLQSNRPL----RELREI--AKGVTKQIGGQMHELAAKVDEYARGMISASGSSLFEELGLYYIGPVDGHNIEDLVDILKEVKSTKSTGPVLIHVVTEKGRGYPYAERAADK--YHGVTKFDPATGKQFKSGGSTQSYTTYFAEALIAEAEVDKDIVAIHAAMGGGTGLNLFHRRFPNKCFDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFMQRAYDQVVHDVDLQKLPVRFAMDRAGLIGADGPTHCGAFDVTFMACPPNMVVMAPSNEAELFNMVATAAAIDDRPSCFRYPR 557
>gi|118595489|sp|Q5NM38|DXS2_ZYMMO 1-deoxy-D-xylulose-5-phosphate synthase 2 (1-deoxyxylulose-5-phosphate synthase 2) (DXP synthase 2) (DXPS 2) (650 aa)
Score = 780, Expect = 1.1e-80, Identities = 176/466 (37%), Positives = 262/466 (56%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNSNNQ--------TYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTK 473
           +DKI    + +++  + L  LA  LRK+ I        HL S LG++EL++AL YVF++P+D + +D GHQ Y HK++T R D+I T+R+ +GLSGF +  ES +D     HS   +S   GF    K +      + +IGD +++ G+A+EA+NN       +++I+NDN MSIS  VGAL   +S+   S+       I+R ++      K +  +  K+         G  FFE LGF+Y G +DG+NL + I VL+ +++    GP ++HV T KG GY  AE   K  YH+++  D  + S  Q        +Y SV +  L K  + D+ I  I  AM   +      + FP    DVGIAE+HAVT AAG+A A  K F  +YSTFLQR YD L+HDVA   LP+ F VDR  L  +DG TH G +D+ F+ ++PN ++   S++ EL  ++         P  +RY +
  S:    10 LDKIKTPAELRQLDRNSLRQLADELRKETISAVGVTGGHLGSGLGVIELTVALHYVFNTPKDALVWDVGHQTYPHKILTGRRDRIRTLRQRDGLSGFTQRAESEYDAFGAAHSSTSISAALGFAMASKLSDSDDKAVAIIGDGSMTAGMAYEAMNNAKAAGKRLIVILNDNEMSISPPVGALSSYLSRLISSRPFMNLRDIMRGVV--NRMPKGLATAARKADEYARGMATGGTFFEELGFYYVGPVDGHNLDQLIPVLENVRD-AKDGPILVHVVTRKGQGYAPAEAA-KDKYHAVQRLD--VVSGKQAKAPPGPPSYTSVFSEQLIKEAKQDDKIVTITAAMPTGTGLDRFQQYFPERMFDVGIAEQHAVTFAAGLAAAGYKPFCCLYSTFLQRGYDQLVHDVAIQNLPVRFAVDRAGLVGADGATHAGSFDLAFMVNLPNMVVMAPSDERELANMVHSMAHYDQGPISVRYPR 479
>gi|56552494|ref|YP_163333.1| 1-deoxy-D-xylulose-5-phosphate synthase [Zymomonas mobilis subsp. mobilis ZM4] >gi|56544068|gb|AAV90222.1| deoxyxylulose-5-phosphate synthase [Zymomonas mobilis subsp. mobilis ZM4] (660 aa)
Score = 780, Expect = 1.1e-80, Identities = 176/466 (37%), Positives = 262/466 (56%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNSNNQ--------TYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTK 473
           +DKI    + +++  + L  LA  LRK+ I        HL S LG++EL++AL YVF++P+D + +D GHQ Y HK++T R D+I T+R+ +GLSGF +  ES +D     HS   +S   GF    K +      + +IGD +++ G+A+EA+NN       +++I+NDN MSIS  VGAL   +S+   S+       I+R ++      K +  +  K+         G  FFE LGF+Y G +DG+NL + I VL+ +++    GP ++HV T KG GY  AE   K  YH+++  D  + S  Q        +Y SV +  L K  + D+ I  I  AM   +      + FP    DVGIAE+HAVT AAG+A A  K F  +YSTFLQR YD L+HDVA   LP+ F VDR  L  +DG TH G +D+ F+ ++PN ++   S++ EL  ++         P  +RY +
  S:    20 LDKIKTPAELRQLDRNSLRQLADELRKETISAVGVTGGHLGSGLGVIELTVALHYVFNTPKDALVWDVGHQTYPHKILTGRRDRIRTLRQRDGLSGFTQRAESEYDAFGAAHSSTSISAALGFAMASKLSDSDDKAVAIIGDGSMTAGMAYEAMNNAKAAGKRLIVILNDNEMSISPPVGALSSYLSRLISSRPFMNLRDIMRGVV--NRMPKGLATAARKADEYARGMATGGTFFEELGFYYVGPVDGHNLDQLIPVLENVRD-AKDGPILVHVVTRKGQGYAPAEAA-KDKYHAVQRLD--VVSGKQAKAPPGPPSYTSVFSEQLIKEAKQDDKIVTITAAMPTGTGLDRFQQYFPERMFDVGIAEQHAVTFAAGLAAAGYKPFCCLYSTFLQRGYDQLVHDVAIQNLPVRFAVDRAGLVGADGATHAGSFDLAFMVNLPNMVVMAPSDERELANMVHSMAHYDQGPISVRYPR 489
>gi|56552130|ref|YP_162969.1| 1-deoxy-D-xylulose-5-phosphate synthase [Zymomonas mobilis subsp. mobilis ZM4] >gi|81354958|sp|Q5NN52|DXS1_ZYMMO 1-deoxy-D-xylulose-5-phosphate synthase 1 (1-deoxyxylulose-5-phosphate synthase 1) (DXP synthase 1) (DXPS 1) >gi|56543704|gb|AAV89858.1| deoxyxylulose-5-phosphate synthase [Zymomonas mobilis subsp. mobilis ZM4] (649 aa)
Score = 780, Expect = 1.1e-80, Identities = 176/466 (37%), Positives = 262/466 (56%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNSNNQ--------TYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTK 473
           +DKI    + +++  + L  LA  LRK+ I        HL S LG++EL++AL YVF++P+D + +D GHQ Y HK++T R D+I T+R+ +GLSGF +  ES +D     HS   +S   GF    K +      + +IGD +++ G+A+EA+NN       +++I+NDN MSIS  VGAL   +S+   S+       I+R ++      K +  +  K+         G  FFE LGF+Y G +DG+NL + I VL+ +++    GP ++HV T KG GY  AE   K  YH+++  D  + S  Q        +Y SV +  L K  + D+ I  I  AM   +      + FP    DVGIAE+HAVT AAG+A A  K F  +YSTFLQR YD L+HDVA   LP+ F VDR  L  +DG TH G +D+ F+ ++PN ++   S++ EL  ++         P  +RY +
  S:    10 LDKIKTPAELRQLDRNSLRQLADELRKETISAVGVTGGHLGSGLGVIELTVALHYVFNTPKDALVWDVGHQTYPHKILTGRRDRIRTLRQRDGLSGFTQRAESEYDAFGAAHSSTSISAALGFAMASKLSDSDDKAVAIIGDGSMTAGMAYEAMNNAKAAGKRLIVILNDNEMSISPPVGALSSYLSRLISSRPFMNLRDIMRGVV--NRMPKGLATAARKADEYARGMATGGTFFEELGFYYVGPVDGHNLDQLIPVLENVRD-AKDGPILVHVVTRKGQGYAPAEAA-KDKYHAVQRLD--VVSGKQAKAPPGPPSYTSVFSEQLIKEAKQDDKIVTITAAMPTGTGLDRFQQYFPERMFDVGIAEQHAVTFAAGLAAAGYKPFCCLYSTFLQRGYDQLVHDVAIQNLPVRFAVDRAGLVGADGATHAGSFDLAFMVNLPNMVVMAPSDERELANMVHSMAHYDQGPISVRYPR 479
>gi|17546940|ref|NP_520342.1| 1-deoxy-D-xylulose-5-phosphate synthase [Ralstonia solanacearum GMI1000] >gi|21263512|sp|Q8XX95|DXS_RALSO 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|17429240|emb|CAD15928.1| probable 1-deoxy-d-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (dxp synthase) (dxps) protein [Ralstonia solanacearum] (636 aa)
Score = 780, Expect = 1.1e-80, Identities = 188/538 (34%), Positives = 292/538 (54%)
  Q:    16 DFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIA-YNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKG----KNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFG--PTILHVKTIKGLGYKEAELD-----DKGLYHSLKLSDPNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEV----------KKEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEK 553
           + +++   +L  LA  LR  +++       HLSSNLG VEL++AL YVF++P D I +D GHQ Y HK++T R ++++T+R+ +G+SGF   +ES +D   T HS   +S   G     K   +++  I VIGD A+S G+AFEA+NN   Y   P+++++NDN MSIS  VGAL++ +++    +    T+K + K+L        +   + +   +  +  KG       FE  GF+Y G IDG++L+  +  L+ I+     G  P  LHV T KG GYK AE D       G ++  +   P       +Y  V   +L  +   D  +  I PAM   S  +   ++FP+ Y DVGIAE+HAVT A G+A    K  V+IYSTFLQR YD L+HDVA   LP+ F +DR  L  +DG TH G YD+ +L+ IPN ++   +++ E  +L+  A+     P  +RY +     + V          K E    S   A Q    +  I+++G ++       +     ++N  F+       VL +  T+  +  VE+
  S:    14 ELRRLDRRQLGTLADELRAFVLESVAQTGGHLSSNLGTVELTIALHYVFNTPDDRIVWDVGHQSYPHKILTGRREQMATLRQLDGISGFPRRSESPYDTFGTAHSSTSISAALGMALGAKTQGENRVAIAVIGDGAMSAGMAFEAMNNAGVYRNLPLVVVLNDNDMSISPPVGALNRYLARLMSGQFYAATKKGVEKLL-------SVAPPVLEFAKRFEEHAKGMLVPATMFEEFGFNYIGPIDGHDLESLVPTLQNIRQRALEGGRPQFLHVVTKKGQGYKLAEADPILYHGPGKFNPQEGIKPAARPAKVSYTQVFGQWLCDMAAADKRLVGITPAMREGSGMVEFEQRFPDRYYDVGIAEQHAVTFAGGLACEGLKPVVAIYSTFLQRGYDQLIHDVALQNLPVVFALDRAGLVGADGATHAGAYDMAYLRCIPNMMVMAPADENECRQLLSTAFAQDC-PTAVRYPRGAGTGVVVQPTLEPLPVGKAEVRRASTAPAGQ----RVVILAFGSMVAPAAAAAERLDATVVNMRFVKPLDAACVLEMARTHDYVVTVEE 563
>gi|161522966|ref|YP_001585895.1| deoxyxylulose-5-phosphate synthase [Burkholderia multivorans ATCC 17616] >gi|189348205|ref|YP_001941401.1| 1-deoxy-D-xylulose-5-phosphate synthase [Burkholderia multivorans ATCC 17616] >gi|160346519|gb|ABX19603.1| deoxyxylulose-5-phosphate synthase [Burkholderia multivorans ATCC 17616] >gi|189338343|dbj|BAG47411.1| 1-deoxy-D-xylulose-5-phosphate synthase [Burkholderia multivorans ATCC 17616] (675 aa)
Score = 780, Expect = 1.1e-80, Identities = 172/458 (37%), Positives = 263/458 (57%)
  Q:    16 DFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIE--KNNSKSKSVIPVIGDAAISNGLAFEALNNIAY-NKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNL-----NSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTK 473
