>gi|26554202|ref|NP_758136.1| acetyltransferase (GNAT) family protein [Mycoplasma penetrans HF-2] >gi|26454211|dbj|BAC44540.1| predicted acetyltransferase (GNAT) family protein [Mycoplasma penetrans HF-2] (228 aa)
Score = 999, Expect = 9.7e-107, Identities = 228/228 (100%), Positives = 228/228 (100%)
  Q:     1 MRIVEITEKDYDDVVLLAKEIFDFDYLLTKRNDEFNMALSRFVTSTIVKNATGGYFIENDEGKKIAMLNYGIPNDKPIFSLMETDFGINLNIFKKYIRDYTITQNEKLIINKEIDIARSFEILYQQYESLLQNKAEIKLLYVAPEYRGKSLSKILIRKFYDDLTRTPYDSFYLFTTTEHNYKFYEKLKMKALDLIVYDNNNAPEYFKYKFKLPYKSIVYMGNKKETIL 228
           MRIVEITEKDYDDVVLLAKEIFDFDYLLTKRNDEFNMALSRFVTSTIVKNATGGYFIENDEGKKIAMLNYGIPNDKPIFSLMETDFGINLNIFKKYIRDYTITQNEKLIINKEIDIARSFEILYQQYESLLQNKAEIKLLYVAPEYRGKSLSKILIRKFYDDLTRTPYDSFYLFTTTEHNYKFYEKLKMKALDLIVYDNNNAPEYFKYKFKLPYKSIVYMGNKKETIL
  S:     1 MRIVEITEKDYDDVVLLAKEIFDFDYLLTKRNDEFNMALSRFVTSTIVKNATGGYFIENDEGKKIAMLNYGIPNDKPIFSLMETDFGINLNIFKKYIRDYTITQNEKLIINKEIDIARSFEILYQQYESLLQNKAEIKLLYVAPEYRGKSLSKILIRKFYDDLTRTPYDSFYLFTTTEHNYKFYEKLKMKALDLIVYDNNNAPEYFKYKFKLPYKSIVYMGNKKETIL 228
>gi|160916223|ref|ZP_02078430.1| hypothetical protein EUBDOL_02250 [Eubacterium dolichum DSM 3991] >gi|158431947|gb|EDP10236.1| hypothetical protein EUBDOL_02250 [Eubacterium dolichum DSM 3991] (212 aa)
Score = 113, Expect = 4.4e-04, Identities = 25/56 (44%), Positives = 32/56 (57%)
  Q:   135 AEIKLLYVAPEYRGKSLSKILIRKFYDDLTRTPYDSFYLFTTTEHNYKFYEKLKMK 190
           AE+ L  ++  YRGK + K L +   D + +   DSFYLFT T  NY FYE   MK
  S:   124 AELALFALSDAYRGKGIGKQLFQAALDYMKQEGLDSFYLFTDTSCNYGFYEHQGMK 179
>gi|167383445|ref|XP_001736539.1| hypothetical protein, conserved [Entamoeba dispar SAW760] >gi|165901039|gb|EDR27217.1| hypothetical protein, conserved [Entamoeba dispar SAW760] (206 aa)
Score = 103, Expect = 6.1e-03, Identities = 27/77 (35%), Positives = 41/77 (53%)
  Q:   121 EILYQQYESLLQNKAEIKLLYVAPEYRGKSLSKILIRKFYDDLTRTPYDSFYLFTTTEHNYKFYEKLKMKALDLIVY 197
           E +YQ+   L+QN  E+ L  V  EYR K + K L+ +F + L +T    FYL T +  NY  Y+ L    ++ + Y
  S:   112 EKMYQKSSKLIQN--EVVLFIVNKEYRRKGIGKQLLNEFINVLQKTNQHDFYLITDSSCNYHLYDYLNYTQINSVFY 186
>gi|169351322|ref|ZP_02868260.1| hypothetical protein CLOSPI_02102 [Clostridium spiroforme DSM 1552] >gi|169291544|gb|EDS73677.1| hypothetical protein CLOSPI_02102 [Clostridium spiroforme DSM 1552] (217 aa)
Score = 101, Expect = 1.3e-02, Identities = 23/57 (40%), Positives = 32/57 (56%)
  Q:   134 KAEIKLLYVAPEYRGKSLSKILIRKFYDDLTRTPYDSFYLFTTTEHNYKFYEKLKMK 190
           +AE+ L  V+   RGK + K+L +   D + +    +FYLFT T  NY FYE   MK
  S:   131 QAELALFAVSSSCRGKGIGKMLFQSTLDYMKQEKLKNFYLFTDTSCNYGFYEHQGMK 187
