>gi|26553528|ref|NP_757462.1| nitrogen fixation protein [Mycoplasma penetrans HF-2] >gi|26453534|dbj|BAC43866.1| nitrogen fixation protein [Mycoplasma penetrans HF-2] (83 aa)
Score = 340, Expect = 8.0e-31, Identities = 83/83 (100%), Positives = 83/83 (100%)
  Q:     1 MLDNNTNKIIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVIVTE 83
           MLDNNTNKIIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVIVTE
  S:     1 MLDNNTNKIIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVIVTE 83
>gi|31544589|ref|NP_853167.1| hypothetical protein MGA_0005 [Mycoplasma gallisepticum R] >gi|31541434|gb|AAP56735.1| conserved hypothetical protein [Mycoplasma gallisepticum R] (100 aa)
Score = 170, Expect = 4.5e-11, Identities = 44/83 (53%), Positives = 59/83 (71%)
  Q:     1 MLDNNTNKIIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVIVTE 83
           M+      +I EI D++D +R  I +DGGDL F  Y  EKG VTIK+LG C GCSL+D+TYK+G+ETILK E+  VKSV++ +
  S:     1 MMARRKQTVIGEILDLLDDLRLLIKRDGGDLSFEGY--EKGIVTIKLLGNCDGCSLVDMTYKDGVETILKAEIPEVKSVVLIQ 81
>gi|160915579|ref|ZP_02077790.1| hypothetical protein EUBDOL_01587 [Eubacterium dolichum DSM 3991] >gi|158432699|gb|EDP10988.1| hypothetical protein EUBDOL_01587 [Eubacterium dolichum DSM 3991] (76 aa)
Score = 160, Expect = 5.9e-10, Identities = 38/74 (51%), Positives = 52/74 (70%)
  Q:    10 IDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVIVTE 83
           I+EIK VI+ IR YI +DGGD+EFV +  + G V +++LG CIGC+ +D T   G+E IL +EV GV  VI+ E
  S:     5 IEEIKHVINKIRPYIQRDGGDVEFVSF--DNGIVAVRLLGACIGCASVDETISGGIEAILLDEVAGVSKVILVE 76
>gi|169350337|ref|ZP_02867275.1| hypothetical protein CLOSPI_01098 [Clostridium spiroforme DSM 1552] >gi|169293120|gb|EDS75253.1| hypothetical protein CLOSPI_01098 [Clostridium spiroforme DSM 1552] (83 aa)
Score = 149, Expect = 1.1e-08, Identities = 35/70 (50%), Positives = 51/70 (72%)
  Q:    10 IDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           I+EI+ VI+ +R Y+N+DGGD+E VD+  + G V +K+LG C GC+++D T K+G+E IL  EV GV  V
  S:     7 IEEIEKVINKLRPYLNRDGGDIELVDF--KDGIVYVKMLGACAGCAMLDETLKDGVEQILMEEVPGVLEV 74
>gi|167756739|ref|ZP_02428866.1| hypothetical protein CLORAM_02286 [Clostridium ramosum DSM 1402] >gi|167702914|gb|EDS17493.1| hypothetical protein CLORAM_02286 [Clostridium ramosum DSM 1402] (83 aa)
Score = 149, Expect = 1.1e-08, Identities = 34/70 (48%), Positives = 51/70 (72%)
  Q:    10 IDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           I+E++ VI+ +R Y+N+DGGD+E +D+  + G V +K+LG C GCS++D T K+G+E IL  EV GV  V
  S:     7 IEEVEKVINKLRPYLNRDGGDIELIDF--KDGIVYVKMLGACAGCSMLDETLKDGVEQILMEEVPGVLGV 74
>gi|89210750|ref|ZP_01189135.1| Nitrogen-fixing NifU, C-terminal [Halothermothrix orenii H 168] >gi|89159604|gb|EAR79267.1| Nitrogen-fixing NifU, C-terminal [Halothermothrix orenii H 168] (74 aa)
Score = 147, Expect = 2.0e-08, Identities = 32/69 (46%), Positives = 46/69 (66%)
  Q:    11 DEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           +E+  +ID IR  +  DGGD++ VD + EKG V +K+LG C GC +  +T K G+E +LK +V GVK V
  S:     3 EEVAKIIDKIRPSLQADGGDVKLVDVDDEKGIVKVKLLGACQGCPMSTMTIKNGIERVLKEKVPGVKEV 71
>gi|167643992|ref|YP_001681655.1| scaffold protein Nfu/NifU [Caulobacter sp. K31] >gi|167346422|gb|ABZ69157.1| Scaffold protein Nfu/NifU [Caulobacter sp. K31] (189 aa)
Score = 147, Expect = 2.1e-08, Identities = 32/77 (41%), Positives = 46/77 (59%)
  Q:     3 DNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           D  T++I+ EIKD++D+ IR  + QDGGD+ F  + P  G V + + G C GC     T K G+E +LK+ V  V  V
  S:   108 DEETSQIVAEIKDLLDTRIRPAVAQDGGDIVFSKFEPATGVVWLHMRGACSGCPSSSATLKAGVENMLKHYVPEVTRV 185
>gi|45185274|ref|NP_982991.1| ABR045Wp [Ashbya gossypii ATCC 10895] >gi|44980932|gb|AAS50815.1| ABR045Wp [Ashbya gossypii ATCC 10895] (239 aa)
Score = 147, Expect = 2.3e-08, Identities = 33/81 (40%), Positives = 53/81 (65%)
  Q:     3 DNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKN---EVEGVKSVIVTE 83
           D    +I D I+++I + +R  I  DGGD+++  ++PE G V +K+ G C  CS  +VT K G+E++LK+   EV GV+ V+  E
  S:   134 DEEEQEISDTIEEIIQTRVRPAIMDDGGDIQYRGWDPETGRVYLKLQGACKSCSSSEVTLKHGIESMLKHYVEEVSGVEQVLDVE 218
>gi|16124317|ref|NP_418881.1| NifU-like domain-containing protein [Caulobacter crescentus CB15] >gi|13421157|gb|AAK22049.1| NifU-like domain protein [Caulobacter crescentus CB15] (224 aa)
Score = 145, Expect = 3.4e-08, Identities = 31/77 (40%), Positives = 47/77 (61%)
  Q:     3 DNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           D  T++I+ EIK+++D+ IR  + QDGGD+ F  + P+ G V + + G C GC     T K G+E +LK+ V  V  V
  S:   143 DEETSQIVAEIKELLDTRIRPAVAQDGGDIVFSRFEPQTGVVWLHMRGACSGCPSSSATLKSGVENMLKHYVPEVTRV 220
>gi|149238520|ref|XP_001525136.1| HIRA-interacting protein 5 [Lodderomyces elongisporus NRRL YB-4239] >gi|146450629|gb|EDK44885.1| HIRA-interacting protein 5 [Lodderomyces elongisporus NRRL YB-4239] (292 aa)
Score = 142, Expect = 7.4e-08, Identities = 29/78 (37%), Positives = 49/78 (62%)
  Q:     2 LDNNTNKIIDEIKDVI-DSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
            + + ++++  IK++I   IR  I  DGGD+EFV++    G V +++ G C  C    VT K G+E++LK+ +E V+SV
  S:   174 FNEDDDEVVQMIKELIFTRIRPAIQDDGGDIEFVEFRESDGTVFLRLKGACRSCDSSSVTLKNGIESMLKHYIEEVQSV 252
>gi|110004115|emb|CAK98454.1| hypothetical nitrogen fixation protein [Spiroplasma citri] (75 aa)
Score = 142, Expect = 7.6e-08, Identities = 33/71 (46%), Positives = 51/71 (71%)
  Q:    11 DEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVIV 81
           ++ KD+ID++R YINQDGGD+EFV+   +   V +++ G C+GC LID T K+G+E I+K E+  + +V V
  S:     5 NQAKDIIDNLRPYINQDGGDIEFVEV--KNNIVYVRLAGACVGCGLIDSTIKDGVEQIVKQEMPDIIAVEV 73
>gi|196480339|gb|ACG79867.1| thioredoxin-like protein [Phenylobacterium zucineum HLK1] (191 aa)
Score = 140, Expect = 1.3e-07, Identities = 31/77 (40%), Positives = 46/77 (59%)
  Q:     3 DNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           +  T +I+ EIKD++D+ IR  + QDGGD+ F  + P+ G V + + G C GC     T K G+E +LK+ V  V  V
  S:   109 EGETAQIVAEIKDLLDTRIRPAVAQDGGDILFHKFEPDTGVVWLNMRGACSGCPSSTATLKAGVENMLKHYVPEVTRV 186
>gi|83944990|ref|ZP_00957356.1| nifU domain protein [Oceanicaulis alexandrii HTCC2633] >gi|83851772|gb|EAP89627.1| nifU domain protein [Oceanicaulis alexandrii HTCC2633] (186 aa)
Score = 140, Expect = 1.4e-07, Identities = 31/71 (43%), Positives = 45/71 (63%)
  Q:     9 IIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           I+ EIKDVID+ +R  + +DGGD+ F  Y+   G V + + G C GC    +T K+G+E +LK+ V  V SV
  S:   111 IVKEIKDVIDTRVRPAVARDGGDIVFHSYDEATGVVNLHMRGACAGCPSSTMTLKQGIENLLKHYVPEVSSV 182
>gi|192813654|ref|ZP_03042313.1| nitrogen-fixing NifU domain protein [Geobacillus sp. Y412MC10] >gi|192797491|gb|EDV74012.1| nitrogen-fixing NifU domain protein [Geobacillus sp. Y412MC10] (81 aa)
Score = 139, Expect = 1.9e-07, Identities = 31/80 (38%), Positives = 49/80 (61%)
  Q:     1 MLDNNTNKIIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           M +N    + DE+ +V+D +R ++ +DGGD+E VD   E G V +K++G C  C    +T K G+E  L  EVEG++ V+
  S:     1 MSENTQTTVYDEVAEVLDKLRPFLQRDGGDVELVDV--EDGIVKLKLMGACGSCPSSTITLKAGIERALVEEVEGIQEVV 78
>gi|68490038|ref|XP_711140.1| hypothetical protein CaO19.6283 [Candida albicans SC5314] >gi|68490075|ref|XP_711122.1| hypothetical protein CaO19.13662 [Candida albicans SC5314] >gi|46432400|gb|EAK91883.1| hypothetical protein CaO19.13662 [Candida albicans SC5314] >gi|46432419|gb|EAK91901.1| hypothetical protein CaO19.6283 [Candida albicans SC5314] (262 aa)
Score = 139, Expect = 2.0e-07, Identities = 31/78 (39%), Positives = 51/78 (65%)
  Q:     2 LDNNTNKIIDEIKDVI-DSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           ++ + ++++  IK++I   IR  I  DGGD+EFV++N E G V +++ G C  C    VT K G+E++LK+ +E V SV
  S:   144 INEDDDEVVSMIKELIFTRIRPAIQDDGGDIEFVNFNEEDGTVYLRLKGACRSCDSSSVTLKNGIESMLKHYIEEVNSV 222
>gi|68492023|ref|XP_710207.1| hypothetical protein CaO19.3485 [Candida albicans SC5314] >gi|46431364|gb|EAK90941.1| hypothetical protein CaO19.3485 [Candida albicans SC5314] (262 aa)
Score = 139, Expect = 2.0e-07, Identities = 31/78 (39%), Positives = 51/78 (65%)
  Q:     2 LDNNTNKIIDEIKDVI-DSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           ++ + ++++  IK++I   IR  I  DGGD+EFV++N E G V +++ G C  C    VT K G+E++LK+ +E V SV
  S:   144 INEDDDEVVSMIKELIFTRIRPAIQDDGGDIEFVNFNEEDGTVYLRLKGACRSCDSSSVTLKNGIESMLKHYIEEVNSV 222
>gi|125550903|gb|EAY96612.1| hypothetical protein OsI_017845 [Oryza sativa (indica cultivar-group)] (272 aa)
Score = 138, Expect = 2.1e-07, Identities = 29/78 (37%), Positives = 49/78 (62%)
  Q:     2 LDNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           +  + ++I+  IK+++++ IR  +  DGGD+E+  ++PE G V +K+ G C GC    VT K G+E +L + V  VK V
  S:   177 IHEDDSEIVAMIKELLETRIRPAVQDDGGDIEYRGFDPETGIVKLKMQGACSGCPSSSVTLKSGIENMLMHYVPEVKGV 255
>gi|115462181|ref|NP_001054690.1| Os05g0155300 [Oryza sativa (japonica cultivar-group)] >gi|54291852|gb|AAV32220.1| unknown protein [Oryza sativa (japonica cultivar-group)] >gi|113578241|dbj|BAF16604.1| Os05g0155300 [Oryza sativa (japonica cultivar-group)] >gi|125592875|gb|EAZ32934.1| hypothetical protein OsJ_016417 [Oryza sativa (japonica cultivar-group)] (272 aa)
Score = 138, Expect = 2.1e-07, Identities = 29/78 (37%), Positives = 49/78 (62%)
  Q:     2 LDNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           +  + ++I+  IK+++++ IR  +  DGGD+E+  ++PE G V +K+ G C GC    VT K G+E +L + V  VK V
  S:   177 IHEDDSEIVAMIKELLETRIRPAVQDDGGDIEYRGFDPETGIVKLKMQGACSGCPSSSVTLKSGIENMLMHYVPEVKGV 255
>gi|50426637|ref|XP_461916.1| hypothetical protein DEHA0G09207g [Debaryomyces hansenii CBS767] >gi|49657586|emb|CAG90379.1| unnamed protein product [Debaryomyces hansenii CBS767] (240 aa)
Score = 137, Expect = 3.4e-07, Identities = 30/73 (41%), Positives = 49/73 (67%)
  Q:     8 KIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           +I+  IK++I++ IR  I  DGGD+EF  ++ E G V +K+ G C  CS  + T K G+E ++K+ ++GV+ VI
  S:   134 EIVSMIKELIETRIRPAIQDDGGDIEFKGFDEETGNVFLKLQGACKTCSSSEDTLKNGIEQMMKHYIDGVQEVI 207
>gi|145344446|ref|XP_001416743.1| predicted protein [Ostreococcus lucimarinus CCE9901] >gi|144576969|gb|ABO95036.1| predicted protein [Ostreococcus lucimarinus CCE9901] (206 aa)
Score = 135, Expect = 5.6e-07, Identities = 29/76 (38%), Positives = 50/76 (65%)
  Q:     5 NTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           + ++I+  IK+++++ IR  + +DGGD+ F  ++PE G VT+++ G C GC    VT K G+E +L + V  VK V+
  S:   108 DDDEIVAMIKELLETRIRPAVAEDGGDIVFKAFDPESGLVTVQLQGSCDGCPSSSVTLKSGIENMLMHYVPEVKGVV 184
>gi|189200054|ref|XP_001936364.1| HIRA-interacting protein 5 [Pyrenophora tritici-repentis Pt-1C-BFP] >gi|187983463|gb|EDU48951.1| HIRA-interacting protein 5 [Pyrenophora tritici-repentis Pt-1C-BFP] (312 aa)
Score = 135, Expect = 5.8e-07, Identities = 29/77 (37%), Positives = 50/77 (64%)
  Q:     3 DNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           D N ++++  IK+++++ +R  I +DGGD+EF  +N   G+V +K+ G C  C    VT K G+E++L + +E VK V
  S:   193 DENDDEVVGMIKELLETRVRPAIQEDGGDIEFRGFN--DGQVWLKLRGACRTCDSSTVTLKNGIESMLMHYIEEVKGV 268
>gi|50292835|ref|XP_448850.1| unnamed protein product [Candida glabrata] >gi|49528163|emb|CAG61820.1| unnamed protein product [Candida glabrata] (263 aa)
Score = 135, Expect = 5.8e-07, Identities = 29/61 (47%), Positives = 42/61 (68%)
  Q:    20 IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           IR  I +DGGD++F  ++PE G V +K+ G C  CS  +VT K G+E++LK+ V+ VK VI
  S:   166 IRPAILEDGGDIDFRGWDPESGTVYLKLQGACTSCSSSEVTLKYGIESMLKHYVDEVKEVI 226
>gi|190346499|gb|EDK38598.2| hypothetical protein PGUG_02696 [Pichia guilliermondii ATCC 6260] (244 aa)
Score = 134, Expect = 6.4e-07, Identities = 30/71 (42%), Positives = 47/71 (66%)
  Q:     9 IIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           I+  IK++I++ IR  I  DGGD+E+  ++ E G V +K+ G C  CS  + T K G+E++LK+ VE V+ V
  S:   137 IVSMIKELIETRIRPAIQDDGGDIEYKAFDEETGTVFLKLQGACKSCSASEDTLKHGIESMLKHYVEEVQEV 208
>gi|146418001|ref|XP_001484967.1| hypothetical protein PGUG_02696 [Pichia guilliermondii ATCC 6260] (244 aa)
Score = 134, Expect = 6.9e-07, Identities = 30/71 (42%), Positives = 47/71 (66%)
  Q:     9 IIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           I+  IK++I++ IR  I  DGGD+E+  ++ E G V +K+ G C  CS  + T K G+E++LK+ VE V+ V
  S:   137 IVSMIKELIETRIRPAIQDDGGDIEYKAFDEETGTVFLKLQGACKSCSASEDTLKHGIESMLKHYVEEVQEV 208
>gi|116056795|emb|CAL53084.1| NifU-like domain-containing proteins (ISS) [Ostreococcus tauri] (244 aa)
Score = 134, Expect = 7.2e-07, Identities = 27/78 (34%), Positives = 51/78 (65%)
  Q:     2 LDNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           ++ + ++++  IK+++++ IR  + +DGGD+ F  Y+ E G V+++++G C GC    VT K G+E +L + V  VK V
  S:   144 IEEDDDEVVAMIKELLETRIRPAVAEDGGDIVFKAYDQETGVVSVQLMGACDGCPSSSVTLKSGIENMLMHYVPEVKGV 222
>gi|57335931|emb|CAH25367.1| nifU-like protein [Guillardia theta] (183 aa)
Score = 134, Expect = 7.2e-07, Identities = 29/82 (35%), Positives = 51/82 (62%)
  Q:     2 LDNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVIVTE 83
           ++ + ++I+  IK+++D+ IR  +  DGGD+ F+ ++ E G VT+++ G C  CS   VT K G+E +L + V  V  V+  E
  S:    71 VNEDDSEIVAMIKELLDTRIRPAVQDDGGDISFIGFDEETGRVTVRLQGACSTCSSSKVTLKSGVENMLMHYVPEVTEVVAVE 153
>gi|134300123|ref|YP_001113619.1| NifU domain-containing protein [Desulfotomaculum reducens MI-1] >gi|134052823|gb|ABO50794.1| nitrogen-fixing NifU domain protein [Desulfotomaculum reducens MI-1] (74 aa)
Score = 133, Expect = 8.9e-07, Identities = 28/70 (40%), Positives = 46/70 (65%)
  Q:    11 DEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           +++K+ ++ +R ++ +DGGD+EFVD + EKG V +K+ G C  C     T K G+E +LK +V GV  V+
  S:     3 EQVKEALEQVRPFLQRDGGDVEFVDCD-EKGVVKVKLRGACGSCPGALYTLKNGIERVLKQQVPGVTEVV 71
>gi|168061090|ref|XP_001782524.1| predicted protein [Physcomitrella patens subsp. patens] >gi|162666009|gb|EDQ52676.1| predicted protein [Physcomitrella patens subsp. patens] (212 aa)
Score = 133, Expect = 9.1e-07, Identities = 30/77 (38%), Positives = 45/77 (58%)
  Q:     3 DNNTNKIIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           D+ T  +I E+ +    IR  +  DGGD+E+  ++PE G V++K+ G C GC    VT K G+E +L + V  VK V
  S:   122 DDETVAMIKELLET--RIRPAVQDDGGDIEYRGFDPESGIVSLKMQGACSGCPSSAVTLKSGIENMLMHYVSEVKGV 196
>gi|150864668|ref|XP_001383601.2| hypothetical protein PICST_82838 [Pichia stipitis CBS 6054] >gi|149385924|gb|ABN65572.2| predicted protein [Pichia stipitis CBS 6054] (254 aa)
Score = 133, Expect = 9.4e-07, Identities = 30/78 (38%), Positives = 50/78 (64%)
  Q:     2 LDNNTNKIIDEIKDVI-DSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           ++++ ++++  IK++I   IR  I  DGGD+EFV +  E G V +++ G C  C    VT K G+E++LK  +E VK+V
  S:   139 INDDDDEVVSIIKELIFTRIRPAIQDDGGDIEFVSFREEDGTVFLRLKGACRSCDSSSVTLKNGIESMLKYYIEEVKAV 217
>gi|162312172|ref|NP_595452.2| NifU-like protein [Schizosaccharomyces pombe] >gi|46397296|sp|Q9UUB8|YH9J_SCHPO NifU-like protein C1709.19c >gi|157310401|emb|CAA21258.2| NifU-like protein [Schizosaccharomyces pombe] (260 aa)
Score = 133, Expect = 9.9e-07, Identities = 29/74 (39%), Positives = 51/74 (68%)
  Q:     7 NKIIDEIKDVID-SIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           ++I+  IK++I+ SIR  I +DGGD+EF  ++ + G V++K+ G C  CS   VT K G++ +LK+ +  V++V+
  S:   155 SQIVAMIKELIETSIRPSIQEDGGDVEFRGFDEKTGTVSLKLRGACRTCSSSAVTLKNGIQQMLKHYIPEVENVV 229
>gi|18402817|ref|NP_566673.1| NFU4 (NFU domain protein 4) [Arabidopsis thaliana] >gi|75273382|sp|Q9LIG6|NIFU4_ARATH NifU-like protein 4, mitochondrial precursor (AtNfu4) (AtNfu-III) >gi|13899085|gb|AAK48964.1|AF370537_1 Unknown protein [Arabidopsis thaliana] >gi|9294004|dbj|BAB01907.1| unnamed protein product [Arabidopsis thaliana] >gi|18377516|gb|AAL66924.1| unknown protein [Arabidopsis thaliana] >gi|28207822|emb|CAD55561.1| NFU4 protein [Arabidopsis thaliana] (283 aa)
Score = 132, Expect = 1.1e-06, Identities = 27/78 (34%), Positives = 48/78 (61%)
  Q:     2 LDNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           +  + ++ +  IK+++++ IR  +  DGGD+E+  ++PE G V +++ G C GC    VT K G+E +L + V  VK V
  S:   185 ISEDDSETVAMIKELLETRIRPAVQDDGGDIEYCGFDPESGIVKLRMQGACSGCPSSSVTLKSGIENMLMHYVSEVKGV 263
>gi|114799747|ref|YP_759252.1| NifU domain-containing protein [Hyphomonas neptunium ATCC 15444] >gi|114739921|gb|ABI78046.1| NifU domain protein [Hyphomonas neptunium ATCC 15444] (192 aa)
Score = 132, Expect = 1.1e-06, Identities = 27/77 (35%), Positives = 49/77 (63%)
  Q:     3 DNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           +  T +I++EIK++I++ +R  + QDGGD+ F  ++ + G V + + G C GC    +T K+G+E +L+  V  V +V
  S:   111 EGETAEIVNEIKELIETRVRPAVAQDGGDITFHRFDADTGIVHLSMRGACAGCPSSTMTLKQGIENMLRTYVPEVTAV 188
>gi|50312363|ref|XP_456215.1| unnamed protein product [Kluyveromyces lactis] >gi|49645351|emb|CAG98923.1| unnamed protein product [Kluyveromyces lactis NRRL Y-1140] (256 aa)
Score = 131, Expect = 1.4e-06, Identities = 30/78 (38%), Positives = 49/78 (62%)
  Q:     3 DNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           D +  +I + I ++I + IR  I  DGGD+++  +NPE G V +K+ G C  CS  + T K G+E +LK+ +E V+ V+
  S:   152 DEDEQEISEMIDELIQTRIRPAIMDDGGDIQYRGWNPETGTVYLKLQGACKSCSSSEDTLKHGIEAMLKHYIEEVEDVV 230
>gi|71029204|ref|XP_764245.1| hypothetical protein TP04_0610 [Theileria parva strain Muguga] >gi|68351199|gb|EAN31962.1| hypothetical protein [Theileria parva] (180 aa)
Score = 131, Expect = 1.4e-06, Identities = 29/72 (40%), Positives = 46/72 (63%)
  Q:     8 KIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           + ++ IK +ID  IR  I QDGGD+ FV Y+P  G V +++ G C+GC   DVT K  ++ +L + +E + +V
  S:    90 ETVESIKILIDKRIRPVIQQDGGDVSFVSYDPSTGYVYVRLSGACVGCIQSDVTLKHMIQGMLCHYLEEITAV 162
>gi|50545601|ref|XP_500339.1| hypothetical protein [Yarrowia lipolytica] >gi|49646205|emb|CAG82553.1| unnamed protein product [Yarrowia lipolytica CLIB122] (285 aa)
Score = 131, Expect = 1.5e-06, Identities = 28/76 (36%), Positives = 49/76 (64%)
  Q:     4 NNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           ++ ++++  IK++I++ IR  I +DGGD+ F  ++ + G V +K+LG C  C    VT K G+E++L + VE V  V
  S:   175 DDDSEVVSMIKELIETRIRPAIQEDGGDIAFRGFDEDTGVVHLKLLGACRSCDSSAVTLKNGIESMLMHYVEEVTGV 251
>gi|4790|emb|CAA49299.1| YKL253 [Saccharomyces cerevisiae] (230 aa)
Score = 131, Expect = 1.5e-06, Identities = 30/78 (38%), Positives = 51/78 (65%)
  Q:     3 DNNTNKIIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           D   +++I+E+ D    IR  I +DGGD+++  ++P+ G V +++ G C  CS  +VT K G+E++LK+ V+ VK VI
  S:   150 DEEVSELIEELIDT--RIRPAILEDGGDIDYRGWDPKTGTVYLRLQGACTSCSSSEVTLKYGIESMLKHYVDEVKEVI 225
>gi|77919925|ref|YP_357740.1| NifU-like protein [Pelobacter carbinolicus DSM 2380] >gi|77546008|gb|ABA89570.1| NifU-like protein [Pelobacter carbinolicus DSM 2380] (103 aa)
Score = 131, Expect = 1.6e-06, Identities = 29/81 (35%), Positives = 48/81 (59%)
  Q:     3 DNNTNKIIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVIVTE 83
           D    ++ +++ +++D IR  +  DGGD+E VD + E G V +++ G C  C +  +T K G+E  LK +V GVK V+  E
  S:    23 DKGRCQMKEQVLEILDKIRPSLQADGGDVELVDIS-EDGVVKVRLKGACGSCPMSTMTLKMGIERTLKAQVPGVKEVVRAE 102
>gi|68472639|ref|XP_719638.1| hypothetical protein CaO19.9614 [Candida albicans SC5314] >gi|68472898|ref|XP_719514.1| hypothetical protein CaO19.2067 [Candida albicans SC5314] >gi|46441335|gb|EAL00633.1| hypothetical protein CaO19.2067 [Candida albicans SC5314] >gi|46441464|gb|EAL00761.1| hypothetical protein CaO19.9614 [Candida albicans SC5314] (237 aa)
Score = 131, Expect = 1.7e-06, Identities = 31/74 (41%), Positives = 48/74 (64%)
  Q:     7 NKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           +++I  IK++I++ IR  I  DGGD+E   ++ E G V +K+ G C  CS  + T K G+E++L + VE VK VI
  S:   128 SELISMIKELIETRIRPAIQDDGGDIELKGFDEETGTVFVKLQGACKSCSASEDTLKHGIESMLMHYVEEVKEVI 202
>gi|151941505|gb|EDN59868.1| nifu-like protein [Saccharomyces cerevisiae YJM789] (256 aa)
Score = 130, Expect = 1.8e-06, Identities = 30/78 (38%), Positives = 51/78 (65%)
  Q:     3 DNNTNKIIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           D   +++I+E+ D    IR  I +DGGD+++  ++P+ G V +++ G C  CS  +VT K G+E++LK+ V+ VK VI
  S:   150 DEEVSELIEELIDT--RIRPAILEDGGDIDYRGWDPKTGTVYLRLQGACTSCSSSEVTLKYGIESMLKHYVDEVKEVI 225
>gi|156839096|ref|XP_001643243.1| hypothetical protein Kpol_460p20 [Vanderwaltozyma polyspora DSM 70294] >gi|156113844|gb|EDO15385.1| hypothetical protein Kpol_460p20 [Vanderwaltozyma polyspora DSM 70294] (256 aa)
Score = 130, Expect = 1.9e-06, Identities = 31/79 (39%), Positives = 52/79 (65%)
  Q:     2 LDNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           L+ +  ++ D I ++I + IR  I  DGGD+++  Y+P+ G+V +K+ G C  CS  + T K G+E++LK+ VE V+ VI
  S:   150 LNEDEQEVSDMIDELIQTRIRPAIQDDGGDIQYRGYDPKTGKVYLKLQGACKSCSSSEDTLKYGIESMLKHYVEEVEEVI 229
>gi|78224272|ref|YP_386019.1| nitrogen-fixing NifU-like [Geobacter metallireducens GS-15] >gi|78195527|gb|ABB33294.1| Nitrogen-fixing NifU-like [Geobacter metallireducens GS-15] (74 aa)
Score = 130, Expect = 2.1e-06, Identities = 30/75 (40%), Positives = 48/75 (64%)
  Q:     9 IIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVIVTE 83
           +++E+K V+D++R  +  DGGD+E V+   E G V +K++G C  C +  +T K G+E  LK +V GVK VI  +
  S:     1 MLEEVKKVLDTVRPALQADGGDVELVEVT-EDGVVKVKLVGACGHCPMSTMTLKMGIERTLKEKVPGVKEVISVQ 74
>gi|6322811|ref|NP_012884.1| Protein involved in iron metabolism in mitochondria; similar to NifU, which is a protein required for the maturation of the Fe/S clusters of nitrogenase in nitrogen-fixing bacteria; Nfu1p [Saccharomyces cerevisiae] >gi|549668|sp|P32860|NFU1_YEAST NifU-like protein, mitochondrial precursor >gi|486050|emb|CAA81875.1| unnamed protein product [Saccharomyces cerevisiae] >gi|45269699|gb|AAS56230.1| YKL040C [Saccharomyces cerevisiae] >gi|190409786|gb|EDV13051.1| hypothetical protein SCRG_03979 [Saccharomyces cerevisiae RM11-1a] (256 aa)
Score = 130, Expect = 2.1e-06, Identities = 30/78 (38%), Positives = 51/78 (65%)
  Q:     3 DNNTNKIIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           D   +++I+E+ D    IR  I +DGGD+++  ++P+ G V +++ G C  CS  +VT K G+E++LK+ V+ VK VI
  S:   150 DEEVSELIEELIDT--RIRPAILEDGGDIDYRGWDPKTGTVYLRLQGACTSCSSSEVTLKYGIESMLKHYVDEVKEVI 225
>gi|156088839|ref|XP_001611826.1| NifU-like domain containing protein [Babesia bovis] >gi|154799080|gb|EDO08258.1| NifU-like domain containing protein [Babesia bovis] (123 aa)
Score = 130, Expect = 2.2e-06, Identities = 27/73 (36%), Positives = 47/73 (64%)
  Q:     8 KIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           +++D IK +ID  I   + QDGGD+ F+ Y+PE G V +++ G C+GC+  D+T K  ++  L + ++ V  V+
  S:    32 EVVDSIKLLIDKRIAPVVRQDGGDVSFISYDPETGFVYVRLSGACVGCAQSDITLKHMIQGTLCHYLDDVTGVM 105
>gi|126131446|ref|XP_001382248.1| hypothetical protein PICST_76567 [Pichia stipitis CBS 6054] >gi|126094073|gb|ABN64219.1| predicted protein [Pichia stipitis CBS 6054] (242 aa)
Score = 129, Expect = 2.7e-06, Identities = 28/74 (37%), Positives = 49/74 (66%)
  Q:     7 NKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           ++I+  IK++I++ IR  I  DGGD+E+  ++ E G V +K+ G C  CS  + T K G+E++L + +E V+ V+
  S:   131 SEIVSMIKELIETRIRPAIQDDGGDIEYKAFDEETGTVFLKLQGACKSCSSSEDTLKHGIESMLMHYIEEVREVV 205
>gi|162448199|ref|YP_001621331.1| NifU-like domain-containing protein [Acholeplasma laidlawii PG-8A] >gi|161986306|gb|ABX81955.1| NifU-like domain protein [Acholeplasma laidlawii PG-8A] (77 aa)
Score = 128, Expect = 3.0e-06, Identities = 29/72 (40%), Positives = 48/72 (66%)
  Q:     9 IIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           + +++  +I  +R YI +DGGD+E V  N E G V +K+ G C GC+ ID+T K+G+ET++   V G+ +V+
  S:     6 MTEQVGQIIKRVRPYIQRDGGDIELV--NIEDGIVYVKMGGACDGCAAIDITLKQGIETMMLENVPGIIAVV 75
>gi|169608792|ref|XP_001797815.1| hypothetical protein SNOG_07481 [Phaeosphaeria nodorum SN15] >gi|111063827|gb|EAT84947.1| hypothetical protein SNOG_07481 [Phaeosphaeria nodorum SN15] (263 aa)
Score = 128, Expect = 3.7e-06, Identities = 29/77 (37%), Positives = 50/77 (64%)
  Q:     3 DNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           D N ++++  IK+++++ IR  I +DGGD++F  +N   G+V +K+ G C  C    VT K G+E++L + +E VK V
  S:   144 DENDSEVVQMIKELLETRIRPSIQEDGGDIDFRGFN--DGQVLLKLRGACRTCDSSTVTLKNGIESMLMHYIEEVKGV 219
>gi|171689560|ref|XP_001909720.1| unnamed protein product [Podospora anserina] >gi|170944742|emb|CAP70853.1| unnamed protein product [Podospora anserina] (323 aa)
Score = 127, Expect = 4.2e-06, Identities = 32/81 (39%), Positives = 52/81 (64%)
  Q:     3 DNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKN---EVEGVKSVIVTE 83
           D N ++++  IK+++++ IR  I +DGGD+EF  +  E G V +K+ G C  C    VT K G+E +L +   EV+GV+ V+  E
  S:   205 DENDSEVVGMIKELLETRIRPAIQEDGGDIEFRGF--ENGIVMLKLRGACRTCDSSTVTLKNGIEGMLMHYIEEVQGVEQVLDEE 287
>gi|167465184|ref|ZP_02330273.1| nitrogen-fixing NifU domain protein [Paenibacillus larvae subsp. larvae BRL-230010] (82 aa)
Score = 127, Expect = 4.4e-06, Identities = 28/70 (40%), Positives = 45/70 (64%)
  Q:    11 DEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           DE+ +V+D +R ++ +DGGD+E VD   E G V ++++G C  C    +T K G+E  L  EVEG++ V+
  S:    12 DEVLEVLDKLRPFLQRDGGDVELVDV--EDGIVKLRLMGACGSCPSSTITLKAGIERALVEEVEGIQEVV 79
>gi|149248632|ref|XP_001528703.1| hypothetical protein LELG_01223 [Lodderomyces elongisporus NRRL YB-4239] >gi|146448657|gb|EDK43045.1| hypothetical protein LELG_01223 [Lodderomyces elongisporus NRRL YB-4239] (248 aa)
Score = 127, Expect = 4.6e-06, Identities = 29/77 (37%), Positives = 50/77 (64%)
  Q:     3 DNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           D + ++++  IK++I++ IR  I  DGGD+E+  ++ E G V +K+ G C  CS  + T K G+E++L + +E VK V
  S:   134 DEDDSELVLMIKELIETRIRPAIQDDGGDIEYKGFDEETGTVFLKLQGACKSCSASEDTLKGGIESMLMHYIEEVKEV 211
>gi|148263012|ref|YP_001229718.1| NifU domain-containing protein [Geobacter uraniireducens Rf4] >gi|146396512|gb|ABQ25145.1| nitrogen-fixing NifU domain protein [Geobacter uraniireducens Rf4] (73 aa)
Score = 126, Expect = 5.7e-06, Identities = 32/72 (44%), Positives = 46/72 (63%)
  Q:     9 IIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           +I+E+K V+D IR  +  DGGD+E V+   E G V +K++G C  C +  +T K G+E  LK +V GVK VI
  S:     1 MIEEVKKVLDLIRPNLQADGGDVELVEVT-EDGVVKVKLVGACGHCPMSTMTLKMGIERTLKEKVPGVKEVI 71
>gi|110601540|ref|ZP_01389722.1| Nitrogen-fixing NifU-like [Geobacter sp. FRC-32] >gi|110547744|gb|EAT60988.1| Nitrogen-fixing NifU-like [Geobacter sp. FRC-32] (93 aa)
Score = 126, Expect = 6.4e-06, Identities = 31/74 (41%), Positives = 49/74 (66%)
  Q:     7 NKIIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           +++I+++K V+D+IR  +  DGGD+E V+   E G V +K++G C  C +  +T K G+E  LK +V GVK VI
  S:    19 DEMIEDVKKVLDTIRPNLQADGGDVELVEVG-EDGVVKVKLVGACGHCPMSTMTLKMGIERTLKEKVPGVKEVI 91
>gi|116781621|gb|ABK22181.1| unknown [Picea sitchensis] (181 aa)
Score = 126, Expect = 6.5e-06, Identities = 27/78 (34%), Positives = 49/78 (62%)
  Q:     2 LDNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           ++ + ++ +  IK+++++ IR  +  DGGD+E+  ++PE G V +K+ G C GC    +T K G+E +L + V  VK V
  S:    84 INEDDDETVAMIKELLETRIRPAVQDDGGDIEYCGFDPETGVVKLKMQGACSGCPSSSLTLKSGIENMLMHYVPEVKGV 162
>gi|85859635|ref|YP_461837.1| nifU-like domain-containing protein [Syntrophus aciditrophicus SB] >gi|85722726|gb|ABC77669.1| nifU-like domain protein [Syntrophus aciditrophicus SB] (73 aa)
Score = 126, Expect = 6.5e-06, Identities = 27/70 (38%), Positives = 44/70 (62%)
  Q:    11 DEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           D++++ ID +R  +  DGGD+E VD   E G V ++++G C GC++  +T K G+E  LK  +  VK V+
  S:     3 DKVQEAIDQVRPGLQADGGDVELVDVT-EDGVVKVRLVGACRGCAMSQMTLKMGIERFLKERIPEVKEVV 71
>gi|116199405|ref|XP_001225514.1| hypothetical protein CHGG_07858 [Chaetomium globosum CBS 148.51] >gi|88179137|gb|EAQ86605.1| hypothetical protein CHGG_07858 [Chaetomium globosum CBS 148.51] (337 aa)
Score = 126, Expect = 6.7e-06, Identities = 31/81 (38%), Positives = 51/81 (62%)
  Q:     3 DNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKN---EVEGVKSVIVTE 83
           D N ++++  IK+++++ +R  I +DGGD+EF  +  E G V +K+ G C  C    VT K G+E +L +   EV+GV  V+  E
  S:   218 DENDSEVVGMIKELLETRVRPAIQEDGGDIEFRGF--ENGYVMLKLRGACRTCDSSTVTLKNGIEGMLMHYIEEVQGVHQVLDQE 300
>gi|86138949|ref|ZP_01057520.1| nifU domain protein [Roseobacter sp. MED193] >gi|85824180|gb|EAQ44384.1| nifU domain protein [Roseobacter sp. MED193] (187 aa)
Score = 125, Expect = 6.8e-06, Identities = 30/75 (40%), Positives = 50/75 (66%)
  Q:     7 NKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKN---EVEGVKSVIV 81
           ++I+D+IKD++DS +R  + QDGGD+ F  +  ++G V + + G C GC    +T K G+E +L++   EV  V+ V V
  S:   111 SEIVDQIKDLLDSRVRPAVAQDGGDITFHGF--DRGVVYLHMQGACAGCPSSTLTLKMGIENLLRHYIPEVTEVRPVAV 187
>gi|157357561|emb|CAO64130.1| unnamed protein product [Vitis vinifera] (194 aa)
Score = 125, Expect = 8.0e-06, Identities = 31/75 (41%), Positives = 48/75 (64%)
  Q:     2 LDNNTNKIIDE------------IKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGV 76
           LD+NT   +D             IK+++++ IR  +  DGGD+E+  ++PE G V +K+ G C GC    VT K G+E +L + V  V
  S:    94 LDSNTAAAMDTAIHEDDSETVAMIKELLETRIRPAVQDDGGDIEYRGFDPETGIVKLKMQGACSGCPSSSVTLKSGIENMLMHYVPEV 181
>gi|164657977|ref|XP_001730114.1| hypothetical protein MGL_2496 [Malassezia globosa CBS 7966] >gi|159104009|gb|EDP42900.1| hypothetical protein MGL_2496 [Malassezia globosa CBS 7966] (276 aa)
Score = 125, Expect = 8.4e-06, Identities = 32/83 (38%), Positives = 55/83 (66%)
  Q:     1 MLDNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEK-GEVTIKILGECIGCSLIDVTYKEGLETILKN---EVEGVKSVIVTE 83
           +LD ++ +++  IK+++D+ +R  I +DGGDLE+  +  +  G V +K+ G C GC    VT K G+E +L +   EV+GV+ V+  E
  S:   162 ILDTDS-EVVAMIKELLDTRVRPAIQEDGGDLEYRGFGEDSDGIVRVKLKGSCRGCDSSTVTLKSGIERMLMHYVPEVQGVEQVLDPE 248
>gi|114571567|ref|YP_758247.1| NifU domain-containing protein [Maricaulis maris MCS10] >gi|114342029|gb|ABI67309.1| nitrogen-fixing NifU domain protein [Maricaulis maris MCS10] (187 aa)
Score = 125, Expect = 8.4e-06, Identities = 28/75 (37%), Positives = 46/75 (61%)
  Q:     9 IIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVIVTE 83
           ++ EI ++ID+ +R  + QDGGD+ F  Y  + G V +K+ G C GC    +T K G+E +LK+ +  ++SV   E
  S:   112 LVKEIIELIDTRVRPAVAQDGGDILFHSYLADSGIVRLKMRGACSGCPSSTMTLKSGIENLLKHYIPEIQSVEAVE 187
>gi|84997065|ref|XP_953254.1| hypothetical protein, conserved [Theileria annulata] >gi|65304250|emb|CAI76629.1| hypothetical protein, conserved [Theileria annulata] (179 aa)
Score = 125, Expect = 8.4e-06, Identities = 28/72 (38%), Positives = 46/72 (63%)
  Q:     8 KIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           + ++ IK +ID  IR  I QDGGD+ FV Y+P  G V +++ G C+GC   D+T K  ++ +L + +E + +V
  S:    90 ETVESIKLLIDKRIRPVIQQDGGDVFFVSYDPSTGYVYVRLSGACVGCIQSDITLKHMIQGMLCHYLEEITAV 162
>gi|145605625|ref|XP_370496.2| NifU-related protein [Magnaporthe grisea 70-15] >gi|145013431|gb|EDJ98072.1| NifU-related protein [Magnaporthe grisea 70-15] (319 aa)
Score = 125, Expect = 8.5e-06, Identities = 29/78 (37%), Positives = 49/78 (62%)
  Q:     3 DNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           + N ++++  IK+++++ IR  I +DGGD+EF  +  E G V +K+ G C  C    VT K G+E +L + +E V+ VI
  S:   200 NENDSEVVGMIKELLETRIRPAIQEDGGDIEFRGF--EDGNVLLKLRGACRTCDSSTVTLKNGIEGMLMHYIEEVQGVI 276
>gi|158520102|ref|YP_001527972.1| NifU domain-containing protein [Desulfococcus oleovorans Hxd3] >gi|158508928|gb|ABW65895.1| nitrogen-fixing NifU domain protein [Desulfococcus oleovorans Hxd3] (72 aa)
Score = 124, Expect = 9.4e-06, Identities = 27/69 (39%), Positives = 42/69 (60%)
  Q:    11 DEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           +++K  +D IR  +  DGGD+E VD   E G V++++ G C GC +  +T K+ +E  LK  V GV +V
  S:     3 EQVKAALDKIRPQLQADGGDVELVDV--ENGNVSVRLKGACAGCPMSQITLKQRIEAYLKKTVPGVINV 69
>gi|4836948|gb|AAD30650.1|AC006085_23 Similar to human CGI-33 protein [Arabidopsis thaliana] (304 aa)
Score = 124, Expect = 9.9e-06, Identities = 26/67 (38%), Positives = 42/67 (62%)
  Q:    13 IKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           IK+++++ IR  +  DGGD+E+  ++ E G V +++ G C GC    VT K G+E +L + V  VK V
  S:   220 IKELLETRIRPSVQDDGGDIEYCGFDTETGIVKLRMQGACSGCPSSSVTLKSGIENMLMHYVSEVKGV 287
>gi|145505407|ref|XP_001438670.1| hypothetical protein GSPATT00000987001 [Paramecium tetraurelia strain d4-2] >gi|124405842|emb|CAK71273.1| unnamed protein product [Paramecium tetraurelia] (207 aa)
Score = 124, Expect = 1.0e-05, Identities = 28/82 (34%), Positives = 51/82 (62%)
  Q:     2 LDNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVIVTE 83
           ++ + ++++  IK++ID+ IR  + +DGGD+ F D++ + G V + + G C GC    VT K G+E +L + V  VK V+  +
  S:   120 INEDDSEVVQLIKEIIDTRIRPTVQEDGGDIVFRDFDEKSGIVQLYMKGSCAGCPSSSVTLKNGIERMLCHYVAEVKEVVAED 202
>gi|115390869|ref|XP_001212939.1| HIRA-interacting protein 5 [Aspergillus terreus NIH2624] >gi|114193863|gb|EAU35563.1| HIRA-interacting protein 5 [Aspergillus terreus NIH2624] (323 aa)
Score = 124, Expect = 1.1e-05, Identities = 30/77 (38%), Positives = 51/77 (66%)
  Q:     7 NKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKN---EVEGVKSVIVTE 83
           ++++  IK+++D+ IR  I +DGGD+EF  +  E G V +K+ G C  C    VT + G+E++L +   EV+GV+ V+  E
  S:   212 DEVVSMIKELLDTRIRPAIQEDGGDIEFRGF--ENGIVMLKLRGACRTCDSSTVTLRNGIESMLMHYIEEVQGVEQVMDAE 290
>gi|42562675|ref|NP_175550.2| NFU5 (NFU domain protein 5) [Arabidopsis thaliana] >gi|75169527|sp|Q9C8J2|NIFU5_ARATH NifU-like protein 5, mitochondrial precursor (AtNfu5) (AtNfu-I) >gi|12325368|gb|AAG52627.1|AC024261_14 unknown protein; 90320-88994 [Arabidopsis thaliana] >gi|28207824|emb|CAD55562.1| NFU5 protein [Arabidopsis thaliana] >gi|105829764|gb|ABF74703.1| At1g51390 [Arabidopsis thaliana] >gi|110741134|dbj|BAE98660.1| hypothetical protein [Arabidopsis thaliana] (275 aa)
Score = 124, Expect = 1.1e-05, Identities = 28/77 (36%), Positives = 43/77 (55%)
  Q:     3 DNNTNKIIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           D+ T  +I E+ +    IR  +  DGGD+E+  ++ E G V +++ G C GC    VT K G+E +L + V  VK V
  S:   184 DSETVAMIKELLET--RIRPSVQDDGGDIEYCGFDTETGIVKLRMQGACSGCPSSSVTLKSGIENMLMHYVSEVKGV 258
>gi|145228927|ref|XP_001388772.1| hypothetical protein An01g03410 [Aspergillus niger] >gi|134054866|emb|CAK36880.1| unnamed protein product [Aspergillus niger] (330 aa)
Score = 124, Expect = 1.1e-05, Identities = 31/81 (38%), Positives = 52/81 (64%)
  Q:     3 DNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKN---EVEGVKSVIVTE 83
           +   +++I  IK+++D+ IR  I +DGGD+EF  +  E G V +K+ G C  C    VT + G+E++L +   EV+GV+ V+  E
  S:   211 EEEEDEVIGMIKELLDTRIRPAIQEDGGDIEFRGF--ENGIVLLKLRGACRTCDSSTVTLRNGIESMLMHYIEEVQGVEQVLDQE 293
>gi|188996345|ref|YP_001930596.1| nitrogen-fixing NifU domain protein [Sulfurihydrogenibium sp. YO3AOP1] >gi|188931412|gb|ACD66042.1| nitrogen-fixing NifU domain protein [Sulfurihydrogenibium sp. YO3AOP1] (79 aa)
Score = 124, Expect = 1.1e-05, Identities = 27/69 (39%), Positives = 44/69 (63%)
  Q:    12 EIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           ++++V++ +R Y+  DGGD+E VD   E G V ++++G C GC +   T K G+ET LK  +  VK V+
  S:     7 KVEEVLEQVRPYLRFDGGDVELVDVG-EDGTVYVRLMGACSGCHMSLWTLKGGVETRLKQAIPEVKEVV 74
>gi|154281411|ref|XP_001541518.1| conserved hypothetical protein [Ajellomyces capsulatus NAm1] >gi|150411697|gb|EDN07085.1| conserved hypothetical protein [Ajellomyces capsulatus NAm1] (279 aa)
Score = 123, Expect = 1.2e-05, Identities = 28/77 (36%), Positives = 50/77 (64%)
  Q:     3 DNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           + + ++++  IK+++++ IR  I +DGGD+EF  +  E G V++K+ G C  C    VT K G+E++L + +E VK V
  S:   164 NEDDDEVVGMIKELLETRIRPAIQEDGGDIEFRGF--EDGIVSLKLRGACRTCDSSTVTLKNGIESMLMHYIEEVKGV 239
>gi|15615981|ref|NP_244286.1| nitrogen fixation protein (NifU protein) [Bacillus halodurans C-125] >gi|10176042|dbj|BAB07138.1| nitrogen fixation protein (NifU protein) [Bacillus halodurans C-125] (79 aa)
Score = 123, Expect = 1.2e-05, Identities = 28/74 (37%), Positives = 47/74 (63%)