           D +++ +H L  LA  LR  ++D       HL+SNLG VE+++AL YVFD+P D I +D GHQ Y HK++T R D ++ IR+S G+SGF    ES +D   T HS   +S   G +   +   +++  + VIGD A+S G+AFEALNN       P+++++NDN MSIS  VGAL   + +   S++    ++ ++ +L   + +  I     +  +++  +      FE  G +Y G IDG+++   I+ L  +K  VP GP +LHV T KG GY  AE D  G YH     DP +      +   TY  V +++L      D  +  I PAM   S  ++  ++FP  Y DV IAE+HAVT AAG+A    +  V+IYSTFLQR YD L+HDVA   L +TF +DR  +  +DG TH G +D+ +L+ +PN ++   S++ E  +++  A  +   P  +RY++
  S:    13 DLRRLPVHALRPLADELRAFVLDSVAKTGGHLASNLGSVEVAIALHYVFDTPYDRIVWDVGHQSYPHKILTGRRDAMAGIRQSGGISGFPCRTESEYDAFGTAHSSTSISAALGMVHAARLRGETRHCVAVIGDGALSAGMAFEALNNAGVAGDLPLIVLLNDNDMSISPPVGALRHALGRLTASRTYTQAKRHMQDVL---DLAPSIRQLANRMETQVKGWLAPATLFEEFGLNYAGPIDGHDVHALIDALLNLKR-VP-GPHLLHVVTQKGHGYAHAERDPVG-YHGPGKFDPAVGLVPGKAGRPTYARVFSDWLCDEAARDERVVAITPAMRDGSGLVDFERRFPERYFDVAIAEQHAVTFAAGLAAEGMRPVVAIYSTFLQRGYDQLIHDVALQRLSVTFAIDRAGIVGADGATHMGAFDLAYLRCVPNLVVMAPSDENECRQMLHTALHH-PGPCAVRYSR 471
>gi|170760576|ref|YP_001787209.1| 1-deoxy-D-xylulose-5-phosphate synthase [Clostridium botulinum A3 str. Loch Maree] >gi|169407565|gb|ACA55976.1| 1-deoxy-D-xylulose-5-phosphate synthase [Clostridium botulinum A3 str. Loch Maree] (622 aa)
Score = 779, Expect = 1.1e-80, Identities = 211/608 (34%), Positives = 330/608 (54%)
  Q:     3 KNKVKIDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKSK--SVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFK-KEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELD-DKGLYHSLKLSDPNLNSNNQ----TYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKE---KCEDIEVKKEFSFGSWVYALQTKESKTCIISYGDIIN------DLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEI 610
           K K  +DK  +++  K M ++EL   +  +R+ +ID       HL+SNLG+VEL++++  VFD  +D I +D GHQ YVHK++T R DK +T+R+  GLSGF +  ES +D   TGHS   +S   G     + K +   VI VIGD A++ G+AFEALN++ +NKT ++II+NDN MSI++NVG +   +SK ++  +    +K +   L K     K +  S+ +  + + +      FFE+LG  Y G IDG+++K+   V+K  K+I   GP ++H  T KG GY  AE   DK  +HS+   D      N     +Y  V    L K+ + D  +  I  AM   +     ++ FP  + DVGIAE+HAVT AAG+A    K   ++YSTFLQR+YD +LHD+    LP+ F +DR  +  SDG+TH GI+D+ +L S+PN  I       E++ ++  A  N+++P  IRY +    K  ++   K    G W   +  +E    II+ G ++       +  KE   KS  ++NA FI    KE +   +     I  VE        G  ++   +E K +  +  +  ++  +  G+ + + K   +D   I   I
  S:     2 KMKNILDKYQDFDSIKSMSINELNQFSYEIREFLIDNVSKTGGHLASNLGVVELTLSIFNVFDLNKDKIIWDVGHQAYVHKILTGRKDKFNTLRQYGGLSGFPKKCESPYDAFETGHSSTSISAALGMARARDIKGEDNKVIAVIGDGALTGGMAFEALNDLGFNKTDLIIILNDNQMSIAENVGGMSSYLSKVRLDPTYNKLKKEVNNTLNKIPNVGKGMARSLERVKNGIKQMIVPGMFFENLGIKYLGPIDGHDIKELSKVMKMAKDIK--GPVLIHTITKKGKGYAYAEKKPDK--FHSIGSFDCTSGEINSKACLSYSGVFGEELTKIGKEDKRVVAITAAMKDGTGLRKFAETFPKRFFDVGIAEQHAVTLAAGIATEGLKPVFAVYSTFLQRAYDQILHDICIQNLPVVFAIDRAGIVGSDGETHQGIFDLSYLSSLPNMTIIAPKCLEEMKPMLKWAL-NQNSPVAIRYPRGGDIKSLEMTPIKNMKKGKW--EVICEEGDIAIIATGKMVQHAIIAREKLKEYGIKST-IVNANFINPIDKELIKNFVKKGYKIVTVEDNVIKGGFGSLVLQYISELKANNTVLNLGFKDKFVPHGSTDILYKIEGLDPEGIVKNI 618
>gi|194097633|ref|YP_002000669.1| 1-deoxy-D-xylulose-5-phosphate synthase [Neisseria gonorrhoeae NCCP11945] >gi|193932923|gb|ACF28747.1| 1-deoxy-D-xylulose-5-phosphate synthase [Neisseria gonorrhoeae NCCP11945] (637 aa)
Score = 779, Expect = 1.3e-80, Identities = 190/546 (34%), Positives = 306/546 (56%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGF--IEKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKF-------QMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSL----KLSDPNLNSNNQ-------TYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTK---------EKCEDIEVKKEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEK 553
           +D I + +D +++   +L  LA  LR  +++       H +SNLG VEL++AL YV+D+P+D + +D GHQ Y HK++T R +++ T+R+  GL+GF +  ES +D    GHS   +    G    +K     +  + +IGD A++ G AFEALN        +L+++NDN MSIS NVGAL K ++          +S     T K+L KI    E+++K+   I     +     +  + FE+ GF Y G +DG+N++  ++VLK +++    GP +LHV T KG GYK AE +D   YH++    K     + S  +       TY  V   +L      D+ +  I PAM   S  +   ++FP+ Y DVGIAE+HAVT A G+A    K  V+IYSTFLQR+YD L+HD+A   LP+ F VDR  +  +DG TH G+YD+ FL+ +PN I+   S++ E   L+   YQ  + P  +RY +         +  E +E+ K          ++ +  KT  I++G ++       +  +  + +  F+    +E ++R+  ++  I  +E+
  S:     7 LDLIDSPQDLRRLDKKQLPRLAGELRAFLLESVGQTGGHFASNLGAVELTIALHYVYDTPEDKLVWDVGHQSYPHKILTGRKNQMHTMRQYGGLAGFPKRCESEYDAFGVGHSSTSIGAALGMAATDKLLGGDRRSVAIIGDGAMTAGQAFEALNCAGDMDVDLLVVLNDNEMSISPNVGALPKYLASNVVRDMHGLLSTVKAQTGKVLDKIPGAMEFAQKVEHKIKTLAEEAEHAKQSLSLFENFGFRYTGPVDGHNVENLVDVLKDLRS--RKGPQLLHVITKKGNGYKLAE-NDPVKYHAVANLPKEGGAQMPSEKEPKPAAKPTYTQVFGKWLCDRAAADSRLVAITPAMREGSGLVEFEQRFPDRYFDVGIAEQHAVTFAGGLACEGMKPVVAIYSTFLQRAYDQLVHDIALQNLPVLFAVDRAGIVGADGPTHAGLYDLSFLRCVPNMIVAAPSDENECRLLLSTCYQADA-PAAVRYPRGTGTGAPVSDGMETVEIGKGI--------IRREGEKTAFIAFGSMVAPALAVAEKLNATVADMRFVKPIDEELIVRLARSHDRIVTLEE 569
>gi|88704426|ref|ZP_01102140.1| 1-deoxy-D-xylulose-5-phosphate synthase [gamma proteobacterium KT 71] >gi|88701477|gb|EAQ98582.1| 1-deoxy-D-xylulose-5-phosphate synthase [Congregibacter litoralis KT71] (646 aa)
Score = 779, Expect = 1.4e-80, Identities = 191/548 (34%), Positives = 301/548 (54%)
  Q:    45 AHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKS--KSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKS-VFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGK----NFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLS-DPNLNSNNQT------------YGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDI---EVKKEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNK 592
            H  + LG+VEL++AL  VFD+P+D + +D GHQ Y HK++T R  ++ TIR++ GL+GF + +ES +D    GHS   +S   G       +   + V+ VIGD AI+ G+AFEAL +    +  ML+I+NDN MSI KN G L K  +K   SK+ + + E   R +   K       W + K   +  +  KG       FE LG+HY G IDG++L + +  L+ ++++   GP  LHV T+KG GY  AE D  G +   KL   P+L + +              Y  V   +L  +   D+ +  I PAM   S  +  + ++P+ + DV IAE+HAVT AAGMA    K  V+IYSTFLQR+YD L+HDVA  +L +TF +DR  L   DG THHG +DI +L+ IPN +I   S++ E  +++  AY++   P  IRY +         E   E   G  V     +E    I+++G + ++  K  +     +++  ++    +E +L + +++  I  +E+   +   G  +    ++N + C +K   I +  I  G++
  S:    52 GHFGAGLGVVELTIALHRVFDTPRDRVVWDVGHQAYPHKILTGRMQRMHTIRQAGGLAGFPKRSESDYDTFGVGHSSTSISAAMGMALAAAREKDPRRVVAVIGDGAITGGMAFEALAHAGDVRPNMLVILNDNQMSIGKNTGGLAKYFAKIWASKTYISMREGGKRALAMIKP-----AWDLAK---RTEEHMKGMVAPGTLFEELGWHYIGPIDGHDLPQLVQTLENMRDLE--GPQFLHVLTMKGKGYSPAEADPIGFHAINKLEVKPSLEAGDAPPAAPPPTLKKVKYQDVFGQWLCDMAATDDRLMAITPAMCEGSGMVPYAAQYPDRFFDVAIAEQHAVTLAAGMACEGAKPVVAIYSTFLQRAYDQLVHDVALQKLDVTFAIDRAGLVGQDGPTHHGAFDISYLRCIPNMVIGAPSDENECRQMLYTAYRH-PGPAAIRYPRGTGPGALIEETMAELPIGKAVLVRPGQE--IAILNFGALFSEAMKAGEELDATVVDMRWVKPLDEEMILELAASHSLIITLEENAIAGGAGSAVAEYLSQNNVRCPVKHFGIPDEFIDHGDQ 609
>gi|9107403|gb|AAF85048.1|AE004037_9 deoxyxylulose-5-phosphate synthase [Xylella fastidiosa 9a5c] (670 aa)
Score = 778, Expect = 1.6e-80, Identities = 194/606 (32%), Positives = 321/606 (52%)
  Q:     7 KIDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGF--IEKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTP---MLIIINDNGMSISKNVGALHKIMSKFQMSKS----------VFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPN-----LNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFS-FGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           ++ +I   ED +  +  EL  +A  LR  +I+       H ++ LG+VEL++AL Y++ +P D + +D GHQ Y HK++T R DKIST++   GL+ F +  ESI+D    GHS   +S   G   + + +   + V+ +IGD A++ G+A+EALN+ A   +P   +L+I+NDN MSIS+ VG L K++ +   SK+          +F  +K      F + W +  +W            F     FE +GFHY G IDG++L   +  LK ++ +   GP +LHV T KG GY+ AE D  G YH++   DP        +  QTY  V + +L  +   +  +  I PAM   S  +  S+++P  Y DV IAE+HA+T AAGMA    K  V+IYSTFLQR YD L+HDVA  +L + F VDR  +   DG TH G  D+ FL+ +PN ++   +++ E  +++   + + S P  +RY +     +    E       V  L+   ++  ++ +G  +   ++  +   + ++N  FI    +  +L +  T++    +E    +   G  +  L N   +   I  + + +      ++ED+  +  ID   ++A + S
