>gi|26554222|ref|NP_758156.1| hypothetical protein MYPE7660 [Mycoplasma penetrans HF-2] >gi|26454231|dbj|BAC44560.1| conserved hypothetical protein [Mycoplasma penetrans HF-2] (1043 aa)
Score = 4173, Expect = 0.0e+00, Identities = 1043/1043 (100%), Positives = 1043/1043 (100%)
  Q:     1 MNKKKILLASVFATSALSAVGFVQLASTSNISNNISKTDSSLDVTSASTKATASGLKNLATETQNAQISIPTSYYQQNSFKNLSNDNGPILLFDEARSFGATDWYGNPAWYITLNSASGQNNGYYSAAWFSTSTSSAIDFTKAGTKVVDWAYNHKTDNLYVLTDTQYLIIVSSKTGTIVSTSEVGNSVDKIQIIDFNNSVYLWNSKTTNPQVLTIEPQTGMVNSAKITSTFLSSKHLFALIPLDVNYTIAVTSTSQVTDTNGNVNFSLDFVNDDLNQITSSKTQSVSLTGTKASDIYINGFKRNSDYVIFIQNKIYSVSLNKSLMSNSTFTDLLSSSNSNLGGFSITTGSINSAFIDVNNQIYFKTTESKEVNTMLVSNSFNKMDIPTTLGATFAGKEENAKTTQIFPVLSSASSSSDNLISRSYTGYLLSSNGFIGTGFLNGSVISNQFTSQSSAPSFNVSNAGSSSIPSGVNSTNITKNNTSLSNVTLETSNAILIADDISGTLYVKVPYTLVGSWYGNGSQTSEFNSRGFLIGKFTFTNIQTATTWASNLPADIARLEPSQISTDILKRNATSIVSIPSSVLALQNSNLNINFAIVTKNDNAGQITLKATVTYKNAYGSIVSYAMANDKQYTVKKAAATYAFAFAGQTDADKPKVDKSSSSITDLLAEAQSVLTNGSEKFLTVDVGTLEGNLTQYANVLPSLWNPNSVNDYFITTKDKYPNNPTITLFPDDENGNIVIVVQYNNLSNNTPSKFAIRYTGITNYAKSSVRFQGSRKTDLLTPSGTSPFPSEQNNILDVTTVSGFSDYGTKLVSDVSPNEFSTLYSSNLINYMGFTPEVTFVQEQNGSEGTTTYDSEYGSFLLKIDFSKSVSSNLLNAKDEYIPFSETPFANQLGLKDGVIYQRYAGLLPIGSTYNISIDRNSTSYRSLIANNNVNAALSSTDILSILTINGYDSSQGDTITIFDYRWNGETFEFTVYAKSSTYDSISTTQTFGVSWSPKFASIRNMSLSVAVITSVVGITLVSLAIALYIVRRNKIRRLLK 1043
           MNKKKILLASVFATSALSAVGFVQLASTSNISNNISKTDSSLDVTSASTKATASGLKNLATETQNAQISIPTSYYQQNSFKNLSNDNGPILLFDEARSFGATDWYGNPAWYITLNSASGQNNGYYSAAWFSTSTSSAIDFTKAGTKVVDWAYNHKTDNLYVLTDTQYLIIVSSKTGTIVSTSEVGNSVDKIQIIDFNNSVYLWNSKTTNPQVLTIEPQTGMVNSAKITSTFLSSKHLFALIPLDVNYTIAVTSTSQVTDTNGNVNFSLDFVNDDLNQITSSKTQSVSLTGTKASDIYINGFKRNSDYVIFIQNKIYSVSLNKSLMSNSTFTDLLSSSNSNLGGFSITTGSINSAFIDVNNQIYFKTTESKEVNTMLVSNSFNKMDIPTTLGATFAGKEENAKTTQIFPVLSSASSSSDNLISRSYTGYLLSSNGFIGTGFLNGSVISNQFTSQSSAPSFNVSNAGSSSIPSGVNSTNITKNNTSLSNVTLETSNAILIADDISGTLYVKVPYTLVGSWYGNGSQTSEFNSRGFLIGKFTFTNIQTATTWASNLPADIARLEPSQISTDILKRNATSIVSIPSSVLALQNSNLNINFAIVTKNDNAGQITLKATVTYKNAYGSIVSYAMANDKQYTVKKAAATYAFAFAGQTDADKPKVDKSSSSITDLLAEAQSVLTNGSEKFLTVDVGTLEGNLTQYANVLPSLWNPNSVNDYFITTKDKYPNNPTITLFPDDENGNIVIVVQYNNLSNNTPSKFAIRYTGITNYAKSSVRFQGSRKTDLLTPSGTSPFPSEQNNILDVTTVSGFSDYGTKLVSDVSPNEFSTLYSSNLINYMGFTPEVTFVQEQNGSEGTTTYDSEYGSFLLKIDFSKSVSSNLLNAKDEYIPFSETPFANQLGLKDGVIYQRYAGLLPIGSTYNISIDRNSTSYRSLIANNNVNAALSSTDILSILTINGYDSSQGDTITIFDYRWNGETFEFTVYAKSSTYDSISTTQTFGVSWSPKFASIRNMSLSVAVITSVVGITLVSLAIALYIVRRNKIRRLLK
  S:     1 MNKKKILLASVFATSALSAVGFVQLASTSNISNNISKTDSSLDVTSASTKATASGLKNLATETQNAQISIPTSYYQQNSFKNLSNDNGPILLFDEARSFGATDWYGNPAWYITLNSASGQNNGYYSAAWFSTSTSSAIDFTKAGTKVVDWAYNHKTDNLYVLTDTQYLIIVSSKTGTIVSTSEVGNSVDKIQIIDFNNSVYLWNSKTTNPQVLTIEPQTGMVNSAKITSTFLSSKHLFALIPLDVNYTIAVTSTSQVTDTNGNVNFSLDFVNDDLNQITSSKTQSVSLTGTKASDIYINGFKRNSDYVIFIQNKIYSVSLNKSLMSNSTFTDLLSSSNSNLGGFSITTGSINSAFIDVNNQIYFKTTESKEVNTMLVSNSFNKMDIPTTLGATFAGKEENAKTTQIFPVLSSASSSSDNLISRSYTGYLLSSNGFIGTGFLNGSVISNQFTSQSSAPSFNVSNAGSSSIPSGVNSTNITKNNTSLSNVTLETSNAILIADDISGTLYVKVPYTLVGSWYGNGSQTSEFNSRGFLIGKFTFTNIQTATTWASNLPADIARLEPSQISTDILKRNATSIVSIPSSVLALQNSNLNINFAIVTKNDNAGQITLKATVTYKNAYGSIVSYAMANDKQYTVKKAAATYAFAFAGQTDADKPKVDKSSSSITDLLAEAQSVLTNGSEKFLTVDVGTLEGNLTQYANVLPSLWNPNSVNDYFITTKDKYPNNPTITLFPDDENGNIVIVVQYNNLSNNTPSKFAIRYTGITNYAKSSVRFQGSRKTDLLTPSGTSPFPSEQNNILDVTTVSGFSDYGTKLVSDVSPNEFSTLYSSNLINYMGFTPEVTFVQEQNGSEGTTTYDSEYGSFLLKIDFSKSVSSNLLNAKDEYIPFSETPFANQLGLKDGVIYQRYAGLLPIGSTYNISIDRNSTSYRSLIANNNVNAALSSTDILSILTINGYDSSQGDTITIFDYRWNGETFEFTVYAKSSTYDSISTTQTFGVSWSPKFASIRNMSLSVAVITSVVGITLVSLAIALYIVRRNKIRRLLK 1043