  Q:     6 TNKIIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           + ++ +++K+V+D +R ++ +DGGD+E VD   E G V +++LG C  C    +T K G+E  L  EV GVK +
  S:     4 STEMHEQVKEVLDKLRPFLLRDGGDVELVDV--EDGIVKVRLLGACGSCPSSTITLKAGIERALLEEVPGVKEI 75
>gi|146423384|ref|XP_001487621.1| hypothetical protein PGUG_00997 [Pichia guilliermondii ATCC 6260] (236 aa)
Score = 123, Expect = 1.3e-05, Identities = 25/72 (34%), Positives = 46/72 (63%)
  Q:     2 LDNNTNKIIDEIKDVI-DSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEV 73
           ++ + ++++  IK++I   IR  I +DGGD+EF  ++ + G V +K+ G C  C    VT K G+E++LK+ +
  S:   133 INEDDDEVVAMIKELIFTRIRPAIQEDGGDIEFAKFDEDSGTVYLKLKGACRSCESSSVTLKNGIESMLKHYI 205
>gi|71021777|ref|XP_761119.1| hypothetical protein UM04972.1 [Ustilago maydis 521] >gi|46100569|gb|EAK85802.1| hypothetical protein UM04972.1 [Ustilago maydis 521] (293 aa)
Score = 123, Expect = 1.4e-05, Identities = 32/83 (38%), Positives = 55/83 (66%)
  Q:     1 MLDNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEK-GEVTIKILGECIGCSLIDVTYKEGLETILKN---EVEGVKSVIVTE 83
           +LD ++ +++  IK+++D+ +R  I +DGGDLE+  +  +  G V +K+ G C GC    VT K G+E +L +   EV+GV+ V+  E
  S:   178 ILDTDS-EVVAMIKELLDTRVRPAIQEDGGDLEYRGFGEDTDGIVKVKLKGSCRGCDSSTVTLKSGIERMLMHYIPEVKGVEQVLDPE 264
>gi|154254042|ref|YP_001414866.1| scaffold protein Nfu/NifU [Parvibaculum lavamentivorans DS-1] >gi|154157992|gb|ABS65209.1| Scaffold protein Nfu/NifU [Parvibaculum lavamentivorans DS-1] (201 aa)
Score = 122, Expect = 1.5e-05, Identities = 27/72 (37%), Positives = 45/72 (62%)
  Q:     8 KIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           +I+ +IK+++D+ +R  + QDGGD+ F  Y  E+G V + + G C GC    VT K G+E +LK+ +  +  V
  S:   128 EIVTQIKEILDTRVRPAVAQDGGDITFQGY--EEGVVFLNMQGACAGCPSSTVTLKRGVENMLKHYIPEIVEV 198
>gi|154345572|ref|XP_001568723.1| hypothetical protein LbrM35_V2.1000 [Leishmania braziliensis MHOM/BR/75/M2904] >gi|134066065|emb|CAM43852.1| hypothetical protein, conserved [Leishmania braziliensis] (260 aa)
Score = 122, Expect = 1.5e-05, Identities = 24/79 (30%), Positives = 51/79 (64%)
  Q:     2 LDNNTNKIIDEIKDVI-DSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           L +N ++++  IK+++ + +R  + +DGGD++ +++N + G V++ +LG C  C     T K+G+E ++K+ +  V  VI
  S:   125 LKDNDSEVLQCIKELLREQVRPMVQRDGGDVKLLNFNEKTGVVSLAMLGACRTCPSSQNTLKDGIERVMKHFLPEVTEVI 204
>gi|190345080|gb|EDK36900.2| hypothetical protein PGUG_00997 [Pichia guilliermondii ATCC 6260] (236 aa)
Score = 122, Expect = 1.5e-05, Identities = 25/72 (34%), Positives = 46/72 (63%)
  Q:     2 LDNNTNKIIDEIKDVI-DSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEV 73
           ++ + ++++  IK++I   IR  I +DGGD+EF  ++ + G V +K+ G C  C    VT K G+E++LK+ +
  S:   133 INEDDDEVVAMIKELIFTRIRPAIQEDGGDIEFAKFDEDSGTVYLKLKGACRSCESSSVTLKNGIESMLKHYI 205
>gi|39995588|ref|NP_951539.1| NifU-like domain-containing protein [Geobacter sulfurreducens PCA] >gi|39982351|gb|AAR33812.1| NifU-like domain protein [Geobacter sulfurreducens PCA] (74 aa)
Score = 122, Expect = 1.7e-05, Identities = 28/75 (37%), Positives = 47/75 (62%)
  Q:     9 IIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVIVTE 83
           +++++K V+D +R  +  DGGD+E V+   E G V +K++G C  C +  +T K G+E  LK +V GVK V+  +
  S:     1 MLEDVKKVLDLVRPALQADGGDVELVEVT-EDGVVKVKLVGACGHCPMSTMTLKMGIERTLKEKVPGVKEVVSVQ 74
>gi|84702264|ref|ZP_01016839.1| NifU-like domain protein [Parvularcula bermudensis HTCC2503] >gi|84691510|gb|EAQ17350.1| NifU-like domain protein [Parvularcula bermudensis HTCC2503] (163 aa)
Score = 122, Expect = 1.7e-05, Identities = 28/77 (36%), Positives = 47/77 (61%)
  Q:     3 DNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           +  T +I+++I D+I++ +R  + QDGGD+ F  + P  G V + + G C GC    +T K G+E +LK+ V  V +V
  S:    82 EGETKEIVEQIIDLIETRVRPAVAQDGGDIVFHRFVPGDGIVFLSMRGACSGCPSSTMTLKSGIENLLKHYVPEVTAV 159
>gi|85083846|ref|XP_957202.1| HIRA-interacting protein 5 [Neurospora crassa OR74A] >gi|18376131|emb|CAD21196.1| conserved hypothetical protein [Neurospora crassa] >gi|28918289|gb|EAA27966.1| HIRA-interacting protein 5 [Neurospora crassa OR74A] (326 aa)
Score = 122, Expect = 1.7e-05, Identities = 32/81 (39%), Positives = 52/81 (64%)
  Q:     3 DNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKN---EVEGVKSVIVTE 83
           D N ++++  IK+++++ IR  I +DGGD+EF  +  E G V +K+ G C  C    VT K G+E +L +   EV+GV+ V+  E
  S:   207 DENDSEVVGMIKELLETRIRPAIQEDGGDIEFRGF--EDGIVKLKLRGACRTCDSSTVTLKNGIEGMLMHYIEEVQGVEQVLDPE 289
>gi|50419691|ref|XP_458373.1| hypothetical protein DEHA0C17028g [Debaryomyces hansenii CBS767] >gi|49654039|emb|CAG86455.1| unnamed protein product [Debaryomyces hansenii CBS767] (246 aa)
Score = 122, Expect = 1.7e-05, Identities = 29/77 (37%), Positives = 44/77 (57%)
  Q:     3 DNNTNKIIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           D+ T  +I E+  +   IR  I  DGGD+EFV +  + G V +++ G C  C    VT K G+E++LK  +E V +V
  S:   139 DDETVTMIKEL--IFTRIRPAIQDDGGDIEFVSFAEDNGTVYLRLKGACRSCDSSSVTLKNGIESMLKYYIEEVTTV 213
>gi|114769272|ref|ZP_01446898.1| nifU domain protein [alpha proteobacterium HTCC2255] >gi|114550189|gb|EAU53070.1| nifU domain protein [alpha proteobacterium HTCC2255] (186 aa)
Score = 121, Expect = 2.4e-05, Identities = 26/71 (36%), Positives = 45/71 (63%)
  Q:     9 IIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           I+++IKD++D+ +R  + QDGGD+ F  +  E+G V + + G C GC    +T K G+E +L++ +  V  V
  S:   112 IVNQIKDLLDTRVRPAVAQDGGDITFHGF--ERGIVYLHMQGACAGCPSSTITLKMGIENLLRHYIPEVTEV 181
>gi|163722753|ref|ZP_02130290.1| nitrogen-fixing NifU domain protein [Desulfatibacillum alkenivorans AK-01] >gi|161403751|gb|EDQ27982.1| nitrogen-fixing NifU domain protein [Desulfatibacillum alkenivorans AK-01] (74 aa)
Score = 120, Expect = 2.7e-05, Identities = 27/69 (39%), Positives = 43/69 (62%)
  Q:    11 DEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           +++K  ID IR  + +DGGD+E V+   + G V ++++G C GC +   T K G+E  +K  + GVKSV
  S:     3 EQVKAAIDEIRPTLQRDGGDVELVEVG-DDGVVKVRLVGACKGCPMSQQTLKNGIEKYMKKNIPGVKSV 70
>gi|163784585|ref|ZP_02179431.1| nifU-like domain protein [Hydrogenivirga sp. 128-5-R1-1] >gi|159880146|gb|EDP73804.1| nifU-like domain protein [Hydrogenivirga sp. 128-5-R1-1] (89 aa)
Score = 120, Expect = 2.8e-05, Identities = 31/80 (38%), Positives = 50/80 (62%)
  Q:     1 MLDNNTNKIID-EIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           M +NN   I   ++++V++ IR  +  DGGD+E VD   E G V ++++G C GC++  +T K G+E  LK E+  VK V+
  S:     1 MAENNQATIDRAKVEEVLEKIRPALRFDGGDVELVDIG-EDGTVYVRLMGACSGCAMSLMTLKGGIEQRLKQEIPEVKEVV 80
>gi|163744246|ref|ZP_02151606.1| NifU-like domain protein [Oceanibulbus indolifex HEL-45] >gi|161381064|gb|EDQ05473.1| NifU-like domain protein [Oceanibulbus indolifex HEL-45] (186 aa)
Score = 120, Expect = 3.1e-05, Identities = 27/77 (35%), Positives = 46/77 (59%)
  Q:     3 DNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           D    +I+ +IK+++DS +R  + QDGGD+ F  +  E+G V + + G C GC    +T K G+E +L++ +  V  V
  S:   107 DGEDGEIVGQIKELLDSRVRPAVAQDGGDITFHGF--ERGVVYLHMQGACAGCPSSTLTLKMGIENLLRHYIPEVTEV 182
>gi|118356024|ref|XP_001011271.1| NifU-like domain containing protein [Tetrahymena thermophila SB210] >gi|89293038|gb|EAR91026.1| NifU-like domain containing protein [Tetrahymena thermophila SB210] (225 aa)
Score = 120, Expect = 3.1e-05, Identities = 28/78 (35%), Positives = 52/78 (66%)
  Q:     2 LDNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKN---EVEGVKSV 79
           + ++ ++ +  IK++ID+ IR  +  DGGD+ + +++   G VT+ ++G C GC    VT K+G+E ++ +   EV GV+SV
  S:   130 IKDDDSEAVQMIKEIIDTRIRPLVQDDGGDVIYRNFDEPSGIVTLTMMGSCSGCPSSQVTLKQGIEKMIMHYVPEVNGVESV 211
>gi|46107542|ref|XP_380830.1| hypothetical protein FG00654.1 [Gibberella zeae PH-1] (304 aa)
Score = 120, Expect = 3.1e-05, Identities = 30/81 (37%), Positives = 53/81 (65%)
  Q:     3 DNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKN---EVEGVKSVIVTE 83
           + N ++++  IK+++++ IR  I +DGGD++F  ++ E G V +++ G C  C    VT K G+E +L +   EV+GVK V+  E
  S:   196 NENDSEVVGMIKELLETRIRPAIQEDGGDIDFRGFDDE-GYVHLRLRGACRTCDSSTVTLKNGIEGMLMHYIEEVKGVKQVMDQE 279
>gi|103487552|ref|YP_617113.1| nitrogen-fixing NifU-like protein [Sphingopyxis alaskensis RB2256] >gi|98977629|gb|ABF53780.1| nitrogen-fixing NifU-like protein [Sphingopyxis alaskensis RB2256] (190 aa)
Score = 120, Expect = 3.3e-05, Identities = 27/71 (38%), Positives = 46/71 (64%)
  Q:     9 IIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           II++IK++I++ +R  +  DGGD+ +  +  +KG V +K+ G C GC     T K G+E++LK+ V  V +V
  S:   118 IIEQIKELIETRVRPAVANDGGDIVYRGF--DKGNVYLKMQGACAGCPSSTATLKNGIESLLKHYVPEVTAV 187
>gi|84683414|ref|ZP_01011317.1| nifU domain protein [Rhodobacterales bacterium HTCC2654] >gi|84668157|gb|EAQ14624.1| nifU domain protein [Rhodobacterales bacterium HTCC2654] (186 aa)
Score = 119, Expect = 3.4e-05, Identities = 31/79 (39%), Positives = 49/79 (62%)
  Q:     3 DNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKN---EVEGVKSVIV 81
           D    +I+ +IKD++D+ +R  + QDGGD+ F  +  E+G V + + G C GC    +T K G+E +LK+   EV  V+ V V
  S:   106 DGPDAEIVVQIKDLLDTRVRPAVAQDGGDITFHGF--ERGVVYLHMQGACAGCPSSTLTLKMGIENLLKHYIPEVTEVRPVAV 186
>gi|148555295|ref|YP_001262877.1| scaffold protein Nfu/NifU-like protein [Sphingomonas wittichii RW1] >gi|148500485|gb|ABQ68739.1| Scaffold protein Nfu/NifU-like protein [Sphingomonas wittichii RW1] (192 aa)
Score = 119, Expect = 3.6e-05, Identities = 27/71 (38%), Positives = 45/71 (63%)
  Q:     9 IIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           I+ +IKD+ID+ +R  + +DGGD+ +  +  ++G V + + G C GC     T K+G+ET+LK+ V  V  V
  S:   120 IVAQIKDLIDTRVRPAVARDGGDIVYRGF--QRGTVYLSMQGACSGCPSSAATLKQGIETLLKHYVPEVTEV 189
>gi|71747438|ref|XP_822774.1| HIRA-interacting protein 5 [Trypanosoma brucei TREU927] >gi|70832442|gb|EAN77946.1| HIRA-interacting protein 5, putative [Trypanosoma brucei] (261 aa)
Score = 119, Expect = 3.8e-05, Identities = 23/80 (28%), Positives = 52/80 (65%)
  Q:     1 MLDNNTNKIIDEIKDVI-DSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           ++  + ++++  IK+++ + +R  + +DGGD++ +++N + G V++ +LG C  C     T K+G+E +LK+ +  VK V+
  S:   124 VIHEDDSEVLQCIKELVREQVRPMVQRDGGDVKLLNFNEKTGVVSLAMLGACRTCPSSQNTLKDGVERLLKHFLPEVKEVV 204
>gi|195952454|ref|YP_002120744.1| nitrogen-fixing NifU domain protein [Hydrogenobaculum sp. Y04AAS1] >gi|195932066|gb|ACG56766.1| nitrogen-fixing NifU domain protein [Hydrogenobaculum sp. Y04AAS1] (87 aa)
Score = 119, Expect = 3.9e-05, Identities = 25/70 (35%), Positives = 42/70 (60%)
  Q:    10 IDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           ++E+++ +D IR  +  DGGD+E V    E G V ++++G C GC +  +T K G+E  LK +   +K V
  S:     6 VEEVEEALDEIRPALRFDGGDIELVSIE-EDGTVLVRLMGACSGCGMSTLTLKAGVERALKQKFPDIKEV 74
>gi|67516331|ref|XP_658051.1| hypothetical protein AN0447.2 [Aspergillus nidulans FGSC A4] >gi|40747390|gb|EAA66546.1| hypothetical protein AN0447.2 [Aspergillus nidulans FGSC A4] (326 aa)
Score = 119, Expect = 4.1e-05, Identities = 29/77 (37%), Positives = 51/77 (66%)
  Q:     7 NKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKN---EVEGVKSVIVTE 83
           ++++  IK+++++ IR  I +DGGD+EF  +  E G V +K+ G C  C    VT + G+E++L +   EV+GV+ V+  E
  S:   215 DEVVSMIKELLETRIRPAIQEDGGDIEFRGF--ENGIVMLKLRGACRTCDSSTVTLRNGIESMLMHYIEEVQGVEQVLDEE 293
>gi|65316943|ref|ZP_00389902.1| COG0694: Thioredoxin-like proteins and domains [Bacillus anthracis str. A2012] (95 aa)
Score = 119, Expect = 4.2e-05, Identities = 26/69 (37%), Positives = 43/69 (62%)
  Q:    11 DEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           +++ +V+D +R ++ +DGGD+E VD   E+G V ++++G C  C    +T K G+E  L  EV GV  V
  S:     8 EQVLEVLDKLRPFLLRDGGDVELVDI--EEGIVKLRLMGACGSCPSSTITLKAGIERALLEEVPGVIEV 74
>gi|196186832|gb|EDX81808.1| Scaffold protein Nfu/NifU N terminal [Brevundimonas sp. BAL3] (185 aa)
Score = 119, Expect = 4.3e-05, Identities = 26/75 (34%), Positives = 46/75 (61%)
  Q:     5 NTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           + ++I+ EIK ++DS IR  + QDGGD+ F  ++   G +++++ G C GC     T K G+E ++++ V  V  V
  S:   106 DDSEIVAEIKALLDSRIRPAVAQDGGDILFDAFDEATGVLSLRMRGACSGCPSSSATLKAGVEQMMRHYVPEVTRV 181
>gi|94498004|ref|ZP_01304568.1| nitrogen-fixing NifU-like protein [Sphingomonas sp. SKA58] >gi|94422587|gb|EAT07624.1| nitrogen-fixing NifU-like protein [Sphingomonas sp. SKA58] (194 aa)
Score = 118, Expect = 4.5e-05, Identities = 27/72 (37%), Positives = 45/72 (62%)
  Q:     8 KIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           +I+D+I+++ID+ +R  +  DGGD+ +  +  +KG V +K+ G C GC     T K G+E +LK+ V  V  V
  S:   121 EIVDQIRELIDTRVRPAVANDGGDIIYRGF--DKGTVYLKMQGACAGCPSSSATLKNGIEQLLKHYVPEVTEV 191
>gi|163781905|ref|ZP_02176905.1| nifU-like domain protein [Hydrogenivirga sp. 128-5-R1-1] >gi|159883125|gb|EDP76629.1| nifU-like domain protein [Hydrogenivirga sp. 128-5-R1-1] (87 aa)
Score = 118, Expect = 4.6e-05, Identities = 27/69 (39%), Positives = 42/69 (60%)
  Q:    11 DEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           +E++ V+D IR  +  DGGD+E VD   E G V ++++G C GC +  +T K G+E  LK +   +K V
  S:     7 EEVEKVLDEIRPALRFDGGDVELVDIQ-EDGTVLVRLVGACSGCGMSVLTLKAGIERALKQKFPEIKEV 74
>gi|126740480|ref|ZP_01756167.1| nifU domain protein [Roseobacter sp. SK209-2-6] >gi|126718281|gb|EBA14996.1| nifU domain protein [Roseobacter sp. SK209-2-6] (187 aa)
Score = 118, Expect = 4.7e-05, Identities = 28/74 (37%), Positives = 49/74 (66%)
  Q:     8 KIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKN---EVEGVKSVIV 81
           +++++IKD++DS +R  + QDGGD+ F  +  ++G V + + G C GC    +T K G+E +L++   EV  V+ V V
  S:   112 EVVNQIKDLLDSRVRPAVAQDGGDITFHGF--DRGVVYLHMQGACAGCPSSTLTLKMGIENLLRHYIPEVTEVRPVAV 187
>gi|157876630|ref|XP_001686660.1| hypothetical protein, conserved [Leishmania major] >gi|68129735|emb|CAJ09041.1| hypothetical protein, conserved [Leishmania major] (311 aa)
Score = 118, Expect = 4.7e-05, Identities = 24/79 (30%), Positives = 49/79 (62%)
  Q:     2 LDNNTNKIIDEIKDVI-DSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           L +   +++  IK+++ + +R  + +DGGD++ +++N + G V++ +LG C  C     T K+G+E ++K+ V  V  VI
  S:   176 LKDTDTEVLQCIKELLREQVRPMVQRDGGDVKLLNFNEKTGIVSLAMLGACKTCPSSQNTLKDGIERVMKHFVPEVTEVI 255
>gi|124521469|ref|ZP_01696400.1| nitrogen-fixing NifU-like [Bacillus coagulans 36D1] >gi|124496796|gb|EAY44376.1| nitrogen-fixing NifU-like [Bacillus coagulans 36D1] (78 aa)
Score = 118, Expect = 4.9e-05, Identities = 27/73 (36%), Positives = 44/73 (60%)
  Q:     7 NKIIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           + I +++++V+D +R ++ +DGGD E +D   E G V +++LG C  C    +T K G+E  L  EV GV  V
  S:     4 DTITEQVQEVLDKLRPFLLRDGGDCELIDV--EDGIVKLRLLGACGSCPSSTITLKAGIERALFEEVPGVMEV 74
>gi|145507614|ref|XP_001439762.1| hypothetical protein GSPATT00008807001 [Paramecium tetraurelia strain d4-2] >gi|124406957|emb|CAK72365.1| unnamed protein product [Paramecium tetraurelia] (207 aa)
Score = 118, Expect = 5.1e-05, Identities = 28/77 (36%), Positives = 47/77 (61%)
  Q:     7 NKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVIVTE 83
           ++ I  IK++ID+ IR  + +DGGD+ F D++ + G V + + G C GC    +T K G+E +L + V  VK V+  +
  S:   125 SEAIQLIKEIIDTRIRPTVQEDGGDIVFRDFDEQNGIVHLYMKGSCAGCPSSSITLKNGIERMLCHYVAEVKEVVAED 202
>gi|187605598|ref|ZP_02991790.1| nitrogen-fixing NifU domain protein [Exiguobacterium sp. AT1b] >gi|187482375|gb|EDU20387.1| nitrogen-fixing NifU domain protein [Exiguobacterium sp. AT1b] (75 aa)
Score = 118, Expect = 5.4e-05, Identities = 26/72 (36%), Positives = 46/72 (63%)
  Q:     8 KIIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           ++ D++++V+D +R ++ +DGGD+E VD   E+G V ++++G C  C    +T K G+E  L  EV G+  V
  S:     2 EMFDQVQEVLDKLRPFLLRDGGDVELVDV--EEGIVKLRLMGACGSCPSSTITLKAGIERALIEEVPGIVEV 71
>gi|126652035|ref|ZP_01724224.1| nitrogen fixation protein (NifU protein) [Bacillus sp. B14905] >gi|169826170|ref|YP_001696328.1| NifU-like protein [Lysinibacillus sphaericus C3-41] >gi|126591125|gb|EAZ85235.1| nitrogen fixation protein (NifU protein) [Bacillus sp. B14905] >gi|168990658|gb|ACA38198.1| NifU-like protein [Lysinibacillus sphaericus C3-41] (78 aa)
Score = 118, Expect = 5.5e-05, Identities = 28/71 (39%), Positives = 43/71 (60%)
  Q:     9 IIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           I D++++V+D +R ++ +DGGD E VD   E G V +++LG C  C    +T K G+E  L  EV G+  V
  S:     6 INDQVQEVLDKLRPFLLRDGGDCELVDV--EDGVVKLRLLGACGSCPSSTITLKAGIERALLEEVPGIVEV 74
>gi|119189821|ref|XP_001245517.1| hypothetical protein CIMG_04958 [Coccidioides immitis RS] >gi|90304303|gb|EAS33934.1| hypothetical protein CIMG_04958 [Coccidioides immitis RS] (325 aa)
Score = 118, Expect = 5.5e-05, Identities = 27/72 (37%), Positives = 46/72 (63%)
  Q:     8 KIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           +++  I +++++ IR  I +DGGD+EF  +  + G V +K+ G C  C    VT K G+E++L + +E VKSV
  S:   210 EVVGMINELLETRIRPAIQEDGGDIEFRGF--KDGNVMLKLRGACRTCDSSTVTLKNGIESMLMHYIEEVKSV 280
>gi|163797123|ref|ZP_02191078.1| nitrogen-fixing NifU-like protein [alpha proteobacterium BAL199] >gi|159177639|gb|EDP62192.1| nitrogen-fixing NifU-like protein [alpha proteobacterium BAL199] (187 aa)
Score = 118, Expect = 5.6e-05, Identities = 26/72 (36%), Positives = 45/72 (62%)
  Q:     8 KIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           +I+ +IK+++D+ +R  +  DGGD+ F  Y  E G VT+++ G C GC     T K G+E +L++ +  V+ V
  S:   111 EIVSQIKELLDTRVRPAVAMDGGDITFQGY--EDGVVTLQMQGACSGCPSSTATLKMGIENMLRHYIPEVREV 181
>gi|56964703|ref|YP_176434.1| nitrogen fixation protein [Bacillus clausii KSM-K16] >gi|56910946|dbj|BAD65473.1| nitrogen fixation protein [Bacillus clausii KSM-K16] (79 aa)
Score = 117, Expect = 5.9e-05, Identities = 24/74 (32%), Positives = 47/74 (63%)
  Q:     6 TNKIIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           + ++++++++V+D +R ++ +DGGD+E +D   E G V +++LG C  C    +T K G+E  L  EV G+  +
  S:     4 STELMEQVQEVLDKLRPFLLRDGGDVELIDV--EDGVVKVRLLGACGSCPSSTITLKAGIERALLEEVPGITEI 75
>gi|159465189|ref|XP_001690805.1| iron-sulfur cluster assembly protein [Chlamydomonas reinhardtii] >gi|158279491|gb|EDP05251.1| iron-sulfur cluster assembly protein [Chlamydomonas reinhardtii] (319 aa)
Score = 117, Expect = 6.1e-05, Identities = 24/76 (31%), Positives = 47/76 (61%)
  Q:     5 NTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           + ++++  IK+++++ IR  + +DGGD+ F  +  + G V +K++G C  C    VT K G+E +L + +  VK V+
  S:   192 DDSEVVAMIKELLETRIRPAVQEDGGDIVFKGFEEDTGMVQVKLVGACSTCPSSTVTLKNGIENMLMHYIPEVKGVM 268
>gi|23099811|ref|NP_693277.1| nitrogen fixation protein [Oceanobacillus iheyensis HTE831] >gi|22778042|dbj|BAC14312.1| nitrogen fixation protein (NifU protein) [Oceanobacillus iheyensis HTE831] (74 aa)
Score = 117, Expect = 7.2e-05, Identities = 23/69 (33%), Positives = 46/69 (66%)
  Q:    11 DEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           +++++V++ +R ++ +DGGD+E +D + E+G V ++++G C  C    +T K G+E  L  EV GV+ +
  S:     3 EQVQEVLNKLRPFLLRDGGDVELIDVD-EEGVVLLRLMGACGNCPSSTITLKAGIERALMAEVPGVREI 70
>gi|146103241|ref|XP_001469515.1| hypothetical protein [Leishmania infantum] >gi|134073885|emb|CAM72624.1| hypothetical protein, conserved [Leishmania infantum] (299 aa)
Score = 116, Expect = 7.6e-05, Identities = 23/79 (29%), Positives = 51/79 (64%)
  Q:     2 LDNNTNKIIDEIKDVI-DSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           L ++ ++++  IK+++ + +R  + +DGGD++ +++N + G V++ +LG C  C     T K+G+E ++K+ +  V  VI
  S:   164 LKDSDSEVLQCIKELLREQVRPMVQRDGGDVKLLNFNEKTGIVSLAMLGACKTCPSSQNTLKDGIERVMKHFLPEVTEVI 243
>gi|114764450|ref|ZP_01443675.1| nifU domain protein [Roseovarius sp. HTCC2601] >gi|114543017|gb|EAU46036.1| nifU domain protein [Roseovarius sp. HTCC2601] (186 aa)
Score = 116, Expect = 8.4e-05, Identities = 29/74 (39%), Positives = 48/74 (64%)
  Q:     8 KIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKN---EVEGVKSVIV 81
           +I+ +IK+++DS +R  + QDGGD+ F  +  E+G V + + G C GC    +T K G+E +L++   EV  V+ V V
  S:   111 EIVGQIKELLDSRVRPAVAQDGGDITFHGF--ERGVVYLHMQGACAGCPSSTLTLKMGIENLLRHYIPEVTEVRPVAV 186
>gi|149913250|ref|ZP_01901784.1| NifU-like domain protein [Roseobacter sp. AzwK-3b] >gi|149813656|gb|EDM73482.1| NifU-like domain protein [Roseobacter sp. AzwK-3b] (187 aa)
Score = 116, Expect = 9.2e-05, Identities = 25/73 (34%), Positives = 46/73 (63%)
  Q:     7 NKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           ++I+ +IK+++D+ +R  + QDGGD+ F  +  E+G V + + G C GC    +T K G+E +L++ +  V  V
  S:   111 SEIVGQIKELLDTRVRPAVAQDGGDITFHGF--ERGVVYLHMQGACAGCPSSTITLKMGIENLLRHYIPEVTEV 182
>gi|121702857|ref|XP_001269693.1| NifU-related protein [Aspergillus clavatus NRRL 1] >gi|119397836|gb|EAW08267.1| NifU-related protein [Aspergillus clavatus NRRL 1] (320 aa)
Score = 116, Expect = 9.2e-05, Identities = 30/82 (36%), Positives = 51/82 (62%)
  Q:     2 LDNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKN---EVEGVKSVIVTE 83
            +   +++I  IK+++++ IR  I +DGGD+E   +  E G V +K+ G C  C    VT K G+E++L +   EV+GV+ V+  E
  S:   200 FNEEDDEVIGMIKELLETRIRPAIQEDGGDIELRGF--ENGIVKLKLRGACRTCDSSTVTLKNGIESMLMHYIEEVQGVEQVLDEE 283
>gi|8118105|gb|AAF72894.1|AF228511_2 NU1 [Trypanosoma cruzi] (261 aa)
Score = 116, Expect = 9.5e-05, Identities = 22/74 (29%), Positives = 48/74 (64%)
  Q:     7 NKIIDEIKDVI-DSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           ++++  IK+++ + +R  + +DGGD++ +++N E G V++ +LG C  C     T K+G+E ++K+ +  V  V+
  S:   130 SEVLQCIKELLREQVRPMVQRDGGDVKLLNFNEETGVVSLAMLGACRTCPSSSNTLKDGIERVMKHFLPEVTEVV 204
>gi|71666135|ref|XP_820030.1| hypothetical protein Tc00.1047053506679.60 [Trypanosoma cruzi strain CL Brener] >gi|70885357|gb|EAN98179.1| hypothetical protein, conserved [Trypanosoma cruzi] (261 aa)
Score = 116, Expect = 9.5e-05, Identities = 22/74 (29%), Positives = 48/74 (64%)
  Q:     7 NKIIDEIKDVI-DSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           ++++  IK+++ + +R  + +DGGD++ +++N E G V++ +LG C  C     T K+G+E ++K+ +  V  V+
  S:   130 SEVLQCIKELLREQVRPMVQRDGGDVKLLNFNEETGVVSLAMLGACRTCPSSSNTLKDGIERVMKHFLPEVTEVV 204
>gi|149183085|ref|ZP_01861537.1| YutI [Bacillus sp. SG-1] >gi|148849214|gb|EDL63412.1| YutI [Bacillus sp. SG-1] (78 aa)
Score = 115, Expect = 1.0e-04, Identities = 26/72 (36%), Positives = 44/72 (61%)
  Q:     8 KIIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           +++ ++++V+D +R ++ +DGGD E VD   E G V +++LG C  C    +T K G+E  L  EV G+  V
  S:     5 ELVPQVQEVLDKLRPFLLRDGGDCELVDI--EDGIVKLRLLGACGSCPSSTITLKAGIERALLEEVPGIVEV 74
>gi|119496847|ref|XP_001265197.1| NifU-related protein [Neosartorya fischeri NRRL 181] >gi|119413359|gb|EAW23300.1| NifU-related protein [Neosartorya fischeri NRRL 181] (326 aa)
Score = 115, Expect = 1.0e-04, Identities = 29/82 (35%), Positives = 51/82 (62%)
  Q:     2 LDNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKN---EVEGVKSVIVTE 83
            +   ++++  IK+++++ IR  I +DGGD+E   +  E G V +K+ G C  C    VT K G+E++L +   EV+GV+ V+  E
  S:   206 FNEEDDEVVSMIKELLETRIRPAIQEDGGDIELRGF--ENGIVKLKLRGACRTCDSSTVTLKNGIESMLMHYIEEVQGVEQVLDEE 289
>gi|163738966|ref|ZP_02146379.1| nitrogen-fixing NifU-like protein [Phaeobacter gallaeciensis BS107] >gi|163741789|ref|ZP_02149179.1| nifU domain protein [Phaeobacter gallaeciensis 2.10] >gi|161384962|gb|EDQ09341.1| nifU domain protein [Phaeobacter gallaeciensis 2.10] >gi|161387771|gb|EDQ12127.1| nitrogen-fixing NifU-like protein [Phaeobacter gallaeciensis BS107] (187 aa)
Score = 115, Expect = 1.1e-04, Identities = 28/74 (37%), Positives = 49/74 (66%)
  Q:     8 KIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKN---EVEGVKSVIV 81
           +I+++IK+++DS +R  + QDGGD+ F  +  ++G V + + G C GC    +T K G+E +L++   EV  V+ V V
  S:   112 EIVNQIKELLDSRVRPAVAQDGGDITFHGF--DRGVVYLHMQGACAGCPSSTLTLKMGIENLLRHYIPEVTEVRPVAV 187
>gi|99078069|ref|YP_611327.1| nitrogen-fixing NifU-like [Silicibacter sp. TM1040] >gi|99035207|gb|ABF62065.1| nitrogen-fixing NifU-like protein [Silicibacter sp. TM1040] (187 aa)
Score = 115, Expect = 1.1e-04, Identities = 28/74 (37%), Positives = 49/74 (66%)
  Q:     8 KIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKN---EVEGVKSVIV 81
           +I+++IK+++DS +R  + QDGGD+ F  +  ++G V + + G C GC    +T K G+E +L++   EV  V+ V V
  S:   112 EIVNQIKELLDSRVRPAVAQDGGDITFHGF--DRGVVYLHMQGACAGCPSSTLTLKMGIENLLRHYIPEVTEVRPVAV 187
>gi|70990736|ref|XP_750217.1| NifU-related protein [Aspergillus fumigatus Af293] >gi|66847849|gb|EAL88179.1| NifU-related protein [Aspergillus fumigatus Af293] >gi|159130693|gb|EDP55806.1| NifU-related protein [Aspergillus fumigatus A1163] (326 aa)
Score = 115, Expect = 1.1e-04, Identities = 29/77 (37%), Positives = 50/77 (64%)
  Q:     7 NKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKN---EVEGVKSVIVTE 83
           ++++  IK+++++ IR  I +DGGD+E   +  E G V +K+ G C  C    VT K G+E++L +   EV+GV+ V+  E
  S:   211 DEVVSMIKELLETRIRPAIQEDGGDIELRGF--ENGIVKLKLRGACRTCDSSTVTLKNGIESMLMHYIEEVQGVEQVLDEE 289
>gi|163734126|ref|ZP_02141567.1| NifU-like domain protein [Roseobacter litoralis Och 149] >gi|161392662|gb|EDQ16990.1| NifU-like domain protein [Roseobacter litoralis Och 149] (187 aa)
Score = 115, Expect = 1.1e-04, Identities = 25/71 (35%), Positives = 45/71 (63%)
  Q:     9 IIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           I+++IK+++D+ +R  + QDGGD+ F  +  E+G V + + G C GC    +T K G+E +L++ +  V  V
  S:   113 IVNQIKELLDTRVRPAVAQDGGDITFHGF--ERGVVYLHMQGACAGCPSSTLTLKMGIENLLRHYIPEVTEV 182
>gi|110678955|ref|YP_681962.1| NifU-like domain-containing protein [Roseobacter denitrificans OCh 114] >gi|109455071|gb|ABG31276.1| NifU-like domain protein [Roseobacter denitrificans OCh 114] (187 aa)
Score = 115, Expect = 1.1e-04, Identities = 25/71 (35%), Positives = 45/71 (63%)
  Q:     9 IIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           I+++IK+++D+ +R  + QDGGD+ F  +  E+G V + + G C GC    +T K G+E +L++ +  V  V
  S:   113 IVNQIKELLDTRVRPAVAQDGGDITFHGF--ERGVVYLHMQGACAGCPSSTLTLKMGIENLLRHYIPEVTEV 182
>gi|83943871|ref|ZP_00956328.1| nifU domain protein [Sulfitobacter sp. EE-36] >gi|83953512|ref|ZP_00962234.1| nifU domain protein [Sulfitobacter sp. NAS-14.1] >gi|83842480|gb|EAP81648.1| nifU domain protein [Sulfitobacter sp. NAS-14.1] >gi|83845118|gb|EAP82998.1| nifU domain protein [Sulfitobacter sp. EE-36] (186 aa)
Score = 115, Expect = 1.1e-04, Identities = 26/71 (36%), Positives = 44/71 (61%)
  Q:     9 IIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           I+ +IK+++DS +R  + QDGGD+ F  +  E+G V + + G C GC    +T K G+E +L++ +  V  V
  S:   113 IVGQIKELLDSRVRPAVAQDGGDITFHGF--ERGVVYLHMQGACAGCPSSTLTLKMGIENLLRHYIPEVTEV 182
>gi|85705721|ref|ZP_01036818.1| nifU domain protein [Roseovarius sp. 217] >gi|85669711|gb|EAQ24575.1| nifU domain protein [Roseovarius sp. 217] (187 aa)
Score = 115, Expect = 1.2e-04, Identities = 24/73 (32%), Positives = 47/73 (64%)
  Q:     7 NKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           ++I+++IK+++D+ +R  + QDGGD+ F  +  ++G V + + G C GC    +T K G+E +L++ +  V  V
  S:   111 SEIVNQIKELLDTRVRPAVAQDGGDITFHGF--DRGVVYLHMQGACAGCPSSTITLKMGIENLLRHYIPEVTEV 182
>gi|167037171|ref|YP_001664749.1| NifU domain-containing protein [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|167040690|ref|YP_001663675.1| NifU domain-containing protein [Thermoanaerobacter sp. X514] >gi|166854930|gb|ABY93339.1| nitrogen-fixing NifU domain protein [Thermoanaerobacter sp. X514] >gi|166856005|gb|ABY94413.1| nitrogen-fixing NifU domain protein [Thermoanaerobacter pseudethanolicus ATCC 33223] (73 aa)
Score = 115, Expect = 1.2e-04, Identities = 26/70 (37%), Positives = 43/70 (61%)
  Q:    11 DEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           + +++V++ +R  +  DGGD+E +D   E G V +++ G C GC    +T KEG+E  +K E+  VK VI
  S:     3 ERVEEVLELLRPSLQADGGDVELIDVT-EDGIVKVRLTGACGGCPFATLTLKEGIERAIKEEIPEVKEVI 71
>gi|56552311|ref|YP_163150.1| thioredoxin-like protein [Zymomonas mobilis subsp. mobilis ZM4] >gi|56543885|gb|AAV90039.1| thioredoxin-like protein [Zymomonas mobilis subsp. mobilis ZM4] (167 aa)
Score = 115, Expect = 1.2e-04, Identities = 30/76 (39%), Positives = 47/76 (61%)
  Q:     4 NNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           +  + +I +IKD+IDS +R  + +DGGD+ F  +  E G V + + G C GC     T K+G+ET+LK+ V  +K V
  S:    90 DEEDDVILQIKDLIDSRVRPAVARDGGDIVFQKF--EDGIVYLSMRGACAGCPSSVATLKQGVETLLKHFVPEIKEV 164
>gi|83949998|ref|ZP_00958731.1| nifU domain protein [Roseovarius nubinhibens ISM] >gi|83837897|gb|EAP77193.1| nifU domain protein [Roseovarius nubinhibens ISM] (188 aa)
Score = 114, Expect = 1.3e-04, Identities = 27/74 (36%), Positives = 49/74 (66%)
  Q:     8 KIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKN---EVEGVKSVIV 81
           +I+++IK+++D+ +R  + QDGGD+ F  +  ++G V + + G C GC    +T K G+E +L++   EV  V+ V V
  S:   113 EIVNQIKELLDTRVRPAVAQDGGDITFHGF--DRGVVYLHMQGACAGCPSSTITLKMGIENLLRHYIPEVTEVRPVAV 188
>gi|20808161|ref|NP_623332.1| thioredoxin domain-containing protein [Thermoanaerobacter tengcongensis MB4] >gi|20516751|gb|AAM24936.1| Thioredoxin-like proteins and domains [Thermoanaerobacter tengcongensis MB4] (73 aa)
Score = 114, Expect = 1.4e-04, Identities = 27/70 (38%), Positives = 43/70 (61%)
  Q:    11 DEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           + ++++++ I+  +  DGGD+E VD   E G V +K+ G C GC    +T KEG+E  +K E+  VK VI
  S:     3 ERVEEILNLIKPSLQADGGDVELVDVT-EDGVVKVKLTGACGGCPFATLTLKEGIERAIKEEIPEVKEVI 71
>gi|67633331|gb|AAY78582.1| predicted thioredoxin-like protein [uncultured bacterium MedeBAC82F10] (185 aa)
Score = 114, Expect = 1.5e-04, Identities = 27/77 (35%), Positives = 47/77 (61%)
  Q:     3 DNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           D N + ++ +IK+++D+ +R  +  DGGD+ F  YN  +G V +++ G C GC     T K G+E +LK+ +  V+ V
  S:   105 DENDSDVVKKIKELLDTKVRPAVAMDGGDIIFDKYN--EGIVFLQMQGACQGCPSSTATLKMGIENMLKHYIPEVREV 180
>gi|187039912|emb|CAP21246.1| C. briggsae CBR-LPD-8 protein [Caenorhabditis briggsae] (228 aa)
Score = 114, Expect = 1.5e-04, Identities = 28/78 (35%), Positives = 48/78 (61%)
  Q:     3 DNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           + + N+++  IK+++++ IR  + +DGGD+ +V +  + G V +K+ G C GC    VT K G+E +L   V  VK VI
  S:   127 EEDDNEVVMMIKEILETRIRPMVQEDGGDITYVGF--DDGVVKLKMQGSCTGCPSSGVTLKNGIENMLTFYVPEVKEVI 203
>gi|95929342|ref|ZP_01312085.1| nitrogen-fixing NifU-like [Desulfuromonas acetoxidans DSM 684] >gi|95134458|gb|EAT16114.1| nitrogen-fixing NifU-like [Desulfuromonas acetoxidans DSM 684] (74 aa)
Score = 114, Expect = 1.6e-04, Identities = 27/70 (38%), Positives = 45/70 (64%)
  Q:    11 DEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           ++I+  +D +R  +  DGG++E VD + + G V++K++G C  C +  VT K G+E IL  +V GVK V+
  S:     3 EQIEAALDEVRPTLLADGGNVELVDVS-DDGVVSVKLVGACGSCPMSTVTLKMGIERILLEKVPGVKEVV 71
>gi|163764531|ref|ZP_02171587.1| cell division protein FtsQ [Bacillus selenitireducens MLS10] >gi|160354909|gb|EDP81566.1| cell division protein FtsQ [Bacillus selenitireducens MLS10] (78 aa)
Score = 114, Expect = 1.6e-04, Identities = 26/71 (36%), Positives = 43/71 (60%)
  Q:     6 TNKIIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGV 76
           T  +  ++++V+D +R ++ +DGGD+E VD   E G V ++++G C  C    +T K G+E  L  EV GV
  S:     3 TETMESQVQEVLDKLRPFLLRDGGDVELVDV--EDGVVKVRLMGACGSCPSSTITLKAGIERALLEEVPGV 71
>gi|169190032|ref|ZP_02850017.1| nitrogen-fixing NifU domain protein [Paenibacillus sp. JDR-2] >gi|169003249|gb|EDS50120.1| nitrogen-fixing NifU domain protein [Paenibacillus sp. JDR-2] (80 aa)
Score = 114, Expect = 1.7e-04, Identities = 24/63 (38%), Positives = 39/63 (61%)
  Q:     7 NKIIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETIL 69
           + + DE+ DV+D +R ++ +DGGD+E VD   E G V ++++G C  C    +T K G+E  L
  S:     6 DTMYDEVLDVLDKLRPFLQRDGGDVELVDV--EDGIVKLRLMGACGSCPSSTITLKAGIERAL 66
>gi|149202972|ref|ZP_01879943.1| nitrogen-fixing NifU-like protein [Roseovarius sp. TM1035] >gi|149143518|gb|EDM31554.1| nitrogen-fixing NifU-like protein [Roseovarius sp. TM1035] (187 aa)
Score = 113, Expect = 1.7e-04, Identities = 24/71 (33%), Positives = 45/71 (63%)
  Q:     9 IIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           I+++IK+++D+ +R  + QDGGD+ F  +  ++G V + + G C GC    +T K G+E +L++ +  V  V
  S:   113 IVNQIKELLDTRVRPAVAQDGGDITFHGF--DRGVVYLHMQGACAGCPSSTITLKMGIENLLRHYIPEVTEV 182
>gi|69935202|ref|ZP_00630182.1| Nitrogen-fixing NifU, C-terminal [Paracoccus denitrificans PD1222] >gi|119383283|ref|YP_914339.1| NifU domain-containing protein [Paracoccus denitrificans PD1222] >gi|119373050|gb|ABL68643.1| nitrogen-fixing NifU domain protein [Paracoccus denitrificans PD1222] (184 aa)
Score = 113, Expect = 1.8e-04, Identities = 25/77 (32%), Positives = 47/77 (61%)
  Q:     3 DNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           D    +I+++IK+++D+ +R  + QDGGD+ F  +  ++G V + + G C GC    +T K G+E +L++ +  V  V
  S:   105 DGPDAEIVNQIKELLDTRVRPAVAQDGGDITFHGF--DRGVVYLHMQGACAGCPSSTLTLKMGIENLLRHYIPEVTEV 180
>gi|108805648|ref|YP_645585.1| nitrogen-fixing NifU-like protein [Rubrobacter xylanophilus DSM 9941] >gi|108766891|gb|ABG05773.1| nitrogen-fixing NifU-like protein [Rubrobacter xylanophilus DSM 9941] (80 aa)
Score = 113, Expect = 1.9e-04, Identities = 21/68 (30%), Positives = 39/68 (57%)
  Q:    13 IKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           ++  +  +R  +  DGGD   VD + E G V I++LG C GC L  + +   +E++++ EV  V+ ++
  S:    11 VEAALGKVRPAMQADGGDARVVDCDEETGSVKIQMLGACSGCPLSQLDFVYAIESLIRREVPEVREIL 78
>gi|163842411|ref|YP_001626815.1| HIRA-interacting protein 5 [Brucella suis ATCC 23445] >gi|163673134|gb|ABY37245.1| HIRA-interacting protein 5 [Brucella suis ATCC 23445] (190 aa)
Score = 113, Expect = 2.1e-04, Identities = 26/78 (33%), Positives = 45/78 (57%)
  Q:     2 LDNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
            D    +I++ IK++I++ +R  + QDGGD+ F  +  E G V + + G C GC     T K G++ +L++ V  V+ V
  S:   111 FDEADTEIVETIKELIETRVRPAVAQDGGDITFRGF--ENGTVFLHMKGACSGCPSSTATLKHGIQNLLRHFVPEVQQV 187
>gi|23501052|ref|NP_697179.1| NifU-related protein [Brucella suis 1330] >gi|62289118|ref|YP_220911.1| NifU-related protein [Brucella abortus bv. 1 str. 9-941] >gi|82699057|ref|YP_413631.1| nitrogen-fixing NifU, C-terminal [Brucella melitensis biovar Abortus 2308] >gi|148560296|ref|YP_001258173.1| NifU-related protein [Brucella ovis ATCC 25840] >gi|161618129|ref|YP_001592016.1| HIRA-interacting protein 5 [Brucella canis ATCC 23365] >gi|189023393|ref|YP_001934161.1| Nitrogen-fixing NifU, C-terminal [Brucella abortus S19] >gi|23346918|gb|AAN29094.1| NifU-related protein [Brucella suis 1330] >gi|62195250|gb|AAX73550.1| NifU-related protein [Brucella abortus biovar 1 str. 9-941] >gi|82615158|emb|CAJ10095.1| Nitrogen-fixing NifU, C-terminal [Brucella melitensis biovar Abortus 2308] >gi|148371553|gb|ABQ61532.1| NifU-related protein [Brucella ovis ATCC 25840] >gi|161334940|gb|ABX61245.1| HIRA-interacting protein 5 [Brucella canis ATCC 23365] >gi|189018965|gb|ACD71687.1| Nitrogen-fixing NifU, C-terminal [Brucella abortus S19] (190 aa)
Score = 113, Expect = 2.1e-04, Identities = 26/78 (33%), Positives = 45/78 (57%)
  Q:     2 LDNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
            D    +I++ IK++I++ +R  + QDGGD+ F  +  E G V + + G C GC     T K G++ +L++ V  V+ V
  S:   111 FDEADTEIVETIKELIETRVRPAVAQDGGDITFRGF--ENGTVFLHMKGACSGCPSSTATLKHGIQNLLRHFVPEVQQV 187
>gi|126730479|ref|ZP_01746290.1| nifU domain protein [Sagittula stellata E-37] >gi|126709212|gb|EBA08267.1| nifU domain protein [Sagittula stellata E-37] (187 aa)
Score = 112, Expect = 2.2e-04, Identities = 28/74 (37%), Positives = 48/74 (64%)
  Q:     8 KIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKN---EVEGVKSVIV 81
           +I+ +IK+++DS +R  + QDGGD+ F  +  ++G V + + G C GC    +T K G+E +L++   EV  V+ V V
  S:   112 EIVGQIKELLDSRVRPAVAQDGGDITFHGF--DRGVVYLHMQGACAGCPSSTLTLKMGIENLLRHYIPEVTEVRPVAV 187
>gi|148260770|ref|YP_001234897.1| NifU domain-containing protein [Acidiphilium cryptum JF-5] >gi|146402451|gb|ABQ30978.1| nitrogen-fixing NifU domain protein [Acidiphilium cryptum JF-5] (185 aa)
Score = 112, Expect = 2.3e-04, Identities = 29/78 (37%), Positives = 45/78 (57%)