  S:    44 RLSRIQIPEDLRTFQESELRAVADELRNYLIESVGLSGGHFAAGLGVVELTIALHYLYCTPIDHLVWDVGHQTYPHKILTGRRDKISTVKHQGGLAPFPKREESIYDTFGVGHSSTSISAALGMAIVAQRHGDERKVVAIIGDGAMTAGMAYEALNH-AGGMSPAPNLLVILNDNRMSISEAVGGLTKMLGRATGSKALNAIREGGKRIFGDKKTNATARFLRRWEE--HWK---------GMFVPSTLFEEMGFHYTGPIDGHDLPALLGALKTLRTLK--GPQLLHVITTKGKGYELAEGDQIG-YHAVAPFDPQKGLIKAGAKKQTYTDVFSEWLCDMAAVEPRLLAITPAMREGSGLVRFSQEYPQRYFDVAIAEQHAITLAAGMATQGAKPVVAIYSTFLQRGYDQLVHDVALQKLDVLFAVDRGGVVGPDGATHAGNLDLSFLRCVPNMMLMAPADEAECRKMLSTGF-HYSGPVAVRYPRGTGPGVVPSAELDVLPVGVAQLRHSGTRIALLGFGVCVAPAEQVGRRLGLTVVNMRFIKPLDRTLLLELARTHEGFVTIEDNVVAGGAGSGVAELLNAEGIVLPIVHLGLPDAFQQHASREDLLAEAGIDAAGVYAALLS 654
>gi|77747589|ref|NP_299528.2| 1-deoxy-D-xylulose-5-phosphate synthase [Xylella fastidiosa 9a5c] >gi|13124144|sp|Q9PB95|DXS_XYLFA 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) (635 aa)
Score = 778, Expect = 1.6e-80, Identities = 194/606 (32%), Positives = 321/606 (52%)
  Q:     7 KIDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGF--IEKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTP---MLIIINDNGMSISKNVGALHKIMSKFQMSKS----------VFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPN-----LNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFS-FGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           ++ +I   ED +  +  EL  +A  LR  +I+       H ++ LG+VEL++AL Y++ +P D + +D GHQ Y HK++T R DKIST++   GL+ F +  ESI+D    GHS   +S   G   + + +   + V+ +IGD A++ G+A+EALN+ A   +P   +L+I+NDN MSIS+ VG L K++ +   SK+          +F  +K      F + W +  +W            F     FE +GFHY G IDG++L   +  LK ++ +   GP +LHV T KG GY+ AE D  G YH++   DP        +  QTY  V + +L  +   +  +  I PAM   S  +  S+++P  Y DV IAE+HA+T AAGMA    K  V+IYSTFLQR YD L+HDVA  +L + F VDR  +   DG TH G  D+ FL+ +PN ++   +++ E  +++   + + S P  +RY +     +    E       V  L+   ++  ++ +G  +   ++  +   + ++N  FI    +  +L +  T++    +E    +   G  +  L N   +   I  + + +      ++ED+  +  ID   ++A + S
  S:     9 RLSRIQIPEDLRTFQESELRAVADELRNYLIESVGLSGGHFAAGLGVVELTIALHYLYCTPIDHLVWDVGHQTYPHKILTGRRDKISTVKHQGGLAPFPKREESIYDTFGVGHSSTSISAALGMAIVAQRHGDERKVVAIIGDGAMTAGMAYEALNH-AGGMSPAPNLLVILNDNRMSISEAVGGLTKMLGRATGSKALNAIREGGKRIFGDKKTNATARFLRRWEE--HWK---------GMFVPSTLFEEMGFHYTGPIDGHDLPALLGALKTLRTLK--GPQLLHVITTKGKGYELAEGDQIG-YHAVAPFDPQKGLIKAGAKKQTYTDVFSEWLCDMAAVEPRLLAITPAMREGSGLVRFSQEYPQRYFDVAIAEQHAITLAAGMATQGAKPVVAIYSTFLQRGYDQLVHDVALQKLDVLFAVDRGGVVGPDGATHAGNLDLSFLRCVPNMMLMAPADEAECRKMLSTGF-HYSGPVAVRYPRGTGPGVVPSAELDVLPVGVAQLRHSGTRIALLGFGVCVAPAEQVGRRLGLTVVNMRFIKPLDRTLLLELARTHEGFVTIEDNVVAGGAGSGVAELLNAEGIVLPIVHLGLPDAFQQHASREDLLAEAGIDAAGVYAALLS 619
>gi|163766321|ref|ZP_02173347.1| deoxyxylulose-5-phosphate synthase [Anaeromyxobacter sp. K] >gi|196171417|gb|ACG72390.1| deoxyxylulose-5-phosphate synthase [Anaeromyxobacter sp. K] (636 aa)
Score = 778, Expect = 1.6e-80, Identities = 172/475 (36%), Positives = 265/475 (55%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIE--KNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSD-----PNLNS-NNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVK 482
           +D I +  D KK+ + +L  L   +R++II        HL S+LG VE+++AL +VF SPQD + +D GHQ Y HK++T R +   TIR   GL+GF E +ES HD    GH+   +S   G IE  +   +   V+ V+GD A++ G+AFE LN   Y    +L+++NDN MSIS NVGAL +  SK   S++     + +++ L       +    I    +           FE LGFHY G +DG+++K  +   +++   +  GP +LH  T KG GY  AE D     H L   D     P   S   + Y  + A  L + +E+D  +  I  AM   +  +   ++FP+   DVGIAE+HAVT AAG+A    +  V+IYSTFLQR+YD ++HDVA  +LP+TF +DR  L  +DG TH G +D+ +L+ +P  ++   S++ EL  ++  + Q++  P  +RY +   E + ++
  S:     5 LDTIDSPTDLKKVPVEQLPALCQEIREQIIQTCARNGGHLGSSLGAVEINVALHHVFSSPQDKLVWDVGHQAYAHKLLTGRREAFRTIRTEGGLAGFPERHESAHDAFGVGHASTAISAALGMIEAKRVTGEPGKVVAVVGDGAMTGGVAFEGLNQAGYLGRNLLVVLNDNEMSISPNVGALSEWFSKKFASRTYNRWRRQVKEFLESVPKGPEAIEIIRHGINATKALVTPGILFEGLGFHYVGPVDGHDVKGLVETFQKLA--IFDGPVLLHAITTKGKGYHPAESDKATRGHGLSFFDVATGKPVKKSPGAKAYTDLFAEALCEEMEHDPRVVAITAAMLEGTGLIKAKQRFPDRTYDVGIAEQHAVTFAAGLACEGIRPVVAIYSTFLQRAYDQIIHDVALQKLPVTFALDRGGLVGADGKTHQGAFDLAYLRCVPGLVVMAPSDENELRHMLHTSLQHEG-PAALRYPRGAGEGVALE 484
>gi|154250192|ref|YP_001411017.1| 1-deoxy-D-xylulose-5-phosphate synthase [Fervidobacterium nodosum Rt17-B1] >gi|154154128|gb|ABS61360.1| deoxyxylulose-5-phosphate synthase [Fervidobacterium nodosum Rt17-B1] (631 aa)
Score = 778, Expect = 1.7e-80, Identities = 209/589 (35%), Positives = 330/589 (56%)
  Q:    18 KKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKN---NSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSK-SVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLN-----SNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLI--ILAYQNK-SNPFFIRYTKE----KCEDIEVKKEF-SFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENK----LSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSI 606
           K M   EL + +  +R  +ID+      HL+SNLG VEL++AL  VFD  +D I +DTGHQ Y HK++T R ++  T+R+  G+SGF    E   D    GH G  ++   G IEK    + K  +V+ VIGD A+++G A EALN +    + + II+N NGMSI+KNVG L  ++   + SK  + L E+I      KK  ++ + + + K    L     G++FFES+G  +FG IDG++++     LK+IK   P+ PT+L V T KG GY  +E +    YH ++  DP+        N+ +Y  V    L K+ E D+ +  +  AM   +     SK+FP+ + D+GI E+  VT A G++    K  V+IYSTFLQR+YD ++HD+A   L + F +DR  L  +DG THHG++DI +LKSIPN  I    +  +L  ++  I+  +NK S P  IRY ++      ++I  K E+ S   W Y    K+    ++S G +  +  +  K K+  L+    +    +E++  I+S +  I+ +E+   +   G+ ++   NEN      +  IK I I++  I  G + ++ K + +D  SI
  S:    15 KNMNYDELYEFSEKIRNYMIDVVSKNGGHLASNLGTVELTIALYRVFDPFEDYIIWDTGHQAYTHKLLTGRWEEFKTLRKFGGISGFTNIFEDSVDRFGAGHVGTSIAAALG-IEKALNLSKKEANVVVVIGDGALTSGQALEALNQVKSQNSKIKIILNSNGMSIAKNVGGLSILLESLRTSKLYITLKERI------KKGMNEGVEFELKKIKEALKVALVGEDFFESIGLKHFGPIDGHDIRTLEEALKQIK-AYPY-PTVLTVFTTKGKGYHYSEANPTK-YHGVEKFDPDTGYFEKPENSYSYSEVFGKTLIKIAEEDDKVVALTAAMPDGTGLTQFSKEFPDRFVDLGITEQSVVTYAGGLSTIGYKPVVAIYSTFLQRAYDQIIHDIALQNLSVLFAIDRAGLVGTDGPTHHGVFDICYLKSIPNMKILTPIDAKDLANMLYTIIKQRNKYSGPIAIRYPRDVEFGNLDEIYGKIEYESPFKWKYINSGKD--IALLSVGTLTKEYIEMCKEKNWTLVGVRSVKPLDEESLKEIISNHSFIFTIEEGMINGGFGESVLSYINENLSDEITNVKIKNIGIKDEFITHGTRYELIKLVGLDSESI 612
>gi|86134360|ref|ZP_01052942.1| 1-deoxy-D-xylulose-5-phosphate synthase [Tenacibaculum sp. MED152] >gi|85821223|gb|EAQ42370.1| 1-deoxy-D-xylulose-5-phosphate synthase [Polaribacter dokdonensis MED152] (588 aa)
Score = 778, Expect = 1.7e-80, Identities = 208/596 (34%), Positives = 318/596 (53%)
  Q:    11 IPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSK---SKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSD-------PNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTK--EKCEDIEV---KKEFSFGSWVYALQTKESKTCIISYG----DIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSI 606
           I N  D +K+   +L +LA  LR  IIDI   K  HL ++LG+VEL++AL Y+FD+P DL+ +D GHQ Y HK++TDR     T R+  G++GF    ES  D    GHS   +S   G    +N K   +K  I VIGDA+I++G+AFEALN+   +K  +LII+NDN + I  +VGAL + +++ +  K                                  K     N  ++L F Y G +DG+++ K +  L R+K +   GP  LHV T KG G ++AE +D+  YH+    D       P   ++   Y  V    + +L + ++ I  I PAM   S+   + ++ PN   DVGIAE+HAVT AAGMA      F +IYSTFLQR+YD ++HDVA   LP+ F +DR  L   DG THHG++DI +L+ IPN I+    N+ EL  ++  A     NP  IRY +   K ++ EV   K E   G   + L+ + S+  ++S G    +II  +      ++I   +  F+    ++ +  I   +  I  +E        G  ++  A +N    +IK I + +N I  G+  ++ K++ +D+ S+