>gi|26554227|ref|NP_758161.1| hypothetical protein MYPE7710 [Mycoplasma penetrans HF-2] >gi|26454236|dbj|BAC44565.1| conserved hypothetical protein [Mycoplasma penetrans HF-2] (1042 aa)
Score = 3424, Expect = 0.0e+00, Identities = 814/1043 (78%), Positives = 939/1043 (90%)
  Q:     1 MNKKKILLASVFATSALSAVGFVQLASTSNISNNISKTDSSLDVTSASTKATASGLKNLATET-QNAQISIPTSYYQQNSFKNLSNDNGPILLFDEARSFGATDWYGNPAWYITLNSASGQNNGYYSAAWFSTSTSSAIDFTKAGTKVVDWAYNHKTDNLYVLTDTQYLIIVSSKTGTIVSTSEVGNSVDKIQIIDFNNSVYLWNSKTTNPQVLTIEPQTGMVNSAKITSTFLSSKHLFALIPLDVNYTIAVTSTSQVTDTNGNVNFSLDFVNDDLNQITSSKTQSVSLTGTKASDIYINGFKRNSDYVIFIQNKIYSVSLNKSLMSNSTFTDLLSSSNSNLGGFSITTGSI-NSAFIDVNNQIYFKTTESKEVNTMLVSNSFNKMDIPTTLGATFAGKEENAKTTQIFPVLSSASSSSDNLISRSYTGYLLSSNGFIGTGFLNGSVISNQFTSQSSAPSFNVSNAGSSSIPSGVNSTNITKNNTSLSNVTLETSNAILIADDISGTLYVKVPYTLVGSWYGNGSQTSEFNSRGFLIGKFTFTNIQTATTWASNLPADIARLEPSQISTDILKRNATSIVSIPSSVLALQNSNLNINFAIVTKNDNAGQITLKATVTYKNAYGSIVSYAMANDKQYTVKKAAATYAFAFAGQTDADKPKVDKSSSSITDLLAEAQSVLTNGSEKFLTVDVGTLEGNLTQYANVLPSLWNPNSVNDYFITTKDKYPNNPTITLFPDDENGNIVIVVQYNNLSNNTPSKFAIRYTGITNYAKSSVRFQGSRKTDLLTPSGTSPFPSEQNNILDVTTVSGFSDYGTKLVSDVSPNEFSTLYSSNLINYMGFTPEVTFVQE-QNGSEGTTTYDSEYGSFLLKIDFSKSVSSNLLNAKDEYIPFSETPFANQLGLKDGVIYQRYAGLLPIGSTYNISIDRNSTSYRSLIANNNVNAALSSTDILSILTINGYDSSQGDTITIFDYRWNGETFEFTVYAKSSTYDSISTTQTFGVSWSPKFASIRNMSLSVAVITSVVGITLVSLAIALYIVRRNKIRRLLK 1043
           MNKKKILLASVFAT ALS VGF QL +TSN+SN+I K ++SLD  ++S   + SGLKNL+T+T QNAQISIPTSYYQQNSFKNLSNDNGPILLFD AR+FGATDWYGNP+WYITLNSA G+N+GYYSAAWFSTSTSSAIDF+KAGTKVVDWAYNHKTDNLYVLTD  +LIIVSSKTGTIVSTSE+GNSVDKIQI+DFN+SVYLWNSK T   + T+EPQTG +N+++I +T  S K+L+ +IPLDVNY+IAVTST++  DTN  V+ +LDFV+D+L +I+ + +++ +L  TKASDIYINGF+RNSDYVIF+QNKIYSVSLNKSLMS+S FTDLL SSN+NLGGF++ +G I NSAF+D NNQIYFKT+ES++VN++ VSNSFNKM+IP TL  TFA KE NAK TQ+FPVL+S  SS++ ++SR +TGY+LS + FIGTGFLNGSVI+ QFT+QS++PSFNVSNAG S+IPSGVNSTNI KNN SLSNVTLETSNAILIADDISG+LYVKVPYT+VG+WYGNG+ +    SRG+L+GKF F  I+TATTWA+NLPA+IARLEPSQI+ ++LKRN TSIV+IPSSVLALQNSNLNINF IV+KNDN G+ITLKAT+TYKNAYGSIVSYAMA DK Y VKKAAA Y FAFAGQT ADKPKV+K +S I  LL EA + + +GS+ FLTVDVGTLEG L QYANVLPSLWNPNSVNDYFITTKDKYPNNPT++LFPDDE GNIVIVVQYNNLS +TPSKFAIRYTGITNYAKSSVRFQGS+K+DLL P GTSPFP+EQNNILD+TTVSGFSD+G KLVS VSPNE ST+Y+SNLI+ MGFTPEV+FVQ+  NG+EGTTTYDSEYGSFLLKIDFSKSVSSNLLNAKDEYIPFS+TPFANQ+GL +G+IYQRYAGLLPIGSTYNISIDRNS+SYRSLIANNNVNA+LSSTDILSILTINGYD+S+GDTITI++YRWNGE FEF ++AKS TYDSISTTQTFGVSWSPKFAS+RNMSLSVAVITSV+GITLVSL +A YI+RRNKIR+LLK
  S:     1 MNKKKILLASVFATFALSTVGFAQLINTSNVSNDIFKKETSLDANASSRATSNSGLKNLSTDTTQNAQISIPTSYYQQNSFKNLSNDNGPILLFDNARTFGATDWYGNPSWYITLNSADGKNDGYYSAAWFSTSTSSAIDFSKAGTKVVDWAYNHKTDNLYVLTDKSFLIIVSSKTGTIVSTSEIGNSVDKIQIVDFNSSVYLWNSKNTMSVIYTVEPQTGKLNTSQINTTEFSGKYLYGIIPLDVNYSIAVTSTTKQADTNSTVSITLDFVDDNLKKISGAVSETTTLNSTKASDIYINGFQRNSDYVIFVQNKIYSVSLNKSLMSSSKFTDLLGSSNTNLGGFTLPSGGIINSAFLDANNQIYFKTSESRDVNSLSVSNSFNKMEIPITLNTTFANKEANAKNTQVFPVLNS--SSNNQVVSRGFTGYILSYDSFIGTGFLNGSVINYQFTTQSNSPSFNVSNAGISAIPSGVNSTNIAKNNNSLSNVTLETSNAILIADDISGSLYVKVPYTMVGAWYGNGNNS--VISRGYLVGKFNFQKIETATTWATNLPANIARLEPSQINPELLKRNGTSIVTIPSSVLALQNSNLNINFVIVSKNDNNGEITLKATITYKNAYGSIVSYAMATDKTYKVKKAAANYDFAFAGQTTADKPKVNKHNSDIGTLLTEAAAAVKDGSDNFLTVDVGTLEGTLAQYANVLPSLWNPNSVNDYFITTKDKYPNNPTVSLFPDDETGNIVIVVQYNNLSKDTPSKFAIRYTGITNYAKSSVRFQGSKKSDLLKPDGTSPFPNEQNNILDITTVSGFSDFGAKLVSQVSPNELSTVYNSNLISSMGFTPEVSFVQDTTNGTEGTTTYDSEYGSFLLKIDFSKSVSSNLLNAKDEYIPFSQTPFANQMGLSNGIIYQRYAGLLPIGSTYNISIDRNSSSYRSLIANNNVNASLSSTDILSILTINGYDTSKGDTITIYNYRWNGEVFEFQIFAKSLTYDSISTTQTFGVSWSPKFASVRNMSLSVAVITSVIGITLVSLGVAFYIIRRNKIRKLLK 1042