  Q:     2 LDNNTNKIIDEIKDVID-SIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           +D    +I D+IK+++D  +R  +  DGGD+ F  +    G V++ + G C GC     T K G+E +LK+ V  VKSV
  S:   104 VDPADREIADQIKELLDMRVRPAVAGDGGDIVFRGF--RDGIVSLHMQGACSGCPSSTATLKMGIENLLKHYVPEVKSV 180
>gi|187250677|ref|YP_001875159.1| NifU domain-containing protein [Elusimicrobium minutum Pei191] >gi|186970837|gb|ACC97822.1| nitrogen-fixing NifU domain protein [Elusimicrobium minutum Pei191] (74 aa)
Score = 112, Expect = 2.3e-04, Identities = 25/68 (36%), Positives = 39/68 (57%)
  Q:    12 EIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           +I++VI  I+  +  DGGDLEFV ++   G V + + G C GC    +T K  +E  +  E+  VK+V
  S:     4 KIEEVIAKIKPVLQADGGDLEFVSFDENTGTVYVSLKGRCGGCPAAQMTLKAVIERKIMQEIPEVKAV 71
>gi|156044806|ref|XP_001588959.1| hypothetical protein SS1G_10507 [Sclerotinia sclerotiorum 1980] >gi|154694895|gb|EDN94633.1| hypothetical protein SS1G_10507 [Sclerotinia sclerotiorum 1980] (372 aa)
Score = 112, Expect = 2.3e-04, Identities = 26/73 (35%), Positives = 46/73 (63%)
  Q:     8 KIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           +++  IK+++++ IR  I +DGGD+++  +  E G V +K+ G C  C    VT K G+E +L + +E VK V+
  S:   203 EVVGMIKELLETRIRPAIQEDGGDIDYRGF--EDGMVKLKLRGACRTCDSSTVTLKNGIEGMLMHYIEEVKGVV 274
>gi|17988091|ref|NP_540725.1| NifU protein [Brucella melitensis 16M] >gi|17983843|gb|AAL52989.1| NIFU PROTEIN [Brucella melitensis 16M] (190 aa)
Score = 112, Expect = 2.5e-04, Identities = 26/78 (33%), Positives = 45/78 (57%)
  Q:     2 LDNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
            D    +I++ IK++I++ +R  + QDGGD+ F  +  E G V + + G C GC     T K G++ +L++ V  V+ V
  S:   111 FDEADTEIVETIKELIETRVRPAVAQDGGDITFRGF--ENGTVFLHMKGACSGCPSSTATLKHGVQNLLRHFVPEVQQV 187
>gi|169844430|ref|XP_001828936.1| hypothetical protein CC1G_03730 [Coprinopsis cinerea okayama7#130] >gi|116510048|gb|EAU92943.1| hypothetical protein CC1G_03730 [Coprinopsis cinerea okayama7#130] (219 aa)
Score = 112, Expect = 2.7e-04, Identities = 29/83 (34%), Positives = 54/83 (65%)
  Q:     1 MLDNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKN---EVEGVKSVIVTE 83
           +LD ++ + +  IK+++++ +R  I +DGGD+E+  ++   G V +K+ G C GC    VT K G+E +L +   EV+GV+ ++  E
  S:   109 ILDTDS-ETVAMIKELLETRVRPAIMEDGGDIEYRGFDENDGIVRVKLKGSCRGCESSSVTLKSGIERMLMHYVPEVKGVEQILDEE 194
>gi|30022992|ref|NP_834623.1| NifU protein [Bacillus cereus ATCC 14579] >gi|30264992|ref|NP_847369.1| NifU domain-containing protein [Bacillus anthracis str. Ames] >gi|42784132|ref|NP_981379.1| NifU domain-containing protein [Bacillus cereus ATCC 10987] >gi|47530492|ref|YP_021841.1| NifU domain-containing protein [Bacillus anthracis str. 'Ames Ancestor'] >gi|47566983|ref|ZP_00237700.1| NifU protein-related protein [Bacillus cereus G9241] >gi|49187811|ref|YP_031064.1| NifU domain-containing protein [Bacillus anthracis str. Sterne] >gi|49481022|ref|YP_038969.1| NifU domain-containing protein [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|52140580|ref|YP_086250.1| NifU domain-containing protein [Bacillus cereus E33L] >gi|75758910|ref|ZP_00739021.1| NifU protein [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|118480036|ref|YP_897187.1| NifU-like domain-containing protein [Bacillus thuringiensis str. Al Hakam] >gi|163942665|ref|YP_001647549.1| NifU domain-containing protein [Bacillus weihenstephanensis KBAB4] >gi|165870953|ref|ZP_02215605.1| nifU domain protein [Bacillus anthracis str. A0488] >gi|166984147|ref|ZP_02255517.1| nitrogen-fixing NifU domain protein [Bacillus cereus AH187] >gi|166996849|ref|ZP_02263309.1| nitrogen-fixing NifU domain protein [Bacillus cereus AH820] >gi|167634861|ref|ZP_02393179.1| nifU domain protein [Bacillus anthracis str. A0442] >gi|167639907|ref|ZP_02398175.1| nifU domain protein [Bacillus anthracis str. A0193] >gi|167938327|ref|ZP_02525402.1| nitrogen-fixing NifU domain protein [Bacillus cereus AH1134] >gi|168137360|ref|ZP_02580589.1| nitrogen-fixing NifU domain protein [Bacillus cereus B4264] >gi|168143693|ref|ZP_02586922.1| nitrogen-fixing NifU domain protein [Bacillus cereus G9842] >gi|168161632|ref|ZP_02596865.1| nitrogen-fixing NifU domain protein [Bacillus cereus H3081.97] >gi|170685656|ref|ZP_02876879.1| nifU domain protein [Bacillus anthracis str. A0465] >gi|170706993|ref|ZP_02897450.1| nifU domain protein [Bacillus anthracis str. A0389] >gi|177652329|ref|ZP_02934832.1| nifU domain protein [Bacillus anthracis str. A0174] >gi|190567150|ref|ZP_03020065.1| nifU domain protein [Bacillus anthracis Tsiankovskii-I] >gi|196033148|ref|ZP_03100561.1| nifU domain protein [Bacillus cereus W] >gi|196040592|ref|ZP_03107892.1| nifU domain protein [Bacillus cereus NVH0597-99] >gi|196043939|ref|ZP_03111176.1| nifU domain protein [Bacillus cereus 03BB108] >gi|29898552|gb|AAP11824.1| NifU protein [Bacillus cereus ATCC 14579] >gi|30259669|gb|AAP28855.1| nifU domain protein [Bacillus anthracis str. Ames] >gi|42740063|gb|AAS43987.1| nifU domain protein [Bacillus cereus ATCC 10987] >gi|47505640|gb|AAT34316.1| nifU domain protein [Bacillus anthracis str. 'Ames Ancestor'] >gi|47556301|gb|EAL14635.1| NifU protein-related protein [Bacillus cereus G9241] >gi|49181738|gb|AAT57114.1| nifU domain protein [Bacillus anthracis str. Sterne] >gi|49332578|gb|AAT63224.1| nitrogen-fixing NifU domain protein [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|51974049|gb|AAU15599.1| nitrogen-fixing NifU domain protein [Bacillus cereus E33L] >gi|74493584|gb|EAO56689.1| NifU protein [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|118419261|gb|ABK87680.1| NifU-like domain protein [Bacillus thuringiensis str. Al Hakam] >gi|163864862|gb|ABY45921.1| nitrogen-fixing NifU domain protein [Bacillus weihenstephanensis KBAB4] >gi|164713462|gb|EDR18987.1| nifU domain protein [Bacillus anthracis str. A0488] >gi|167511988|gb|EDR87366.1| nifU domain protein [Bacillus anthracis str. A0193] >gi|167529611|gb|EDR92360.1| nifU domain protein [Bacillus anthracis str. A0442] >gi|170128096|gb|EDS96966.1| nifU domain protein [Bacillus anthracis str. A0389] >gi|170670120|gb|EDT20860.1| nifU domain protein [Bacillus anthracis str. A0465] >gi|172082335|gb|EDT67401.1| nifU domain protein [Bacillus anthracis str. A0174] >gi|190561654|gb|EDV15624.1| nifU domain protein [Bacillus anthracis Tsiankovskii-I] >gi|195994577|gb|EDX58532.1| nifU domain protein [Bacillus cereus W] >gi|196025275|gb|EDX63945.1| nifU domain protein [Bacillus cereus 03BB108] >gi|196028724|gb|EDX67331.1| nifU domain protein [Bacillus cereus NVH0597-99] (78 aa)
Score = 112, Expect = 2.8e-04, Identities = 26/69 (37%), Positives = 43/69 (62%)
  Q:    11 DEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           +++ +V+D +R ++ +DGGD+E VD   E+G V ++++G C  C    +T K G+E  L  EV GV  V
  S:     8 EQVLEVLDKLRPFLLRDGGDVELVDI--EEGIVKLRLMGACGSCPSSTITLKAGIERALLEEVPGVIEV 74
>gi|195059008|ref|XP_001995543.1| GH17809 [Drosophila grimshawi] >gi|193896329|gb|EDV95195.1| GH17809 [Drosophila grimshawi] (298 aa)
Score = 111, Expect = 3.0e-04, Identities = 27/67 (40%), Positives = 43/67 (64%)
  Q:    13 IKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           IK+++D+ IR  + +DGGD+ F+ Y  EKG V +K+ G C  C    VT K G++ +L+  +  V+SV
  S:   194 IKELLDTRIRPTVQEDGGDIVFISY--EKGVVKLKMQGSCSSCPSSIVTLKNGVQNMLQFYIPEVESV 259
>gi|154291187|ref|XP_001546179.1| NifU-like protein [Botryotinia fuckeliana B05.10] >gi|150847081|gb|EDN22274.1| NifU-like protein [Botryotinia fuckeliana B05.10] (313 aa)
Score = 111, Expect = 3.0e-04, Identities = 26/73 (35%), Positives = 46/73 (63%)
  Q:     8 KIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           +++  IK+++++ IR  I +DGGD+++  +  E G V +K+ G C  C    VT K G+E +L + +E VK V+
  S:   202 EVVGMIKELLETRIRPAIQEDGGDIDYRGF--EDGLVKLKLRGACRTCDSSTVTLKNGIEGMLMHYIEEVKGVV 273
>gi|52081716|ref|YP_080507.1| hypothetical protein BL02118 [Bacillus licheniformis ATCC 14580] >gi|52787102|ref|YP_092931.1| YutI [Bacillus licheniformis ATCC 14580] >gi|52004927|gb|AAU24869.1| Conserved protein YutI [Bacillus licheniformis ATCC 14580] >gi|52349604|gb|AAU42238.1| YutI [Bacillus licheniformis DSM 13] (79 aa)
Score = 111, Expect = 3.3e-04, Identities = 27/69 (39%), Positives = 42/69 (60%)
  Q:    11 DEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           +++++V+D +R ++ +DGGD E VD   E G V +++LG C  C    +T K G+E  L  EV GV  V
  S:     9 EQVQEVLDKLRPFLLRDGGDCELVDV--EDGIVKLRLLGACGSCPSSTITLKAGIERALLEEVPGVIEV 75
>gi|83594860|ref|YP_428612.1| nitrogen-fixing NifU-like [Rhodospirillum rubrum ATCC 11170] >gi|83577774|gb|ABC24325.1| Nitrogen-fixing NifU-like [Rhodospirillum rubrum ATCC 11170] (183 aa)
Score = 111, Expect = 3.5e-04, Identities = 25/74 (33%), Positives = 49/74 (66%)
  Q:     7 NKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKN---EVEGVKSVI 80
           ++++ +I+D++++ +R  + QDGGD+ F  +  + G V + + G C GC     T K G+E +L++   EVE V++V+
  S:   108 DEVVRQIRDLLETRVRPAVAQDGGDIVFDRF--QDGVVYLHLRGSCSGCPSSTATLKHGIENMLRHYIPEVEAVEAVL 183
>gi|145618680|ref|ZP_01774737.1| nitrogen-fixing NifU domain protein [Geobacter bemidjiensis Bem] >gi|144945058|gb|EDJ80126.1| nitrogen-fixing NifU domain protein [Geobacter bemidjiensis Bem] >gi|197088529|gb|ACH39800.1| nitrogen-fixing NifU domain protein [Geobacter bemidjiensis Bem] (73 aa)
Score = 111, Expect = 3.5e-04, Identities = 24/72 (33%), Positives = 45/72 (62%)
  Q:     9 IIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           + +E+K +++ IR  +  DGGD+E V+   + G V ++++G C  C +  +T K G+E  +K +V G+K V+
  S:     1 MTEEVKAILEQIRPALQADGGDVELVEVT-DDGIVKVRLVGACGHCPMSTMTLKMGIERTIKEKVPGIKEVV 71
>gi|195169040|ref|XP_002025336.1| GL13432 [Drosophila persimilis] >gi|194108792|gb|EDW30835.1| GL13432 [Drosophila persimilis] (282 aa)
Score = 110, Expect = 3.8e-04, Identities = 28/79 (35%), Positives = 49/79 (62%)
  Q:     1 MLDNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           +LD++   ++  IK+++D+ IR  + +DGGD+ F+ Y  E G V +K+ G C  C    VT K G++ +L+  +  V+SV
  S:   167 ILDDDDETVM-MIKELLDTRIRPTVQEDGGDIVFISY--ENGVVKLKMQGSCSSCPSSIVTLKNGVQNMLQFYIPEVESV 243
>gi|191163012|ref|ZP_03024889.1| nitrogen-fixing NifU domain protein [Geobacter sp. M21] >gi|190995795|gb|EDV71246.1| nitrogen-fixing NifU domain protein [Geobacter sp. M21] (73 aa)
Score = 110, Expect = 3.8e-04, Identities = 23/72 (31%), Positives = 46/72 (63%)
  Q:     9 IIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           + +E+K +++ IR  +  DGGD+E V+   + G V ++++G C  C +  +T K G+E  +K+++ G+K V+
  S:     1 MTEEVKAILEQIRPALQADGGDVELVEVT-DDGIVKVRLVGACGHCPMSTMTLKMGIERTIKDKIPGIKEVV 71
>gi|120601745|ref|YP_966145.1| NifU domain-containing protein [Desulfovibrio vulgaris subsp. vulgaris DP4] >gi|120561974|gb|ABM27718.1| nitrogen-fixing NifU domain protein [Desulfovibrio vulgaris subsp. vulgaris DP4] (75 aa)
Score = 110, Expect = 4.1e-04, Identities = 24/69 (34%), Positives = 39/69 (56%)
  Q:    11 DEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           D+++  +  +R  + QDGGD+E VD  PE G V +++ G C GC +   T K  +E ++   V  V+ V
  S:     3 DKVEQALAIVRPLLQQDGGDVELVDITPE-GVVRVRLTGRCKGCPMSQKTLKNSVEKMVLKFVPAVQRV 70
>gi|159045379|ref|YP_001534173.1| scaffold protein Nfu/NifU [Dinoroseobacter shibae DFL 12] >gi|157913139|gb|ABV94572.1| Scaffold protein Nfu/NifU [Dinoroseobacter shibae DFL 12] (187 aa)
Score = 110, Expect = 4.4e-04, Identities = 25/77 (32%), Positives = 47/77 (61%)
  Q:     3 DNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           D   ++I+ +IK+++D+ +R  + QDGGD+ F  +  ++G V + + G C GC    +T K G+E +L++ +  V  V
  S:   107 DGPDSEIVGQIKELLDTRVRPAVAQDGGDITFHGF--DRGIVYLHMQGACAGCPSSTLTLKMGIENLLRHYIPEVLEV 182
>gi|126734863|ref|ZP_01750609.1| NifU-like domain protein [Roseobacter sp. CCS2] >gi|126715418|gb|EBA12283.1| NifU-like domain protein [Roseobacter sp. CCS2] (187 aa)
Score = 110, Expect = 4.7e-04, Identities = 25/72 (34%), Positives = 45/72 (62%)
  Q:     8 KIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           +I+ +IK+++D+ +R  + QDGGD+ F  +  E+G V + + G C GC    +T K G+E +L++ +  V  V
  S:   112 EIVGQIKELLDTRVRPAVAQDGGDITFHGF--ERGIVYLHMQGACAGCPSSTLTLKMGIENLLRHYIPEVVEV 182
>gi|46580957|ref|YP_011765.1| NifU family protein [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] >gi|46450377|gb|AAS97025.1| NifU family protein [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] (81 aa)
Score = 109, Expect = 5.1e-04, Identities = 24/69 (34%), Positives = 39/69 (56%)
  Q:    11 DEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           D+++  +  +R  + QDGGD+E VD  PE G V +++ G C GC +   T K  +E ++   V  V+ V
  S:     9 DKVEQALAIVRPLLQQDGGDVELVDITPE-GVVRVRLTGRCKGCPMSQKTLKNSVEKMVLKFVPAVQRV 76
>gi|116753461|ref|YP_842579.1| NifU domain-containing protein [Methanosaeta thermophila PT] >gi|116664912|gb|ABK13939.1| nitrogen-fixing NifU domain protein [Methanosaeta thermophila PT] (75 aa)
Score = 109, Expect = 5.4e-04, Identities = 27/69 (39%), Positives = 41/69 (59%)
  Q:    11 DEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           +E++  ++SIR  +  +GGD+E VD N   G V +K+ G C GC    +T +  +E  LK  V GVK+V
  S:     6 EEVESTLESIRNVLRIEGGDVELVDIN--DGVVYVKLTGSCAGCPFSQMTLRNFVERELKKNVSGVKAV 72
>gi|83855572|ref|ZP_00949101.1| NifU protein, putative [Croceibacter atlanticus HTCC2559] >gi|83849372|gb|EAP87240.1| NifU protein, putative [Croceibacter atlanticus HTCC2559] (80 aa)
Score = 109, Expect = 5.4e-04, Identities = 23/75 (30%), Positives = 44/75 (58%)
  Q:     8 KIIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVIVT 82
           ++ + ++  ++ IR ++  DGGD+  V    +K  V +K++G C+GCS+  +T K G+E  +K     ++ VI T
  S:     5 ELYNSVQAALEEIRPFLQNDGGDISLVSIEDDK-TVFVKLMGNCVGCSVNQMTLKSGVEMTIKKHAPQIEKVINT 78
>gi|56417173|ref|YP_154247.1| hypothetical protein AM1146 [Anaplasma marginale str. St. Maries] >gi|56388405|gb|AAV86992.1| hypothetical protein AM1146 [Anaplasma marginale str. St. Maries] (194 aa)
Score = 109, Expect = 6.0e-04, Identities = 26/78 (33%), Positives = 46/78 (58%)
  Q:     2 LDNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
            D   ++++  +K++I+  +R  + QDGGD++F  Y  ++G V + + G C GC    VT K+G+  +L   V  VK+V
  S:   115 FDTKDSEVVQRVKELIEHYVRPAVAQDGGDIKFRGY--KEGVVFVHLRGACSGCPSAAVTLKDGVYGMLSYYVPEVKAV 191
>gi|146278315|ref|YP_001168474.1| NifU domain-containing protein [Rhodobacter sphaeroides ATCC 17025] >gi|145556556|gb|ABP71169.1| nitrogen-fixing NifU domain protein [Rhodobacter sphaeroides ATCC 17025] (186 aa)
Score = 109, Expect = 6.2e-04, Identities = 25/77 (32%), Positives = 46/77 (59%)
  Q:     3 DNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           D    +I+ +IK+++D+ +R  + QDGGD+ F  +  ++G V + + G C GC    +T K G+E +L++ +  V  V
  S:   106 DGPDEEIVRQIKELLDTRVRPAVAQDGGDITFHGF--DRGIVYLHMQGACAGCPSSTLTLKMGIENLLRHYIPEVLEV 181
>gi|152977236|ref|YP_001376753.1| NifU domain-containing protein [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|152025988|gb|ABS23758.1| nitrogen-fixing NifU domain protein [Bacillus cereus subsp. cytotoxis NVH 391-98] (78 aa)
Score = 109, Expect = 6.3e-04, Identities = 26/69 (37%), Positives = 42/69 (60%)
  Q:    11 DEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           +++ +V+D +R ++ +DGGD+E VD   E G V ++++G C  C    +T K G+E  L  EV GV  V
  S:     8 EQVLEVLDKLRPFLLRDGGDVELVDI--EDGIVKLRLMGACGSCPSSTITLKAGIERALLEEVPGVIEV 74
>gi|110636361|ref|YP_676569.1| nitrogen-fixing NifU-like [Mesorhizobium sp. BNC1] >gi|110287345|gb|ABG65404.1| nitrogen-fixing NifU-like [Mesorhizobium sp. BNC1] (189 aa)
Score = 109, Expect = 6.3e-04, Identities = 26/77 (33%), Positives = 43/77 (55%)
  Q:     3 DNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           D    +I+  IK+++++ +R  + QDGGD+ F  Y  E G V + + G C GC     T K G++ +L + V  V+ V
  S:   110 DEADEEIVTTIKELLETRVRPAVAQDGGDITFRGY--ENGTVFLHMKGACAGCPSSTATLKHGIQNLLHHFVPEVQQV 185
>gi|66348055|ref|NP_001018093.1| hypothetical protein LOC796111 [Danio rerio] >gi|62202252|gb|AAH92870.1| Zgc:110319 [Danio rerio] >gi|182890178|gb|AAI64833.1| Zgc:110319 [synthetic construct] (256 aa)
Score = 108, Expect = 6.9e-04, Identities = 27/75 (36%), Positives = 49/75 (65%)
  Q:     5 NTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILK---NEVEGVKSV 79
           + ++I+  IK+++D+ IR  + +DGGD+ F  +  E G V +K++G C GC    VT K G++ +++    EV+ V+ V
  S:   158 DDDEIVSLIKELLDTRIRPTVQEDGGDVIFKGF--EDGTVKLKLVGSCTGCPSSTVTLKNGIQNMMQFYIPEVDNVEQV 234
>gi|41351250|gb|AAH65889.1| Zgc:110319 protein [Danio rerio] (255 aa)
Score = 108, Expect = 7.3e-04, Identities = 27/75 (36%), Positives = 49/75 (65%)
  Q:     5 NTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILK---NEVEGVKSV 79
           + ++I+  IK+++D+ IR  + +DGGD+ F  +  E G V +K++G C GC    VT K G++ +++    EV+ V+ V
  S:   157 DDDEIVSLIKELLDTRIRPTVQEDGGDVIFKGF--EDGTVKLKLVGSCTGCPSSTVTLKNGIQNMMQFYIPEVDNVEQV 233
>gi|114326814|ref|YP_743971.1| Fe-S cluster assembly protein NFU [Granulibacter bethesdensis CGDNIH1] >gi|114314988|gb|ABI61048.1| Fe-S cluster assembly protein NFU [Granulibacter bethesdensis CGDNIH1] (186 aa)
Score = 108, Expect = 8.1e-04, Identities = 26/72 (36%), Positives = 43/72 (59%)
  Q:     8 KIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           +I+D+IK+++D+ +R  +  DGGD+ F  Y    G V + + G C GC     T K G+E +L++ V  V +V
  S:   111 EIVDQIKELLDTRVRPAVAGDGGDIVFRGY--RDGVVLLHMQGACSGCPSSRATLKHGIENMLRHYVPEVLAV 181
>gi|56695297|ref|YP_165645.1| NifU domain-containing protein [Silicibacter pomeroyi DSS-3] >gi|56677034|gb|AAV93700.1| nifU domain protein [Silicibacter pomeroyi DSS-3] (187 aa)
Score = 108, Expect = 8.2e-04, Identities = 27/74 (36%), Positives = 47/74 (63%)
  Q:     8 KIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKN---EVEGVKSVIV 81
           +++ +IK ++DS +R  + QDGGD+ F  +  ++G V + + G C GC    +T K G+E +L++   EV  V+ V V
  S:   112 EVVTQIKALLDSRVRPAVAQDGGDITFHGF--DRGVVYLHMQGACAGCPSSTLTLKMGIENLLRHYIPEVTEVRPVAV 187
>gi|13474434|ref|NP_106002.1| hypothetical protein mll5315 [Mesorhizobium loti MAFF303099] >gi|14025187|dbj|BAB51788.1| mll5315 [Mesorhizobium loti MAFF303099] (189 aa)
Score = 107, Expect = 8.4e-04, Identities = 25/77 (32%), Positives = 44/77 (57%)
  Q:     3 DNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           D    +++  IK+++D+ +R  + QDGGD+ F  +  E G V + + G C GC     T K G++ +L++ V  V+ V
  S:   110 DKADEELVITIKELLDTRVRPAVAQDGGDITFRGF--ENGTVFLHMKGACAGCPSSTATLKHGIQNLLRHFVPEVQQV 185
>gi|16801558|ref|NP_471826.1| hypothetical protein lin2496 [Listeria innocua Clip11262] >gi|16415018|emb|CAC97723.1| lin2496 [Listeria innocua] (78 aa)
Score = 107, Expect = 8.5e-04, Identities = 26/69 (37%), Positives = 39/69 (56%)
  Q:    12 EIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           E+   +   R ++ +DGGD E V+  P+ G V IK+LG C  C   D+T K G+E  L  ++ G K V+
  S:     8 EVDKALKKFRPFLVRDGGDYELVEVTPD-GIVKIKLLGACETCPSSDMTLKMGIELTLAEKIIGFKEVV 75
>gi|89068101|ref|ZP_01155518.1| Nitrogen-fixing NifU [Oceanicola granulosus HTCC2516] >gi|89046340|gb|EAR52397.1| Nitrogen-fixing NifU [Oceanicola granulosus HTCC2516] (186 aa)
Score = 107, Expect = 8.9e-04, Identities = 24/72 (33%), Positives = 45/72 (62%)
  Q:     8 KIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           +I+ +IK+++D+ +R  + QDGGD+ F  +  ++G V + + G C GC    +T K G+E +L++ +  V  V
  S:   111 EIVAQIKELLDTRVRPAVAQDGGDITFHGF--DRGVVYLHMQGACAGCPSSTLTLKMGIENLLRHYIPEVVEV 181
>gi|73667413|ref|YP_303429.1| nitrogen-fixing NifU, C-terminal [Ehrlichia canis str. Jake] >gi|72394554|gb|AAZ68831.1| Nitrogen-fixing NifU, C-terminal [Ehrlichia canis str. Jake] (186 aa)
Score = 107, Expect = 9.2e-04, Identities = 28/72 (38%), Positives = 49/72 (68%)
  Q:     8 KIIDEIKDVI-DSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILK---NEVEGVKSV 79
           +++D+IK++I D ++  + QDGGD++F  Y+   G V +K+ G C GC    +T KEG+  +L     +++GV+SV
  S:   112 EMVDKIKELINDYVKPAVMQDGGDIKFKGYS--NGIVFVKLRGACSGCPSASITLKEGIYNMLSYYIPDIQGVESV 185
>gi|194897711|ref|XP_001978709.1| GG17526 [Drosophila erecta] >gi|190650358|gb|EDV47636.1| GG17526 [Drosophila erecta] (283 aa)
Score = 107, Expect = 9.6e-04, Identities = 30/77 (38%), Positives = 44/77 (57%)
  Q:     3 DNNTNKIIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILK---NEVEGVKSV 79
           D+ T  +I E+ D    IR  + +DGGD+ F+ Y  E G V +K+ G C  C    VT K G++ +L+    EVE V+ V
  S:   175 DDETVMMIKELLDT--RIRPTVQEDGGDIVFMGY--EAGVVKLKMQGSCSSCPSSIVTLKNGVQNMLQFYIPEVESVEQV 250
>gi|149727512|ref|XP_001491099.1| PREDICTED: similar to HIRA interacting protein 5 isoform 1 [Equus caballus] (253 aa)
Score = 107, Expect = 9.7e-04, Identities = 27/77 (35%), Positives = 49/77 (63%)
  Q:     7 NKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILK---NEVEGVKSVIVTE 83
           ++++  IK+++D+ IR  + +DGGD+ +  +  E G V +K+ G C  C    +T K G++ +L+    EVEGV+ V+  E
  S:   166 DEVVAMIKELLDTRIRPTVQEDGGDVIYKGF--EDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQFYIPEVEGVEQVMDDE 244
>gi|126725029|ref|ZP_01740872.1| nifU domain protein [Rhodobacterales bacterium HTCC2150] >gi|126706193|gb|EBA05283.1| nifU domain protein [Rhodobacterales bacterium HTCC2150] (187 aa)
Score = 107, Expect = 9.8e-04, Identities = 24/72 (33%), Positives = 45/72 (62%)
  Q:     8 KIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           +I+ +IK+++D+ +R  + QDGGD+ F  +  ++G V + + G C GC    +T K G+E +L++ +  V  V
  S:   112 EIVGQIKELLDTRVRPAVAQDGGDITFHGF--DRGIVYLHMQGACAGCPSSTLTLKMGIENLLRHYIPEVVEV 182
>gi|17541876|ref|NP_501917.1| LiPid Depleted family member (lpd-8) [Caenorhabditis elegans] >gi|3879150|emb|CAA94609.1| C. elegans protein R10H10.1, confirmed by transcript evidence [Caenorhabditis elegans] (222 aa)
Score = 107, Expect = 1.0e-03, Identities = 27/74 (36%), Positives = 46/74 (62%)
  Q:     7 NKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           ++++  IK+++++ IR  + +DGGD+ +V +  + G V +K+ G C GC    VT K G+E +L   V  VK VI
  S:   125 DEVVMMIKEILETRIRPMVQEDGGDITYVGF--DDGVVKLKMQGSCTGCPSSGVTLKNGIENMLTFYVPEVKEVI 197
>gi|144900396|emb|CAM77260.1| NifU domain protein [Magnetospirillum gryphiswaldense MSR-1] (182 aa)
Score = 107, Expect = 1.1e-03, Identities = 27/77 (35%), Positives = 43/77 (55%)
  Q:     3 DNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           D     I+ +IK+++D+ +R  + QDGGD+ F  +  + G V + + G C GC     T K G+E +LK  V  V +V
  S:   103 DGEETDIVRQIKELLDTRVRPAVAQDGGDIIFRSF--DDGIVYVHLQGACSGCPSSTATLKHGIENMLKYYVPEVVAV 178
>gi|34500319|gb|AAQ73784.1| NifU-like protein HIRIP5 [Homo sapiens] >gi|194374137|dbj|BAG62381.1| unnamed protein product [Homo sapiens] (254 aa)
Score = 107, Expect = 1.1e-03, Identities = 27/77 (35%), Positives = 49/77 (63%)
  Q:     7 NKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILK---NEVEGVKSVIVTE 83
           ++++  IK+++D+ IR  + +DGGD+ +  +  E G V +K+ G C  C    +T K G++ +L+    EVEGV+ V+  E
  S:   167 DEVVAMIKELLDTRIRPTVQEDGGDVIYKGF--EDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQFYIPEVEGVEQVMDDE 245
>gi|50593021|ref|NP_001002755.1| HIRA interacting protein 5 isoform 2 [Homo sapiens] >gi|32967069|gb|AAP92372.1| iron-sulfur cluster scaffold protein Nfu [Homo sapiens] >gi|109731123|gb|AAI13693.1| NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) [Homo sapiens] >gi|109731125|gb|AAI13695.1| NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) [Homo sapiens] >gi|119620255|gb|EAW99849.1| HIRA interacting protein 5, isoform CRA_a [Homo sapiens] (254 aa)
Score = 107, Expect = 1.1e-03, Identities = 27/77 (35%), Positives = 49/77 (63%)
  Q:     7 NKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILK---NEVEGVKSVIVTE 83
           ++++  IK+++D+ IR  + +DGGD+ +  +  E G V +K+ G C  C    +T K G++ +L+    EVEGV+ V+  E
  S:   167 DEVVAMIKELLDTRIRPTVQEDGGDVIYKGF--EDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQFYIPEVEGVEQVMDDE 245
>gi|83313502|ref|YP_423766.1| HIRA-interacting protein 5 [Magnetospirillum magneticum AMB-1] >gi|82948343|dbj|BAE53207.1| HIRA-interacting protein 5 [Magnetospirillum magneticum AMB-1] (190 aa)
Score = 106, Expect = 1.1e-03, Identities = 27/71 (38%), Positives = 42/71 (59%)
  Q:     9 IIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           I+ +IK+++D+ +R  + QDGGD+ F  +  E G V + + G C GC     T K G+E +LK  V  V +V
  S:   117 IVMQIKELLDTRVRPAVAQDGGDIIFRAF--EDGIVYLHLQGACSGCPSSSATLKHGIENMLKYYVPEVMAV 186
>gi|46201919|ref|ZP_00054106.2| COG0694: Thioredoxin-like proteins and domains [Magnetospirillum magnetotacticum MS-1] (182 aa)
Score = 106, Expect = 1.1e-03, Identities = 27/71 (38%), Positives = 42/71 (59%)
  Q:     9 IIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           I+ +IK+++D+ +R  + QDGGD+ F  +  E G V + + G C GC     T K G+E +LK  V  V +V
  S:   109 IVMQIKELLDTRVRPAVAQDGGDIIFRAF--EDGIVYLHLQGACSGCPSSSATLKHGIENMLKYYVPEVMAV 178
>gi|84500284|ref|ZP_00998550.1| nifU domain protein [Oceanicola batsensis HTCC2597] >gi|84392218|gb|EAQ04486.1| nifU domain protein [Oceanicola batsensis HTCC2597] (187 aa)
Score = 106, Expect = 1.1e-03, Identities = 27/74 (36%), Positives = 48/74 (64%)
  Q:     8 KIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKN---EVEGVKSVIV 81
           +I+ +IK+++D+ +R  + QDGGD+ F  +  ++G V + + G C GC    +T K G+E +L++   EV  V+ V V
  S:   112 EIVVQIKELLDTRVRPAVAQDGGDITFHGF--DRGVVYLYMQGACAGCPSSTLTLKMGIENLLRHYIPEVTEVRPVAV 187
>gi|148666782|gb|EDK99198.1| mCG130855, isoform CRA_b [Mus musculus] (256 aa)
Score = 106, Expect = 1.2e-03, Identities = 26/74 (35%), Positives = 48/74 (64%)
  Q:     7 NKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILK---NEVEGVKSVI 80
           ++++  IK+++D+ IR  + +DGGD+ +  +  E G V +K+ G C  C    +T K G++ +L+    EVEGV+ V+
  S:   168 DEVVAMIKELLDTRIRPTVQEDGGDVIYRGF--EDGIVRLKLQGSCTSCPSSIITLKSGIQNMLQFYIPEVEGVEQVM 243
>gi|34500321|gb|AAQ73785.1| NifU-like protein HIRIP5 [Mus musculus] (245 aa)
Score = 106, Expect = 1.2e-03, Identities = 26/74 (35%), Positives = 48/74 (64%)
  Q:     7 NKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILK---NEVEGVKSVI 80
           ++++  IK+++D+ IR  + +DGGD+ +  +  E G V +K+ G C  C    +T K G++ +L+    EVEGV+ V+
  S:   157 DEVVAMIKELLDTRIRPTVQEDGGDVIYRGF--EDGIVRLKLQGSCTSCPSSIITLKSGIQNMLQFYIPEVEGVEQVM 232
>gi|148666781|gb|EDK99197.1| mCG130855, isoform CRA_a [Mus musculus] (255 aa)
Score = 106, Expect = 1.2e-03, Identities = 26/74 (35%), Positives = 48/74 (64%)
  Q:     7 NKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILK---NEVEGVKSVI 80
           ++++  IK+++D+ IR  + +DGGD+ +  +  E G V +K+ G C  C    +T K G++ +L+    EVEGV+ V+
  S:   167 DEVVAMIKELLDTRIRPTVQEDGGDVIYRGF--EDGIVRLKLQGSCTSCPSSIITLKSGIQNMLQFYIPEVEGVEQVM 242
>gi|55596270|ref|XP_525775.1| PREDICTED: similar to HIRA interacting protein 5 isoform 8 [Pan troglodytes] (254 aa)
Score = 106, Expect = 1.2e-03, Identities = 27/77 (35%), Positives = 49/77 (63%)
  Q:     7 NKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILK---NEVEGVKSVIVTE 83
           ++++  IK+++D+ IR  + +DGGD+ +  +  E G V +K+ G C  C    +T K G++ +L+    EVEGV+ V+  E
  S:   167 DEVVAMIKELLDTRIRPTVQEDGGDVIYKGF--EDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQFYIPEVEGVEQVMDDE 245
>gi|114053059|ref|NP_001040031.1| HIRA interacting protein 5 [Bos taurus] >gi|86823819|gb|AAI05370.1| NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) [Bos taurus] (253 aa)
Score = 106, Expect = 1.2e-03, Identities = 27/79 (34%), Positives = 50/79 (63%)
  Q:     5 NTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILK---NEVEGVKSVIVTE 83
           + ++++  IK+++D+ IR  + +DGGD+ +  +  E G V +K+ G C  C    +T K G++ +L+    EVEGV+ V+  E
  S:   164 DDDEVVAMIKELLDTRIRPTVQEDGGDVIYKGF--EDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQFYIPEVEGVEQVMDDE 244
>gi|58617525|ref|YP_196724.1| hypothetical protein ERGA_CDS_07980 [Ehrlichia ruminantium str. Gardel] >gi|58417137|emb|CAI28250.1| Conserved hypothetical protein [Ehrlichia ruminantium str. Gardel] (185 aa)
Score = 106, Expect = 1.2e-03, Identities = 28/78 (35%), Positives = 46/78 (58%)
  Q:     2 LDNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
            D    +I+ +IK++ID  I+  + QDGGD++F  Y+   G V +K+ G C GC    +T KEG+  +L   +  ++SV
  S:   106 FDAKDEEIVSKIKELIDDYIKPAVAQDGGDIKFKGYS--NGIVFVKLRGACSGCPSASITLKEGIYNMLTYYLPDIQSV 182
>gi|167357028|ref|ZP_02291698.1| Scaffold protein Nfu/NifU [Rhizobium leguminosarum bv. trifolii WSM1325] >gi|167075996|gb|EDR79802.1| Scaffold protein Nfu/NifU [Rhizobium leguminosarum bv. trifolii WSM1325] (188 aa)
Score = 106, Expect = 1.2e-03, Identities = 25/79 (31%), Positives = 45/79 (56%)
  Q:     2 LDNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
            D     I+  IK+++++ +R  + QDGGD+ F  +  + G+V + + G C GC     T K G++ +L++ V  V+ VI
  S:   109 FDEGDESIVLTIKELLETRVRPAVAQDGGDITFRGF--KDGKVYLNMKGSCAGCPSSTATLKHGVQNLLRHFVPEVQEVI 186
>gi|149036647|gb|EDL91265.1| histone cell cycle regulation defective interacting protein 5 (predicted), isoform CRA_a [Rattus norvegicus] (253 aa)
Score = 106, Expect = 1.2e-03, Identities = 27/77 (35%), Positives = 49/77 (63%)
  Q:     7 NKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILK---NEVEGVKSVIVTE 83
           ++++  IK+++D+ IR  + +DGGD+ +  +  E G V +K+ G C  C    +T K G++ +L+    EVEGV+ V+  E
  S:   165 DEVVAMIKELLDTRIRPTVQEDGGDVIYRGF--EDGIVRLKLQGSCTSCPSSIITLKSGIQNMLQFYIPEVEGVEQVMDDE 243
>gi|86132468|ref|ZP_01051062.1| nifU protein-like [Cellulophaga sp. MED134] >gi|85817029|gb|EAQ38213.1| nifU protein-like [Dokdonia donghaensis MED134] (80 aa)
Score = 106, Expect = 1.2e-03, Identities = 21/76 (27%), Positives = 46/76 (60%)
  Q:     5 NTNKIIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           +T ++  +++D ++ IR ++  DGGD+  +  + ++  V +++ G C+GCS+  +T K G+E  +K     ++ VI
  S:     2 STAELTQKVEDALEEIRPFLQSDGGDISLLGIDDDR-VVRVQLQGACVGCSVNQMTLKSGVEMTIKKHAPQIEQVI 76
>gi|195482335|ref|XP_002102005.1| GE15286 [Drosophila yakuba] >gi|194189529|gb|EDX03113.1| GE15286 [Drosophila yakuba] (283 aa)
Score = 106, Expect = 1.3e-03, Identities = 30/77 (38%), Positives = 44/77 (57%)
  Q:     3 DNNTNKIIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILK---NEVEGVKSV 79
           D+ T  +I E+ D    IR  + +DGGD+ F+ Y  E G V +K+ G C  C    VT K G++ +L+    EVE V+ V
  S:   175 DDETVMMIKELLDT--RIRPTVQEDGGDIVFMGY--EAGVVKLKMQGSCSSCPSSIVTLKNGVQNMLQFYIPEVESVEQV 250
>gi|114577887|ref|XP_001137189.1| PREDICTED: hypothetical protein isoform 2 [Pan troglodytes] (248 aa)
Score = 106, Expect = 1.3e-03, Identities = 26/73 (35%), Positives = 47/73 (64%)
  Q:     7 NKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILK---NEVEGVKSV 79
           ++++  IK+++D+ IR  + +DGGD+ +  +  E G V +K+ G C  C    +T K G++ +L+    EVEGV+ V
  S:   167 DEVVAMIKELLDTRIRPTVQEDGGDVIYKGF--EDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQFYIPEVEGVEQV 241
>gi|31874276|emb|CAD98142.1| hypothetical protein [Homo sapiens] (242 aa)
Score = 106, Expect = 1.3e-03, Identities = 26/73 (35%), Positives = 47/73 (64%)
  Q:     7 NKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILK---NEVEGVKSV 79
           ++++  IK+++D+ IR  + +DGGD+ +  +  E G V +K+ G C  C    +T K G++ +L+    EVEGV+ V
  S:   167 DEVVAMIKELLDTRIRPTVQEDGGDVIYKGF--EDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQFYIPEVEGVEQV 241
>gi|88606830|ref|YP_504700.1| NifU domain-containing protein [Anaplasma phagocytophilum HZ] >gi|88597893|gb|ABD43363.1| NifU domain protein [Anaplasma phagocytophilum HZ] (188 aa)
Score = 106, Expect = 1.3e-03, Identities = 24/73 (32%), Positives = 48/73 (65%)
  Q:     7 NKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           ++I+ ++K++I++ ++  + QDGGD++F  Y  ++G V +K+ G C GC    VT K+G+  +L   +  +K+V
  S:   114 SEIVQQVKELIENYVKPAVAQDGGDIKFRGY--KEGVVFVKLRGACSGCPSAAVTLKDGVYGMLSYYIPAIKAV 185
>gi|84515908|ref|ZP_01003269.1| nifU domain protein [Loktanella vestfoldensis SKA53] >gi|84510350|gb|EAQ06806.1| nifU domain protein [Loktanella vestfoldensis SKA53] (187 aa)
Score = 106, Expect = 1.3e-03, Identities = 24/71 (33%), Positives = 44/71 (61%)
  Q:     9 IIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           I+ +IK+++D+ +R  + QDGGD+ F  +  ++G V + + G C GC    +T K G+E +L++ +  V  V
  S:   113 IVTQIKELLDTRVRPAVAQDGGDITFHGF--DRGIVYLHMQGACAGCPSSTLTLKMGIENLLRHYIPEVIEV 182
>gi|156548302|ref|XP_001602506.1| PREDICTED: similar to protein phosphatase 2a [Nasonia vitripennis] (511 aa)
Score = 106, Expect = 1.3e-03, Identities = 27/79 (34%), Positives = 51/79 (64%)
  Q:     1 MLDNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILK---NEVEGVKSV 79
           +++ + ++I+  IK+++D+ IR  + +DGGD+ F+ +  E G V +K+ G C  C    VT K G++ +++    EV GV+ V
  S:   171 VINEDDDEIVQMIKELLDTRIRPTVQEDGGDIVFMGF--ENGIVKLKMQGSCTSCPSSVVTLKNGVQNMMQFYIPEVLGVEQV 251
>gi|195568040|ref|XP_002107563.1| GD15490 [Drosophila simulans] >gi|194204973|gb|EDX18549.1| GD15490 [Drosophila simulans] (283 aa)
Score = 106, Expect = 1.3e-03, Identities = 30/77 (38%), Positives = 44/77 (57%)
  Q:     3 DNNTNKIIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILK---NEVEGVKSV 79
           D+ T  +I E+ D    IR  + +DGGD+ F+ Y  E G V +K+ G C  C    VT K G++ +L+    EVE V+ V
  S:   175 DDETVMMIKELLDT--RIRPTVQEDGGDIVFMGY--EAGVVKLKMQGSCSSCPSSIVTLKNGVQNMLQFYIPEVESVEQV 250
>gi|27467548|ref|NP_764185.1| nitrogen fixation protein NifU [Staphylococcus epidermidis ATCC 12228] >gi|57866465|ref|YP_188114.1| NifU domain-containing protein [Staphylococcus epidermidis RP62A] >gi|27315092|gb|AAO04227.1|AE016746_17 nitrogen fixation protein NifU [Staphylococcus epidermidis ATCC 12228] >gi|57637123|gb|AAW53911.1| NifU domain protein [Staphylococcus epidermidis RP62A] (80 aa)
Score = 106, Expect = 1.3e-03, Identities = 26/71 (36%), Positives = 40/71 (56%)
  Q:     9 IIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           + D++ +VI+ +R ++ +DGGD   VD   E G V +++ G C  C    +T K G+E  L  EV GV  V
  S:     8 MFDQVAEVIERLRPFLLRDGGDCTLVDV--EDGIVKLQLHGACGTCPSSTITLKAGIERALHEEVPGVIEV 76
>gi|190890051|ref|YP_001976593.1| nitrogen fixation protein [Rhizobium etli CIAT 652] >gi|190695330|gb|ACE89415.1| nitrogen fixation protein [Rhizobium etli CIAT 652] (188 aa)
Score = 106, Expect = 1.3e-03, Identities = 25/79 (31%), Positives = 45/79 (56%)
  Q:     2 LDNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
            D     I+  IK+++++ +R  + QDGGD+ F  +  + G+V + + G C GC     T K G++ +L++ V  V+ VI
  S:   109 FDEGDESIVLTIKELLETRVRPAVAQDGGDITFRGF--KDGKVYLNMKGSCSGCPSSTATLKHGVQNLLRHFVPEVQEVI 186
>gi|15964154|ref|NP_384507.1| hypothetical protein SMc01119 [Sinorhizobium meliloti 1021] >gi|15073330|emb|CAC41838.1| Conserved hypothetical protein [Sinorhizobium meliloti 1021] (188 aa)
Score = 106, Expect = 1.4e-03, Identities = 26/78 (33%), Positives = 46/78 (58%)
  Q:     2 LDNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKN---EVEGVKSV 79
            D     I+  IK+++++ +R  + QDGGD+ F  +  + G V + + G C GC     T + G++ +L++   EVE V+SV
  S:   109 FDEGDEAIVATIKELLETRVRPAVAQDGGDITFRGF--KDGTVFLNMKGACSGCPSSTATLRHGVQNLLRHFVPEVEAVESV 188
>gi|74211556|dbj|BAE26508.1| unnamed protein product [Mus musculus] (256 aa)
Score = 106, Expect = 1.4e-03, Identities = 26/74 (35%), Positives = 48/74 (64%)
  Q:     7 NKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILK---NEVEGVKSVI 80
           ++++  IK+++D+ IR  + +DGGD+ +  +  E G V +K+ G C  C    +T K G++ +L+    EVEGV+ V+
  S:   168 DEVVAMIKELLDTRIRPTVQEDGGDVIYRGF--EDGIVRLKLQGSCTSCPSSIITLKSGIQNMLQFYIPEVEGVEQVM 243
>gi|12834577|dbj|BAB22965.1| unnamed protein product [Mus musculus] (255 aa)
Score = 105, Expect = 1.4e-03, Identities = 26/74 (35%), Positives = 48/74 (64%)
  Q:     7 NKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILK---NEVEGVKSVI 80
           ++++  IK+++D+ IR  + +DGGD+ +  +  E G V +K+ G C  C    +T K G++ +L+    EVEGV+ V+
  S:   167 DEVVAMIKELLDTRIRPTVQEDGGDVIYRGF--EDGIVRLKLQGSCTSCPSSIITLKSGIQNMLQFYIPEVEGVEQVM 242
>gi|70727016|ref|YP_253930.1| nitrogen fixation protein NifU [Staphylococcus haemolyticus JCSC1435] >gi|68447740|dbj|BAE05324.1| nitrogen fixation protein NifU [Staphylococcus haemolyticus JCSC1435] (80 aa)
Score = 105, Expect = 1.5e-03, Identities = 26/71 (36%), Positives = 40/71 (56%)
  Q:     9 IIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           + D++ +VI+ +R ++ +DGGD   VD   E G V +++ G C  C    +T K G+E  L  EV GV  V
