>gi|26553527|ref|NP_757461.1| hypothetical protein MYPE750 [Mycoplasma penetrans HF-2] >gi|26453533|dbj|BAC43865.1| hypothetical protein [Mycoplasma penetrans HF-2] (109 aa)
Score = 425, Expect = 1.4e-40, Identities = 109/109 (100%), Positives = 109/109 (100%)
  Q:     1 MNLVKNKKIILCKVLDIKKDHLVVEYKKEKHICDINQISDYSVDLFDFFKIGKTYKFCLVNNKFISYKAVRPKLIKNKRYILPTISGVRTLENHLKEIIRMEKEKKEIK 109
           MNLVKNKKIILCKVLDIKKDHLVVEYKKEKHICDINQISDYSVDLFDFFKIGKTYKFCLVNNKFISYKAVRPKLIKNKRYILPTISGVRTLENHLKEIIRMEKEKKEIK
  S:     1 MNLVKNKKIILCKVLDIKKDHLVVEYKKEKHICDINQISDYSVDLFDFFKIGKTYKFCLVNNKFISYKAVRPKLIKNKRYILPTISGVRTLENHLKEIIRMEKEKKEIK 109