>gi|26554229|ref|NP_758163.1| hypothetical protein MYPE7730 [Mycoplasma penetrans HF-2] >gi|26454238|dbj|BAC44567.1| conserved hypothetical protein [Mycoplasma penetrans HF-2] (1003 aa)
Score = 3101, Expect = 0.0e+00, Identities = 739/997 (74%), Positives = 872/997 (87%)
  Q:    47 ASTKATASGLKNLATE-TQNAQISIPTSYYQQNSFKNLSNDNGPILLFDEARSFGATDWYGNPAWYITLNSASGQNNGYYSAAWFSTSTSSAIDFTKAGTKVVDWAYNHKTDNLYVLTDTQYLIIVSSKTGTIVSTSEVGNSVDKIQIIDFNNSVYLWNSKTTNPQVLTIEPQTG-MVNSAKITSTFLSSKHLFALIPLDVNYTIAVTSTSQVTDTNGNVNFSLDFVNDDLNQITSSKTQSVSLTGTKASDIYINGFKRNSDYVIFIQNKIYSVSLNKSLMSNSTFTDLL-SSSNSNLGGFSITTGS--INSAFIDVNNQIYFKTTESKEVNTMLVSNSFNKMDIPTTLGATFAGKEENAKTTQIFPVLSSASSSSDNLISRSYTGYLLSSNGFIGTGFLNGSVISNQFTSQSSAPSFNVSNAGSSSIPSGVNSTNITKNNTSLSNVTLETSNAILIADDISGTLYVKVPYTLVGSWYGNGSQTSEFNSRGFLIGKFTFTNIQTATTWASNLPADIARLEPSQISTDILKRNATSIVSIPSSVLALQNSNLNINFAIVTKNDNAGQITLKATVTYKNAYGSIVSYAMANDKQYTVKKAAATYAFAFAGQTDADKPKVDKSSSSITDLLAEAQSVLTNGSEKFLTVDVGTLEGNLTQYANVLPSLWNPNSVNDYFITTKDKYPNNPTITLFPDDENGNIVIVVQYNNLSNNTPSKFAIRYTGITNYAKSSVRFQGSRKTDLLTPSGTSPFPSEQNNILDVTTVSGFSDYGTKLVSDVSPNEFSTLYSSNLINYMGFTPEVTFVQE-QNGSEGTTTYDSEYGSFLLKIDFSKSVSSNLLNAKDEYIPFSETPFANQLGLKDGVIYQRYAGLLPIGSTYNISIDRNSTSYRSLIANNNVNAALSSTDILSILTINGYDSSQGDTITIFDYRWNGETFEFTVYAKSSTYDSISTTQTFGVSWSPKFASIRNMSLSVAVITSVVGITLVSLAIALYIVRRNKIRRLLK 1043
           A+TKA  SGLK+L+ E +QN+Q+SIP SYYQQNSFKNLSNDNGPILLFD+ARSFGATDWYGNPAWYITLNSA+ + +GYYSAAWFSTSTSSAIDF +AGTKVVDWAYNHKTDNLYVLTDTQYLIIVSSKTGT+VST++V N+V+KIQIIDFN+SVYLWNSK    +  ++EPQTG + N+   TST LS+KHL+ LIPLDVNYTIAVTSTS+ +DT+ +++ SLDFV+D+LN+IT S T+++SL+ TK S IYINGFKRNSDYVIFI+NKIYSVSLNKSLMSNS+FT+LL +S N  LG FS+T+GS  INSAF+D N QIYFK T S+ +NT+ VSN F  M IPT L  TFA   E AK TQIFPV  + SS+S+++ISR++TGY+LS +GFIGTGFLNGSV+S + TS SSAP FNVSNAG+SSIPS VN+TNI K +++LSNVTLE SNA LIADDI+GTLYV+VPYT+ GSWYGNGS +SEFNSRGFLIGKFTF  IQ ATTW +NLP  + RLEP+QIS ++LKR ATSI++IPSSVLALQNSNLNI+F I +KN   G I L AT+TYKNAYGSIVSY M+ +K+Y+VKK AA+YAFAFAGQT AD+ KVDKSS  I+ LL +A+  +T  S+ FLTVDVGTL+G+L QYANVLPSLWNPN VND FITTKDKYPNNPTITLFPDD+ GNI+IVV+Y+NL+  T SKFAIRYTGIT+YAKS+V+FQG++K+DL  P+G   FP EQ+NILD+TTVSGF +YG KLVSD++P+E S LY+S LI+ MGFTP+VTF Q+  +G+EGTTTYDSEYGSFLLKIDF++SVSSNL NAKDE++PFS+TPF +++GL +GVIYQRYAGLLPIGSTYNISIDRNSTSYRSLIANNNVNAAL+STDILSILTINGYDSSQGDTITIF+YRWNGE FEF ++AKS TY+SISTTQTFGVSWSPKFAS+RNMSLSVAVITS+VGITLVSL +A YI+RRNKIR+LLK
  S:     3 ANTKAADSGLKDLSAEASQNSQVSIPQSYYQQNSFKNLSNDNGPILLFDDARSFGATDWYGNPAWYITLNSATSKTDGYYSAAWFSTSTSSAIDFAQAGTKVVDWAYNHKTDNLYVLTDTQYLIIVSSKTGTVVSTNKVNNNVNKIQIIDFNSSVYLWNSKDKTGKFYSVEPQTGKLSNTNGNTSTHLSNKHLYGLIPLDVNYTIAVTSTSEPSDTDSSISLSLDFVDDNLNKITGSPTENISLSSTKLSSIYINGFKRNSDYVIFIKNKIYSVSLNKSLMSNSSFTNLLDNSKNPALGNFSLTSGSDDINSAFLDANGQIYFKATNSENINTLSVSNGFITMQIPTGLNTTFASNAEKAKKTQIFPV--ANSSTSEDVISRAFTGYVLSWDGFIGTGFLNGSVLSQRMTSLSSAPIFNVSNAGNSSIPSSVNTTNIAKGSSNLSNVTLENSNATLIADDIAGTLYVRVPYTITGSWYGNGSISSEFNSRGFLIGKFTFRQIQQATTWVTNLPDVVKRLEPNQISPELLKRYATSIITIPSSVLALQNSNLNIDFVITSKNSGNGTIKLMATITYKNAYGSIVSYKMSQEKEYSVKKEAASYAFAFAGQTTADQNKVDKSSLDISTLLTQAKDSVTTTSDNFLTVDVGTLQGDLAQYANVLPSLWNPNVVNDSFITTKDKYPNNPTITLFPDDDGGNIIIVVKYDNLAATTASKFAIRYTGITSYAKSTVKFQGNKKSDLTRPNGQPAFPQEQDNILDITTVSGFGEYGAKLVSDITPSELSNLYNSPLISSMGFTPKVTFAQDETSGTEGTTTYDSEYGSFLLKIDFTESVSSNLRNAKDEFVPFSDTPFKDKMGLSNGVIYQRYAGLLPIGSTYNISIDRNSTSYRSLIANNNVNAALTSTDILSILTINGYDSSQGDTITIFNYRWNGEVFEFQIFAKSKTYESISTTQTFGVSWSPKFASVRNMSLSVAVITSIVGITLVSLGVAFYIIRRNKIRKLLK 1003