  S:     8 MFDQVAEVIERLRPFLLRDGGDCTLVDV--EDGIVKLQLHGACGTCPSSTITLKAGIERALHEEVPGVIEV 76
>gi|77462766|ref|YP_352270.1| nitrogen-fixing NifU [Rhodobacter sphaeroides 2.4.1] >gi|77387184|gb|ABA78369.1| Nitrogen-fixing NifU [Rhodobacter sphaeroides 2.4.1] (186 aa)
Score = 105, Expect = 1.5e-03, Identities = 24/77 (31%), Positives = 45/77 (58%)
  Q:     3 DNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           D     ++ +IK+++D+ +R  + QDGGD+ F  +  ++G V + + G C GC    +T K G+E +L++ +  V  V
  S:   106 DGPDEDVVRQIKELLDTRVRPAVAQDGGDITFHGF--DRGIVYLHMQGACAGCPSSTLTLKMGIENLLRHYIPEVLEV 181
>gi|126461658|ref|YP_001042772.1| NifU domain-containing protein [Rhodobacter sphaeroides ATCC 17029] >gi|126103322|gb|ABN76000.1| nitrogen-fixing NifU domain protein [Rhodobacter sphaeroides ATCC 17029] (186 aa)
Score = 105, Expect = 1.5e-03, Identities = 24/77 (31%), Positives = 45/77 (58%)
  Q:     3 DNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           D     ++ +IK+++D+ +R  + QDGGD+ F  +  ++G V + + G C GC    +T K G+E +L++ +  V  V
  S:   106 DGPDEDVVRQIKELLDTRVRPAVAQDGGDITFHGF--DRGIVYLHMQGACAGCPSSTLTLKMGIENLLRHYIPEVLEV 181
>gi|169196463|ref|ZP_02855817.1| Scaffold protein Nfu/NifU [Rhizobium leguminosarum bv. trifolii WSM2304] >gi|169091206|gb|EDS69916.1| Scaffold protein Nfu/NifU [Rhizobium leguminosarum bv. trifolii WSM2304] (188 aa)
Score = 105, Expect = 1.5e-03, Identities = 25/79 (31%), Positives = 45/79 (56%)
  Q:     2 LDNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
            D     I+  IK+++++ +R  + QDGGD+ F  +  + G+V + + G C GC     T K G++ +L++ V  V+ VI
  S:   109 FDEGDESIVLTIKELLETRVRPAVAQDGGDITFRGF--KDGKVYLNMKGSCAGCPSSTATLKHGVQNLLRHFVPEVQEVI 186
>gi|195392814|ref|XP_002055049.1| GJ19011 [Drosophila virilis] >gi|194149559|gb|EDW65250.1| GJ19011 [Drosophila virilis] (298 aa)
Score = 105, Expect = 1.5e-03, Identities = 28/77 (36%), Positives = 43/77 (55%)
  Q:     3 DNNTNKIIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           D+ T  +I E+ D    IR  + +DGGD+ F+ Y  E G V +K+ G C  C    VT K G++ +L+  +  V+SV
  S:   183 DDETVMMIKELLDT--RIRPTVQEDGGDIVFMGY--ENGIVKLKMQGSCSSCPSSIVTLKNGVQNMLQFYIPEVESV 255
>gi|58177342|pdb|1XHJ|A Chain A, Solution Structure Of The Staphylococcus Epidermidis Protein Se0630. Northest Structural Genomics Consortium Target Ser8. (88 aa)
Score = 105, Expect = 1.6e-03, Identities = 26/71 (36%), Positives = 40/71 (56%)
  Q:     9 IIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           + D++ +VI+ +R ++ +DGGD   VD   E G V +++ G C  C    +T K G+E  L  EV GV  V
  S:     8 MFDQVAEVIERLRPFLLRDGGDCTLVDV--EDGIVKLQLHGACGTCPSSTITLKAGIERALHEEVPGVIEV 76
>gi|150395264|ref|YP_001325731.1| scaffold protein Nfu/NifU [Sinorhizobium medicae WSM419] >gi|150026779|gb|ABR58896.1| Scaffold protein Nfu/NifU [Sinorhizobium medicae WSM419] (188 aa)
Score = 105, Expect = 1.6e-03, Identities = 26/78 (33%), Positives = 46/78 (58%)
  Q:     2 LDNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKN---EVEGVKSV 79
            D     I+  IK+++++ +R  + QDGGD+ F  +  + G V + + G C GC     T + G++ +L++   EVE V+SV
  S:   109 FDEGDEAIVATIKELLETRVRPAVAQDGGDITFRGF--KDGTVFLNMKGACSGCPSSTATLRHGVQNLLRHFVPEVESVESV 188
>gi|73663148|ref|YP_301929.1| hypothetical protein SSP1839 [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|72495663|dbj|BAE18984.1| conserved hypothetical protein [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (80 aa)
Score = 105, Expect = 1.6e-03, Identities = 26/71 (36%), Positives = 40/71 (56%)
  Q:     9 IIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           + D++ +VI+ +R ++ +DGGD   VD   E G V +++ G C  C    +T K G+E  L  EV GV  V
  S:     8 MFDQVAEVIEKLRPFLLRDGGDCSLVDV--EDGIVKLQLHGACGTCPSSTITLKAGIERALHEEVPGVIEV 76
>gi|4680705|gb|AAD27742.1|AF132967_1 CGI-33 protein [Homo sapiens] (231 aa)
Score = 105, Expect = 1.6e-03, Identities = 27/77 (35%), Positives = 49/77 (63%)
  Q:     7 NKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILK---NEVEGVKSVIVTE 83
           ++++  IK+++D+ IR  + +DGGD+ +  +  E G V +K+ G C  C    +T K G++ +L+    EVEGV+ V+  E
  S:   144 DEVVAMIKELLDTRIRPTVQEDGGDVIYKGF--EDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQFYIPEVEGVEQVMDDE 222
>gi|57239492|ref|YP_180628.1| hypothetical protein Erum7660 [Ehrlichia ruminantium str. Welgevonden] >gi|58579471|ref|YP_197683.1| hypothetical protein ERWE_CDS_08070 [Ehrlichia ruminantium str. Welgevonden] >gi|57161571|emb|CAH58499.1| putative NifU-related protein [Ehrlichia ruminantium str. Welgevonden] >gi|58418097|emb|CAI27301.1| Conserved hypothetical protein [Ehrlichia ruminantium str. Welgevonden] (185 aa)
Score = 105, Expect = 1.7e-03, Identities = 28/78 (35%), Positives = 46/78 (58%)
  Q:     2 LDNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
            D    +I+ +IK++ID  I+  + QDGGD++F  Y+   G V +K+ G C GC    +T KEG+  +L   +  ++SV
  S:   106 FDAKDEEIVSKIKELIDDYIKPAVAQDGGDIKFKGYS--NGIVFVKLRGACSGCPSASITLKEGIYNMLTYYLPDIQSV 182
>gi|89100547|ref|ZP_01173407.1| nitrogen fixation protein (NifU protein) [Bacillus sp. NRRL B-14911] >gi|89084734|gb|EAR63875.1| nitrogen fixation protein (NifU protein) [Bacillus sp. NRRL B-14911] (77 aa)
Score = 105, Expect = 1.7e-03, Identities = 24/61 (39%), Positives = 38/61 (62%)
  Q:     9 IIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETIL 69
           II ++++V+D +R ++ +DGGD E VD   E G V +++LG C  C    +T K G+E  L
  S:     5 IISDVQEVLDKLRPFLLRDGGDCELVDV--EDGIVKLRLLGACGSCPSSTITLKAGIERAL 63
>gi|195357024|ref|XP_002044916.1| GM13534 [Drosophila sechellia] >gi|194124051|gb|EDW46094.1| GM13534 [Drosophila sechellia] (283 aa)
Score = 105, Expect = 1.7e-03, Identities = 28/77 (36%), Positives = 43/77 (55%)
  Q:     3 DNNTNKIIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           D+ T  +I E+ D    IR  + +DGGD+ F+ Y  E G V +K+ G C  C    VT K G++ +L+  +  V+SV
  S:   175 DDETVMMIKELLDT--RIRPTVQEDGGDIVFMGY--EAGVVKLKMQGSCSSCPSSIVTLKNGVQNMLQFYIPEVESV 247
>gi|89053356|ref|YP_508807.1| nitrogen-fixing NifU-like [Jannaschia sp. CCS1] >gi|88862905|gb|ABD53782.1| nitrogen-fixing NifU-like protein [Jannaschia sp. CCS1] (187 aa)
Score = 105, Expect = 1.7e-03, Identities = 24/72 (33%), Positives = 44/72 (61%)
  Q:     8 KIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           +I+ +IK ++D+ +R  + QDGGD+ F  +  ++G V + + G C GC    +T K G+E +L++ +  V  V
  S:   112 EIVGQIKSLLDTRVRPAVAQDGGDITFHGF--DRGVVYLHMQGACAGCPSSTLTLKMGIENLLRHYIPEVVEV 182
>gi|58039243|ref|YP_191207.1| NifU protein [Gluconobacter oxydans 621H] >gi|58001657|gb|AAW60551.1| NifU protein [Gluconobacter oxydans 621H] (212 aa)
Score = 105, Expect = 1.8e-03, Identities = 25/72 (34%), Positives = 42/72 (58%)
  Q:     8 KIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           +++  I+D++D+ +R  +  DGGD+ F  Y  + G V + + G C GC     T K G+E +L++ V  V SV
  S:   137 EVVSRIQDLLDTRVRPAVAGDGGDIAFRGY--KDGVVYLAMQGACSGCPSSRATLKHGVENMLRHYVPEVASV 207
>gi|156743727|ref|YP_001433856.1| NifU domain-containing protein [Roseiflexus castenholzii DSM 13941] >gi|156235055|gb|ABU59838.1| nitrogen-fixing NifU domain protein [Roseiflexus castenholzii DSM 13941] (291 aa)
Score = 105, Expect = 1.8e-03, Identities = 25/73 (34%), Positives = 39/73 (53%)
  Q:     9 IIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVIV 81
           I+  +  V+D+ R YI   GGD+E V+    +  V +++ G C GCSL  VT +  +E  L+  V  +  V V
  S:    95 IVARVSRVLDAARPYIRSHGGDVELVEV--RENVVYVRLHGSCNGCSLSAVTLRNEIEAALRANVPEIVGVQV 165
>gi|50593025|ref|NP_056515.2| HIRA interacting protein 5 isoform 1 [Homo sapiens] >gi|32967071|gb|AAP92373.1| cytosolic iron-sulfur cluster scaffold protein Nfu [Homo sapiens] >gi|119620256|gb|EAW99850.1| HIRA interacting protein 5, isoform CRA_b [Homo sapiens] (230 aa)
Score = 105, Expect = 1.8e-03, Identities = 27/77 (35%), Positives = 49/77 (63%)
  Q:     7 NKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILK---NEVEGVKSVIVTE 83
           ++++  IK+++D+ IR  + +DGGD+ +  +  E G V +K+ G C  C    +T K G++ +L+    EVEGV+ V+  E
  S:   143 DEVVAMIKELLDTRIRPTVQEDGGDVIYKGF--EDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQFYIPEVEGVEQVMDDE 221
>gi|195132295|ref|XP_002010579.1| GI14603 [Drosophila mojavensis] >gi|193909029|gb|EDW07896.1| GI14603 [Drosophila mojavensis] (259 aa)
Score = 104, Expect = 1.9e-03, Identities = 28/77 (36%), Positives = 43/77 (55%)
  Q:     3 DNNTNKIIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           D+ T  +I E+ D    IR  + +DGGD+ F+ Y  E G V +K+ G C  C    VT K G++ +L+  +  V+SV
  S:   148 DDETVMMIKELLDT--RIRPTVQEDGGDIVFMGY--ENGVVKLKMQGSCSSCPSSIVTLKNGVQNMLQFYIPEVESV 220
>gi|149369678|ref|ZP_01889530.1| thioredoxin-related protein [unidentified eubacterium SCB49] >gi|149357105|gb|EDM45660.1| thioredoxin-related protein [unidentified eubacterium SCB49] (306 aa)
Score = 104, Expect = 1.9e-03, Identities = 25/78 (32%), Positives = 44/78 (56%)
  Q:     3 DNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           D + + I +EI D++D  I+  +  DGG + F  Y+     V + + G C GC    VT K G+ET+L++ ++G   ++
  S:   223 DKSYSDIDNEIMDILDEYIKPAVASDGGHIAFDSYDANTKTVKVILQGACSGCPSATVTLKNGIETMLRDMMKGRVEIV 301
>gi|194763845|ref|XP_001964043.1| GF20932 [Drosophila ananassae] >gi|190618968|gb|EDV34492.1| GF20932 [Drosophila ananassae] (286 aa)
Score = 104, Expect = 1.9e-03, Identities = 28/77 (36%), Positives = 43/77 (55%)
  Q:     3 DNNTNKIIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           D+ T  +I E+ D    IR  + +DGGD+ F+ Y  E G V +K+ G C  C    VT K G++ +L+  +  V+SV
  S:   175 DDETVMMIKELLDT--RIRPTVQEDGGDIVFMGY--ENGIVKLKMQGSCSSCPSSIVTLKNGVQNMLQFYIPEVESV 247
>gi|164688813|ref|ZP_02212841.1| hypothetical protein CLOBAR_02460 [Clostridium bartlettii DSM 16795] >gi|164602289|gb|EDQ95754.1| hypothetical protein CLOBAR_02460 [Clostridium bartlettii DSM 16795] (73 aa)
Score = 104, Expect = 1.9e-03, Identities = 24/70 (34%), Positives = 42/70 (60%)
  Q:    11 DEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           +++  V+D +R  + +DGGD+E V+ + + G V +++ G C GC    +T K  +E +L  EV GV  V+
  S:     3 EQVAAVLDKVRPVLQRDGGDVELVEVS-DDGVVLVRLKGACSGCPGATMTLKAVIENLLVKEVPGVTRVV 71
>gi|15604511|ref|NP_221029.1| hypothetical protein RP667 [Rickettsia prowazekii str. Madrid E] >gi|3861205|emb|CAA15105.1| unknown [Rickettsia prowazekii] (190 aa)
Score = 104, Expect = 2.0e-03, Identities = 29/79 (36%), Positives = 48/79 (60%)
  Q:     1 MLDNNTNKIIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKN---EVEGVKSV 79
           ML     +II+ I+     +R ++ QDGGD+ +  +  E G V + + G C+GC    +T K G+E++LK+   EV+ VK+V
  S:   109 MLSEIEKQIIETIET---RVRPFVTQDGGDIIYKGF--ESGVVKLALRGACLGCPSSTITLKNGIESMLKHFIPEVQEVKAV 185
>gi|116873760|ref|YP_850541.1| NifU family protein [Listeria welshimeri serovar 6b str. SLCC5334] >gi|116742638|emb|CAK21762.1| unnamed protein product [Listeria welshimeri serovar 6b str. SLCC5334] (78 aa)
Score = 104, Expect = 2.0e-03, Identities = 25/69 (36%), Positives = 39/69 (56%)
  Q:    12 EIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           E+   +   R ++ +DGGD E ++  P+ G V IK+LG C  C   D+T K G+E  L  ++ G K V+
  S:     8 EVDKALKKFRPFLVRDGGDYELIEVTPD-GIVKIKLLGACETCPSSDMTLKMGIELTLAEKIIGFKEVV 75
>gi|73970249|ref|XP_855433.1| PREDICTED: similar to HIRA interacting protein 5 isoform 2 [Canis familiaris] (253 aa)
Score = 104, Expect = 2.1e-03, Identities = 27/77 (35%), Positives = 49/77 (63%)
  Q:     7 NKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILK---NEVEGVKSVIVTE 83
           ++++  IK+++D+ IR  + +DGGD+ +  +  E G V +K+ G C  C    +T K G++ +L+    EVEGV+ V+  E
  S:   166 DEVVAMIKELLDTRIRPTVQEDGGDVIYKGF--EDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQFYIPEVEGVEQVMDDE 244
>gi|57651628|ref|YP_185809.1| NifU domain-containing protein [Staphylococcus aureus subsp. aureus COL] >gi|57285814|gb|AAW37908.1| NifU domain protein [Staphylococcus aureus subsp. aureus COL] (73 aa)
Score = 104, Expect = 2.1e-03, Identities = 25/71 (35%), Positives = 40/71 (56%)
  Q:     9 IIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           + D++ +VI+ +R ++ +DGGD   +D   E G V +++ G C  C    +T K G+E  L  EV GV  V
  S:     1 MFDQVAEVIERLRPFLLRDGGDCSLIDV--EDGIVKLQLHGACGTCPSSTITLKAGIERALHEEVPGVIEV 69
>gi|86356038|ref|YP_467930.1| nitrogen fixation protein [Rhizobium etli CFN 42] >gi|86280140|gb|ABC89203.1| nitrogen fixation protein [Rhizobium etli CFN 42] (188 aa)
Score = 104, Expect = 2.1e-03, Identities = 25/79 (31%), Positives = 45/79 (56%)
  Q:     2 LDNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
            D     I+  IK+++++ +R  + QDGGD+ F  +  + G+V + + G C GC     T K G++ +L++ V  V+ VI
  S:   109 FDEGDESIVLTIKELLETRVRPAVAQDGGDITFRGF--KDGKVYLNMKGSCSGCPSSTATLKHGVQNLLRHFVPEVQEVI 186
>gi|153007498|ref|YP_001368713.1| scaffold protein Nfu/NifU [Ochrobactrum anthropi ATCC 49188] >gi|151559386|gb|ABS12884.1| Scaffold protein Nfu/NifU [Ochrobactrum anthropi ATCC 49188] (190 aa)
Score = 104, Expect = 2.1e-03, Identities = 25/78 (32%), Positives = 44/78 (56%)
  Q:     2 LDNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
            D    + ++ IK++I++ +R  + QDGGD+ F  +  E G V + + G C GC     T K G++ +L++ V  V+ V
  S:   111 FDEADAETVEIIKELIETRVRPAVAQDGGDITFRGF--ENGTVFLNMKGACSGCPSSTATLKHGIQNLLRHFVPEVQQV 187
>gi|157693637|ref|YP_001488099.1| iron-sulfur assembly protein [Bacillus pumilus SAFR-032] >gi|194015287|ref|ZP_03053903.1| conserved domain protein [Bacillus pumilus ATCC 7061] >gi|157682395|gb|ABV63539.1| possible iron-sulfur assembly protein [Bacillus pumilus SAFR-032] >gi|194012691|gb|EDW22257.1| conserved domain protein [Bacillus pumilus ATCC 7061] (78 aa)
Score = 104, Expect = 2.1e-03, Identities = 23/59 (38%), Positives = 37/59 (62%)
  Q:    11 DEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETIL 69
           D++++V+D +R ++ +DGGD E VD   E G V +++LG C  C    +T K G+E  L
  S:     8 DQVQEVLDKLRPFLLRDGGDCELVDI--EDGIVKLRLLGACGSCPSSTITLKAGIERAL 64
>gi|114577877|ref|XP_001137587.1| PREDICTED: similar to HIRA interacting protein 5 isoform 7 [Pan troglodytes] (230 aa)
Score = 104, Expect = 2.2e-03, Identities = 27/77 (35%), Positives = 49/77 (63%)
  Q:     7 NKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILK---NEVEGVKSVIVTE 83
           ++++  IK+++D+ IR  + +DGGD+ +  +  E G V +K+ G C  C    +T K G++ +L+    EVEGV+ V+  E
  S:   143 DEVVAMIKELLDTRIRPTVQEDGGDVIYKGF--EDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQFYIPEVEGVEQVMDDE 221
>gi|195447128|ref|XP_002071076.1| GK25604 [Drosophila willistoni] >gi|194167161|gb|EDW82062.1| GK25604 [Drosophila willistoni] (289 aa)
Score = 104, Expect = 2.3e-03, Identities = 29/77 (37%), Positives = 44/77 (57%)
  Q:     3 DNNTNKIIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILK---NEVEGVKSV 79
           D+ T  +I E+ D    IR  + +DGGD+ F+ Y  + G V +K+ G C  C    VT K G++ +L+    EVE V+ V
  S:   176 DDETVMMIKELLDT--RIRPTVQEDGGDIVFMSY--DNGVVKLKMQGSCSSCPSSIVTLKNGVQNMLQFYIPEVESVEQV 251
>gi|15923926|ref|NP_371460.1| hypothetical protein SAV0936 [Staphylococcus aureus subsp. aureus Mu50] >gi|15926525|ref|NP_374058.1| hypothetical protein SA0797 [Staphylococcus aureus subsp. aureus N315] >gi|21282547|ref|NP_645635.1| hypothetical protein MW0818 [Staphylococcus aureus subsp. aureus MW2] >gi|49483096|ref|YP_040320.1| hypothetical protein SAR0898 [Staphylococcus aureus subsp. aureus MRSA252] >gi|49485712|ref|YP_042933.1| hypothetical protein SAS0806 [Staphylococcus aureus subsp. aureus MSSA476] >gi|82750551|ref|YP_416292.1| hypothetical protein SAB0802c [Staphylococcus aureus RF122] >gi|87159950|ref|YP_493539.1| hypothetical protein SAUSA300_0839 [Staphylococcus aureus subsp. aureus USA300] >gi|88194630|ref|YP_499426.1| hypothetical protein SAOUHSC_00873 [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|148267370|ref|YP_001246313.1| NifU domain-containing protein [Staphylococcus aureus subsp. aureus JH9] >gi|150393423|ref|YP_001316098.1| NifU domain-containing protein [Staphylococcus aureus subsp. aureus JH1] >gi|151221019|ref|YP_001331841.1| hypothetical protein NWMN_0807 [Staphylococcus aureus subsp. aureus str. Newman] >gi|156979262|ref|YP_001441521.1| hypothetical protein SAHV_0931 [Staphylococcus aureus subsp. aureus Mu3] >gi|161509138|ref|YP_001574797.1| hypothetical protein USA300HOU_0897 [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|168728695|ref|ZP_02760972.1| possible NifU family protein [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|13700740|dbj|BAB42036.1| SA0797 [Staphylococcus aureus subsp. aureus N315] >gi|14246705|dbj|BAB57098.1| nitrogen fixation protein NifU [Staphylococcus aureus subsp. aureus Mu50] >gi|21203984|dbj|BAB94683.1| MW0818 [Staphylococcus aureus subsp. aureus MW2] >gi|49241225|emb|CAG39904.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus MRSA252] >gi|49244155|emb|CAG42581.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus MSSA476] >gi|82656082|emb|CAI80490.1| nitrogen fixation protein [Staphylococcus aureus RF122] >gi|87125924|gb|ABD20438.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|87202188|gb|ABD29998.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|147740439|gb|ABQ48737.1| nitrogen-fixing NifU domain protein [Staphylococcus aureus subsp. aureus JH9] >gi|149945875|gb|ABR51811.1| nitrogen-fixing NifU domain protein [Staphylococcus aureus subsp. aureus JH1] >gi|150373819|dbj|BAF67079.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus str. Newman] >gi|156721397|dbj|BAF77814.1| hypothetical protein [Staphylococcus aureus subsp. aureus Mu3] >gi|160367947|gb|ABX28918.1| possible NifU family protein [Staphylococcus aureus subsp. aureus USA300_TCH1516] (80 aa)
Score = 103, Expect = 2.4e-03, Identities = 25/71 (35%), Positives = 40/71 (56%)
  Q:     9 IIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           + D++ +VI+ +R ++ +DGGD   +D   E G V +++ G C  C    +T K G+E  L  EV GV  V
  S:     8 MFDQVAEVIERLRPFLLRDGGDCSLIDV--EDGIVKLQLHGACGTCPSSTITLKAGIERALHEEVPGVIEV 76
>gi|91089707|ref|XP_974909.1| PREDICTED: similar to AGAP000598-PA [Tribolium castaneum] (244 aa)
Score = 103, Expect = 2.4e-03, Identities = 28/78 (35%), Positives = 50/78 (64%)
  Q:     2 LDNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILK---NEVEGVKSV 79
           ++ + ++I+  IK+++D+ IR  + +DGGD+ F+ Y  + G V +K+ G C  C    VT K G++ +L+    EV GV+ V
  S:   154 INEDDSEIVQMIKELLDTRIRPTVQEDGGDIIFMGY--DDGIVKLKLQGACTSCPSSIVTLKNGVQNMLQFYIPEVLGVEQV 233
>gi|56421496|ref|YP_148814.1| nitrogen fixation protein (NifU protein) [Geobacillus kaustophilus HTA426] >gi|138896548|ref|YP_001127001.1| nitrogen fixation protein NifU [Geobacillus thermodenitrificans NG80-2] >gi|56381338|dbj|BAD77246.1| nitrogen fixation protein (NifU protein) [Geobacillus kaustophilus HTA426] >gi|134268061|gb|ABO68256.1| Nitrogen fixation protein NifU [Geobacillus thermodenitrificans NG80-2] (80 aa)
Score = 103, Expect = 2.5e-03, Identities = 23/68 (33%), Positives = 41/68 (60%)
  Q:     2 LDNNTNKIIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETIL 69
           ++    +I +++++V+D +R ++ +DGGD E VD   E G V +++LG C  C    +T K G+E  L
  S:     1 MEMTDQEIKEQVQEVLDKLRPFLLRDGGDCELVDV--EDGVVKLRLLGACGSCPSSTITLKAGIERAL 66
>gi|116250169|ref|YP_766007.1| putative nifU iron-sulphur cluster scaffold protein [Rhizobium leguminosarum bv. viciae 3841] >gi|115254817|emb|CAK05891.1| putative nifU iron-sulphur cluster scaffold protein [Rhizobium leguminosarum bv. viciae 3841] (188 aa)
Score = 103, Expect = 2.6e-03, Identities = 24/72 (33%), Positives = 44/72 (61%)
  Q:     9 IIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           I+  IK+++++ +R  + QDGGD+ F  +  + G+V + + G C GC     T K G++ +L++ V  V+ VI
  S:   116 IVLTIKELLETRVRPAVAQDGGDITFRGF--KDGKVYLNMKGSCAGCPSSTATLKHGVQNLLRHFVPEVQEVI 186
>gi|24643765|ref|NP_728443.1| CG32857 CG32857-PA [Drosophila melanogaster] >gi|45551492|ref|NP_728447.2| CG32500 CG32500-PA, isoform A [Drosophila melanogaster] >gi|45556188|ref|NP_996529.1| CG33502 CG33502-PA [Drosophila melanogaster] >gi|17946577|gb|AAL49319.1| RH16335p [Drosophila melanogaster] >gi|22831388|gb|AAG22462.2| CG33502-PA [Drosophila melanogaster] >gi|22831391|gb|AAN09001.1| CG32857-PA [Drosophila melanogaster] >gi|45446754|gb|AAN09005.2| CG32500-PA, isoform A [Drosophila melanogaster] (283 aa)
Score = 103, Expect = 2.6e-03, Identities = 26/67 (38%), Positives = 42/67 (62%)
  Q:    13 IKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           IK+++D+ IR  + +DGGD+ F+ Y  E G V +K+ G C  C    VT K G++ +L+  +  V+SV
  S:   182 IKELLDTRIRPTVQEDGGDIVFMGY--EGGVVKLKMQGSCSSCPSSIVTLKNGVQNMLQFYIPEVESV 247
>gi|6760408|gb|AAF28338.1|AF213379_1 r10h10-like protein TO42 [Drosophila melanogaster] >gi|6554171|gb|AAF16622.1| TO42 [Drosophila melanogaster] (286 aa)
Score = 103, Expect = 2.6e-03, Identities = 26/67 (38%), Positives = 42/67 (62%)
  Q:    13 IKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           IK+++D+ IR  + +DGGD+ F+ Y  E G V +K+ G C  C    VT K G++ +L+  +  V+SV
  S:   185 IKELLDTRIRPTVQEDGGDIVFMGY--EGGVVKLKMQGSCSSCPSSIVTLKNGVQNMLQFYIPEVESV 250
>gi|45387881|ref|NP_991300.1| HIRA interacting protein 5 [Danio rerio] >gi|37681825|gb|AAQ97790.1| HIRA interacting protein 5 [Danio rerio] >gi|62205090|gb|AAH92670.1| HIRA interacting protein 5 [Danio rerio] >gi|182891738|gb|AAI65097.1| Hirip5 protein [synthetic construct] (243 aa)
Score = 103, Expect = 2.7e-03, Identities = 26/75 (34%), Positives = 48/75 (64%)
  Q:     5 NTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILK---NEVEGVKSV 79
           + ++++  IK+++D+ IR  + +DGGD+ +  +  E G V +K+ G C  C    +T K G++ +L+    EVEGV+ V
  S:   159 DDDEVVAMIKELLDTRIRPTVQEDGGDVLYHGF--EDGIVKLKLQGSCTSCPSSIITLKNGIQNMLQFYVPEVEGVEQV 235
>gi|170016007|ref|NP_001116180.1| hypothetical protein LOC100000309 [Danio rerio] >gi|169158109|emb|CAQ14737.1| HIRA interacting protein 5 [Danio rerio] (243 aa)
Score = 103, Expect = 2.9e-03, Identities = 26/75 (34%), Positives = 48/75 (64%)
  Q:     5 NTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILK---NEVEGVKSV 79
           + ++++  IK+++D+ IR  + +DGGD+ +  +  E G V +K+ G C  C    +T K G++ +L+    EVEGV+ V
  S:   159 DDDEVVAMIKELLDTRIRPTVQEDGGDVLYHGF--EDGIVKLKLQGSCTSCPSSIITLKNGIQNMLQFYVPEVEGVEQV 235
>gi|146326964|gb|AAI41716.1| Lpd-8 protein [Xenopus laevis] (250 aa)
Score = 103, Expect = 2.9e-03, Identities = 25/73 (34%), Positives = 47/73 (64%)
  Q:     7 NKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILK---NEVEGVKSV 79
           ++++  IK+++D+ IR  + +DGGD+ +  +  + G V +K+ G C  C    +T K G++ +L+    EVEGV+ V
  S:   163 DEVVAMIKELLDTRIRPTVQEDGGDVLYKGF--QDGIVQLKLQGSCTSCPSSIITLKSGIQNMLQFYIPEVEGVEQV 237
>gi|83815451|ref|YP_444955.1| hypothetical protein SRU_0820 [Salinibacter ruber DSM 13855] >gi|83756845|gb|ABC44958.1| conserved domain protein [Salinibacter ruber DSM 13855] (101 aa)
Score = 103, Expect = 2.9e-03, Identities = 23/69 (33%), Positives = 39/69 (56%)
  Q:    11 DEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           D I++ +D+IR Y+  DGG +  ++   +   V +++LG C  C +  +T + G+E  LK  V  VK V
  S:    25 DNIEEALDTIRPYLMADGGSVRLLNVTADY-VVELELLGACGSCPMSTMTLRAGIEQALKRSVPKVKRV 92
>gi|87199010|ref|YP_496267.1| nitrogen-fixing NifU-like [Novosphingobium aromaticivorans DSM 12444] >gi|87134691|gb|ABD25433.1| nitrogen-fixing NifU-like protein [Novosphingobium aromaticivorans DSM 12444] (195 aa)
Score = 103, Expect = 3.0e-03, Identities = 25/68 (36%), Positives = 41/68 (60%)
  Q:    12 EIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           +IKD+I++ +R  +  DGGD+ +  +   +G V +K+ G C GC     T K G+E++LK+ V  V  V
  S:   126 QIKDLIETRVRPAVANDGGDIIYRGF--REGVVYLKMQGACSGCPSSTATLKNGIESLLKHYVPEVSEV 192
>gi|167520450|ref|XP_001744564.1| predicted protein [Monosiga brevicollis MX1] >gi|163776895|gb|EDQ90513.1| predicted protein [Monosiga brevicollis MX1] (209 aa)
Score = 103, Expect = 3.0e-03, Identities = 30/82 (36%), Positives = 49/82 (59%)
  Q:     2 LDNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKN---EVEGVKSVIVTE 83
           +  + ++I+  IK+++DS IR  + +DGGD+ F  +    G V +++ G C GC     T K G+E +L +   EVEGV+ V   E
  S:   105 VSEDDDEIVAMIKELLDSRIRPAVQEDGGDILFQGF--VDGIVQLRLSGACTGCPSSIFTLKNGVENMLMHYIPEVEGVEQVFDEE 188
>gi|114108171|gb|AAI23134.1| Lpd-8 protein [Xenopus laevis] (249 aa)
Score = 103, Expect = 3.1e-03, Identities = 25/73 (34%), Positives = 47/73 (64%)
  Q:     7 NKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILK---NEVEGVKSV 79
           ++++  IK+++D+ IR  + +DGGD+ +  +  + G V +K+ G C  C    +T K G++ +L+    EVEGV+ V
  S:   162 DEVVAMIKELLDTRIRPTVQEDGGDVLYKGF--QDGIVQLKLQGSCTSCPSSIITLKSGIQNMLQFYIPEVEGVEQV 236
>gi|163757734|ref|ZP_02164823.1| hypothetical protein HPDFL43_20027 [Hoeflea phototrophica DFL-43] >gi|162285236|gb|EDQ35518.1| hypothetical protein HPDFL43_20027 [Hoeflea phototrophica DFL-43] (187 aa)
Score = 102, Expect = 3.2e-03, Identities = 24/71 (33%), Positives = 42/71 (59%)
  Q:     9 IIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           I+  IK++++S +R  + QDGGD+ F  +    G+V + + G C GC     T K G++ +L++ V  V+ V
  S:   115 IVATIKELLESRVRPAVAQDGGDITFRGF--RDGKVFLHMKGACAGCPSSTATLKHGIQNLLRHFVPEVREV 184
>gi|83855636|ref|ZP_00949165.1| NifU-like domain protein [Croceibacter atlanticus HTCC2559] >gi|83849436|gb|EAP87304.1| NifU-like domain protein [Croceibacter atlanticus HTCC2559] (305 aa)
Score = 102, Expect = 3.3e-03, Identities = 25/72 (34%), Positives = 42/72 (58%)
  Q:     4 NNTNKIIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEG 75
           ++T+K I EI D  + I+  +  DGG++ F  Y+ E   V + + G C GC    +T K G+ET+L++ + G
  S:   226 DDTSKAIVEILD--EYIKPAVASDGGNIMFDSYDEETKSVKVILQGACSGCPSSTMTLKNGIETMLRDMLNG 295
>gi|114577879|ref|XP_001137508.1| PREDICTED: hypothetical protein isoform 6 [Pan troglodytes] (235 aa)
Score = 102, Expect = 3.4e-03, Identities = 27/77 (35%), Positives = 49/77 (63%)
  Q:     7 NKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILK---NEVEGVKSVIVTE 83
           ++++  IK+++D+ IR  + +DGGD+ +  +  E G V +K+ G C  C    +T K G++ +L+    EVEGV+ V+  E
  S:   148 DEVVAMIKELLDTRIRPTVQEDGGDVIYKGF--EDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQFYIPEVEGVEQVMDDE 226
>gi|121601928|ref|YP_989428.1| NifU family protein [Bartonella bacilliformis KC583] >gi|120614105|gb|ABM44706.1| NifU family protein [Bartonella bacilliformis KC583] (192 aa)
Score = 102, Expect = 3.6e-03, Identities = 26/77 (33%), Positives = 45/77 (58%)
  Q:     3 DNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKN---EVEGVKSV 79
           D     I+  IK+++++ +R  +  DGGD+ F  +  E G V + + G C GC     T K G+E +L++   EV GV+++
  S:   112 DEKDADIVSTIKELLETRVRPAVANDGGDITFRGF--EHGIVYLNMRGACAGCPSSTATLKHGIENLLRHFIPEVVGVEAM 190
>gi|114577889|ref|XP_001137105.1| PREDICTED: similar to HIRA interacting protein 5 isoform 1 [Pan troglodytes] (240 aa)
Score = 102, Expect = 3.7e-03, Identities = 25/71 (35%), Positives = 46/71 (64%)
  Q:     7 NKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILK---NEVEGVK 77
           ++++  IK+++D+ IR  + +DGGD+ +  +  E G V +K+ G C  C    +T K G++ +L+    EVEGV+
  S:   167 DEVVAMIKELLDTRIRPTVQEDGGDVIYKGF--EDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQFYIPEVEGVE 239
>gi|91216703|ref|ZP_01253668.1| nifU related protein [Psychroflexus torquis ATCC 700755] >gi|91185172|gb|EAS71550.1| nifU related protein [Psychroflexus torquis ATCC 700755] (302 aa)
Score = 102, Expect = 3.7e-03, Identities = 23/72 (31%), Positives = 42/72 (58%)
  Q:     4 NNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEG 75
           +N + I  EI  +++  ++  +  DGG++ F  YN E  +V + + G C GC    +T K G+E++LK  ++G
  S:   220 SNLDDISKEIVQILEEYVKPAVASDGGNIMFKSYNAESKDVQVILQGACSGCPSSTITLKNGIESMLKEMLQG 292
>gi|152993863|ref|YP_001359584.1| hypothetical protein SUN_2287 [Sulfurovum sp. NBC37-1] >gi|151425724|dbj|BAF73227.1| conserved hypothetical protein [Sulfurovum sp. NBC37-1] (92 aa)
Score = 102, Expect = 3.8e-03, Identities = 25/58 (43%), Positives = 35/58 (60%)
  Q:    13 IKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILK 70
           +KDVI+ +R  I  DGGD+E VD   + G V +++ G C+GC     T K G+E  LK
  S:    13 VKDVIEKVRPSIKLDGGDIELVDI--KDGVVYVQLQGACVGCGSAGTTIKFGVERQLK 68
>gi|126304005|ref|XP_001381686.1| PREDICTED: similar to iron-sulfur cluster scaffold protein Nfu [Monodelphis domestica] (235 aa)
Score = 102, Expect = 4.1e-03, Identities = 27/77 (35%), Positives = 49/77 (63%)
  Q:     7 NKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILK---NEVEGVKSVIVTE 83
           ++++  IK+++D+ IR  + +DGGD+ +  +  E G V +K+ G C  C    +T K G++ +L+    EVEGV+ V+  E
  S:   148 DEVVAMIKELLDTRIRPTVQEDGGDVIYKGF--EDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQFYIPEVEGVEQVVDDE 226
>gi|90421987|ref|YP_530357.1| nitrogen-fixing NifU-like [Rhodopseudomonas palustris BisB18] >gi|90104001|gb|ABD86038.1| nitrogen-fixing NifU-like [Rhodopseudomonas palustris BisB18] (188 aa)
Score = 101, Expect = 4.1e-03, Identities = 26/78 (33%), Positives = 43/78 (55%)
  Q:     2 LDNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
            D    + +D IKD+I++ +R  +  DGGD+ F  +  + G V +K+ G C GC     T + G++ +LK+ V  V  V
  S:   109 FDKADAETVDMIKDLIETRVRPAVANDGGDITFRGF--KDGIVYLKMQGACSGCPSSTATLQHGIQNLLKHFVPAVVEV 185
>gi|171325445|ref|ZP_02913949.1| nitrogen-fixing NifU domain protein [Geobacillus sp. WCH70] >gi|171088583|gb|EDT34930.1| nitrogen-fixing NifU domain protein [Geobacillus sp. WCH70] (78 aa)
Score = 101, Expect = 4.1e-03, Identities = 22/62 (35%), Positives = 39/62 (62%)
  Q:     8 KIIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETIL 69
           +I +++++V+D +R ++ +DGGD E +D   E G V +++LG C  C    +T K G+E  L
  S:     5 EIKEQVQEVLDKLRPFLLRDGGDCELIDV--EDGVVKLRLLGACGSCPSSTITLKAGIERAL 64
>gi|172058330|ref|YP_001814790.1| NifU domain-containing protein [Exiguobacterium sibiricum 255-15] >gi|171990851|gb|ACB61773.1| nitrogen-fixing NifU domain protein [Exiguobacterium sibiricum 255-15] (75 aa)
Score = 101, Expect = 4.1e-03, Identities = 21/62 (33%), Positives = 39/62 (62%)
  Q:     8 KIIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETIL 69
           ++ D++ +V++ +R ++ +DGGD+E VD   E G V ++++G C  C    +T K G+E  L
  S:     2 EMFDQVNEVLEKLRPFLLRDGGDVELVDV--EDGIVKLRLMGACGSCPSSTITLKAGIERAL 61
>gi|150025719|ref|YP_001296545.1| NifU-like protein [Flavobacterium psychrophilum JIP02/86] >gi|149772260|emb|CAL43736.1| NifU-like protein [Flavobacterium psychrophilum JIP02/86] (79 aa)
Score = 101, Expect = 4.3e-03, Identities = 21/68 (30%), Positives = 40/68 (58%)
  Q:    13 IKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           ++  ++ IR ++N DGGD+E V     K  V +++ G C  CS+  +T + G+ET +K     +++V+
  S:    10 VEKALEEIRPFLNSDGGDIELVSIEDSK-HVKVRLQGACNSCSVSQMTMRAGVETTIKKYAPQIETVV 76
>gi|15887702|ref|NP_353383.1| hypothetical protein Atu0351 [Agrobacterium tumefaciens str. C58] >gi|15155261|gb|AAK86168.1| conserved hypothetical protein [Agrobacterium tumefaciens str. C58] (187 aa)
Score = 101, Expect = 4.3e-03, Identities = 24/71 (33%), Positives = 41/71 (57%)
  Q:     9 IIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           I+  IK+++D+ +R  + QDGGD+ F  +    G V + + G C GC     T K G++ +L++ V  V+ V
  S:   115 IVATIKELLDTRVRPAVAQDGGDITFRGF--RDGTVFLNMKGACSGCPSSTATLKHGVQNLLRHFVPEVREV 184
>gi|170084143|ref|XP_001873295.1| predicted protein [Laccaria bicolor S238N-H82] >gi|164650847|gb|EDR15087.1| predicted protein [Laccaria bicolor S238N-H82] (212 aa)
Score = 101, Expect = 4.5e-03, Identities = 31/83 (37%), Positives = 54/83 (65%)
  Q:     1 MLDNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGE-VTIKILGECIGCSLIDVTYKEGLETILKN---EVEGVKSVIVTE 83
           +LD ++ + +  IK+++++ +R  I +DGGD+EF  ++ E    V +K+ G C GC    VT K G+E +L +   EV+GV+ V+  E
  S:   109 ILDTDS-ETVAMIKELLETRVRPAIMEDGGDIEFRGFDEEGDRLVKVKLKGSCRGCDSSTVTLKSGIERMLMHYVPEVKGVEQVLDQE 195
>gi|150387401|ref|ZP_01925765.1| nitrogen-fixing NifU domain protein [Victivallis vadensis ATCC BAA-548] >gi|150256128|gb|EDM93772.1| nitrogen-fixing NifU domain protein [Victivallis vadensis ATCC BAA-548] (76 aa)
Score = 101, Expect = 4.6e-03, Identities = 25/68 (36%), Positives = 41/68 (60%)
  Q:     7 NKIIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVE 74
           +++  +I + ++S+R ++  DGGDLE V    E   V +K+ G C GC    +T K GLE IL+ E++
  S:     2 DELTKKITERLESLRVHLQADGGDLEIVAI--EGKTVKLKLQGACGGCPHAAMTIKGGLERILREEID 67
>gi|51892183|ref|YP_074874.1| NifU-like nitrogen fixation protein [Symbiobacterium thermophilum IAM 14863] >gi|51855872|dbj|BAD40030.1| NifU-like nitrogen fixation protein [Symbiobacterium thermophilum IAM 14863] (77 aa)
Score = 101, Expect = 4.7e-03, Identities = 22/71 (30%), Positives = 41/71 (57%)
  Q:     9 IIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           + + ++  +D IR  I  DGG++E V    E G   I+++G C GC +  +T K G+E  ++ +V  +++V
  S:     6 LFERVERALDLIRPAIRMDGGEVELVAV--EDGVARIRMVGACGGCPMSTMTLKMGIERAVRQQVPEIRAV 74
>gi|196480059|gb|ACG79587.1| thioredoxin-like domain protein [Phenylobacterium zucineum HLK1] (233 aa)
Score = 101, Expect = 4.8e-03, Identities = 25/77 (32%), Positives = 43/77 (55%)
  Q:     3 DNNTNKIIDEIKDVID-SIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           D   +++  EI+ V+   +R  + +DGGD+ F  + P+ G + I++ G C GC    +T K G+E I++  V  V  V
  S:   104 DPEESQVEGEIRQVLGLYVRPGVARDGGDVLFDRFEPDTGVLWIRMQGACGGCPSSRLTLKAGIEQIVRRYVPEVLRV 181
>gi|167729990|emb|CAO80902.1| NifU-like domain protein [Candidatus Cloacamonas acidaminovorans] (75 aa)
Score = 101, Expect = 4.9e-03, Identities = 23/70 (32%), Positives = 42/70 (60%)
  Q:    11 DEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           ++I+ ++  +R  I  DGGD+E ++   E   + +++ G C GC +  +T K G+E ++K E+  VK VI
  S:     5 EKIESILAKVRPSIQADGGDVELINIR-EDNVIEVRLKGTCNGCPMATLTLKAGIERLIKEEIPEVKEVI 73
>gi|167218224|ref|ZP_02287860.1| NifU family protein [Listeria monocytogenes FSL J1-175] (100 aa)
Score = 101, Expect = 4.9e-03, Identities = 24/70 (34%), Positives = 39/70 (55%)
  Q:    12 EIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVIV 81
           E+   +   R ++ +DGGD E ++   + G V IK+LG C  C   D+T K G+E  L  ++ G K V++
  S:     8 EVDKALKKFRPFLVRDGGDYELIEVT-QDGVVKIKLLGACETCPSSDMTLKMGIELTLAEKIIGFKEVVL 76
>gi|42520881|ref|NP_966796.1| NifU domain-containing protein [Wolbachia endosymbiont of Drosophila melanogaster] >gi|42410621|gb|AAS14730.1| NifU domain protein [Wolbachia endosymbiont of Drosophila melanogaster] (191 aa)
Score = 101, Expect = 5.0e-03, Identities = 25/81 (30%), Positives = 48/81 (59%)
  Q:     2 LDNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVIVT 82
            D N  +I++ IK++++S I+  + QDGGD++F  Y  + G V +++ G C GC    +T K+G++ +L   +  +  +  T
  S:   111 FDKNDIEIVNRIKELMESHIKPAVAQDGGDIKFRGY--KDGIVYVELQGACSGCPSAAITLKQGVQNMLSYHIPEIAGIETT 190
>gi|58697437|ref|ZP_00372735.1| NifU domain protein [Wolbachia endosymbiont of Drosophila simulans] >gi|58536136|gb|EAL59746.1| NifU domain protein [Wolbachia endosymbiont of Drosophila simulans] (190 aa)
Score = 101, Expect = 5.1e-03, Identities = 25/81 (30%), Positives = 48/81 (59%)
  Q:     2 LDNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVIVT 82
            D N  +I++ IK++++S I+  + QDGGD++F  Y  + G V +++ G C GC    +T K+G++ +L   +  +  +  T
  S:   110 FDKNDIEIVNRIKELMESYIKPAVAQDGGDIKFRGY--KDGIVYVELQGACSGCPSAAITLKQGVQNMLSYHIPEIAGIETT 189
>gi|157167461|ref|XP_001654807.1| hypothetical protein AaeL_AAEL002148 [Aedes aegypti] >gi|108882432|gb|EAT46657.1| conserved hypothetical protein [Aedes aegypti] (263 aa)
Score = 101, Expect = 5.2e-03, Identities = 25/78 (32%), Positives = 47/78 (60%)
  Q:     2 LDNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           ++ + ++ +  IK+++DS IR  + +DGGD+ F+ +  E G V +K+ G C  C    VT K G++ +L+  +  V +V
  S:   159 INEDDDETVQMIKELLDSKIRPTVQEDGGDIIFMAF--EDGVVKLKMQGSCSSCPSSIVTLKNGVQNMLQFYIPEVVAV 235
>gi|51473845|ref|YP_067602.1| hypothetical protein RT0659 [Rickettsia typhi str. Wilmington] >gi|51460157|gb|AAU04120.1| conserved hypothetical protein [Rickettsia typhi str. Wilmington] (190 aa)
Score = 101, Expect = 5.3e-03, Identities = 26/83 (31%), Positives = 46/83 (55%)
  Q:     1 MLDNNTNKIIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVIVTE 83
