>gi|26553526|ref|NP_757460.1| hypothetical protein MYPE740 [Mycoplasma penetrans HF-2] >gi|26453532|dbj|BAC43864.1| conserved hypothetical protein [Mycoplasma penetrans HF-2] (296 aa)
Score = 1274, Expect = 1.7e-138, Identities = 296/296 (100%), Positives = 296/296 (100%)
  Q:     1 MIRMSEKEIREFLQKLGLKIENWIKLANFLSIYPTDRIIKDYFYIFLDKNTDMFYEGTTDTDIISLIMFDKEISTNLLKWLLIFETRFKKILIEKWVDIAKPKTDKVYLLNENDFIKLIPNIRKNNLDFKKFTYSLFEHVSNSEFLQDYHSLKDIPFHDLSYSWTFATAINFYRVVSDQVQKEILIEFNIPFEFKDYFHKALNVFLKIRNTISHNHIIYNFKTNLYRLEFNKIYKYLFKEDNQLNQPINLNQIMTFLDYLLNWKHCKKEFEDKLKDLKILNKAKENLIKLFYGLEY 296
           MIRMSEKEIREFLQKLGLKIENWIKLANFLSIYPTDRIIKDYFYIFLDKNTDMFYEGTTDTDIISLIMFDKEISTNLLKWLLIFETRFKKILIEKWVDIAKPKTDKVYLLNENDFIKLIPNIRKNNLDFKKFTYSLFEHVSNSEFLQDYHSLKDIPFHDLSYSWTFATAINFYRVVSDQVQKEILIEFNIPFEFKDYFHKALNVFLKIRNTISHNHIIYNFKTNLYRLEFNKIYKYLFKEDNQLNQPINLNQIMTFLDYLLNWKHCKKEFEDKLKDLKILNKAKENLIKLFYGLEY
  S:     1 MIRMSEKEIREFLQKLGLKIENWIKLANFLSIYPTDRIIKDYFYIFLDKNTDMFYEGTTDTDIISLIMFDKEISTNLLKWLLIFETRFKKILIEKWVDIAKPKTDKVYLLNENDFIKLIPNIRKNNLDFKKFTYSLFEHVSNSEFLQDYHSLKDIPFHDLSYSWTFATAINFYRVVSDQVQKEILIEFNIPFEFKDYFHKALNVFLKIRNTISHNHIIYNFKTNLYRLEFNKIYKYLFKEDNQLNQPINLNQIMTFLDYLLNWKHCKKEFEDKLKDLKILNKAKENLIKLFYGLEY 296
>gi|171920871|ref|ZP_02932032.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|185178895|ref|ZP_02964666.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188024046|ref|ZP_02996800.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188039583|ref|ZP_02998300.1| hypothetical protein Uures_02857 [Ureaplasma urealyticum serovar 8] >gi|188518233|ref|ZP_03003767.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|188524406|ref|ZP_03004428.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|188530965|ref|ZP_03005228.1| hypothetical protein Uurese_01000005_0200002500 [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gi|188569201|ref|ZP_03005718.1| hypothetical protein Uurealyserovar_03351 [Ureaplasma urealyticum serovar 2] >gi|188592840|ref|ZP_03006102.1| hypothetical protein Uureaserovar_03235 [Ureaplasma urealyticum serovar 10] >gi|195867879|ref|ZP_03079878.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|171903080|gb|EDT49369.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|184209153|gb|EDU06196.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188019079|gb|EDU57119.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188998252|gb|EDU67349.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|195660041|gb|EDX53421.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|195660456|gb|EDX53714.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (291 aa)
Score = 183, Expect = 6.4e-12, Identities = 58/223 (26%), Positives = 111/223 (49%)
  Q:    13 LQKLGLKIENWIKLANFLSIYPTDRIIKDYFYIFLDKNTDMFYEGTTDTDIISLIMFDKEISTNLLKWLLIFETRFKKILIEKWVDIAKPKTDKVYLLNENDFIKLIPNIRKNNLDFKKFTYSLFEHVSNSEFLQDYH-SLKDIPFHDLSYSWTFATAINFYRVVSDQVQKEILIEFNI----PFEFKDYFHKALNVFLKIRNTISHNHIIYNFKTNLYRLEFNKIYK 235