>gi|26554228|ref|NP_758162.1| hypothetical protein MYPE7720 [Mycoplasma penetrans HF-2] >gi|26454237|dbj|BAC44566.1| conserved hypothetical protein [Mycoplasma penetrans HF-2] (1041 aa)
Score = 2713, Expect = 0.0e+00, Identities = 698/1043 (66%), Positives = 840/1043 (80%)
  Q:     1 MNKKKILLASVFATSALSAVGFVQLASTSNISNNISKTDSSLDVTSASTKATASGLKNLATETQ-NAQISIPTSYYQQNSFKNLSNDNGPILLFDEARSFGATDWYGNPAWYITLNSASGQNNGYYSAAWFSTSTSSAIDFTKAGTKVVDWAYNHKTDNLYVLTDTQYLIIVSSKTGTIVSTSEVGNSVDKIQIIDFNNSVYLWNSKTTNPQVLTIEPQTGMVNSAKITSTFLSSKHLFALIPLDVNYTIAVTSTSQVTDTNGNVNFSLDFVNDDLNQITSSKTQSVSLTGTKASDIYINGFKRNSDYVIFIQNKIYSVSLNKSLMSNSTFTDLL-SSSNSNLGGFSITTGSINSAFIDVNNQIYFKTTESKEVNTMLVSNSFNKMDIP-TTLGATFAGKEENAKTTQIFPVLSSASSSSDNLISRSYTGYLLSSNGFIGTGFLNGSVISNQFTSQSSAPSF-NVSNAGSSSIPSGVNSTNITKNNTSLSNVTLETSNAILIADDISGTLYVKVPYTLVGSWYGNGSQTSEFNSRGFLIGKFTFTNIQTATTWASNLPADIARLEPSQISTDILKRNATSIVSIPSSVLALQNSNLNINFAIVTKNDNAGQITLKATVTYKNAYGSIVSYAMANDKQYTVKKAAATYAFAFAGQTD--ADKPKVDKSSSSITDLLAEAQSVLTNGSE-KFLTVDVGTLEGNLT---QYANVLPSLWNPNSVNDYFITTKDKYPNNPTITLFPDDENGNIVIVVQYNNLSNNTPSKFAIRYTGITNYAKSSVRFQGSRKTDLLTPSGTSP----FPSEQNNILDVTTVSGFSDYGTKLVSDVSPNEFSTLYSSNLINYMGFTPEVTFVQE---QNGSEGTTTYDSEYGSFLLKIDFSKSVSSNLLNAKDEYIPFSETPFANQLGLKDGVIYQRYAGLLPIGSTYNISIDRNSTSYRSLIANNNVNAALSSTDILSILTINGYDSSQGDTITIFDYRWNGETFEFTVYAKSSTYDSISTTQTFGVSWSPKFASIRNMSLSVAVITSVVGITLVSLAIALYIVRRNKIRRLLK 1043
           MNKKKILL S+FA SALS+VGFVQL+  ++   NI+KTDS LD  SA TKAT SGL NL+T+T  N QI++PT+YYQQNSFKNLSNDNGPILLFD+A++FGA DWYGNP+WYITL    G ++GYYSAAWFSTSTSS IDF +AGTKVVDWAYNHKTDNLYVLTDTQYLIIV+SKTGTIVST++VGN V+KIQIIDFN+SVYLWN+K   P +  IEPQTGMV S   +++FL+SK+L+ +IPLD NY+IAVTST+  ++T+  V+ SLDFV+D+LN IT   TQ++SL  TKA+DIY+NGFKR+SDYVIFIQNKIYSVSLNKS M NS FTDLL ++SNS+LG F+  T  +NSAFID NNQIYFKT+ S ++ ++ V+NSFN M I  TTLG+ FA KE +AK+ Q+F V      S + +ISR YTGY+L S  F GTGF NGS+++N +TS+S +P F    ++ +SSIPS VNSTNIT NN SLSNVTLETSNAILIADD+SGTL+VKVPYT+ G+WYGNGS T    SRG+LIGKF + NI+ ATTWA+NLP  I   EPSQI+T +LK NATSI++IP S+L L +S L+INF I + N   G ITL AT++YKNAYGSIV+Y+M  +KQY VKK +A YAF FAGQTD  ADK KV + + +I +L+ +AQS++++ S+ +FL VDVG+L    T    Y NVLPSLW+   V  YFI   DKYP++PTITL P D  G+I+I+VQYNNLSN+TPSKFAIRY GITNY+ S++RF GS  T     S  +P    FP ++  IL++TTVSGFSDY   LVS + PN  S LY+S LI  MGF P V+FV      N ++G TTYD EYGSFLLKIDFS+SVS    ++    IPFS+TPFANQ+GL +GVIYQR+ GLLPIGSTYNISIDR+STSYRSLI NNNVNA+LS TDILSILTINGYD+S+GDTI I +YRWNGE FEF+V+A S+TYDSIST QTFGVSWSPKFASIRNMSLSVAVITSVVGITLVSLAIALYIVRRNKIRRLLK
  S:     1 MNKKKILLTSLFAVSALSSVGFVQLSKNTS---NITKTDSELD-ASAITKATTSGLTNLSTDTTVNGQINVPTNYYQQNSFKNLSNDNGPILLFDDAKTFGANDWYGNPSWYITL----GASDGYYSAAWFSTSTSSTIDFAQAGTKVVDWAYNHKTDNLYVLTDTQYLIIVASKTGTIVSTNKVGNDVNKIQIIDFNSSVYLWNNKIAKPTIYVIEPQTGMVKSNVTSTSFLNSKYLYGIIPLDTNYSIAVTSTTAPSETDVTVSLSLDFVDDNLNNITGPTTQTISLNNTKAADIYLNGFKRDSDYVIFIQNKIYSVSLNKSAMQNSKFTDLLDANSNSSLGNFTALTEKVNSAFIDSNNQIYFKTSNSTDITSLSVNNSFNNMQISTTTLGSVFASKETSAKSAQVFAV---PVESQNEIISRGYTGYILGSTDFTGTGFTNGSILTNTYTSRSLSPLFTITGSSSTSSIPSSVNSTNITTNNGSLSNVTLETSNAILIADDLSGTLFVKVPYTITGAWYGNGSAT--VRSRGYLIGKFQYLNIKQATTWATNLPQAIRNYEPSQITTTMLKENATSIITIPQSILVLTDSQLDINFVIESSNGANGTITLFATISYKNAYGSIVNYSMTTNKQYNVKKESANYAFLFAGQTDSTADKNKVQR-TEAIGELITKAQSLVSDESQTEFLNVDVGSLSSVNTIFNTYTNVLPSLWSAEVVKSYFIAKNDKYPSDPTITLIPSDSTGSIIIIVQYNNLSNSTPSKFAIRYNGITNYSTSAIRFSGSEMT---IKSNRNPNEDVFPDQK--ILNITTVSGFSDYDENLVSSLDPNSLSALYNSQLITTMGFEPTVSFVSSSDANNQTDGITTYDEEYGSFLLKIDFSQSVSRYFRDSTGNLIPFSQTPFANQMGLTNGVIYQRFGGLLPIGSTYNISIDRSSTSYRSLITNNNVNASLSETDILSILTINGYDTSKGDTIRIENYRWNGEVFEFSVFAHSATYDSISTRQTFGVSWSPKFASIRNMSLSVAVITSVVGITLVSLAIALYIVRRNKIRRLLK 1041