           ML     +II+ I+     +R ++ QDGGD+ +  +  E G V + + G C+GC    +T K G+E++L++ +  V+ V   E
  S:   109 MLSEIEKQIIETIET---RVRPFVTQDGGDIIYKGF--ESGVVKLALRGACLGCPSSTITLKNGIESMLRHFIPEVQEVQAVE 186
>gi|187601282|ref|ZP_02987511.1| Rieske (2Fe-2S) domain protein [Chloroflexus sp. Y-400-fl] >gi|187486509|gb|EDU24481.1| Rieske (2Fe-2S) domain protein [Chloroflexus sp. Y-400-fl] (285 aa)
Score = 100, Expect = 5.6e-03, Identities = 23/64 (35%), Positives = 34/64 (53%)
  Q:    10 IDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEV 73
           I   + V+DS R Y+   GGD E +D     G   +++ G C GCSL   T ++ +E +L  EV
  S:    92 ITRARRVLDSARPYMQSHGGDAELIDV--RDGVAYLRLHGSCNGCSLSAFTLRKHVEEVLLREV 153
>gi|88608783|ref|YP_506689.1| NifU-like domain-containing protein [Neorickettsia sennetsu str. Miyayama] >gi|88600952|gb|ABD46420.1| NifU-like domain protein [Neorickettsia sennetsu str. Miyayama] (180 aa)
Score = 100, Expect = 5.6e-03, Identities = 25/74 (33%), Positives = 47/74 (63%)
  Q:     6 TNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           T+++  +I+++ID+ +R  + +DGG++ F  Y  + G V +K+ G C GC    VT K+G+E +L+  +  V+ V
  S:   105 TDEVSKKIQEIIDTKVRPSVIEDGGNIVFKGY--KDGIVYLKLQGACAGCPSASVTLKDGIENLLQYYIPEVREV 177
>gi|163848313|ref|YP_001636357.1| Rieske (2Fe-2S) domain-containing protein [Chloroflexus aurantiacus J-10-fl] >gi|163669602|gb|ABY35968.1| Rieske (2Fe-2S) domain protein [Chloroflexus aurantiacus J-10-fl] (293 aa)
Score = 100, Expect = 5.6e-03, Identities = 23/64 (35%), Positives = 34/64 (53%)
  Q:    10 IDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEV 73
           I   + V+DS R Y+   GGD E +D     G   +++ G C GCSL   T ++ +E +L  EV
  S:   100 ITRARRVLDSARPYMQSHGGDAELIDV--RDGVAYLRLHGSCNGCSLSAFTLRKHVEEVLLREV 161
>gi|124009117|ref|ZP_01693800.1| conserved domain protein [Microscilla marina ATCC 23134] >gi|123985331|gb|EAY25251.1| conserved domain protein [Microscilla marina ATCC 23134] (84 aa)
Score = 100, Expect = 5.6e-03, Identities = 22/76 (28%), Positives = 46/76 (60%)
  Q:     4 NNTNKIIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           + T  +I+ + + +D+IR Y+  DGGD++ ++ + E G V ++++G C  C +  +T K G+E  ++  V  + +V
  S:     2 DTTIDMIERVDNALDTIRPYLKTDGGDVKVLEVS-EDGVVKLELMGSCGSCPMSAMTLKAGIEESIRKAVPEITAV 76
>gi|189485737|ref|YP_001956678.1| conserved hypothetical protein [uncultured Termite group 1 bacterium phylotype Rs-D17] >gi|170287696|dbj|BAG14217.1| conserved hypothetical protein [uncultured Termite group 1 bacterium phylotype Rs-D17] (75 aa)
Score = 100, Expect = 5.7e-03, Identities = 22/69 (31%), Positives = 41/69 (59%)
  Q:    11 DEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           ++++  ++S+R ++  D GD+E +D + E G V +K+ G C GC +  +T + G+   +K  V  VK V
  S:     5 EKVEKALESVRPHLQADCGDVELIDVS-EDGIVKVKLTGSCGGCPMAAMTLQYGVTNTIKQAVPEVKDV 72
>gi|114706882|ref|ZP_01439782.1| nitrogen fixation protein [Fulvimarina pelagi HTCC2506] >gi|114537830|gb|EAU40954.1| nitrogen fixation protein [Fulvimarina pelagi HTCC2506] (187 aa)
Score = 100, Expect = 5.8e-03, Identities = 25/78 (32%), Positives = 42/78 (53%)
  Q:     2 LDNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
            D    + +  IK++I++ +R  + QDGGD+ F  Y    G V + + G C GC     T K G++ +L++ V  V+ V
  S:   108 FDEGDKETVATIKELIETRVRPAVAQDGGDITFRGY--RDGIVYLNMRGACSGCPSSTATLKHGIQNLLRHFVPEVEEV 184
>gi|145955730|ref|ZP_01804731.1| hypothetical protein CdifQ_04000936 [Clostridium difficile QCD-32g58] (95 aa)
Score = 100, Expect = 5.8e-03, Identities = 24/63 (38%), Positives = 38/63 (60%)
  Q:    18 DSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           + I+  + +DGGD+E +D N E G V +++ G C GC    +T K  +E +L +EV GV  V+
  S:    32 EKIKPVLQRDGGDVELIDVN-ENGVVLVRLQGACSGCPGATMTIKAIIENVLVSEVPGVTQVL 93
>gi|58699011|ref|ZP_00373859.1| NifU domain protein [Wolbachia endosymbiont of Drosophila ananassae] >gi|58534475|gb|EAL58626.1| NifU domain protein [Wolbachia endosymbiont of Drosophila ananassae] (194 aa)
Score = 100, Expect = 5.8e-03, Identities = 25/81 (30%), Positives = 48/81 (59%)
  Q:     2 LDNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVIVT 82
            D N  +I++ IK++++S I+  + QDGGD++F  Y  + G V +++ G C GC    +T K+G++ +L   +  +  +  T
  S:   114 FDKNDIEIVNRIKELMESYIKPAVAQDGGDIKFRGY--KDGIVYVELQGACSGCPSAAITLKQGVQNMLSYHIPEIAGIETT 193
>gi|154687334|ref|YP_001422495.1| YutI [Bacillus amyloliquefaciens FZB42] >gi|154353185|gb|ABS75264.1| YutI [Bacillus amyloliquefaciens FZB42] (86 aa)
Score = 100, Expect = 6.0e-03, Identities = 21/59 (35%), Positives = 38/59 (64%)
  Q:    11 DEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETIL 69
           +++++V+D +R ++ +DGGD E VD   ++G V +++LG C  C    +T K G+E  L
  S:    16 EQVQEVLDKLRPFLLRDGGDCELVDV--DEGIVKLRLLGACGSCPSSTITLKAGIERAL 72
>gi|16080275|ref|NP_391102.1| hypothetical protein BSU32220 [Bacillus subtilis subsp. subtilis str. 168] >gi|2635719|emb|CAB15212.1| yutI [Bacillus subtilis subsp. subtilis str. 168] (111 aa)
Score = 100, Expect = 6.0e-03, Identities = 21/59 (35%), Positives = 38/59 (64%)
  Q:    11 DEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETIL 69
           +++++V+D +R ++ +DGGD E VD   ++G V +++LG C  C    +T K G+E  L
  S:    41 EQVQEVLDKLRPFLLRDGGDCELVDV--DEGIVKLRLLGACGSCPSSTITLKAGIERAL 97
>gi|162147187|ref|YP_001601648.1| putative nitrogen fixation protein [Gluconacetobacter diazotrophicus PAl 5] >gi|187598680|ref|ZP_02984930.1| Scaffold protein Nfu/NifU [Gluconacetobacter diazotrophicus PAl 5] >gi|161785764|emb|CAP55335.1| putative nitrogen fixation protein [Gluconacetobacter diazotrophicus PAl 5] >gi|187489196|gb|EDU27147.1| Scaffold protein Nfu/NifU [Gluconacetobacter diazotrophicus PAl 5] (187 aa)
Score = 100, Expect = 6.5e-03, Identities = 26/72 (36%), Positives = 42/72 (58%)
  Q:     8 KIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           +I+ +IK+++D+ +R  +  DGGD+ F  Y    G V + + G C GC     T K G+E +L++ V  V SV
  S:   112 EIVRQIKELLDTRVRPAVAGDGGDIVFRGY--RDGVVRLTMQGACSGCPSSRATLKHGVENMLRHYVPEVVSV 182
>gi|66543732|ref|XP_395826.2| PREDICTED: similar to CG32857-PA [Apis mellifera] (275 aa)
Score = 100, Expect = 6.5e-03, Identities = 24/82 (29%), Positives = 50/82 (60%)
  Q:     2 LDNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVIVTE 83
           + ++ ++I+  IK+++D+ IR  + +DGGD+ F+ +  E+G V +K+ G C  C    +T K G++ +++  +  V  V+  E
  S:   169 ISDDDSEIVQMIKELLDTRIRPTVQEDGGDIVFMGF--EEGIVKLKMQGSCTSCPSSVITLKNGVQNMMQFYIPEVLGVVQVE 249
>gi|196003412|ref|XP_002111573.1| hypothetical protein TRIADDRAFT_55734 [Trichoplax adhaerens] >gi|190585472|gb|EDV25540.1| hypothetical protein TRIADDRAFT_55734 [Trichoplax adhaerens] (236 aa)
Score = 100, Expect = 6.7e-03, Identities = 27/77 (35%), Positives = 46/77 (59%)
  Q:     3 DNNTNKIIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILK---NEVEGVKSV 79
           D++T  +I E+ +    IR  + +DGGD+ ++ Y  + G V +K+ G C  C    VT K G++ +L+    EVEGV+ +
  S:   144 DSDTVAMIKELLET--RIRPTLQEDGGDIVYMGY--DNGIVKLKMQGACDSCPSATVTLKHGIQNMLQFYIPEVEGVEQI 219
>gi|117924033|ref|YP_864650.1| NifU domain-containing protein [Magnetococcus sp. MC-1] >gi|117607789|gb|ABK43244.1| nitrogen-fixing NifU domain protein [Magnetococcus sp. MC-1] (76 aa)
Score = 100, Expect = 7.0e-03, Identities = 25/69 (36%), Positives = 39/69 (56%)
  Q:    11 DEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           ++I  V+  IR  + +DGGD+EFVD   E   V +++ G C  C    +T K G+E ++K  +  V SV
  S:     3 EKILAVLAEIRPMLQRDGGDVEFVDLT-EDNVVQVRLRGACGSCPGAMMTLKGGIERLMKERIPEVHSV 70
>gi|146299086|ref|YP_001193677.1| NifU domain-containing protein [Flavobacterium johnsoniae UW101] >gi|146153504|gb|ABQ04358.1| nitrogen-fixing NifU domain protein [Flavobacterium johnsoniae UW101] (79 aa)
Score = 99, Expect = 7.0e-03, Identities = 22/75 (29%), Positives = 44/75 (58%)
  Q:     6 TNKIIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           T ++ + +   +D IR ++  DGGD+  +  + +K  V +++ G CI CS+  +T K G+ET +K     +++V+
  S:     3 TEELTNNVLLALDEIRPFLKSDGGDITLISIDDDK-HVKVRLEGACISCSVNQMTLKAGVETTIKKYAPQIETVV 76
>gi|88658493|ref|YP_507026.1| NifU domain-containing protein [Ehrlichia chaffeensis str. Arkansas] >gi|88599950|gb|ABD45419.1| NifU domain protein [Ehrlichia chaffeensis str. Arkansas] (186 aa)
Score = 99, Expect = 7.3e-03, Identities = 27/78 (34%), Positives = 50/78 (64%)
  Q:     2 LDNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILK---NEVEGVKSV 79
            D    +++ +IK++ID+ ++  + QDGGD++F  Y+   G V +K+ G C GC    +T KEG+  +L     +++GV+S+
  S:   106 FDEKDIEMVGKIKELIDNYVKPAVIQDGGDIKFKGYS--NGIVFVKLRGACSGCPSASITLKEGIYNMLSYYIPDIQGVESI 185
>gi|126646531|ref|ZP_01719048.1| nifU domain protein [Algoriphagus sp. PR1] >gi|126578163|gb|EAZ82383.1| nifU domain protein [Algoriphagus sp. PR1] (193 aa)
Score = 99, Expect = 7.3e-03, Identities = 26/79 (32%), Positives = 43/79 (54%)
  Q:     1 MLDNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           + D N ++ + +IK ++D  IR  + QDGG + F  ++   G V + + G C GC    VT K G++ +L   +  VK V
  S:   111 LFDENDSETVKKIKGILDEYIRPAVEQDGGAIVFHSFH--DGVVKVLLQGSCSGCPSSTVTLKAGIQNLLTRMLPEVKEV 188
>gi|189546089|ref|XP_001921803.1| PREDICTED: similar to NFU1 iron-sulfur cluster scaffold homolog (HIRA-interacting protein 5) (mHIRIP5) [Danio rerio] (454 aa)
Score = 99, Expect = 7.6e-03, Identities = 22/71 (30%), Positives = 42/71 (59%)
  Q:     9 IIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           I+  IK+++++ +R  + QDGGD+ F  +    G+V + + G C GC     T K G++ +L++ +  V+ V
  S:   115 IVKTIKELLETRVRPAVAQDGGDITFRGF--RDGKVFLNMKGSCAGCPSSTATLKHGVQNLLRHFIPEVQEV 184
>gi|146097555|ref|XP_001468136.1| hypothetical protein [Leishmania infantum] >gi|134072503|emb|CAM71216.1| hypothetical protein, conserved [Leishmania infantum] (448 aa)
Score = 99, Expect = 7.8e-03, Identities = 24/73 (32%), Positives = 44/73 (60%)
  Q:     7 NKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKN---EVEGVKSV 79
           ++++  IK+++ + IR  +  DGGDL FV ++P  G++ +++LG C  C     T  + +E   ++   EV  VK V
  S:   281 SEVVLMIKELVSTTIRPQLQDDGGDLRFVGFDPVLGDMHVELLGACRTCKSSKTTLVDLIERTTRHWIPEVSAVKDV 357
>gi|154343762|ref|XP_001567825.1| hypothetical protein LbrM33_V2.0550 [Leishmania braziliensis MHOM/BR/75/M2904] >gi|134065159|emb|CAM40585.1| hypothetical protein, conserved [Leishmania braziliensis] (431 aa)
Score = 99, Expect = 8.2e-03, Identities = 22/73 (30%), Positives = 44/73 (60%)
  Q:     7 NKIIDEIKDVI-DSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           ++I+  IK+++  +IR  + +DGGDL FV ++P  G++ +++LG C  C        + +E   ++ +  VK+V
  S:   264 SEIVLMIKELVATTIRPQLQEDGGDLRFVGFDPVLGDMRVELLGACRTCKNSKTALVDLIERTTRHWIPEVKAV 337
>gi|190571129|ref|YP_001975487.1| NifU domain protein [Wolbachia pipientis] >gi|190357401|emb|CAQ54835.1| NifU domain protein [Wolbachia pipientis] (190 aa)
Score = 99, Expect = 8.6e-03, Identities = 26/79 (32%), Positives = 52/79 (65%)
  Q:     2 LDNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILK---NEVEGVKSVI 80
            + N  +I++ IK++++S I+  + QDGGD++F  Y  + G V +++ G C GC    +T K+G++ +L     EV G+++++
  S:   110 FNENDIEIVNRIKELMESYIKPAVAQDGGDIKFRGY--KDGIVYVELQGACSGCPSAAITLKQGVQNMLSYHIPEVSGIETML 190
>gi|177675544|ref|ZP_02946023.1| Scaffold protein Nfu/NifU [Methylocella silvestris BL2] >gi|172069770|gb|EDT55878.1| Scaffold protein Nfu/NifU [Methylocella silvestris BL2] (187 aa)
Score = 99, Expect = 8.6e-03, Identities = 25/72 (34%), Positives = 41/72 (56%)
  Q:     8 KIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           + +  IK +I++ +R  +  DGGD++F  Y    G V + + G C GC     T K G++ +LK+ V  V+SV
  S:   114 ETVTAIKQLIETHVRPAVANDGGDIKFRGY--RDGIVYLAMKGSCSGCPSSTATLKHGIQNLLKHYVPDVQSV 184
>gi|26324295|dbj|BAC24985.1| unnamed protein product [Mus musculus] (200 aa)
Score = 99, Expect = 9.0e-03, Identities = 26/74 (35%), Positives = 48/74 (64%)
  Q:     7 NKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILK---NEVEGVKSVI 80
           ++++  IK+++D+ IR  + +DGGD+ +  +  E G V +K+ G C  C    +T K G++ +L+    EVEGV+ V+
  S:   112 DEVVAMIKELLDTRIRPTVQEDGGDVIYRGF--EDGIVRLKLQGSCTSCPSSIITLKSGIQNMLQFYIPEVEGVEQVM 187
>gi|165909938|gb|ABY73882.1| thioredoxin-like protein [Flammeovirga yaeyamensis] (233 aa)
Score = 99, Expect = 9.1e-03, Identities = 23/53 (43%), Positives = 34/53 (64%)
  Q:    28 GGDLEFVDY--NPEKG-EVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           GG+   V+   +PEKG    +K  G C GCS ID+T K+G+ET LK  +  + +V+
  S:   164 GGNCALVEVKEDPEKGLTAVLKFGGGCQGCSAIDITLKQGVETTLKQHIPELMNVV 219
>gi|118578775|ref|YP_900025.1| NifU domain-containing protein [Pelobacter propionicus DSM 2379] >gi|118501485|gb|ABK97967.1| nitrogen-fixing NifU domain protein [Pelobacter propionicus DSM 2379] (74 aa)
Score = 98, Expect = 9.2e-03, Identities = 21/70 (30%), Positives = 40/70 (57%)
  Q:    11 DEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           +++  V+  +R  +  DGGD+E V+   + G V +++ G C  C +  +T K G+E  +K ++  VK V+
  S:     3 EDVLRVLGQVRPALQADGGDVELVEVTAD-GIVKVRLKGACGSCPMSTMTLKMGIERAMKEQIPAVKEVV 71
>gi|189426530|ref|YP_001953707.1| nitrogen-fixing NifU domain protein [Geobacter lovleyi SZ] >gi|189422789|gb|ACD97187.1| nitrogen-fixing NifU domain protein [Geobacter lovleyi SZ] (74 aa)
Score = 98, Expect = 9.6e-03, Identities = 21/71 (29%), Positives = 43/71 (60%)
  Q:     9 IIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           +I++++ V+D +R  + +DGGD+E ++   + G V +K+ G C  C +  +T K G+E  +K ++  +  V
  S:     1 MIEKVQAVLDQVRPMLQRDGGDVELIEVTAD-GIVKVKLQGACGSCPMSTMTLKMGIEKAIKEQIPEIVEV 70
>gi|9910264|ref|NP_064429.1| histone cell cycle regulation defective interacting protein 5 [Mus musculus] >gi|22095757|sp|Q9QZ23|NFU1_MOUSE NFU1 iron-sulfur cluster scaffold homolog (HIRA-interacting protein 5) (mHIRIP5) >gi|6013069|emb|CAB57314.1| HIRA-interacting protein (HIRIP5) [Mus musculus] >gi|17390830|gb|AAH18355.1| NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) [Mus musculus] (199 aa)
Score = 98, Expect = 9.7e-03, Identities = 26/74 (35%), Positives = 48/74 (64%)
  Q:     7 NKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILK---NEVEGVKSVI 80
           ++++  IK+++D+ IR  + +DGGD+ +  +  E G V +K+ G C  C    +T K G++ +L+    EVEGV+ V+
  S:   111 DEVVAMIKELLDTRIRPTVQEDGGDVIYRGF--EDGIVRLKLQGSCTSCPSSIITLKSGIQNMLQFYIPEVEGVEQVM 186
>gi|46908571|ref|YP_014960.1| NifU family protein [Listeria monocytogenes str. 4b F2365] >gi|47092981|ref|ZP_00230761.1| NifU family protein [Listeria monocytogenes str. 4b H7858] >gi|153168478|ref|ZP_01928321.1| hypothetical protein LMHG_01343 [Listeria monocytogenes FSL N1-017] >gi|153203970|ref|ZP_01944836.1| hypothetical protein LMSG_01609 [Listeria monocytogenes HPB2262] >gi|167015508|ref|ZP_02278041.1| NifU family protein [Listeria monocytogenes FSL J1-194] >gi|167454869|ref|ZP_02321092.1| NifU family protein [Listeria monocytogenes FSL J2-064] >gi|168266653|ref|ZP_02688618.1| NifU family protein [Listeria monocytogenes FSL J2-071] >gi|46881843|gb|AAT05137.1| NifU family protein [Listeria monocytogenes str. 4b F2365] >gi|47018635|gb|EAL09388.1| NifU family protein [Listeria monocytogenes str. 4b H7858] >gi|133726249|gb|EBA27947.1| hypothetical protein LMHG_01343 [Listeria monocytogenes FSL N1-017] >gi|133734382|gb|EBA36080.1| hypothetical protein LMSG_01609 [Listeria monocytogenes HPB2262] (78 aa)
Score = 98, Expect = 9.7e-03, Identities = 24/69 (34%), Positives = 38/69 (55%)
  Q:    12 EIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           E+   +   R ++ +DGGD E ++   + G V IK+LG C  C   D+T K G+E  L  ++ G K V+
  S:     8 EVDKALKKFRPFLVRDGGDYELIEVT-QDGVVKIKLLGACETCPSSDMTLKMGIELTLAEKIIGFKEVV 75
>gi|88714028|ref|ZP_01108107.1| Nitrogen-fixing NifU-like protein [Flavobacteriales bacterium HTCC2170] >gi|88707679|gb|EAQ99920.1| Nitrogen-fixing NifU-like protein [Flavobacteriales bacterium HTCC2170] (79 aa)
Score = 98, Expect = 1.0e-02, Identities = 23/71 (32%), Positives = 41/71 (57%)
  Q:    13 IKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVIVTE 83
           ++  ++ IR ++  DGGD+E V  + +   V +K+ G C+GCS+  +T K G+E  +K     ++ VI  E
  S:    10 VEKALEEIRPFLQSDGGDIELVSIDNDS-SVKVKLQGACVGCSVNQMTLKSGVEMTIKKYAPQIEEVINIE 79
>gi|163753376|ref|ZP_02160500.1| nifU-like domain protein [Kordia algicida OT-1] >gi|161327108|gb|EDP98433.1| nifU-like domain protein [Kordia algicida OT-1] (79 aa)
Score = 98, Expect = 1.0e-02, Identities = 23/71 (32%), Positives = 41/71 (57%)
  Q:    13 IKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVIVTE 83
           ++  +D IR ++  DGGD++ V    +   V +++ G C+GCS+  +T K G+E  +K  V  ++ VI  E
  S:    10 VQKALDEIRPFLQSDGGDIKLVGIENDT-LVKVQLEGACVGCSVNQMTLKSGVEMTIKKHVPQIEKVISVE 79
>gi|22256812|sp|Q9UMS0|NFU1_HUMAN NFU1 iron-sulfur cluster scaffold homolog (HIRA-interacting protein 5) >gi|5738608|emb|CAB53015.1| HIRA-interacting protein HIRIP5 [Homo sapiens] >gi|62822279|gb|AAY14828.1| unknown [Homo sapiens] >gi|189054196|dbj|BAG36716.1| unnamed protein product [Homo sapiens] (196 aa)
Score = 98, Expect = 1.0e-02, Identities = 27/77 (35%), Positives = 49/77 (63%)
  Q:     7 NKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILK---NEVEGVKSVIVTE 83
           ++++  IK+++D+ IR  + +DGGD+ +  +  E G V +K+ G C  C    +T K G++ +L+    EVEGV+ V+  E
  S:   109 DEVVAMIKELLDTRIRPTVQEDGGDVIYKGF--EDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQFYIPEVEGVEQVMDDE 187
>gi|49474596|ref|YP_032638.1| hypothetical protein BQ10720 [Bartonella quintana str. Toulouse] >gi|49240100|emb|CAF26539.1| hypothetical protein [Bartonella quintana str. Toulouse] (192 aa)
Score = 98, Expect = 1.0e-02, Identities = 26/77 (33%), Positives = 45/77 (58%)
  Q:     3 DNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKN---EVEGVKSV 79
           D     I+  IK+++++ +R  +  DGGD+ F  +  E G V + + G C GC     T K G+E +L++   EV GV+++
  S:   112 DEKDVDIVSTIKELLETRVRPAVANDGGDITFCGF--ENGIVYLNMRGACAGCPSSTATLKTGIENLLRHFIPEVLGVEAM 190
>gi|110636788|ref|YP_676995.1| thioredoxin-related protein [Cytophaga hutchinsonii ATCC 33406] >gi|110279469|gb|ABG57655.1| thioredoxin-related protein [Cytophaga hutchinsonii ATCC 33406] (191 aa)
Score = 98, Expect = 1.0e-02, Identities = 27/73 (36%), Positives = 41/73 (56%)
  Q:     8 KIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           +++ +IK V+D  IR  + QDGG + F  +    G V +++ G C GC    VT K G+E +LK  V  V  V+
  S:   116 EVVTKIKVVLDEYIRPAVEQDGGAINFESF--VDGVVKVQLQGSCSGCPSSTVTLKSGIENLLKRMVPEVTEVV 187
>gi|70940575|ref|XP_740685.1| hypothetical protein PC401665.00.0 [Plasmodium chabaudi chabaudi] >gi|56518569|emb|CAH83895.1| hypothetical protein PC401665.00.0 [Plasmodium chabaudi] (191 aa)
Score = 98, Expect = 1.1e-02, Identities = 23/69 (33%), Positives = 45/69 (65%)
  Q:    11 DEIKDVIDSIRFYINQ--------DGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           +EI ++I SI+  I +        DGGD++FV ++ + G V +++ G C+GCS  +VT +  ++ +L   +  +K +
  S:   105 EEIMEIISSIKLLIEKRVRPIVVNDGGDIKFVCFDMDSGIVYVQLQGACVGCSQSEVTLQYMIKNMLTYYISEIKEI 181
>gi|169796823|ref|YP_001714616.1| putative membrane-bound protein in GNT I transport system (GntY) [Acinetobacter baumannii AYE] >gi|184157261|ref|YP_001845600.1| thioredoxin-like protein [Acinetobacter baumannii ACICU] >gi|169149750|emb|CAM87641.1| putative membrane-bound protein in GNT I transport system (GntY) [Acinetobacter baumannii] >gi|183208855|gb|ACC56253.1| Thioredoxin-like protein [Acinetobacter baumannii ACICU] >gi|193076708|gb|ABO11411.2| putative membrane-bound protein in GNT I transport system (GntY) [Acinetobacter baumannii ATCC 17978] (212 aa)
Score = 98, Expect = 1.1e-02, Identities = 23/53 (43%), Positives = 33/53 (62%)
  Q:    28 GGDLEFVDY--NPEKG-EVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           GG+   V+   +PE G    +K  G C GCS IDVT K+G+ET LK  +  ++ V+
  S:   143 GGNCSLVEVQDDPEHGLTAVLKFGGGCQGCSAIDVTLKQGVETTLKEHIPELQRVV 198
>gi|163868796|ref|YP_001610020.1| NifU-related protein [Bartonella tribocorum CIP 105476] >gi|161018467|emb|CAK02025.1| NifU-related protein [Bartonella tribocorum CIP 105476] (192 aa)
Score = 98, Expect = 1.2e-02, Identities = 27/77 (35%), Positives = 45/77 (58%)
  Q:     3 DNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKN---EVEGVKSV 79
           D     I+  IK+++++ IR  +  DGGD+ F  +  E G V + + G C GC     T K G+E +L++   EV GV+++
  S:   112 DEKDADIVLTIKELLETRIRPAVANDGGDITFRGF--ENGIVYLNMRGACAGCPSSTATLKHGIENLLRHFIPEVLGVEAM 190
>gi|4325122|gb|AAD17270.1| NifV [Frankia sp. EuIK1] (206 aa)
Score = 97, Expect = 1.2e-02, Identities = 23/68 (33%), Positives = 38/68 (55%)
  Q:    12 EIKDVIDSIRFYINQDGGDLEFV-----DYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           +++DVI  IR ++  DGGD++ V     +  P   EV I+++G C GCS    T    +E  +K  +  +  V
  S:   130 QVEDVIAEIRPFLQGDGGDVQLVTVLAGNGQPGTAEVHIRLVGACNGCSSASATVTAVIEKRIKESLPEIGRV 202
>gi|16804435|ref|NP_465920.1| hypothetical protein lmo2397 [Listeria monocytogenes EGD-e] >gi|47095874|ref|ZP_00233478.1| NifU family protein [Listeria monocytogenes str. 1/2a F6854] >gi|153175653|ref|ZP_01930957.1| hypothetical protein LMIG_01474 [Listeria monocytogenes FSL N3-165] >gi|153180497|ref|ZP_01933540.1| hypothetical protein LMMG_01902 [Listeria monocytogenes F6900] >gi|153186546|ref|ZP_01936802.1| hypothetical protein LMOG_02772 [Listeria monocytogenes J0161] >gi|153192055|ref|ZP_01939100.1| hypothetical protein LMPG_01179 [Listeria monocytogenes J2818] >gi|153197297|ref|ZP_01941567.1| hypothetical protein LMRG_01851 [Listeria monocytogenes 10403S] >gi|16411885|emb|CAD00475.1| lmo2397 [Listeria monocytogenes] >gi|47015751|gb|EAL06680.1| NifU family protein [Listeria monocytogenes str. 1/2a F6854] >gi|126941048|gb|EBA18946.1| hypothetical protein LMOG_02772 [Listeria monocytogenes J0161] >gi|127633348|gb|EBA22765.1| hypothetical protein LMRG_01851 [Listeria monocytogenes 10403S] >gi|127764383|gb|EBA24915.1| hypothetical protein LMPG_01179 [Listeria monocytogenes J2818] >gi|133729078|gb|EBA30776.1| hypothetical protein LMIG_01474 [Listeria monocytogenes FSL N3-165] >gi|133731890|gb|EBA33588.1| hypothetical protein LMMG_01902 [Listeria monocytogenes F6900] (78 aa)
Score = 97, Expect = 1.3e-02, Identities = 24/69 (34%), Positives = 38/69 (55%)
  Q:    12 EIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           E+   +   R ++ +DGGD E ++   + G V IK+LG C  C   D+T K G+E  L  ++ G K V+
  S:     8 EVDKALKKFRPFLVRDGGDYELIEVT-QDGIVKIKLLGACETCPSSDMTLKMGIELTLAEKIIGFKEVV 75
>gi|149280243|ref|ZP_01886366.1| thioredoxin-related protein [Pedobacter sp. BAL39] >gi|149229080|gb|EDM34476.1| thioredoxin-related protein [Pedobacter sp. BAL39] (183 aa)
Score = 97, Expect = 1.3e-02, Identities = 21/63 (33%), Positives = 37/63 (58%)
  Q:    18 DSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           D +R  + QDGG + +  +  ++G VT+++ G C GC    +T K G++ +L+  V  VK V+
  S:   119 DYVRPAVEQDGGAISYKSF--DEGVVTVELRGSCSGCPSSTITLKSGIQNLLQRMVPEVKEVV 179
>gi|58584670|ref|YP_198243.1| NifU family protein [Wolbachia endosymbiont strain TRS of Brugia malayi] >gi|58418986|gb|AAW71001.1| NifU family protein containing thioredoxin-like domain [Wolbachia endosymbiont strain TRS of Brugia malayi] (190 aa)
Score = 97, Expect = 1.3e-02, Identities = 26/79 (32%), Positives = 51/79 (64%)
  Q:     2 LDNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETIL---KNEVEGVKSVI 80
            D N  +I++ IK+++++ I+  + QDGGD++F  Y  + G V +++ G C GC    +T K+G++ +L     EV G+++ +
  S:   110 FDENDIEIVNRIKELMENYIKPAVAQDGGDIKFRGY--KDGIVYVELQGACSGCPSAAITLKQGVQNMLCYHIPEVSGIETTL 190
>gi|195559882|ref|XP_002077376.1| GD12677 [Drosophila simulans] >gi|194202482|gb|EDX16058.1| GD12677 [Drosophila simulans] (175 aa)
Score = 97, Expect = 1.4e-02, Identities = 26/67 (38%), Positives = 42/67 (62%)
  Q:    13 IKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           IK+++D+ IR  + +DGGD+ F+ Y  E G V +K+ G C  C    VT K G++ +L+  +  V+SV
  S:    74 IKELLDTRIRPTVQEDGGDIVFMGY--EAGVVKLKMQGSCSSCPSSIVTLKNGVQNMLQFYIPEVESV 139
>gi|126641029|ref|YP_001084013.1| putative membrane-bound protein in GNT I transport system (GntY) [Acinetobacter baumannii ATCC 17978] (156 aa)
Score = 97, Expect = 1.4e-02, Identities = 23/53 (43%), Positives = 33/53 (62%)
  Q:    28 GGDLEFVDY--NPEKG-EVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           GG+   V+   +PE G    +K  G C GCS IDVT K+G+ET LK  +  ++ V+
  S:    87 GGNCSLVEVQDDPEHGLTAVLKFGGGCQGCSAIDVTLKQGVETTLKEHIPELQRVV 142
>gi|158318602|ref|YP_001511110.1| iron-sulfur cluster assembly accessory protein [Frankia sp. EAN1pec] >gi|158114007|gb|ABW16204.1| iron-sulfur cluster assembly accessory protein [Frankia sp. EAN1pec] (206 aa)
Score = 97, Expect = 1.4e-02, Identities = 23/73 (31%), Positives = 41/73 (56%)
  Q:     7 NKIIDEIKDVIDSIRFYINQDGGDLEFV-----DYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           +++  +++DVI  IR ++  DGGD++ V     +  P   EV I+++G C GCS    T    +E  +K  +  +  V
  S:   125 DRLRGQVEDVIAEIRPFLQGDGGDVQLVTVLAGNGEPGTAEVHIRLVGACNGCSSASATVTAVIEKRIKESLPEIGRV 202
>gi|154245767|ref|YP_001416725.1| scaffold protein Nfu/NifU [Xanthobacter autotrophicus Py2] >gi|154159852|gb|ABS67068.1| Scaffold protein Nfu/NifU [Xanthobacter autotrophicus Py2] (186 aa)
Score = 97, Expect = 1.5e-02, Identities = 25/72 (34%), Positives = 41/72 (56%)
  Q:     8 KIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           +I+  IK+++D+ +R  +  DGGD+ F  +  + G V + + G C GC     T K G+E +LK+ V  V  V
  S:   113 EIVATIKELLDTRVRPAVANDGGDITFRGF--KDGIVFLNMKGSCSGCPSSTATLKNGIENLLKHFVPEVTEV 183
>gi|126698430|ref|YP_001087327.1| hypothetical protein CD0850 [Clostridium difficile 630] >gi|168694689|ref|ZP_02726966.1| hypothetical protein CdifQCD_04485 [Clostridium difficile QCD-37x79] >gi|168710910|ref|ZP_02743187.1| hypothetical protein CdifQCD-6_02596 [Clostridium difficile QCD-63q42] >gi|168726069|ref|ZP_02758346.1| hypothetical protein CdifQCD-7_16912 [Clostridium difficile QCD-76w55] >gi|168731732|ref|ZP_02764009.1| hypothetical protein CdifQCD-_10555 [Clostridium difficile QCD-97b34] >gi|196126267|ref|ZP_03118016.1| hypothetical protein CdifA_11854 [Clostridium difficile ATCC 43255] >gi|196160027|ref|ZP_03120588.1| hypothetical protein CdifC_05088 [Clostridium difficile CIP 107932] >gi|196162951|ref|ZP_03123482.1| hypothetical protein CdifQCD-2_01199 [Clostridium difficile QCD-23m63] >gi|115249867|emb|CAJ67684.1| conserved hypothetical protein [Clostridium difficile 630] (74 aa)
Score = 97, Expect = 1.6e-02, Identities = 24/63 (38%), Positives = 38/63 (60%)
  Q:    18 DSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           + I+  + +DGGD+E +D N E G V +++ G C GC    +T K  +E +L +EV GV  V+
  S:    11 EKIKPVLQRDGGDVELIDVN-ENGVVLVRLQGACSGCPGATMTIKAIIENVLVSEVPGVTQVL 72
>gi|157874760|ref|XP_001685794.1| hypothetical protein, conserved [Leishmania major] >gi|68128867|emb|CAJ06031.1| hypothetical protein, conserved [Leishmania major] (426 aa)
Score = 96, Expect = 1.6e-02, Identities = 23/73 (31%), Positives = 44/73 (60%)
  Q:     7 NKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKN---EVEGVKSV 79
           ++++  IK+++ + IR  +  DGGDL FV ++P  G++ +++LG C  C     T  + +E   ++   EV  V+ V
  S:   259 SEVVLMIKELVSTTIRPQLQDDGGDLRFVGFDPVLGDMHVELLGACRTCKSSKTTLVDLIERTTRHWIPEVSAVRDV 335
>gi|194334614|ref|YP_002016474.1| nitrogen-fixing NifU domain protein [Prosthecochloris aestuarii DSM 271] >gi|194312432|gb|ACF46827.1| nitrogen-fixing NifU domain protein [Prosthecochloris aestuarii DSM 271] (86 aa)
Score = 96, Expect = 1.6e-02, Identities = 21/75 (28%), Positives = 40/75 (53%)
  Q:     5 NTNKIIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           +T+ + D + + ++ +R Y+  DGGD + V    +   V +K+LG C  C +  +T + G+E  +K  +  V  V
  S:    10 DTDPLYDRVINALEDVRPYLQADGGDCQLVGITKDM-VVDVKLLGACGSCPMSTLTLRAGVEQAVKKAIPEVARV 83
>gi|163753913|ref|ZP_02161036.1| thioredoxin-related protein [Kordia algicida OT-1] >gi|161326127|gb|EDP97453.1| thioredoxin-related protein [Kordia algicida OT-1] (301 aa)
Score = 96, Expect = 1.7e-02, Identities = 26/79 (32%), Positives = 44/79 (55%)
  Q:     3 DNNTNKIIDEIKDVIDSIRFYIN----QDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVIV 81
           D +  ++ D  K++++ +  YI      DGG++ F  Y+P    V + + G C GC    +T K G+E  LKN ++G  S +V
  S:   215 DESFEELDDISKEIVNILEEYIKPAVASDGGNIMFDSYDPNSKIVKVVLQGACSGCPSSTMTLKSGIENTLKNLLKGQVSEVV 297
>gi|193215039|ref|YP_001996238.1| nitrogen-fixing NifU domain protein [Chloroherpeton thalassium ATCC 35110] >gi|193088516|gb|ACF13791.1| nitrogen-fixing NifU domain protein [Chloroherpeton thalassium ATCC 35110] (95 aa)
Score = 96, Expect = 1.7e-02, Identities = 22/73 (30%), Positives = 39/73 (53%)
  Q:     7 NKIIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           + I   + + ++SIR Y+  DGGD E V    E+  V ++++G C  C +  +T + G+E  +K  V  +  V
  S:    20 DPIYARVTEALNSIRPYLQADGGDCELVGITDEQ-VVDLRLVGACGSCPMSAMTLRAGVEQAIKRAVPEIVRV 91
>gi|61806099|ref|YP_214459.1| NifU-like protein [Prochlorococcus phage P-SSM2] >gi|61374608|gb|AAX44605.1| NifU-like protein [Cyanophage P-SSM2] (96 aa)
Score = 96, Expect = 1.7e-02, Identities = 20/65 (30%), Positives = 38/65 (58%)
  Q:    16 VIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           V++ +  Y+  DGG L+FV+   E G V +++ G C  C++  +T K+G+E  + +E+     V+
  S:    29 VLEELAPYVEADGGFLQFVEIEEETGYVKVRLGGACETCAMSAMTLKQGIEKKVMSEIPDCVGVV 93
>gi|57529447|ref|NP_001006305.1| HIRA interacting protein 5 [Gallus gallus] >gi|53136898|emb|CAG32778.1| hypothetical protein [Gallus gallus] (232 aa)
Score = 96, Expect = 1.8e-02, Identities = 25/71 (35%), Positives = 46/71 (64%)
  Q:     7 NKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILK---NEVEGVK 77
           ++++  IK+++D+ IR  + +DGGD+ +  +  E G V +K+ G C  C    +T K G++ +L+    EVEGV+
  S:   144 DEVVLMIKELLDTRIRPTVQEDGGDVIYKGF--EDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQFYIPEVEGVE 216
>gi|148284929|ref|YP_001249019.1| hypothetical protein OTBS_1710 [Orientia tsutsugamushi str. Boryong] >gi|189184851|ref|YP_001938636.1| thioredoxin-like protein [Orientia tsutsugamushi str. Ikeda] >gi|146740368|emb|CAM80805.1| conserved hypothetical protein [Orientia tsutsugamushi Boryong] >gi|189181622|dbj|BAG41402.1| thioredoxin-like protein [Orientia tsutsugamushi str. Ikeda] (182 aa)
Score = 96, Expect = 1.8e-02, Identities = 21/60 (35%), Positives = 37/60 (61%)
  Q:    20 IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           +R  +  DGGD+E+  +  + G V +++ G C+GC    +T K+G+E++LK  +  V SV
  S:   122 VRPAVAMDGGDIEYHSF--KDGIVKLQMRGACVGCPSSTMTLKQGIESLLKYYIPEVVSV 179
>gi|91200475|emb|CAJ73523.1| conserved hypothetical protein [Candidatus Kuenenia stuttgartiensis] (72 aa)
Score = 96, Expect = 1.9e-02, Identities = 25/69 (36%), Positives = 39/69 (56%)
  Q:    11 DEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           ++I++ +  IR  +  DGGD+E VDY  E G V +++ G C  C     T K G+E  LK  +  ++SV
  S:     3 EKIEEALKGIRPALQADGGDIELVDY--EDGIVKVRLKGACGSCPSSLATLKYGVEARLKEIIPEIESV 69
>gi|21430120|gb|AAM50738.1| GM32035p [Drosophila melanogaster] (104 aa)
Score = 96, Expect = 1.9e-02, Identities = 26/67 (38%), Positives = 42/67 (62%)
  Q:    13 IKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           IK+++D+ IR  + +DGGD+ F+ Y  E G V +K+ G C  C    VT K G++ +L+  +  V+SV
  S:     3 IKELLDTRIRPTVQEDGGDIVFMGY--EGGVVKLKMQGSCSSCPSSIVTLKNGVQNMLQFYIPEVESV 68
>gi|57233705|ref|YP_182326.1| NifU-like protein [Dehalococcoides ethenogenes 195] >gi|57224153|gb|AAW39210.1| NifU-like protein [Dehalococcoides ethenogenes 195] (72 aa)
Score = 96, Expect = 1.9e-02, Identities = 27/72 (37%), Positives = 45/72 (62%)
  Q:     9 IIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           ++++++ V+D IR  +  DGG++E V      G V +K++G C GC +  +T K G+E ILK E+  VK V+
  S:     1 MLEKVEAVLDKIRPALEADGGNVELV--EVVDGVVKVKLVGACAGCPMSTMTLKNGIEKILKREIPEVKEVV 70
>gi|27375911|ref|NP_767440.1| hypothetical protein bll0800 [Bradyrhizobium japonicum USDA 110] >gi|27349049|dbj|BAC46065.1| bll0800 [Bradyrhizobium japonicum USDA 110] (189 aa)
Score = 96, Expect = 1.9e-02, Identities = 24/70 (34%), Positives = 40/70 (57%)
  Q:    10 IDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           +D IKD+I++ +R  +  DGGD+ F  +  + G V + + G C GC     T + G++ +LK+ V  V  V
  S:   118 VDMIKDLIETRVRPAVANDGGDITFRGF--KDGIVYLNMKGACSGCPSSTATLQHGIQNLLKHFVPDVVEV 186
>gi|50084252|ref|YP_045762.1| putative membrane-bound protein in GNT I transport system (GntY) [Acinetobacter sp. ADP1] >gi|51701945|sp|Q6FDB8|NFUA_ACIAD Fe/S biogenesis protein nfuA >gi|49530228|emb|CAG67940.1| putative membrane-bound protein in GNT I transport system (GntY) [Acinetobacter sp. ADP1] (212 aa)
Score = 96, Expect = 2.0e-02, Identities = 22/53 (41%), Positives = 34/53 (64%)
  Q:    28 GGDLEFVDY--NPEKG-EVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           GG+   V+   +PE G    +K  G C GCS IDVT K+G+ET L+ ++  ++ V+
  S:   143 GGNCALVEVQDDPENGLTAVLKFGGGCQGCSAIDVTLKQGVETTLRQQIPELQRVV 198
>gi|49476032|ref|YP_034073.1| hypothetical protein BH13490 [Bartonella henselae str. Houston-1] >gi|49238840|emb|CAF28122.1| hypothetical protein [Bartonella henselae str. Houston-1] (192 aa)
Score = 96, Expect = 2.0e-02, Identities = 26/71 (36%), Positives = 44/71 (61%)
  Q:     9 IIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKN---EVEGVKSV 79
           I+  IK+++++ IR  +  DGGD+ F  +  E G V + + G C GC     T K G+E +L++   EV GV+++
  S:   118 IVLTIKELLETRIRPAVANDGGDITFRGF--ENGIVYLNMRGACAGCPSSTATLKHGIENLLRHFIPEVVGVEAM 190
>gi|193599106|ref|XP_001949519.1| PREDICTED: similar to AGAP000598-PA [Acyrthosiphon pisum] (254 aa)
Score = 96, Expect = 2.0e-02, Identities = 26/78 (33%), Positives = 46/78 (58%)
  Q:     2 LDNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           +  + N+ +  IK+++DS IR  + +DGGD+ F+ Y  + G V +K+ G C  C    VT K G++ +L+  +  V +V
  S:   148 IHEDDNETVMMIKELLDSRIRPTVQEDGGDILFIGY--DAGIVKLKLQGSCTSCPSSVVTLKGGVQYMLQFYIPEVIAV 224
>gi|169633930|ref|YP_001707666.1| putative membrane-bound protein in GNT I transport system (GntY) [Acinetobacter baumannii SDF] >gi|169152722|emb|CAP01733.1| putative membrane-bound protein in GNT I transport system (GntY) [Acinetobacter baumannii] (212 aa)
Score = 95, Expect = 2.0e-02, Identities = 23/53 (43%), Positives = 33/53 (62%)
  Q:    28 GGDLEFVDY--NPEKG-EVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           GG+   V+   +PE G    +K  G C GCS IDVT K+G+ET LK  +  ++ V+
  S:   143 GGNCSLVEVQDDPEHGLTAVLKFGGGCQGCSAIDVTLKQGVETTLKEHILELQRVV 198
>gi|118403546|ref|NP_001072356.1| HIRA interacting protein 5 [Xenopus tropicalis] >gi|111307911|gb|AAI21453.1| HIRA interacting protein 5 [Xenopus tropicalis] (199 aa)
Score = 95, Expect = 2.0e-02, Identities = 25/73 (34%), Positives = 47/73 (64%)
  Q:     7 NKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILK---NEVEGVKSV 79
           ++++  IK+++D+ IR  + +DGGD+ +  +  + G V +K+ G C  C    +T K G++ +L+    EVEGV+ V
  S:   110 DEVVAMIKELLDTRIRPTVQEDGGDVLYKGF--QDGIVQLKLQGSCTSCPSSIITLKSGIQNMLQFYIPEVEGVEQV 184
>gi|119357807|ref|YP_912451.1| NifU domain-containing protein [Chlorobium phaeobacteroides DSM 266] >gi|119355156|gb|ABL66027.1| nitrogen-fixing NifU domain protein [Chlorobium phaeobacteroides DSM 266] (86 aa)
Score = 95, Expect = 2.1e-02, Identities = 20/75 (26%), Positives = 41/75 (54%)
  Q:     5 NTNKIIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           N++ + D +   ++++R Y+  DGGD + V  + +   V +K+LG C  C +  +T + G+E  +K  +  +  V
  S:    10 NSDALYDRVIAALETVRPYLQVDGGDCQLVGISKDM-VVDVKLLGACGSCPMSTLTLRAGVEQAIKKAIPEIARV 83
>gi|189345962|ref|YP_001942491.1| nitrogen-fixing NifU domain protein [Chlorobium limicola DSM 245] >gi|189340109|gb|ACD89512.1| nitrogen-fixing NifU domain protein [Chlorobium limicola DSM 245] (86 aa)
Score = 95, Expect = 2.1e-02, Identities = 20/75 (26%), Positives = 40/75 (53%)
  Q:     5 NTNKIIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           N++ + D +   ++++R Y+  DGGD + V    +   V +K+LG C  C +  +T + G+E  +K  +  +  V
  S:    10 NSDALYDRVIAALETVRPYLQVDGGDCQLVGITKDM-VVDVKLLGACGSCPMSTITLRAGVEQAIKKAIPEIARV 83
>gi|165933598|ref|YP_001650387.1| mitochondrial-type Fe-S cluster assembly protein NFU [Rickettsia rickettsii str. Iowa] >gi|165908685|gb|ABY72981.1| mitochondrial-type Fe-S cluster assembly protein NFU [Rickettsia rickettsii str. Iowa] (190 aa)