  S:     8 ISNPSDLRKLNADQLPELAKDLRAFIIDIVATKEGHLGASLGVVELTIALHYLFDTPNDLLVWDVGHQAYGHKILTDRKAVFHTNRQFKGIAGFPSRQESNFDTFGVGHSSTSISAALGMAIASNLKGETNKHHIAVIGDASIASGMAFEALNHAGVSKANILIILNDNAIGIDPSVGALKEYLTRVKTDK----------------------------------KLAAQNNIIKALNFDYSGPVDGHDIPKLLAELDRLKQVK--GPKFLHVITTKGKGLQKAE-EDQITYHAPGKFDKISGERLPKEANSFTKYQDVFGKTVLELAKKNSKIVAITPAMLTGSSLKLMMQELPNRTFDVGIAEQHAVTLAAGMATQGLVPFCNIYSTFLQRAYDQVIHDVALQNLPVIFCLDRAGLVGEDGATHHGVFDIAYLRCIPNLIVFAPRNEIELRNILYTAQLGLENPIAIRYPRGYGKIKNWEVAYSKIEIGKG---FCLK-EGSEIAVLSVGTISENIIEAIANSNNKETIAHYDMRFVKPLDEKLLETIFHKFSKIITIEDGTVKGGFGSAIVEFAAKNSFKNDIKIIGVPDNFITHGSILELQKEIGLDVKSL 581
>gi|154483651|ref|ZP_02026099.1| hypothetical protein EUBVEN_01355 [Eubacterium ventriosum ATCC 27560] >gi|149735561|gb|EDM51447.1| hypothetical protein EUBVEN_01355 [Eubacterium ventriosum ATCC 27560] (628 aa)
Score = 778, Expect = 1.8e-80, Identities = 207/603 (34%), Positives = 327/603 (54%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKN--NSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFK-KEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSD-----PNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTK-----EKCEDI-------EVKKEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSID-----LINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEI 610
           ++KI    D K +   +   LA  +R+ +ID       HL+SNLG V+L++AL  V D P+D I +D GHQ Y HK++T R D+  ++R+ NGLSGF + +ES+ D   TGHS   +S   G       N   + ++ VIGD A+S G+A EA+NN A  K  MLIIINDN MSISKNVG +   ++K + S+     +  +   L +  ++   +  S+ ++   +   F  +  FE LG    G +DG+N+ + I++ K    I    P I+ V+T KG GY+ AE ++   YH +   D       + +   +Y  V +  L K+ + ++ I  I  AM   +      K+FP+ + DVGIAEEHAVT AAG+A++  K  VSIYS+F QR+YD +LHDV   +LP+T + DR  L  SDG+TH GI+D+ FL ++PN  I   S   EL+  +  A ++   P  IR+ +     E  EDI       ++ KE S                II+ G ++ +  K I     +      +N VFI     E + R+   +K+I VVE+       G+ +     E+ +  +++ + I +  +  GN   + +++ I   +I+ ++
  S:     5 LEKINKPNDIKNIDKKDYPKLAEEIREFLIDSVSKTGGHLASNLGTVDLTIALHAVLDFPKDKIVWDVGHQAYTHKILTGRKDEFESLRQLNGLSGFPKRHESLCDSFDTGHSSTSISAALGMATAAELNETDEKIVAVIGDGALSGGMALEAINNAADLKRNMLIIINDNKMSISKNVGGMSNYLNKLRASEQYNDFKSDVETSLSRIPKFGSSLVKSVKRTKDHIKNLFISQGLFEDLGITSIGPVDGHNIPEMIDIFKEALKINR--PIIICVRTKKGKGYEPAE-NNPSKYHGVNPFDISTGLETVTNGMMSYTDVFSKTLVKMAKTNDRILAITAAMPDGTGLSRFQKEFPDRFFDVGIAEEHAVTFAAGLAVSGYKPVVSIYSSFYQRAYDQILHDVCIQKLPVTLIFDRAGLVGSDGETHQGIFDMSFLSAMPNMTIIAPSGIKELKEAMKFA-EHFDGPIAIRFARGVAFPEIKEDINLQYGKGQILKEGSKDG-----NNAGGNVAIIAVGSMVEETYKAIDMLEKENVHPAFVNPVFIKPMDTELIKRVAENHKHIIVVEEGIKKGGFGESVETFILESGIDADVQVMAIDDRFVEQGNVALLREEIGISYKNIYEKV 623
>gi|116620902|ref|YP_823058.1| 1-deoxy-D-xylulose-5-phosphate synthase [Solibacter usitatus Ellin6076] >gi|116224064|gb|ABJ82773.1| 1-Deoxy-D-xylulose-5-phosphate synthase [Solibacter usitatus Ellin6076] (638 aa)
Score = 778, Expect = 1.9e-80, Identities = 184/466 (39%), Positives = 263/466 (56%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGF-IEKNNSKSKS-VIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMS-----------KSVFLT--EKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNN---LKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNSNN----QTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTK 473
           ++ I + E  +K+ L EL  LA  +R+++I +  N   HL  NLG+VEL++AL YVF +P D + +D  HQ YVHK++T R D+  TIR   GL+GF    ES HD    GH+G  LS   G  + ++ +  K  VI V GDAA + G+ +EALNNIA++   M++++NDN  SI KNVGA+   ++K   S           K V +   E  LR     +E +K + W                  FE LG  YFG IDG++   L KT   LK+        P +LHV T KG G++ A +  +  +H L   DP          +TY  V A+ + KL +YD  +  I  AM   +         P+ Y DVGIAEEHAV  AAG+A    K F +IYSTFLQR++D ++HDV    LP+ F +DR  LS  DG THHG++DI +L+S+PN +     ++ EL  ++  A +  + P  +RY +
  S:    15 LEGIQSPEQVQKLSLPELDQLAAEIRERLITVLSNNGGHLGPNLGVVELTLALHYVFQTPADSLLFDVSHQAYVHKLLTGRQDQFHTIRTPGGLNGFMLRTESPHDAYGAGHAGTALSAALGMAVARDKTGGKEHVIAVAGDAAFTCGITYEALNNIAHHTKRMIVVLNDNEWSIDKNVGAIATYLNKIVTSPRFDYLHDRAGKLVEMVGGEAALRMARRAEEVAKGMLWP--------------SVIFEELGLKYFGPIDGHDTATLIKTFEYLKKQDR-----PVLLHVLTQKGKGFEPA-MQKQKKFHGLGPYDPETGETKPLGRRTYSEVFADTMVKLADYDPKVVAITAAMPNGTGLDRFQPHHPDKYFDVGIAEEHAVLFAAGLAAKGFKPFCAIYSTFLQRAFDPIVHDVCLQNLPVVFCMDRGGLSADDGPTHHGLFDISYLRSVPNLVHMVPKDEDELADMLFTAMK-WNGPIAVRYPR 481
>gi|15793580|ref|NP_283402.1| 1-deoxy-D-xylulose-5-phosphate synthase [Neisseria meningitidis Z2491] >gi|13124127|sp|Q9JW13|DXS_NEIMA 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|121051561|emb|CAM07859.1| putative 1-deoxyxylulose-5-phosphate synthase [Neisseria meningitidis Z2491] (637 aa)
Score = 777, Expect = 2.2e-80, Identities = 194/605 (32%), Positives = 329/605 (54%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKF-------QMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSL----KLSDPNLNSNNQ-------TYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTK---------EKCEDIEVKKEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           +D I + +D +++   +L  LA  LR  +++       H +SNLG VEL++AL YV+++P+D + +D GHQ Y HK++T R +++ T+R+  GL+GF +  ES +D    GHS   +    G    +K     +  + +IGD A++ G AFEALN        +L+++NDN MSIS NVGAL K ++          +S     T K+L KI    E+++K+   I     +     +  + FE+ GF Y G +DG+N++  ++VL+ ++     GP +LHV T KG GYK AE +D   YH++    K S   + S  +       TY  V   +L      D+ +  I PAM   S  +   ++FP+ Y DVGIAE+HAVT A G+A    K  V+IYSTFLQR+YD L+HD+A   LP+ F VDR  +  +DG TH G+YD+ FL+ IPN I+   S++ E   L+   YQ  + P  +RY +         +  E +E+ K          ++ +  KT  I++G ++          +  + +  F+    +E ++R+  ++  I  +E+  +    G  ++ +  ++ +   +  + + +   G G+ + +   L +   ++   +++
  S:     7 LDLIDSPQDLRRLDKKQLPRLAGELRTFLLESVGQTGGHFASNLGAVELTVALHYVYNTPEDKLVWDVGHQSYPHKILTGRKNQMHTMRQYGGLAGFPKRCESEYDAFGVGHSSTSIGAALGMAAADKQLGSDRRSVAIIGDGAMTAGQAFEALNCAGDMDVDLLVVLNDNEMSISPNVGALPKYLASNVVRDMHGLLSTVKAQTGKVLDKIPGAMEFAQKVEHKIKTLAEEAEHAKQSLSLFENFGFRYTGPVDGHNVENLVDVLEDLRG--RKGPQLLHVITKKGNGYKLAE-NDPVKYHAVANLPKESAAQMPSEKEPKPAAKPTYTQVFGKWLCDRAAADSRLVAITPAMREGSGLVEFEQRFPDRYFDVGIAEQHAVTFAGGLACEGMKPVVAIYSTFLQRAYDQLVHDIALQNLPVLFAVDRAGIVGADGPTHAGLYDLSFLRCIPNMIVAAPSDENECRLLLSTCYQADA-PAAVRYPRGTGTGVPVSDGMETVEIGKGI--------IRREGEKTAFIAFGSMVAPALAVAGKLNATVADMRFVKPIDEELIVRLARSHDRIVTLEENAEQGGAGSAVLEVLAKHGICKPVLLLGVADTVTGHGDPKKLLDDLGLSAEAVERRVRA 628
>gi|117921342|ref|YP_870534.1| 1-deoxy-D-xylulose-5-phosphate synthase [Shewanella sp. ANA-3] >gi|166201539|sp|A0KZA9|DXS_SHESA 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|117613674|gb|ABK49128.1| deoxyxylulose-5-phosphate synthase [Shewanella sp. ANA-3] (622 aa)
Score = 777, Expect = 2.2e-80, Identities = 195/601 (32%), Positives = 319/601 (53%)
  Q:    12 PNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI---EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLT-----EKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPN------LNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEK---CEDIEVKKEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           PN  + +++    L  LA  LR+ ++      S H +S LG VEL++AL YV+++P D + +D GHQ Y HK++T R D++ TIR+ NGL  F    ES +D  S GHSG  +S         EK  +  K V+ VIGD A++ G+ FEA+N+       ML+++NDN MSIS+NVGAL+  +++  MS  ++ T     +K+L+ +   KE +K+       +   L         FE LGF+Y G IDG+++   +  L+ ++++   GP +LH+ T KG GY+ AE D  G +H++   DP+            T+  V   +L  + E D  +  I PAM   S  +  S++FP  Y D  IAE+HAVT  AG A    K  V+IYSTFLQR YD L+HDVA   LP+ F +DR  +  +DG TH G +D+ F++ IPN +I   S++ E  +++   Y   + P  +RY +        +E       G  V  ++       ++++G  +       ++    +++  F+     + V  +  T+  +  VE+       G  ++ L  + K+   + +I + +  I  G+ E++   L +D   + A+I +