>gi|26553768|ref|NP_757702.1| hypothetical protein MYPE3140 [Mycoplasma penetrans HF-2] >gi|26453775|dbj|BAC44106.1| conserved hypothetical protein [Mycoplasma penetrans HF-2] (1182 aa)
Score = 115, Expect = 2.4e-03, Identities = 146/571 (25%), Positives = 240/571 (42%)
  Q:    82 NLSNDNGPILLFDEARSFGATDWYGNPAWYITLNSASGQNNGYYSAAWFSTSTSSAIDFTKAGTKV--VDWAYNHKTDNLYVL------TDTQYLIIVSSKTGTIVST--------SEVGN--------SVDKIQIIDFNNSVYLWNSKTTNPQVLTIEPQTGMVNSAKITSTFLSSK------HLFALIPLDVN------YTIAVTSTSQVTDTNGNVNFSLDF--VNDDLNQITSSKTQSVSLTGTKASDIYING-FKRNSDYVIFIQNKIYSVSLNKSLMSNSTFTDLLSSSNSNLGGFSITTGS-INSAFIDVNNQIYFKTTESKEV--------NTMLVSNSFNKMDIPTTLGATFAGKEENAKT-TQIFPVLSSASSSSDNLISRSYTGYL--LSSNGFIGTGFLNGSVIS-----------------NQFTSQSSAPSFNVSNA-GSSSIPSGVNSTNITKNNTSLSNVTLETSNAILIADDISGTLYVKVPYTLVGSWYGNGSQTSEFNSRGFLIGKFTFTNIQTATTW---ASNLPADIARLEPSQISTDILKRNATSIVSIPSSVLALQNSNL---NINFAIVTKNDNAGQITLKATVTYKNAYGSIVSY-----AMANDKQYTVKKAAATYAFAFAGQTD 652
           N+S +NGPI          A DW+GN  W I   +               TST   +D+T +  +    +W YN   D L+VL      T  Q L  ++  TG I  T        S V N        S  K+ +     S Y   +   +P   T+   +G  N+  I     S+       + F LIP+  N      +  +   TS  T    N ++ + F  V+D+LN I ++   +  +    A   Y N       DY   +  K+ +V  N +++ ++T       ++ N G F +T    I S   D N  +YFK  +  ++         T+  SN+      PT         ++N  T    F + +    +   +I  SY      LS +  I +    G  I+                 N   S   A  F + N+   S IPS +   +IT  N S       +   I   DD  GT  V V    +  W+ N    S+ + R       T   I   T+W   +++   D   + PS++    +        S  S  +   N         ++I +++D  G+IT+KA   Y     ++ +Y     + ++   Y +   ++   F FAGQT+
  S:   128 NISTNNGPITF--HGNKITALDWFGNKKWEIDFATHVPDK----------TSTKPGVDYTDSAWQRSWFNWDYNRSKDKLWVLGYYSTNTKKQPLFQINGSTGAIEKTFDLTYTNLSSVNNAYRFVSALSSGKVMVYGGAGSTYDAKALLYDPDTDTLTQISGNSNNTTILPIGDSTYGQKYRWYFFNLIPIANNKNLVEVFPFSTDPTSDDTTAARNASYDIYFLLVDDNLNMIETTGEWATKVKAANAMVGYRNTQVTPQRDYYTMLDGKVVTVVYNTAIIIDAT------GNSVNYGTFPMTDNKWIKSWAFDSNQNLYFKFKDDTKIYKVSGDFWKTLTSSNNHTASVSPTIYLDLSGISKDNVNTYASNFVIYNVYGYTGQLMIINSYYNKFIRLSESEKIPSDANYGLAIAVTQNENQQNQGDFKGTLNGPDSFQKASDFTIENSILQSKIPSEITKNDITTLNNSFIKDGDSSGFVISDIDDSKGTFKVTVNLYQI-PWFTN-ELPSDSSPRTVSYDFTTTNKIGNKTSWKTLSTSTDYDFLNMLPSKVQVSDVSSLNPFQASFQSQTITNANGEQLYPKTTYSIQSRDDTKGEITVKADYQYVPMSANLSNYVSNVKSYSSTNTYKIFSNSSAANFKFAGQTN 758
>gi|26553708|ref|NP_757642.1| hypothetical protein MYPE2550 [Mycoplasma penetrans HF-2] >gi|26453715|dbj|BAC44046.1| conserved hypothetical protein [Mycoplasma penetrans HF-2] (1124 aa)
Score = 103, Expect = 6.6e-02, Identities = 195/788 (24%), Positives = 327/788 (41%)
  Q:     1 MNKKKILLASVFATSALSAVGFVQLASTSNISNNISKTDSSLDVTSASTKATASGLKNLATETQNAQISIPTSYYQQNSFKNLSNDNGPILLFDEARSFGATDWYGNPAWYITL-------NSASGQNN--GYYSAAWFSTSTSSAIDFTKAGTKVVDWAYNHKTDNLYVL------TDTQYLIIVSSKTGTIVSTSEVGNSVDKIQIIDFNNS---------------VYLWNSKTTNPQVLTIEPQT---GMVNSAKITSTFLSSK----------HLFALIPLDVNYTIAVTSTSQVTDTNG-------NVNFSLDFVNDDLNQITSSKTQSV----SLTGTKASDIYINGFKRNSDYVIFIQNKIYSVSLNKSLMSNSTFTDLLSSSNSNLGGFSITTGS-INSAFIDVNNQIYFKTTESKEVNTMLVSNSF------NKMDIPTTLGATFAG-KEENAKTTQIFPVLSSASSSSDNLISRSYTGYLLSSNGFIGT--------------------------GFLNGSVISNQFTSQSSAPSFNVSNAGSSSIPSGVNSTNITKNNTSLSNVTLETSNAILIADDISGTLYVKVPYTLVGSWYGNGSQTSEFNSRGFLIGKFTFT-NIQTATTW---ASNLPADIARLEPSQISTDILKRNATSIVSIPSSVLALQNSNL---NINFAIVTKNDNAGQITLKAT-------VTYKNAYGSIVSYAMANDKQYTVKKAAATYAFAFAGQTDADKPKVDKSSSSITDLLAEAQSVLTNGSEKFLTVDVGTLEGNLTQYANVLPSLWNPNSVNDYFITTKDKYPNNPTITLFPDDENGNIVIVVQYNNLSNNTPSKFAIRYTGITNYAKSSVRFQ-----GSRKTDLLTPSGTS 788