Score = 95, Expect = 2.1e-02, Identities = 24/73 (32%), Positives = 46/73 (63%)
  Q:     7 NKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           ++I  +I ++I++ +R  + QDGGD+ +  +  E G V + + G C+GC    +T + G+E++LK+ V  V+ V
  S:   111 SEIEKQIVEIIETRVRPSVAQDGGDIIYKGF--ENGVVKLALRGACLGCPSSTITLRNGIESMLKHFVPEVQEV 182
>gi|126663010|ref|ZP_01734008.1| hypothetical protein FBBAL38_06650 [Flavobacteria bacterium BAL38] >gi|126624668|gb|EAZ95358.1| hypothetical protein FBBAL38_06650 [Flavobacteria bacterium BAL38] (79 aa)
Score = 95, Expect = 2.3e-02, Identities = 25/74 (33%), Positives = 44/74 (59%)
  Q:     6 TNKIIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           T +I + ++  ++ IR ++N DGGD+  V+   +K  V +++ G C  CSL   T K G+ET +K  V  +++V
  S:     3 TLEIKENVEKALNEIRPFLNSDGGDITLVEIIDDK-HVKVRLEGACTNCSLSISTMKAGVETTIKKFVPQIETV 75
>gi|157828872|ref|YP_001495114.1| hypothetical protein A1G_05615 [Rickettsia rickettsii str. 'Sheila Smith'] >gi|157801353|gb|ABV76606.1| hypothetical protein A1G_05615 [Rickettsia rickettsii str. 'Sheila Smith'] (190 aa)
Score = 95, Expect = 2.3e-02, Identities = 24/73 (32%), Positives = 46/73 (63%)
  Q:     7 NKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           ++I  +I ++I++ +R  + QDGGD+ +  +  E G V + + G C+GC    +T + G+E++LK+ V  V+ V
  S:   111 SEIEKQIVEIIETRVRPSVAQDGGDIIYKGF--ENGVVKLALRGACLGCPSSTITLRNGIESMLKHFVPEVQEV 182
>gi|88711025|ref|ZP_01105113.1| nifU related protein [Flavobacteriales bacterium HTCC2170] >gi|88709966|gb|EAR02198.1| nifU related protein [Flavobacteriales bacterium HTCC2170] (300 aa)
Score = 95, Expect = 2.4e-02, Identities = 22/70 (31%), Positives = 38/70 (54%)
  Q:     2 LDNNTNKIIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKN 71
           LD+ + +I+D +++ +      +  DGG++ F  Y  +   V + + G C GC     T K G+ET+LKN
  S:   220 LDDTSKQIVDILEEYVKPA---VASDGGNILFQSYEKDTKTVNVILQGACSGCPSSTFTLKNGIETMLKN 286
>gi|158426327|ref|YP_001527619.1| nitrogen-fixing protein [Azorhizobium caulinodans ORS 571] >gi|158333216|dbj|BAF90701.1| nitrogen-fixing protein [Azorhizobium caulinodans ORS 571] (186 aa)
Score = 95, Expect = 2.5e-02, Identities = 24/72 (33%), Positives = 41/72 (56%)
  Q:     8 KIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           +I+  IK++I++ +R  +  DGGD+ F  +   +G V + + G C GC     T K G+E +L++ V  V  V
  S:   113 EIVGTIKELIETRVRPAVAADGGDITFRGF--REGVVYLNMKGSCSGCPSSTATLKNGIENLLRHFVPEVNEV 183
>gi|150015239|ref|YP_001307493.1| NifU domain-containing protein [Clostridium beijerinckii NCIMB 8052] >gi|149901704|gb|ABR32537.1| nitrogen-fixing NifU domain protein [Clostridium beijerinckii NCIMB 8052] (73 aa)
Score = 95, Expect = 2.6e-02, Identities = 28/68 (41%), Positives = 39/68 (57%)
  Q:    13 IKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           I   +D IR  + +DGGD+E VD + + G V++K+ G C  C    +T K  +E  LK EV GV  VI
  S:     5 IMKSLDKIRPMLQRDGGDVELVDVSND-GVVSVKMQGACGNCPGAMMTIKMIIEQKLKEEVPGVTEVI 71
>gi|167215116|ref|ZP_02285423.1| NifU family protein [Listeria monocytogenes FSL R2-503] (74 aa)
Score = 94, Expect = 2.7e-02, Identities = 23/64 (35%), Positives = 36/64 (56%)
  Q:    17 IDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           +   R ++ +DGGD E ++   + G V IK+LG C  C   D+T K G+E  L  ++ G K V+
  S:     5 LKKFRPFLVRDGGDYELIEVT-QDGVVKIKLLGACETCPSSDMTLKMGIELTLAEKIIGFKEVV 67
>gi|118047748|ref|ZP_01516377.1| nitrogen-fixing NifU-like [Chloroflexus aggregans DSM 9485] >gi|117995735|gb|EAV09947.1| nitrogen-fixing NifU-like [Chloroflexus aggregans DSM 9485] (286 aa)
Score = 94, Expect = 2.8e-02, Identities = 25/74 (33%), Positives = 39/74 (52%)
  Q:    10 IDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEV-EGVKSVIVTE 83
           +   + V+D+ R Y+   GGD E VD     G   +++ G C GCSL   T ++ +E  L  EV E  +  +VT+
  S:    93 VTRARRVLDNARPYMQSHGGDAELVDV--RDGVAYVRLHGSCNGCSLSAFTLRKHVEEALLREVPEMTRLEVVTD 165
>gi|111226134|ref|YP_716928.1| hypothetical protein FRAAL6802 [Frankia alni ACN14a] >gi|111153666|emb|CAJ65425.1| Hypothetical protein in nifB-nifU intergenic region (ORF2) [Frankia alni ACN14a] (192 aa)
Score = 94, Expect = 2.8e-02, Identities = 22/72 (30%), Positives = 40/72 (55%)
  Q:     8 KIIDEIKDVIDSIRFYINQDGGDLEFVDY-----NPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           K+ ++++++++ IR  +  DGGD E V        P   EV +++ G C GCS  + T    +E  L+ E+  +  V
  S:   112 KLREQVEEIMEEIRPMLRGDGGDAEVVAVLAGGGQPGSAEVHLRLTGACGGCSSANATLTGVIEARLRQELPEIGRV 188
>gi|88804867|ref|ZP_01120387.1| hypothetical protein RB2501_08435 [Robiginitalea biformata HTCC2501] >gi|88785746|gb|EAR16915.1| hypothetical protein RB2501_08435 [Robiginitalea biformata HTCC2501] (79 aa)
Score = 94, Expect = 2.8e-02, Identities = 20/75 (26%), Positives = 42/75 (56%)
  Q:     6 TNKIIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           + ++  +I+  ++ IR ++  DGGD+  V    +   V +++ G C+GC++  +T K G+E  +K     ++ VI
  S:     3 SEELTSKIEAALEEIRPFLQSDGGDISLVGIE-DGTRVKVRLEGACVGCTVNQMTLKSGVEMTIKKHAPQIEQVI 76
>gi|110596893|ref|ZP_01385183.1| Nitrogen-fixing NifU-like [Chlorobium ferrooxidans DSM 13031] >gi|110341580|gb|EAT60040.1| Nitrogen-fixing NifU-like [Chlorobium ferrooxidans DSM 13031] (86 aa)
Score = 94, Expect = 2.9e-02, Identities = 24/75 (32%), Positives = 44/75 (58%)
  Q:     5 NTNKIIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKN---EVEGVKSV 79
           N++ I D +   ++++R Y+  DGGD + V  + +   V +K+LG C  C +  +T + G+E  +K    E+  V+SV
  S:    10 NSDAIYDRVIAALETVRPYLQVDGGDCQLVGISKDM-VVDVKLLGACGSCPMSTLTLRAGVEQAIKKANPEIVRVESV 86
>gi|86140721|ref|ZP_01059280.1| NifU-like domain protein [Flavobacterium sp. MED217] >gi|85832663|gb|EAQ51112.1| NifU-like domain protein [Leeuwenhoekiella blandensis MED217] (301 aa)
Score = 94, Expect = 3.0e-02, Identities = 22/64 (34%), Positives = 36/64 (56%)
  Q:    12 EIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEG 75
           EI ++I+  ++  +  DGG++ F  Y+PE   V + + G C GC     T K G+E +LK  + G
  S:   227 EIANIIEEYVKPAVASDGGNILFKHYDPESKNVKVILQGACSGCPSSTFTLKNGIENMLKEMLRG 291
>gi|1480126|emb|CAA68019.1| nifU [Pantoea agglomerans] (275 aa)
Score = 94, Expect = 3.1e-02, Identities = 21/53 (39%), Positives = 36/53 (67%)
  Q:     8 KIIDE----IKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVT 60
           K+ DE    +++V+ S+R +I  DGGD+  V  + +  EVT+++ G C GC + D+T
  S:   199 KVRDENWLAVEEVVASLRPHIRADGGDMSLVRVDGQ--EVTVELSGSCSGCMMTDMT 253
>gi|111035797|emb|CAL29424.1| NifU-related protein [Wolbachia endosymbiont of Onchocerca volvulus] (194 aa)
Score = 94, Expect = 3.2e-02, Identities = 22/68 (32%), Positives = 43/68 (63%)
  Q:     2 LDNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETIL 69
            D +  +I+  I+++++S I+  + QDGGD++F  Y  + G V +++ G C GC    +T K+G++ +L
  S:   114 FDKSDTEIVSRIRELMESYIKPAVVQDGGDIKFRGY--KNGIVYVELQGACSGCPSATITLKQGIQNML 180
>gi|194337374|ref|YP_002019168.1| nitrogen-fixing NifU domain protein [Pelodictyon phaeoclathratiforme BU-1] >gi|194309851|gb|ACF44551.1| nitrogen-fixing NifU domain protein [Pelodictyon phaeoclathratiforme BU-1] (86 aa)
Score = 94, Expect = 3.2e-02, Identities = 21/75 (28%), Positives = 40/75 (53%)
  Q:     5 NTNKIIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           N++ + D +   ++++R Y+  DGGD + V    +   V +K+LG C  C +  +T + G+E  +K  V  +  V
  S:    10 NSDALYDRVIAALETVRPYLQVDGGDCQIVGITKDM-TVDVKLLGACGSCPMSTLTLRAGVEQAIKKAVPEIVRV 83
>gi|17946069|gb|AAL49077.1| RE53788p [Drosophila melanogaster] (134 aa)
Score = 94, Expect = 3.2e-02, Identities = 26/67 (38%), Positives = 42/67 (62%)
  Q:    13 IKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           IK+++D+ IR  + +DGGD+ F+ Y  E G V +K+ G C  C    VT K G++ +L+  +  V+SV
  S:    33 IKELLDTRIRPTVQEDGGDIVFMGY--EGGVVKLKMQGSCSSCPSSIVTLKNGVQNMLQFYIPEVESV 98
>gi|58269446|ref|XP_571879.1| iron ion homeostasis-related protein [Cryptococcus neoformans var. neoformans JEC21] >gi|57228115|gb|AAW44572.1| iron ion homeostasis-related protein, putative [Cryptococcus neoformans var. neoformans JEC21] (309 aa)
Score = 94, Expect = 3.3e-02, Identities = 30/79 (37%), Positives = 53/79 (67%)
  Q:     1 MLDNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           +LD ++ +I+  IK+++++ +R  I +DGGD+E+  ++ + G V +K+ G C GCS   VT K G+E +L + V  V+SV
  S:   186 ILDTDS-EIVGMIKELLETRVRPAIMEDGGDIEYRGFDEDTGLVKLKLKGSCRGCSSSSVTLKNGIERMLTHYVPEVQSV 264
>gi|189500939|ref|YP_001960409.1| nitrogen-fixing NifU domain protein [Chlorobium phaeobacteroides BS1] >gi|189496380|gb|ACE04928.1| nitrogen-fixing NifU domain protein [Chlorobium phaeobacteroides BS1] (86 aa)
Score = 94, Expect = 3.3e-02, Identities = 21/75 (28%), Positives = 39/75 (52%)
  Q:     5 NTNKIIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           +T+ + D +   ++ +R Y+  DGGD + V    +   V +K+LG C  C +  +T + G+E  +K  V  +  V
  S:    10 DTDPLYDRVIKALEEVRPYLQADGGDCQLVGITKDM-LVDVKLLGACGSCPMSTLTLRAGVEQAIKKAVPEIARV 83
>gi|134114121|ref|XP_774308.1| hypothetical protein CNBG2890 [Cryptococcus neoformans var. neoformans B-3501A] >gi|50256943|gb|EAL19661.1| hypothetical protein CNBG2890 [Cryptococcus neoformans var. neoformans B-3501A] (309 aa)
Score = 94, Expect = 3.4e-02, Identities = 30/79 (37%), Positives = 53/79 (67%)
  Q:     1 MLDNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           +LD ++ +I+  IK+++++ +R  I +DGGD+E+  ++ + G V +K+ G C GCS   VT K G+E +L + V  V+SV
  S:   186 ILDTDS-EIVGMIKELLETRVRPAIMEDGGDIEYRGFDEDTGLVKLKLKGSCRGCSSSSVTLKNGIERMLTHYVPEVQSV 264
>gi|170787861|gb|EDT28905.1| nitrogen-fixing NifU domain protein [Oligotropha carboxidovorans OM5] (187 aa)
Score = 94, Expect = 3.4e-02, Identities = 24/67 (35%), Positives = 38/67 (56%)
  Q:    13 IKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           IKD+I++ +R  +  DGGD+ F  +  + G V + + G C GC     T K G++ +LK+ V  V  V
  S:   119 IKDIIETRVRPAVASDGGDITFRGF--KDGIVFLDMKGSCSGCPSSTATLKHGIQNLLKHFVPDVVEV 184
>gi|146337209|ref|YP_001202257.1| putative nifU protein (C-terminal fragment) [Bradyrhizobium sp. ORS278] >gi|146190015|emb|CAL74007.1| putative nifU protein (C-terminal fragment) [Bradyrhizobium sp. ORS278] (189 aa)
Score = 94, Expect = 3.5e-02, Identities = 25/78 (32%), Positives = 41/78 (52%)
  Q:     2 LDNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
            D    + +  IKD+I+S +R  +  DGGD+ F  +  + G V + + G C GC     T + G++ +LK+ V  V  V
  S:   110 FDEADTETVGMIKDLIESRVRPAVANDGGDITFRGF--KDGIVYLNMKGACSGCPSSTATLQHGIQNLLKHFVPEVVEV 186
>gi|91214967|ref|ZP_01251939.1| nifU-like domain protein [Psychroflexus torquis ATCC 700755] >gi|91186572|gb|EAS72943.1| nifU-like domain protein [Psychroflexus torquis ATCC 700755] (87 aa)
Score = 93, Expect = 3.5e-02, Identities = 21/64 (32%), Positives = 37/64 (57%)
  Q:    17 IDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           +D IR ++  DGGD+E +    +   V +++LG C+ C++  +T K G+E  +K     +K VI
  S:    15 LDEIRPFLKSDGGDIELLSIE-DDSLVKVQLLGTCVDCTVNQMTLKSGVEMTIKKYAPQIKEVI 77
>gi|193212089|ref|YP_001998042.1| nitrogen-fixing NifU domain protein [Chlorobaculum parvum NCIB 8327] >gi|193085566|gb|ACF10842.1| nitrogen-fixing NifU domain protein [Chlorobaculum parvum NCIB 8327] (83 aa)
Score = 93, Expect = 3.5e-02, Identities = 19/75 (25%), Positives = 40/75 (53%)
  Q:     5 NTNKIIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           N++ + D +   ++++R Y+  DGGD + +    +   V +K+LG C  C +  +T + G+E  +K  +  +  V
  S:     7 NSDPLYDRVISALETVRPYLQVDGGDCQLIGITKDM-VVDVKLLGACGSCPMSTLTLRAGVEQAIKKAIPEIARV 80
>gi|157804045|ref|YP_001492594.1| NifU-like domain-containing protein [Rickettsia canadensis str. McKiel] >gi|157785308|gb|ABV73809.1| NifU-like domain [Rickettsia canadensis str. McKiel] (189 aa)
Score = 93, Expect = 3.6e-02, Identities = 22/60 (36%), Positives = 37/60 (61%)
  Q:    20 IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           +R  + QDGGD+ +  +  E G V + + G C+GC    +T K G+E++LK+ V  V++V
  S:   125 VRPSVAQDGGDIIYKCF--ENGVVKLVLRGACLGCPSSTITLKNGIESMLKHFVPEVQAV 182
>gi|50121870|ref|YP_051037.1| nitrogen fixation protein [Pectobacterium atrosepticum SCRI1043] >gi|49612396|emb|CAG75846.1| nitrogen fixation protein [Erwinia carotovora subsp. atroseptica SCRI1043] (279 aa)
Score = 93, Expect = 3.9e-02, Identities = 18/48 (37%), Positives = 28/48 (58%)
  Q:    13 IKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVT 60
           + DV+  +R YI  DGGD+  +  N    +VT+ + G C GC + D+T
  S:   210 VADVVAELRPYIQADGGDMALL--NVSDHQVTVSLSGSCQGCMMTDMT 255
>gi|51702196|sp|Q9PAB5|NFUA_XYLFA Fe/S biogenesis protein nfuA (199 aa)
Score = 93, Expect = 3.9e-02, Identities = 21/52 (40%), Positives = 31/52 (59%)
  Q:    28 GGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           GG +E  + + E G V ++  G C GC ++DVT K+G+E  L   V GV +V
  S:   129 GGRVEVQEVSAE-GVVLLRFGGGCHGCGMVDVTLKQGVEKTLMERVHGVIAV 179
>gi|158288625|ref|XP_310479.4| AGAP000598-PA [Anopheles gambiae str. PEST] >gi|157018658|gb|EAA06366.4| AGAP000598-PA [Anopheles gambiae str. PEST] (226 aa)
Score = 93, Expect = 3.9e-02, Identities = 24/78 (30%), Positives = 46/78 (58%)
  Q:     2 LDNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
            + + ++ +  IK+++D+ IR  + +DGGD+ F+ +  + G V +K+ G C  C    VT K G++ +L+  +  V SV
  S:   115 FNEDDDETVQMIKELLDTRIRPTVQEDGGDIIFMGF--DDGVVKLKMQGSCSSCPSSIVTLKNGVQNMLQFYIPEVVSV 191
>gi|154148473|ref|YP_001407292.1| NifU family protein [Campylobacter hominis ATCC BAA-381] >gi|153804482|gb|ABS51489.1| NifU family protein [Campylobacter hominis ATCC BAA-381] (88 aa)
Score = 93, Expect = 3.9e-02, Identities = 25/80 (31%), Positives = 45/80 (56%)
  Q:     1 MLDNNTNKIIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           M+  + +++I+ ++  +D IR  + +DGGDLE +    +   V +++ G C GCS    T K G+E  LK ++    SV+
  S:     1 MIPFSDDELIEPVQKSLDLIRPMLQKDGGDLELLGI--KNAVVYVRLKGACHGCSASAQTLKYGVERQLKIDIHPEISVV 78
>gi|157964815|ref|YP_001499639.1| NifU-like protein [Rickettsia massiliae MTU5] >gi|157844591|gb|ABV85092.1| NifU-like protein [Rickettsia massiliae MTU5] (191 aa)
Score = 93, Expect = 4.0e-02, Identities = 22/65 (33%), Positives = 42/65 (64%)
  Q:     7 NKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKN 71
           ++I  +I ++I++ +R  + QDGGD+ +  +  E G V + + G C+GC    +T K G+E++LK+
  S:   112 SEIEKQIVEIIETRVRPSVAQDGGDIIYKGF--ENGVVKLALRGACLGCPSSTITLKNGIESMLKH 175
>gi|78186286|ref|YP_374329.1| NifU protein, putative [Pelodictyon luteolum DSM 273] >gi|78166188|gb|ABB23286.1| NifU protein, putative [Pelodictyon luteolum DSM 273] (89 aa)
Score = 93, Expect = 4.0e-02, Identities = 20/75 (26%), Positives = 40/75 (53%)
  Q:     5 NTNKIIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           N++ + D +   ++++R Y+  DGGD + V    +   V +K+LG C  C +  +T + G+E  +K  +  +  V
  S:    13 NSDALYDRVIAALETVRPYLQVDGGDCQLVGITKDM-VVDVKLLGACGSCPMSTLTLRAGVEQAIKKAIPEIVRV 86
>gi|8571395|gb|AAF76865.1|AF232919_4 NifU-like protein [Sinorhizobium meliloti] (63 aa)
Score = 93, Expect = 4.1e-02, Identities = 22/60 (36%), Positives = 36/60 (60%)
  Q:    20 IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKN---EVEGVKSV 79
           +R  + QDGGD+ F  +  + G V + + G C GC     T + G++ +L++   EVE V+SV
  S:     3 VRPAVAQDGGDITFRGF--KDGTVFLNMKGACSGCPSSTATLRHGVQNLLRHFVPEVEAVESV 63
>gi|163813115|ref|ZP_02204732.1| HesB/YadR/YfhF-family protein [Dehalococcoides sp. VS] >gi|157403250|gb|EDO69353.1| HesB/YadR/YfhF-family protein [Dehalococcoides sp. VS] (198 aa)
Score = 93, Expect = 4.3e-02, Identities = 18/40 (45%), Positives = 27/40 (67%)
  Q:    40 KGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           +G V ++  G C GC + DVT K+G+ET L ++V GV +V
  S:   139 EGVVLLRFGGGCHGCGMADVTLKQGIETTLMSKVPGVTAV 178
>gi|118590483|ref|ZP_01547885.1| nitrogen-fixing NifU-like protein [Stappia aggregata IAM 12614] >gi|118436946|gb|EAV43585.1| nitrogen-fixing NifU-like protein [Stappia aggregata IAM 12614] (185 aa)
Score = 93, Expect = 4.3e-02, Identities = 22/70 (31%), Positives = 44/70 (62%)
  Q:    10 IDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKN---EVEGVKSV 79
           +  IK+++++ +R  + QDGGD+ F  +  ++G V + + G C GC     T + G++ +L++   EVE V+ +
  S:   114 VSTIKELLETRVRPAVAQDGGDITFKGF--KEGIVYLSMRGACAGCPSSTATLQHGIQNLLRHFVPEVEEVRPI 185
>gi|145219268|ref|YP_001129977.1| NifU domain-containing protein [Prosthecochloris vibrioformis DSM 265] >gi|145205432|gb|ABP36475.1| nitrogen-fixing NifU domain protein [Prosthecochloris vibrioformis DSM 265] (86 aa)
Score = 93, Expect = 4.4e-02, Identities = 20/75 (26%), Positives = 41/75 (54%)
  Q:     5 NTNKIIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           N++ + D +   ++++R Y+  DGGD + V  + +   V +K+LG C  C +  +T + G+E  +K  +  +  V
  S:    10 NSDALYDRVIAALETVRPYLQVDGGDCQLVGISKDM-VVDVKLLGACGSCPMSTLTLRAGVEQAIKKAIPEIVRV 83
>gi|15839192|ref|NP_299880.1| hypothetical protein XF2603 [Xylella fastidiosa 9a5c] >gi|9107825|gb|AAF85400.1|AE004067_7 conserved hypothetical protein [Xylella fastidiosa 9a5c] (176 aa)
Score = 92, Expect = 4.7e-02, Identities = 21/52 (40%), Positives = 31/52 (59%)
  Q:    28 GGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           GG +E  + + E G V ++  G C GC ++DVT K+G+E  L   V GV +V
  S:   106 GGRVEVQEVSAE-GVVLLRFGGGCHGCGMVDVTLKQGVEKTLMERVHGVIAV 156
>gi|149195166|ref|ZP_01872257.1| Nitrogen-fixing NifU-like protein [Caminibacter mediatlanticus TB-2] >gi|149134718|gb|EDM23203.1| Nitrogen-fixing NifU-like protein [Caminibacter mediatlanticus TB-2] (98 aa)
Score = 92, Expect = 4.8e-02, Identities = 21/63 (33%), Positives = 37/63 (58%)
  Q:    11 DEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEV 73
           + +  VI+ IR  +  DGGD++ +D   +K  V +++ G C+GC+    T K G+E  LK ++
  S:    13 EAVAGVIEEIRPMLQMDGGDVKLIDV--KKPIVFVQLQGGCVGCASAGATLKYGIEKALKEKI 73
>gi|15892941|ref|NP_360655.1| hypothetical protein RC1018 [Rickettsia conorii str. Malish 7] >gi|15620134|gb|AAL03556.1| unknown [Rickettsia conorii str. Malish 7] (190 aa)
Score = 92, Expect = 4.8e-02, Identities = 22/65 (33%), Positives = 42/65 (64%)
  Q:     7 NKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKN 71
           ++I  +I ++I++ +R  + QDGGD+ +  +  E G V + + G C+GC    +T K G+E++LK+
  S:   111 SEIEKQIVEIIETRVRPSVAQDGGDIIYKGF--ENGVVKLALRGACLGCPSSTITLKNGIESMLKH 174
>gi|148251664|ref|YP_001236249.1| putative nifU protein [Bradyrhizobium sp. BTAi1] >gi|146403837|gb|ABQ32343.1| putative nifU protein [Bradyrhizobium sp. BTAi1] (189 aa)
Score = 92, Expect = 4.9e-02, Identities = 25/77 (32%), Positives = 41/77 (53%)
  Q:     3 DNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           D    + +  IKD+I+S +R  +  DGGD+ F  +  + G V + + G C GC     T + G++ +LK+ V  V  V
  S:   111 DEADTETVGMIKDLIESRVRPAVANDGGDITFRGF--KDGIVYLNMKGACSGCPSSTATLQHGIQNLLKHFVPEVVEV 186
>gi|91975564|ref|YP_568223.1| nitrogen-fixing NifU-like [Rhodopseudomonas palustris BisB5] >gi|91682020|gb|ABE38322.1| nitrogen-fixing NifU-like [Rhodopseudomonas palustris BisB5] (331 aa)
Score = 92, Expect = 4.9e-02, Identities = 18/48 (37%), Positives = 29/48 (60%)
  Q:    13 IKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVT 60
           I + +D +R ++ +DGGD E V  N E   V +++ G C+GC L  +T
  S:   264 IAEALDELRPHLKRDGGDCELV--NVEGNVVYVRLSGNCVGCQLSSLT 309
>gi|109103338|ref|XP_001096379.1| PREDICTED: similar to HIRA interacting protein 5 isoform 2 [Macaca mulatta] (257 aa)
Score = 92, Expect = 4.9e-02, Identities = 23/64 (35%), Positives = 38/64 (59%)
  Q:    20 IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILK---NEVEGVKSVIVTE 83
           +R  + +DGGD+ +  +  E G V +K+ G C  C    +T K G++ +L+    EVEGV+ V+  E
  S:   184 LRPTVQEDGGDVIYKGF--EDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQFYIPEVEGVEQVMDDE 248
>gi|42525980|ref|NP_971078.1| NifU domain-containing protein [Treponema denticola ATCC 35405] >gi|41816030|gb|AAS10959.1| NifU domain protein [Treponema denticola ATCC 35405] (75 aa)
Score = 92, Expect = 4.9e-02, Identities = 26/70 (37%), Positives = 39/70 (55%)
  Q:    11 DEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           +EI+  I  +R Y+  DGGD+E +D   E G+V +K+ G C  C +   T K G+E  LK+    V  V+
  S:     5 EEIEKGIALVRPYLQADGGDIE-LDSVDEAGKVYVKLKGACGSCPMAIYTLKMGVEEQLKDMFPEVTEVV 73
>gi|90425924|ref|YP_534294.1| nitrogen-fixing NifU-like [Rhodopseudomonas palustris BisB18] >gi|90107938|gb|ABD89975.1| nitrogen-fixing NifU-like [Rhodopseudomonas palustris BisB18] (338 aa)
Score = 92, Expect = 5.0e-02, Identities = 18/58 (31%), Positives = 33/58 (56%)
  Q:     3 DNNTNKIIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVT 60
           D  T +  + IK  ++++R ++ +DGGD E VD   +   + +++ G C+ C L  VT
  S:   261 DRGTPEQFELIKQAVEALRPHLQRDGGDCELVDV--DGNTIYLRLSGNCVDCQLASVT 316
>gi|78776531|ref|YP_392846.1| nitrogen-fixing NifU-like protein [Sulfurimonas denitrificans DSM 1251] >gi|78497071|gb|ABB43611.1| Nitrogen-fixing NifU-like protein [Sulfurimonas denitrificans DSM 1251] (91 aa)
Score = 92, Expect = 5.2e-02, Identities = 24/80 (30%), Positives = 44/80 (55%)
  Q:     1 MLDNNTNKIIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           M+     ++++ +++VID +R  +  D GD+ F+     K  V I++ G C+GC+    T K G+E  LK ++    +VI
  S:     1 MIPFTDEELMNPVRNVIDKVRPSLALDSGDISFITVKNSK--VYIQLKGACVGCASSGTTLKYGVERQLKMDIHPEITVI 78
>gi|159163237|pdb|1VEH|A Chain A, Solution Structure Of Rsgi Ruh-018, A Nifu-Like Domain Of Hirip5 Protein From Mouse Cdna (92 aa)
Score = 92, Expect = 5.3e-02, Identities = 26/71 (36%), Positives = 45/71 (63%)
  Q:     9 IIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILK---NEVEGVKSV 79
           ++  IK+++D+ IR  + +DGGD+ +  +  E G V +K+ G C  C    +T K G++ +L+    EVEGV+ V
  S:    14 VVAMIKELLDTRIRPTVQEDGGDVIYRGF--EDGIVRLKLQGSCTSCPSSIITLKSGIQNMLQFYIPEVEGVEQV 86
>gi|46579079|ref|YP_009887.1| nitrogen fixation protein nifU [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] >gi|120603338|ref|YP_967738.1| Fe-S cluster assembly protein NifU [Desulfovibrio vulgaris subsp. vulgaris DP4] >gi|46448492|gb|AAS95146.1| nitrogen fixation protein nifU [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] >gi|120563567|gb|ABM29311.1| Fe-S cluster assembly protein NifU [Desulfovibrio vulgaris subsp. vulgaris DP4] (281 aa)
Score = 92, Expect = 5.4e-02, Identities = 24/64 (37%), Positives = 36/64 (56%)
  Q:    20 IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVIVTE 83
           IR  + QDGGD+E VD N    EV + + G C  C    +T KE +E  L++ V+  + ++V E
  S:   219 IRPRLQQDGGDIELVDMNGT--EVMVALRGMCTSCPSSQLTLKEFVERTLRDHVD--QEIVVRE 278
>gi|89889561|ref|ZP_01201072.1| thioredoxin containing NifU domain [Flavobacteria bacterium BBFL7] >gi|89517834|gb|EAS20490.1| thioredoxin containing NifU domain [Flavobacteria bacterium BBFL7] (214 aa)
Score = 92, Expect = 5.5e-02, Identities = 25/74 (33%), Positives = 43/74 (58%)
  Q:     2 LDNNTNKIIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEG 75
           LD+ + K++ EI D  + I+  +  DGG++ F  Y+    EV + + G C GC    +T K G+ET+L++ + G
  S:   134 LDDVSKKVV-EILD--EYIKPAVASDGGNIVFDSYDENTKEVKVILQGACSGCPSSTMTLKSGIETMLRDMLPG 204
>gi|116748860|ref|YP_845547.1| NifU domain-containing protein [Syntrophobacter fumaroxidans MPOB] >gi|116697924|gb|ABK17112.1| nitrogen-fixing NifU domain protein [Syntrophobacter fumaroxidans MPOB] (72 aa)
Score = 92, Expect = 5.5e-02, Identities = 21/68 (30%), Positives = 38/68 (55%)
  Q:    12 EIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           ++++ +  IR  + +DGG +E VD   +   V +++ G C GC +  +T K G+E ++K  V  V  V
  S:     4 KVEEALAKIRPMLERDGGSVELVDV--QGTVVKVRLTGACHGCPMSQMTLKAGIERVVKENVPEVTEV 69
>gi|157373320|ref|YP_001471920.1| putative DNA uptake protein [Shewanella sediminis HAW-EB3] >gi|189041731|sp|A8FPL9|NFUA_SHESH Fe/S biogenesis protein nfuA >gi|157315694|gb|ABV34792.1| HesB/YadR/YfhF-family protein [Shewanella sediminis HAW-EB3] (192 aa)
Score = 92, Expect = 5.6e-02, Identities = 23/52 (44%), Positives = 34/52 (65%)
  Q:    28 GGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETIL----KNEVEGVKSV 79
           GG++  V+   E+G   ++  G C GCS++DVT K+G+ET L      E+ GVK V
  S:   127 GGNIMLVEVT-EEGTAILQFGGGCNGCSMVDVTLKDGIETQLLEKFPGELTGVKDV 181
>gi|145351003|ref|XP_001419878.1| predicted protein [Ostreococcus lucimarinus CCE9901] >gi|144580111|gb|ABO98171.1| predicted protein [Ostreococcus lucimarinus CCE9901] (213 aa)
Score = 92, Expect = 5.7e-02, Identities = 25/73 (34%), Positives = 39/73 (53%)
  Q:    11 DEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVIVTE 83
           D I+ V+D +R Y+  DGGD+E V+   +   V +K+ G C  C    VT + G+E  L  ++  +  VI  E
  S:    65 DNIESVLDEVRPYLIADGGDVELVEI--DGLSVKLKLKGACGSCPSSTVTMRMGIEKRLLEKIPDIMEVIQVE 135
>gi|67458659|ref|YP_246283.1| NifU-like domain-containing protein [Rickettsia felis URRWXCal2] >gi|67004192|gb|AAY61118.1| NifU-like domain [Rickettsia felis URRWXCal2] (190 aa)
Score = 92, Expect = 5.7e-02, Identities = 22/65 (33%), Positives = 42/65 (64%)
  Q:     7 NKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKN 71
           ++I  +I ++I++ +R  + QDGGD+ +  +  E G V + + G C+GC    +T K G+E++LK+
  S:   111 SEIEKQIVEIIETRVRPSVAQDGGDIIYKGF--ENGVVKLALRGACLGCPSSTITLKNGIESMLKH 174
>gi|34581359|ref|ZP_00142839.1| hypothetical protein [Rickettsia sibirica 246] >gi|167472152|ref|ZP_02336856.1| hypothetical protein RafrE_05770 [Rickettsia africae ESF-5] >gi|28262744|gb|EAA26248.1| unknown [Rickettsia sibirica 246] (190 aa)
Score = 92, Expect = 5.7e-02, Identities = 22/65 (33%), Positives = 42/65 (64%)
  Q:     7 NKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKN 71
           ++I  +I ++I++ +R  + QDGGD+ +  +  E G V + + G C+GC    +T K G+E++LK+
  S:   111 SEIEKQIVEIIETRVRPSVAQDGGDIIYKGF--ENGVVKLALRGACLGCPSSTITLKNGIESMLKH 174
>gi|90420546|ref|ZP_01228453.1| putative nitrogen-fixing NifU domain protein [Aurantimonas sp. SI85-9A1] >gi|90335274|gb|EAS49027.1| putative nitrogen-fixing NifU domain protein [Aurantimonas sp. SI85-9A1] (191 aa)
Score = 92, Expect = 5.8e-02, Identities = 20/59 (33%), Positives = 35/59 (59%)
  Q:    13 IKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKN 71
           IK+++++ +R  + QDGGD+ F  Y    G V + + G C GC     T K G++ +L++
  S:   120 IKELLETRVRPAVAQDGGDITFRGY--RDGTVYLNMRGACAGCPSSTATLKHGIQNLLRH 177
>gi|86743152|ref|YP_483552.1| HesB/YadR/YfhF [Frankia sp. CcI3] >gi|86570014|gb|ABD13823.1| HesB/YadR/YfhF [Frankia sp. CcI3] (206 aa)
Score = 92, Expect = 5.8e-02, Identities = 21/72 (29%), Positives = 41/72 (56%)
  Q:     8 KIIDEIKDVIDSIRFYINQDGGDLEFV-----DYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           ++ ++++++++ IR ++  DGGD E V     +  P   EV +++ G C GCS    T    +E+ LK  +  +  V
  S:   126 RLREQVEEIMEEIRPFLRGDGGDAEVVATLAGNGEPGTAEVHLRLTGACGGCSSATATLTGVIESRLKEALPEIGRV 202
>gi|148926387|ref|ZP_01810071.1| nifU protein like protein [Campylobacter jejuni subsp. jejuni CG8486] >gi|145844779|gb|EDK21884.1| nifU protein like protein [Campylobacter jejuni subsp. jejuni CG8486] (317 aa)
Score = 91, Expect = 6.0e-02, Identities = 25/61 (40%), Positives = 38/61 (62%)
  Q:    13 IKDVIDS-IRFYINQDGGDLEFVDYNPEKG---EVTIKILGECIGCSLIDVTYKEGLETILKNEV 73
           ++ V+D+ IR  ++ DGGDLE +D    +G   +V I+ LG C GCS         +ETIL+ E+
  S:   244 VESVLDAEIRPMLHNDGGDLEVIDIQKAEGAAIDVYIRYLGACSGCSSGSGATLYAIETILQEEL 308
>gi|110637337|ref|YP_677544.1| hypothetical protein CHU_0925 [Cytophaga hutchinsonii ATCC 33406] >gi|110280018|gb|ABG58204.1| conserved hypothetical protein [Cytophaga hutchinsonii ATCC 33406] (86 aa)
Score = 91, Expect = 6.2e-02, Identities = 22/72 (30%), Positives = 42/72 (58%)
  Q:     8 KIIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           +++D ++  ++SIR Y+  DGG++  V+   E   V +++LG C  C +  +T K G+E  ++  V  +K V
  S:     9 ELLDRVEQALESIRPYLITDGGNVRLVEIT-EDMIVKLELLGACGTCPMSAMTLKAGVEESIRKAVPEIKGV 79
>gi|86134908|ref|ZP_01053490.1| NifU-like protein [Tenacibaculum sp. MED152] >gi|85821771|gb|EAQ42918.1| NifU-like protein [Polaribacter dokdonensis MED152] (78 aa)
Score = 91, Expect = 6.3e-02, Identities = 21/73 (28%), Positives = 41/73 (56%)
  Q:     8 KIIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           +I + ++  +D IR ++  DGG+++ +    E   V +++ G C GCS+  +T K G+E  +K     ++ VI
  S:     5 EIHNNVEKALDEIRPFLMSDGGNIKLLSI--EDAIVKVQLQGACTGCSVNQMTLKNGVEATIKKYAPQIEQVI 75
>gi|115953358|ref|XP_798698.2| PREDICTED: similar to HIRA interacting protein 5, partial [Strongylocentrotus purpuratus] (211 aa)
Score = 91, Expect = 6.4e-02, Identities = 26/82 (31%), Positives = 48/82 (58%)
  Q:     2 LDNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVIVTE 83
           +  + ++ +  IK+++D+ IR  + +DGGD+ ++ +  E+G V +K+ G C  C    VT K G++ +L+  V  V SV   E
  S:   108 IQEDDDETVMMIKELLDTRIRPTVQEDGGDIVYMGF--EEGVVKLKLQGACTSCPSSIVTLKHGVQNMLQFYVPEVLSVEAVE 188
>gi|116059909|emb|CAL55968.1| NifU-like domain-containing proteins (ISS) [Ostreococcus tauri] (203 aa)
Score = 91, Expect = 6.6e-02, Identities = 25/73 (34%), Positives = 39/73 (53%)
  Q:    11 DEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVIVTE 83
           D I+ V+D +R Y+  DGGD+E V+   +   V +K+ G C  C    VT + G+E  L  ++  +  VI  E
  S:    55 DNIEKVLDEVRPYLIADGGDVELVEI--DGLSVKLKLKGACGSCPSSTVTMRMGIEKRLLEKIPDIMEVIQIE 125
>gi|86151274|ref|ZP_01069489.1| NifU family protein [Campylobacter jejuni subsp. jejuni 260.94] >gi|85841621|gb|EAQ58868.1| NifU family protein [Campylobacter jejuni subsp. jejuni 260.94] (323 aa)
Score = 91, Expect = 6.8e-02, Identities = 25/61 (40%), Positives = 38/61 (62%)
  Q:    13 IKDVIDS-IRFYINQDGGDLEFVDYNPEKG---EVTIKILGECIGCSLIDVTYKEGLETILKNEV 73
           ++ V+D+ IR  ++ DGGDLE +D    +G   +V I+ LG C GCS         +ETIL+ E+
  S:   250 VESVLDAEIRPMLHNDGGDLEVIDIQKAEGAAIDVYIRYLGACSGCSSGSGATLYAIETILQEEL 314
>gi|86149607|ref|ZP_01067837.1| NifU family protein [Campylobacter jejuni subsp. jejuni CF93-6] >gi|85839875|gb|EAQ57134.1| NifU family protein [Campylobacter jejuni subsp. jejuni CF93-6] (323 aa)
Score = 91, Expect = 6.8e-02, Identities = 25/61 (40%), Positives = 38/61 (62%)
  Q:    13 IKDVIDS-IRFYINQDGGDLEFVDYNPEKG---EVTIKILGECIGCSLIDVTYKEGLETILKNEV 73
           ++ V+D+ IR  ++ DGGDLE +D    +G   +V I+ LG C GCS         +ETIL+ E+
  S:   250 VESVLDAEIRPMLHNDGGDLEVIDIQKAEGAAIDVYIRYLGACSGCSSGSGATLYAIETILQEEL 314
>gi|15791611|ref|NP_281434.1| NifU family protein [Campylobacter jejuni subsp. jejuni NCTC 11168] >gi|57237299|ref|YP_178312.1| NifU family protein [Campylobacter jejuni RM1221] >gi|88597232|ref|ZP_01100467.1| NifU family protein [Campylobacter jejuni subsp. jejuni 84-25] >gi|121613377|ref|YP_999952.1| NifU family protein [Campylobacter jejuni subsp. jejuni 81-176] >gi|157414537|ref|YP_001481793.1| NifU family protein [Campylobacter jejuni subsp. jejuni 81116] >gi|167004909|ref|ZP_02270667.1| nifU-like protein [Campylobacter jejuni subsp. jejuni 81-176] >gi|57166103|gb|AAW34882.1| NifU family protein [Campylobacter jejuni RM1221] >gi|87250262|gb|EAQ73220.1| NifU family protein [Campylobacter jejuni subsp. jejuni 81-176] >gi|88190293|gb|EAQ94267.1| NifU family protein [Campylobacter jejuni subsp. jejuni 84-25] >gi|112359609|emb|CAL34394.1| NifU protein homolog [Campylobacter jejuni subsp. jejuni NCTC 11168] >gi|157385501|gb|ABV51816.1| nifU-like protein [Campylobacter jejuni subsp. jejuni 81116] (323 aa)
Score = 91, Expect = 6.8e-02, Identities = 25/61 (40%), Positives = 38/61 (62%)
  Q:    13 IKDVIDS-IRFYINQDGGDLEFVDYNPEKG---EVTIKILGECIGCSLIDVTYKEGLETILKNEV 73
           ++ V+D+ IR  ++ DGGDLE +D    +G   +V I+ LG C GCS         +ETIL+ E+
  S:   250 VESVLDAEIRPMLHNDGGDLEVIDIQKAEGAAIDVYIRYLGACSGCSSGSGATLYAIETILQEEL 314
>gi|115946407|ref|XP_001184965.1| PREDICTED: similar to HIRA interacting protein 5 [Strongylocentrotus purpuratus] (209 aa)
Score = 91, Expect = 7.0e-02, Identities = 26/71 (36%), Positives = 43/71 (60%)
  Q:    13 IKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVIVTE 83
           IK+++D+ IR  + +DGGD+ ++ +  E+G V +K+ G C  C    VT K G++ +L+  V  V SV   E
  S:   117 IKELLDTRIRPTVQEDGGDIVYMGF--EEGVVKLKLQGACTSCPSSIVTLKHGVQNMLQFYVPEVLSVEAVE 186
>gi|86153596|ref|ZP_01071799.1| NifU family protein [Campylobacter jejuni subsp. jejuni HB93-13] >gi|85842557|gb|EAQ59769.1| NifU family protein [Campylobacter jejuni subsp. jejuni HB93-13] (323 aa)
Score = 91, Expect = 7.0e-02, Identities = 25/61 (40%), Positives = 38/61 (62%)
  Q:    13 IKDVIDS-IRFYINQDGGDLEFVDYNPEKG---EVTIKILGECIGCSLIDVTYKEGLETILKNEV 73
           ++ V+D+ IR  ++ DGGDLE +D    +G   +V I+ LG C GCS         +ETIL+ E+
  S:   250 VESVLDAEIRPMLHNDGGDLEVIDIQKAEGAAIDVYIRYLGACSGCSSGSGATLYAIETILQEEL 314
>gi|57168365|ref|ZP_00367499.1| nifU protein homolog Cj0239c [Campylobacter coli RM2228] >gi|57020173|gb|EAL56847.1| nifU protein homolog Cj0239c [Campylobacter coli RM2228] (323 aa)
Score = 91, Expect = 7.0e-02, Identities = 25/61 (40%), Positives = 38/61 (62%)
  Q:    13 IKDVIDS-IRFYINQDGGDLEFVDYNPEKG---EVTIKILGECIGCSLIDVTYKEGLETILKNEV 73
           ++ V+D+ IR  ++ DGGDLE +D    +G   +V I+ LG C GCS         +ETIL+ E+
  S:   250 VESVLDAEIRPMLHNDGGDLEVIDIQKAEGAAIDVYIRYLGACSGCSSGSGATLYAIETILQEEL 314
>gi|153951672|ref|YP_001397468.1| NifU family protein [Campylobacter jejuni subsp. doylei 269.97] >gi|152939118|gb|ABS43859.1| NifU family protein [Campylobacter jejuni subsp. doylei 269.97] (323 aa)
Score = 91, Expect = 7.4e-02, Identities = 25/61 (40%), Positives = 38/61 (62%)
  Q:    13 IKDVIDS-IRFYINQDGGDLEFVDYNPEKG---EVTIKILGECIGCSLIDVTYKEGLETILKNEV 73
           ++ V+D+ IR  ++ DGGDLE +D    +G   +V I+ LG C GCS         +ETIL+ E+
  S:   250 VESVLDAEIRPMLHNDGGDLEVIDIQKAEGAAIDVYIRYLGACSGCSSGSGATLYAIETILQEEL 314
>gi|149371976|ref|ZP_01891295.1| nifU-like domain protein [unidentified eubacterium SCB49] >gi|149355116|gb|EDM43677.1| nifU-like domain protein [unidentified eubacterium SCB49] (80 aa)
Score = 91, Expect = 7.6e-02, Identities = 21/72 (29%), Positives = 40/72 (55%)
  Q:    12 EIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVIVTE 83
           +++  +D IR ++  DGGD+  +    +   V +++ G C+GCS+  +T K G+E  +K     ++ VI  E
  S:     9 KVEIALDEIRPFLQTDGGDILLLGIE-DGTTVKVQLQGACVGCSVNQMTLKSGVEMTIKKHAPQIERVINVE 79
>gi|47212055|emb|CAF90173.1| unnamed protein product [Tetraodon nigroviridis] (196 aa)
Score = 91, Expect = 7.6e-02, Identities = 23/76 (30%), Positives = 47/76 (61%)
  Q:     4 NNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           ++ ++++  IK+++D+ IR  + +DGGD+ +  +  E G V +K+ G C  C    +T K G++ +L+  +  V+SV
  S:   108 DDDDELVAMIKELLDTRIRPTVQEDGGDVLYRGF--EGGVVKLKLQGSCTSCPSSIITLKSGIQNMLQFYIPEVESV 182
>gi|162146272|ref|YP_001600731.1| nitrogen fixation protein nifU [Gluconacetobacter diazotrophicus PAl 5] >gi|187595779|ref|ZP_02982043.1| Fe-S cluster assembly protein NifU [Gluconacetobacter diazotrophicus PAl 5] >gi|11034776|gb|AAG27073.1|AF105225_9 NifU [Gluconacetobacter diazotrophicus] >gi|161784847|emb|CAP54390.1| Nitrogen fixation protein nifU [Gluconacetobacter diazotrophicus PAl 5] >gi|187492614|gb|EDU30551.1| Fe-S cluster assembly protein NifU [Gluconacetobacter diazotrophicus PAl 5] (309 aa)
Score = 91, Expect = 7.7e-02, Identities = 20/57 (35%), Positives = 32/57 (56%)
  Q:     6 TNKIIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYK 62
           T + I  I++V++ +R  +  DGGD E VD   E   V +++ G C+ C L  VT +
  S:   232 TVQKIRAIEEVLEELRPALRNDGGDCELVDV--EDNRVMVRLTGACVNCQLAAVTVQ 286
>gi|78189610|ref|YP_379948.1| NifU protein, putative [Chlorobium chlorochromatii CaD3] >gi|78171809|gb|ABB28905.1| NifU protein, putative [Chlorobium chlorochromatii CaD3] (84 aa)
Score = 90, Expect = 7.8e-02, Identities = 19/75 (25%), Positives = 41/75 (54%)
  Q:     5 NTNKIIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           +++ + D +   ++++R Y+  DGGD + V  + +   V +K+LG C  C +  +T + G+E  +K  +  +  V
  S:     8 SSDSLYDRVIAALETVRPYLQADGGDCQLVGISKDM-VVDVKLLGACGSCPMSTLTLRAGVEQAIKKAIPEIVRV 81
>gi|149525599|ref|XP_001517848.1| PREDICTED: similar to HIRA interacting protein 5 [Ornithorhynchus anatinus] (180 aa)
Score = 90, Expect = 7.8e-02, Identities = 23/59 (38%), Positives = 35/59 (59%)
  Q:    21 RFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILK---NEVEGVKSV 79
           R  + +DGGD+ +  +  E G V +K+ G C  C    VT K G++ +L+    EVEGV+ V