  S:    17 PN--ELRQLPQALLPQLADELREFLLKSVGMSSGHFASGLGTVELTVALHYVYNTPFDRLIWDVGHQAYPHKILTGRRDRMHTIRQKNGLHPFPWREESEYDTFSVGHSGTSISAALAMAVAAEKEQAGRK-VVAVIGDGAMTGGMVFEAMNHAGDLHNDMLMVLNDNEMSISENVGALNNHLAQL-MSGRLYTTIRESSKKVLKGMPVIKEMAKR-------TEEHLKGMVVPGTLFEELGFNYIGPIDGHDVDALVETLRNMRSLK--GPQVLHIMTKKGRGYEPAEKDPIG-WHAVPKFDPSQFKKPATKPGLPTFSQVFGKWLCDIAEQDEKVLGITPAMREGSGMVEFSQRFPKQYFDAAIAEQHAVTLGAGFACEGFKPVVAIYSTFLQRGYDQLIHDVALQRLPVLFAIDRGGIVGADGPTHQGAFDLSFMRCIPNMVIMAPSDENECRQMLYTGYCYDAGPSAVRYPRGSATGATQVEAMTALPIGKGV--IKRLGKGIAMLNFGTTLAAALTAAESLDATVVDMRFVKPLDVDLVKEMAQTHDVLVTVEENAIMGGAGSGVLELLQKLKMPKPVLQIGLPDEFIKHGSPEEVTHDLQLDAEGMLAQINA 618
>gi|123443362|ref|YP_001007336.1| 1-deoxy-D-xylulose-5-phosphate synthase [Yersinia enterocolitica subsp. enterocolitica 8081] >gi|166201547|sp|A1JNR7|DXS_YERE8 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|122090323|emb|CAL13189.1| 1-deoxy-D-xylulose 5-phosphate synthase [Yersinia enterocolitica subsp. enterocolitica 8081] (619 aa)
Score = 777, Expect = 2.2e-80, Identities = 192/600 (32%), Positives = 328/600 (54%)
  Q:    13 NYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWS---IYKSFSKLSKFFKG----KNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDP------NLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCED--IEVKKEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEK--VFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           N E+ + +    L  L   LR+ ++      S H +S LG+VEL++AL YV+++P D + +D GHQ Y HK++T R ++I TIR+ +GL  F    ES +D +S GHS   +S   G     +   K +  + VIGD AI+ G+AFEA+N+     + ML+I+NDN MSIS+NVG L+  +++        L+ K+   +   +E  KK +     I     +  +  KG       FE LGF+Y G +DG++++     LK ++++   GP +LH+ T KG GY  AE D  G +H++   DP          N  TY  +   +L +    D+ +  + PAM   S  +  S+++P  Y DV IAE+HAVT AAG+AI   K  V+IYSTFLQR+YD L+HDVA   LP+ F +DR  L  +DG TH G +D+ F++ IPN  I   S++ E  +++   Y + + P  +RY +       +E       G  +  ++ +  K  I+ +G ++   +      +  L++  F+    +E VL + ++++ +  VE+  +      G + +++A    +S  +  + + ++ +  G ++++  +  +D   I ++I++
  S:    16 NPEELRMLPKESLPKLCDELRQYLLASVSRSSGHFASGLGVVELTVALHYVYNTPFDSLVWDVGHQAYPHKILTGRREQIGTIRQKDGLHPFPWRGESEYDVLSVGHSSTSISAGLGMAVAAEREGKGRRTVCVIGDGAITAGMAFEAMNHAGDIHSDMLVILNDNEMSISENVGGLNNHLAQL-------LSGKLYTSL---REGGKKAFSGLPPIKDLLKRTEEHLKGMVVPSTLFEELGFNYIGPVDGHDVQALTQTLKNMRSLK--GPQLLHIMTKKGKGYAPAEKDPIG-WHAVPKFDPASGTLPKSQGNIPTYSKIFGEWLCETAAKDSQLMAVTPAMREGSGMVRFSREYPQQYFDVAIAEQHAVTFAAGLAIGGYKPIVAIYSTFLQRAYDQLIHDVAIQNLPVLFAIDRGGLVGADGQTHQGAFDLSFMRCIPNMAIMTPSDENECRQMLHTGYHH-NGPAAVRYPRGNGTGAVLEPLAIMPIGKGI--VRREGEKVAILCFGTLLAQAQIVADNLNATLVDMRFVKPLDEELVLELAASHEVLVTVEENAIMGGAGSGVNELLMAKRQLVS--VLNLGLPDHFVPQGEQDEMRAEFGLDAAGIQSQIEA 616
>gi|167455388|ref|ZP_02321610.1| deoxyxylulose-5-phosphate synthase [Anaeromyxobacter dehalogenans 2CP-1] >gi|167418073|gb|EDR84772.1| deoxyxylulose-5-phosphate synthase [Anaeromyxobacter dehalogenans 2CP-1] (636 aa)
Score = 777, Expect = 2.2e-80, Identities = 172/475 (36%), Positives = 264/475 (55%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIE--KNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSD-----PNLNS-NNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVK 482
           +D I +  D KK+ + +L  L   +R++II        HL S+LG VE+++AL +VF SPQD + +D GHQ Y HK++T R +   TIR   GL+GF E +ES HD    GH+   +S   G IE  +   +   V+ V+GD A++ G+AFE LN   Y    +L+++NDN MSIS NVGAL +  SK   S++     + +++ L       +    I    +           FE LGFHY G +DG+++K  +   +++   +  GP +LH  T KG GY  AE D     H L   D     P   S   + Y  + A  L + +E+D  +  I  AM   +  +   ++FP+   DVGIAE+HAVT AAG+A    +  V+IYSTFLQR+YD ++HDVA  +LP+TF +DR  L  +DG TH G +D+ +L+ +P  ++   S++ EL  ++  + Q+   P  +RY +   E + ++
  S:     5 LDTIDSPTDLKKVPVEQLPALCQEIREQIIQTCARNGGHLGSSLGAVEINVALHHVFSSPQDKLVWDVGHQAYAHKLLTGRREAFRTIRTEGGLAGFPERHESAHDAFGVGHASTAISAALGMIEAKRVTGEPGKVVAVVGDGAMTGGVAFEGLNQAGYLGRNLLVVLNDNEMSISPNVGALSEWFSKKFASRTYNRWRRQVKEFLESVPKGPEAIEIIRHGINATKALVTPGILFEGLGFHYVGPVDGHDVKGLVETFQKLA--IFDGPVLLHAITTKGKGYHPAESDKATRGHGLSFFDVATGKPVKKSPGAKAYTDLFAEALCEEMEHDPRVVAITAAMLEGTGLIKAKQRFPDRTYDVGIAEQHAVTFAAGLACEGIRPVVAIYSTFLQRAYDQIIHDVALQKLPVTFALDRGGLVGADGKTHQGAFDLAYLRCVPGLVVMAPSDENELRHMLHTSLQH-DGPAALRYPRGAGEGVALE 484
>gi|145620130|ref|ZP_01776168.1| deoxyxylulose-5-phosphate synthase [Geobacter bemidjiensis Bem] >gi|144943542|gb|EDJ78629.1| deoxyxylulose-5-phosphate synthase [Geobacter bemidjiensis Bem] >gi|197089086|gb|ACH40357.1| deoxyxylulose-5-phosphate synthase [Geobacter bemidjiensis Bem] (635 aa)
Score = 777, Expect = 2.3e-80, Identities = 209/605 (34%), Positives = 319/605 (52%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILS------ICQGFIEKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKK--EWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAE-LDDKGLYHSLKLSDPNLNSNNQ----TYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVK---KEFSFGSWVYALQTKESKTCIISYGDIIN---DLKKEIKTKSI--DLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKL-SCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           + KI   +D KK+   EL  LA  +R  +++       HL+SNLG VEL++AL Y FDSP+D I +D GHQ Y HK++T R D   T R   G+SGF +  ES HD    GHS   +S      + QG  E     +  VI VIGD +++ G+AFEALN   + K  +++++NDN MSISKNVGAL   +S+ +M+   + + K   + L          I     K+ + L  F      FE LGF Y G I G++L   + VL+ +K +   GP +LHV T KG GY  AE + DK  +H +  + P   S  +    +Y SV  N + KL E D  I  I  AM   +     +++FP+ + DVGIAE+HA+T AAG+A+   +   +IYSTF QR+YD + HDV   +LP+T  +DR  L   DG THHG +DI +L+ +P   +    ++ EL+ ++  A  +   P  +RY +     + +    +E   G     L        I++ G  ++   +   +++ K I   ++NA FI     E +L        +  VE+       G  ++ L ++  L +  IK+I I +  I  G +  +   L +D   I A  ++
  S:     5 LSKINGPDDLKKLDAEELTPLAEEVRAFLLETVTRTGGHLASNLGAVELTIALHYCFDSPKDKIIWDVGHQAYTHKILTGRRDSFHTQRCYKGISGFPKRAESPHDAFGVGHSSTSISAGLGMAVAQGLKED----AARVISVIGDGSLTGGMAFEALNQAGHLKKNLIVVLNDNEMSISKNVGALSSFISR-KMTGGYYRSLKKEMEALMANIPAIGGNILHFAKKAENSLKGFLTPGTLFEGLGFEYVGPIAGHDLPTLLGVLENVKRLE--GPILLHVMTKKGKGYPPAETMPDK--FHGVAPTKPASASPAKLPPPSYTSVFGNTMVKLGEIDPKILAITAAMPDGTGLTPFAERFPDRFFDVGIAEQHALTFAAGLAVEGFRPVAAIYSTFTQRAYDQIFHDVCLQKLPVTLALDRAGLVGDDGPTHHGSFDISYLRHLPELTVMAPKDENELQHMLKTALYS-GRPISLRYPRGAGFGVPLDHELQELPIGKG--ELLIDGGDLTIVAIGSTVHPALEAAAQLRQKGIFAAVVNARFIKPIDSELILAQAKKTGCLVTVEENALLGGFGSAVLELLSDAGLNAVRIKRIGIPDRFIEQGTQAQLRADLGLDAAGIAATCET 619
>gi|163857372|ref|YP_001631670.1| 1-deoxy-D-xylulose-5-phosphate synthase [Bordetella petrii DSM 12804] >gi|163261100|emb|CAP43402.1| 1-deoxy-D-xylulose 5-phosphate synthase [Bordetella petrii] (627 aa)
Score = 777, Expect = 2.4e-80, Identities = 199/605 (32%), Positives = 318/605 (52%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTP---MLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSK-FFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLN------SNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYALQTKESK-TCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           +D+I + +D +++   EL  LA  LR  +++       HLSSNLG VEL++AL  VFD+P D I +D GHQ Y HK++T R   ++++R+  G+SGF + +ES +D   T HS   +S   G     +N    +  I VIGD A+S G+AFEA+NN     TP   +L+++NDN MSIS  VGAL++ +++  MS   +   K + + + +          + + F + +K        FE  GF+Y G IDG++L   +  L+ +K +   G   LHV T KG GYK AE D   LYH     DP +       S  +T+  V   +L  + E D  +  I PAM   S  +   ++FP  Y DVGIAE+HAVT AAG+A   +K  V+IYSTFLQR YD L+HDVA   L +TF +DR  L  +DG TH G YDI +L+ +PN ++   S++ E   L+   Y+    P  +RY +      E+            +  ++ +   I+++G +        +     + +  F+    +E +L++ + +  I  VE+       G  +I + +   +   + ++ + +  I  G++  +   L +D   I   I++