>gi|160941146|ref|ZP_02088483.1| hypothetical protein CLOBOL_06039 [Clostridium bolteae ATCC BAA-613] >gi|158435707|gb|EDP13474.1| hypothetical protein CLOBOL_06039 [Clostridium bolteae ATCC BAA-613] (206 aa)
Score = 101, Expect = 1.3e-02, Identities = 24/72 (33%), Positives = 38/72 (52%)
  Q:   118 RSFEILYQQYESLL-----QNKAEIKLLYVAPEYRGKSLSKILIRKFYDDLTRTPYDSFYLFTTTEHNYKFYEKLKM 189
           R  E + + Y +LL     + K E+    + P+Y G+ + + L  +F   + R     FY+FT T  NY FYE + M
  S:   103 RFLEEIDRIYAALLSGQPQEYKGELSFFAIHPDYHGQGIGRELFSRFCMYMERENIQHFYVFTDTSCNYGFYENMNM 179
>gi|90961860|ref|YP_535776.1| hypothetical protein LSL_0883 [Lactobacillus salivarius UCC118] >gi|90821054|gb|ABD99693.1| Conserved hypothetical protein [Lactobacillus salivarius UCC118] (201 aa)
Score = 98, Expect = 2.8e-02, Identities = 26/58 (44%), Positives = 34/58 (58%)
  Q:   135 AEIKLLYVAPEYRGKSLSKILIRKFYDDLTRTPYDSFYLFTTTEHNYKFYEK--LKMKAL 192
           AE+ L  V+PE+RG  +   L R+F   L +    SF+L T T   YKFYE   LK KA+
  S:   119 AELNLFVVSPEFRGYGIGSKLYRQFEIYLKKQHLKSFFLHTDTGCAYKFYEHKGLKRKAM 178
>gi|154505009|ref|ZP_02041747.1| hypothetical protein RUMGNA_02519 [Ruminococcus gnavus ATCC 29149] >gi|153794892|gb|EDN77312.1| hypothetical protein RUMGNA_02519 [Ruminococcus gnavus ATCC 29149] (216 aa)
Score = 93, Expect = 9.0e-02, Identities = 22/56 (39%), Positives = 30/56 (53%)
  Q:   135 AEIKLLYVAPEYRGKSLSKILIRKFYDDLTRTPYDSFYLFTTTEHNYKFYEKLKMK 190
           AE+ L  V+   RGK + K+L +   + + +     FYLFT T  NY FYE   MK
  S:   132 AELALFAVSSSCRGKGIGKMLFQSALNYMKQEKLKEFYLFTDTSCNYGFYEHQGMK 187
>gi|167746582|ref|ZP_02418709.1| hypothetical protein ANACAC_01292 [Anaerostipes caccae DSM 14662] >gi|167653542|gb|EDR97671.1| hypothetical protein ANACAC_01292 [Anaerostipes caccae DSM 14662] (212 aa)
Score = 90, Expect = 2.1e-01, Identities = 19/56 (33%), Positives = 28/56 (50%)
  Q:   134 KAEIKLLYVAPEYRGKSLSKILIRKFYDDLTRTPYDSFYLFTTTEHNYKFYEKLKM 189
           + EI    V  E+RG+ + K+L +     +      S+YLFT T  N+ FYE   M
  S:   125 QGEITFFAVDAEFRGRGVGKVLFQNIKTYMKHEEIQSYYLFTDTSCNFGFYEHQGM 180
>gi|163791134|ref|ZP_02185553.1| hypothetical protein CAT7_03319 [Carnobacterium sp. AT7] >gi|159873606|gb|EDP67691.1| hypothetical protein CAT7_03319 [Carnobacterium sp. AT7] (212 aa)
Score = 89, Expect = 2.6e-01, Identities = 20/51 (39%), Positives = 29/51 (56%)
  Q:   135 AEIKLLYVAPEYRGKSLSKILIRKFYDDLTRTPYDSFYLFTTTEHNYKFYE 185
           A + LL V  E++G  +  +L   FYD L +   ++FYLFT    NY +YE
  S:   126 AGLNLLIVKEEFKGLGIGGLLYNHFYDYLKQHQAENFYLFTDNSSNYHYYE 176
>gi|67476892|ref|XP_653983.1| acetyltransferase, GNAT family [Entamoeba histolytica HM-1:IMSS] >gi|56470994|gb|EAL48597.1| acetyltransferase, GNAT family [Entamoeba histolytica HM-1:IMSS] (206 aa)