           MNKK   +     +S LS    + +A    I+NN  K  S  +V+S +   T S +             IP+    QN+  N+S +NGP+          A DW+GN  W I         + A+  NN  G +  AWF                  +W YN  TD ++VL       + Q L  + +  GTI  T E+  +     +   NNS               VY     T N + +  +P+T    ++N        L  K          + F LIP+  N  I    T    +T+G       N N     V+D+LN + +  T +      L     S    +      DY   +  ++ +V  N +++      D  +S++   G + ++    I S   D N  +YFK  +  E N   VS S       N   IP  +     G    +A    +        +    +I+  Y   + +SN  I T                          G LNG       T Q ++     S+A SS IPS +   +I  +N      +  T   I   DD +G++ ++     +  W+   +   E  +   +  ++T T  I   T+W    ++   D   ++PS+I+ + +       VS  S  +      +      +++ TKND+ GQ+ +K         +TY N   +    A      YTV  ++ T AF F GQ +     +D S  S    L  A ++ ++      + D         Q+ N   S   P S   + +T  D   N+ ++T+  D         +  +    NT   F++ YTG+   +  S  F+     G++  + + PS  +
  S:     5 MNKKSKKIILSTTSSVLSIATALSIALP--ITNNAIKNYSITNVSSTNQVTTESKI-------------IPSEVNDQNA--NISTNNGPVTFL--GNKITALDWFGNELWSIDFSQKVPDKDGATPGNNYDGAWKRAWF------------------NWDYNRSTDTIWVLGSWSVKNNKQPLFEIKAADGTITKTHEINYAEFTSSLGQANNSNVYRFVSALSSGKVMVYGGAGTTYNGKAILYDPKTLKGTVLNGNSSDDKILPLKNTSYGSDYKWYFFNLIPVATNRNIVEVVTFANKETSGDAGNGLANYNVYFLLVDDELNMVYNQNTNNPWSKHVLVANGISGYRNSKVTPQRDYYSLLDGRVVTVVYNTAII-----IDAKNSNDIKYGTYPVSESKWIKSWAFDSNQNLYFKFKD--ESNIYKVSGSVWQTINNNTTSIPLYVYLDLKGIGSTSAYANDLIMYNVYGYTGQLMMINSKYNSLVNTSNSNITTDNNPQNYGLALAVTQNANLQDKGDYKGILNGPD-----TFQKASDFELSSSALSSKIPSEITKDDIETSNGGFMKDS--TDFTIKSMDDKTGSIQIECKLYQI-PWF--TTSLPEGITPKIITKQYTTTKKIADKTSWKTLTTSTDYDFLNMKPSKITEEDVTNLDPFQVSFQSQTIVDSTGKILYPKKTYSVGTKNDSNGQVEVKIKYEYIPMGITYSNDTKATTYDA---SHTYTVFNSSTTPAFKFMGQ-NGSSSSIDISKVSELKNLLSADTLPSSFLSLNSSSD--KTNSAFLQFINTNESKGYPISKMKFTVTAND---NSGSLTIKAD---------MPASYSPENTAKSFSVTYTGLNRASNYSFSFKDVTKIGTQNINAILPSAVT 827
>gi|26553724|ref|NP_757658.1| MYPE 2560 paralog, 57% [Mycoplasma penetrans HF-2] >gi|26453731|dbj|BAC44062.1| MYPE 2560 paralog, 57% [Mycoplasma penetrans HF-2] (1123 aa)
Score = 98, Expect = 2.1e-01, Identities = 206/899 (22%), Positives = 361/899 (40%)
  Q:    23 VQLASTSNISNNISKTDSSLDVTSASTKATASGLKNLATETQNAQISIPTSYYQQNSFKNLSNDNGPILLFDEARSFGATDWYGNPAWYITLNSASGQNNGYYSAAWFSTSTSSAIDFTKAGTKVVDWAYNHKTDNLYVL------TDTQYLIIVSSKTGTIVS---------TSEVGNSVD-------------KIQIIDFNNSVYLWNSKTTNPQVLTIEPQTGMVNSAKITSTFLSSK------HLFALIPLDVNYTIAV-------TSTSQVTDTNGNVNFSLDFVNDDLNQITSSKTQSVSLTGTKASDIYIN-GFKRNSDYVIFIQNKIYSVSLNKSLMSNSTFTDLLSSSNSNLGGFSITTGS-INSAFIDVNNQIYFKTTESKEV---------------NTMLVSNSF-------------NKMDIPTTLGATFAGKEENAKTTQIFPVLSSASSSSDNL----ISRSYTGYLLSSNGFIGTGFLNGSVISNQFTSQSSAPSFNVSNAG-SSSIPSGVNSTNI-TKNNTSLSNVTLETSNAILIADDISGTLYVKVPYTLVGSWYGNGSQTSEFNSRGFLIGKFTFTNIQTATTW---ASNLPADIARLEPSQISTDILKRNATSIVSIPSSVLAL---QNSNLNINFAIVTKNDNAGQITLKATVTYKNAYGSIVSYAMANDKQY------TVKKAAATYAFAFAGQTDADKPKVDKSSSSITDLLAEAQSVLTNGSEKFLTVDVGTLEGNLTQYANVLPSLWNPNSVNDYFITTKDKYPNNPTITLFP---DDENGNIVIVVQYNNLSNNTPSKFAIRYTGITNYAKSSVRFQGSRKTDLLTPSGTSPFPSEQNNILDVTTVSGFSDYGTKLVSDVSPNEFSTLYSSNLINYMGFTPEVTFVQEQNGSEGTTTYDSEY--GSFLLKIDFSKSVSSNL---LNAKDEYIPFSETPFANQLGLKDGVIYQRYAGLLPIGSTYNISID 921