  S:   112 RPTVQEDGGDVIYRGF--EDGVVQLKLQGSCTSCPSSIVTLKSGIQNMLQFYIPEVEGVEQV 171
>gi|124006329|ref|ZP_01691163.1| NifU domain protein [Microscilla marina ATCC 23134] >gi|123987986|gb|EAY27657.1| NifU domain protein [Microscilla marina ATCC 23134] (197 aa)
Score = 90, Expect = 8.3e-02, Identities = 28/79 (35%), Positives = 44/79 (55%)
  Q:     2 LDNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEV-EGVKSVI 80
           L+ +  +I  +IK +++  +R  +  DGG + F  Y  E G V + + G C GC    VT K G+E +LK  + E VK V+
  S:   115 LNKDEPEIDRKIKGILEEYVRPAVESDGGAINFHSY--ENGTVKVLLQGSCSGCPSSMVTLKSGIENLLKRMLPEDVKEVV 193
>gi|149278153|ref|ZP_01884291.1| hypothetical protein PBAL39_11367 [Pedobacter sp. BAL39] >gi|149230919|gb|EDM36300.1| hypothetical protein PBAL39_11367 [Pedobacter sp. BAL39] (100 aa)
Score = 90, Expect = 8.4e-02, Identities = 21/72 (29%), Positives = 40/72 (55%)
  Q:     9 IIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           +  +++  +++IR Y+  DGG++E  +   E   V +K+LG C  C +  +T K G+E  +   V  + SV+
  S:    22 LTQQVEQALETIRPYLIADGGNVEIEEITAEN-VVKLKLLGNCGSCKMSFMTMKAGIEQAILKAVPQITSVV 92
>gi|15803918|ref|NP_289954.1| putative DNA uptake protein [Escherichia coli O157:H7 EDL933] >gi|15833510|ref|NP_312283.1| putative DNA uptake protein [Escherichia coli O157:H7 str. Sakai] >gi|16131290|ref|NP_417873.1| predicted gluconate transport associated protein [Escherichia coli str. K-12 substr. MG1655] >gi|24114681|ref|NP_709191.1| putative DNA uptake protein [Shigella flexneri 2a str. 301] >gi|26250015|ref|NP_756055.1| putative DNA uptake protein [Escherichia coli CFT073] >gi|30065301|ref|NP_839472.1| putative DNA uptake protein [Shigella flexneri 2a str. 2457T] >gi|74313917|ref|YP_312336.1| putative DNA uptake protein [Shigella sonnei Ss046] >gi|82545771|ref|YP_409718.1| putative DNA uptake protein [Shigella boydii Sb227] >gi|82778770|ref|YP_405119.1| putative DNA uptake protein [Shigella dysenteriae Sd197] >gi|89110596|ref|AP_004376.1| predicted gluconate transport associated protein [Escherichia coli W3110] >gi|91212889|ref|YP_542875.1| putative DNA uptake protein [Escherichia coli UTI89] >gi|110643647|ref|YP_671377.1| putative DNA uptake protein [Escherichia coli 536] >gi|110807249|ref|YP_690769.1| putative DNA uptake protein [Shigella flexneri 5 str. 8401] >gi|117625679|ref|YP_859002.1| putative DNA uptake protein [Escherichia coli APEC O1] >gi|157155730|ref|YP_001464872.1| putative DNA uptake protein [Escherichia coli E24377A] >gi|157162891|ref|YP_001460209.1| putative DNA uptake protein [Escherichia coli HS] >gi|168709020|ref|ZP_02741297.1| protein GntY [Escherichia coli O157:H7 str. EC4045] >gi|168717050|ref|ZP_02749327.1| protein GntY [Escherichia coli O157:H7 str. EC4206] >gi|168734850|ref|ZP_02767127.1| protein GntY [Escherichia coli O157:H7 str. EC4115] >gi|168747108|ref|ZP_02772130.1| protein GntY [Escherichia coli O157:H7 str. EC4113] >gi|168753167|ref|ZP_02778174.1| protein GntY [Escherichia coli O157:H7 str. EC4401] >gi|168759439|ref|ZP_02784446.1| protein GntY [Escherichia coli O157:H7 str. EC4501] >gi|168765762|ref|ZP_02790769.1| protein GntY [Escherichia coli O157:H7 str. EC4486] >gi|168772693|ref|ZP_02797700.1| protein GntY [Escherichia coli O157:H7 str. EC4196] >gi|168779498|ref|ZP_02804505.1| protein GntY [Escherichia coli O157:H7 str. EC4076] >gi|168785219|ref|ZP_02810226.1| protein GntY [Escherichia coli O157:H7 str. EC869] >gi|168791436|ref|ZP_02816443.1| protein GntY [Escherichia coli O157:H7 str. EC4042] >gi|168797185|ref|ZP_02822192.1| protein GntY [Escherichia coli O157:H7 str. EC508] >gi|170018350|ref|YP_001723304.1| IscR-regulated protein YhgI [Escherichia coli ATCC 8739] >gi|170082930|ref|YP_001732250.1| gluconate transport associated protein [Escherichia coli str. K12 substr. DH10B] >gi|170681204|ref|YP_001745662.1| protein GntY [Escherichia coli SMS-3-5] >gi|170766983|ref|ZP_02901436.1| protein GntY [Escherichia albertii TW07627] >gi|187731025|ref|YP_001882093.1| protein GntY [Shigella boydii CDC 3083-94] >gi|188492005|ref|ZP_02999275.1| protein GntY [Escherichia coli 53638] >gi|191167295|ref|ZP_03029112.1| protein GntY [Escherichia coli B7A] >gi|191167903|ref|ZP_03029707.1| protein GntY [Escherichia coli B7A] >gi|191171521|ref|ZP_03033069.1| protein GntY [Escherichia coli F11] >gi|193061845|ref|ZP_03042942.1| protein GntY [Escherichia coli E22] >gi|193068805|ref|ZP_03049765.1| protein GntY [Escherichia coli E110019] >gi|194426967|ref|ZP_03059519.1| protein GntY [Escherichia coli B171] >gi|194435891|ref|ZP_03067994.1| protein GntY [Escherichia coli 101-1] >gi|195934903|ref|ZP_03080285.1| putative DNA uptake protein [Escherichia coli O157:H7 str. EC4024] >gi|51702267|sp|P63020|NFUA_ECOLI Fe/S biogenesis protein nfuA >gi|51702268|sp|P63021|NFUA_ECOL6 Fe/S biogenesis protein nfuA >gi|51702269|sp|P63022|NFUA_ECO57 Fe/S biogenesis protein nfuA >gi|51702270|sp|P63023|NFUA_SHIFL Fe/S biogenesis protein nfuA >gi|119370608|sp|Q0TC53|NFUA_ECOL5 Fe/S biogenesis protein nfuA >gi|119370609|sp|Q1R5M0|NFUA_ECOUT Fe/S biogenesis protein nfuA >gi|119370617|sp|Q31VL8|NFUA_SHIBS Fe/S biogenesis protein nfuA >gi|119370618|sp|Q32AM7|NFUA_SHIDS Fe/S biogenesis protein nfuA >gi|119370619|sp|Q3YWL1|NFUA_SHISS Fe/S biogenesis protein nfuA >gi|122957141|sp|Q0SZQ1|NFUA_SHIF8 Fe/S biogenesis protein nfuA >gi|150383445|sp|A1AGT8|NFUA_ECOK1 Fe/S biogenesis protein nfuA >gi|166990521|sp|A7ZSU3|NFUA_ECO24 Fe/S biogenesis protein nfuA >gi|166990522|sp|A8A5M2|NFUA_ECOHS Fe/S biogenesis protein nfuA >gi|189041724|sp|B1IP51|NFUA_ECOLC Fe/S biogenesis protein nfuA >gi|12518044|gb|AAG58515.1|AE005563_9 orf, hypothetical protein [Escherichia coli O157:H7 EDL933] >gi|26110444|gb|AAN82629.1|AE016768_47 Protein yhgI [Escherichia coli CFT073] >gi|606349|gb|AAA58212.1| ORF_o191 [Escherichia coli] >gi|1789819|gb|AAC76439.1| predicted gluconate transport associated protein [Escherichia coli str. K-12 substr. MG1655] >gi|13363730|dbj|BAB37679.1| hypothetical protein [Escherichia coli O157:H7 str. Sakai] >gi|24053889|gb|AAN44898.1| orf, conserved hypothetical protein [Shigella flexneri 2a str. 301] >gi|30043563|gb|AAP19283.1| hypothetical protein S4328 [Shigella flexneri 2a str. 2457T] >gi|73857394|gb|AAZ90101.1| conserved hypothetical protein [Shigella sonnei Ss046] >gi|81242918|gb|ABB63628.1| conserved hypothetical protein [Shigella dysenteriae Sd197] >gi|81247182|gb|ABB67890.1| conserved hypothetical protein [Shigella boydii Sb227] >gi|85676627|dbj|BAE77877.1| predicted gluconate transport associated protein [Escherichia coli W3110] >gi|91074463|gb|ABE09344.1| hypothetical protein UTI89_C3915 [Escherichia coli UTI89] >gi|110345239|gb|ABG71476.1| hypothetical protein YhgI (HesB-like domain) [Escherichia coli 536] >gi|110616797|gb|ABF05464.1| conserved hypothetical protein [Shigella flexneri 5 str. 8401] >gi|115514803|gb|ABJ02878.1| conserved hypothetical protein [Escherichia coli APEC O1] >gi|157068571|gb|ABV07826.1| protein GntY [Escherichia coli HS] >gi|157077760|gb|ABV17468.1| protein GntY [Escherichia coli E24377A] >gi|169753278|gb|ACA75977.1| IscR-regulated protein YhgI [Escherichia coli ATCC 8739] >gi|169890765|gb|ACB04472.1| predicted gluconate transport associated protein [Escherichia coli str. K12 substr. DH10B] >gi|170124421|gb|EDS93352.1| protein GntY [Escherichia albertii TW07627] >gi|170518922|gb|ACB17100.1| protein GntY [Escherichia coli SMS-3-5] >gi|187428017|gb|ACD07291.1| protein GntY [Shigella boydii CDC 3083-94] >gi|187771744|gb|EDU35588.1| protein GntY [Escherichia coli O157:H7 str. EC4196] >gi|188018489|gb|EDU56611.1| protein GntY [Escherichia coli O157:H7 str. EC4113] >gi|188487204|gb|EDU62307.1| protein GntY [Escherichia coli 53638] >gi|189002308|gb|EDU71294.1| protein GntY [Escherichia coli O157:H7 str. EC4076] >gi|189359050|gb|EDU77469.1| protein GntY [Escherichia coli O157:H7 str. EC4401] >gi|189364704|gb|EDU83123.1| protein GntY [Escherichia coli O157:H7 str. EC4486] >gi|189369561|gb|EDU87977.1| protein GntY [Escherichia coli O157:H7 str. EC4501] >gi|189374586|gb|EDU93002.1| protein GntY [Escherichia coli O157:H7 str. EC869] >gi|189380102|gb|EDU98518.1| protein GntY [Escherichia coli O157:H7 str. EC508] >gi|190902076|gb|EDV61821.1| protein GntY [Escherichia coli B7A] >gi|190902647|gb|EDV62379.1| protein GntY [Escherichia coli B7A] >gi|190908148|gb|EDV67739.1| protein GntY [Escherichia coli F11] >gi|192932635|gb|EDV85232.1| protein GntY [Escherichia coli E22] >gi|192957881|gb|EDV88324.1| protein GntY [Escherichia coli E110019] >gi|194414928|gb|EDX31198.1| protein GntY [Escherichia coli B171] >gi|194425434|gb|EDX41418.1| protein GntY [Escherichia coli 101-1] (191 aa)
Score = 90, Expect = 8.6e-02, Identities = 21/52 (40%), Positives = 30/52 (57%)
  Q:    28 GGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           GG +  ++   E G   ++  G C GCS++DVT KEG+E  L NE   +K V
  S:   127 GGRVSLMEIT-EDGYAILQFGGGCNGCSMVDVTLKEGIEKQLLNEFPELKGV 177
>gi|28199845|ref|NP_780159.1| hypothetical protein PD1979 [Xylella fastidiosa Temecula1] >gi|182682596|ref|YP_001830756.1| HesB/YadR/YfhF-family protein [Xylella fastidiosa M23] >gi|51702170|sp|Q87A52|NFUA_XYLFT Fe/S biogenesis protein nfuA >gi|28057966|gb|AAO29808.1| conserved hypothetical protein [Xylella fastidiosa Temecula1] >gi|182632706|gb|ACB93482.1| HesB/YadR/YfhF-family protein [Xylella fastidiosa M23] (199 aa)
Score = 90, Expect = 8.7e-02, Identities = 21/52 (40%), Positives = 31/52 (59%)
  Q:    28 GGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           GG +E  + + E G V ++  G C GC + DVT K+G+E  L + V GV +V
  S:   129 GGRVEVQEVSAE-GVVLLRFGGGCHGCGMADVTLKQGVEKTLMDRVHGVIAV 179
>gi|149186788|ref|ZP_01865099.1| hypothetical protein ED21_29856 [Erythrobacter sp. SD-21] >gi|148829696|gb|EDL48136.1| hypothetical protein ED21_29856 [Erythrobacter sp. SD-21] (193 aa)
Score = 90, Expect = 8.8e-02, Identities = 22/71 (30%), Positives = 42/71 (59%)
  Q:     9 IIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           I+ +I +++++ +R  +  DGGD+++  +  + G V +++ G C GC     T K G+E +LK+ V  V  V
  S:   121 IVAQINELLETRVRPAVAGDGGDIQYRGF--KDGVVYLQLQGACSGCPSSTATLKHGIEGLLKHYVPEVVEV 190
>gi|125586047|gb|EAZ26711.1| hypothetical protein OsJ_010194 [Oryza sativa (japonica cultivar-group)] (251 aa)
Score = 90, Expect = 8.8e-02, Identities = 22/69 (31%), Positives = 37/69 (53%)
  Q:    11 DEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEV-EGVKSV 79
           + +  V+D +R Y+  DGGD+       E G +++K+ G C  C     T K G+E +LK +  + VK +
  S:    79 ENVDRVLDDVRPYLIADGGDVTVASV--EDGVISLKLEGACGSCPSSTTTMKMGIERVLKEKFGDAVKDI 146
>gi|163702712|ref|ZP_02121551.1| nitrogen-fixing protein [Methylobacterium nodulans ORS 2060] >gi|162431188|gb|EDQ41793.1| nitrogen-fixing protein [Methylobacterium nodulans ORS 2060] (187 aa)
Score = 90, Expect = 9.0e-02, Identities = 23/67 (34%), Positives = 42/67 (62%)
  Q:    13 IKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKN---EVEGVKSV 79
           IKD++++ +R  +  DGGD+ F  Y   +G V +++ G C GC     T ++G++ + ++   EV  V+SV
  S:   119 IKDLLETRVRPAVAGDGGDITFRGY--REGVVYLEMKGACSGCPSSTATLRQGVQNLFRHFLPEVREVQSV 187
>gi|56415426|ref|YP_152501.1| putative DNA uptake protein [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|81361710|sp|Q5PLY6|NFUA_SALPA Fe/S biogenesis protein nfuA >gi|56129683|gb|AAV79189.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] (191 aa)
Score = 90, Expect = 9.2e-02, Identities = 21/52 (40%), Positives = 30/52 (57%)
  Q:    28 GGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           GG +  ++   E G   ++  G C GCS++DVT KEG+E  L NE   +K V
  S:   127 GGRVSLMEITDE-GYAILQFGGGCNGCSMVDVTLKEGIEKQLLNEFPELKGV 177
>gi|194430959|ref|ZP_03063252.1| protein GntY [Shigella dysenteriae 1012] >gi|194420414|gb|EDX36490.1| protein GntY [Shigella dysenteriae 1012] (191 aa)
Score = 90, Expect = 9.2e-02, Identities = 21/52 (40%), Positives = 30/52 (57%)
  Q:    28 GGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           GG +  ++   E G   ++  G C GCS++DVT KEG+E  L NE   +K V
  S:   127 GGRVSLMEIT-EDGYAILQFGGGCNGCSMVDVTLKEGIEKHLLNEFPELKGV 177
>gi|16762776|ref|NP_458393.1| putative DNA uptake protein [Salmonella enterica subsp. enterica serovar Typhi str. CT18] >gi|29144263|ref|NP_807605.1| putative DNA uptake protein [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] >gi|51701440|sp|Q8Z223|NFUA_SALTI Fe/S biogenesis protein nfuA >gi|25356753|pir||AC0997 conserved hypothetical protein STY4285 [imported] - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) >gi|16505082|emb|CAD08103.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Typhi] >gi|29139900|gb|AAO71465.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Typhi Ty2] (191 aa)
Score = 90, Expect = 9.4e-02, Identities = 21/52 (40%), Positives = 30/52 (57%)
  Q:    28 GGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           GG +  ++   E G   ++  G C GCS++DVT KEG+E  L NE   +K V
  S:   127 GGRVSLMEITDE-GYAILQFGGGCNGCSMVDVTLKEGIEKQLLNEFPELKGV 177
>gi|21674600|ref|NP_662665.1| NifU protein, putative [Chlorobium tepidum TLS] >gi|21647799|gb|AAM73007.1| nifU protein, putative [Chlorobium tepidum TLS] (83 aa)
Score = 90, Expect = 9.9e-02, Identities = 23/74 (31%), Positives = 43/74 (58%)
  Q:     6 TNKIIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKN---EVEGVKSV 79
           T+ + D++   ++++R Y+  DGGD + V    +   V +K+LG C  C +  +T + G+E  +K    E+  V+SV
  S:     8 TDPLYDKVISALETVRPYLQVDGGDCQLVGITKDM-VVDVKLLGACGSCPMSTLTLRAGVEQAIKKANPEIVRVESV 83
>gi|86141694|ref|ZP_01060218.1| nifU protein-like [Flavobacterium sp. MED217] >gi|85831257|gb|EAQ49713.1| nifU protein-like [Leeuwenhoekiella blandensis MED217] (80 aa)
Score = 90, Expect = 9.9e-02, Identities = 20/72 (27%), Positives = 40/72 (55%)
  Q:    12 EIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVIVTE 83
           +++  ++ IR ++  DGGD+  +    +   V +++ G C+GCS+  +T K G+E  +K     ++ VI  E
  S:     9 KVEAALEEIRPFLQSDGGDIALLSIE-DGTTVKVQLEGACVGCSVNQMTLKSGVEMTIKKHAPQIERVINIE 79
>gi|91205888|ref|YP_538243.1| NifU-like protein [Rickettsia bellii RML369-C] >gi|157826752|ref|YP_001495816.1| NifU-like protein [Rickettsia bellii OSU 85-389] >gi|91069432|gb|ABE05154.1| NifU-like protein [Rickettsia bellii RML369-C] >gi|157802056|gb|ABV78779.1| NifU-like protein [Rickettsia bellii OSU 85-389] (185 aa)
Score = 90, Expect = 1.0e-01, Identities = 19/52 (36%), Positives = 32/52 (61%)
  Q:    20 IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKN 71
           +R  + QDGGD+ +  +  E G V + + G C+GC    +T K G+E++LK+
  S:   122 VRPSVAQDGGDIIYKGF--ENGVVKLALRGACLGCPSSTITLKNGIESMLKH 171
>gi|163786509|ref|ZP_02180957.1| thioredoxin-related protein [Flavobacteriales bacterium ALC-1] >gi|159878369|gb|EDP72425.1| thioredoxin-related protein [Flavobacteriales bacterium ALC-1] (300 aa)
Score = 90, Expect = 1.0e-01, Identities = 21/69 (30%), Positives = 37/69 (53%)
  Q:     2 LDNNTNKIIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILK 70
           LD+ +  I++ +++ I      +  DGG++EF  Y+    +V + + G C GC     T K G+E +LK
  S:   220 LDDTSKNIVNILEEYIKPA---VESDGGNIEFKSYDANTKKVEVLLQGACSGCPSSTFTLKNGIENMLK 285
>gi|157148997|ref|YP_001456316.1| putative DNA uptake protein [Citrobacter koseri ATCC BAA-895] >gi|166990520|sp|A8AQW7|NFUA_CITK8 Fe/S biogenesis protein nfuA >gi|157086202|gb|ABV15880.1| hypothetical protein CKO_04835 [Citrobacter koseri ATCC BAA-895] (191 aa)
Score = 90, Expect = 1.0e-01, Identities = 21/52 (40%), Positives = 30/52 (57%)
  Q:    28 GGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           GG +  ++   E G   ++  G C GCS++DVT KEG+E  L NE   +K V
  S:   127 GGRVSLMEITDE-GYAILQFGGGCNGCSMVDVTLKEGIEKQLLNEFPELKGV 177
>gi|42523787|ref|NP_969167.1| nifU related protein [Bdellovibrio bacteriovorus HD100] >gi|39575994|emb|CAE80160.1| nifU related protein [Bdellovibrio bacteriovorus HD100] (186 aa)
Score = 90, Expect = 1.0e-01, Identities = 25/68 (36%), Positives = 37/68 (54%)
  Q:     3 DNNTNKIIDEIKDVID-SIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILK 70
           + N + ++  IK V++  IR  +  DGGD+ F  Y  E   + I + G C GC    VT KEG+E  +K
  S:   108 NENDSPMVRNIKSVLNREIRPVVALDGGDIVFHKY--ENNVLYIHMKGACSGCPSSTVTLKEGIEVRMK 174
>gi|16766799|ref|NP_462414.1| putative DNA uptake protein [Salmonella typhimurium LT2] >gi|62182013|ref|YP_218430.1| putative DNA uptake protein [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|161616554|ref|YP_001590519.1| putative DNA uptake protein [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|167541689|ref|ZP_02337265.1| hypothetical protein Sentent_00345 [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23] >gi|167549282|ref|ZP_02343041.1| hypothetical protein Sentente_02145 [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] >gi|167555312|ref|ZP_02348330.1| hypothetical protein Sententeri_00340 [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853] >gi|167990716|ref|ZP_02571815.1| hypothetical protein Sententer_01000004_0100004682 [Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701] >gi|168220374|ref|ZP_02645606.1| hypothetical protein Senterenterica_08276 [Salmonella enterica subsp. enterica serovar Agona str. SL483] >gi|168224632|ref|ZP_02649863.1| hypothetical protein Sententeric_02558 [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433] >gi|168232650|ref|ZP_02657708.1| hypothetical protein Sententerica_16829 [Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191] >gi|168235106|ref|ZP_02660164.1| hypothetical protein Senteenterica_02884 [Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480] >gi|168241653|ref|ZP_02666585.1| hypothetical protein Senterienterica_08487 [Salmonella enterica subsp. enterica serovar Heidelberg str. SL486] >gi|168260762|ref|ZP_02682735.1| hypothetical protein Salmentericaenterica_06720 [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] >gi|168465218|ref|ZP_02699110.1| protein GntY [Salmonella enterica subsp. enterica serovar Newport str. SL317] >gi|168473477|ref|ZP_02702500.1| hypothetical protein Salmoentericaenterica_02360 [Salmonella enterica subsp. enterica serovar Virchow str. SL491] >gi|168818674|ref|ZP_02830674.1| hypothetical protein Salentericaenterica_04766 [Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537] >gi|194445195|ref|YP_002042763.1| protein GntY [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194448010|ref|YP_002047536.1| protein GntY [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194472075|ref|ZP_03078059.1| protein GntY [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|194735692|ref|YP_002116454.1| protein GntY [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|51701441|sp|Q8ZLI7|NFUA_SALTY Fe/S biogenesis protein nfuA >gi|75480222|sp|Q57IW3|NFUA_SALCH Fe/S biogenesis protein nfuA >gi|189041727|sp|A9MTT1|NFUA_SALPB Fe/S biogenesis protein nfuA >gi|16422070|gb|AAL22373.1| putative thioredoxin-like proteins and domain [Salmonella typhimurium LT2] >gi|62129646|gb|AAX67349.1| putative Thioredoxin-like proteins and domain [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|161365918|gb|ABX69686.1| hypothetical protein SPAB_04370 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|194403858|gb|ACF64080.1| protein GntY [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194406314|gb|ACF66533.1| protein GntY [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194458439|gb|EDX47278.1| protein GntY [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|194711194|gb|ACF90415.1| protein GntY [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|195632440|gb|EDX50924.1| protein GntY [Salmonella enterica subsp. enterica serovar Newport str. SL317] (191 aa)
Score = 89, Expect = 1.0e-01, Identities = 21/52 (40%), Positives = 30/52 (57%)
  Q:    28 GGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           GG +  ++   E G   ++  G C GCS++DVT KEG+E  L NE   +K V
  S:   127 GGRVSLMEITDE-GYAILQFGGGCNGCSMVDVTLKEGIEKQLLNEFPELKGV 177
>gi|85709112|ref|ZP_01040178.1| possible NifU-like domain protein [Erythrobacter sp. NAP1] >gi|85690646|gb|EAQ30649.1| possible NifU-like domain protein [Erythrobacter sp. NAP1] (193 aa)
Score = 89, Expect = 1.0e-01, Identities = 23/72 (31%), Positives = 41/72 (56%)
  Q:     8 KIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           +II  I +++++ +R  +  DGGD+ +  ++   G V + + G C GC     T K G+E++LK+ V  V  V
  S:   120 EIIASINELLETRVRPAVAGDGGDIAYRGFS--DGVVYLTLQGACAGCPSSTATLKHGIESLLKHYVPEVVEV 190
>gi|167041225|gb|ABZ05982.1| putative NifU-like domain protein [uncultured marine microorganism HF4000_001N02] (79 aa)
Score = 89, Expect = 1.1e-01, Identities = 16/42 (38%), Positives = 27/42 (64%)
  Q:    39 EKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           + G+  I   G C GC ++DVT K+G+E ++K+ V G+  V+
  S:    25 DDGKAIIAFGGGCQGCGMVDVTLKQGVEVMIKDSVPGISEVV 66
>gi|150026140|ref|YP_001296966.1| hypothetical protein FP2102 [Flavobacterium psychrophilum JIP02/86] >gi|149772681|emb|CAL44164.1| Protein of unknown function [Flavobacterium psychrophilum JIP02/86] (298 aa)
Score = 89, Expect = 1.1e-01, Identities = 24/70 (34%), Positives = 39/70 (55%)
  Q:     2 LDNNTNKIIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKN 71
           LD  + KII+ I++ I   R  +  DGG++ F  Y  +  +V + + G C GC     T K G+E++LK+
  S:   218 LDVTSQKIINIIEEYI---RPAVAADGGNILFDSYCQDTKQVKVILQGACSGCPSSTFTLKNGIESMLKD 284
>gi|188582635|ref|YP_001926080.1| Scaffold protein Nfu/NifU [Methylobacterium populi BJ001] >gi|179346133|gb|ACB81545.1| Scaffold protein Nfu/NifU [Methylobacterium populi BJ001] (188 aa)
Score = 89, Expect = 1.1e-01, Identities = 21/77 (27%), Positives = 42/77 (54%)
  Q:     3 DNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           D   +  +  IKD++++ +R  +  DGGD+ F  Y    G V +++ G C GC     T ++G++ + ++ +  V+ V
  S:   110 DEADHDTVATIKDLLETRVRPAVAGDGGDITFRGY--RDGIVYLEMKGACSGCPSSTATLRQGVQNLFRHFLPSVREV 185
>gi|88801953|ref|ZP_01117481.1| NifU-like protein [Polaribacter irgensii 23-P] >gi|88782611|gb|EAR13788.1| NifU-like protein [Polaribacter irgensii 23-P] (78 aa)
Score = 89, Expect = 1.1e-01, Identities = 21/75 (28%), Positives = 42/75 (56%)
  Q:     6 TNKIIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           T + ++ ++  ++ IR ++  DGG+++ +    E G V +++ G C GCS+  +T K G+E  +K     +  VI
  S:     3 TEETLENVEKALEEIRPFLMSDGGNIKLLSI--EDGVVKVQLEGACTGCSVNQMTLKNGVEATIKKYAPQIVEVI 75
>gi|23006361|ref|ZP_00048716.1| COG0694: Thioredoxin-like proteins and domains [Magnetospirillum magnetotacticum MS-1] (184 aa)
Score = 89, Expect = 1.1e-01, Identities = 21/77 (27%), Positives = 42/77 (54%)
  Q:     3 DNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           D   +  +  IKD++++ +R  +  DGGD+ F  Y    G V +++ G C GC     T ++G++ + ++ +  V+ V
  S:   106 DEADHDTVATIKDLLETRVRPAVAGDGGDITFRGY--RDGIVYLEMKGACSGCPSSTATLRQGVQNLFRHFLPSVREV 181
>gi|50593019|ref|NP_001002757.1| HIRA interacting protein 5 isoform 3 [Homo sapiens] >gi|50593023|ref|NP_001002756.1| HIRA interacting protein 5 isoform 3 [Homo sapiens] >gi|114577881|ref|XP_001137265.1| PREDICTED: hypothetical protein isoform 3 [Pan troglodytes] >gi|114577883|ref|XP_001137343.1| PREDICTED: hypothetical protein isoform 4 [Pan troglodytes] >gi|114577885|ref|XP_001137421.1| PREDICTED: hypothetical protein isoform 5 [Pan troglodytes] (113 aa)
Score = 89, Expect = 1.2e-01, Identities = 27/77 (35%), Positives = 49/77 (63%)
  Q:     7 NKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILK---NEVEGVKSVIVTE 83
           ++++  IK+++D+ IR  + +DGGD+ +  +  E G V +K+ G C  C    +T K G++ +L+    EVEGV+ V+  E
  S:    26 DEVVAMIKELLDTRIRPTVQEDGGDVIYKGF--EDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQFYIPEVEGVEQVMDDE 104
>gi|161505922|ref|YP_001573034.1| putative DNA uptake protein [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] >gi|189041726|sp|A9MMB3|NFUA_SALAR Fe/S biogenesis protein nfuA >gi|160867269|gb|ABX23892.1| hypothetical protein SARI_04103 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] (191 aa)
Score = 89, Expect = 1.2e-01, Identities = 21/52 (40%), Positives = 30/52 (57%)
  Q:    28 GGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           GG +  ++   E G   ++  G C GCS++DVT KEG+E  L NE   +K V
  S:   127 GGRVSLMEITDE-GYAILQFGGGCNGCSMVDVTLKEGIEKQLLNEFPELKGV 177
>gi|156936423|ref|YP_001440339.1| putative DNA uptake protein [Enterobacter sakazakii ATCC BAA-894] >gi|166990524|sp|A7ME80|NFUA_ENTS8 Fe/S biogenesis protein nfuA >gi|156534677|gb|ABU79503.1| hypothetical protein ESA_04324 [Enterobacter sakazakii ATCC BAA-894] (191 aa)
Score = 89, Expect = 1.2e-01, Identities = 21/52 (40%), Positives = 30/52 (57%)
  Q:    28 GGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           GG +  ++   E G   ++  G C GCS++DVT KEG+E  L NE   +K V
  S:   127 GGRVTLMEITDE-GYAILQFGGGCNGCSMVDVTLKEGIEKQLLNEFPELKGV 177
>gi|167367035|ref|ZP_02301177.1| nitrogen-fixing NifU domain protein [Rhodopseudomonas palustris TIE-1] >gi|192293449|ref|YP_001994054.1| Fe-S cluster assembly protein NifU [Rhodopseudomonas palustris TIE-1] >gi|192287198|gb|ACF03579.1| Fe-S cluster assembly protein NifU [Rhodopseudomonas palustris TIE-1] (328 aa)
Score = 89, Expect = 1.2e-01, Identities = 17/48 (35%), Positives = 29/48 (60%)
  Q:    13 IKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVT 60
           I + ++ +R ++ +DGGD EFV    +   V +++ G C+GC L  VT
  S:   261 IAEAVEELRPHLQRDGGDCEFVSL--DGNIVYVRLSGNCVGCQLSSVT 306
>gi|39937667|ref|NP_949943.1| putative nifU protein [Rhodopseudomonas palustris CGA009] >gi|39651526|emb|CAE30049.1| putative nifU protein [Rhodopseudomonas palustris CGA009] (328 aa)
Score = 89, Expect = 1.2e-01, Identities = 17/48 (35%), Positives = 29/48 (60%)
  Q:    13 IKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVT 60
           I + ++ +R ++ +DGGD EFV    +   V +++ G C+GC L  VT
  S:   261 IAEAVEELRPHLQRDGGDCEFVSL--DGNIVYVRLSGNCVGCQLSSVT 306
>gi|92115649|ref|YP_575378.1| nitrogen-fixing NifU-like [Nitrobacter hamburgensis X14] >gi|91798543|gb|ABE60918.1| nitrogen-fixing NifU-like [Nitrobacter hamburgensis X14] (191 aa)
Score = 89, Expect = 1.3e-01, Identities = 22/70 (31%), Positives = 39/70 (55%)
  Q:     2 LDNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKN 71
            D    + +  IKD+I++ +R  +  DGGD+ F  +  + G V + + G C GC    VT + G++ +LK+
  S:   112 FDEADAETVTLIKDLIETRVRPGVADDGGDITFRGF--KDGVVYVNMKGSCSGCPSSTVTLRNGIQNLLKH 180
>gi|86146559|ref|ZP_01064881.1| hypothetical protein MED222_18183 [Vibrio sp. MED222] >gi|85835616|gb|EAQ53752.1| hypothetical protein MED222_18183 [Vibrio sp. MED222] (194 aa)
Score = 89, Expect = 1.3e-01, Identities = 20/48 (41%), Positives = 28/48 (58%)
  Q:    28 GGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEG 75
           GG +  V+   E+G   +   G C GCS++DVT KEG+E  L  + EG
  S:   129 GGHVSLVEIT-EEGAAIVAFGGGCNGCSMVDVTLKEGIEKELLQQFEG 175
>gi|84386342|ref|ZP_00989370.1| hypothetical protein V12B01_02495 [Vibrio splendidus 12B01] >gi|84378766|gb|EAP95621.1| hypothetical protein V12B01_02495 [Vibrio splendidus 12B01] (194 aa)
Score = 89, Expect = 1.3e-01, Identities = 20/48 (41%), Positives = 28/48 (58%)
  Q:    28 GGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEG 75
           GG +  V+   E+G   +   G C GCS++DVT KEG+E  L  + EG
  S:   129 GGHVSLVEIT-EEGAAIVAFGGGCNGCSMVDVTLKEGIEKELLQQFEG 175
>gi|71275227|ref|ZP_00651514.1| Nitrogen-fixing NifU, C-terminal [Xylella fastidiosa Dixon] >gi|71899552|ref|ZP_00681708.1| HesB/YadR/YfhF:Nitrogen-fixing NifU, C-terminal [Xylella fastidiosa Ann-1] >gi|71899937|ref|ZP_00682084.1| HesB/YadR/YfhF:Nitrogen-fixing NifU, C-terminal [Xylella fastidiosa Ann-1] >gi|170731222|ref|YP_001776655.1| thioredoxin-like protein [Xylella fastidiosa M12] >gi|71164036|gb|EAO13751.1| Nitrogen-fixing NifU, C-terminal [Xylella fastidiosa Dixon] >gi|71730300|gb|EAO32384.1| HesB/YadR/YfhF:Nitrogen-fixing NifU, C-terminal [Xylella fastidiosa Ann-1] >gi|71730681|gb|EAO32756.1| HesB/YadR/YfhF:Nitrogen-fixing NifU, C-terminal [Xylella fastidiosa Ann-1] >gi|167966015|gb|ACA13025.1| thioredoxin-like protein [Xylella fastidiosa M12] (199 aa)
Score = 88, Expect = 1.4e-01, Identities = 21/52 (40%), Positives = 30/52 (57%)
  Q:    28 GGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           GG +E  + + E G V ++  G C GC + DVT K+G+E  L   V GV +V
  S:   129 GGRVEVQEVSAE-GVVLLRFGGGCHGCGMADVTLKQGVEKTLMERVHGVIAV 179
>gi|125543619|gb|EAY89758.1| hypothetical protein OsI_010991 [Oryza sativa (indica cultivar-group)] (251 aa)
Score = 88, Expect = 1.4e-01, Identities = 20/62 (32%), Positives = 33/62 (53%)
  Q:    11 DEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNE 72
           + +  V+D +R Y+  DGGD+       E G +++K+ G C  C     T K G+E +LK +
  S:    79 ENVDRVLDDVRPYLIADGGDVTVASV--EDGVISLKLEGACGSCPSSTTTMKMGIERVLKEK 138
>gi|167344519|ref|ZP_02290360.1| NifU family protein [Listeria monocytogenes FSL J1-208] (71 aa)
Score = 88, Expect = 1.5e-01, Identities = 21/58 (36%), Positives = 32/58 (55%)
  Q:    12 EIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETIL 69
           E+   +   R ++ +DGGD E ++   + G V IK+LG C  C   D+T K G+E  L
  S:     8 EVDKALKKFRPFLVRDGGDYELIEVT-QDGVVKIKLLGACETCPSSDMTLKMGIELTL 64
>gi|75674208|ref|YP_316629.1| nitrogen-fixing NifU [Nitrobacter winogradskyi Nb-255] >gi|74419078|gb|ABA03277.1| nitrogen-fixing NifU [Nitrobacter winogradskyi Nb-255] (190 aa)
Score = 88, Expect = 1.6e-01, Identities = 22/70 (31%), Positives = 38/70 (54%)
  Q:     2 LDNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKN 71
            D    + +  IKD+I++ +R  +  DGGD+ F  +    G V + + G C GC    VT + G++ +LK+
  S:   111 FDEADAETVTLIKDLIETRVRPGVADDGGDITFRGF--RDGIVYVNMKGACSGCPSSTVTLRNGIQNLLKH 179
>gi|115452669|ref|NP_001049935.1| Os03g0314700 [Oryza sativa (japonica cultivar-group)] >gi|108707815|gb|ABF95610.1| NifU-like domain containing protein, expressed [Oryza sativa (japonica cultivar-group)] >gi|113548406|dbj|BAF11849.1| Os03g0314700 [Oryza sativa (japonica cultivar-group)] (224 aa)
Score = 88, Expect = 1.6e-01, Identities = 20/62 (32%), Positives = 33/62 (53%)
  Q:    11 DEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNE 72
           + +  V+D +R Y+  DGGD+       E G +++K+ G C  C     T K G+E +LK +
  S:    79 ENVDRVLDDVRPYLIADGGDVTVASV--EDGVISLKLEGACGSCPSSTTTMKMGIERVLKEK 138
>gi|192288888|ref|YP_001989493.1| Scaffold protein Nfu/NifU [Rhodopseudomonas palustris TIE-1] >gi|192282637|gb|ACE99017.1| Scaffold protein Nfu/NifU [Rhodopseudomonas palustris TIE-1] (188 aa)
Score = 88, Expect = 1.7e-01, Identities = 20/64 (31%), Positives = 38/64 (59%)
  Q:     8 KIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKN 71
           + ++ IKD+I++ +R  +  DGGD+ F  +  + G V + + G C GC     T + G++ +LK+
  S:   114 ETVEIIKDLIETRVRPAVANDGGDITFRGF--KDGIVYLNMRGACAGCPSSTATLQHGIQNLLKH 176
>gi|148976499|ref|ZP_01813195.1| predicted gluconate transport associated protein [Vibrionales bacterium SWAT-3] >gi|145964075|gb|EDK29332.1| predicted gluconate transport associated protein [Vibrionales bacterium SWAT-3] (194 aa)
Score = 88, Expect = 1.7e-01, Identities = 20/48 (41%), Positives = 27/48 (56%)
  Q:    28 GGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEG 75
           GG +  V+   E G   +   G C GCS++DVT KEG+E  L  + EG
  S:   129 GGHVSLVEIT-EDGAAIVAFGGGCNGCSMVDVTLKEGIEKELLQQFEG 175
>gi|39933530|ref|NP_945806.1| NifU-like domain-containing protein [Rhodopseudomonas palustris CGA009] >gi|39647376|emb|CAE25897.1| possible NifU-like domain (residues 119-187) [Rhodopseudomonas palustris CGA009] (188 aa)
Score = 88, Expect = 1.7e-01, Identities = 20/64 (31%), Positives = 38/64 (59%)
  Q:     8 KIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKN 71
           + ++ IKD+I++ +R  +  DGGD+ F  +  + G V + + G C GC     T + G++ +LK+
  S:   114 ETVEIIKDLIETRVRPAVANDGGDITFRGF--KDGIVYLNMRGACAGCPSSTATLQHGIQNLLKH 176
>gi|67155723|ref|ZP_00417350.1| HesB/YadR/YfhF:Nitrogen-fixing NifU, C-terminal [Azotobacter vinelandii AvOP] >gi|67086667|gb|EAM06135.1| HesB/YadR/YfhF:Nitrogen-fixing NifU, C-terminal [Azotobacter vinelandii AvOP] (194 aa)
Score = 88, Expect = 1.7e-01, Identities = 23/71 (32%), Positives = 40/71 (56%)
  Q:     9 IIDEIKDVIDSIRFYINQD--------GGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           +IDE   + + I +Y+  +        GG +  VD   E+G   ++  G C GC ++D+T K+G+E  L   +  +K V
  S:   103 MIDEDSPLGERINYYLQTEINPGLASHGGQVSLVDI-VEEGIAVLRFGGGCQGCGMVDMTLKDGVEKTLLERIPDLKGV 180
>gi|115376684|ref|ZP_01463912.1| NifU domain protein [Stigmatella aurantiaca DW4/3-1] >gi|115366301|gb|EAU65308.1| NifU domain protein [Stigmatella aurantiaca DW4/3-1] (187 aa)
Score = 88, Expect = 1.7e-01, Identities = 24/68 (35%), Positives = 37/68 (54%)
  Q:    13 IKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           I++++D+ IR  + QDGGD+    Y  E G V + + G C GC     T K G+E  L+  +  V  V+
  S:   119 IREILDAEIRPAVAQDGGDITLDRY--ENGVVYLHMQGSCSGCPSSTATLKMGIEGRLREAIPEVTEVV 185
>gi|156452214|ref|ZP_02058586.1| Scaffold protein Nfu/NifU-like protein [Methylobacterium chloromethanicum CM4] >gi|163852613|ref|YP_001640656.1| scaffold protein Nfu/NifU [Methylobacterium extorquens PA1] >gi|156188831|gb|EDO21028.1| Scaffold protein Nfu/NifU-like protein [Methylobacterium chloromethanicum CM4] >gi|163664218|gb|ABY31585.1| Scaffold protein Nfu/NifU [Methylobacterium extorquens PA1] (188 aa)
Score = 88, Expect = 1.7e-01, Identities = 21/77 (27%), Positives = 42/77 (54%)
  Q:     3 DNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           D   +  +  IKD++++ +R  +  DGGD+ F  Y    G V +++ G C GC     T ++G++ + ++ +  V+ V
  S:   110 DEADHDTVVTIKDLLETRVRPAVAGDGGDITFRGY--RDGIVYLEMKGACSGCPSSTATLRQGVQNLFRHFLPSVREV 185
>gi|85714190|ref|ZP_01045179.1| nitrogen-fixing NifU [Nitrobacter sp. Nb-311A] >gi|85699316|gb|EAQ37184.1| nitrogen-fixing NifU [Nitrobacter sp. Nb-311A] (190 aa)
Score = 88, Expect = 1.7e-01, Identities = 22/70 (31%), Positives = 39/70 (55%)
  Q:     2 LDNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKN 71
            D    + +  IKD+I++ +R  +  DGGD+ F  +  + G V + + G C GC    VT + G++ +LK+
  S:   111 FDEADAETVTLIKDLIETRVRPGVADDGGDITFRGF--KDGVVYVNMKGACSGCPSSTVTLRNGIQNLLKH 179
>gi|57168801|ref|ZP_00367932.1| nifU protein homolog Cj1639 [Campylobacter coli RM2228] >gi|57019848|gb|EAL56531.1| nifU protein homolog Cj1639 [Campylobacter coli RM2228] (90 aa)
Score = 87, Expect = 1.7e-01, Identities = 23/73 (31%), Positives = 40/73 (54%)
  Q:     1 MLDNNTNKIIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEV 73
           M+  +  ++I+ +K  +D     + +DGG LEF+    + G V + ++G C GC+    T K GLE  LK ++
  S:     1 MMPFSDEELINPVKASLDKSMPMLERDGGGLEFLGI--KNGVVYVHLIGACKGCASSGTTLKYGLERQLKIDI 71
>gi|182677480|ref|YP_001831626.1| NifU domain-containing protein [Beijerinckia indica subsp. indica ATCC 9039] >gi|182633363|gb|ACB94137.1| nitrogen-fixing NifU domain protein [Beijerinckia indica subsp. indica ATCC 9039] (106 aa)
Score = 87, Expect = 1.8e-01, Identities = 19/48 (39%), Positives = 29/48 (60%)
  Q:    13 IKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVT 60
           I + I+SIR  + +D GD E +D   +K  V +K+ G C+GC L  +T
  S:    33 IAETIESIRPNLQRDKGDCELIDVQGDK--VFVKMTGACVGCQLSSMT 78
>gi|170741563|ref|YP_001770218.1| scaffold protein Nfu/NifU [Methylobacterium sp. 4-46] >gi|168195837|gb|ACA17784.1| Scaffold protein Nfu/NifU [Methylobacterium sp. 4-46] (187 aa)
Score = 87, Expect = 1.8e-01, Identities = 20/67 (29%), Positives = 40/67 (59%)
  Q:    13 IKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           IKD++++ +R  +  DGGD+ F  Y   +G V +++ G C GC     T ++G++ + ++ +  V+ V
  S:   119 IKDLLETRVRPAVAGDGGDITFRGY--REGVVYLEMKGACSGCPSSTATLRQGVQNLFRHFLPEVREV 184
>gi|39934444|ref|NP_946720.1| nitrogen-fixing NifU, C-terminal [Rhodopseudomonas palustris CGA009] >gi|39648293|emb|CAE26813.1| Nitrogen-fixing NifU, C-terminal [Rhodopseudomonas palustris CGA009] (355 aa)
Score = 87, Expect = 1.9e-01, Identities = 21/51 (41%), Positives = 28/51 (54%)
  Q:    10 IDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVT 60
           I  I D I ++R  I  DGGDLE +  N  + EV  K+ G+C  C L+  T
  S:   286 IKIISDTIAALRPNIQADGGDLELISVNGNRIEV--KLHGKCRACGLVGQT 334