           L+  GL I+N  K  +FL  Y   R+I  Y +    K  + + EG    D+I+ ++ D++I+  +   +++FE +   ++++ ++ I    +  V  +  + F+K       +   ++  + +++ + ++S  L  ++ S++ IP  +L+ SWT  T I FYR V   VQ  +L  F +    P EF D  H    +    RN+ISHN ++     N     F K+ +
  S:    14 LKNKGLIIKNKEKFISFLFNYGVIRVIDGYSFFL--KKDNQYVEGLKSKDLINFVLLDRKIANLMGDCIMLFEQQLNAVVVQNFLKINNLTSKYVIDMRADPFLKF-----DSPRHYEILSENIYTYANSSNLLSQFNISVQQIPLINLALSWTLNTTIGFYRAVDANVQISVLEHFELNHITPLEFIDILH----IVKHFRNSISHNDMVITNSFNDNASAFAKVLR 230
>gi|183508429|ref|ZP_02957975.1| conserved hypothetical protein [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|182675837|gb|EDT87742.1| conserved hypothetical protein [Ureaplasma parvum serovar 14 str. ATCC 33697] (291 aa)
Score = 181, Expect = 1.1e-11, Identities = 55/206 (26%), Positives = 108/206 (52%)
  Q:    13 LQKLGLKIENWIKLANFLSIYPTDRIIKDYFYIFLDKNTDMFYEGTTDTDIISLIMFDKEISTNLLKWLLIFETRFKKILIEKWVDIAKPKTDKVYLLNENDFIKLIPNIRKNNLDFKKFTYSLFEHVSNSEFLQDYHS-LKDIPFHDLSYSWTFATAINFYRVVSDQVQKEILIEFNI----PFEFKDYFHKALNVFLKIRNTISHNHII 218
           L+  GL I+N  K  +FL  Y   R+I  Y +    K  + + +G    D+I+ ++ D++I+  +   +++FE +   I+++ ++ I    +  V  +  + FIK      ++   ++  + +++ + ++S  L  +++  ++IP  +L+ SWT  T I FYR V + VQ  +L  F +    P EF D  H    +    RN+ISHN ++
  S:    14 LKNKGLTIKNKEKFISFLFNYGVIRVIDGYSFFL--KKDNQYVKGLKSKDLINFVLLDRKIANLMGDCIMLFEQQLNAIVVQNFLKINNLNSKYVIDMRTDPFIKF-----ESPKHYEILSENIYTYANSSNLLSQFNTNAQEIPLINLALSWTLNTTIGFYRAVDNNVQISVLEYFQLNHITPLEFIDILH----IIKHFRNSISHNDMV 213
>gi|13357949|ref|NP_078223.1| hypothetical protein UU388 [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|170762250|ref|YP_001752471.1| hypothetical protein UPA3_0404 [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|11345879|pir||F82897 hypothetical protein UU388 [imported] - Ureaplasma urealyticum >gi|6899373|gb|AAF30798.1|AE002136_5 unique hypothetical [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168827827|gb|ACA33089.1| conserved hypothetical protein [Ureaplasma parvum serovar 3 str. ATCC 27815] (291 aa)
Score = 181, Expect = 1.1e-11, Identities = 55/206 (26%), Positives = 108/206 (52%)
  Q:    13 LQKLGLKIENWIKLANFLSIYPTDRIIKDYFYIFLDKNTDMFYEGTTDTDIISLIMFDKEISTNLLKWLLIFETRFKKILIEKWVDIAKPKTDKVYLLNENDFIKLIPNIRKNNLDFKKFTYSLFEHVSNSEFLQDYHS-LKDIPFHDLSYSWTFATAINFYRVVSDQVQKEILIEFNI----PFEFKDYFHKALNVFLKIRNTISHNHII 218
           L+  GL I+N  K  +FL  Y   R+I  Y +    K  + + +G    D+I+ ++ D++I+  +   +++FE +   I+++ ++ I    +  V  +  + FIK      ++   ++  + +++ + ++S  L  +++  ++IP  +L+ SWT  T I FYR V + VQ  +L  F +    P EF D  H    +    RN+ISHN ++
  S:    14 LKNKGLTIKNKEKFISFLFNYGVIRVIDGYSFFL--KKDNQYVKGLKSKDLINFVLLDRKIANLMGDCIMLFEQQLNAIVVQNFLKINNLNSKYVIDMRTDPFIKF-----ESPKHYEILSENIYTYANSSNLLSQFNTNAQEIPLINLALSWTLNTTIGFYRAVDNNVQISVLEYFQLNHITPLEFIDILH----IIKHFRNSISHNDMV 213