           + L++ +++ +  +     L +++ S K ++    + + ++  A    P+    QN+  NLS  NGPI          A DWYGN  W   L++     NG  S    +  +++  D         +W YN  TD L+++      T  Q L+ + + +G I           TS +G +               K+ I     + Y       NP   T+    G   +  I     S        + F LIP+  N             +T      N N N     V+D+LN I ++ T S  +        Y N       DY   +  K+ +V  N +++ N+T       ++ N G + ++    I S   D N  +YFK  +   +               ++ +  N++             N + I    G T      N+K  +     +S  +   N     ++ + T    S N     G LNG        S   A  F +S +   S IPS +  ++I T N++ L N +  T   I   DD +GT+ ++     +  W+ +    S    R       T   I    +W   +     D   ++PS+I+ D +       VS  S ++     Q       +++   ND AG  T+K +V Y+     + SY+  N K Y      TV K+  T AF F GQT +         S++ +L     +     S  +L     +      Q+ N   S   P S   + +T  D           P     +N      V Y NL+     KF  + +  +  +++      S  TD    +    +    +N   +T  +   + GT LV     + +++   +    +  ++   TF    N  +    ++ E+   S  + ID  +  SS +   L  K+  +    T + N   L + ++  +   L+P G   N SID
  S:     8 ITLSAITSVLSIATGLSIGLPISNNSLKNSSITNISSSNQSTTASKLAPSEANDQNA--NLSTSNGPITFL--GNKITALDWYGNKLWEKDLSTLIPDYNGKVS----TDGSATNYDNGPWKRAWFNWDYNRNTDLLWIIGYWSPVTKKQPLLGIKASSGDIQHNYDIDYQSYTSSLGATTTGTAYRFVSALASGKVMIYGGAATAYNGKGLLFNPSDSTLTLLNGNSATESIFPPNDSEYGTKYRWYFFNLIPIGNNKNFVEVLPFSRDATTGDAGYPNANYNVYFLLVDDNLNLIETTGTWSKLVKVADGMQNYRNTKITPQRDYYTMLDGKVVTVVYNTAIVINAT------GNSINYGTYPMSEAKWIKSWAFDSNQNLYFKFKDESTIYKVSGSAWSSLNNNTSSAIAPNTYLDLAGIPQTKDYANNLIIYNVYGYTGQLMMVNSKYNENVDTSNSGITEDANPDKLGLALAVTQNANSQNQGDYKGILNGD------DSIQKASDFELSQSAIDSKIPSEITRSDINTLNSSFLKNASDFTITKI---DDANGTIEIQCNLYQI-PWFAS-ELPSNITPRVVTHQYTTTNKINNKISWKTLSETTDYDFLNMKPSKIAVDDVTNLDPFQVSFQSQIITTAQGQQLYPKKTYSVSDPNDTAG--TIKVSVKYEYVPMGL-SYSTNNVKSYETNFTYTVFKSTDTPAFRFTGQTTSGS-SASIDVSNVAELKNLLNASTLPSSFNYLNSSTDSTNSAFLQFINTANSKGYPISKMKFTVTADDVAGTLKITATMPASYSPKNSEETFTVTYTNLNKAANYKFNFKTSSSSIGSQNFSTLLPSSITDGDIINNLIEYQGFNSNDFTITKTANDQN-GTLLVQISLNSSYASAIGNGNAGFKNYSATHTFTGFMNEDQYNERFNVEFVDDSSEVLIDLKQMQSSQVYDTLVTKNTSLTVGNTTYNNLKELVEKLLITKLGSLVPTGWKDNASID 973
>gi|26553711|ref|NP_757645.1| hypothetical protein MYPE2580 [Mycoplasma penetrans HF-2] >gi|26453718|dbj|BAC44049.1| conserved hypothetical protein [Mycoplasma penetrans HF-2] (1130 aa)
Score = 98, Expect = 2.2e-01, Identities = 159/633 (25%), Positives = 279/633 (44%)
  Q:    38 TDSSLDVTSASTKATASGLKNLATETQNAQIS--IPTSYYQQNSFKNLSNDNGPILLFDEARSFGATDWYGNPAWYITLNSASGQNNGYYSAAWFSTSTSSAIDFTKAGTKVVDWAYNHKTDNLYVL------TDTQYLIIVSSKTGTIVST---------SEVGN----------SVDKIQIIDFNNSVYLWNSKTTNPQVLTIEPQTGMVNSAKITSTFLSSK------HLFALIPLDVNYTIA----VTSTSQVTD---TNGNVNFSLDFVNDDLNQITSSKTQSVSLTGTKASDIYIN-GFKRNSDYVIFIQNKIYSVSLNKSLMSNSTFTDLLSSSNSNLGGFSITTGS-INSAFIDVNNQIYFKTTESKEVNTM------LVSNSFNKMDIPTTLGATFAGKEE-------------NAKTTQIFPVLSSASSSSDNL-----ISRSYTGYLL-------SSNGFIG--TGFLNGSVISNQFTSQSSAPSFNVS-NAGSSSIPSGVNSTNITKNNTSLSNVTLETSNAILIADDISGTLYVKVPYTLVGSWYGNGSQTS--------EFNSRGFLIGKFTFTNIQTATTWASNLPADIARLEPSQISTDILKRNATSIVSIPSSVLALQNSNL---NINFAIVTKNDNAGQITLKAT-------VTYKNAYGSIVSYAMANDKQYTVKKAAATYAFAFAGQTDADKPKVDKSSSSITDLLA 670
           T  S+ +  +++    S + N+ ++ Q  + S  IP+    QN+  N+S  NGP+          A DW+GN  W I   +     NG  +    S S + +  +++A     +W YN  TD +++L        TQ L+ + +  G +  T         + VG           S  K+ +     S Y       +P   +    +G     +I  T   +       + F LIP+  N  +      +    V D    N N N     V+D LN I    T S  +        Y N       DY   +  K+ +V  N +++ +        + N   G + ++    I S   D N  +YFK  +  +V  +       ++NS    ++P  L    AG ++                T Q+  + S  ++  D       +  +   Y L       SSN   G   G LNG    N F   S+   F +S +A SS IPS +   +I  +N  L N +  T   +   DD +GT+ ++     V  W+ +             E+ +   +  K ++ N+ T+T +      D   ++P+ I    ++      VS  S  +  +N N       + +  K+D  G + +          +TYK++  S+ SY    +  Y V K++ T AF F GQT+++     ++ S + +LL+