  S:     6 LDRIHSPDDVRQLDRRELKALAEELRGFVLESVSRTGGHLSSNLGTVELTLALHRVFDTPHDRIVWDVGHQSYPHKILTGRRAGMASLRQEGGISGFPKRSESEYDAFGTAHSSTSISAALGMAVASRNAGIQRQHIAVIGDGAMSAGMAFEAMNNAGV--TPDINLLVVLNDNDMSISPPVGALNRYLARL-MSGRFYAAAKNVGRAMLQH---VPPVLELARRFEEHAKGMVTPATLFEEFGFNYVGPIDGHDLDALVPTLQNLKALQ--GLQFLHVVTRKGHGYKLAEADPV-LYHGPGKFDPAVGIQQGKASTRKTFTQVFGQWLCDMAERDERLVGITPAMREGSGLVEFERRFPRRYFDVGIAEQHAVTFAAGLACEGQKPVVAIYSTFLQRGYDQLIHDVALQNLDVTFALDRAGLVGADGATHAGNYDIAYLRCVPNMVVAAPSDENEARLLLSTCYE-YPGPASVRYPRGAGRGAEISPGLDTVPMGKGIVRRQGRGIAILAFGTLTQAALAAAEALDATVADMRFVKPIDRELILQLAAGHDAIVTVEEAAIMGGAGSAVIEVLHHEGVVVPVLQLGLPDRFIDHGDQAALLAGLGLDAAGIERSIRA 613
>gi|153007892|ref|YP_001369107.1| 1-deoxy-D-xylulose-5-phosphate synthase [Ochrobactrum anthropi ATCC 49188] >gi|166198634|sp|A6WWC4|DXS_OCHA4 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|151559780|gb|ABS13278.1| deoxyxylulose-5-phosphate synthase [Ochrobactrum anthropi ATCC 49188] (638 aa)
Score = 776, Expect = 2.5e-80, Identities = 176/466 (37%), Positives = 263/466 (56%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNN--SKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELD-DKGLYHSL--------KLSDPNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTK 473
           +DK P  E  + +   +L  LA  LR ++ID+      HL + LG+VEL++AL +VFD+P D I +D GHQ Y HK++T R D+I T+R++ GLSGF +  ES +D     HS   +S   G    ++   + ++VI VIGD ++S G+A+EA+NN       +++I+NDN MSI+   GA+   +++    K+     +  +++   K+  K +     KS      FF G   FE LGF+Y G IDG+NL   + +LK +++    GP ++HV T KG GY  AE   DK  YH +        K S P  N+   +Y  +    L +   +D+ I  I  AM   +      + FP    DVGIAE+HAVT AAG+A    K F +IYSTFLQR YD ++HDV+   LP+ F +DR  L  +DG TH G +D GFL ++P  ++  AS++ EL  ++  A +    P   RY +
  S:     9 LDKAPIPEALRALPESDLPQLAQELRAELIDVVSTTGGHLGAGLGVVELTVALHHVFDTPHDRIIWDVGHQAYPHKILTGRRDRIRTLRQTGGLSGFTKRTESEYDPFGAAHSSTSISAGLGMAVASDLSGEKRNVIAVIGDGSMSAGMAYEAMNNAGALDARLIVILNDNDMSIAPPTGAMSAYLARLVSGKTYRSVREAAKQV--AKKLPKFLQDKARKSEEYARAFFTGGTLFEELGFYYVGPIDGHNLDHLLPILKNVRDTQE-GPVLIHVVTQKGKGYAPAEAAADK--YHGVNKFDVITGKQSKPPANA--PSYTKIFGTSLIEEARHDDRIVAITAAMPSGTGLDLFGEVFPQRTFDVGIAEQHAVTFAAGLASEGYKPFCAIYSTFLQRGYDQVVHDVSIQNLPVRFPIDRAGLVGADGPTHAGSFDTGFLAALPGFVVMAASDEAELRHMVRTAAEYDEGPISFRYPR 478
>gi|51246552|ref|YP_066436.1| 1-deoxy-D-xylulose-5-phosphate synthase [Desulfotalea psychrophila LSv54] >gi|81641296|sp|Q6AJQ1|DXS_DESPS 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|50877589|emb|CAG37429.1| probable 1-deoxy-D-xylulose 5-phosphate synthase [Desulfotalea psychrophila LSv54] (645 aa)
Score = 776, Expect = 2.6e-80, Identities = 168/477 (35%), Positives = 270/477 (56%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNN--SKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNL-----NSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKE 484
           +D++ + +D +++   +L+ LA  +R+KIID       HL+ +LG+VEL++AL YVF++P D + +D GHQ Y HK++T R  +  T+R+  G+SGF +  ES +D   TGHS   +S   G     +   +    I VIGD +++ G+AFEALN+  +    +++I+NDN MSIS NVGAL   +S+    K++   +  L + L   +  + I   + KS      FF     FE+  F Y G IDG+++   I+ L  +++    GP ++HV T KG GY  AE ++   +H +   +             +Y +V    + +L + + NI  I+ AM   +     S+ +P+ + DVGIAE+HA+T AAG+A    +  V+IYS+F QR+ D ++HDV    LP+T  +DR  +   DG THHGI+DI FL+ IPN  I    ++ EL+++++ A      P  IRY +   ED+   +E
  S:    14 LDRVDSPKDIRQLTHDDLIILAAEIREKIIDTVSKTGGHLAPSLGVVELTLALHYVFNTPTDKLVWDVGHQSYAHKILTGRRKQFDTLRQYRGMSGFPKRGESDYDAFETGHSSTSISAALGMTLAMDLLQQDNKAIAVIGDGSMTAGMAFEALNHAGHLDKNLIVILNDNEMSISPNVGALSSFLSRKLTGKTMRRVKSHLVEKLQDSDVGENILNVLRKSEESFKSFFTPGMLFEAFKFDYIGPIDGHDIDALISTLNTVRDTAK-GPALIHVLTKKGKGYLPAE-ENPDAFHGVGPFNRQTGKIIKKKGPASYTTVFGQTMLELGKKNKNIVAISAAMVAGTGLTPFSEAYPDRFFDVGIAEQHAITFAAGLASQGMRPVVAIYSSFYQRAMDQIIHDVCIPNLPVTLAIDRAGVVGDDGPTHHGIFDISFLRFIPNLTIMAPKDEAELQQMLVTA-TGHDGPTAIRYPRGAGEDVSTSQE 494
>gi|194681493|emb|CAR40354.1| 1-deoxy-D-xylulose-5-phosphate synthase [Proteus mirabilis HI4320] (624 aa)
Score = 776, Expect = 2.7e-80, Identities = 200/607 (32%), Positives = 322/607 (53%)
  Q:     6 VKIDKIPNY------EDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI---EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSI---YKSFSKLSKFFKGK----NFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNS------NNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEK--CEDIEVKKEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           + I+K P        ED + +    L  L   LR  +++     S H +S LG +EL++AL YV+ +P D + +D GHQ Y HK++T R D+I TIR+ NGL  F   +ES +D +  GHS   +S   G     E+ N   K+V  VIGD AI+ G+AFEA+N+       ML+++NDN MSIS+NVGAL+  +++  +S  ++ T          +E  KK++  I    +   K  +  KG       FE LGF+Y G +DG+++   +  L  ++++   GP +LH+ T KG GY  AE D    +H++   DP   +         T+  +  ++L +    D  +  I PAM   S  +  SK++P  Y DV IAE+HAVT AAG+AI   K  V+IYSTFLQR+YD ++HDVA  +LP+ F +DR  +  +DG TH G +D+ FL+ IPN II   S++ E  +++   Y  +  P  +RY +       ++   E   G  +   Q K     I+++G ++ +     +     + +  FI    KE +L +   +  +  +E+       G  +  L  + +    +  + + +  +  G +E+I   L +D   I   IK+
  S:     3 IDIEKYPTLALVETPEDLRLLPKESLPKLCDELRLYLLNSVSRSSGHFASGLGAIELTVALHYVYKTPFDNLIWDVGHQAYPHKILTGRRDRIDTIRQKNGLHPFPWRDESEYDKLCVGHSSTSISAGLGMAVAAEQENLGRKTVC-VIGDGAITAGMAFEAMNHAGDINPDMLVVLNDNEMSISENVGALNNHLAQL-LSGKLYTT---------LREGGKKVFSGIPPIKELLKKTEEHIKGMVVPGTMFEELGFNYIGPVDGHDVIALVQTLTNMRDLK--GPQLLHIMTKKGRGYAPAEQDPIS-WHAVPKFDPKTGTLPKSPNARPTFSKIFGDWLCEEAATDEKLMAITPAMREGSGMVRFSKEYPAQYFDVAIAEQHAVTFAAGLAIGGYKPIVAIYSTFLQRAYDQVIHDVAIQKLPVLFAIDRGGIVGADGQTHQGAFDLSFLRCIPNMIIMAPSDENECRQMLHTGYHYQEGPVAVRYPRGSGVGAPLQPLSELPIGKGIIRRQGKS--IAILNFGTLLPEALDVAEKLDATVADMRFIKPLDKELILSLAKQHDILVTLEENAIMGGAGSGVNELLMQERCLVPVLNLGLPDLFVPQGGQEEIRADLGLDATGIEKSIKA 617
>gi|86157524|ref|YP_464309.1| 1-deoxy-D-xylulose-5-phosphate synthase [Anaeromyxobacter dehalogenans 2CP-C] >gi|118595491|sp|Q2IPZ2|DXS_ANADE 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|85774035|gb|ABC80872.1| 1-Deoxy-D-xylulose-5-phosphate synthase [Anaeromyxobacter dehalogenans 2CP-C] (636 aa)
Score = 776, Expect = 2.7e-80, Identities = 174/475 (36%), Positives = 263/475 (55%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIE--KNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSD-----PNLNS-NNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVK 482
           +D I +  D KK+ + +L  L   +R+ II        HL S+LG VE+++AL +VF SPQD + +D GHQ Y HK++T R D   TIR   GL+GF E +ES HD    GH+   +S   G IE  +   +   V+ V+GD A++ G+AFE LN   Y    +L+++NDN MSIS NVGAL +  SK   S++     + +++ L       +    I    +           FE LGFHY G +DG+++K  +   +++   V  GP +LH  T KG GY  AE D     H L   D     P   S   + Y  + A  L + +E+D  +  I  AM   +  +   ++FP+   DVGIAE+HAVT AAG+A    +  V+IYSTFLQR+YD ++HDVA  +LP+TF +DR  L  +DG TH G +D+ +L+ +P  ++   S++ EL  ++  + Q+   P  +RY +   E + ++
  S:     5 LDTIDSPADLKKVPVEQLPALCQEIRELIIQTCARNGGHLGSSLGAVEINVALHHVFASPQDKLVWDVGHQAYAHKLLTGRRDAFRTIRTEGGLAGFPERHESAHDAFGVGHASTAISAALGMIEAKRVTGEPGKVVAVVGDGAMTGGVAFEGLNQAGYLGRNLLVVLNDNEMSISPNVGALSEWFSKKFASRTYNRWRRQVKEFLESVPKGPEAIGIIRHGINATKALVTPGILFEGLGFHYVGPVDGHDVKGLVETFQKLA--VFDGPVLLHAITTKGKGYHPAESDKATRGHGLSFFDVATGKPVKKSPGAKAYTDLFAEALCEEMEHDPRVVAITAAMLEGTGLIKAKQRFPDRTYDVGIAEQHAVTFAAGLACEGIRPVVAIYSTFLQRAYDQIIHDVALQKLPVTFALDRGGLVGADGKTHQGAFDLAYLRCVPGLVLMAPSDENELRHMLHTSLQH-DGPAALRYPRGAGEGVPLE 484
>gi|77979409|ref|ZP_00834828.1| COG1154: Deoxyxylulose-5-phosphate synthase [Yersinia intermedia ATCC 29909] (619 aa)
Score = 776, Expect = 2.8e-80, Identities = 191/600 (31%), Positives = 324/600 (54%)