>gi|86135255|ref|ZP_01053836.1| nifU related protein [Tenacibaculum sp. MED152] >gi|85819428|gb|EAQ40585.1| nifU related protein [Polaribacter dokdonensis MED152] (301 aa)
Score = 87, Expect = 1.9e-01, Identities = 20/59 (33%), Positives = 35/59 (59%)
  Q:    12 EIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILK 70
           +I D++D  I+  +  DGG++ F  Y+ +   V++ + G C GC     T K G+E++LK
  S:   227 QISDILDEYIKPAVAGDGGNIAFRSYDEQNKVVSVILQGACSGCPSSTATLKNGIESLLK 286
>gi|118470355|ref|YP_886620.1| hypothetical protein MSMEG_2268 [Mycobacterium smegmatis str. MC2 155] >gi|118171642|gb|ABK72538.1| conserved hypothetical protein [Mycobacterium smegmatis str. MC2 155] (295 aa)
Score = 87, Expect = 2.0e-01, Identities = 22/62 (35%), Positives = 33/62 (53%)
  Q:    20 IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVIV 81
           +R  +   GGD+  V    E G   +++ G C GCS+  VT ++ +ET L   V+GV  V V
  S:   101 VRPQLRSHGGDVTLVRI--ESGTAFVRLEGACNGCSMSAVTLRQLVETALLEGVQGVSKVEV 160
>gi|156389173|ref|XP_001634866.1| predicted protein [Nematostella vectensis] >gi|156221954|gb|EDO42803.1| predicted protein [Nematostella vectensis] (186 aa)
Score = 87, Expect = 2.1e-01, Identities = 25/75 (33%), Positives = 43/75 (57%)
  Q:     5 NTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           N +  +  IK+++D+ IR  + +DGGD+ F  +  + G V +K+ G C  C    VT K G+E +++  +  V SV
  S:   107 NDDDTVLMIKELLDTRIRPTVQEDGGDIIFKGF--KDGIVKLKMQGACASCPSSIVTLKNGIENMMQFYIPEVVSV 180
>gi|146313459|ref|YP_001178533.1| putative DNA uptake protein [Enterobacter sp. 638] >gi|166990523|sp|A4WFK2|NFUA_ENT38 Fe/S biogenesis protein nfuA >gi|145320335|gb|ABP62482.1| HesB/YadR/YfhF-family protein [Enterobacter sp. 638] (191 aa)
Score = 87, Expect = 2.1e-01, Identities = 18/41 (43%), Positives = 25/41 (60%)
  Q:    39 EKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           E G   ++  G C GCS++DVT KEG+E  + NE   +K V
  S:   137 EDGLAILQFGGGCNGCSMVDVTLKEGIEKQMLNEFPELKGV 177
>gi|145630391|ref|ZP_01786172.1| predicted gluconate transport-associated protein [Haemophilus influenzae 22.4-21] >gi|144984126|gb|EDJ91563.1| predicted gluconate transport-associated protein [Haemophilus influenzae R3021] (198 aa)
Score = 87, Expect = 2.1e-01, Identities = 24/71 (33%), Positives = 43/71 (60%)
  Q:     9 IIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLE----TILKNEVEGVKSV 79
           +I+ ++ VI + I   +   GG +  ++   E G   ++  G C GCS++DVT K+G+E    ++  NE++G K V
  S:   113 LIERVEYVIQTQINPQLANHGGRITLIEIT-EDGYAVLQFGGGCNGCSMVDVTLKDGVEKQLVSLFPNELKGAKDV 187
>gi|170741742|ref|YP_001770397.1| Fe-S cluster assembly protein NifU [Methylobacterium sp. 4-46] >gi|168196016|gb|ACA17963.1| Fe-S cluster assembly protein NifU [Methylobacterium sp. 4-46] (329 aa)
Score = 87, Expect = 2.2e-01, Identities = 17/48 (35%), Positives = 29/48 (60%)
  Q:    13 IKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVT 60
           I   I+++R  + +DGGD E V+   E   V++++ G C+GC +  VT
  S:   262 IDKAIEALRPVLQRDGGDCELVEV--EGTVVSVRLSGACVGCQMASVT 307
>gi|146281734|ref|YP_001171887.1| Fe-S cluster assembly protein NifU [Pseudomonas stutzeri A1501] >gi|145569939|gb|ABP79045.1| Fe-S cluster assembly protein NifU [Pseudomonas stutzeri A1501] (316 aa)
Score = 87, Expect = 2.2e-01, Identities = 23/73 (31%), Positives = 40/73 (54%)
  Q:    10 IDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVIVT 82
           I  I+ V++SIR  + +D GD+E +D   E   + +K+ G C GC +  +T     + +++   E VK V V+
  S:   236 IRRIERVLESIRPTLQRDHGDVELLDV--EGKNIYVKLTGACTGCQMASMTLSGIQQRLIEELGEFVKVVPVS 306
>gi|149000|gb|AAA25015.1| The predicted molecular weight and pI of ORF G are 21.8 Kd and 4.3 respectively; ORF G; putative (198 aa)
Score = 86, Expect = 2.3e-01, Identities = 23/71 (32%), Positives = 43/71 (60%)
  Q:     9 IIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLE----TILKNEVEGVKSV 79
           +I+ ++ VI + I   +   GG +  ++   E G   ++  G C GCS++DVT K+G+E    ++  NE++G K +
  S:   113 LIERVEYVIQTQINPQLANHGGRITLIEIT-EDGYAVLQFGGGCNGCSMVDVTLKDGVEKQLVSLFPNELKGAKDI 187
>gi|113476915|ref|YP_722976.1| nitrogen-fixing NifU-like [Trichodesmium erythraeum IMS101] >gi|110167963|gb|ABG52503.1| nitrogen-fixing NifU-like [Trichodesmium erythraeum IMS101] (80 aa)
Score = 86, Expect = 2.3e-01, Identities = 22/69 (31%), Positives = 38/69 (55%)
  Q:    11 DEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           + ++ V+D +R Y+  DGG++E VD   E   V +++ G C  C    +T K G+E  L+ E+  +  V
  S:    10 ENVEIVLDELRPYLAADGGNVELVDI--EGPIVKLRLQGACSSCPSSTMTLKMGIERKLREEIPEIAEV 76
>gi|127511040|ref|YP_001092237.1| putative DNA uptake protein [Shewanella loihica PV-4] >gi|150383448|sp|A3Q930|NFUA_SHELP Fe/S biogenesis protein nfuA >gi|126636335|gb|ABO21978.1| HesB/YadR/YfhF-family protein [Shewanella loihica PV-4] (192 aa)
Score = 86, Expect = 2.5e-01, Identities = 26/69 (37%), Positives = 41/69 (59%)
  Q:    11 DEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLET----ILKNEVEGVKSV 79
           + I+ VI S I   +   GG++  VD + E G   ++  G C GCS++DVT K+G+E     +   E+ GV+ V
  S:   109 ERIEYVIQSEINPQLASHGGNIMLVDID-EAGIAILQFGGGCNGCSMVDVTLKDGIEKQLLDMFPGELTGVRDV 181
>gi|157826074|ref|YP_001493794.1| hypothetical protein A1C_05170 [Rickettsia akari str. Hartford] >gi|157800032|gb|ABV75286.1| hypothetical protein A1C_05170 [Rickettsia akari str. Hartford] (190 aa)
Score = 86, Expect = 2.5e-01, Identities = 19/52 (36%), Positives = 31/52 (59%)
  Q:    20 IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKN 71
           +R  + QDGGD+ +  +  E G V + + G C GC    +T K G+E++LK+
  S:   125 VRPSVAQDGGDIIYKGF--ENGVVKLALRGACRGCPSSTITLKNGIESMLKH 174
>gi|126649012|ref|ZP_01721492.1| hypothetical protein ALPR1_14324 [Algoriphagus sp. PR1] >gi|126574883|gb|EAZ79254.1| hypothetical protein ALPR1_14324 [Algoriphagus sp. PR1] (82 aa)
Score = 86, Expect = 2.5e-01, Identities = 21/69 (30%), Positives = 39/69 (56%)
  Q:    11 DEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           ++I+  +D+IR Y+  DGG++  V+   E   + I++LG C  C +  +T K G+E  +K  +  +  V
  S:     7 NKIEFALDTIRPYLEADGGNVRIVELT-EDMVLRIEMLGSCGSCPMSSMTLKAGVEDAIKRAIPEITKV 74
>gi|73749405|ref|YP_308644.1| nifU protein,-like protein [Dehalococcoides sp. CBDB1] >gi|147670014|ref|YP_001214832.1| NifU domain-containing protein [Dehalococcoides sp. BAV1] >gi|73661121|emb|CAI83728.1| nifU protein, homolog [Dehalococcoides sp. CBDB1] >gi|146270962|gb|ABQ17954.1| nitrogen-fixing NifU domain protein [Dehalococcoides sp. BAV1] (72 aa)
Score = 86, Expect = 2.5e-01, Identities = 26/72 (36%), Positives = 46/72 (63%)
  Q:     9 IIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           ++++++ V+D IR  +  DGG++E V  +   G V +K++G C GC +  +T K G+E ILK E+  +K V+
  S:     1 MLEKVEAVLDKIRPALEADGGNVELV--DVVDGVVKVKLVGACAGCPMSTMTLKNGIERILKREIPEIKEVV 70
>gi|93007026|ref|YP_581463.1| HesB/YadR/YfhF [Psychrobacter cryohalolentis K5] >gi|92394704|gb|ABE75979.1| HesB/YadR/YfhF [Psychrobacter cryohalolentis K5] (257 aa)
Score = 86, Expect = 2.5e-01, Identities = 19/53 (35%), Positives = 33/53 (62%)
  Q:    28 GGDLEFVDYNPEKG---EVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           GGD++ ++   E+G      +K  G C GCS +D+T ++G+E  LK ++  +  VI
  S:   188 GGDVQLLELIDEEGVGLTAVLKFGGGCQGCSAVDMTLRQGVEVQLKQQIPELTQVI 243
>gi|16272381|ref|NP_438594.1| putative DNA uptake protein [Haemophilus influenzae Rd KW20] >gi|1176271|sp|P31774|NFUA_HAEIN Fe/S biogenesis protein nfuA >gi|148877|gb|AAA24950.1| ORF 3 >gi|1573408|gb|AAC22092.1| orfG protein [Haemophilus influenzae Rd KW20] (198 aa)
Score = 86, Expect = 2.5e-01, Identities = 23/71 (32%), Positives = 43/71 (60%)
  Q:     9 IIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLE----TILKNEVEGVKSV 79
           +I+ ++ VI + I   +   GG +  ++   E G   ++  G C GCS++DVT K+G+E    ++  NE++G K +
  S:   113 LIERVEYVIQTQINPQLANHGGRITLIEIT-EDGYAVLQFGGGCNGCSMVDVTLKDGVEKQLVSLFPNELKGAKDI 187
>gi|190575128|ref|YP_001972973.1| putative iron-sulphur cluster/NifU like protein [Stenotrophomonas maltophilia K279a] >gi|190013050|emb|CAQ46682.1| putative iron-sulphur cluster/NifU like protein [Stenotrophomonas maltophilia K279a] (199 aa)
Score = 86, Expect = 2.6e-01, Identities = 20/52 (38%), Positives = 29/52 (55%)
  Q:    28 GGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           GG +   + + E G V ++  G C GC + DVT K+G+E  L   V GV +V
  S:   129 GGKVAVQEVSAE-GVVLLRFGGGCQGCGMADVTLKQGIEKTLMGRVPGVTAV 179
>gi|194366446|ref|YP_002029056.1| HesB/YadR/YfhF-family protein [Stenotrophomonas maltophilia R551-3] >gi|194349250|gb|ACF52373.1| HesB/YadR/YfhF-family protein [Stenotrophomonas maltophilia R551-3] (199 aa)
Score = 86, Expect = 2.6e-01, Identities = 20/52 (38%), Positives = 29/52 (55%)
  Q:    28 GGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           GG +   + + E G V ++  G C GC + DVT K+G+E  L   V GV +V
  S:   129 GGKVAVQEVSAE-GVVLLRFGGGCQGCGMADVTLKQGIEKTLMGRVPGVTAV 179
>gi|195941174|ref|ZP_03086556.1| putative DNA uptake protein [Escherichia coli O157:H7 str. EC4024] (152 aa)
Score = 86, Expect = 2.6e-01, Identities = 18/41 (43%), Positives = 25/41 (60%)
  Q:    39 EKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           E G   ++  G C GCS++DVT KEG+E  + NE   +K V
  S:    98 EDGLAILQFGGGCNGCSMVDVTLKEGIEKQMLNEFPELKGV 138
>gi|87303149|ref|ZP_01085947.1| NifU-like protein [Synechococcus sp. WH 5701] >gi|87282316|gb|EAQ74276.1| NifU-like protein [Synechococcus sp. WH 5701] (97 aa)
Score = 86, Expect = 2.6e-01, Identities = 20/71 (28%), Positives = 39/71 (54%)
  Q:    10 IDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           ++ ++ V+D +R Y+  DGG++E V+ +     V +++ G C  C    +T K G+E  L+  +  V  V+
  S:    26 VENVERVLDELRPYLMADGGNVEIVEIDGPT--VKVRLQGACGSCPSSTMTLKMGIERKLREAIPEVNEVV 94
>gi|88803877|ref|ZP_01119397.1| nifU related protein [Robiginitalea biformata HTCC2501] >gi|88784756|gb|EAR15925.1| nifU related protein [Robiginitalea biformata HTCC2501] (300 aa)
Score = 86, Expect = 2.8e-01, Identities = 20/65 (30%), Positives = 35/65 (53%)
  Q:     7 NKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKN 71
           + I  EI  +++  ++  +  DGG++ F  Y  E   V + + G C GC     T K G++T+L+N
  S:   221 DPISQEIAGILEEYVKPAVASDGGNIVFQSYEAESKTVHVILQGACSGCPSSTFTLKNGIQTMLQN 286
>gi|16120470|ref|NP_403783.1| putative DNA uptake protein [Yersinia pestis CO92] >gi|22127773|ref|NP_671196.1| putative DNA uptake protein [Yersinia pestis KIM] >gi|45439990|ref|NP_991529.1| putative DNA uptake protein [Yersinia pestis biovar Microtus str. 91001] >gi|51598063|ref|YP_072254.1| putative DNA uptake protein [Yersinia pseudotuberculosis IP 32953] >gi|108809333|ref|YP_653249.1| putative DNA uptake protein [Yersinia pestis Antiqua] >gi|108814098|ref|YP_649865.1| putative DNA uptake protein [Yersinia pestis Nepal516] >gi|145597377|ref|YP_001161452.1| putative DNA uptake protein [Yersinia pestis Pestoides F] >gi|150260809|ref|ZP_01917537.1| predicted gluconate transport associated protein [Yersinia pestis CA88-4125] >gi|153947285|ref|YP_001402938.1| putative DNA uptake protein [Yersinia pseudotuberculosis IP 31758] >gi|162421404|ref|YP_001608065.1| putative DNA uptake protein [Yersinia pestis Angola] >gi|165928048|ref|ZP_02223880.1| hesB-like domain/nifU-like domain protein [Yersinia pestis biovar Orientalis str. F1991016] >gi|165936266|ref|ZP_02224835.1| hesB-like domain/nifU-like domain protein [Yersinia pestis biovar Orientalis str. IP275] >gi|166010431|ref|ZP_02231329.1| hesB-like domain/nifU-like domain protein [Yersinia pestis biovar Antiqua str. E1979001] >gi|166214579|ref|ZP_02240614.1| hesB-like domain/nifU-like domain protein [Yersinia pestis biovar Antiqua str. B42003004] >gi|167399248|ref|ZP_02304772.1| hesB-like domain/nifU-like domain protein [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167419001|ref|ZP_02310754.1| hesB-like domain/nifU-like domain protein [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167426539|ref|ZP_02318292.1| hesB-like domain/nifU-like domain protein [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167468684|ref|ZP_02333388.1| hesB-like domain/nifU-like domain protein [Yersinia pestis FV-1] >gi|170022424|ref|YP_001718929.1| IscR-regulated protein YhgI [Yersinia pseudotuberculosis YPIII] >gi|186897263|ref|YP_001874375.1| IscR-regulated protein YhgI [Yersinia pseudotuberculosis PB1/+] >gi|51702126|sp|Q8ZJI0|NFUA_YERPE Fe/S biogenesis protein nfuA >gi|81638196|sp|Q664J6|NFUA_YERPS Fe/S biogenesis protein nfuA >gi|119370621|sp|Q1C2L8|NFUA_YERPA Fe/S biogenesis protein nfuA >gi|119370622|sp|Q1CCL5|NFUA_YERPN Fe/S biogenesis protein nfuA >gi|166990533|sp|A7FNW0|NFUA_YERP3 Fe/S biogenesis protein nfuA >gi|166990534|sp|A4TGR7|NFUA_YERPP Fe/S biogenesis protein nfuA >gi|21960901|gb|AAM87447.1|AE013995_2 hypothetical protein y3903 [Yersinia pestis KIM] >gi|45434845|gb|AAS60406.1| Thioredoxin-like proteins and domains [Yersinia pestis biovar Microtus str. 91001] >gi|51591345|emb|CAH23011.1| conserved hypothetical protein [Yersinia pseudotuberculosis IP 32953] >gi|108777746|gb|ABG20265.1| hypothetical protein YPN_3938 [Yersinia pestis Nepal516] >gi|108781246|gb|ABG15304.1| hypothetical protein YPA_3342 [Yersinia pestis Antiqua] >gi|115345949|emb|CAL18813.1| conserved hypothetical protein [Yersinia pestis CO92] >gi|145209073|gb|ABP38480.1| hypothetical protein YPDSF_0054 [Yersinia pestis Pestoides F] >gi|149290217|gb|EDM40294.1| predicted gluconate transport associated protein [Yersinia pestis CA88-4125] >gi|152958780|gb|ABS46241.1| hesB-like domain/nifU-like domain protein [Yersinia pseudotuberculosis IP 31758] >gi|162354219|gb|ABX88167.1| hesB-like domain/nifU-like domain protein [Yersinia pestis Angola] >gi|165915880|gb|EDR34488.1| hesB-like domain/nifU-like domain protein [Yersinia pestis biovar Orientalis str. IP275] >gi|165919997|gb|EDR37298.1| hesB-like domain/nifU-like domain protein [Yersinia pestis biovar Orientalis str. F1991016] >gi|165990521|gb|EDR42822.1| hesB-like domain/nifU-like domain protein [Yersinia pestis biovar Antiqua str. E1979001] >gi|166204234|gb|EDR48714.1| hesB-like domain/nifU-like domain protein [Yersinia pestis biovar Antiqua str. B42003004] >gi|166962995|gb|EDR59016.1| hesB-like domain/nifU-like domain protein [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167051752|gb|EDR63160.1| hesB-like domain/nifU-like domain protein [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167054527|gb|EDR64335.1| hesB-like domain/nifU-like domain protein [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|169748958|gb|ACA66476.1| IscR-regulated protein YhgI [Yersinia pseudotuberculosis YPIII] >gi|186700289|gb|ACC90918.1| IscR-regulated protein YhgI [Yersinia pseudotuberculosis PB1/+] (191 aa)
Score = 86, Expect = 2.8e-01, Identities = 20/52 (38%), Positives = 30/52 (57%)
  Q:    28 GGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           GG +  ++  PE G   ++  G C GCS++DVT KEG+E  L  +   +K V
  S:   127 GGRVTLMEITPE-GLAILQFGGGCNGCSMVDVTLKEGIEKELLQKFPELKGV 177
>gi|116059759|emb|CAL55466.1| nitrogen fixation NifU-like family protein (ISS) [Ostreococcus tauri] (186 aa)
Score = 86, Expect = 2.8e-01, Identities = 18/63 (28%), Positives = 35/63 (55%)
  Q:    10 IDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNE 72
           ++ +   +D +R Y+  DGG++E V    + G + +++ G C  C+    T K G+E +LK +
  S:    40 MENVDAALDEVRPYLIADGGNVELVTI--DDGMIVVRLNGACGTCASSTATMKGGIEKLLKQK 100
>gi|85374519|ref|YP_458581.1| hypothetical protein ELI_08460 [Erythrobacter litoralis HTCC2594] >gi|84787602|gb|ABC63784.1| hypothetical protein ELI_08460 [Erythrobacter litoralis HTCC2594] (192 aa)
Score = 86, Expect = 2.9e-01, Identities = 22/71 (30%), Positives = 41/71 (57%)
  Q:     9 IIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           I+ +I +++++ +R  +  DGGD+ +  +  + G V + + G C GC     T K+G+E +LK+ V  V  V
  S:   120 IVAQINELLETRVRPAVAGDGGDIAYRGF--KDGVVYLTLQGACSGCPSSTATLKQGIEGLLKHYVPEVVEV 189
>gi|86747711|ref|YP_484207.1| nitrogen-fixing NifU-like [Rhodopseudomonas palustris HaA2] >gi|86570739|gb|ABD05296.1| Nitrogen-fixing NifU-like [Rhodopseudomonas palustris HaA2] (188 aa)
Score = 86, Expect = 2.9e-01, Identities = 20/64 (31%), Positives = 38/64 (59%)
  Q:     8 KIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKN 71
           + ++ IKD+I++ +R  +  DGGD+ F  +  + G V + + G C GC     T + G++ +LK+
  S:   115 ETVEIIKDLIETRVRPAVANDGGDITFRGF--KDGIVYLAMKGACSGCPSSTATLQHGIQNLLKH 177
>gi|59713068|ref|YP_205844.1| putative DNA uptake protein [Vibrio fischeri ES114] >gi|163730793|ref|ZP_02138264.1| predicted gluconate transport associated protein [Vibrio fischeri MJ11] >gi|75353229|sp|Q5E1Z0|NFUA_VIBF1 Fe/S biogenesis protein nfuA >gi|59481169|gb|AAW86956.1| predicted gluconate transport associated protein [Vibrio fischeri ES114] >gi|161395974|gb|EDQ20272.1| predicted gluconate transport associated protein [Vibrio fischeri MJ11] (194 aa)
Score = 86, Expect = 2.9e-01, Identities = 20/48 (41%), Positives = 29/48 (60%)
  Q:    28 GGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEG 75
           GG +  ++ N E G   ++  G C GCS++DVT KEG+E  L  + EG
  S:   129 GGHVSLMEINDE-GVAIVQFGGGCNGCSMVDVTLKEGIEKELLVQFEG 175
>gi|172035933|ref|YP_001802434.1| NifU-like protein [Cyanothece sp. ATCC 51142] >gi|171697387|gb|ACB50368.1| NifU-like protein [Cyanothece sp. ATCC 51142] (80 aa)
Score = 85, Expect = 2.9e-01, Identities = 21/69 (30%), Positives = 37/69 (53%)
  Q:    11 DEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           D ++ V+D +R Y+  DGG++E V+   E   V +++ G C  C    +T K G+E  L+  +  +  V
  S:    10 DNVEQVLDEMRPYLMADGGNVELVEI--EGPIVKLRLQGACGSCPSSTMTLKMGIERRLREMIPEIAEV 76
>gi|170747078|ref|YP_001753338.1| scaffold protein Nfu/NifU [Methylobacterium radiotolerans JCM 2831] >gi|170653600|gb|ACB22655.1| Scaffold protein Nfu/NifU [Methylobacterium radiotolerans JCM 2831] (188 aa)
Score = 85, Expect = 3.0e-01, Identities = 20/77 (25%), Positives = 43/77 (55%)
  Q:     3 DNNTNKIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           D   +  +  IKD++++ +R  +  DGGD+ F  Y  ++G V +++ G C GC     T + G++ + ++ +  ++ V
  S:   110 DEADHDTVVTIKDLLETRVRPAVAGDGGDITFRGY--KEGVVYLEMKGACSGCPSSTATLRHGVQNLFRHFLPEIREV 185
>gi|119509243|ref|ZP_01628393.1| Nitrogen-fixing NifU-like protein [Nodularia spumigena CCY9414] >gi|119466085|gb|EAW46972.1| Nitrogen-fixing NifU-like protein [Nodularia spumigena CCY9414] (277 aa)
Score = 85, Expect = 3.0e-01, Identities = 19/72 (26%), Positives = 35/72 (48%)
  Q:     9 IIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           +I+ I   ++ +R  +    GD+EFV   P    V +K++G C  C    +T  + +E  +KN    +  V+
  S:    85 LIERINTALEEVRPGLKSHDGDVEFVAIKPPD-TVEVKLIGSCSSCPTSTLTLTQSVEQAIKNHCPEITKVV 155
>gi|32491050|ref|NP_871304.1| hypothetical protein WGLp301 [Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis] >gi|25166257|dbj|BAC24447.1| yhgI [Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis] (207 aa)
Score = 85, Expect = 3.1e-01, Identities = 30/78 (38%), Positives = 41/78 (52%)
  Q:     3 DNNTNKIIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           +N  N+I + IK  I+S   Y    GG +E +D   E   V +K  G C GCS+  VT KEG+E  +K     +K VI
  S:   121 ENLKNRISNFIKYKINSKLEY---HGGFVELIDIK-ENMFVILKFFGGCNGCSMAKVTLKEGIEKEIKKNFPNIKGVI 194
>gi|188997215|ref|YP_001931466.1| nitrogen-fixing NifU domain protein [Sulfurihydrogenibium sp. YO3AOP1] >gi|188932282|gb|ACD66912.1| nitrogen-fixing NifU domain protein [Sulfurihydrogenibium sp. YO3AOP1] (84 aa)
Score = 85, Expect = 3.1e-01, Identities = 22/72 (30%), Positives = 41/72 (56%)
  Q:    12 EIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVIVTE 83
           E+++++D +R  +  D G++E V    E  EV +K+ G C  C + D+T K+ +   +K  +  VK+V + E
  S:     9 EVREILDKVRPALLADAGNIELVKV--ENDEVFLKLYGTCQTCPVADMTMKDLVIYTIKESLPWVKAVNIGE 78
>gi|167213066|ref|ZP_02283373.1| hypothetical protein LmonL_21609 [Listeria monocytogenes LO28] (70 aa)
Score = 85, Expect = 3.2e-01, Identities = 21/62 (33%), Positives = 34/62 (54%)
  Q:    12 EIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEV 73
           E+   +   R ++ +DGGD E ++   + G V IK+LG C  C   D+T K G+E  L  ++
  S:     8 EVDKALKKFRPFLVRDGGDYELIEVT-QDGIVKIKLLGACETCPSSDMTLKMGIELTLAEKL 68
>gi|53733260|ref|ZP_00156269.2| COG0316: Uncharacterized conserved protein [Haemophilus influenzae R2866] >gi|68249033|ref|YP_248145.1| putative DNA uptake protein [Haemophilus influenzae 86-028NP] >gi|145628803|ref|ZP_01784603.1| conserved hypothetical 21.9 kD protein in locus involved in transformation [Haemophilus influenzae 22.1-21] >gi|145636298|ref|ZP_01791967.1| predicted gluconate transport-associated protein [Haemophilus influenzae PittHH] >gi|145638657|ref|ZP_01794266.1| predicted gluconate transport-associated protein [Haemophilus influenzae PittII] >gi|145640398|ref|ZP_01795982.1| conserved hypothetical 21.9 kD protein in locus involved in transformation [Haemophilus influenzae R3021] >gi|148825287|ref|YP_001290040.1| putative DNA uptake protein [Haemophilus influenzae PittEE] >gi|148827630|ref|YP_001292383.1| putative DNA uptake protein [Haemophilus influenzae PittGG] >gi|81336556|sp|Q4QNB2|NFUA_HAEI8 Fe/S biogenesis protein nfuA >gi|166990525|sp|A5UA56|NFUA_HAEIE Fe/S biogenesis protein nfuA >gi|166990526|sp|A5UGU4|NFUA_HAEIG Fe/S biogenesis protein nfuA >gi|68057232|gb|AAX87485.1| conserved hypothetical 21.9 kD protein in locus involved in transformation [Haemophilus influenzae 86-028NP] >gi|144979273|gb|EDJ88959.1| conserved hypothetical 21.9 kD protein in locus involved in transformation [Haemophilus influenzae 22.1-21] >gi|145270463|gb|EDK10397.1| predicted gluconate transport-associated protein [Haemophilus influenzae PittHH] >gi|145272252|gb|EDK12160.1| predicted gluconate transport-associated protein [Haemophilus influenzae PittII] >gi|145274984|gb|EDK14846.1| conserved hypothetical 21.9 kD protein in locus involved in transformation [Haemophilus influenzae 22.4-21] >gi|148715447|gb|ABQ97657.1| predicted gluconate transport-associated protein [Haemophilus influenzae PittEE] >gi|148718872|gb|ABQ99999.1| conserved hypothetical 21.9 kD protein in locus involved in transformation [Haemophilus influenzae PittGG] (198 aa)
Score = 85, Expect = 3.2e-01, Identities = 23/71 (32%), Positives = 43/71 (60%)
  Q:     9 IIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLE----TILKNEVEGVKSV 79
           +I+ ++ VI + I   +   GG +  ++   E G   ++  G C GCS++DVT K+G+E    ++  NE++G K +
  S:   113 LIERVEYVIQTQINPQLANHGGRITLIEIT-EDGYAVLQFGGGCNGCSMVDVTLKDGVEKQLVSLFPNELKGAKDI 187
>gi|148653644|ref|YP_001280737.1| HesB/YadR/YfhF-family protein [Psychrobacter sp. PRwf-1] >gi|148572728|gb|ABQ94787.1| HesB/YadR/YfhF-family protein [Psychrobacter sp. PRwf-1] (216 aa)
Score = 85, Expect = 3.4e-01, Identities = 18/53 (33%), Positives = 33/53 (62%)
  Q:    28 GGDLEFVDYNPEKG---EVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           GGD++ ++   E+G      +K  G C GCS +D+T ++G+E  LK ++  +  V+
  S:   147 GGDVQLLELIEEEGVGLTAVLKFGGGCQGCSAVDMTLRQGVEVQLKQQIPELTQVV 202
>gi|21242852|ref|NP_642434.1| hypothetical protein XAC2117 [Xanthomonas axonopodis pv. citri str. 306] >gi|51702177|sp|Q8PKQ2|NFUA_XANAC Fe/S biogenesis protein nfuA >gi|21108342|gb|AAM36970.1| conserved hypothetical protein [Xanthomonas axonopodis pv. citri str. 306] (199 aa)
Score = 85, Expect = 3.4e-01, Identities = 17/40 (42%), Positives = 24/40 (60%)
  Q:    40 KGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           +G V ++  G C GC + DVT K+G+E  L   V GV +V
  S:   140 EGVVLLRFGGGCHGCGMADVTLKQGIEKTLMGRVPGVTAV 179
>gi|51702010|sp|Q8D2Q3|NFUA_WIGBR Fe/S biogenesis protein nfuA (184 aa)
Score = 85, Expect = 3.4e-01, Identities = 30/78 (38%), Positives = 41/78 (52%)
  Q:     3 DNNTNKIIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           +N  N+I + IK  I+S   Y    GG +E +D   E   V +K  G C GCS+  VT KEG+E  +K     +K VI
  S:    98 ENLKNRISNFIKYKINSKLEY---HGGFVELIDIK-ENMFVILKFFGGCNGCSMAKVTLKEGIEKEIKKNFPNIKGVI 171
>gi|163787250|ref|ZP_02181697.1| NifU-like protein [Flavobacteriales bacterium ALC-1] >gi|159877138|gb|EDP71195.1| NifU-like protein [Flavobacteriales bacterium ALC-1] (79 aa)
Score = 85, Expect = 3.5e-01, Identities = 20/68 (29%), Positives = 37/68 (54%)
  Q:    13 IKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           ++  +D IR ++  DGGD+  +    +K  V +++ G C  CS+  +T K G+E  +K     ++ VI
  S:    10 VEKALDEIRPFLQSDGGDIALLSIEDDKF-VKVQLEGACTSCSVNQMTLKSGVEMTIKKYAPQIEKVI 76
>gi|53733008|ref|ZP_00155435.2| COG0316: Uncharacterized conserved protein [Haemophilus influenzae R2846] >gi|145632678|ref|ZP_01788412.1| conserved hypothetical 21.9 kD protein in locus involved in transformation [Haemophilus influenzae 3655] >gi|145634570|ref|ZP_01790279.1| predicted gluconate transport-associated protein [Haemophilus influenzae PittAA] >gi|144986873|gb|EDJ93425.1| conserved hypothetical 21.9 kD protein in locus involved in transformation [Haemophilus influenzae 3655] >gi|145268115|gb|EDK08110.1| predicted gluconate transport-associated protein [Haemophilus influenzae PittAA] (198 aa)
Score = 85, Expect = 3.6e-01, Identities = 23/71 (32%), Positives = 43/71 (60%)
  Q:     9 IIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLE----TILKNEVEGVKSV 79
           +I+ ++ VI + I   +   GG +  ++   E G   ++  G C GCS++DVT K+G+E    ++  NE++G K +
  S:   113 LIERVEYVIQTQINPQLANHGGRITLIEIT-EDGYAVLQFGGGCNGCSMVDVTLKDGVEKQLVSLFPNELKGAKDI 187
>gi|182702317|ref|ZP_02955318.1| Fe-S cluster assembly protein NifU [Methylocella silvestris BL2] >gi|172067962|gb|EDT54076.1| Fe-S cluster assembly protein NifU [Methylocella silvestris BL2] (344 aa)
Score = 85, Expect = 3.6e-01, Identities = 17/51 (33%), Positives = 29/51 (56%)
  Q:    10 IDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVT 60
           I  I++ I+ +R ++ +DGGD E +D   +   V +K+ G C+ C L   T
  S:   263 IKLIEETIEELRPFLRKDGGDCELIDV--DGSNVLVKMSGACVLCKLASAT 311
>gi|152972292|ref|YP_001337438.1| putative DNA uptake protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] >gi|166990527|sp|A6TF37|NFUA_KLEP7 Fe/S biogenesis protein nfuA >gi|150957141|gb|ABR79171.1| membrane-bound protein in GNT I transport system [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] (191 aa)
Score = 85, Expect = 3.7e-01, Identities = 18/41 (43%), Positives = 25/41 (60%)
  Q:    39 EKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           + G   ++  G C GCS++DVT KEG+E  L NE   +K V
  S:   137 DDGLAILQFGGGCNGCSMVDVTLKEGIEKQLLNEFPELKGV 177
>gi|126660171|ref|ZP_01731289.1| putative NifU-like protein [Cyanothece sp. CCY0110] >gi|126618536|gb|EAZ89287.1| putative NifU-like protein [Cyanothece sp. CCY0110] (80 aa)
Score = 85, Expect = 3.7e-01, Identities = 21/69 (30%), Positives = 37/69 (53%)
  Q:    11 DEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           D ++ V+D +R Y+  DGG++E V+   E   V +++ G C  C    +T K G+E  L+  +  +  V
  S:    10 DNVETVLDEMRPYLMADGGNVELVEI--EGPIVKLRLQGACGSCPSSTMTLKMGIERRLREMIPEIAEV 76
>gi|71066466|ref|YP_265193.1| hypothetical protein Psyc_1911 [Psychrobacter arcticus 273-4] >gi|71039451|gb|AAZ19759.1| conserved hypothetical protein [Psychrobacter arcticus 273-4] (227 aa)
Score = 85, Expect = 3.7e-01, Identities = 19/53 (35%), Positives = 33/53 (62%)
  Q:    28 GGDLEFVDYNPEKG---EVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           GGD++ ++   E+G      +K  G C GCS +D+T ++G+E  LK ++  +  VI
  S:   158 GGDVQLLELIDEEGIGLTAVLKFGGGCQGCSAVDMTLRQGVEVQLKQQIPELTQVI 213
>gi|86130774|ref|ZP_01049373.1| NifU-like domain protein [Cellulophaga sp. MED134] >gi|85818185|gb|EAQ39345.1| NifU-like domain protein [Dokdonia donghaensis MED134] (300 aa)
Score = 85, Expect = 3.8e-01, Identities = 21/74 (28%), Positives = 40/74 (54%)
  Q:     2 LDNNTNKIIDEIKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEG 75
           LD+ + +I++ I++ +      +  DGG++ F  Y+ +   V++ + G C GC     T K G+E +LK  + G
  S:   220 LDDVSKEIVNIIEEYVKPA---VASDGGNIVFKHYDEKTQNVSVILQGACSGCPSSTFTLKNGIENMLKQMLPG 290
>gi|156081764|ref|XP_001608375.1| hypothetical protein PVX_087160 [Plasmodium vivax SaI-1] >gi|148800946|gb|EDL42351.1| hypothetical protein, conserved [Plasmodium vivax] (191 aa)
Score = 85, Expect = 3.8e-01, Identities = 21/72 (29%), Positives = 44/72 (61%)
  Q:     8 KIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           +II  IK +I+  +R  I  DGGD++F+ ++ + G V +++ G C+ CS  ++T +  ++ +L   +  +K +
  S:   109 EIISSIKLLIEKRVRPVIVNDGGDIKFICFDIDDGIVYVQLEGACVTCSQSEITLQYMIKNMLTYYISEIKEI 181
>gi|91974729|ref|YP_567388.1| nitrogen-fixing NifU-like [Rhodopseudomonas palustris BisB5] >gi|91681185|gb|ABE37487.1| nitrogen-fixing NifU-like [Rhodopseudomonas palustris BisB5] (188 aa)
Score = 84, Expect = 3.9e-01, Identities = 20/64 (31%), Positives = 38/64 (59%)
  Q:     8 KIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKN 71
           + ++ IKD+I++ +R  +  DGGD+ F  +  + G V + + G C GC     T + G++ +LK+
  S:   115 ETVEIIKDLIETRVRPAVANDGGDITFRGF--KDGVVYLAMKGACSGCPSSTATLQHGIQNLLKH 177
>gi|167622188|ref|YP_001672482.1| putative DNA uptake protein [Shewanella halifaxensis HAW-EB4] >gi|189041729|sp|B0TNS0|NFUA_SHEHH Fe/S biogenesis protein nfuA >gi|167352210|gb|ABZ74823.1| HesB/YadR/YfhF-family protein [Shewanella halifaxensis HAW-EB4] (192 aa)
Score = 84, Expect = 3.9e-01, Identities = 26/69 (37%), Positives = 42/69 (60%)
  Q:    11 DEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLET----ILKNEVEGVKSV 79
           + I+ VI S I   +   GG++  V+   E+G   ++  G C GCS++DVT K+G+E     +  +E+ GVK V
  S:   109 ERIEYVIQSEINPQLASHGGNIMLVEIT-EEGIAVLQFGGGCNGCSMVDVTLKDGIEKQLLEMFPSELTGVKDV 181
>gi|150016970|ref|YP_001309224.1| NifU domain-containing protein [Clostridium beijerinckii NCIMB 8052] >gi|149903435|gb|ABR34268.1| nitrogen-fixing NifU domain protein [Clostridium beijerinckii NCIMB 8052] (93 aa)
Score = 84, Expect = 4.2e-01, Identities = 26/71 (36%), Positives = 42/71 (59%)
  Q:     9 IIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           +IDEI +VI++ I+  + +  GD+E V+ N   G   +K+LG C GC     T +E +  +LK E+  +K V
  S:     5 MIDEINNVINTKIKPLLAEHNGDIELVEVN--NGVAYVKLLGACSGCPSARFTMEELISCVLK-EIPEIKDV 73
>gi|78047985|ref|YP_364160.1| thioredoxin-like protein [Xanthomonas campestris pv. vesicatoria str. 85-10] >gi|78036415|emb|CAJ24106.1| thioredoxin-like protein [Xanthomonas campestris pv. vesicatoria str. 85-10] (199 aa)
Score = 84, Expect = 4.3e-01, Identities = 17/39 (43%), Positives = 23/39 (58%)
  Q:    41 GEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           G V ++  G C GC + DVT K+G+E  L   V GV +V
  S:   141 GVVLLRFGGGCHGCGMADVTLKQGIEKTLMGRVPGVTAV 179
>gi|86748105|ref|YP_484601.1| nitrogen-fixing NifU-like protein [Rhodopseudomonas palustris HaA2] >gi|86571133|gb|ABD05690.1| Nitrogen-fixing NifU-like protein [Rhodopseudomonas palustris HaA2] (333 aa)
Score = 84, Expect = 4.3e-01, Identities = 16/48 (33%), Positives = 28/48 (58%)
  Q:    13 IKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVT 60
           + + ++ +R ++ +DGGD E V    E   V +++ G C+GC L  VT
  S:   266 VAEALEDLRPHLQRDGGDCELVSV--EGNVVYVRLSGNCVGCQLSSVT 311
>gi|172035474|ref|YP_001801975.1| iron-sulfur cluster assembly protein [Cyanothece sp. ATCC 51142] >gi|171696928|gb|ACB49909.1| iron-sulfur cluster assembly protein [Cyanothece sp. ATCC 51142] (293 aa)
Score = 84, Expect = 4.3e-01, Identities = 23/63 (36%), Positives = 35/63 (55%)
  Q:    18 DSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           + IR ++ +DGGDLE +D   +  +VT++  G C  C+    T K G+E  LK  V    +VI
  S:   231 EEIRPFLAKDGGDLELIDIEGDLVKVTLQ--GACGSCASSTATLKGGIEARLKERVSPELTVI 291
>gi|109900531|ref|YP_663786.1| putative DNA uptake protein [Pseudoalteromonas atlantica T6c] >gi|119370611|sp|Q15N06|NFUA_PSEA6 Fe/S biogenesis protein nfuA >gi|109702812|gb|ABG42732.1| HesB/YadR/YfhF [Pseudoalteromonas atlantica T6c] (192 aa)
Score = 84, Expect = 4.4e-01, Identities = 16/37 (43%), Positives = 24/37 (64%)
  Q:    39 EKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEG 75
           EKGE  ++  G C GCS++DVT K+G+E  +  +  G
  S:   137 EKGEAILQFGGGCNGCSMVDVTLKDGIEKQMLAQFSG 173
>gi|33151606|ref|NP_872959.1| putative DNA uptake protein [Haemophilus ducreyi 35000HP] >gi|51701995|sp|Q7VNV0|NFUA_HAEDU Fe/S biogenesis protein nfuA >gi|33147826|gb|AAP95348.1| transformation locus protein OrfG-like protein [Haemophilus ducreyi 35000HP] (199 aa)
Score = 84, Expect = 4.4e-01, Identities = 21/52 (40%), Positives = 33/52 (63%)
  Q:    28 GGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETIL----KNEVEGVKSV 79
           GG +  ++   +K  + ++  G C GCS++DVT KEG+E  L      E++GVK V
  S:   134 GGQVTLIEVTEDKYAI-LQFGGGCNGCSMVDVTLKEGIEKQLLATFPTELKGVKDV 188
>gi|167041235|gb|ABZ05992.1| putative HesB-like domain protein [uncultured marine microorganism HF4000_001N02] (189 aa)
Score = 84, Expect = 4.4e-01, Identities = 29/79 (36%), Positives = 43/79 (54%)
  Q:     2 LDNNTNKIIDEI-KDVIDSIRFYIN----QDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
            DN     +DE+ + V D I   IN      GG +E V  + +K    I   G C GC + DVT K+G+E ++K++V  +  VI
  S:    95 FDNPNPMWVDELSQKVADIITQEINPAVASHGGVVELVGVDEDKA--IIAFGGGCQGCGMADVTLKQGVEVMIKDKVPEIIEVI 176
>gi|57864812|gb|AAW56987.1| nitrogen fixation protein U [Cyanothece sp. ATCC 51142] (285 aa)
Score = 84, Expect = 4.6e-01, Identities = 23/63 (36%), Positives = 35/63 (55%)
  Q:    18 DSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVI 80
           + IR ++ +DGGDLE +D   +  +VT++  G C  C+    T K G+E  LK  V    +VI
  S:   223 EEIRPFLAKDGGDLELIDIEGDLVKVTLQ--GACGSCASSTATLKGGIEARLKERVSPELTVI 283
>gi|115522240|ref|YP_779151.1| NifU domain-containing protein [Rhodopseudomonas palustris BisA53] >gi|115516187|gb|ABJ04171.1| nitrogen-fixing NifU domain protein [Rhodopseudomonas palustris BisA53] (188 aa)
Score = 84, Expect = 4.7e-01, Identities = 23/67 (34%), Positives = 38/67 (56%)
  Q:    13 IKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           IKD+I++ +R  +  DGGD+ F  +  + G V + + G C GC     T + G++ +LK+ V  V  V
  S:   120 IKDLIETRVRPAVANDGGDIIFRGF--KDGIVYLHMRGACSGCPSSTATLQHGIQNLLKHFVPEVVEV 185
>gi|193808658|emb|CAQ39361.1| NifU-like protein, putative [Plasmodium knowlesi strain H] (191 aa)
Score = 84, Expect = 4.9e-01, Identities = 21/72 (29%), Positives = 44/72 (61%)
  Q:     8 KIIDEIKDVIDS-IRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSV 79
           +II  IK +I+  +R  I  DGGD++F+ ++ + G V +++ G C+ CS  ++T +  ++ +L   +  +K +
  S:   109 EIISSIKLLIEKRVRPVIVNDGGDIKFICFDVDDGIVYVQLEGACVTCSQSEITLQYMIKNMLTYYISEIKEI 181
>gi|154244065|ref|YP_001415023.1| NifU domain-containing protein [Xanthobacter autotrophicus Py2] >gi|154158150|gb|ABS65366.1| nitrogen-fixing NifU domain protein [Xanthobacter autotrophicus Py2] (121 aa)
Score = 83, Expect = 5.0e-01, Identities = 22/55 (40%), Positives = 34/55 (61%)
  Q:    13 IKDVIDSIRFYINQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLET 67
           I++VI+ IR  + +DGGD E V+ +  K  V +K+ G C+ C L   T  EG++T
  S:    21 IREVIEEIRPNLKRDGGDCELVEIDGNK--VMVKMTGACVFCKLASETI-EGIQT 72
>gi|55378751|ref|YP_136601.1| NifU-like domain-containing protein [Haloarcula marismortui ATCC 43049] >gi|55231476|gb|AAV46895.1| NifU-like domain protein [Haloarcula marismortui ATCC 43049] (108 aa)
Score = 83, Expect = 5.1e-01, Identities = 21/58 (36%), Positives = 31/58 (53%)
  Q:    24 INQDGGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEGVKSVIV 81
           I Q GG+ E  + +  KG  T+ I G C GC +  +T K  +E  L   V+G++ V V
  S:    21 IQQHGGNFEVREVDESKGTATVAIGGACSGCGIAPMTMK-AIEQRLPESVDGLEDVEV 77
>gi|28896920|ref|NP_796525.1| putative DNA uptake protein [Vibrio parahaemolyticus RIMD 2210633] >gi|153837871|ref|ZP_01990538.1| thioredoxin [Vibrio parahaemolyticus AQ3810] >gi|51702006|sp|Q87TC4|NFUA_VIBPA Fe/S biogenesis protein nfuA >gi|28805128|dbj|BAC58409.1| conserved hypothetical protein [Vibrio parahaemolyticus RIMD 2210633] >gi|149748734|gb|EDM59579.1| thioredoxin [Vibrio parahaemolyticus AQ3810] (194 aa)
Score = 83, Expect = 5.1e-01, Identities = 20/48 (41%), Positives = 27/48 (56%)
  Q:    28 GGDLEFVDYNPEKGEVTIKILGECIGCSLIDVTYKEGLETILKNEVEG 75
           GG +  V+   E G   +   G C GCS++DVT KEG+E  L N+  G
  S:   129 GGHVNLVEIT-EAGVAIVAFGGGCNGCSMVDVTLKEGIEKELLNQFVG 175