  S:    29 TGISIALPISNSALLNSSITNITSKNQATESSPVIPSEVNDQNA--NISTKNGPVTFL--GNKITALDWFGNKLWDIDFTTLIPDQNGNKNEGQQSQSLTYSGPWSRAW---FNWDYNRNTDLIWILGYWSNNKKTQPLLGIQASNGQVKHTYNLSYDGVLNNVGTGTAYRFVSALSSGKVMVYGGAGSPYDAKGILYDPDSNSTSVISGDSAKNEILPTNDETYGKKYRWYFFNLIPIGNNKNLVEVLPFSRDESVDDGGFPNANYNVYFLLVDDKLNMIHKEGTWSKLVKVADGMQNYRNTKITPQRDYYTMLDGKVVTVVYNTAIVIDG------KNDNIQFGVYPMSEKKWIKSWAFDSNQNLYFKFKDESKVYKVSGSVWQTLNNSTTNSNVPLDLYLDLAGIQDIKSYANDLIMYNVYGYTGQLMMINSKYNAKVDTTNSTITVDTNDQKYGLAIAVNQNSSNQTKGDYKGMLNGD---NSFQKTSN---FELSASAKSSKIPSEITKEDIVASNGFLKNPSDFTIKEM---DDKTGTIKIECKLYQV-PWFTDKLPDDISPKIIEHEYKTDKTISDKTSWKNLTTSTDY------DFLNMKPTTIQKGDVENLDPFQVSFQSQTIVDKNGNTLYPKKTYDVKDKDDAKGTVKVTVKYEYIPMGITYKDS-TSVRSYDA--ETTYNVFKSSTTPAFKFMGQTNSEPSINIQNVSELKNLLS 723
>gi|26553714|ref|NP_757648.1| hypothetical protein MYPE2610 [Mycoplasma penetrans HF-2] >gi|26453721|dbj|BAC44052.1| hypothetical protein [Mycoplasma penetrans HF-2] (1128 aa)
Score = 97, Expect = 2.7e-01, Identities = 162/648 (25%), Positives = 280/648 (43%)
  Q:    23 VQLASTSNISNNISKTDSSLDVTSASTKATASGLKNLATETQNAQISIPTSYYQQNSFKNLSNDNGPILLFDEARSFGATDWYGNPAWYITLNSASGQNNGYYSAAWFSTSTSSAIDFTKAGTKVV-DWAYNHKTDNLYVL------TDTQYLIIVSSKTGTIVSTSEVG--------------------NSVDKIQIIDFNNSVYLWNSKTT-----NPQVLTIEPQTGMVNSAKITSTFLSSKH---LFALIPLDVNYTIA----VTSTSQVTDTNG----NVNFSLDFVNDDLNQITSSKTQSVSLTGTKASDIYINGFKRNS-----DYVIFIQNKIYSVSLNKSLMSNSTFTDLLSSSNSNLGGFSITTGS-INSAFIDVNNQIYFKTTESKEVNTM-------LVSNSFNKMDIPT---TLGATFAGKEENAKTT---------QIFPVLSSASSSSD---NLISRSYTG-YLL-------SSNGFIG--TGFLNGSVISNQFTSQSSAPSFNVSN-AGSSSIPSGVNSTNITKNNTSLSNVTLETSNAILIADDISGTLYVKVPYTLVGSWYGNGSQTSEFNSRGFLIGKFTFTNIQTATTW---ASNLPADIARLEPSQISTDILKRNATSIVSIPSSVLALQNSNL---NINFAIVTKNDNAGQITLKAT-------VTYKNAYGSIVSYAMANDKQYTVKKAAATYAFAFAGQTDADKPKVDKSSSSITDLLA 670
           + LA TS+I +    T  S+ +  A   A  + + N+++  Q  + S   +    +   NLS  NGPI    +     A DW+GN  W I  +     +NG             + +FT A  +   +W YN  TD ++V+      T  Q L  + +  G I++  E+                      S+   +++ +  +   +++K       N     I+  +       + +T   +K+    F LIP+  N  I           +T  NG    N N     V+D+LN I    + S      + +   + GF+ +      DY   +  K+ +V  N +++ +        S+++ +G F +T    I S   D N  +YFK    K V  +       L SN  NK   P     LG   A K+     T         Q+  + S  + + D   + +S + TG Y L       S+N  +G   G LNG        S   A  FN+S+ A +S IPS +   +I   N  L N    T   I+  DD  G++ ++     +  W+         + +       T   IQ  T+W   ++    D   ++P+ I  + ++      VS  S ++   N         +++  +ND+AG + +          +TY     S +     N           T AF FAGQ  ++     +  S + +LL+
  S:     8 ISLAITSSILS--VATGLSIAIPIAGNTAKDTSIANVSSVNQATESSPIIASEVNDQNANLSTSNGPITFLGD--KITALDWFGNKLWEIDFSKLVEGSNGQIGGG--------SSNFTGAWKRTWWNWDYNRATDTIWVIGYWSNTTKKQPLFEIKASNGEILNKHEIDYSKFGSDFPNPNIGTVYRFITSLSSGKVMIYGGAGNSYDAKGVLYDPKNKTATLIKGDSASTEILPMNNTSYGTKYKWYFFNLIPIATNRNIVEVVNFVDEGSITGDNGAGKANYNIYFLLVDDNLNMIHKKDSSSPWAKHVQVAS-GMQGFRNSKITPQRDYYSLLDGKVVTVVYNTAIIIDG------KSNDTKIGTFPMTDSKWIKSWAFDSNQNLYFKFKGEKIVYKVSGSAWDNLGSNLGNKTISPDRYLDLGGVTAIKDYADNMTIYNVYGFTGQLMMINSKYNENVDTNNSSLSETNTGNYGLAIAVNQNSTNQNVGDYKGILNGP------DSIQKASDFNLSDSARTSKIPSEITKDDIVTTNGFLKN---STDFKIVSMDDTKGSIEIETNLYQI-PWFAT-RLPDNISPKTVRKTYTTDNKIQNKTSWKTLSNTTDYDFVNMKPTTIQREDVENLDPFQVSFQSQIITNANGAQLYPKKTYSVSEQNDSAGTVKVTVKYEYIPMGITYTGNNSSQIKSYETNTTYNVFNSTTTTPAFHFAGQRTSEASVDIRQVSELKNLLS 720