Score = 89, Expect = 2.7e-01, Identities = 27/79 (34%), Positives = 40/79 (50%)
  Q:   119 SFEILYQQYESLLQN-----KAEIKLLYVAPEYRGKSLSKILIRKFYDDLTRTPYDSFYLFTTTEHNYKFYEKLKMKALDLIVY 197
           S E  Y++ E + Q      + E+ L  V  EYR K + K L+ +F   L +T    FYL T T  NY  Y+ L    ++ + Y
  S:   103 SIEKYYEEAEKINQKSNKSIQNEVVLFIVNKEYRKKGIGKQLLNEFIKILQKTNQHDFYLITDTSCNYHLYDHLNYIQINSVFY 186
>gi|47564825|ref|ZP_00235869.1| acetyltransferase, GNAT family family [Bacillus cereus G9241] >gi|47558198|gb|EAL16522.1| acetyltransferase, GNAT family family [Bacillus cereus G9241] (211 aa)
Score = 89, Expect = 2.8e-01, Identities = 39/181 (21%), Positives = 80/181 (44%)
  Q:     6 ITEKDYDDVVLLAKEIFDFDYLLTKRNDEFNMALSRFVTSTIVKNATGGYFIENDEGKKIAMLNYGIPNDKPIFSLMETDFGINLNIFKKYIRDYTITQNEKLIINKEIDIARSFEILYQQYESLLQNKAEIKLLYVAPEYRGKSLSKILIRKFYDDLTRTPYDSFYLFTTTEHNYKFYEK 186
           + ++DY+ +  L  E F F+  +T +    N  L+ ++ S I+ ++     +   + K I ++      DK              N  K +I +    +  +  +   I + ++++ L Q  E   Q +  I+L  V+ + RG  + K L+   +  + +    S YL+T  E NY+FY++
  S:     9 LVKEDYEPIKHLIGEAFGFNEFITDKK-FLNSVLNFYLHSCILGSSFSK--VAEKDNKVIGVILGDSEKDKNRLKRFHNTISFAFNTLKLFITN----KENREFLKAFIQVQKTYKELIQGKED--QFQGCIQLFIVSEQSRGLGVGKSLLNHLFQYMKKEDVTSLYLYTDNECNYEFYDR 180
>gi|158319940|ref|YP_001512447.1| GCN5-related N-acetyltransferase [Alkaliphilus oremlandii OhILAs] >gi|158140139|gb|ABW18451.1| GCN5-related N-acetyltransferase [Alkaliphilus oremlandii OhILAs] (154 aa)
Score = 88, Expect = 4.1e-01, Identities = 23/69 (33%), Positives = 34/69 (49%)
  Q:   140 LYVAPEYRGKSLSKILIRKFYDDLTRTPYDSFYLFTTTEHNYKFYEKLKMKALDLIVYDNNNAPEYFKY 208
           LYV PE+RGK + ++LI      +    Y++ YL   TEH  K+Y  L  + +     +     E FKY
  S:    85 LYVGPEHRGKGIGEVLIEHVQHVVKELGYEALYL--RTEHTSKYYRGLGWEFVYKTEDEKGQETEVFKY 151
>gi|91075962|ref|XP_969092.1| PREDICTED: similar to MGC131022 protein [Tribolium castaneum] (608 aa)
Score = 85, Expect = 7.5e-01, Identities = 42/166 (25%), Positives = 75/166 (45%)
  Q:    17 LAKEIFDFDYLLTKRNDEFNMALSRFVTSTIVKNATGGYFIENDEGKKIAMLNYGIPNDKPIFSLMETDFGINLNIFKKYIRDYTITQNEKLIINKEIDIARSFEILYQQYESLLQNKAEIKLLYVAPEY--RGKSLSKILIRKFYD--DLTRTPYDSFYLFTTTEHNYK 182
           L KE F FD+   K+    N  LS+     ++   TGG       GK +    + +P      +L++  F + +      I+D  +   +  I    I  + S   + + Y+S+   K+ +KLLYV PE+  R K    +L +K Y+   + R   D  +  +T  H+++
  S:    79 LLKEKFKFDHFRAKQLAAINATLSK--KDVLLVMPTGG-------GKSLV---FQLP------ALIDPGFTLVVTPLVSLIQDQLVALEKFKIEAATIHASTSKSEIKEIYDSMTSKKSALKLLYVTPEWIARSKKFMSVL-KKCYEAKRVARVAIDEVHCCSTWGHDFR 229