  Q:    13 NYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFI--EKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWS---IYKSFSKLSKFFKG----KNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNS------NNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVK--KEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIKS 612
           N E+ + +    L  L   LR+ ++      S H +S LG+VEL++AL YV+ +P D + +D GHQ Y HK++T R ++I TIR+ +GL  F    ES +D +S GHS   +S   G     +   K +  + VIGD AI+ G+AFEA+N+     + ML+I+NDN MSIS+NVG L+  +++        L+ K+   +   +E  KK +     I     +  +  KG       FE LGF+Y G +DG++++     LK ++++   GP +LH+ T KG GY  AE D  G +H++   DP   +      N  TY  +   +L +    D+ +  + PAM   S  +  S+++P  Y DV IAE+HAVT AAG+AI   K  V+IYSTFLQR+YD L+HDVA   LP+ F +DR  L  +DG TH G +D+ F++ IPN +I   S++ E  +++   Y + + P  +RY +      ++K  +    G  +  ++ +  K  I+ +G ++   +      +  L++  F+    +  VL + ++++ +  VE+       G  +  L    +    +  + + ++ +  G +E++  +  +D   I  +I++
  S:    16 NPEELRMLPKESLPKLCDELRQYLLASVSRSSGHFASGLGVVELTVALHYVYKTPFDSLVWDVGHQAYPHKILTGRREQIGTIRQKDGLHPFPWRGESEYDVLSVGHSSTSISAGLGMAVAAEREGKGRRTVCVIGDGAITAGMAFEAMNHAGDIHSDMLVILNDNEMSISENVGGLNNHLAQL-------LSGKLYASL---REGGKKAFSGLPPIKDLLKRTEEHLKGMVVPSTLFEELGFNYIGPVDGHDVQALAQTLKNMRDLK--GPQLLHIMTKKGKGYAPAEKDPIG-WHAVPKFDPAAGTLPKSQGNLPTYSKIFGEWLCETAAKDSQLMAVTPAMREGSGMVRFSREYPQQYFDVAIAEQHAVTFAAGLAIGGYKPIVAIYSTFLQRAYDQLIHDVAIQNLPVLFAIDRGGLVGADGQTHQGAFDLSFMRCIPNMVIMTPSDENECRQMLHTGYHH-NGPAAVRYPRGNGTGADLKPLEIMPIGKGI--VRREGEKIAILCFGTLLAQAQLVADNLNATLVDMRFVKPLDEALVLEMAASHEVLVTVEENAIMGGAGSGVNELLMAKRQLVPVLNLGLSDSFVPQGEQEEMRAEFGLDAAGIQRQIEA 616
>gi|150009262|ref|YP_001304005.1| 1-deoxy-D-xylulose-5-phosphate synthase [Parabacteroides distasonis ATCC 8503] >gi|166198635|sp|A6LFB9|DXS_PARD8 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|149937686|gb|ABR44383.1| 1-deoxy-D-xylulose 5-phosphate synthase [Parabacteroides distasonis ATCC 8503] (632 aa)
Score = 776, Expect = 2.9e-80, Identities = 205/611 (33%), Positives = 324/611 (53%)
  Q:     1 MKKNKVK--IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKS---KSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSV----FLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHS--------------LKLSDPNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKKEFSFGSWVYALQTKE-SKTCIISYGDIINDLKKEIKT-----KSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEIK 611
           M ++KV+  +D I   ED + +   +L  +   LR+ IID+      HL ++LG VEL++AL YVF++P D I +D GHQ Y HK++T R D   T+R+  G+SGF  P ES +D    GH+ N +S   G    +  K    + VI VIGD A++ GLAFE LNN + N   +LII+NDN M+I  +VG L + +     S++     +   + L+KI       ++       S   L    +  N FE     YFG +DG+++   + VL  IK++   GP +LH+KT KG G+K AE +    +H+               KL +P      Q Y  V  + L +L E D  I  + PAM    +   + K FP+   DVGIAE H+VT +AG+A      F ++YS+F+QR+YD ++HDVA  +L +   +DR  L   DG THHG++D+ +L+ IPN +I    N+ +L  L+   Y     PF IRY + K E  + + E          + ++     ++S G I N++ K I+       SI   + +++    +E +  I   Y  I  VE        G  ++    +N  + ++K+I + +  I  G+  ++ +   +D  SI  ++K
  S:     1 MAESKVEHLLDSIHFPEDLRHLSQDKLEQVCADLRQYIIDVLSENPGHLGASLGTVELTVALHYVFNTPYDRIVWDVGHQAYGHKILTGRKDIFHTLRKFKGISGFPNPAESEYDAFIAGHASNSISAAMGMSVASALKKELDRHVIAVIGDGAMTGGLAFEGLNNASANPNNLLIILNDNDMAIDHSVGGLSQYLVDITTSQAYNKMRYDVYRGLKKIKLINNDRRENILRFNNSLKAL--LTQQHNLFEGFSIRYFGPVDGHDVNYLVKVLNDIKDMQ--GPKLLHIKTKKGKGFKPAE-ESATEWHAPGKFNKETGQRIIVRKLDEP------QLYQDVFGHTLVELAENDERIVGVTPAMPSGCSMTYMMKAFPDRAFDVGIAEGHSVTFSAGLAKEGMIPFCNVYSSFMQRAYDMVIHDVALQKLHMVICLDRAGLVGEDGATHHGVFDLAYLRPIPNLVIASPLNELDLRNLMYTGYAAFDGPFVIRYPRGKGEMKDWRNEMQVLPIGKGKKLRDGDDIAVLSIGPIGNEVIKAIEMVKEERVSIAHYDMIYLKPLDEELLHEIGQKYNRIITVENGVIKGGFGSAVLEFMADNGYTPHVKRIGVPDAFIEHGSIPELYQLCGMDAESIAKQLK 629
>gi|149202070|ref|ZP_01879043.1| 1-deoxy-D-xylulose-5-phosphate synthase [Roseovarius sp. TM1035] >gi|149144168|gb|EDM32199.1| 1-deoxy-D-xylulose-5-phosphate synthase [Roseovarius sp. TM1035] (661 aa)
Score = 776, Expect = 3.1e-80, Identities = 173/472 (36%), Positives = 266/472 (56%)
  Q:     2 KKNKVKIDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNN--SKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKG----KNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAE-LDDKGLYHSLKLSDPNLNSNNQT------YGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTK 473
           + N   +D+I    D ++M   +L  LA  LR ++I        HL S+LG+VEL++A+  VF +P D + +D GHQCY HK++T R D+I T+R+ +GLSGF + +ESI+D     HS   +S   GF    +    +   I VIGD +IS G+A+EALNN       + +I+NDN MSI+  VGA+   +S+      ++ +E + R     + +   +   + +S  +  +   G       FE LGF Y G IDG+++ + ++VL+  +     GP ++HV T+KG GY  AE   DKG  H +   DP   +  ++      Y  V    L      D+ I  +  AM   +    ++++FP    DVGIAE+HAVT AAGMA +  K F +IYSTFLQR+YD ++HDVA   LP+ F +DR  L  +DG TH G +DIG+L ++P   +  A+++ EL  ++  A  + + P   RY +
  S:    24 RPNTPLLDRIAGPSDLRQMPDRQLAALADELRAEVISAVSETGGHLGSSLGVVELTVAIHAVFSTPMDKLIWDVGHQCYPHKILTGRRDRIRTLRQKDGLSGFTKRSESIYDPFGAAHSSTSISAALGFAVGRDMGQATGDAIAVIGDGSISAGMAYEALNNAGAEGRRLFVILNDNEMSIAPPVGAMSSYLSR------MYASEPLARMASLAEGFEAALPTPLRESAKRARQLVTGLTGSGTLFEELGFQYVGPIDGHDMGQLLSVLRAARTRAT-GPVLIHVCTVKGKGYAPAEGAADKG--HGVSKFDPATGAQAKSKPGAPSYTGVFGQALVDEAARDDRIVAVTAAMPDGTGLTKMAERFPARVFDVGIAEQHAVTFAAGMAASGLKPFCTIYSTFLQRAYDQVVHDVALQGLPVRFAIDRAGLVGADGATHAGAFDIGYLGNLPGMTLMAAADEAELVHMVATAAAHDAGPIAFRYPR 499
>gi|115463849|ref|NP_001055524.1| Os05g0408900 [Oryza sativa (japonica cultivar-group)] >gi|90110016|sp|O22567|DXS_ORYSJ Probable 1-deoxy-D-xylulose-5-phosphate synthase, chloroplast precursor (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|49328155|gb|AAT58851.1| putative 1-deoxy-D-xylulose-5-phosphate synthase [Oryza sativa (japonica cultivar-group)] >gi|113579075|dbj|BAF17438.1| Os05g0408900 [Oryza sativa (japonica cultivar-group)] (720 aa)
Score = 776, Expect = 3.1e-80, Identities = 181/456 (39%), Positives = 268/456 (58%)
  Q:    18 KKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSK--SKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGM---------SISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKG------KNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAE-LDDKGLYHSLKLSDPNLNSNNQTYG---SVAANFLEKLI---EYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTK 473
           K + L EL  LA  LR  +I        HL S+LG+VEL++AL YVF++PQD I +D GHQ Y HK++T R DK+ T+R++NGLSGF + +ES +D   TGHS   +S   G     + K    +V+ VIGD A++ G A+EA+NN  Y  + M++I+NDN             +  VGAL   +SK Q S+ +    + LR++   K  +K+I  S+++  +K+ ++ +G         FE LG +Y G +DG+N+   I +L+ +K+    GP ++HV T KG GY  AE   DK  YH +   DP      ++     S    F E LI   E DN +  I+ AM   +      ++FPN   DVGIAE+HAVT AAG+A    K F +IYS+FLQR YD ++HDV   +LP+ F +DR  L  +DG TH G +D+ ++  +PN ++   S++ EL  ++  A      P   RY +
  S:    83 KNLSLKELQQLADELRSDVIFHVSKTGGHLGSSLGVVELTVALHYVFNTPQDKILWDVGHQSYPHKILTGRRDKMPTMRQTNGLSGFTKRSESEYDSFGTGHSSTTISAALGMAVGRDLKGGKNNVVAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPAPPVGALSSALSKLQSSRPL----RELREV--AKGVTKQIGGSVHELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLITILREVKSTKTTGPVLIHVVTEKGRGYPYAERAADK--YHGVAKFDPATGKQFKSPAKTLSYTNYFAEALIAEAEQDNRVVAIHAAMGGGTGLNYFLRRFPNRCFDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFLQRGYDQVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVTYMACLPNMVVMAPSDEAELCHMVATAAAIDDRPSCFRYPR 554
>gi|2612941|gb|AAB88295.1| CLA1 transketolase-like protein [Oryza sativa] (594 aa)
Score = 776, Expect = 3.1e-80, Identities = 181/456 (39%), Positives = 268/456 (58%)