>gi|171920079|ref|ZP_02931508.1| conserved hypothetical protein [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|186701861|ref|ZP_02971521.1| conserved hypothetical protein [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|171902430|gb|EDT48719.1| conserved hypothetical protein [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|186701164|gb|EDU19446.1| conserved hypothetical protein [Ureaplasma parvum serovar 6 str. ATCC 27818] (291 aa)
Score = 180, Expect = 1.2e-11, Identities = 55/206 (26%), Positives = 108/206 (52%)
  Q:    13 LQKLGLKIENWIKLANFLSIYPTDRIIKDYFYIFLDKNTDMFYEGTTDTDIISLIMFDKEISTNLLKWLLIFETRFKKILIEKWVDIAKPKTDKVYLLNENDFIKLIPNIRKNNLDFKKFTYSLFEHVSNSEFLQDYHS-LKDIPFHDLSYSWTFATAINFYRVVSDQVQKEILIEFNI----PFEFKDYFHKALNVFLKIRNTISHNHII 218
           L+  GL I+N  K  +FL  Y   R+I  Y +    K  + + +G    D+I+ ++ D++I+  +   +++FE +   I+++ ++ I    +  V  +  + FIK      ++   ++  + +++ + ++S  L  +++  ++IP  +L+ SWT  T I FYR V + VQ  +L  F +    P EF D  H    +    RN+ISHN ++
  S:    14 LKNKGLTIKNKEKFISFLFNYGVIRVIDGYSFFL--KKDNQYVKGLKSKDLINFVLLDRKIANLMGDCIMLFEQQLNAIVVQNFLKINNLNSKYVIDMRTDPFIKF-----ESPKHYEILSENIYTYANSSNLLSQFNTNAQEIPLINLALSWTLNTTIGFYRAVDNNVQISVLEYFQLNHITPLEFIDILH----IIKHFRNSISHNDMV 213
>gi|149022032|ref|ZP_01835994.1| hypothetical protein CGSSp23BS72_07651 [Streptococcus pneumoniae SP23-BS72] >gi|147929876|gb|EDK80865.1| hypothetical protein CGSSp23BS72_07651 [Streptococcus pneumoniae SP23-BS72] (316 aa)
Score = 98, Expect = 3.9e-02, Identities = 59/210 (28%), Positives = 95/210 (45%)
  Q:    13 LQKLGLKIENWIKLANFLSIYPTDRIIKDYFYIFLDKNTDMFYEGTTDTDIISLIMFDKEISTNLLKWLLIFETRFKKILIEKWVDIAKPKTDKVYLLNENDFIK--------LIPNIRKNNLDFKKFTYSLFEHVSNSEFLQDYHSLKDIPFHDLSYSWTFATAINFYRVVSDQVQKEI------LIEFNIPFEFKDYF-HKALNVFLK----IRNTISHNHIIYNFK 222
           L+  GL I +  K A +L       II  Y   F    TD + +G T  ++ SL  FDK++   +L+ +L  E   K I   ++ + A P     Y LN N +          ++  + K     K++  +   H +        H+  D+P   L+    F         + + +Q EI       I  NIP +F D F  + L  FLK    +RN  +HN+ + NF+
  S:    14 LKIRGLSITDESKAAKYLLSNNYYNIINGYSKFFQHPGTDTYIDGVTFDEVSSLYTFDKDVKRAILQAILEAEHHIKSITAHRFAE-AYPSQKYAY-LNTNSYADNKILDVGFIVSKLSKIINTNKRYRGNSIHHYA--------HTHSDVPIWVLTDYLEFGDLRTIIENLPNSLQNEIARDLVSFISTNIP-DFNDVFPPETLISFLKNINEVRNKCAHNNRLLNFR 231
>gi|166033328|ref|ZP_02236157.1| hypothetical protein DORFOR_03054 [Dorea formicigenerans ATCC 27755] >gi|166027685|gb|EDR46442.1| hypothetical protein DORFOR_03054 [Dorea formicigenerans ATCC 27755] (313 aa)
Score = 90, Expect = 3.7e-01, Identities = 39/182 (21%), Positives = 83/182 (45%)
  Q:    42 YFYIFLDKNTDMFYEGTTDTDIISLIMFDKEISTNLLKWLLIFETRFKKILIEKWVDIAKPKTDKVYLLNENDFIKLIPNIRKNNLDFKKFTYSLFEHVSNSEFLQDYHSLK---DIPFHDLSYSWTFATAINFYRVVSDQVQKEILIEFNIPFEFKDYFHKALNVFLKIRNTISHNHIIYNFKT 223
           Y ++F   NT  +  GT+  +I+SL  FD E+     K+LL  E + + ++   + ++   +  +   L+ N++     N ++N+    K   +L    + +++    +  K   +IP   L+   TF      +RV    ++ ++   F  P   +    + L+V  K RN  +H   ++ ++T
  S:    47 YKHLFRISNTKKYKVGTSFEEIVSLYKFDAELRELFFKYLLQIERQMRSLMSYYFTEMYGAEQKQ--YLDANNY----NNTKRNHATIVKLIATLKRATTTTDYTYINYYRKTYGEIPLWVLANVLTFGNLSKMFRVFPQSLKSKVSKNFE-PLN-QHQMEQFLSVLTKYRNVCAHGERLFTYRT 223