  Q:    18 KKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSK--SKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGM---------SISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKG------KNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAE-LDDKGLYHSLKLSDPNLNSNNQTYG---SVAANFLEKLI---EYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTK 473
           K + L EL  LA  LR  +I        HL S+LG+VEL++AL YVF++PQD I +D GHQ Y HK++T R DK+ T+R++NGLSGF + +ES +D   TGHS   +S   G     + K    +V+ VIGD A++ G A+EA+NN  Y  + M++I+NDN             +  VGAL   +SK Q S+ +    + LR++   K  +K+I  S+++  +K+ ++ +G         FE LG +Y G +DG+N+   I +L+ +K+    GP ++HV T KG GY  AE   DK  YH +   DP      ++     S    F E LI   E DN +  I+ AM   +      ++FPN   DVGIAE+HAVT AAG+A    K F +IYS+FLQR YD ++HDV   +LP+ F +DR  L  +DG TH G +D+ ++  +PN ++   S++ EL  ++  A      P   RY +
  S:     7 KNLSLKELQQLADELRSDVIFHVSKTGGHLGSSLGVVELTVALHYVFNTPQDKILWDVGHQSYPHKILTGRRDKMPTMRQTNGLSGFTKRSESEYDSFGTGHSSTTISAALGMAVGRDLKGGKNNVVAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTATLDGPAPPVGALSSALSKLQSSRPL----RELREV--AKGVTKQIGGSVHELAAKVDEYARGMISGSGSTLFEELGLYYIGPVDGHNIDDLITILREVKSTKTTGPVLIHVVTEKGRGYPYAERAADK--YHGVAKFDPATGKQFKSPAKTLSYTNYFAEALIAEAEQDNRVVAIHAAMGGGTGLNYFLRRFPNRCFDVGIAEQHAVTFAAGLACEGLKPFCAIYSSFLQRGYDQVVHDVDLQKLPVRFAMDRAGLVGADGPTHCGAFDVTYMACLPNMVVMAPSDEAELCHMVATAAAIDDRPSCFRYPR 478
>gi|27377762|ref|NP_769291.1| 1-deoxy-D-xylulose-5-phosphate synthase [Bradyrhizobium japonicum USDA 110] >gi|41016964|sp|Q89RW1|DXS_BRAJA 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|27350907|dbj|BAC47916.1| 1-deoxy-D-xylulose-5-phosphate synthase [Bradyrhizobium japonicum USDA 110] (661 aa)
Score = 775, Expect = 3.4e-80, Identities = 196/546 (35%), Positives = 308/546 (56%)
  Q:     8 IDKIPNYEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGF-IEKNNSKSKS-VIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKG-----KNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELD-DKGLYHSLKLSD------PNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEKCEDIEVKK-----EFSFGSWVYALQTKESKTCIISYGDIINDLKK---EIKTK--SIDLINAVFITNYQKENVLRILSTYKNIYVVEK 553
           +D I   +D +K+K+ ++  +A  LR++ ID       H  + LG+VEL+ A+ YVFD+P+D + +D GHQ Y HK++T R D+I T+R   GLSGF + +ES +D     HS   +S   G  + ++ S  K+ VI VIGD A+S G+A+EA+NN     + +++I+NDN MSI+  VGA+   +S+    K    T + LR+    K+ +K++   I    +++ ++ +G        FE LGF+Y G IDG+NL   + VLK ++++   GP ++HV T KG GY  AE   DK  YH++   D           N   Y +V    L K  + D  I  I  AM   +     +K FP+   DVGIAE+HAVT AAG+A    K F +IYSTFLQR YD ++HDVA   LP+ F +DR  L  +DG TH G +D  +L  +PN +I  A+++ EL  ++         P  +RY + +   IE+ +     E   G  +     + SK  ++S+G  + + +K   E+     S  + +A F+     E VL++   ++ +  +E+
  S:    29 LDTIRTPDDLRKLKIEQVRQVADELRQETIDAVSVTGGHFGAGLGVVELTTAIHYVFDTPRDRLIWDVGHQAYPHKILTGRRDRIRTLRTGGGLSGFTKRSESDYDPFGAAHSSTSISAGLGMAVARDLSGGKNNVIAVIGDGAMSAGMAYEAMNNAGAMNSRLIVILNDNDMSIAPPVGAMSAYLSRLYSGK----TYRTLREA--AKQINKRLPKIIANRANRVEEYSRGFMMDGGTLFEELGFYYVGPIDGHNLDHLLPVLKNVRDMEE-GPILVHVVTQKGKGYGPAEASADK--YHAVVKFDVATGTQAKAKPNAPAYQNVFGQSLVKEAQKDEKIVAITAAMPSGTGVDIFNKAFPDRTFDVGIAEQHAVTFAAGLASEGYKPFCAIYSTFLQRGYDQIVHDVAIQNLPVRFAIDRAGLVGADGATHAGSFDNAYLGCLPNMVIMAAADEAELVHMVATQVAIDDRPSSLRYPRGEGRGIEMPEVGIPLEIGKGRMI----RQGSKIALLSFGTRLAECEKAADELAAHGLSTTIADARFMKPLDTELVLKLARDHEILITIEE 585
>gi|169337997|ref|ZP_02620836.2| 1-deoxy-D-xylulose-5-phosphate synthase [Clostridium botulinum C str. Eklund] >gi|169295673|gb|EDS77806.1| 1-deoxy-D-xylulose-5-phosphate synthase [Clostridium botulinum C str. Eklund] (650 aa)
Score = 775, Expect = 3.5e-80, Identities = 191/554 (34%), Positives = 303/554 (54%)
  Q:    16 DFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGFIEKNNSKSK--SVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNS----NNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKE-KCEDIEVKKEFSFGSWVYALQTKESKTCIISYGDIIN-DLKKEIKTK----SIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILAN 569
           + + M   +L   A  +R  +I+       HL+SNLG+VEL++AL  VFD  +D I +D GHQ Y+HK++T RADK   +R+  G+SGF +  ES +DF  TGHS   +S   G     + K++  +V+ VIGD A++ G+A EALN++   KT +++I+NDN MSI KNVG +   +S+ ++       +     +L K      +  S+ K  S + +      FFE +G  Y G IDG+N+K+   V+   KN+   GP ++H  T KG GYK AE  D   +H +   + +       +  TY     + +  L + D  I  I  AM   +     S+K+P  + DVGIAE+HAVT AAGMA +  +   ++YSTFLQR+YD ++HDV +  LP+ F +DR  +  SDG+TH G++D+ FL  +PN  I C  +  E++ ++  A   KS P  IRY +      + +K+++  G W   +        +I+ G ++   +K + K +    +I +INA F+    K  V +++S    I  +E    S   G+ ++   N
  S:    40 ELRNMSFSQLDKFAQEIRNFLINKISKTGGHLASNLGVVELTLALYKVFDLDKDKIVWDVGHQTYIHKILTGRADKFDNLRQYGGMSGFPKRCESKYDFFETGHSSTSISAALGMARARDLKNEKCNVVAVIGDGALTGGMAIEALNDVGDKKTNLIVILNDNQMSIGKNVGGVSTYLSRIRIDPKYNKFKSDFNDVLRKTNIGTGVADSLSKLKSGIKQILVPGMFFEEMGIKYLGPIDGHNIKELTKVINMAKNLK--GPVLIHTITQKGRGYKFAE-KDPDRFHGIGAFNLDTGKVSKISGDTYSKAFGDAIVDLAKEDERIVAITAAMRDGTGLKKFSEKYPKRFFDVGIAEQHAVTLAAGMAESGLRPVFAVYSTFLQRAYDQVIHDVCQQNLPVVFAIDRAGIVGSDGETHQGVFDLSFLSHMPNMTIMCPKSLEEIKYMLKWAVNEKS-PVAIRYPRSGDSTRLPIKEDYISGKW--EVLKDGGNIALIATGKMVAIAMKVQEKMRFMGINITIINACFVKPIDKSMVKKLVSKNYKIITLEDNVLSGGFGEQVLQYVN 599
>gi|15617062|ref|NP_240275.1| 1-deoxy-D-xylulose-5-phosphate synthase [Buchnera aphidicola str. APS (Acyrthosiphon pisum)] >gi|11131990|sp|P57536|DXS_BUCAI 1-deoxy-D-xylulose-5-phosphate synthase (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) >gi|25311117|pir||A84984 dxs protein [imported] - Buchnera sp. (strain APS) >gi|10039127|dbj|BAB13161.1| dxs protein [Buchnera aphidicola str. APS (Acyrthosiphon pisum)] (608 aa)
Score = 775, Expect = 3.6e-80, Identities = 204/607 (33%), Positives = 335/607 (55%)
  Q:     4 NKVKIDKIPN-YEDFKKMKLHELLDLAVLLRKKIIDISENKSAHLSSNLGIVELSMALLYVFDSPQDLIAYDTGHQCYVHKMITDRADKISTIRESNGLSGFQEPNESIHDFISTGHSGNILSICQGF--IEKNNSKSKSVIPVIGDAAISNGLAFEALNNIAYNKTPMLIIINDNGMSISKNVGALHKIMSKFQMSKSVFLTEKILRKILFKKEWSKKIYWSIYKSFSKLSKFFKGKNFFESLGFHYFGVIDGNNLKKTINVLKRIKNIVPFGPTILHVKTIKGLGYKEAELDDKGLYHSLKLSDPNLNSNNQTYGSVAANFLEKLIEYDNNIQIINPAMTLSSNFLNLSKKFPNNYEDVGIAEEHAVTKAAGMAIANKKVFVSIYSTFLQRSYDNLLHDVARLELPITFLVDRCDLSYSDGDTHHGIYDIGFLKSIPNTIITCASNKFELERLIILAYQNKSNPFFIRYTKEK--CEDIEVKKEFSFGSWVYALQTKESKTCIISYGDIINDLKKEIKTKSIDLINAVFITNYQKENVLRILSTYKNIYVVEKVFDSNCLGDDLIILANENKLSCNIKKINIRNNKIGFGNKEDIDKKLNIDMNSIFAEI 610
           NK  I    N  E+ + + + +L  L   LR+ ++D+      H +S LG+VE+++AL YV+++P D + +DTGHQ Y HK++T R +KI++IR+ NGL  F    ES +D +S GHS   +S   G     +   +++  I +IGD A++ G+AFEA+N+    ++ +L+I+NDN MSIS+NVGAL+K     ++ +SV  T+K  +KI   +  +KK+++   +  +    F    + F +LG  Y G  DG+N+   IN LK+IKN    G  +LH+ T KG GY  AEL+    +H++   D +  S + +Y  V   +L ++  +D  +  I PAM   S  +  S+ FPN Y DV IAE+HAVT AAG+AI+  K  VSIYSTF QR+YD L+HD+A  +L + F VDR  +  +DG TH G++D+ +L+ IP  +I   SN+ E  +++   Y +   P  +RY K     E +        G  +  ++ +  K  I+++G ++++     +     L++  F+    K  +L++ S  K    +E+   S   G  +      NK+   +  I + +  I  G +E+I     +D   I+ +I
  S:     6 NKYPILSFANSVENLRLLSVEQLPQLCFELREYLLDVVSISKGHFASGLGVVEITVALHYVYNTPFDNLLWDTGHQAYPHKILTGRGEKINSIRKKNGLHSFPCREESEYDSLSVGHSSTSISAGLGMSIAAEKEGRNRKTICIIGDGAMTAGMAFEAINHAGEIQSNLLVILNDNQMSISRNVGALNK---HLKILRSVQNTQKNRKKI---RLLNKKLFFKDKRIQNHSISF---NSIFSNLGCKYLGPFDGHNIFSIINTLKKIKN--KKGTYLLHLVTKKGKGYLPAELNPIK-WHTISSRD-SSVSKSLSYSDVFGTWLCEIAAFDKKLIAITPAMCEGSGMVKFSRLFPNQYFDVAIAEQHAVTFAAGLAISGYKPVVSIYSTFFQRAYDQLIHDIALQKLSVLFAVDRAGIVGNDGQTHQGVFDLAYLRCIPGIVIMTPSNENECRQMLYTGYMHNKGPSVVRYPKGYGVGELLMPMNRIPIGKSL--IKRRGKKIAILNFGILLHNAYCAAEKLDATLVDMRFVKPLDKSMILKLSSQNKFFITLEEGVISGGAGSAVNEFIMVNKIFLPVLNIGLPDTFIPQGTQEEIRHVYKLDSEGIYKQI 602
<